1BZXE

The crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
total genus 54
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bzxE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bzxE02
1GJAB 2XWBI 3OY6U 4JCNA 2R2WU 1G36A 1PFXC 1NN6A 4AYYB 1UMAH 3Q3KA 1GHAG 1OYQA 4ZHAA 2P8OB 3TPIZ 9LPRA 1T31A 1O3FA 1OP8A 2PTNA 3UREA 1QURH 2RA0A 2ESTE 3SJ8A 3SO3A 2ZGXH 2A2QH 4OS6A 1DDJA 1HJ8A 1P9UA 2FIRH 2ZZUH 4OS2A 3QZRA 2WV4A 4YLUA 4MTBA 2ZPQA 2VU8E 1B0FA 5IYTA 1EATA 5HXFA 1YPLH 3TH3H 1BCUH 3BEFB 2ALVA 4X2VA 1C2EA 1NFYA 2FLRH 1BTWA 4UFEH 2BD2A 1GBKA 2J95A 3GY3A 2SNWA 1GJ7B 1H8IH 3E3TA 1ELBA 1WYKA 3RUOA 5ABWA 3FZZA 1AFEH 1KIGH 2A4GA 1GJ6A 3MH7A 4E06H 2J92A 2QF0A 3T25A 1O2ZA 1GDQA 3SNDA 4BXSA 1LCYA 1SC8U 1LPKB 4LK4A 4X1NU 4X8UH 4Y7BA 1V2VT 2ZGCA 2HPPH 2ZDVH 2VJ1A 4MPWA 1FQ3A 2J2UA 1KTTB 3F9HA 3M3TA 4YTAA 4OS4A 1SHHB 3G01A 4IBLH 1C2GA 2BM2A 1XUIA 1QL9A 2JETB 2BLQA 2IN2A 4MNXA 1YPEH 3S7KB 1BJUA 1S84A 3E91A 3RC4A 1VJ9U 3URDA 4KP0A 3E0PB 4X6OA 1GHAF 1O2OA 1G2LA 5DP4A 1HRTH 1C1MA 2D2DA 2F83A 4MG3A 1W12U 4I7YH 2W3KA 4NSVA 4FUEA 1MTNB 1O5FH 2WV5A 2J4IA 1K28D 1A7SA 1O2XA 2GZ8A 4UE7H 1GBIA 4WXVA 4IS5A 2B9LA 1QBNA 4JYUH 3GY8A 3TK5A 5JBCS 5H4IB 2Y5HA 2SGAA 8ESTE 1BA8B 3NKKA 4CRBA 2ZDNA 2BMGB 3PO1B 3TNTA 2Z9JA 3VGCC 3F9EA 3PV4A 4IC6A 1AZZA 1P3EA 1FV9A 2AEIH 4WMDA 1FPHH 4ZH8A 1UTQA 2G51A 3BG4B 1VCQA 1P2MA 2GGVB 3PB1E 2LNCA 1QTFA 1EPTB 3RXGA 5EW1H 1CHOG 5EODA 1Y59T 2A32A 1EZXC 4TPIZ 1QRZA 1BTYA 3GISB 1T4VH 2M5TA 5EPNA 1QL7A 1UTKA 3TH4H 3UFAA 3PMJA 2JKHA 4E05H 4HI3A 1ETTH 1VCWA 1P06A 2C8ZB 1YP9A 3EDXB 1Z1JA 2Q1JA 1YC0A 1QNJA 4FU8A 2ZGBH 2P16A 1AZ8A 5T6DA 3RDZA 3UIRA 1SBWA 2V3OH 3SQEE 2PGBB 1N6YA 1TABE 1ESTA 4AYVB 1EJAA 3ELAH 3GY5A 3UOPA 1D3DB 1XXFA 2CF9H 2PKSB 2XRCA 1ABJH 5A8ZA 1MBQA 3Q3XA 1FDPA 2RCEA 1NC6A 1W0YH 3F9GA 1TGCA 2XC4A 3RC6A 1OKXA 1LQEA 1C2JA 1P2JA 5EQRA 2AIPA 2XW9A 1SGIB 3O8RA 1L1GA 3LIWA 3U98H 1FY8E 2P94A 2Y82A 3A8CA 1C5RA 1EZSC 1AQ7A 4FUIA 1TOCB 1C1PA 1D6RA 3JZ1B 1GBAA 1C5TA 2J9NA 4B75A 1IHSH 1W8BH 2O8MA 1DUEA 1JOUB 2A5AA 2XBXA 3PLKA 3KQDA 1LQDB 1SVPA 4WXIA 3EA7A 5HM9A 4K3JA 2BD8A 5LGOA 4Y10E 4I31A 2I6QA 1TOMH 2I6SA 3BIVH 4ISIH 1XUKA 5C67A 1O3CA 3PWCA 3SV6A 3EYDA 2ODPA 2H9HA 2FOAA 1AMHA 1C5UA 2C3SA 1HGTH 3QWCH 5DGJA 2SFAA 1XUHA 1HDTH 2KAIA 1BJVA 1PPZA 2HNTF 5JPMH 3K2UA 3BTQE 1AY6H 2F9VA 5EXLA 4XSKU 1DWCH 4WMEA 5AVDA 2QA9E 3LT3A 3MHWU 1FPCH 1TMUH 2J38A 1A0LA 1C5PA 2ZTXA 1C1TA 1BTHH 5C3NA 4H4FA 3EQ0H 1QL8A 1G32B 2BYAX 2FI5E 5K7RA 3O8BA 1T8MA 2A4RA 2HLCA 3BIUH 2GCTB 1CT4E 4AOQA 3UNRA 3ATWA 2ZU1A 1E38B 1OXGA 3MTYA 1W0ZU 1CGIE 5HMAA 3M7UA 1CBWB 1K9OE 1C1QA 2ALPA 1VITH 2W3IA 3SU6A 3HGPA 1QCPA 3STJA 1KXFA 1ZMNA 2AGIX 1BB0B 1NESE 1ZTKA 2AMPA 1RGQA 5C1UA 3T62A 1O3PB 3M35A 1QA0A 3CS7A 2G4TA 1JIRA 3RXIA 1DLKB 1O5DH 1O3DA 7GCHG 1T8NA 4DOQA 1TQ0B 1SB1H 1IQJA 1T7CA 1HYLA 1X7AC 2BHGA 3BTWE 5A09A 1O0DH 3QTVH 1YCPM 1C5YB 4K1TA 4B74A 1PQ5A 2SGEE 3K6YA 3RMNH 2GV6A 3U8OH 1JIMA 3M61U 1GBJA 1O2YA 4YESB 4K5ZA 2Q6GA 3QGJA 1MCTA 5LH8A 3K6ZA 4FUFA 1TNHA 3F6UH 3MO6A 1MCVA 3D62A 1ELGA 1HXFH 1O3EA 2FLBH 2XCNA 1EJNA 1VGCC 3LGVA 5BPEA 1C5WB 2DE9A 1O2NA 4FVBA 1NPMA 1SLWB 3BV9B 1Y3XA 2NU3E 1RRKA 3ZV9A 1ESAA 1AVWA 1SOTA 5T3HA 2ANYA 3MWIU 1GI8B 2GMTC 2K1QA 1EJMA 4B2BA 5T6GA 3M7TA 2PUQH 3RU4D 2A4QA 2Z9GA 3A80A 1K2I1 2WPKS 1HB0B 5A0BA 1H9IE 2G00A 3TGKE 2BY8X 1IQGA 5E0HA 3VB7A 2BDBA 2TGTA 1ELEE 3TITA 2OLGA 1J14A 2C93B 1HV7A 2FXRA 2XBVA 4A1VA 1C1OA 4NIWA 3QDZB 5B6OA 2R0LA 1MMJN 1QQUA 2VH6A 3GYMA 1GHZA 1O3HA 2VVCA 1N8OC 1TPSA 1TYNA 2JH6D 6ESTA 3T26A 1ACBE 4WVPE 1Z8JB 3ITIA 1C4V2 2J34A 1WOFA 1AO5A 3CENA 1DS2E 3MO9A 3UR6A 4JZFH 5E2OA 3FANA 4YLQH 4KELA 5FX6A 4E7NA 1CHGA 1OWKA 3GY7A 1GL1A 1ETRH 4OS7A 5L30H 2BVSH 2ANKH 1W2KH 1PPGE 3BSQA 4JZDH 3ZVFA 2AFQB 3ZZ5A 1F5KU 1O3IA 2VB0A 3SJKA 1RTKA 1C1SA 1AKSA 5C1XA 1V2TT 5C1YA 1T32A 2W5EA 1HIAA 1O2RA 1HAYB 2PSYA 2WPLS 4WWYA 2PHBA 2ZTZA 1E35B 4UEHH 2FWWA 1RTLA 4OS5A 3GY4A 4X1SU 3SUFA 3LU9B 1L1NA 2ZCHP 2BLVA 3ZZ4A 1GG6C 1RFNA 1UK2A 5DP3A 3HATH 3QTOH 3BTTE 3UR9A 1HAGE 4DIHH 1BHXF 1MAYA 2BDCA 3GY6A 1L2EA 1D9IA 4ZXYH 2FOMB 4YOIA 4DG4A 4A7IB 1IQIA 3URCA 3M3VA 2ZFTA 2SGFE 3VXEH 1W7GH 4XBBA 4ZAEA 3M5LA 1C1WH 2ZQ2A 3ZVCA 1BRBE 5FPYA 4Y71A 3LPRA 1C4U2 3NCLA 4VGCC 5GXPA 1P01A 1GCTB 2C8YB 2GCHF 2RG3A 1MAXA 2BLWA 6GCHG 4D8NA 8GCHG 3LGUA 1F2SE 1UVTH 2PSXA 1DVAH 1AWFH 1ABIH 1PJPA 1LKBA 1YF4A 3RU4E 4ABEA 4FUGA 2QC2A 4YOJA 3GCOA 2QYIA 5JB9S 4X8SH 1GJCB 4U30A 3NZIA 1SQAA 4NWKA 2CMYA 1Q3XA 1DFPA 2CGAA 1KXEA 2BQWB 3GDVA 1A3EH 5SGAE 1UTNA 1DSUA 3A7XA 1Q31A 1UCYH 3L33A 2J94A 3VXFH 2ZDMA 4NWLA 4NA7A 5FBEA 1IQMA 1GMDG 1HAHH 3S7HB 5E2PA 3UWIA 1FJSA 1G30B 3FZDA 2A4OA 1QJ7B 1ZZZA 5L6NH 1O3GA 2OTVA 1Y5UT 3HK3B 2Z9IA 5I25A 3HKJB 1F5LA 1H8DH 1H4WA 2FYQA 2GTBA 2XBYA 2ZO3H 2R0KA 3V13A 1A61H 3AW1A 5TCAA 4A5TS 1TBQH 3U1JB 3SV8A 1NT1A 3A8DA 2FODA 2FOEA 4INLA 2BOKA 3ATMA 2TPIZ 1CU1A 1Y3UA 1UHBA 1ANBA 1QJ1B 4Q80A 3T28A 1YGCH 4O03A 2BY5X 4NCYA 2GT8A 1P2NA 3EAJA 3A89A 3SU1A 4MDSA 1HAZB 1MTUA 3MFJA 6GCHF 8GCHF 1ZGVA 2QGRA 1L4DA 2F9PA 4THNH 