1BZXE

The crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
222
structure length
222
Chain Sequence
b'IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structure of anionic salmon trypsin in complex with bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bzxE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bzxE02
1C1RA 3URDA 2P59A 3GY7A 2ZDNA 1MD7A 1SGIB 4FUDA 3SU4A 3Q76A 4H6TA 1RFNA 1NFUA 3BG4C 1AKSB 1FI8A 2STBE 2GMTB 3OTJE 1TONA 1BMLA 1QQ4A 5HYOA 3UNRA 2R3UA 4XBBA 5EQQA 5HM9A 3SHCH 4ZHAA 2M5TA 8ESTE 4YZUA 4DGJA 3STIA 1Z6EA 1YPHC 3OYPA 3PLKA 2AIPA 1SC8U 6GCHG 3PLBA 1O5BB 3E6PH 1GJBB 5DP8A 2WUBA 5DK1A 1FY8E 3FVFB 4XE4A 3LOXA 2FYRA 1G9IE 1LVOA 1V2VT 5F8TA 5JB8S 1GBBA 3ZVEA 1GCDA 4KKDA 4AZ2B 3W95A 4YO9A 3P70B 4PROA 4Q80A 2WPIS 1TBQH 2HNTC 1P01A 4JYVH 4BOHA 1JRTA 2I6SA 4AFQA 1ORFA 4JZ1A 2FTMA 4RSPA 5EPNA 3RXKA 5E2PA 4DIHH 1FPHH 3A88A 3RM0H 1FNIA 3RU4E 2BY7X 1GCTC 1QL8A 2BOHB 3AAVA 3LU9B 6CHAB 4B2AA 1C1WH 1HB0B 1VITH 1FPCH 1C4V2 2HVXA 2QYIA 4CRFA 1J8AA 3EQ0H 1S0RA 1SB1H 2VH0A 4AGKA 1HAVA 5LPRA 4JZDH 4DY7B 1TGNA 3A8AA 2CMYA 5FPSA 3A80A 3PV4A 2EI6A 4X8UH 2OCVB 3L3TA 3I77A 1EX3A 2I6QA 1H4WA 1VZQH 2NU3E 5CHAC 3P8GA 3TITA 1JXPA 1WQVH 1GMCG 3M35A 4MPXA 2P8OC 2BLOA 4MDSA 3GDSA 1MKXK 3BTEE 5C1YA 2J2UA 3FP6E 1KY9A 1QRXA 1PPFE 4XSKU 4CREA 1PQ7A 2TGDA 2QA9E 3SNCA 2J4IA 3MU1A 1LVMA 1NRRH 3BSQA 3HKIB 1MTVA 3MTYA 1GJDB 2ALPA 3QUMP 1VITF 1IQHA 2ZG0H 3K9XB 4ZKOU 5A8ZA 5IYTA 5FAHA 4AYVB 2XC4A 1PPEE 3LKWA 1ZSKA 2YNAA 4ABDA 5FHTA 3U9AH 1K1OA 2TRMA 1OS8A 2HALA 2VINA 1EAWA 1BTUA 1YPJH 5FCRA 1GHBG 3QZRA 1GJ5H 2V3OH 1ZMNA 3PROA 2A4GA 1GG6C 2VIDA 3FP8E 2BD5A 2BD3A 2BLWA 1B0EA 1GGDB 3O8CA 1P57B 4JZIA 4Y10E 2GCTB 3RXSA 1CSOE 1P12E 1CA0C 3ZZAA 2ZGHA 3KF2A 3TJOA 3ZZ7A 1FAXA 1JOUB 2WPLS 1O2KA 1DWBH 1BZXE 2QXGA 3ATKA 3UQVA 2G5VA 1KTSB 3IG6B 1RIWC 2XC5A 1PPBH 1HLTH 1MQ5A 3LDXH 5EW2H 1U6QA 1GMHF 1KXCA 1KXDA 2ODPA 2XCFA 3B8JA 4AB9A 2C8ZB 1ESTA 3FP7E 5EXNA 3ATMA 1BTXA 3SUFA 4X8SH 1GI5A 2XW9A 5JB9S 6ESTA 4D7FA 1N1LA 1EPTB 1MCTA 4WMEA 1SG8B 4K8BA 3ZZDA 1TA6A 2TPIZ 3VXFH 2HNTE 3F6UH 3BTQE 2BD8A 2QXHA 1P03A 3UOPA 2SNWA 4KTCA 2A2XH 4JZFH 4O97A 1V3XA 1Y3VA 2BMGB 1EP6A 1SLWB 4CR9A 1TOMH 3OY5U 1HIAB 1AB9B 2ZU4A 1UJ1A 4OS2A 1A61H 1BJUA 2AYWA 1THSH 2BVXH 2GV6A 2G4TA 4ZROA 2ZPQA 4NIVA 5L2YH 1MUEB 3TK6A 4WWYA 1NC6A 4UDWH 3F1SB 1IQIA 3KQEA 3PTBA 1BBRE 4Y76A 1BRUP 5TCCA 2XBXA 3GYLB 1UK4A 4Q7XA 2J34A 2AIQA 4H6SB 1KLIH 4AN7A 1ID5H 2H9EH 2VVCA 2ZA5A 1TIOA 1UCYE 5L2ZH 1C2IA 4MNYA 2FWWA 2KAIB 1KTTB 1DLKB 1V2NT 2CV3A 1C5OH 3ODFA 2IOTA 1KXAA 2BZ6H 1PFXC 3E90B 1G2LA 2WYGA 1O2VA 3CS7A 1BRCE 2FI4E 3M61U 2FODA 8LPRA 1C1SA 3T62A 3A85A 4K1TA 1O5CB 2C8YB 2EEKA 3BTTE 1OPHB 1V2TT 1OXGA 1UK3A 3LGYA 4LXBH 4Y7BA 3TJVA 1XKBC 3E0PB 4GUXA 4DCDA 1SQTA 2GMTC 1IHSH 1UTKA 3SZNA 5EPYA 1YLDA 1SGQE 1NM6A 4MNVA 2W3KA 3QDZB 3SNDA 3O8RA 4NA8A 3U1IB 2F9UA 4NFFA 3QK1A 3RC6A 2VWOA 2BM2A 3SV7A 1W13U 1EZQA 3BF6H 4FUFA 1GHWH 5CE1A 1P9UA 1C5PA 1S85A 2GCHF 1O3HA 2R3YA 3RMMH 2OD3B 3T25A 1EJMA 1ZLRA 3MOCA 3ZV8A 2VVUA 3ZYDA 5G4BA 2A5KA 5LH8A 1ZHRA 4NG9H 1C1TA 1QR3E 1DOJA 3UWIA 1MAYA 3E16B 5JBTA 1L2EA 1GWAA 5E0GA 1XM1A 5HMAA 5JBAS 1QJ1B 2TGAA 3U1JB 2BDBA 1AD8H 1C5LH 2BVRH 2UUYA 4MVNA 1C2HA 5EQSA 3F9FA 4SGAE 3VGCB 4FU8A 2P3TB 1Q3XA 1WUNH 4AORA 5DP5A 1HXFH 4D9QA 3RXFA 2W3IA 3ATLA 3P6ZB 3FANA 1MTWA 6CHAC 4MNWA 4BXSA 4H4FA 5JBCS 4BXWA 1P04A 2AGEX 2F9OA 4ZAEA 4UD9H 3LGUA 4AOQA 1EUFA 2ANYA 1T4UH 1Y3YA 2F9VA 3A8CA 2AEIH 2BOKA 3SU0A 1DLEA 4ZXXH 4Y8ZA 1G3CA 2ZF0H 1FY5A 3RXVA 3RXPA 1HXEH 1YKTA 3SI3H 1CHOF 1GI6A 3MO6A 5EODA 9LPRA 3ZZ3A 1ZR0A 1FV9A 4B75A 3UUZA 3SOSA 2ANMH 3M36A 1JMOH 2G55A 4Y71A 1A0JA 4YM9A 3NXPA 2GV7A 4IS5A 1DXWA 1O3KA 1VJ9U 3BTGE 4OGXA 1W0YH 1FDPA 2ZFSA 1ZHMA 2H9HA 3QO6A 4CRDA 1TQ7B 3QTVH 2Y80A 1O3MA 1TMTH 2ZWLH 2ZC9H 2BY6X 1UTQA 3TH2H 4WF8A 2Z9IA 4JYTA 3I29A 1BTWA 4TYDA 4TY7A 3AASA 2OC8A 2QXJA 3PMAB 2GT8A 3P8FA 3ZZBA 1C5XB 3LH1A 1E37B 3DFLA 1OWHA 1GGDC 3V12A 3VEQB 2GCTC 1XUJA 2A31A 3NWUA 1SGPE 1YP9A 1MH0A 1MBQA 1B7XB 5TCAA 1K28D 4X2YA 1GDUA 4F49A 2Q6FA 5FBEA 1Z7KA 3RXDA 3H7TA 1UMAH 1GBAA 3PWBA 2A7CA 2BQWB 3SBKA 1FY3A 4HZHA 2PGBB 5GJ4B 3RXJA 4TPYA 1ESBA 4AFUA 1O2NA 3H5CB 1K1LA 3S7KB 3SJ9A 1EPTC 2CF8H 4I7YH 1BT7A 3OY6U 1AY6H 2A7HA 2THFB 1VR1H 3SU2A 3ZZ9A 4YOGA 3RXAA 3TPIZ 3V13A 2BLQA 1GI7B 1A0LA 1XUKA 3EA9A 4AG2A 1LKAA 1D6WA 2FS8A 4ZKRU 1CO7E 2C90B 2ZTXA 2OBOA 1GPZA 2J92A 1J14A 2GZ7A 3MO9A 1ZTLA 3QGJA 5JBBS 1TPSA 2IN2A 1FAKH 5EGMA 3SNBA 3PMJA 1AB9C 1W0ZU 1YLCA 1GI8B 5T6DA 1YF4A 4U2WA 3VB5A 2SGDE 2G5NA 1J9CH 1DICA 1T8MA 2TGTA 1K1JA 1ABIH 1PQ8A 4DOQA 1BHXB 1YYY1 2HNTF 1ZTKA 4D8NA 1BBRH 3SHAH 3KQDA 1D3PB 1C5NH 1ARCA 3FFGA 3MH4A 1V6DA 2F9PA 2VH6A 5DP6A 1GBFA 