4DY7B 1C5ZB 1DSTA 4BAHB 1QHRB 1FY5A 1CT2E 2GT7A 1CVWH 2BXTH 3QN7A 1SLVB 3B9FH 3MYWA 2OD3B 2ZDAH 3H7OA 1DICA 1UCYK 4I8KA 1UTMA 2B0FA 1KXDA 4H6TA 3ZZCA 1PPFE 1PQAA 1SSXA 1ESBA 4NZLA 1S81A 4Y8YA 4YOGA 3S9AA 1GDUA 1C5OH 1MH0A 2BDGA 1EKBB 2C4FH 4GCHF 2Q6DA 4PROA 2IOTA 3ZZ9A 1NTPA 1WU1A 1S82A 3ZVDA 1LHFH 4Z0KA 2NWNA 4FU9A 3A81A 1A2CH 1S83A 2QIQA 5JBAS 5GPIB 3U8TH 3MNCA 1O3LA 1AUJA 1JRSA 1BTPA 3MMGA 1O2SA 2OQ5A 1FONA 1QFKH 2H1UA 3ATIA 3OSYA 2HALA 3DD2H 1C1UH 2PW8H 2Z3DA 1V2UT 3PYHA 3GDSA 1GMHF 4Y0ZE 4HZHA 3RU4T 3TLOA 1OWIA 3A7ZA 3HPTB 1QB9A 1HJAC 1EB2A 1HXEH 2AYWA 1CGHA 3UY9A 3RXUA 1YPMH 1FZZA 1EAIA 1O3BA 1HUTH 1YLDA 5FX5A 1C9PA 4BXWA 4WY3A 3D49H 1HCGA 3KL6A 2O9QA 1LVMA 3LONA 4MNYA 4X6PA 4ABFA 4CRGA 6CHAC 4ISHH 3LC3A 3RXJA 3SJOA 3SJIA 3KGPA 1UCYE 1NFUA 3RXBA 2P3UB 3KNXA 1IHTH 2ZFSA 4M7GA 2Z9KA 3F68H 5DKMA 2O8WA 1KDQB 1O2HA 1OWEA 5CHAB 1AFQC 1ELVA 1ELTA 1GWAA 4JZIA 3BTHE 3ENSB 1GJ4H 3ODFA 5AFYH 1OYTH 2FO9A 1C2IA 4CHAB 1C2MA 1W11U 4LOYH 2PFEA 2FM2A 3SNCA 1P12E 2P95A 3PWBA 4CBNA 4UFGH 3RXVA 2QXIA 1MQ6A 1SGPE 4K2YA 1AB9C 2CHAC 1O2PA 3FFGA 1FNIA 4ZMAH 4GHTA 1ZJDA 1K1PA 1ZRBA 2PLXA 1ANCA 4X1QU 1NU7B 1DY9A 1SGTA 2ILNA 1BTXA 5ESTE 1WV7H 1DPOA 5LPFA 1ZPZA 2GZ7A 1P2IA 1IQLA 1KXAA 3FAOA 4X2YA 1KXBA 1LTOA 1ELCA 4ZUHA 2BD4A 1FIZA 1KTSB 1C5QA 5C5NA 1D6WA 4U01A 3V12A 2GDDA 2PR3A 3AASA 2A7CA 4TPYA 3P8NA 1ZLRA 5C2ZA 1TRMA 1DANH 2ZU3A 1ZSKA 1SGEE 4IMQA 2F9BH 2ZHDA 4F49A 1V2JT 3M37A 2ZPRA 3DHKH 3TGIE 3AW0A 1MBMA 3KIDU 1O3NA 1PQ8A 2TGPZ 1XX9A 5FPTA 1AVXA 1Y8TA 1E36B 2OUAA 3ZVEA 1OPHB 1HAVA 1ANEA 1TNKA 2HPQH 1JXPA 1WBGB 2BOHB 2BX3A 1CO7E 2NU4E 3V0XA 2SNVA 1RIWC 4YT6H 2DUCA 1KYNA 3QGNB 1BHXB 1Y3YA 3AVZA 2TGDA 2BDIA 3KN2A 4INKA 2VVUA 3TJNA 3D65E 3BTDE 1VR1H 3M3SA 2F3CE 2PUXB 1S5SA 1AD8H 1NFXA 4AFUA 1FAXA 4BAMB 4BAKB 3D23A 1DUAA 1UJ1A 3CP7A 1CSOE 4R0IA 2ZHWH 1THRH 3LJJA 4I8JA 2V6NA 4JZ1A 3OY5U 1UO6A 2ZPSA 5F6MA 3B23B 5IDKA 2HOBA 3RXOA 4NFEA 2F9UA 3CS0A 3MU0A 2V3HH 3ZV8A 4INHA 4AX9H 1MTSA 4F4OC 4R8TB 3MH6A 4DURA 3ZZAA 1QB1A 1ELDE 1THPB 1NRPH 1ZGIA 2H9EH 4WMFA 1GI1A 2ZCLP 4FXGH 3A87A 4UONA 1E34B 3IG6B 2PKAB 1B5GH 4ABBA 1DLEA 1QA7A 5HM2A 4BAOB 1FI8A 2ZGJA 4B76A 1QRWA 4DGJA 1BMNH 2VIVA 1WAYB 2FDAA 3GCHC 4OGYA 5FHTA 3T27A 1P8VC 4DIIH 1GBBA 4BTTB 3P17H 2WPHS 5DP5A 4NG9H 1F92A 1CA8B 1HBTH 2OQUA 3RXSA 1RD3B 1V2WT 5LPEA 3VGCB 1BT7A 4I33A 2ZG0H 2EI7A 4WJG2 2A5KA 5FBIA 4BTUB 3KF2A 2QAAA 1BZXE 1AGJA 1O5CB 1CA0C 2GD4B 1XKAC 1W10U 2HRVA 3LJOA 3VB6A 3MU4A 3KCGH 2Z94A 1AU8A 3PLBA 1V2RT 2Y6TA 1O34A 1S0QA 1G2MA 4AGKA 1YPKH 1ZRKA 1TX6A 2VGCC 2FMJA 4SGBE 1BOQA 5EPYA 1WCZA 1T4UH 2QXGA 2JH0D 1C2DA 1TGTA 1VJAU 3IWMA 4FUDA 1EASA 1HJ9A 2TBSA 2OC0A 2BVRH 4YM9A 1NRNH 2O8TA 1C5LH 3RM2H 3SGAE 4ZKSU 1GHWH 2H5DA 4B73A 1MTVA 2FEQH 1Q2WA 2ZDKA 3ZVBA 2BDAA 1EX3A 3QK1A 4NIXA 1GGDC 2QCYA 2H5CA 1LHEH 1FUJA 2FTLE 4Y0YE 2ZEBA 1SGRE 3FP6E 2A7JA 1HFDA 1V2PT 5DP7A 1SMFE 2G5VA 3SU4A 3UPEA 4GVUA 3SZNA 1E37B 4X0WU 1F0RA 1GHYH 2JH5D 1TIOA 2BQ6B 3E16B 1TPPA 4XBCA 1KLJH 3W94A 2IPHA 3UNSA 4FUJA 1GHBG 4TWYA 3R0FA 1QRXA 2ZHQH 3E1XB 1KY9A 3PTNA 1EAUA 3GICB 2CXVA 1OWHA 3TGJE 1S6FA 4IW4E 4AFSA 2ZU4A 1ARBA 4ISLA 2Z9LA 5BRRE 4XFQA 1GJDB 5AF9H 3SV9A 1LHCH 1Z8IB 1VITG 3SQHE 1NM6A 2D1JA 1DWEH 3RXMA 1QIXB 1TFXA 1LHDH 1V2MT 2WPMS 3BF6H 5LPRA 1TBZH 1EZUC 3F1SB 2TGAA 3P8GA 4GPGA 4ABGA 1G3CA 2ZECA 1H1BA 3SORA 3HGNA 5DO4H 5EQQA 3ZZ3A 1EPTA 4BOHA 1SGFA 2B8OH 4RKOB 2VIQA 3A85A 3M5MA 4Y8XA 5A0AE 4UD9H 3SU5A 1GI6A 2CV3A 3M5NA 4AFQA 1J8AA 4Q7ZA 3A7YA 4Y76A 2VIPA 3ZVAA 4WH6A 4X8VH 1L1JA 2FOHA 3PLPA 3BN9A 2GCHG 4NGAH 3GOVB 1TALA 2SGQE 1GCTC 4RN6A 4X6NA 1BBRH 4H42U 3SW2B 1F7ZA 1GHBF 2F91A 1ZHMA 2VH0A 2P93A 5DG6A 2QY0B 5HGGA 1N6XA 1PPCE 3MH5A 1B7XB 1VCPA 3MI4A 1PQ7A 5T6FA 4I8GA 3TJVA 2BTCE 4ESTE 3I78A 1P04A 1A1RA 2QXHA 4I8LA 3LDXH 1LKAA 4AB9A 1GI2A 2VWLA 1J16A 3RP2A 1GI4A 1O2KA 1GL0E 3K9XB 2H2ZA 3RMLH 2FZZA 5AHGH 1GHVH 3SNAA 1SFIA 1VITF 1MKXH 5GWZA 3E0NB 4U32A 1Z8RA 1ZPCA 1BRUP 2O8LA 1QB6A 1UVOA 1YPGH 3RXDA 1A0JA 5ESBA 2C8XB 1CGJE 5EU8A 1P10A 4Y11E 3RMMH 1GBHA 1BITA 2BD7A 3OYPA 2ODYB 2B5TB 3MU8A 2GMTB 5EG4A 4DW2U 1GJ9B 1NRQH 3DFJA 2R3UA 5TCCA 1EUFA 3UWJH 2STAE 1GVKB 1WQVH 7ESTE 4JYVH 4MPUA 2Y7ZA 1BBRK 3KEEA 4WH8A 1Z6JH 5EGMA 3U8RH 2Z3CA 3MNSA 1NRRH 3S9CA 3MOCA 4AFZA 2W7UA 2P3TB 5HYOA 1V6DA 5JBTA 1ETSH 2ZFFH 4J2YB 3P95A 3JZ2B 4TY6A 1BMMH 4LZ1H 2QXJA 1H9LB 2WYGA 3A7WA 2OBOA 1O33A 3A86A 3BTFE 1S85A 1W7XH 2WUBA 3NWUA 2BB4A 4D9QA 1MKXK 1FXYA 5DPAA 1DXPA 2BQ7B 1FIWA 2WYJA 1ZMLA 4GCHG 2ZCKP 1SOZA 1TX7A 3T5FH 2EEKA 5AFZH 1JWTA 3B8JA 1GI9B 1MU8B 3OX7U 3BEUA 5EXNA 2AS9A 1C9TA 1XUGA 3RXLA 5EOKA 3EA9A 1DOJA 4KGAA 1ZSJA 4GAWA 5FCKA 2THFB 1W13U 5GCHF 4CRCA 1TQ7B 3QO6A 4Y79A 4BTIB 1IQNA 1FLEE 3LH1A 2OC1A 1ZHRA 4FU7A 1P2KA 2GX4A 4GHQA 2OC7A 1K1LA 1TX8A 1TA6A 2P8OC 2AIQA 1A46H 5F03A 1TE0A 1HAPH 1TWXB 1O39A 1GMHG 2G8TA 1O2VA 5FPSA 1VZQH 4K8BA 2BY9X 3NPSA 1O3MA 1Z6EA 1YM0A 1P0SH 4HFPB 1BBRE 1NS3A 3KQBA 1OWDA 1ZMJA 1QQ4A 4KTCA 1GHXH 2Z3EA 4DT7B 1NROH 1SG8B 2ZFQH 3MH4A 1EAWA 3SUEA 4FUCA 1GBTA 1B0EA 2RDLA 3BTGE 2NU0E 3A8BA 4VGCB 3NXPA 1UTOA 2UUKB 5DJ7A 3I77A 1KSNA 2ZGHA 1KLIH 2XC5A 3RXQA 3MNBA 3DUXH 2FOCA 1TGBA 2BXUH 2BD5A 1T8LA 3NUMA 1O2WA 5F8ZA 1UTLM 1WQSA 2FPZA 5JBBS 4CR9A 1PPEE 2A1DB 2ZDLA 1V2OT 2GKVE 1FN8A 1Z71A 1OSSA 4MQAA 1S6HA 3SBKA 1OP2A 3LGYA 1O3AA 1XM1A 3BTEE 1HAOH 4CHAC 1C2HA 1AUTC 1D3QB 5A8YA 2AERH 4O97A 1V2NT 1GVZA 3QX5H 1O3KA 4BANB 4MNWA 1SGNE 1SLXB 2JETC 3TNSA 4A6LA 8LPRA 3KHVA 3ZZ6A 4XDEA 4FUBA 3MNXA 1G37A 1GBLA 4MPXA 5JYIA 1E0FD 2KAIB 1K1JA 2LPRA 1MQ5A 1MTNC 1C5XB 1FAKH 3NK8A 2FI3E 3SV2H 3UOUA 3ODDA 4B2CA 1DM4B 3N7OA 5EXMA 5F8TA 4A1TA 2STBE 1ORFA 5DP6A 1O5GH 3RXPA 3PTBA 1A3BH 4B71A 3UQOA 1ZOMA 3TK6A 3PO1C 1C1VH 2V35A 1A5GH 3O8CA 2FX6A 3ZVGA 1P11E 4Y6DA 1TNLA 1BTZA 3BG4C 1HLTH 1TA2A 2XC0A 1EPTC 2QF3A 1YBWA 2EI8A 2EI6A 5PTPA 2ULLA 3SNBA 2DE8A 4JZEH 1MUEB 3ATLA 2VIDA 3MU5A 2BY7X 4NA8A 4O9VA 1AI8H 2OCVB 1RS0A 4X2WA 2UUJB 3S0NA 4JK5A 1EOLA 3VFEA 1V2ST 5EW2H 1WUNH 1RXPA 2HVXA 3Q76A 1ARCA 3U1IB 2G4UA 2YNAA 1O32A 1GJBB 3RMOH 1HPGA 3SU3A 3M5OA 1UK3A 2PKSC 3P70B 3MU1A 1XXDA 1UVPA 1C5SA 1ZTLA 1TPOA 4Q7XA 2Y7XA 1D3TB 1CQQA 2FI4E 1EP6A 1SI5H 3A7TA 4B1TA 3A7VA 1TGSZ 3P6ZB 4X1PU 1DY8A 1UTJA 1GBEA 1ID5H 3L6PA 4D7FA 1P3CA 2G52A 4KTSA 1IQEA 1GDNA 1AE5A 2G55A 1WSSH 3OTJE 1ANDA 3P92A 2BLOA 1IOEA 1O5EH 2ZWLH 3P8OA 3UTUH 1Z1IA 2VWNA 5GDSH 4WF8A 1PYTD 4MVNA 1EZQA 1BUIA 3UNQA 4ABDA 1HJAB 1QJ6B 2PTCE 5E0JA 2G5NA 5I46H 1C1NA 1EQ9A 1P9SA 1ZR0A 1TRNA 3ZYEA 2W26A 3GCTG 1EOJA 4DJZB 2UUFB 3KQEA 4K1EA 2BDHA 9ESTA 5ETXA 1GJ5H 4UFFH 1A4WH 3UUZA 1OX1A 2XXLA 4QT8C 2VNTA 4RKJB 1D4PB 2FOGA 2BZ6H 4YO9A 4CRFA 4IC5A 3LC5A 4MPVA 3QLPH 2PGQB 3H5CB 1QGFA 1ZYOA 6CHAB 3RXKA 2PV9B 2AGEX 1V2KT 5K0HA 3RXCA 1S0RA 4ZXXH 4ASHA 1LPZB 1AVGH 4XBDA 1Y5AT 1SL3A 5EQSA 3HKIB 2H6MA 2XBWA 3BTKE 3V3MA 1EXFA 2GZ9A 1AFQB 2ZTYA 1LVOA 3A83A 1TLDA 4ISOA 3I29A 2GCTC 4TYDA 1M9UA 4K69A 4X6MA 2B7DH 5DP8A 1A5IA 2XWAA 3LGIA 3E90B 2OP9A 1GCDA 3TU7H 2A31A 3LOXA 1MD8A 1AB9B 1J15A 2CHAB 1AWHB 2ZA5A 1CBWC 1OOKB 3C1KA 1TNIA 1YPHE 2UWLA 2VVVA 4CRDA 6LPRA 3ZZ7A 2FTMA 4CR5A 1LPGB 3PM3A 4J1YA 3W95A 1P2QA 1O2MA 2D26C 1AKSB 3A8AA 3EGKH 2CF8H 4LXBH 3SUDA 5FAHA 2Y5GA 3FP7E 2F9NA 3A82A 1HIAB 1BTUA 2WPJS 1O2TA 4K1SA 1G3EA 1AE8H 1DT2A 2OINA 3LGTA 4NIYA 1GBFA 2FP7B 1SGYE 3SJ9A 2BD3A 2VINA 2Z7FE 4CBOA 1FMGA 5TJXA 1ZJKA 3GCTF 2BZAA 1WTHD 5GIBA 1C2FA 3GCNA 4CRAA 3ZZDA 3WY8A 1QY6A 3E8LA 2H9TH 5CE1A 4X1RU 3RM0H 5CMXH 2UUYA 1GBDA 4TY7A 5L2ZH 2A7HA 1O37A 1F0UA 2D8WA 2XNIA 4Z6AH 1KLTA 5A8XA 1H9HE 1CHOF 7LPRA 1XVOA 1L4ZA 2UWOA 4K8YA 2ZP0H 4ZHMU 1RIWB 4DCDA 2CJIA 1T8OA 4CREA 4AGJA 1D3PB 3TJUA 1BIOA 2BD9A 3DA9B 2HNTE 1KXCA 1F0TA 1LMWB 1P05A 1XUFA 1LDTT 1MTWA 1SQOA 2TRMA 4YZUA 4IN2A 1THSH 1A0HB 2NU2E 1G9IE 3L3TA 2OBQA 5FXLA 4AG2A 2ZNKH 1SLUB 3RXFA 3GYLB 4IGDA 3U69H 4IMZA 4ZROA 1GI3A 4ZKNU 2OXSA 1O2JA 2OC8A 1YLCA 2ODQA 5J4QA 1QBVH 2WUCA 4NZQA 1GI0A 2VIWA 1BQYA 4FUHA 3GDUA 3ZZBA 2SGDE 3BTME 3OU0A 1EP5A 3UQVA 1C2KA 1FN6A 4OGXA 1C4Y2 2XTTB 3PMBB 1C5MD 1O35A 1GBMA 2RA3A 2AH4X 4GLYA 3DT0H 3PMHB 5E8EH 1ZHPA 1DITH 1O38A 4D7GA 1F5RA 2UWPA 1TAWA 2A0QB 2FS8A 2ZU5A 4ABHA 1V2QT 1EAXA 4YT7H 1KDQA 1W14U 1TRYA 1DX5M 7KMEH 3T2NA 1V2LT 4Q2KA 1MU6B 3GCHB 8KME2 1SGDE 4JMYA 4TWWA 2ANMH 4MLFB 2XYAA 3Q77A 1DXWA 1GVLA 4GSOA 4A1XA 3LH3A 4CH2B 1O3OA 3K65B 3LKWA 1XUJA 5C5OA 1JBUH 1HAIH 4JYTA 1GJ8B 3RXTA 4ABAA 3TK9A 1CA0B 1UHBB 3PROA 1QBOA 3S69A 2ZHEH 3EA8A 1WTGH 1JMOH 1XMNB 2ANWA 2SGPE 1GI5A 3M36A 1RJXB 1BMLA 3M7QA 2R2MB 1MZAA 2WPIS 5J4SA 2VGCB 4DVAU 1K1IA 1ELFA 1Z7KA 2O8UA 4HTCH 3GY2A 3LGWA 1NZQH 4NIVA 4BNRA 1SGFG 1G3DA 1EB1H 1UTPA 3ATKA 2R9PA 1C5VA 1O31A 4UDWH 4AORA 1K1OA 3SI4H 2GP9B 1GI7B 4CH8B 3ZZ8A 3SU2A 3RLYH 1PPHE 1SQTA 2AGGX 3SUGA 4ZKRU 2BVXH 2Y80A 3HK6B 3QUMP 5DP9A 1C5NH 2FS9A 1BRAA 1XKBC 1J17T 1GGDB 5GJ4B 1LHGH 3T29A 4XE4A 3SU0A 1P09A 3SOSA 7GCHF 5A0CA 4ABJA 2AMQA 2CN0H 2YNBA 1O2LA 2IJOB 1O5BB 1NO9H 4AB8A 2ZIQH 2VIOA 2F9OA 3BG8A 1YPHC 1YYY1 5A2MH 3RLWH 1O2GH 4X8TH 4LZ4B 4RSPA 3RXHA 1JRTA 1XVMA 4D9RA 4ABIA 4NSYA 4I32A 1DWDH 5E0GA 4UFDH 1O5AB 1IQKA 3STIA 1O36A 3TVJB 5F8XA 1MKWH 1K21H 1AHTH 1PPBH 1O2IA 3MO3A 1NFWA 1LO6A 2NU1E 1VGCB 2PKAA 4SGAE 2Q6FA 1HNEE 1K1NA 1TGNA 1ZPBA 5GCHG 2ZC9H 1SR5C 5G4BA 2A45B 1U6QA 3S9BA 4BAQB 1TNJA 3C27B 1G3BA 3VB4A 3SHAH 1ZTJA 3EE0B 1BDAA 4NA9H 3VEQB 2R3YA 3SGBE 1ZSLA 1TB6H 2W7SA 3TJOA 3VB3A 5JB8S 3H7TA 3QZQA 1TPAE 1MZDA 1PYTC 2V0BA 3V7TA 4H6SB 1J9CH 1W3CA 4K60A 2HNTC 2Y81A 2HGTH 1TBRH 1YPJH 4AN7A 1MD7A 2C90B 1BMAA 1L0ZA 2FX4A 1BRCE 3AAVA 1P57B 1P2OA 1DWBH 4OS1A 2C8WB 1AIXH 5C20A 3VB5A 1CT0E 1GBCA 1IQHA 4KTUA 1N8OB 5FCRA 3SI3H 1HAXB 2TIOA 4Y8ZA 2EC9H 1MKWK 2XCFA 3ZYDA 2A2XH 3R3GB 1SGCA 4AZ2B 2EA3A 1ELAA 2GV7A 1OWJA 4U2WA 2VWOA 3SGQE 3ESTA 1Y5BT 1A5HA 1TMBH 2ZFRH 2ZHFH 2FESH 1Y3VA 2FYRA 1OP0A 3O8DA 4GUXA 4IN1A 3VPKA 1IQFA 1QR3E 3RC5A 3P8FA 1TONA 1FY1A 4ZKOU 2Z6BD 3FVFB 1SFQB 5DK1A 4O3TA 2ZKSA 1HAVB 4B2AA 3PMAB 1Y3WA 1O2QA 4KKDA 1RTFB 1TMTH 1GMCG 1GPZA 1GG6B 3RXRA 1P03A 1OS8A 2ZFPH 1NRSH 1C2LA 3AAUA 2HWLB 4I8HA 1YCPH 3A88A 2G81E 3DFLA 4A92A 1V3XA 2ZI2H 1TNGA 1SPJA 3SV7A 4JK6A 5L2YH 2GDEH 2WINI 2AMDA 1DE7H 3FP8E 2VWMA 1YKTA 4MNVA 3SN8A 3U9AH 2YOLA 4XOJA 2Y5FA 4Y7AA 1FY4A 4Q7YA 2BX4A 3E6PH 4AG1A 4HGCA 3TIUA 1NU9A 2GVFA 3SNEA 1INCA 3RXAA 2P3FH 3F9FA 2ZU2A 3IITA 2BDYA 1LVYA 3RXEA 1O3JA 4D76A 1UVUH 2P59A 3A84A 3Q00A 3TH2H 1P02A 2PWXA 2ZF0H 1K1MA 1FY3A 1O2UA 1AN1E 2ASUB 2QV1A 1F0SA 4O3UA 4NFFA 1K22H 1N1LA 1UK4A 3BEIB 3Q3YA 5CHAC 2QN5T 2A5IA 3KQCA 1NY22 2FOFA 4ISNA 5JDUB 4E7RG 4X2XA 4ZHLU 1YCPK 1C1RA 2FOBA 1CE5A 1LVBA 1SGQE 3SHCH 2ZQ1A 1UVSH 1IAUA 1Z8GA 1GMCF 4FVDA 1O30A 2BY6X 1GMDF 1SHYA