1L0ZA 3A7VA 4ZMAH 2VIPA 3DT0H 1S82A 1UCYH 3LT3A 1AN1E 2ILNA 5T3HA 3O8BA 1XUHA 1GI4A 2Z6BD 4RN6A 2BYAX 3EDXB 3LH3A 3LIWA 3S69A 1LCYA 4Z0KA 1C9TA 4A1TA 4CRAA 3GDUA 4BAKB 1GI0A 1IHTH 2ZECA 1HAXB 2EI8A 2W7SA 4I8KA 4U32A 2SGQE 1P10A 1GHAG 1MTNB 4Y0ZE 1AUTC 1V2PT 2OBQA 3LC5A 1GVZA 1SI5H 1DSUA 3B23B 5FCKA 3D23A 4THNH 4MTBA 1QB6A 4IMZA 1HAVB 2JH5D 2XXLA 1YPGH 5C2ZA 4X6PA 1D6RA 1IQGA 1C5VA 1FLEE 1WBGB 3GCHB 1P2NA 1BBRK 3FAOA 3LC3A 1A5IA 1ZMJA 1LMWB 4I8HA 3GCTG 3PLPA 3KN2A 1O2GH 5GCHF 1T7CA 2OP9A 1UCYK 1QBVH 3PMHB 4BAMB 2FM2A 2PFEA 4OS5A 1OYQA 1Y3XA 1AFEH 2AS9A 1OP8A 1AU8A 2BDYA 3RLYH 1DWCH 4TWYA 1KXFA 2GDEH 2ZFQH 1GBJA 2VB0A 5GIBA 1FN8A 3HPTB 1TMUH 1TBZH 1N8OB 2PUXB 4YESB 3SNAA 3GY3A 4NFEA 4NIXA 1C1OA 3E3TA 2RDLA 3SJ8A 4ZH8A 3KNXA 3K6ZA 1FONA 6LPRA 4ZHMU 4BTUB 1Z8IB 1BDAA 1GJ8B 1BOQA 5A09A 2HPPH 1AVGH 4WJG2 3ZYEA 2ZCHP 4FUJA 3VGCC 2G81E 8GCHF 2BXUH 5I46H 1SOZA 4B76A 1P8VC 2F3CE 3SGAE 1IQEA 4B73A 1YPLH 3F9EA 3BTKE 1KXBA 1W14U 2FEQH 2PWXA 2UUFB 3UNSA 1LDTT 2GP9B 3EAJA 1OSSA 3SQHE 2H1UA 1O3GA 1WTHD 3SJKA 1AUJA 3ITIA 3NK8A 1A4WH 2XWBI 1KLJH 1NN6A 1MKXH 2FIRH 1GHVH 1QRWA 3NPSA 1Y8TA 1SLXB 1SQAA 3MO3A 2B9LA 1UHBA 3ZZ8A 3DD2H 1W3CA 3GY4A 2ZHWH 2JETB 4AFZA 2O8TA 2G00A 5A8YA 4U01A 4IC6A 2ZEBA 1YPMH 2FOCA 1WYKA 1BTYA 1KLTA 1Z1IA 1O5DH 1TRMA 2BY9X 2FI5E 2G52A 1C5RA 1YBWA 1H8DH 2A2QH 1Z8RA 3BIUH 3GDVA 2NWNA 1SGYE 5C67A 3ZVBA 2CJIA 4I31A 4K3JA 1O2YA 2A4OA 4JZEH 3BEIB 1UTNA 3ESTA 4AYYB 1GMDF 1O31A 4AX9H 1DFPA 2OTVA 4DVAU 1JIMA 5DP7A 3M5MA 4BAQB 1YM0A 1ZOMA 2J38A 3UOUA 3FZDA 4YTAA 1EZUC 5AFYH 1HAYB 4K1SA 4UEHH 3MMGA 3T29A 1MCVA 2FOMB 1O36A 4X2WA 1DWEH 4RKOB 1RS0A 1C2LA 1EOLA 1RRKA 4ABAA 2DE8A 3PM3A 4FVBA 3ATWA 1GJ9B 4WVPE 4LK4A 5DP9A 3RUOA 3LJJA 1LVYA 1MU8B 1A0HB 2GZ9A 1O33A 2FOHA 2JH0D 3BTHE 4MPVA 3SU5A 2PW8H 1D3TB 1S5SA 3A82A 4TWWA 1DT2A 4SGBE 1V2RT 4ABGA 3MH6A 1O3BA 3OU0A 3HK3B 4I8LA 3H7OA 3TNTA 4NWLA 1O3LA 2QAAA 1CT2E 2H5CA 1D3DB 1TPOA 1OWEA 2A45B 4YLUA 1O5FH 1ZJKA 3NCLA 4JCNA 5DGJA 3T26A 4CH2B 5K7RA 1QJ6B 4Y0YE 3U69H 1MTSA 1QL9A 1RTFB 1OYTH 2Z94A 1ZRKA 4HFPB 2H5DA 2ZI2H 1AO5A 1O39A 1C1UH 2OINA 2G8TA 2Z3EA 4WXIA 7GCHF 2K1QA 5JYIA 2ZU3A 3V7TA 1F92A 1ELFA 1GJCB 1P2OA 3TU7H 5A8XA 2P95A 1V2UT 3K65B 3SQEE 3DFJA 1O2OA 1YPHE 3UY9A 4DURA 2TIOA 2ZQ1A 3RLWH 1FY1A 1YCPM 1C1QA 2V35A 2XC0A 1CGIE 3URCA 3A7WA 2C3SA 1VGCB 2ZDVH 2HLCA 1DM4B 1EZXC 2P94A 1ZRBA 1XUGA 1IAUA 1O32A 2D26C 3GOVB 4K60A 1C5TA 2A32A 1BTPA 1CT0E 2Y82A 4ZKSU 5BRRE 2WV4A 4X1SU 2FOBA 1MZAA 1GL0E 2Q6DA 3IITA 3MH7A 1DY8A 1TGCA 4NA9H 3UWJH 4D76A 3QTOH 2PGQB 1RJXB 1Z71A 3TIUA 3E1XB 3AW1A 1TPAE 5PTPA 4U30A 3EA7A 2H9TH 3LGTA 1QURH 1TNHA 2BX3A 3SGQE 2GX4A 1MTNC 1V2LT 2XBYA 4ABHA 1NFYA 3G01A 5EG4A 4E7NA 1EB2A 2XBWA 1BMMH 1WCZA 1QCPA 1XUIA 1ETRH 1QQUA 1GBLA 2WV5A 1BRBE 4X6MA 1VCPA 1EASA 1G3EA 1CVWH 2ODQA 4IGDA 5EU8A 3U8RH 3BTFE 3GCHC 4Y6DA 1TNKA 3PB1E 1IQNA 3NZIA 1LHFH 2HGTH 3KQCA 1P0SH 1TGBA 3UNQA 3VB7A 1NTPA 2FOAA 1ZGVA 3MI4A 2OC1A 2VWMA 4J1YA 2Z9GA 1C2GA 2ZDKA 5EOKA 1P3EA 3M3SA 1CQQA 1DITH 3RXQA 1LKBA 2PLXA 3RU4D 5LPFA 1NU7B 3M37A 3KQBA 2VJ1A 2FZZA 1Y5UT 1Q2WA 3LGIA 4ABIA 2VIVA 1TB6H 4JK6A 3U8TH 3UPEA 4ABBA 3MU4A 1F0RA 1CBWB 4DT7B 2ZGJA 1NFXA 5F8XA 1V2WT 4VGCB 3ZV9A 1YGCH 1N8OC 2BB4A 4AGJA 4MNXA 1BTZA 5FPTA 1S81A 2VU8E 5EXLA 1ESAA 2AH4X 4CRCA 1HBTH 1P2IA 3TH3H 4E05H 4CH8B 2PTCE 5EQRA 1XVOA 2BDCA 5HXFA 3RP2A 1ZYOA 3P95A 3TH4H 1A46H 4XBDA 1AHTH 1C1MA 1ELAA 2ZPSA 1GHYH 1INCA 1PPHE 1ETTH 3JZ2B 3MU5A 2ULLA 1BQYA 4X8VH 2LNCA 1B5GH 1H9IE 3AAUA 3U98H 4I8GA 3DHKH 1QGFA 1QNJA 2P3UB 2BQ7B 2SGPE 3F68H 1EAUA 1A3BH 5L6NH 1TOCB 1GBIA 4YT7H 1LHGH 5A0BA 3W94A 3PO1B 2VIWA 1AVXA 3ATIA 1KDQA 5FPYA 3TJNA 1FIWA 2PR3A 3HKJB 2JETC 2JH6D 2B5TB 5FXLA 1PQAA 4Y79A 1HCGA 1O35A 3SNEA 5BPEA 1J16A 1O2LA 2ZIQH 1WTGH 2DE9A 1E36B 1K1PA 1MBMA 1ABJH 2F9NA 3SW2B 4I8JA 1UTPA 1ZPCA 1O34A 3TGKE 3ZVFA 4KTSA 3RMLH 3MNCA 3SGBE 4B71A 1LHCH 2ZPRA 1LHDH 2WPHS 4FUGA 3LJOA 2IPHA 3WY8A 1LPZB 1Z1JA 4GLYA 3SV8A 2B7DH 2EI7A 4RKJB 4YOJA 2Z3CA 1O2UA 1UVUH 3A86A 1NS3A 2P16A 2RA3A 2BD2A 2BD4A 1FUJA 1TABE 1MQ6A 1PPGE 2ALVA 1ANEA 2ZHEH 6GCHF 2NU4E 1DE7H 4FUIA 1C1NA 2A1DB 3V3MA 1S0QA 1ZTJA 1DANH 4J2YB 4ZKNU 5C3NA 1ANCA 3L33A 1K9OE 2HPQH 1BB0B 4DW2U 1O37A 2Y7XA 1SQOA 2ZO3H 2ZGCA 3M3VA 1KXEA 4B2BA 1W10U 3TJUA 2QIQA 1SGCA 2TGPZ 1D9IA 1Y5BT 1AI8H 1TGSZ 3UR9A 2W5EA 2ZP0H 3RU4T 3VFEA 4WMDA 1O3AA 1TE0A 2QV1A 1TX8A 1GBTA 2TBSA 1QA0A 1VITG 2AGIX 4IN1A 1C5YB 1NY22 4LOYH 3MHWU 4CHAB 3TGJE 1F5RA 2Y7ZA 1O3NA 5C5OA 1SHYA 2B8OH 1GJ6A 2BVSH 7ESTE 1V2JT 2VGCB 4OS1A 2A5IA 1HAPH 2PKAA 3SJOA 1GMCF 2FOFA 3OSYA 1DX5M 2GZ8A 4Z6AH 3PYHA 3D49H 1AQ7A 1NRQH 3SV6A 3B9FH 1DDJA 2QF0A 1VGCC 4A1XA 2UWLA 5ESTE 3R0FA 1SR5C 1NRPH 1RGQA 2EA3A 4GVUA 2R2WU 