chains in the Genus database with same CATH superfamily
1GJAB 2XWBI 3OY6U 4JCNA 2R2WU 1G36A 1H8ED 1PFXC 1NN6A 4AYYB 1UMAH 3Q3KA 1GHAG 1OYQA 4ZHAA 2P8OB 3TPIZ 9LPRA 1T31A 1O3FA 1OP8A 2PTNA 3UREA 3KYGA 1QURH 2RA0A 2ESTE 3SJ8A 3SO3A 2QE7D 2ZGXH 2A2QH 4OS6A 1DDJA 1HJ8A 1P9UA 2FIRH 2ZZUH 4OS2A 3QZRA 2WV4A 4YLUA 4MTBA 2ZPQA 2VU8E 1B0FA 5IYTA 1EATA 5HXFA 1YPLH 3TH3H 1BCUH 3BEFB 2ALVA 4X2VA 1C2EA 1NFYA 2FLRH 1BTWA 4UFEH 2BD2A 1GBKA 2J95A 3GY3A 2SNWA 2EQNA 1GJ7B 1H8IH 3E3TA 1ELBA 1WYKA 3RUOA 5ABWA 3FZZA 1AFEH 1KIGH 2A4GA 1GJ6A 3MH7A 4E06H 2J92A 2QF0A 3T25A 1O2ZA 1GDQA 3SNDA 4BXSA 1LCYA 1SC8U 1LPKB 4LK4A 4X1NU 4X8UH 4Y7BA 1V2VT 2ZGCA 2HPPH 2ZDVH 2VJ1A 4MPWA 4HG6A 1FQ3A 2J2UA 1KTTB 3F9HA 3M3TA 4YTAA 4OS4A 1SHHB 3G01A 4IBLH 1C2GA 2BM2A 1XUIA 1QL9A 2JETB 2BLQA 2IN2A 4MNXA 1YPEH 3S7KB 1BJUA 1S84A 5HKKD 3E91A 3RC4A 1VJ9U 3URDA 4KP0A 3E0PB 2OK5A 4X6OA 1GHAF 1O2OA 1G2LA 5DP4A 1HRTH 5F53A 2JJ2D 1C1MA 2D2DA 2F83A 4MG3A 1W12U 4I7YH 2W3KA 4NSVA 4FUEA 1MTNB 1O5FH 2WV5A 4Q4LA 2J4IA 1K28D 1A7SA 1O2XA 2GZ8A 4UE7H 1GBIA 4WXVA 4IS5A 2B9LA 1QBNA 4JYUH 3GY8A 3TK5A 5JBCS 5H4IB 2Y5HA 2SGAA 8ESTE 5C17A 1BA8B 3NKKA 4CRBA 2ZDNA 2BMGB 3PO1B 3TNTA 2Z9JA 3VGCC 3F9EA 3PV4A 4IC6A 1AZZA 1P3EA 1FV9A 2AEIH 4WMDA 1FPHH 4ZH8A 1UTQA 2G51A 3BG4B 1VCQA 1P2MA 2GGVB 3PB1E 2LNCA 5CDFE 1QTFA 1EPTB 3RXGA 5EW1H 1CHOG 5EODA 1Y59T 2A32A 1EZXC 4TPIZ 1QRZA 1BTYA 3GISB 1T4VH 2M5TA 5EPNA 1QL7A 1UTKA 3TH4H 3UFAA 3PMJA 2JKHA 4E05H 4HI3A 1ETTH 1VCWA 1P06A 2C8ZB 1YP9A 3EDXB 1Z1JA 2Q1JA 1YC0A 1QNJA 4FU8A 2ZGBH 2P16A 1AZ8A 5T6DA 3RDZA 3UIRA 1SBWA 2V3OH 3SQEE 3DCLA 2PGBB 1N6YA 1TABE 1ESTA 3FKSD 4AYVB 1EJAA 3ELAH 3GY5A 3UOPA 1D3DB 1XXFA 2CF9H 2PKSB 2XRCA 1ABJH 5A8ZA 1MBQA 3Q3XA 1FDPA 2RCEA 1NC6A 1W0YH 3F9GA 1TGCA 2XC4A 3RC6A 1OKXA 1LQEA 1C2JA 1P2JA 5EQRA 2AIPA 2XW9A 1SGIB 3O8RA 1L1GA 3LIWA 3U98H 1FY8E 2P94A 2Y82A 3A8CA 1C5RA 1EZSC 1AQ7A 4FUIA 1TOCB 1C1PA 1D6RA 3JZ1B 1GBAA 1C5TA 2J9NA 4B75A 1IHSH 1W8BH 2O8MA 1DUEA 1JOUB 2A5AA 2J98A 2XBXA 3PLKA 3KQDA 1LQDB 1SVPA 4WXIA 3EA7A 5HM9A 4K3JA 2BD8A 5LGOA 4Y10E 4I31A 2I6QA 1TOMH 2I6SA 3BIVH 4I86A 4ISIH 1XUKA 5C67A 1O3CA 3PWCA 3SV6A 3EYDA 2ODPA 2H9HA 2FOAA 2PP6A 1AMHA 5B6LA 1C5UA 2C3SA 1HGTH 3QWCH 5DGJA 1W0JD 2SFAA 1XUHA 4YXWD 1HDTH 2KAIA 1BJVA 1PPZA 2HNTF 5JPMH 1YY3A 3BTQE 3K2UA 1AY6H 2F9VA 5EXLA 4XSKU 1DWCH 1H8HD 4WMEA 5AVDA 2QA9E 3LT3A 3MHWU 1FPCH 1TMUH 2J38A 1A0LA 1C5PA 2ZTXA 1C1TA 3PRDA 1BTHH 5C3NA 4H4FA 3EQ0H 1QL8A 1G32B 2BYAX 2FI5E 5K7RA 3O8BA 1T8MA 2A4RA 2HLCA 3BIUH 2GCTB 1CT4E 4AOQA 3UNRA 3ATWA 2ZU1A 1E38B 1OXGA 3MTYA 1W0ZU 1CGIE 5HMAA 3M7UA 1CBWB 1K9OE 1C1QA 2ALPA 1VITH 2W3IA 3SU6A 3HGPA 1QCPA 3STJA 1KXFA 1ZMNA 2AGIX 1BB0B 1NESE 1ZTKA 2AMPA 1RGQA 5C1UA 3T62A 1O3PB 1EFRD 3M35A 1QA0A 3CS7A 2G4TA 1JIRA 3RXIA 1DLKB 1O5DH 1O3DA 7GCHG 1T8NA 3SZEA 4DOQA 1TQ0B 1SB1H 1IQJA 1T7CA 1HYLA 1X7AC 2BHGA 3BTWE 5A09A 1O0DH 3QTVH 1YCPM 1C5YB 4K1TA 4B74A 1PQ5A 2SGEE 3K6YA 3RMNH 2GV6A 3U8OH 1JIMA 3M61U 1GBJA 1O2YA 1WXRA 4YESB 4K5ZA 2Q6GA 3QGJA 1MCTA 5CHBA 3K6ZA 4FUFA 5LH8A 1TNHA 3F6UH 3MO6A 4XD7D 1MCVA 3D62A 1ELGA 1HXFH 1O3EA 2FLBH 2XCNA 1EJNA 1VGCC 3LGVA 5BPEA 1C5WB 2DE9A 1O2NA 4FVBA 1NPMA 1SLWB 3BV9B 1Y3XA 2NU3E 1RRKA 5KEDA 3ZV9A 1ESAA 1AVWA 1SOTA 5T3HA 2ANYA 3MWIU 1GI8B 2GMTC 2K1QA 1EJMA 4B2BA 5T6GA 3M7TA 2PUQH 3RU4D 2A4QA 2Z9GA 3A80A 1K2I1 2WPKS 1HB0B 5A0BA 1H9IE 4F55A 2G00A 3TGKE 2BY8X 1IQGA 5E0HA 3VB7A 3U28C 2BDBA 2TGTA 1ELEE 3TITA 2OLGA 1J14A 2C93B 1HV7A 2FXRA 2KCOA 2XBVA 4A1VA 5EIYA 1C1OA 4NIWA 3QDZB 5B6OA 2R0LA 1MMJN 1QQUA 2VH6A 3GYMA 1GHZA 1O3HA 2VVCA 1N8OC 1TPSA 1TYNA 2JH6D 5C0TA 6ESTA 3T26A 1ACBE 4WVPE 1Z8JB 3ITIA 2F43B 4TSFD 1C4V2 2J34A 1WOFA 1AO5A 3CENA 1DS2E 3MO9A 3UR6A 4JZFH 5E2OA 3FANA 4YLQH 3FOAA 2HLDD 4KELA 4ACBA 4AC9A 5FX6A 4E7NA 1CHGA 1OWKA 3GY7A 1GL1A 1ETRH 4OS7A 5L30H 2BVSH 2ANKH 1W2KH 1PPGE 1QZ8A 3BSQA 4JZDH 3ZVFA 2AFQB 3ZZ5A 1F5KU 1O3IA 2VB0A 3SJKA 1RTKA 1C1SA 1AKSA 5C1XA 2IPQX 1V2TT 5C1YA 1T32A 2W5EA 2V3MA 1HIAA 3WW7A 1O2RA 1HAYB 2PSYA 2WPLS 4WWYA 2PHBA 2ZTZA 1E35B 4UEHH 2FWWA 3UB0A 1RTLA 5C94A 4OS5A 3GY4A 4X1SU 3SUFA 3LU9B 1L1NA 2ZCHP 2BLVA 3ZZ4A 1GG6C 1RFNA 1UK2A 5DP3A 3HATH 3QTOH 3BTTE 3UR9A 1HAGE 4DIHH 1BHXF 1MAYA 2BDCA 3GY6A 1L2EA 1D9IA 4ZXYH 2FOMB 4YOIA 4DG4A 4A7IB 1IQIA 3URCA 3M3VA 2ZFTA 2SGFE 3VXEH 1W7GH 4XBBA 4ZAEA 3M5LA 1VKYA 1C1WH 2ZQ2A 3ZVCA 1BRBE 5FPYA 4Y71A 3LPRA 1C4U2 3NCLA 4VGCC 3CNRA 5GXPA 1P01A 1GCTB 2C8YB 2GCHF 2RG3A 1MAXA 2BLWA 6GCHG 4D8NA 8GCHG 3LGUA 1F2SE 1UVTH 2PSXA 1DVAH 1FX0B 1AWFH 1ABIH 1PJPA 1LKBA 1YF4A 3RU4E 4F48B 4ABEA 4FUGA 2QC2A 4YOJA 3GCOA 2QYIA 5JB9S 2YMSB 4X8SH 1GJCB 4U30A 3NZIA 1SQAA 5EJZA 4NWKA 2CMYA 1Q3XA 1DFPA 2CGAA 1KXEA 2BQWB 3GDVA 2VBCA 1A3EH 5SGAE 1E1QD 1UTNA 1DSUA 3A7XA 1Q31A 1UCYH 3L33A 2J94A 3VXFH 2ZDMA 4NWLA 4NA7A 5FBEA 1IQMA 1GMDG 1NBMD 1HAHH 3S7HB 5E2PA 3UWIA 5KGOA 1FJSA 1G30B 3FZDA 2A4OA 1QJ7B 1ZZZA 5L6NH 1O3GA 2OTVA 1Y5UT 3HK3B 2Z9IA 5I25A 3HKJB 1F5LA 1H8DH 1H4WA 2FYQA 2GTBA 2XBYA 2L6OA 2ZO3H 2R0KA 3V13A 1A61H 3AW1A 5TCAA 4A5TS 1TBQH 3U1JB 3SV8A 1NT1A 3A8DA 2FODA 2FOEA 4INLA 2BOKA 3ATMA 2TPIZ 1CU1A 1Y3UA 1UHBA 1ANBA 1QJ1B 4Q80A 3T28A 1YGCH 4O03A 2BY5X 4NCYA 2GT8A 1P2NA 3EAJA 3A89A 3SU1A 4MDSA 1HAZB 1MTUA 3MFJA 6GCHF 8GCHF 1ZGVA 2QGRA 1L4DA 2F9PA 4THNH 4DY7B 1C5ZB 1DSTA 4BAHB 1QHRB 1FY5A 1CT2E 2GT7A 1CVWH 2BXTH 3QN7A 1SLVB 3B9FH 3MYWA 2OD3B 2ZDAH 4ASUD 3H7OA 1DICA 5DN6D 1UCYK 4I8KA 1UTMA 2B0FA 1KXDA 4H6TA 3ZZCA 1PPFE 1PQAA 1SSXA 1ESBA 4NZLA 4Z1MD 1S81A 4Y8YA 4YOGA 3S9AA 1GDUA 1C5OH 1MH0A 2BDGA 1EKBB 2C4FH 4GCHF 2Q6DA 4PROA 2IOTA 3ZZ9A 1NTPA 1WU1A 1S82A 3ZVDA 1LHFH 4Z0KA 2NWNA 4FU9A 3A81A 1A2CH 1S83A 2QIQA 5JBAS 5GPIB 3U8TH 2W6JD 3MNCA 1O3LA 1AUJA 1JRSA 1BTPA 3MMGA 1O2SA 2OQ5A 1FONA 1QFKH 2H1UA 2KFWA 3ATIA 3OSYA 2HALA 3DD2H 1C1UH 2PW8H 2Z3DA 1V2UT 3PYHA 3GDSA 1GMHF 4Y0ZE 4HZHA 3RU4T 3TLOA 1OWIA 3A7ZA 3HPTB 1QB9A 1HJAC 1EB2A 1HXEH 2AYWA 1CGHA 3F2HA 1NBME 3UY9A 3RXUA 1YPMH 1FZZA 1EAIA 1O3BA 1HUTH 1YLDA 5FX5A 1C9PA 4BXWA 4WY3A 3D49H 1HCGA 3KL6A 2O9QA 1LVMA 3LONA 4MNYA 4X6PA 4ABFA 4CRGA 6CHAC 4ISHH 3LC3A 3RXJA 3SJOA 3SJIA 3KGPA 1UCYE 1NFUA 3RXBA 2P3UB 3KNXA 1IHTH 2ZFSA 4M7GA 2Z9KA 3F68H 5DKMA 2O8WA 1KDQB 1O2HA 5EJLA 1OWEA 5CHAB 1AFQC 1ELVA 1ELTA 1GWAA 3DSPA 4FOUC 3BTHE 4JZIA 3NRLA 3ENSB 1GJ4H 3ODFA 5AFYH 1OYTH 2FO9A 1C2IA 4CHAB 1C2MA 1W11U 4RT0A 4LOYH 2PFEA 2FM2A 3SNCA 1P12E 2P95A 3PWBA 4CBNA 4UFGH 3RXVA 2QXIA 2QF4A 1MQ6A 1SGPE 4K2YA 1AB9C 2CHAC 1O2PA 3FFGA 4P00A 1FNIA 4ZMAH 4GHTA 1ZJDA 3KQ5A 1K1PA 1ZRBA 2PLXA 1ANCA 4X1QU 4XRNA 1NU7B 1DY9A 1SGTA 2ILNA 1BTXA 5ESTE 1WV7H 1DPOA 5LPFA 1ZPZA 2GZ7A 1P2IA 1IQLA 1COWD 1KXAA 3FAOA 4X2YA 1KXBA 1LTOA 1ELCA 4ZUHA 2BD4A 3SYJA 2KX4A 1FIZA 1KTSB 1C5QA 5C5NA 1D6WA 4U01A 3V12A 2GDDA 2PR3A 3AASA 2A7CA 4TPYA 3P8NA 1ZLRA 5C2ZA 1TRMA 1DANH 2ZU3A 1ZSKA 1SGEE 4IMQA 2F9BH 2ZHDA 4F49A 1V2JT 1SQRA 2ZPRA 3M37A 3DHKH 3TGIE 3AW0A 1MBMA 2KCAA 3KIDU 1O3NA 1PQ8A 2TGPZ 1XX9A 5FPTA 1AVXA 1Y8TA 1E36B 2OUAA 3ZVEA 1OPHB 1HAVA 1ANEA 1TNKA 2HPQH 1JXPA 1WBGB 3KYFA 2BOHB 2BX3A 1CO7E 2NU4E 3V0XA 2SNVA 1RIWC 4YT6H 2DUCA 1KYNA 3QGNB 1BHXB 1Y3YA 3AVZA 2TGDA 2BDIA 3KN2A 4INKA 2VVUA 3TJNA 3D65E 3BTDE 1VR1H 3M3SA 2F3CE 2PUXB 1S5SA 1AD8H 1NFXA 4AFUA 1FAXA 4BAMB 4BAKB 3AK5A 3D23A 1DUAA 1UJ1A 3CP7A 1CSOE 4R0IA 2ZHWH 1THRH 3LJJA 4I8JA 2V6NA 4JZ1A 3OY5U 1UO6A 2ZPSA 5F6MA 3B23B 5IDKA 2HOBA 3RXOA 4NFEA 2K0QA 2F9UA 3CS0A 3MU0A 2V3HH 3ZV8A 4INHA 4AX9H 1MTSA 4F4OC 4R8TB 3MH6A 4DURA 3ZZAA 1QB1A 1ELDE 1THPB 1NRPH 1ZGIA 2H9EH 4WMFA 1GI1A 2ZCLP 4FXGH 3A87A 2M2AA 4UONA 1E34B 3IG6B 2PKAB 1B5GH 4ABBA 1DLEA 1QA7A 5HM2A 4BAOB 1FI8A 2ZGJA 4B76A 1QRWA 4DGJA 1BMNH 2VIVA 1WAYB 2FDAA 3GCHC 4OGYA 5FHTA 3T27A 1P8VC 4DIIH 1GBBA 4BTTB 3P17H 2WPHS 5DP5A 4NG9H 1F92A 1CA8B 1HBTH 3FO8D 4M9FA 2OQUA 3RXSA 1RD3B 1V2WT 5LPEA 3VGCB 1BT7A 4I33A 2ZG0H 2EI7A 4WJG2 2A5KA 5FBIA 4BTUB 3KF2A 2QAAA 1BZXE 1AGJA 1O5CB 1CA0C 2GD4B 1XKAC 1W10U 2HRVA 3LJOA 3VB6A 1KMHB 3MU4A 3KCGH 2Z94A 1AU8A 3PLBA 1V2RT 2Y6TA 4Q63A 1O34A 1S0QA 1G2MA 4AGKA 1YPKH 1ZRKA 1TX6A 2F4LA 2VGCC 2FMJA 4SGBE 1BOQA 5EPYA 1WCZA 1T4UH 2QXGA 2JH0D 1C2DA 1TGTA 1VJAU 3IWMA 4FUDA 1EASA 1HJ9A 2KCYA 2TBSA 2OC0A 2BVRH 2KM0A 4YM9A 1NRNH 3PRBA 2O8TA 1C5LH 3RM2H 3SGAE 4ZKSU 1GHWH 2H5DA 4B73A 1MTVA 2FEQH 1Q2WA 2ZDKA 3ZVBA 2BDAA 1EX3A 3QK1A 4NIXA 1GGDC 2QCYA 2H5CA 1LHEH 1FUJA 2FTLE 4Y0YE 2ZEBA 1SGRE 3FP6E 2A7JA 1HFDA 1V2PT 5DP7A 1SMFE 2G5VA 3SU4A 3UPEA 4GVUA 3SZNA 1E37B 4X0WU 1F0RA 1GHYH 2JH5D 1TIOA 2BQ6B 3E16B 1TPPA 4XBCA 1KLJH 3W94A 2IPHA 3UNSA 2KCPA 4FUJA 1GHBG 4TWYA 3R0FA 1S6LA 1QRXA 2ZHQH 3E1XB 2XNDD 1KY9A 3PTNA 1EAUA 3GICB 2CXVA 1OWHA 2V7QD 3TGJE 1S6FA 4IW4E 4AFSA 2ZU4A 1ARBA 4ISLA 2Z9LA 5BRRE 4XFQA 1GJDB 5AF9H 3SV9A 1LHCH 5FL7D 1Z8IB 3GS9A 1VITG 3SQHE 1NM6A 2D1JA 1DWEH 3RXMA 1QIXB 1TFXA 1LHDH 1V2MT 2LELA 2WPMS 3BF6H 5LPRA 1TBZH 1EZUC 3F1SB 2TGAA 3P8GA 4GPGA 4ABGA 1G3CA 2ZECA 1H1BA 3SORA 3HGNA 5DO4H 5EQQA 3ZZ3A 1EPTA 4BOHA 1SGFA 2B8OH 4RKOB 2VIQA 3A85A 3M5MA 4Y8XA 5A0AE 2K8IA 4UD9H 3SU5A 1GI6A 2CV3A 3M5NA 4AFQA 1J8AA 4Q7ZA 3A7YA 4Y76A 2VIPA 3ZVAA 4WH6A 4X8VH 1L1JA 2FOHA 3PLPA 3BN9A 2GCHG 4NGAH 3GOVB 1TALA 2SGQE 1GCTC 4RN6A 4X6NA 1BBRH 4H42U 3SW2B 1F7ZA 1GHBF 2F91A 1ZHMA 2VH0A 2P93A 5DG6A 2QY0B 5HGGA 1N6XA 1PPCE 5HIYA 3MH5A 1B7XB 1VCPA 3MI4A 1PQ7A 5T6FA 4I8GA 3TJVA 2BTCE 4ESTE 3I78A 1P04A 1A1RA 2QXHA 4I8LA 3LDXH 1LKAA 4AB9A 1GI2A 2VWLA 4FETA 1J16A 3RP2A 1GI4A 1O2KA 1GL0E 3K9XB 2H2ZA 3RMLH 2FZZA 5AHGH 1GHVH 3SNAA 1SFIA 4ZCNA 1VITF 1MKXH 5GWZA 3E0NB 4U32A 1Z8RA 1ZPCA 1BRUP 5DSFA 2O8LA 1QB6A 1UVOA 1YPGH 3RXDA 1A0JA 5ESBA 2C8XB 