2ZU1A 3CP7A 2FX6A 1FXYA 2BDGA 1TBRH 2XBVA 1KSNA 3O8DA 4E06H 1AFQB 1BUIA 1S84A 2G4UA 1GHBF 3ELAH 1ELCA 5ETXA 2XWAA 5AF9H 3UFAA 1HUTH 1GI9B 1FY4A 1ZPBA 1RTKA 3BN9A 4X1QU 1HRTH 4NSVA 1QA7A 2P93A 4MLFB 1O3EA 1K1MA 4CBOA 1S6FA 1O5EH 1SGDE 3A7TA 3RXMA 3UR6A 1DY9A 4WH8A 5F6MA 2R0LA 3MH5A 4UE7H 1X7AC 3A84A 4MPUA 2NU2E 3MNSA 5F03A 1YPEH 1T4VH 1NPMA 2O9QA 4GCHG 2A5AA 4UFFH 1F7ZA 4Y8XA 3T5FH 5F8ZA 4X1RU 3RC5A 4OS4A 2Y5GA 1UHBB 2JKHA 1OWDA 1O30A 1O5GH 4ASHA 3S9AA 1MAXA 1QY6A 4WXVA 3BTDE 4ABFA 1K1IA 2BX4A 1V2KT 1O38A 3NUMA 1FIZA 1SGFA 1UK2A 1CBWC 5J4SA 2SGEE 1YPKH 2FOEA 4B1TA 1BA8B 2F9BH 4VGCC 1ELTA 1YC0A 1TAWA 4YLQH 5AHGH 3RMOH 1ZHPA 1EKBB 1P02A 5FX6A 4CBNA 2FPZA 1F0SA 1EXFA 2C93B 2D8WA 4YOIA 4O3UA 1EAIA 1N6YA 1SLVB 1GVKB 1EATA 1H8IH 2ODYB 1ARBA 1PPCE 2C8XB 3HK6B 1TPPA 1GVLA 1O2PA 4XOJA 1EJAA 1XXFA 3JZ1B 2RCEA 1LPGB 4BTIB 1TX7A 3BIVH 1N6XA 3E0NB 1TRYA 1WOFA 5E0HA 4UFGH 1GHXH 4Q7ZA 1G2MA 1AIXH 1C5ZB 1UTJA 1WV7H 4DJZB 2Q6GA 3TGIE 5L30H 1UVPA 1OP0A 1GDQA 2ZKSA 3CS0A 3PO1C 1KIGH 2Z3DA 1CA8B 1O2RA 1AZ8A 3Q3KA 1A5HA 2RG3A 1E38B 1HJAB 2WYJA 1IQFA 3KGPA 1CT4E 2BD7A 2ZHQH 3R3GB 3SO3A 1BHXF 2W26A 1E34B 1TGTA 3TNSA 1PYTD 1Z8JB 2OLGA 2Z9LA 3A89A 1IQLA 2GTBA 4R0IA 2ZNKH 3GY5A 5JDUB 2O8LA 2GCHG 1LPKB 4GPGA 1OP2A 1HAIH 2AGGX 1B0FA 2QC2A 2ZTZA 2Z9KA 1QL7A 2V0BA 4FUEA 4KELA 4B2CA 4O3TA 4UFDH 4NZLA 1EP5A 2SNVA 1W7XH 1TX6A 1QB1A 5AVDA 2C8WB 1C2DA 1QB9A 3RXLA 5A0AE 2BTCE 1GHZA 1FZZA 2PKSB 3K6YA 4KGAA 4X0WU 4DG4A 2FXRA 2A4QA 1ELBA 3D62A 1UTMA 4H42U 1YCPK 1JBUH 1TALA 5DP3A 2W7UA 3QGNB 2FESH 1ZJDA 1SLUB 3A7ZA 1C2JA 1W2KH 1T32A 2XCNA 1SBWA 3KIDU 1AMHA 5FBIA 5TJXA 3N7OA 1GDNA 1Z8GA 2Y5FA 3VB3A 1V2MT 1P05A 4WMFA 1XXDA 2QCYA 1FJSA 1S6HA 2CHAB 1G37A 1G3DA 1O3FA 2ANWA 1TFXA 4NA7A 4QT8C 1K2I1 2ZDMA 4Y8YA 4X6OA 2XNIA 1TYNA 2OQUA 2ZFTA 3BG8A 3RC4A 4O03A 1CHOG 4Q7YA 3M7QA 1NO9H 2XYAA 3MU8A 1NT1A 1QFKH 4ISOA 2GT7A 1OWJA 1HDTH 2GD4B 3ZVDA 2PV9B 3STJA 2H6MA 4K5ZA 1C2MA 3QX5H 4CHAC 2Z7FE 1AGJA 3Q3XA 2R9PA 2EC9H 1C5QA 2C4FH 1A3EH 1AWHB 2VGCC 3ENSB 3M5LA 3ZVCA 2BZAA 4XBCA 2VWLA 1T31A 1G32B 2VVVA 4ABEA 1MMJN 1HAHH 1TNGA 3SU1A 4ZHLU 1ETSH 1LTOA 4CRBA 1XMNB 5H4IB 4ZUHA 1O3PB 1GJAB 1ANBA 1P11E 1ELGA 1GJ4H 2QN5T 3GY6A 2D1JA 1EB1H 2BDIA 2WUCA 1C5UA 3K2UA 1QBOA 4E7RG 1NROH 1AZZA 2G51A 1XKAC 1HYLA 3KL6A 1ELEE 2J94A 1AFQC 3Q3YA 1EAXA 9ESTA 4AG1A 1MKWH 2IJOB 1G30B 2VIQA 3MU0A 5LPEA 2BDHA 2D2DA 1V2OT 2FYQA 3S0NA 4JK5A 3MNXA 1IOEA 2F91A 4ESTE 1T8NA 4Y11E 2FP7B 4GHTA 3RXGA 4IN2A 3RXHA 4LZ1H 3ZVGA 1GI3A 1SGFG 2PSXA 5ABWA 1GBCA 2V6NA 2UWPA 2OC0A 1C5WB 1C4Y2 2WPMS 4FVDA 3BEFB 3HGNA 4I33A 1O2ZA 5CMXH 2ZQ2A 4WH6A 3Q77A 2PHBA 5GXPA 3BV9B 3GY8A 1RD3B 2BQ6B 3UTUH 1NU9A 1AKSA 1TNIA 1D4PB 1P09A 1KDQB 4XFQA 2Y6TA 4A1VA 4UONA 5T6GA 1VJAU 2J9NA 1MU6B 2UUJB 1O2XA 1FMGA 1HJ9A 2ZHDA 3T27A 3TK9A 1CU1A 2AMDA 3Q00A 2PTNA 2BD9A 2ZFPH 2BHGA 3GCNA 3KCGH 3SU3A 2Q1JA 4D9RA 3AW0A 1MKWK 3RXOA 2CF9H 1WAYB 3AVZA 4CR5A 3ZZCA 3SORA 1SGEE 4MPWA 3RMNH 4A5TS 1MZDA 1O2JA 2ZCLP 5DO4H 4X6NA 1BTHH 1OWKA 1QJ7B 3SUEA 5K0HA 1T8LA 3HATH 1KYNA 1L1GA 1TMBH 5AFZH 5C20A 1BRAA 3EGKH 2Y5HA 5EXMA 1RTLA 3P8OA 4K1EA 1Y3UA 5DKMA 1AE8H 1O3OA 4GCHF 2FO9A 2ZU2A 4KTUA 1ANDA 1O2WA 4K8YA 1C9PA 3V0XA 3C27B 1PQ5A 1OKXA 2A4RA 2AERH 2CGAA 1ELDE 1C4U2 3S7HB 2BY8X 1SSXA 5GDSH 4JYUH 1UVOA 1H9HE 1A7SA 1P2KA 4F4OC 1CE5A 1HJAC 3CENA 3TLOA 2UUKB 2VNTA 5GCHG 1HJ8A 1AWFH 2BXTH 3S9CA 1O3CA 4ISNA 1WSSH 4HI3A 1EQ9A 1DUAA 1TNJA 1J17T 1GHAF 1E35B 1P9SA 2SGAA 5DJ7A 1O5AB 3T2NA 4YT6H 1ZMLA 2XRCA 1HFDA 1LVBA 1L1NA 1BIOA 1JIRA 1TNLA 4BTTB 1NRSH 2PKSC 2OUAA 3RXEA 2AMQA 1K21H 2ZFRH 3MWIU 1OX1A 4NSYA 4UFEH 1D3QB 1BMNH 1DUEA 1SGRE 2PKAB 1EOJA 3KEEA 2GDDA 2QY0B 1W8BH 1W7GH 3GCTF 1HV7A 1FN6A 3RXCA 3SV9A 1XUFA 3E8LA 1O2SA 1SGNE 3PTNA 5HM2A 8GCHG 3A7XA 1A1RA 1XX9A 1C1VH 1SFQB 4IBLH 3QLPH 3SV2H 4IW4E 3QZQA 3BEUA 5DG6A 1K1NA 1GBHA 2CHAC 4FU7A 5LGOA 1Y59T 4JMYA 3SUGA 3ZZ5A 2R2MB 2ESTE 2XTTB 2WINI 3M7UA 5SGAE 1PYTC 4ISHH 3VXEH 3P92A 1DPOA 1BITA 5ESBA 5B6OA 1THPB 1SFIA 4ISIH 3M3TA 3D65E 5T6FA 1CHGA 4BAOB 2Z9JA 1QRZA 1ACBE 5A2MH 4IMQA 1P2MA 1L4ZA 1EPTA 1AE5A 2ZDLA 5EW1H 4LZ4B 5E0JA 3LONA 1VCQA 1BMAA 1ZSJA 3F9HA 1V2ST 5IDKA 2FTLE 2STAE 3A8BA 3TK5A 3SJIA 1GI1A 4K2YA 3PWCA 1ELVA 1GBKA 1BJVA 2YNBA 2ASUB 1F5KU 2SFAA 4X8TH 3EE0B 4WY3A 1GMDG 1BCUH 2FX4A 5HGGA 1HIAA 1TRNA 3BG4B 2SGFE 4FUCA 3I78A 3UREA 1EJNA 3MNBA 4K69A 1O2IA 1DSTA 3QN7A 2VWNA 5C1XA 2A0QB 2P3FH 5DP4A 4NGAH 1H9LB 1O0DH 1TA2A 4R8TB 4INHA 1LHEH 1TWXB 2YOLA 3SU6A 2PUQH 4B74A 2ZU5A 4X1NU 3UIRA 3LGWA 4Q2KA 2AMPA 2FOGA 2FMJA 1UO6A 1Q31A 3KHVA 5E2OA 1HAZB 1NESE 1NZQH 2O8UA 2UWOA 4GSOA 3GISB 2KAIA 1GBEA 3ZVAA 3LGVA 2J95A 1PPZA 3M7TA 4TPIZ 3RXTA 1LQEA 2ZTYA 3DA9B 2CXVA 2NU1E 3VB6A 1C2EA 1QBNA 