1CGJE 5EU8A 1P10A 4Y11E 3RMMH 1GBHA 1BITA 2BD7A 3OYPA 2ODYB 2B5TB 3MU8A 2GMTB 5EG4A 4DW2U 1GJ9B 1NRQH 4DT4A 3DFJA 2R3UA 5TCCA 1EUFA 3UWJH 2STAE 1GVKB 1WQVH 7ESTE 4JYVH 4MPUA 2Y7ZA 1BBRK 3KEEA 4WH8A 1Z6JH 5EGMA 3U8RH 2Z3CA 3MNSA 1NRRH 3S9CA 1YWUA 3MOCA 4AFZA 2W7UA 2P3TB 5HYOA 1V6DA 5JBTA 1ETSH 2ZFFH 2J97A 4J2YB 3P95A 3JZ2B 4TY6A 1BMMH 4LZ1H 2QXJA 1H9LB 2WYGA 3A7WA 3VG8A 2OBOA 1O33A 3A86A 3BTFE 1S85A 1W7XH 2WUBA 3NWUA 2BB4A 5EJ1A 4D9QA 1MKXK 1FXYA 5DPAA 1DXPA 2BQ7B 1FIWA 2WYJA 1ZMLA 4GCHG 2ZCKP 1SOZA 1TX7A 3T5FH 2EEKA 5AFZH 1JWTA 3B8JA 1GI9B 1MU8B 3OX7U 3BEUA 5EXNA 2AS9A 1C9TA 1XUGA 3RXLA 5EOKA 3EA9A 1DOJA 4KGAA 1ZSJA 3F0OA 4GAWA 5FCKA 2THFB 1W13U 5GCHF 4CRCA 1TQ7B 3QO6A 4Y79A 4BTIB 1IQNA 1FLEE 3LH1A 2OC1A 1ZHRA 4FU7A 1P2KA 2GX4A 4GHQA 2OC7A 1K1LA 1TX8A 1TA6A 2P8OC 2AIQA 1A46H 5F03A 1TE0A 1HAPH 1TWXB 1O39A 1GMHG 2G8TA 1O2VA 5FPSA 1VZQH 4K8BA 2BY9X 3NPSA 1O3MA 1Z6EA 1YM0A 1P0SH 4HFPB 1BBRE 1NS3A 3KQBA 1OWDA 1ZMJA 1QQ4A 4KTCA 1GHXH 2Z3EA 4DT7B 1NROH 1SG8B 2ZFQH 3MH4A 1EAWA 3SUEA 4FUCA 1GBTA 1B0EA 2RDLA 3BTGE 2WV9A 2NU0E 2EY4C 3A8BA 4VGCB 3NXPA 1UTOA 2UUKB 5DJ7A 3WWFA 3I77A 1KSNA 1OHHD 2ZGHA 1KLIH 2XC5A 3RXQA 3MNBA 3DUXH 2FOCA 1TGBA 2XOKD 2BXUH 2BD5A 1T8LA 3NUMA 1O2WA 5F8ZA 1UTLM 1WQSA 2FPZA 5JBBS 4CR9A 1PPEE 2A1DB 2ZDLA 1V2OT 2GKVE 1FN8A 1Z71A 1OSSA 4MQAA 2KR7A 3OEED 1S6HA 2J98B 3SBKA 1OP2A 3N99A 3LGYA 1O3AA 3DSGA 1XM1A 3BTEE 1HAOH 4CHAC 1C2HA 1AUTC 1D3QB 5A8YA 2AERH 4O97A 1V2NT 1GVZA 3QX5H 1O3KA 4BANB 4MNWA 1SGNE 1SLXB 2JETC 3TNSA 4A6LA 8LPRA 3KHVA 3ZZ6A 4XDEA 4FUBA 3MNXA 1G37A 1GBLA 4MPXA 5JYIA 1E0FD 2KAIB 1K1JA 2LPRA 1MQ5A 1MTNC 1C5XB 1FAKH 3NK8A 2FI3E 3SV2H 3UOUA 1SKYE 3ODDA 4B2CA 1DM4B 3N7OA 5EXMA 5F8TA 4A1TA 2STBE 1ORFA 5DP6A 1O5GH 3RXPA 3PTBA 1A3BH 4B71A 3UQOA 1ZOMA 3TK6A 3PO1C 1C1VH 2V35A 1A5GH 4OM9A 3O8CA 2FX6A 3ZVGA 1P11E 4Y6DA 1TNLA 1BTZA 3BG4C 1HLTH 1TA2A 2XC0A 3H09A 3W1EA 1EPTC 2QF3A 1YBWA 2EI8A 2EI6A 5PTPA 2ULLA 3SNBA 2DE8A 4JZEH 1MUEB 3ATLA 2VIDA 3MU5A 2BY7X 4NA8A 4O9VA 1AI8H 2CK3D 2OCVB 1RS0A 4X2WA 2UUJB 3S0NA 4JK5A 1EOLA 3VFEA 1V2ST 5EW2H 1WUNH 1RXPA 2YMSD 2WHXA 2HVXA 3OE7D 4B6EA 3Q76A 1ARCA 3U1IB 2G4UA 2YNAA 1O32A 1GJBB 3RMOH 1HPGA 3SU3A 3M5OA 1UK3A 2PKSC 3P70B 4ACAA 3MU1A 1XXDA 1UVPA 1C5SA 1ZTLA 1TPOA 2GJGA 3FN8A 4Q7XA 2Y7XA 2WZQA 1D3TB 1CQQA 2FI4E 1EP6A 1W0KD 1SI5H 3A7TA 4B1TA 3A7VA 1TGSZ 3P6ZB 4X1PU 1DY8A 1UTJA 1GBEA 1ID5H 3L6PA 4D7FA 1P3CA 2G52A 4KTSA 3OFND 1IQEA 1GDNA 1AE5A 2G55A 1WSSH 3OTJE 1ANDA 3P92A 2BLOA 2JIZD 1IOEA 1O5EH 2ZWLH 3P8OA 3UTUH 1Z1IA 2VWNA 5GDSH 4WF8A 1PYTD 4MVNA 1EZQA 1BUIA 3MQKC 3UNQA 4ABDA 1HJAB 1QJ6B 2PTCE 5E0JA 2G5NA 5I46H 1C1NA 1EQ9A 1P9SA 2KZ4A 1ZR0A 1TRNA 3ZYEA 2W26A 3GCTG 1EOJA 4DJZB 2UUFB 3KQEA 4K1EA 2BDHA 9ESTA 3N7DA 5ETXA 1GJ5H 3OAAD 4UFFH 1A4WH 3UUZA 5IK2D 1OX1A 2XXLA 4QT8C 2VNTA 4RKJB 1D4PB 2FOGA 2BZ6H 4YO9A 4CRFA 4IC5A 3LC5A 4MPVA 3QLPH 2PGQB 3EE7A 3H5CB 1QGFA 1ZYOA 6CHAB 3RXKA 2PV9B 2AGEX 1V2KT 5K0HA 3RXCA 1S0RA 4ZXXH 4ASHA 1LPZB 1AVGH 4XBDA 1Y5AT 1SL3A 5EQSA 3HKIB 2H6MA 2XBWA 3BTKE 2WPDD 3V3MA 1EXFA 2GZ9A 1AFQB 2ZTYA 1LVOA 3A83A 1TLDA 4ISOA 3I29A 2GCTC 4TYDA 1M9UA 4K69A 4X6MA 2B7DH 5DP8A 1A5IA 2XWAA 3LGIA 3E90B 2OP9A 1GCDA 3TU7H 2A31A 3LOXA 1MD8A 1AB9B 1J15A 2CHAB 1AWHB 2ZA5A 1CBWC 1OOKB 3C1KA 1TNIA 1YPHE 2UWLA 2VVVA 4CRDA 6LPRA 3ZZ7A 2FTMA 4CR5A 1LPGB 3PM3A 4J1YA 3W95A 1P2QA 1O2MA 2LP6A 2D26C 1AKSB 3A8AA 3EGKH 2CF8H 2IJD1 4LXBH 3SUDA 5FAHA 2Y5GA 3FP7E 2F9NA 3A82A 1HIAB 1BTUA 2WPJS 1O2TA 4K1SA 1G3EA 1AE8H 1DT2A 2OINA 3LGTA 4NIYA 1GBFA 2FP7B 1SGYE 3SJ9A 2BD3A 2VINA 2Z7FE 5T1VA 4CBOA 1FMGA 5TJXA 1ZJKA 3GCTF 2BZAA 3ZIAD 1WTHD 5GIBA 1C2FA 3GCNA 3UAIC 4CRAA 1E79D 3ZZDA 3WY8A 2L74A 1QY6A 3E8LA 2H9TH 5CE1A 1MABB 4X1RU 3RM0H 2UUYA 5CMXH 1GBDA 4TY7A 5L2ZH 2A7HA 1O37A 1F0UA 2D8WA 2XNIA 4Z6AH 1KLTA 5A8XA 1H9HE 1CHOF 7LPRA 1XVOA 1L4ZA 2UWOA 4K8YA 2ZP0H 4ZHMU 1RIWB 4DCDA 2CJIA 1T8OA 4CREA 4AGJA 1D3PB 3TJUA 1BIOA 2BD9A 3DA9B 2HNTE 1KXCA 1F0TA 1LMWB 1P05A 1XUFA 1LDTT 1MTWA 1SQOA 2TRMA 4YZUA 4IN2A 1THSH 1A0HB 2NU2E 1G9IE 3L3TA 2OBQA 5FXLA 4AG2A 2ZNKH 1SLUB 3RXFA 3GYLB 4IGDA 3U69H 4IMZA 4ZROA 1GI3A 4ZKNU 2OXSA 1O2JA 2OC8A 1YLCA 2ODQA 5J4QA 1QBVH 2WUCA 4NZQA 1GI0A 1K0HA 2VIWA 1BQYA 4FUHA 3GDUA 3ZZBA 2SGDE 3BTME 3OU0A 1EP5A 3UQVA 1C2KA 1FN6A 4OGXA 1C4Y2 2XTTB 3PMBB 1C5MD 1O35A 1GBMA 2RA3A 2AH4X 2W6ID 4GLYA 3DT0H 3PMHB 5E8EH 1ZHPA 1DITH 1O38A 4D7GA 1F5RA 2UWPA 1TAWA 2A0QB 2FS8A 2ZU5A 4ABHA 1V2QT 1EAXA 4YT7H 1KDQA 1W14U 1TRYA 1DX5M 7KMEH 3PV5A 3T2NA 1V2LT 4Q2KA 1MU6B 3GCHB 8KME2 1SGDE 4JMYA 3WWBA 4TWWA 4RI0A 2ANMH 4MLFB 2XYAA 3Q77A 1DXWA 1GVLA 4GSOA 4A1XA 3LH3A 4CH2B 1O3OA 3K65B 3LKWA 1XUJA 5C5OA 1JBUH 1HAIH 2QF5A 4JYTA 1GJ8B 3RXTA 4ABAA 3TK9A 1CA0B 1UHBB 3PROA 1QBOA 3S69A 2ZHEH 3EA8A 1WTGH 1JMOH 1XMNB 2ANWA 2SGPE 1GI5A 3M36A 1RJXB 1BMLA 4B6FA 3M7QA 2R2MB 1MZAA 2WPIS 5J4SA 2VGCB 1UW7A 4DVAU 1K1IA 1ELFA 1YLNA 1Z7KA 2O8UA 4HTCH 3GY2A 3LGWA 1NZQH 4NIVA 4BNRA 1SGFG 3OEHD 1G3DA 1EB1H 1UTPA 3F3BA 3ATKA 2R9PA 1C5VA 1O31A 4UDWH 4AORA 1K1OA 3SI4H 2GP9B 1GI7B 4CH8B 3ZZ8A 3SU2A 3RLYH 1PPHE 1SQTA 2AGGX 2AHME 3SUGA 4ZKRU 2BVXH 2Y80A 3HK6B 3QUMP 5DP9A 1C5NH 2FS9A 1BRAA 1XKBC 1J17T 1GGDB 5GJ4B 1LHGH 3T29A 4XE4A 3SU0A 2HVYB 1P09A 3SOSA 3F0PA 7GCHF 5A0CA 4ABJA 2AMQA 2CN0H 2YNBA 1O2LA 2IJOB 1O5BB 1NO9H 3N7EA 4AB8A 2ZIQH 2VIOA 2F9OA 3BG8A 1YPHC 3PV2A 1YYY1 5A2MH 3RLWH 1O2GH 4X8TH 2YMSC 4LZ4B 4RSPA 3RXHA 1JRTA 1XVMA 4D9RA 4ABIA 4NSYA 4I32A 1DWDH 5E0GA 4UFDH 1O5AB 1IQKA 3STIA 1O36A 3TVJB 5F8XA 1MKWH 1K21H 1AHTH 1BMFD 1PPBH 1O2IA 3MO3A 1NFWA 1LO6A 2NU1E 1VGCB 2PKAA 4SGAE 2Q6FA 1HNEE 1K1NA 1TGNA 1ZPBA 5GCHG 2ZC9H 1SR5C 5G4BA 2A45B 1U6QA 3S9BA 2RDEA 5C0UA 4BAQB 1TNJA 3C27B 1G3BA 3VB4A 3SHAH 1ZTJA 3EE0B 1BDAA 4NA9H 3VEQB 2R3YA 2JDID 3SGBE 1ZSLA 1TB6H 2W7SA 3TJOA 3VB3A 5JB8S 3H7TA 3QZQA 1TPAE 1MZDA 1PYTC 2V0BA 3V7TA 4H6SB 1J9CH 1W3CA 4K60A 2HNTC 2Y81A 2HGTH 1TBRH 1WDIA 1YPJH 4AN7A 1MD7A 2C90B 1BMAA 1L0ZA 2FX4A 1BRCE 3AAVA 1P57B 1P2OA 1DWBH 4OS1A 2J5UA 2C8WB 3OTPA 1AIXH 5C20A 3VB5A 1CT0E 1GBCA 1IQHA 4KTUA 5KECA 1N8OB 5FCRA 1E1RD 3SI3H 1HAXB 2TIOA 4Y8ZA 2EC9H 1MKWK 2XCFA 3ZYDA 2RFKC 2A2XH 3R3GB 1SGCA 4AZ2B 2EA3A 1ELAA 2GV7A 1OWJA 4U2WA 3F2GA 2VWOA 3SGQE 4P02A 3ESTA 1Y5BT 1A5HA 1TMBH 2ZFRH 2ZHFH 2FESH 1Y3VA 2FYRA 1OP0A 3O8DA 3F2FA 4GUXA 4IN1A 3VPKA 1IQFA 1QR3E 3RC5A 3P8FA 1TONA 1FY1A 4ZKOU 2Z6BD 3FVFB 1SFQB 5DK1A 4O3TA 2ZKSA 1HAVB 5HIZA 3PMAB 4B2AA 1Y3WA 1O2QA 4KKDA 1RTFB 1TMTH 1GMCG 1GPZA 3DSOA 1GG6B 3RXRA 1P03A 1OS8A 2ZFPH 1NRSH 1C2LA 3AAUA 2HWLB 4I8HA 1YCPH 3A88A 2G81E 3DFLA 4A92A 1V3XA 2ZI2H 1TNGA 4RT1A 1SPJA 2JJ1D 3SV7A 4JK6A 5L2YH 2GDEH 2WINI 2AMDA 1DE7H 3FP8E 2VWMA 1YKTA 4MNVA 3SN8A 3U9AH 2YOLA 4XOJA 2Y5FA 4Y7AA 1FY4A 4Q7YA 2BX4A 3E6PH 4AG1A 4HGCA 3TIUA 1NU9A 2GVFA 3SNEA 1INCA 3RXAA 2P3FH 3F9FA 2ZU2A 3IITA 2BDYA 1LVYA 3RXEA 1O3JA 5GNDA 4D76A 1UVUH 2P59A 3A84A 3Q00A 3TH2H 1P02A 2PWXA 2ZF0H 1K1MA 1FY3A 1O2UA 1AN1E 2ASUB 2QV1A 2WSSD 1F0SA 4O3UA 4NFFA 1K22H 1N1LA 1UK4A 3BEIB 3Q3YA 4TT3D 5CHAC 2QN5T 2A5IA 3KQCA 1NY22 2FOFA 4ISNA 5JDUB 4E7RG 4X2XA 4ZHLU 1YCPK 1C1RA 2FOBA 1CE5A 1LVBA 1SGQE 3SHCH 2ZQ1A 1UVSH 1IAUA 1Z8GA 1GMCF 4FVDA 1O30A 2BY6X 1GMDF 1SHYA
chains in the Genus database with same CATH topology
1GJAB 2XWBI 3OY6U 4JCNA 2R2WU 1G36A 1PFXC 1NN6A 4AYYB 1UMAH 3Q3KA 1GHAG 1OYQA 4ZHAA 2P8OB 3TPIZ 9LPRA 1T31A 1O3FA 1OP8A 2PTNA 3UREA 1QURH 2RA0A 2ESTE 3SJ8A 3SO3A 2ZGXH 2A2QH 4OS6A 1DDJA 1HJ8A 1P9UA 2FIRH 2ZZUH 4OS2A 3QZRA 2WV4A 4YLUA 4MTBA 2ZPQA 2VU8E 1B0FA 5IYTA 1EATA 5HXFA 1YPLH 3TH3H 1BCUH 3BEFB 2ALVA 4X2VA 1C2EA 1NFYA 2FLRH 1BTWA 4UFEH 2BD2A 1GBKA 2J95A 3GY3A 2SNWA 1GJ7B 1H8IH 3E3TA 1ELBA 1WYKA 3RUOA 5ABWA 3FZZA 1AFEH 1KIGH 2A4GA 1GJ6A 3MH7A 4E06H 2J92A 2QF0A 3T25A 1O2ZA 1GDQA 3SNDA 4BXSA 1LCYA 1SC8U 1LPKB 4LK4A 4X1NU 4X8UH 4Y7BA 1V2VT 2ZGCA 2HPPH 2ZDVH 2VJ1A 4MPWA 1FQ3A 2J2UA 1KTTB 3F9HA 3M3TA 4YTAA 4OS4A 1SHHB 3G01A 4IBLH 1C2GA 2BM2A 1XUIA 1QL9A 2JETB 2BLQA 2IN2A 4MNXA 1YPEH 3S7KB 1BJUA 1S84A 3E91A 3RC4A 1VJ9U 3URDA 4KP0A 3E0PB 4X6OA 1GHAF 1O2OA 1G2LA 5DP4A 1HRTH 1C1MA 2D2DA 2F83A 4MG3A 1W12U 4I7YH 2W3KA 4NSVA 4FUEA 1MTNB 1O5FH 2WV5A 2J4IA 1K28D 1A7SA 1O2XA 2GZ8A 4UE7H 1GBIA 4WXVA 4IS5A 2B9LA 1QBNA 4JYUH 3GY8A 3TK5A 5JBCS 5H4IB 2Y5HA 2SGAA 8ESTE 1BA8B 3NKKA 4CRBA 2ZDNA 2BMGB 3PO1B 3TNTA 2Z9JA 3VGCC 3F9EA 3PV4A 4IC6A 1AZZA 1P3EA 1FV9A 2AEIH 4WMDA 1FPHH 4ZH8A 1UTQA 2G51A 3BG4B 1VCQA 1P2MA 2GGVB 3PB1E 2LNCA 1QTFA 1EPTB 3RXGA 5EW1H 1CHOG 5EODA 1Y59T 2A32A 1EZXC 4TPIZ 1QRZA 1BTYA 3GISB 1T4VH 2M5TA 5EPNA 1QL7A 1UTKA 3TH4H 3UFAA 3PMJA 2JKHA 4E05H 4HI3A 1ETTH 1VCWA 1P06A 2C8ZB 1YP9A 3EDXB 1Z1JA 2Q1JA 1YC0A 1QNJA 4FU8A 2ZGBH 2P16A 1AZ8A 5T6DA 3RDZA 3UIRA 1SBWA 2V3OH 3SQEE 2PGBB 1N6YA 1TABE 1ESTA 4AYVB 1EJAA 3ELAH 3GY5A 3UOPA 1D3DB 1XXFA 2CF9H 2PKSB 2XRCA 1ABJH 5A8ZA 1MBQA 3Q3XA 1FDPA 2RCEA 1NC6A 1W0YH 3F9GA 1TGCA 2XC4A 3RC6A 1OKXA 1LQEA 1C2JA 1P2JA 5EQRA 2AIPA 2XW9A 1SGIB 3O8RA 1L1GA 3LIWA 3U98H 1FY8E 2P94A 2Y82A 3A8CA 1C5RA 1EZSC 1AQ7A 4FUIA 1TOCB 1C1PA 1D6RA 3JZ1B 1GBAA 1C5TA 2J9NA 4B75A 1IHSH 1W8BH 2O8MA 1DUEA 1JOUB 2A5AA 2XBXA 3PLKA 3KQDA 1LQDB 1SVPA 4WXIA 3EA7A 5HM9A 4K3JA 2BD8A 5LGOA 4Y10E 4I31A 2I6QA 1TOMH 2I6SA 3BIVH 4ISIH 1XUKA 5C67A 1O3CA 3PWCA 3SV6A 3EYDA 2ODPA 2H9HA 2FOAA 1AMHA 1C5UA 2C3SA 1HGTH 3QWCH 5DGJA 2SFAA 1XUHA 1HDTH 2KAIA 1BJVA 1PPZA 2HNTF 5JPMH 3K2UA 3BTQE 1AY6H 2F9VA 5EXLA 4XSKU 1DWCH 4WMEA 5AVDA 2QA9E 3LT3A 3MHWU 1FPCH 1TMUH 2J38A 1A0LA 1C5PA 2ZTXA 1C1TA 1BTHH 5C3NA 4H4FA 3EQ0H 1QL8A 1G32B 2BYAX 2FI5E 5K7RA 3O8BA 1T8MA 2A4RA 2HLCA 3BIUH 2GCTB 1CT4E 4AOQA 3UNRA 3ATWA 2ZU1A 1E38B 1OXGA 3MTYA 1W0ZU 1CGIE 5HMAA 3M7UA 1CBWB 1K9OE 1C1QA 2ALPA 1VITH 2W3IA 3SU6A 3HGPA 1QCPA 3STJA 1KXFA 1ZMNA 2AGIX 1BB0B 1NESE 1ZTKA 2AMPA 1RGQA 5C1UA 3T62A 1O3PB 3M35A 1QA0A 3CS7A 2G4TA 1JIRA 3RXIA 1DLKB 1O5DH 1O3DA 7GCHG 1T8NA 4DOQA 1TQ0B 1SB1H 1IQJA 1T7CA 1HYLA 1X7AC 2BHGA 3BTWE 5A09A 1O0DH 3QTVH 1YCPM 1C5YB 4K1TA 4B74A 1PQ5A 2SGEE 3K6YA 3RMNH 2GV6A 3U8OH 1JIMA 3M61U 1GBJA 1O2YA 4YESB 4K5ZA 2Q6GA 3QGJA 1MCTA 5LH8A 3K6ZA 4FUFA 1TNHA 3F6UH 3MO6A 1MCVA 3D62A 1ELGA 1HXFH 1O3EA 2FLBH 