4Y7AA 1JRSA 2WPKS 3FZZA 3VB4A 1MTUA 1UTLM 1A5GH 4A92A 4ISLA 1DVAH 4OS7A 1MD8A 1GCTB 7LPRA 1THRH 5C5NA 1S83A 3RXIA 2LPRA 1O3DA 3P17H 7GCHG 3NKKA 1C2FA 1DWDH 4OS6A 1GL1A 2VIOA 1HAGE 2FLBH 3GICB 1IQJA 2ZCKP 3F9GA 1Z6JH 3L6PA 2FLRH 1E0FD 3HGPA 5JPMH 1K22H 1M9UA 2Y81A 5CHAB 3T28A 3BTME 3A83A 5I25A 3S9BA 2P8OB 1EZSC 2WPJS 4A7IB 1VCWA 4O9VA 4X2XA 4NCYA 1GMHG 3RXBA 1DS2E 4BAHB 1Y5AT 3MFJA 1P06A 2ANKH 2FS9A 3ODDA 5C1UA 1C5MD 4DIIH 1L4DA 3EYDA 1ZPZA 1DXPA 4FUBA 1ZGIA 4M7GA 3SUDA 3DUXH 8KME2 1QTFA 3LPRA 4FUHA 1P2QA 2V3HH 1SPJA 4NZQA 3UQOA 1TLDA 3GYMA 2BLVA 2PSYA 1V2QT 1JWTA 2ZGBH 1O3IA 3A8DA 1GG6B 1LQDB 3PMBB 2FI3E 1WQSA 3P8NA 1NRNH 3IWMA 1F2SE 3C1KA 1W11U 1HAOH 1GBDA 1AVWA 4BNRA 5J4QA 3TVJB 1HPGA 1CA0B 1ZSLA 2OQ5A 2OXSA 1OWIA 2ZZUH 1IQKA 4X2VA 5GPIB 1RIWB 4TY6A 3RDZA 4BANB 5DPAA 4NWKA 1C1PA 1SVPA 4I32A 1UVSH 2GKVE 2DUCA 3ZZ6A 1C2KA 1F0TA 1O2QA 2BDAA 1GJ7B 1Y3WA 2F83A 1HGTH 4ABJA 4GAWA 1F5LA 2BY5X 1HNEE 3BTWE 3U8OH 3GY2A 3VPKA 4D7GA 1IQMA 4IC5A 1G36A 5A0CA 3A7YA 4ZXYH 1H1BA 1O2HA 4NIWA 3RXUA 2ZDAH 5FX5A 4KP0A 3SI4H 3SN8A 4NIYA 1GI2A 1WU1A 2NU0E 2QF3A 2H2ZA 4X1PU 3QWCH 2AFQB 4MG3A 1P2JA 2OC7A 1L1JA 1YCPH 1ZZZA 1C5SA 4AB8A 1J15A 2ZGXH 4HGCA 1SL3A 4INLA 1CGJE 2HRVA 1SMFE 2A7JA 2R0KA 4GHQA 7KMEH 1UTOA 1QIXB 4HTCH 4CRGA 2QGRA 3M5OA 2O8MA 3E91A 5GWZA 2GVFA 1OOKB 1O2MA 1G3BA 4XDEA 4FU9A 2ZHFH 4AFSA 1F0UA 2GGVB 1CGHA 1O2TA 3RXRA 2QXIA 2O8WA 4INKA 4FXGH 1T8OA 3M5NA 3OX7U 1GBMA 1A2CH 1O3JA 2CN0H 2ZFFH 5E8EH 2HOBA 1XVMA 3GCOA 4A6LA 4MQAA 1LO6A 1PJPA 2FDAA 1SGTA 1RXPA 1FQ3A 1UVTH 1SOTA 1TQ0B 3A81A 3ZZ4A 1QHRB 2HWLB 1NFWA 1W12U 1SHHB 4OGYA 3RM2H 3A87A 3MYWA 2RA0A 2B0FA 1P3CA 3EA8A
chains in the Genus database with same CATH superfamily
1C1RA 3URDA 2P59A 3GY7A 2ZDNA 1MD7A 1SGIB 4FUDA 3SU4A 3Q76A 4H6TA 1RFNA 1NFUA 3BG4C 1AKSB 1FI8A 2STBE 2GMTB 3OTJE 1TONA 1BMLA 1QQ4A 5HYOA 4HG6A 3UNRA 2R3UA 4XBBA 5EQQA 5HM9A 3SHCH 4ZHAA 2M5TA 8ESTE 2KCYA 4YZUA 4DGJA 3STIA 1Z6EA 1YPHC 3OYPA 3PLKA 2AIPA 1SC8U 3F0OA 1E1QD 3PLBA 1O5BB 3E6PH 6GCHG 1GJBB 5DP8A 2WUBA 5DK1A 1FY8E 3FVFB 4XE4A 3LOXA 2FYRA 1G9IE 1LVOA 1V2VT 5F8TA 3WWFA 5JB8S 1WXRA 1GBBA 3ZVEA 1GCDA 4KKDA 4AZ2B 3W95A 4YO9A 3P70B 4PROA 4Q80A 2WPIS 1TBQH 2HNTC 1P01A 4JYVH 4BOHA 1JRTA 2I6SA 4AFQA 1ORFA 4JZ1A 2FTMA 4RSPA 5CHBA 5EPNA 3RXKA 5E2PA 4DIHH 1FPHH 3A88A 3RM0H 1FNIA 4Q63A 3RU4E 2BY7X 1GCTC 1QL8A 2BOHB 1BMFD 3AAVA 3LU9B 6CHAB 4B2AA 1C1WH 1HB0B 1VITH 1FPCH 1C4V2 2HVXA 2QYIA 4CRFA 1J8AA 3EQ0H 1S0RA 1SB1H 2VH0A 4AGKA 1HAVA 5LPRA 4JZDH 4DY7B 1TGNA 3A8AA 2CMYA 5FPSA 3A80A 3PV4A 2EI6A 4X8UH 2OCVB 3L3TA 3I77A 1EX3A 2I6QA 1H4WA 1VZQH 2NU3E 3PRDA 5CHAC 3P8GA 3TITA 1JXPA 1WQVH 1GMCG 3M35A 4MPXA 2P8OC 2BLOA 4MDSA 3GDSA 1MKXK 3BTEE 5C1YA 2J2UA 3FP6E 1KY9A 1QRXA 1PPFE 4XSKU 4CREA 1PQ7A 2TGDA 2QA9E 3SNCA 2J4IA 3MU1A 1LVMA 1NRRH 3BSQA 3HKIB 1MTVA 3MTYA 1GJDB 2ALPA 3OEHD 3QUMP 1VITF 1IQHA 2ZG0H 3K9XB 4ZKOU 5A8ZA 5IYTA 5FAHA 4AYVB 2XC4A 1PPEE 3LKWA 1QZ8A 1ZSKA 2YNAA 4ABDA 5FHTA 4P00A 3U9AH 1K1OA 2TRMA 1OS8A 2HALA 2VINA 2CK3D 1EAWA 1BTUA 1YPJH 5FCRA 1GHBG 3QZRA 1GJ5H 2V3OH 1ZMNA 3PROA 2A4GA 1GG6C 2VIDA 3FP8E 2BD5A 2BD3A 2BLWA 1B0EA 1GGDB 3O8CA 1P57B 4JZIA 4Y10E 2GCTB 3RXSA 1CSOE 1P12E 1CA0C 3ZZAA 2ZGHA 3KF2A 3TJOA 3ZZ7A 1FAXA 1JOUB 2WPLS 1O2KA 1DWBH 1BZXE 2QXGA 3ATKA 3UQVA 2G5VA 1KTSB 3IG6B 1RIWC 2XC5A 3KYGA 1PPBH 1HLTH 1MQ5A 3LDXH 5EW2H 1U6QA 1GMHF 1KXCA 1KXDA 2ODPA 2XCFA 3B8JA 4TT3D 2IPQX 4AB9A 2C8ZB 1ESTA 3FP7E 2JJ2D 5EXNA 3ATMA 1BTXA 3SUFA 4X8SH 1GI5A 2XW9A 5JB9S 6ESTA 4D7FA 1N1LA 1EPTB 1MCTA 2LP6A 4WMEA 1SG8B 4K8BA 3ZZDA 1TA6A 2TPIZ 3VXFH 2HNTE 3F6UH 3BTQE 2BD8A 2QXHA 1P03A 3UOPA 2SNWA 4KTCA 2A2XH 4JZFH 4O97A 1V3XA 1Y3VA 2BMGB 1EP6A 1SLWB 4CR9A 1TOMH 3OY5U 1HIAB 1AB9B 2ZU4A 1UJ1A 4OS2A 1A61H 1BJUA 2AYWA 1THSH 2BVXH 2GV6A 2G4TA 3N7EA 4ZROA 2ZPQA 4NIVA 5L2YH 1MUEB 3TK6A 4WWYA 1NC6A 2YMSC 2V7QD 4OM9A 4UDWH 3F1SB 1IQIA 3KQEA 3PTBA 1BBRE 4Y76A 1BRUP 5TCCA 2XBXA 3GYLB 1UK4A 4Q7XA 2J34A 2AIQA 4H6SB 1KLIH 4AN7A 1ID5H 2H9EH 2VVCA 2ZA5A 1TIOA 1UCYE 5L2ZH 1C2IA 4MNYA 2FWWA 2KAIB 1KTTB 1DLKB 1V2NT 2CV3A 1C5OH 3ODFA 2IOTA 1KXAA 2BZ6H 1PFXC 3E90B 1G2LA 2WYGA 1O2VA 3CS7A 1BRCE 2FI4E 3M61U 2FODA 8LPRA 5EJZA 1C1SA 2OK5A 3T62A 3A85A 4K1TA 1O5CB 2C8YB 2EEKA 3BTTE 1OPHB 1V2TT 1OXGA 1UK3A 3LGYA 4LXBH 4Y7BA 3TJVA 1XKBC 3E0PB 4GUXA 4DCDA 1SQTA 2GMTC 1IHSH 1UTKA 3SZNA 5EPYA 1YLDA 1SGQE 1NM6A 4MNVA 2W3KA 3QDZB 3SNDA 3O8RA 4NA8A 3U1IB 2F9UA 4NFFA 5KGOA 3QK1A 3RC6A 2VWOA 2BM2A 3SV7A 1W13U 1EZQA 3BF6H 4FUFA 1GHWH 5CE1A 1P9UA 2GJGA 1C5PA 1S85A 2GCHF 1O3HA 2R3YA 3RMMH 2OD3B 3T25A 2WPDD 1EJMA 1ZLRA 3MOCA 3ZV8A 2VVUA 3ZYDA 5G4BA 2A5KA 5LH8A 1ZHRA 4NG9H 1C1TA 1QR3E 1DOJA 3UWIA 1MAYA 3E16B 5JBTA 1L2EA 1GWAA 5E0GA 1XM1A 5HMAA 5JBAS 1QJ1B 2TGAA 3U1JB 2BDBA 1AD8H 1C5LH 2BVRH 2UUYA 4MVNA 1C2HA 5EQSA 3F9FA 4SGAE 3VGCB 4FU8A 2P3TB 1Q3XA 1WUNH 4AORA 5DP5A 1HXFH 4D9QA 3RXFA 2W3IA 3ATLA 3P6ZB 3FANA 1MTWA 6CHAC 4MNWA 4BXSA 4H4FA 5JBCS 4BXWA 1P04A 2AGEX 2F9OA 4ZAEA 4UD9H 3LGUA 4AOQA 1EUFA 2ANYA 1T4UH 1Y3YA 2F9VA 3A8CA 2AEIH 2BOKA 3SU0A 1DLEA 4ZXXH 4Y8ZA 1G3CA 2ZF0H 1FY5A 3RXVA 4Q4LA 3RXPA 1HXEH 1YKTA 3SI3H 1CHOF 1GI6A 3MO6A 5EODA 4DT4A 9LPRA 3ZZ3A 1ZR0A 1FV9A 4B75A 3UUZA 3SOSA 2ANMH 3M36A 1JMOH 2G55A 4Y71A 1A0JA 4YM9A 3NXPA 2GV7A 4IS5A 1DXWA 1O3KA 4M9FA 1VJ9U 3BTGE 4OGXA 1W0YH 1FDPA 2ZFSA 1ZHMA 2H9HA 3QO6A 4CRDA 1TQ7B 3QTVH 2Y80A 1O3MA 1TMTH 2ZWLH 2ZC9H 2BY6X 1UTQA 3TH2H 4WF8A 2Z9IA 4JYTA 3I29A 1BTWA 4TYDA 2RFKC 4TY7A 3AASA 2OC8A 2QXJA 3PMAB 2GT8A 3P8FA 3ZZBA 1C5XB 3LH1A 1E37B 3DFLA 1OWHA 4X6MA 1GGDC 2JDID 3V12A 3VEQB 2GCTC 1XUJA 2A31A 3NWUA 1SGPE 1YP9A 1MH0A 1MBQA 1B7XB 5TCAA 1K28D 4X2YA 1GDUA 4F49A 2Q6FA 5FBEA 1Z7KA 3RXDA 3H7TA 1UMAH 1GBAA 3PWBA 2A7CA 2W6ID 2BQWB 3SBKA 1FY3A 4HZHA 2PGBB 5GJ4B 3RXJA 4TPYA 1ESBA 4AFUA 1O2NA 3H5CB 1K1LA 3S7KB 3SJ9A 1EPTC 2CF8H 4I7YH 1BT7A 3OY6U 1AY6H 2A7HA 2THFB 1VR1H 3SU2A 3ZZ9A 4YOGA 3RXAA 3TPIZ 3V13A 2BLQA 1GI7B 1A0LA 1XUKA 3EA9A 4AG2A 1LKAA 1D6WA 2FS8A 4ZKRU 1CO7E 2C90B 2ZTXA 2OBOA 1GPZA 2J92A 1J14A 2GZ7A 3MO9A 1ZTLA 3QGJA 5JBBS 1TPSA 2IN2A 1FAKH 5EGMA 3SNBA 3PMJA 1AB9C 1W0ZU 1YLCA 1GI8B 5T6DA 1YF4A 4U2WA 3VB5A 2SGDE 2G5NA 1J9CH 1DICA 1T8MA 2TGTA 1K1JA 1ABIH 1PQ8A 4DOQA 1BHXB 1YYY1 2HNTF 3EE7A 1ZTKA 4D8NA 1BBRH 3SHAH 3KQDA 1D3PB 1C5NH 1ARCA 3FFGA 3MH4A 1V6DA 2F9PA 2VH6A 5DP6A 1GBFA 1L0ZA 3A7VA 4ZMAH 2VIPA 3DT0H 1S82A 1UCYH 3LT3A 1AN1E 2ILNA 5T3HA 3O8BA 1XUHA 1GI4A 2Z6BD 4RN6A 2BYAX 3EDXB 3LH3A 3LIWA 3S69A 4B6EA 1LCYA 4Z0KA 1C9TA 4A1TA 4CRAA 3GDUA 4BAKB 1GI0A 1IHTH 2ZECA 1HAXB 1YY3A 2EI8A 2W7SA 4I8KA 4U32A 3CNRA 2SGQE 1P10A 1GHAG 1OHHD 2QF5A 1MTNB 4Y0ZE 1AUTC 1V2PT 2OBQA 3LC5A 1GVZA 1SI5H 1DSUA 3B23B 5FCKA 3D23A 4THNH 4MTBA 1QB6A 4IMZA 1HAVB 2JH5D 2XXLA 1YPGH 5C2ZA 4X6PA 1D6RA 1IQGA 1C5VA 1FLEE 1WBGB 3GCHB 1P2NA 1BBRK 3FAOA 3LC3A 1A5IA 1ZMJA 1LMWB 4I8HA 3GCTG 3PLPA 3KN2A 1O2GH 5GCHF 1T7CA 2OP9A 1UCYK 1QBVH 3PMHB 4BAMB 2FM2A 2PFEA 4OS5A 1OYQA 1Y3XA 1AFEH 2AS9A 2HLDD 2M2AA 1OP8A 1AU8A 2BDYA 3RLYH 1DWCH 4TWYA 1KXFA 2GDEH 2ZFQH 1GBJA 2VB0A 5GIBA 1FN8A 3HPTB 4FETA 1TMUH 1TBZH 1N8OB 2PUXB 4YESB 3SNAA 3GY3A 4NFEA 4NIXA 1C1OA 3E3TA 2RDLA 3SJ8A 4ZH8A 3KNXA 3K6ZA 1FONA 6LPRA 2KCAA 4ZHMU 4BTUB 1Z8IB 1BDAA 1GJ8B 1BOQA 5A09A 2HPPH 1AVGH 4WJG2 3ZYEA 2ZCHP 4FUJA 3VGCC 2G81E 8GCHF 2BXUH 5I46H 1SOZA 4B76A 1P8VC 3UB0A 2F3CE 3SGAE 1IQEA 4B73A 1YPLH 3F9EA 3BTKE 1KXBA 1W14U 4I86A 2FEQH 2PWXA 2UUFB 3UNSA 1LDTT 2GP9B 3EAJA 1OSSA 3SQHE 2H1UA 1O3GA 1WTHD 3SJKA 1AUJA 3ITIA 3NK8A 1A4WH 2XWBI 1KLJH 1NN6A 1MKXH 2FIRH 1GHVH 1QRWA 3NPSA 1Y8TA 1SLXB 1SQAA 3MO3A 2B9LA 1UHBA 3ZZ8A 1H8HD 3DD2H 1W3CA 3GY4A 2ZHWH 2JETB 3U28C 4AFZA 2O8TA 2G00A 5A8YA 4U01A 4IC6A 2ZEBA 1YPMH 2FOCA 1WYKA 1BTYA 1KLTA 1Z1IA 1O5DH 1TRMA 2BY9X 2FI5E 2G52A 1C5RA 1YBWA 1H8DH 2A2QH 1Z8RA 3BIUH 3GDVA 2WZQA 1SGYE 2NWNA 5C67A 3ZVBA 2CJIA 4I31A 4K3JA 1O2YA 2A4OA 4JZEH 3BEIB 1UTNA 3ESTA 4AYYB 1GMDF 1O31A 4AX9H 1DFPA 2OTVA 4DVAU 1JIMA 5DP7A 3M5MA 4BAQB 1YM0A 4ACBA 1ZOMA 2J38A 3UOUA 3FZDA 4YTAA 1EZUC 5CDFE 5AFYH 1HAYB 4K1SA 3OE7D 2LELA 3MMGA 4UEHH 3T29A 1MCVA 3VG8A 2FOMB 1O36A 4X2WA 1DWEH 4RKOB 1RS0A 1C2LA 1EOLA 1RRKA 4ABAA 2DE8A 2WSSD 3PM3A 4FVBA 3ATWA 1GJ9B 4WVPE 4LK4A 5DP9A 3RUOA 3LJJA 1LVYA 1MU8B 1A0HB 2GZ9A 1O33A 2FOHA 2JH0D 3BTHE 4MPVA 2KM0A 3SU5A 2JJ1D 2PW8H 1D3TB 1S5SA 3A82A 4TWWA 1DT2A 4SGBE 1V2RT 4ABGA 3MH6A 1O3BA 3OU0A 3HK3B 4I8LA 3H7OA 3TNTA 4NWLA 1O3LA 2QAAA 1CT2E 2H5CA 1D3DB 2JIZD 1TPOA 1OWEA 2A45B 4YLUA 1O5FH 1ZJKA 3NCLA 4JCNA 5DGJA 3T26A 4CH2B 4RT0A 5K7RA 1QJ6B 4Y0YE 3U69H 1MTSA 1QL9A 1RTFB 1OYTH 2Z94A 1ZRKA 4HFPB 2H5DA 2ZI2H 1AO5A 1O39A 1C1UH 3UAIC 2OINA 2G8TA 2Z3EA 4WXIA 7GCHF 2K1QA 5JYIA 2ZU3A 3V7TA 1F92A 1ELFA 1GJCB 1P2OA 3TU7H 4Z1MD 5A8XA 2P95A 1V2UT 3K65B 3SQEE 3DFJA 1O2OA 2QF4A 1YPHE 3UY9A 4DURA 2TIOA 2ZQ1A 1FX0B 3RLWH 1E79D 1FY1A 1YCPM 1C1QA 2V35A 2XC0A 1CGIE 3URCA 3A7WA 2C3SA 1VGCB 2ZDVH 2XOKD 2HLCA 1DM4B 1EZXC 2P94A 1ZRBA 1XUGA 1IAUA 1O32A 2D26C 3GOVB 1KMHB 4K60A 1C5TA 2A32A 1BTPA 1CT0E 2Y82A 5C94A 4ZKSU 5BRRE 2WV4A 4X1SU 2FOBA 1MZAA 1GL0E 2Q6DA 3IITA 3MH7A 1DY8A 1TGCA 4NA9H 3UWJH 4D76A 3QTOH 2PGQB 1YWUA 1RJXB 1Z71A 3TIUA 3E1XB 3AW1A 3F0PA 3DCLA 1TPAE 5PTPA 4U30A 3EA7A 2H9TH 3LGTA 1QURH 1TNHA 2BX3A 3SGQE 2GX4A 1MTNC 1V2LT 2XBYA 4ABHA 1NFYA 3G01A 5EG4A 4E7NA 1EB2A 2XBWA 1BMMH 1WCZA 1QCPA 1XUIA 1ETRH 1QQUA 1GBLA 2WV5A 1BRBE 3N7DA 1VCPA 1EASA 1G3EA 4FOUC 1CVWH 2ODQA 4IGDA 5EU8A 3U8RH 3BTFE 3GCHC 4Y6DA 1TNKA 3PB1E 1IQNA 