2XCNA 1EJNA 1VGCC 3LGVA 5BPEA 1C5WB 2DE9A 1O2NA 4FVBA 1NPMA 1SLWB 3BV9B 1Y3XA 2NU3E 1RRKA 3ZV9A 1ESAA 1AVWA 1SOTA 5T3HA 2ANYA 3MWIU 1GI8B 2GMTC 2K1QA 1EJMA 4B2BA 5T6GA 3M7TA 2PUQH 3RU4D 2A4QA 2Z9GA 3A80A 1K2I1 2WPKS 1HB0B 5A0BA 1H9IE 2G00A 3TGKE 2BY8X 1IQGA 5E0HA 3VB7A 2BDBA 2TGTA 1ELEE 3TITA 2OLGA 1J14A 2C93B 1HV7A 2FXRA 2XBVA 4A1VA 1C1OA 4NIWA 3QDZB 5B6OA 2R0LA 1MMJN 1QQUA 2VH6A 3GYMA 1GHZA 1O3HA 2VVCA 1N8OC 1TPSA 1TYNA 2JH6D 6ESTA 3T26A 1ACBE 4WVPE 1Z8JB 3ITIA 1C4V2 2J34A 1WOFA 1AO5A 3CENA 1DS2E 3MO9A 3UR6A 4JZFH 5E2OA 3FANA 4YLQH 4KELA 5FX6A 4E7NA 1CHGA 1OWKA 3GY7A 1GL1A 1ETRH 4OS7A 5L30H 2BVSH 2ANKH 1W2KH 1PPGE 3BSQA 4JZDH 3ZVFA 2AFQB 3ZZ5A 1F5KU 1O3IA 2VB0A 3SJKA 1RTKA 1C1SA 1AKSA 5C1XA 1V2TT 5C1YA 1T32A 2W5EA 1HIAA 1O2RA 1HAYB 2PSYA 2WPLS 4WWYA 2PHBA 2ZTZA 1E35B 4UEHH 2FWWA 1RTLA 4OS5A 3GY4A 4X1SU 3SUFA 3LU9B 1L1NA 2ZCHP 2BLVA 3ZZ4A 1GG6C 1RFNA 1UK2A 5DP3A 3HATH 3QTOH 3BTTE 3UR9A 1HAGE 4DIHH 1BHXF 1MAYA 2BDCA 3GY6A 1L2EA 1D9IA 4ZXYH 2FOMB 4YOIA 4DG4A 4A7IB 1IQIA 3URCA 3M3VA 2ZFTA 2SGFE 3VXEH 1W7GH 4XBBA 4ZAEA 3M5LA 1C1WH 2ZQ2A 3ZVCA 1BRBE 5FPYA 4Y71A 3LPRA 1C4U2 3NCLA 4VGCC 5GXPA 1P01A 1GCTB 2C8YB 2GCHF 2RG3A 1MAXA 2BLWA 6GCHG 4D8NA 8GCHG 3LGUA 1F2SE 1UVTH 2PSXA 1DVAH 1AWFH 1ABIH 1PJPA 1LKBA 1YF4A 3RU4E 4ABEA 4FUGA 2QC2A 4YOJA 3GCOA 2QYIA 5JB9S 4X8SH 1GJCB 4U30A 3NZIA 1SQAA 4NWKA 2CMYA 1Q3XA 1DFPA 2CGAA 1KXEA 2BQWB 3GDVA 1A3EH 5SGAE 1UTNA 1DSUA 3A7XA 1Q31A 1UCYH 3L33A 2J94A 3VXFH 2ZDMA 4NWLA 4NA7A 5FBEA 1IQMA 1GMDG 1HAHH 3S7HB 5E2PA 3UWIA 1FJSA 1G30B 3FZDA 2A4OA 1QJ7B 1ZZZA 5L6NH 1O3GA 2OTVA 1Y5UT 3HK3B 2Z9IA 5I25A 3HKJB 1F5LA 1H8DH 1H4WA 2FYQA 2GTBA 2XBYA 2ZO3H 2R0KA 3V13A 1A61H 3AW1A 5TCAA 4A5TS 1TBQH 3U1JB 3SV8A 1NT1A 3A8DA 2FODA 2FOEA 4INLA 2BOKA 3ATMA 2TPIZ 1CU1A 1Y3UA 1UHBA 1ANBA 1QJ1B 4Q80A 3T28A 1YGCH 4O03A 2BY5X 4NCYA 2GT8A 1P2NA 3EAJA 3A89A 3SU1A 4MDSA 1HAZB 1MTUA 3MFJA 6GCHF 8GCHF 1ZGVA 2QGRA 1L4DA 2F9PA 4THNH 4DY7B 1C5ZB 1DSTA 4BAHB 1QHRB 1FY5A 1CT2E 2GT7A 1CVWH 2BXTH 3QN7A 1SLVB 3B9FH 3MYWA 2OD3B 2ZDAH 3H7OA 1DICA 1UCYK 4I8KA 1UTMA 2B0FA 1KXDA 4H6TA 3ZZCA 1PPFE 1PQAA 1SSXA 1ESBA 4NZLA 1S81A 4Y8YA 4YOGA 3S9AA 1GDUA 1C5OH 1MH0A 2BDGA 1EKBB 2C4FH 4GCHF 2Q6DA 4PROA 2IOTA 3ZZ9A 1NTPA 1WU1A 1S82A 3ZVDA 1LHFH 4Z0KA 2NWNA 4FU9A 3A81A 1A2CH 1S83A 2QIQA 5JBAS 5GPIB 3U8TH 3MNCA 1O3LA 1AUJA 1JRSA 1BTPA 3MMGA 1O2SA 2OQ5A 1FONA 1QFKH 2H1UA 3ATIA 3OSYA 2HALA 3DD2H 1C1UH 2PW8H 2Z3DA 1V2UT 3PYHA 3GDSA 1GMHF 4Y0ZE 4HZHA 3RU4T 3TLOA 1OWIA 3A7ZA 3HPTB 1QB9A 1HJAC 1EB2A 1HXEH 2AYWA 1CGHA 3UY9A 3RXUA 1YPMH 1FZZA 1EAIA 1O3BA 1HUTH 1YLDA 5FX5A 1C9PA 4BXWA 4WY3A 3D49H 1HCGA 3KL6A 2O9QA 1LVMA 3LONA 4MNYA 4X6PA 4ABFA 4CRGA 6CHAC 4ISHH 3LC3A 3RXJA 3SJOA 3SJIA 3KGPA 1UCYE 1NFUA 3RXBA 2P3UB 3KNXA 1IHTH 2ZFSA 4M7GA 2Z9KA 3F68H 5DKMA 2O8WA 1KDQB 1O2HA 1OWEA 5CHAB 1AFQC 1ELVA 1ELTA 1GWAA 4JZIA 3BTHE 3ENSB 1GJ4H 3ODFA 5AFYH 1OYTH 2FO9A 1C2IA 4CHAB 1C2MA 1W11U 4LOYH 2PFEA 2FM2A 3SNCA 1P12E 2P95A 3PWBA 4CBNA 4UFGH 3RXVA 2QXIA 1MQ6A 1SGPE 4K2YA 1AB9C 2CHAC 1O2PA 3FFGA 1FNIA 4ZMAH 4GHTA 1ZJDA 1K1PA 1ZRBA 2PLXA 1ANCA 4X1QU 1NU7B 1DY9A 1SGTA 2ILNA 1BTXA 5ESTE 1WV7H 1DPOA 5LPFA 1ZPZA 2GZ7A 1P2IA 1IQLA 1KXAA 3FAOA 4X2YA 1KXBA 1LTOA 1ELCA 4ZUHA 2BD4A 1FIZA 1KTSB 1C5QA 5C5NA 1D6WA 4U01A 3V12A 2GDDA 2PR3A 3AASA 2A7CA 4TPYA 3P8NA 1ZLRA 5C2ZA 1TRMA 1DANH 2ZU3A 1ZSKA 1SGEE 4IMQA 2F9BH 2ZHDA 4F49A 1V2JT 3M37A 2ZPRA 3DHKH 3TGIE 3AW0A 1MBMA 3KIDU 1O3NA 1PQ8A 2TGPZ 1XX9A 5FPTA 1AVXA 1Y8TA 1E36B 2OUAA 3ZVEA 1OPHB 1HAVA 1ANEA 1TNKA 2HPQH 1JXPA 1WBGB 2BOHB 2BX3A 1CO7E 2NU4E 3V0XA 2SNVA 1RIWC 4YT6H 2DUCA 1KYNA 3QGNB 1BHXB 1Y3YA 3AVZA 2TGDA 2BDIA 3KN2A 4INKA 2VVUA 3TJNA 3D65E 3BTDE 1VR1H 3M3SA 2F3CE 2PUXB 1S5SA 1AD8H 1NFXA 4AFUA 1FAXA 4BAMB 4BAKB 3D23A 1DUAA 1UJ1A 3CP7A 1CSOE 4R0IA 2ZHWH 1THRH 3LJJA 4I8JA 2V6NA 4JZ1A 3OY5U 1UO6A 2ZPSA 5F6MA 3B23B 5IDKA 2HOBA 3RXOA 4NFEA 2F9UA 3CS0A 3MU0A 2V3HH 3ZV8A 4INHA 4AX9H 1MTSA 4F4OC 4R8TB 3MH6A 4DURA 3ZZAA 1QB1A 1ELDE 1THPB 1NRPH 1ZGIA 2H9EH 4WMFA 1GI1A 2ZCLP 4FXGH 3A87A 4UONA 1E34B 3IG6B 2PKAB 1B5GH 4ABBA 1DLEA 1QA7A 5HM2A 4BAOB 1FI8A 2ZGJA 4B76A 1QRWA 4DGJA 1BMNH 2VIVA 1WAYB 2FDAA 3GCHC 4OGYA 5FHTA 3T27A 1P8VC 4DIIH 1GBBA 4BTTB 3P17H 2WPHS 5DP5A 4NG9H 1F92A 1CA8B 1HBTH 2OQUA 3RXSA 1RD3B 1V2WT 5LPEA 3VGCB 1BT7A 4I33A 2ZG0H 2EI7A 4WJG2 2A5KA 5FBIA 4BTUB 3KF2A 2QAAA 1BZXE 1AGJA 1O5CB 1CA0C 2GD4B 1XKAC 1W10U 2HRVA 3LJOA 3VB6A 3MU4A 3KCGH 2Z94A 1AU8A 3PLBA 1V2RT 2Y6TA 1O34A 1S0QA 1G2MA 4AGKA 1YPKH 1ZRKA 1TX6A 2VGCC 2FMJA 4SGBE 1BOQA 5EPYA 1WCZA 1T4UH 2QXGA 2JH0D 1C2DA 1TGTA 1VJAU 3IWMA 4FUDA 1EASA 1HJ9A 2TBSA 2OC0A 2BVRH 4YM9A 1NRNH 2O8TA 1C5LH 3RM2H 3SGAE 4ZKSU 1GHWH 2H5DA 4B73A 1MTVA 2FEQH 1Q2WA 2ZDKA 3ZVBA 2BDAA 1EX3A 3QK1A 4NIXA 1GGDC 2QCYA 2H5CA 1LHEH 1FUJA 2FTLE 4Y0YE 2ZEBA 1SGRE 3FP6E 2A7JA 1HFDA 1V2PT 5DP7A 1SMFE 2G5VA 3SU4A 3UPEA 4GVUA 3SZNA 1E37B 4X0WU 1F0RA 1GHYH 2JH5D 1TIOA 2BQ6B 3E16B 1TPPA 4XBCA 1KLJH 3W94A 2IPHA 3UNSA 4FUJA 1GHBG 4TWYA 3R0FA 1QRXA 2ZHQH 3E1XB 1KY9A 3PTNA 1EAUA