3NZIA 1LHFH 2HGTH 3KQCA 1P0SH 1TGBA 3UNQA 3VB7A 1NTPA 2FOAA 1ZGVA 3MI4A 2OC1A 2VWMA 4J1YA 2Z9GA 1C2GA 2ZDKA 5EOKA 1P3EA 3M3SA 1CQQA 1DITH 3RXQA 1LKBA 2PLXA 3RU4D 5LPFA 1NU7B 3M37A 3KQBA 2VJ1A 2FZZA 1Y5UT 1Q2WA 3LGIA 4ABIA 2VIVA 1TB6H 4JK6A 3U8TH 3UPEA 4ABBA 3MU4A 1F0RA 1CBWB 4DT7B 2ZGJA 1NFXA 5F8XA 1V2WT 4VGCB 3ZV9A 1YGCH 1N8OC 2BB4A 4AGJA 4MNXA 2F4LA 1BTZA 5FPTA 1S81A 2VU8E 2XNDD 5EXLA 3F2GA 1ESAA 2AH4X 4CRCA 1HBTH 1P2IA 3TH3H 4E05H 4CH8B 2PTCE 5EQRA 1XVOA 2BDCA 5HXFA 3RP2A 1ZYOA 3P95A 3TH4H 1A46H 4XBDA 1AHTH 1C1MA 1ELAA 2ZPSA 1GHYH 1INCA 1PPHE 1ETTH 3JZ2B 3MU5A 2ULLA 1BQYA 4X8VH 2LNCA 1B5GH 1H9IE 3AAUA 3U98H 4I8GA 3DHKH 1QGFA 1QNJA 2P3UB 2BQ7B 2SGPE 3F68H 5C0UA 1EAUA 1A3BH 5L6NH 1TOCB 1GBIA 4XRNA 4YT7H 1LHGH 5A0BA 3W94A 3PO1B 2VIWA 1AVXA 3ATIA 1KDQA 3DSGA 5FPYA 3TJNA 1FIWA 2PR3A 3HKJB 2JETC 2JH6D 2B5TB 5FXLA 1PQAA 4Y79A 1HCGA 1O35A 3SNEA 5BPEA 1J16A 1O2LA 2ZIQH 5HIZA 1WTGH 2DE9A 1E36B 1K1PA 1MBMA 1ABJH 2F9NA 3SW2B 4I8JA 1UTPA 1ZPCA 1O34A 3TGKE 3ZVFA 3SYJA 4KTSA 3RMLH 3MNCA 3SGBE 4B71A 1LHCH 2ZPRA 1LHDH 2WPHS 4FUGA 3LJOA 2IPHA 3WY8A 1LPZB 1Z1JA 4GLYA 3SV8A 2B7DH 2EI7A 4RKJB 4YOJA 2Z3CA 1O2UA 1UVUH 3A86A 1NS3A 2P16A 2RA3A 2BD2A 2BD4A 1FUJA 1TABE 1MQ6A 1PPGE 2ALVA 1ANEA 2ZHEH 6GCHF 2NU4E 3DSOA 1DE7H 4FUIA 1C1NA 2A1DB 3V3MA 1S0QA 1ZTJA 1DANH 4J2YB 4ZKNU 5C3NA 1ANCA 3L33A 1K9OE 5HIYA 2HPQH 3F2FA 1BB0B 4DW2U 1O37A 2Y7XA 1SQOA 2ZO3H 2ZGCA 3M3VA 1KXEA 4B2BA 1W10U 3TJUA 2QIQA 1SGCA 2TGPZ 1D9IA 1Y5BT 1AI8H 1TGSZ 3UR9A 2W5EA 2ZP0H 3RU4T 3VFEA 4WMDA 1O3AA 1TE0A 2QV1A 1TX8A 1GBTA 2TBSA 1QA0A 1VITG 2AGIX 4IN1A 1C5YB 1NY22 4LOYH 3MHWU 4CHAB 3TGJE 5KEDA 1F5RA 2Y7ZA 1O3NA 5C5OA 1SHYA 2B8OH 1GJ6A 2BVSH 7ESTE 1V2JT 2VGCB 4OS1A 2A5IA 1HAPH 2PKAA 3SJOA 1GMCF 2FOFA 3OSYA 1DX5M 2GZ8A 4Z6AH 3PYHA 3D49H 1AQ7A 1NRQH 3SV6A 3B9FH 1S6LA 1DDJA 1VKYA 2QF0A 1VGCC 4A1XA 2UWLA 5ESTE 3R0FA 1SR5C 1NRPH 1RGQA 4F55A 2EA3A 4GVUA 2R2WU 2ZU1A 3CP7A 2FX6A 1YLNA 1FXYA 2BDGA 1TBRH 2XBVA 1KSNA 3O8DA 4E06H 1AFQB 2KFWA 1BUIA 1S84A 2G4UA 1GHBF 3ELAH 1ELCA 5ETXA 2XWAA 5AF9H 3UFAA 1HUTH 1GI9B 1FY4A 1ZPBA 1RTKA 3OTPA 3BN9A 4X1QU 1HRTH 4NSVA 3H09A 4ASUD 1QA7A 2P93A 4MLFB 1O3EA 1K1MA 4CBOA 1S6FA 1O5EH 1SGDE 3A7TA 3RXMA 3UR6A 2WV9A 1DY9A 4WH8A 5F6MA 2R0LA 3MH5A 4UE7H 1X7AC 3A84A 4MPUA 5DN6D 2NU2E 3MNSA 5F03A 2W6JD 1YPEH 3FN8A 1T4VH 1NPMA 2O9QA 4GCHG 2A5AA 4UFFH 1F7ZA 4Y8XA 3T5FH 5F8ZA 4X1RU 3RC5A 4OS4A 2Y5GA 1UHBB 2JKHA 1OWDA 1O30A 2L6OA 1O5GH 4ASHA 3S9AA 1MAXA 1QY6A 4WXVA 3BTDE 4ABFA 1K1IA 2BX4A 1V2KT 1O38A 3NUMA 1FIZA 1SGFA 2YMSD 1UK2A 1CBWC 5J4SA 2SGEE 1YPKH 2FOEA 4B1TA 1BA8B 2F9BH 4VGCC 1ELTA 1YC0A 1TAWA 4YLQH 5AHGH 3RMOH 1ZHPA 4AC9A 1EKBB 1P02A 5FX6A 4CBNA 2FPZA 1F0SA 1EXFA 2C93B 2D8WA 4YOIA 4O3UA 1EAIA 1N6YA 4ACAA 1SLVB 1GVKB 1EATA 1H8IH 2ODYB 1ARBA 1PPCE 2C8XB 3HK6B 1TPPA 1GVLA 1O2PA 4XOJA 1EJAA 1XXFA 3JZ1B 2RCEA 1LPGB 4BTIB 1TX7A 3BIVH 1N6XA 3E0NB 1TRYA 1WOFA 5E0HA 4UFGH 1GHXH 4Q7ZA 1G2MA 1AIXH 1C5ZB 1UTJA 1WV7H 4DJZB 2Q6GA 3TGIE 5L30H 1UVPA 1OP0A 1GDQA 2ZKSA 2KCOA 3CS0A 3PO1C 1KIGH 2Z3DA 1CA8B 1O2RA 1AZ8A 3Q3KA 1A5HA 2RG3A 1E38B 1HJAB 2WYJA 1IQFA 3KGPA 1CT4E 2BD7A 2ZHQH 3R3GB 3SO3A 1BHXF 2W26A 1E34B 1TGTA 3TNSA 1PYTD 1Z8JB 2OLGA 2Z9LA 3A89A 1IQLA 2GTBA 4R0IA 2ZNKH 3GY5A 5JDUB 2GCHG 1LPKB 2O8LA 4GPGA 1OP2A 1HAIH 2AGGX 1B0FA 2QC2A 2ZTZA 2Z9KA 1QL7A 2V0BA 3FKSD 4FUEA 4KELA 4O3TA 4B2CA 4UFDH 4NZLA 1EP5A 2SNVA 1W7XH 2QE7D 1TX6A 1QB1A 5AVDA 2C8WB 1C2DA 1QB9A 3RXLA 5A0AE 2BTCE 1GHZA 1FZZA 2PKSB 3K6YA 4KGAA 4X0WU 4DG4A 2FXRA 2AHME 2A4QA 1ELBA 3D62A 1UTMA 4H42U 1H8ED 1JBUH 1TALA 1YCPK 5DP3A 2W7UA 3QGNB 2FESH 1ZJDA 1SLUB 3A7ZA 5F53A 1C2JA 1W2KH 1T32A 2XCNA 1SBWA 3KIDU 1AMHA 5FBIA 5TJXA 3N7OA 1GDNA 1Z8GA 2Y5FA 3VB3A 1V2MT 1P05A 4WMFA 1XXDA 2QCYA 5DSFA 1FJSA 1S6HA 2CHAB 1G37A 1G3DA 1O3FA 2ANWA 1TFXA 4NA7A 4QT8C 1K2I1 2ZDMA 4Y8YA 4X6OA 2XNIA 1TYNA 2OQUA 2ZFTA 3BG8A 4XD7D 3RC4A 4O03A 1CHOG 4Q7YA 3M7QA 1NO9H 2XYAA 1W0JD 3MU8A 1NT1A 1QFKH 4ISOA 2GT7A 1OWJA 1HDTH 2GD4B 3ZVDA 2PV9B 3STJA 2H6MA 4K5ZA 1C2MA 3QX5H 2WHXA 3F3BA 4CHAC 2Z7FE 1AGJA 3KQ5A 3Q3XA 2R9PA 2EC9H 1C5QA 2C4FH 1A3EH 5GNDA 4B6FA 1AWHB 2VGCC 3DSPA 3ENSB 3M5LA 3ZVCA 2BZAA 4XBCA 2VWLA 1T31A 1G32B 4RT1A 2VVVA 4ABEA 1MMJN 1HAHH 1TNGA 3SU1A 4ZHLU 1ETSH 1LTOA 4CRBA 1XMNB 5H4IB 3AK5A 2J98A 4ZUHA 1O3PB 1GJAB 1ANBA 1P11E 1ELGA 1GJ4H 2QN5T 3GY6A 2D1JA 1EB1H 2BDIA 2WUCA 1C5UA 3PV2A 3K2UA 1QBOA 4E7RG 1NROH 1AZZA 2G51A 1XKAC 1HYLA 3KL6A 1ELEE 2J94A 1AFQC 3Q3YA 1EAXA 1NBMD 9ESTA 4AG1A 1MKWH 2IJOB 1G30B 3PV5A 2VIQA 3MU0A 5LPEA 2BDHA 2D2DA 1V2OT 2FYQA 3S0NA 4JK5A 3MNXA 5EJLA 1IOEA 2F91A 4ESTE 1T8NA 4Y11E 2FP7B 4GHTA 3RXGA 4IN2A 3RXHA 4LZ1H 3ZVGA 1GI3A 1SGFG 2PSXA 5ABWA 1GBCA 2V6NA 2UWPA 2OC0A 1C5WB 1C4Y2 2WPMS 4FVDA 3BEFB 3HGNA 4I33A 1O2ZA 5CMXH 2ZQ2A 4WH6A 5EJ1A 3Q77A 2PHBA 5GXPA 3BV9B 3GY8A 1RD3B 2BQ6B 3UTUH 1NU9A 1AKSA 1TNIA 1D4PB 1P09A 1KDQB 1EFRD 2Y6TA 4XFQA 4A1VA 3F2HA 4UONA 5T6GA 1VJAU 2J9NA 3SZEA 1MU6B 2UUJB 1O2XA 1FMGA 2HVYB 1HJ9A 2ZHDA 3T27A 3TK9A 1CU1A 2AMDA 3Q00A 2PTNA 2BD9A 2ZFPH 2BHGA 3GCNA 3KCGH 3SU3A 2Q1JA 4D9RA 3AW0A 1MKWK 3RXOA 2CF9H 1WAYB 3AVZA 4CR5A 3ZZCA 5KECA 3SORA 1SGEE 4MPWA 3RMNH 4A5TS 1MZDA 1O2JA 2ZCLP 5DO4H 4X6NA 1BTHH 1OWKA 1QJ7B 3SUEA 5K0HA 1T8LA 3HATH 1KYNA 1L1GA 1TMBH 5AFZH 4ZCNA 5C20A 1BRAA 3EGKH 2Y5HA 5EXMA 1RTLA 3P8OA 4K1EA 1Y3UA 3FOAA 3OAAD 5DKMA 1AE8H 1O3OA 4GCHF 2FO9A 2ZU2A 4KTUA 1ANDA 1O2WA 4K8YA 1C9PA 3V0XA 3C27B 1PQ5A 1OKXA 2A4RA 2AERH 2CGAA 3MQKC 1ELDE 1C4U2 3S7HB 2BY8X 1SSXA 5GDSH 1UW7A 1UVOA 4JYUH 1H9HE 1A7SA 1P2KA 4F4OC 1CE5A 2EY4C 1E1RD 1HJAC 2VBCA 3CENA 3TLOA 2UUKB 2VNTA 5GCHG 1HJ8A 1AWFH 2BXTH 3S9CA 1O3CA 4ISNA 1WSSH 4HI3A 1EQ9A 1DUAA 1TNJA 2KX4A 1J17T 1GHAF 1E35B 1P9SA 2SGAA 5DJ7A 1O5AB 3T2NA 4YT6H 1ZMLA 2XRCA 1HFDA 1LVBA 1L1NA 1BIOA 2K8IA 1JIRA 1TNLA 3OFND 4BTTB 1NRSH 4YXWD 2PKSC 2OUAA 3RXEA 2AMQA 1K21H 2ZFRH 3MWIU 1OX1A 4NSYA 4UFEH 1D3QB 1BMNH 1DUEA 1SGRE 2PKAB 1EOJA 3KEEA 2GDDA 2QY0B 1W8BH 5FL7D 1W7GH 3GCTF 5IK2D 1HV7A 1FN6A 3RXCA 3SV9A 1WDIA 1XUFA 3E8LA 1O2SA 1SGNE 3PTNA 5HM2A 8GCHG 3A7XA 1A1RA 1XX9A 1C1VH 1SFQB 4IBLH 3QLPH 3SV2H 4IW4E 2F43B 3QZQA 3BEUA 5DG6A 1K1NA 1GBHA 2CHAC 4FU7A 5LGOA 1Y59T 4JMYA 3SUGA 3ZZ5A 2R2MB 2ESTE 2XTTB 2WINI 3M7UA 5SGAE 1PYTC 4P02A 4ISHH 3VXEH 3P92A 1DPOA 1BITA 5ESBA 5B6OA 1THPB 1SFIA 4ISIH 3M3TA 3D65E 3NRLA 5T6FA 2IJD1 1CHGA 4BAOB 2Z9JA 1QRZA 1ACBE 5A2MH 3PRBA 4IMQA 1P2MA 1L4ZA 1EPTA 1AE5A 2ZDLA 5EW1H 2V3MA 4LZ4B 5E0JA 3LONA 1VCQA 1BMAA 1ZSJA 3F9HA 1V2ST 5HKKD 5IDKA 2FTLE 2STAE 3A8BA 3TK5A 3SJIA 1GI1A 4K2YA 3PWCA 1ELVA 1GBKA 1BJVA 2YNBA 2ASUB 1F5KU 2SFAA 2RDEA 4X8TH 5C0TA 3EE0B 4WY3A 1GMDG 1BCUH 2FX4A 5HGGA 1HIAA 1TRNA 3BG4B 2SGFE 4FUCA 3I78A 3UREA 1EJNA 3MNBA 4K69A 1O2IA 1DSTA 3QN7A 2VWNA 5C1XA 2A0QB 2P3FH 5DP4A 4NGAH 1H9LB 1O0DH 1TA2A 4R8TB 4INHA 1LHEH 1TWXB 2YOLA 3SU6A 3N99A 2EQNA 2PUQH 4B74A 1SQRA 2ZU5A 4X1NU 1MABB 3UIRA 3LGWA 4Q2KA 2AMPA 3WWBA 2FOGA 2FMJA 1UO6A 1Q31A 2J5UA 3KHVA 5E2OA 3FO8D 1HAZB 1NESE 1NZQH 2O8UA 2UWOA 4GSOA 3GISB 2KAIA 1GBEA 3ZVAA 3LGVA 2J95A 1PPZA 3M7TA 4TPIZ 3RXTA 1LQEA 2ZTYA 3DA9B 1K0HA 2CXVA 2NU1E 3VB6A 1C2EA 1QBNA 4Y7AA 1JRSA 2WPKS 3FZZA 3VB4A 1MTUA 1UTLM 1A5GH 4A92A 2KZ4A 4ISLA 1DVAH 4OS7A 1MD8A 1GCTB 7LPRA 1THRH 5C5NA 1S83A 3RXIA 2LPRA 1O3DA 3P17H 7GCHG 3NKKA 1C2FA 1DWDH 4OS6A 1GL1A 2VIOA 1HAGE 2FLBH 3GICB 1IQJA 2ZCKP 3F9GA 1Z6JH 3L6PA 2FLRH 1E0FD 3HGPA 5JPMH 1K22H 1M9UA 2Y81A 5CHAB 3T28A 3BTME 3A83A 5I25A 3S9BA 2P8OB 1EZSC 2WPJS 4A7IB 1VCWA 4O9VA 4X2XA 4NCYA 1GMHG 3RXBA 1DS2E 4BAHB 1Y5AT 3MFJA 1P06A 2ANKH 2FS9A 3ODDA 5C1UA 1C5MD 4DIIH 1L4DA 3EYDA 1ZPZA 1DXPA 4FUBA 1ZGIA 4M7GA 3SUDA 3DUXH 8KME2 2KR7A 1QTFA 3LPRA 4FUHA 1P2QA 2V3HH 5EIYA 1SPJA 4NZQA 3UQOA 1TLDA 3GYMA 2K0QA 2BLVA 2PSYA 5T1VA 1V2QT 1JWTA 2ZGBH 1O3IA 3A8DA 1GG6B 1LQDB 3PMBB 2FI3E 1WQSA 3P8NA 1NRNH 3IWMA 1F2SE 3C1KA 1W11U 1HAOH 1GBDA 1AVWA 4BNRA 5J4QA 3TVJB 1HPGA 1CA0B 1ZSLA 4TSFD 2OQ5A 2OXSA 1OWIA 2ZZUH 4F48B 1IQKA 4X2VA 5GPIB 3W1EA 1RIWB 4TY6A 3RDZA 2KCPA 4BANB 5DPAA 4NWKA 2J97A 1C1PA 1SVPA 4I32A 1UVSH 2GKVE 2DUCA 3ZZ6A 1C2KA 1F0TA 1O2QA 2BDAA 1GJ7B 1Y3WA 2F83A 1HGTH 4ABJA 4GAWA 3GS9A 1F5LA 2BY5X 1HNEE 3BTWE 3U8OH 3GY2A 3VPKA 3OEED 4D7GA 1IQMA 4IC5A 1G36A 1SKYE 5A0CA 4RI0A 3A7YA 4ZXYH 1H1BA 1O2HA 4NIWA 3RXUA 2ZDAH 5FX5A 4KP0A 3SI4H 3SN8A 4NIYA 1GI2A 1WU1A 2NU0E 2QF3A 2H2ZA 4X1PU 3QWCH 2AFQB 4MG3A 1P2JA 2OC7A 1L1JA 1YCPH 1ZZZA 1C5SA 4AB8A 3WW7A 5C17A 1J15A 2ZGXH 4HGCA 1SL3A 4INLA 3ZIAD 1CGJE 2HRVA 1SMFE 2A7JA 2R0KA 4GHQA 5B6LA 7KMEH 1UTOA 2J98B 1QIXB 4HTCH 4CRGA 3KYFA 2YMSB 2QGRA 3M5OA 2O8MA 3E91A 5GWZA 2GVFA 2PP6A 1OOKB 1O2MA 1G3BA 1W0KD 4XDEA 4FU9A 2ZHFH 4AFSA 1F0UA 1NBME 2GGVB 1CGHA 1O2TA 3RXRA 2QXIA 2O8WA 4INKA 4FXGH 1COWD 1T8OA 3M5NA 3OX7U 1GBMA 1A2CH 1O3JA 2CN0H 2ZFFH 5E8EH 2HOBA 1XVMA 3GCOA 4A6LA 4MQAA 1LO6A 1PJPA 2FDAA 1SGTA 1RXPA 1FQ3A 1UVTH 1SOTA 1TQ0B 3A81A 3ZZ4A 1QHRB 2L74A 2HWLB 1NFWA 1W12U 1SHHB 4OGYA 3RM2H 3A87A 3MYWA 2RA0A 2B0FA 1P3CA 3EA8A
chains in the Genus database with same CATH topology
1C1RA 3URDA 2P59A 3GY7A 2ZDNA 1MD7A 1SGIB 4FUDA 3SU4A 3Q76A 4H6TA 1RFNA 1NFUA 3BG4C 1AKSB 1FI8A 2STBE 2GMTB 3OTJE 1TONA 1BMLA 1QQ4A 5HYOA 3UNRA 2R3UA 4XBBA 5EQQA 5HM9A 3SHCH 4ZHAA 2M5TA 8ESTE 4YZUA 4DGJA 3STIA 1Z6EA 1YPHC 3OYPA 3PLKA 2AIPA 1SC8U 6GCHG 3PLBA 1O5BB 3E6PH 1GJBB 5DP8A 2WUBA 5DK1A 1FY8E 3FVFB 4XE4A 3LOXA 2FYRA 1G9IE 1LVOA 1V2VT 5F8TA 5JB8S 1GBBA 3ZVEA 1GCDA 4KKDA 4AZ2B 3W95A 4YO9A 3P70B 4PROA 4Q80A 2WPIS 1TBQH 2HNTC 1P01A 4JYVH 4BOHA 1JRTA 2I6SA 4AFQA 1ORFA 4JZ1A 2FTMA 4RSPA 5EPNA 3RXKA 5E2PA 4DIHH 1FPHH 3A88A 3RM0H 1FNIA 3RU4E 2BY7X 1GCTC 1QL8A 2BOHB 3AAVA 3LU9B 6CHAB 4B2AA 1C1WH 1HB0B 1VITH 1FPCH 1C4V2 2HVXA 2QYIA 4CRFA 1J8AA 3EQ0H 1S0RA 1SB1H 2VH0A 4AGKA 1HAVA 5LPRA 4JZDH 4DY7B 1TGNA 3A8AA 2CMYA 5FPSA 3A80A 3PV4A 2EI6A 4X8UH 2OCVB 3L3TA 3I77A 1EX3A 2I6QA 1H4WA 1VZQH 2NU3E 5CHAC 3P8GA 3TITA 1JXPA 1WQVH 1GMCG 3M35A 4MPXA 2P8OC 2BLOA 4MDSA 3GDSA 1MKXK 3BTEE 5C1YA 2J2UA 3FP6E 1KY9A 1QRXA 1PPFE 4XSKU 4CREA 1PQ7A 2TGDA 2QA9E 3SNCA 2J4IA 3MU1A 1LVMA 1NRRH 3BSQA 3HKIB 1MTVA 3MTYA 1GJDB 2ALPA 3QUMP 1VITF 1IQHA 2ZG0H 3K9XB 4ZKOU 5A8ZA 5IYTA 5FAHA 4AYVB 2XC4A 1PPEE 3LKWA 1ZSKA 2YNAA 4ABDA 5FHTA 3U9AH 1K1OA 2TRMA 1OS8A 2HALA 2VINA 1EAWA 1BTUA 1YPJH 5FCRA 1GHBG 3QZRA 1GJ5H 2V3OH 1ZMNA 3PROA 2A4GA 1GG6C 2VIDA 3FP8E 2BD5A 2BD3A 2BLWA 1B0EA 1GGDB 3O8CA 1P57B 4JZIA 4Y10E 2GCTB 3RXSA 1CSOE 1P12E 1CA0C 3ZZAA 2ZGHA 3KF2A 3TJOA 3ZZ7A 1FAXA 1JOUB 2WPLS 1O2KA 1DWBH 1BZXE 2QXGA 3ATKA 3UQVA 2G5VA 1KTSB 3IG6B 1RIWC 2XC5A 1PPBH 1HLTH 1MQ5A 3LDXH 5EW2H 1U6QA 1GMHF 1KXCA 1KXDA 2ODPA 2XCFA 3B8JA 4AB9A 2C8ZB 1ESTA 3FP7E 5EXNA 3ATMA 1BTXA 3SUFA 4X8SH 1GI5A 2XW9A 5JB9S 6ESTA 4D7FA 1N1LA 1EPTB 1MCTA 4WMEA 1SG8B 4K8BA 3ZZDA 1TA6A 2TPIZ 3VXFH 2HNTE 3F6UH 3BTQE 2BD8A 2QXHA 1P03A 3UOPA 2SNWA 4KTCA 2A2XH 4JZFH 4O97A 1V3XA 1Y3VA 2BMGB 1EP6A 1SLWB 4CR9A 1TOMH 3OY5U 1HIAB 1AB9B 2ZU4A 1UJ1A 4OS2A 1A61H 1BJUA 2AYWA 1THSH 2BVXH 2GV6A 2G4TA 4ZROA 2ZPQA 4NIVA 5L2YH 1MUEB 3TK6A 4WWYA 1NC6A 4UDWH 3F1SB 1IQIA 3KQEA 3PTBA 1BBRE 4Y76A 1BRUP 5TCCA 2XBXA 3GYLB 1UK4A 4Q7XA 2J34A 2AIQA 4H6SB 1KLIH 4AN7A 1ID5H 2H9EH 2VVCA 2ZA5A 1TIOA 1UCYE 5L2ZH 1C2IA 4MNYA 2FWWA 2KAIB 1KTTB 1DLKB 1V2NT 2CV3A 1C5OH 3ODFA 2IOTA 1KXAA 2BZ6H 1PFXC 3E90B 1G2LA 2WYGA 1O2VA 3CS7A 1BRCE 2FI4E 3M61U 2FODA 8LPRA 1C1SA 3T62A 3A85A 4K1TA 1O5CB 2C8YB 2EEKA 3BTTE 1OPHB 1V2TT 1OXGA 1UK3A 3LGYA 4LXBH 4Y7BA 3TJVA 1XKBC 3E0PB 4GUXA 4DCDA 1SQTA 2GMTC 1IHSH 1UTKA 3SZNA 5EPYA 1YLDA 1SGQE 1NM6A 4MNVA 2W3KA 3QDZB 3SNDA 3O8RA 4NA8A 3U1IB 2F9UA 4NFFA 3QK1A 3RC6A 2VWOA 2BM2A 3SV7A 1W13U 1EZQA 3BF6H 4FUFA 1GHWH 5CE1A 1P9UA 1C5PA 1S85A 2GCHF 1O3HA 2R3YA 3RMMH 2OD3B 3T25A 1EJMA 1ZLRA 3MOCA 3ZV8A 2VVUA 3ZYDA 5G4BA 2A5KA 5LH8A 1ZHRA 4NG9H 1C1TA 1QR3E 1DOJA 3UWIA 1MAYA 3E16B 5JBTA 1L2EA 1GWAA 5E0GA 1XM1A 5HMAA 5JBAS 1QJ1B 2TGAA 3U1JB 2BDBA 1AD8H 1C5LH 2BVRH 2UUYA 4MVNA 1C2HA 5EQSA 3F9FA 4SGAE 3VGCB 4FU8A 2P3TB 1Q3XA 1WUNH 4AORA 5DP5A 1HXFH 4D9QA 3RXFA 2W3IA 3ATLA 3P6ZB 3FANA 1MTWA 6CHAC 4MNWA 4BXSA 4H4FA 5JBCS 4BXWA 1P04A 2AGEX 2F9OA 4ZAEA 4UD9H 3LGUA 4AOQA 1EUFA 2ANYA 1T4UH 1Y3YA 2F9VA 3A8CA 2AEIH 2BOKA 3SU0A 1DLEA 4ZXXH 4Y8ZA 1G3CA 2ZF0H 1FY5A 3RXVA 3RXPA 1HXEH 1YKTA 3SI3H 1CHOF 1GI6A 3MO6A 5EODA 9LPRA 3ZZ3A 1ZR0A 1FV9A 4B75A 3UUZA 3SOSA 2ANMH 3M36A 1JMOH 2G55A 4Y71A 1A0JA 4YM9A 3NXPA 2GV7A 4IS5A 1DXWA 1O3KA 1VJ9U 3BTGE 4OGXA 1W0YH 1FDPA 2ZFSA 1ZHMA 2H9HA 3QO6A 4CRDA 1TQ7B 3QTVH 2Y80A 1O3MA 1TMTH 2ZWLH 2ZC9H 2BY6X 1UTQA 3TH2H 4WF8A 2Z9IA 4JYTA 3I29A 1BTWA 4TYDA 4TY7A 3AASA 2OC8A 2QXJA 3PMAB 2GT8A 3P8FA 3ZZBA 1C5XB 3LH1A 1E37B 3DFLA 1OWHA 1GGDC 3V12A 3VEQB 2GCTC 1XUJA 2A31A 3NWUA 1SGPE 1YP9A 1MH0A 1MBQA 1B7XB 5TCAA 1K28D 4X2YA 1GDUA 4F49A 2Q6FA 5FBEA 1Z7KA 3RXDA 3H7TA 1UMAH 1GBAA 3PWBA 2A7CA 2BQWB 3SBKA 1FY3A 4HZHA 2PGBB 5GJ4B 3RXJA 4TPYA 1ESBA 4AFUA 1O2NA 3H5CB 1K1LA 3S7KB 3SJ9A 1EPTC 2CF8H 4I7YH 1BT7A 3OY6U 1AY6H 2A7HA 2THFB 1VR1H 3SU2A 3ZZ9A 4YOGA 3RXAA 3TPIZ 3V13A 2BLQA 1GI7B 1A0LA 1XUKA 3EA9A 4AG2A 1LKAA 1D6WA 2FS8A 4ZKRU 1CO7E 2C90B 2ZTXA 2OBOA 1GPZA 2J92A 1J14A 2GZ7A 3MO9A 1ZTLA 3QGJA 5JBBS 1TPSA 2IN2A 1FAKH 5EGMA 3SNBA 3PMJA 1AB9C 1W0ZU 1YLCA 1GI8B 5T6DA 1YF4A 4U2WA 3VB5A 2SGDE 2G5NA 1J9CH 1DICA 1T8MA 2TGTA 1K1JA 1ABIH 1PQ8A 4DOQA 1BHXB 1YYY1 2HNTF 1ZTKA 4D8NA 1BBRH 3SHAH 3KQDA 1D3PB 1C5NH 1ARCA 3FFGA 3MH4A 1V6DA 2F9PA 2VH6A 5DP6A 1GBFA 1L0ZA 3A7VA 4ZMAH 2VIPA 3DT0H 1S82A 1UCYH 3LT3A 1AN1E 2ILNA 5T3HA 3O8BA 1XUHA 1GI4A 2Z6BD 4RN6A 2BYAX 3EDXB 3LH3A 3LIWA 3S69A 1LCYA 4Z0KA 1C9TA 4A1TA 4CRAA 3GDUA 4BAKB 1GI0A 1IHTH 2ZECA 1HAXB 2EI8A 2W7SA 4I8KA 4U32A 2SGQE 1P10A 1GHAG 1MTNB 4Y0ZE 1AUTC 1V2PT 2OBQA 3LC5A 1GVZA 1SI5H 1DSUA 3B23B 5FCKA 3D23A 4THNH 4MTBA 1QB6A 4IMZA 1HAVB 2JH5D 2XXLA 1YPGH 5C2ZA 4X6PA 1D6RA 1IQGA 1C5VA 1FLEE 1WBGB 3GCHB 1P2NA 1BBRK 3FAOA 3LC3A 1A5IA 1ZMJA 1LMWB 4I8HA 3GCTG 3PLPA 3KN2A 1O2GH 5GCHF 1T7CA 2OP9A 1UCYK 1QBVH 3PMHB 4BAMB 2FM2A 2PFEA 4OS5A 1OYQA 1Y3XA 1AFEH 2AS9A 1OP8A 1AU8A 2BDYA 3RLYH 1DWCH 4TWYA 1KXFA 2GDEH 2ZFQH 1GBJA 2VB0A 5GIBA 1FN8A 3HPTB 1TMUH 1TBZH 1N8OB 2PUXB 4YESB 3SNAA 3GY3A 4NFEA 4NIXA 1C1OA 3E3TA 2RDLA 3SJ8A 4ZH8A 3KNXA 3K6ZA 1FONA 6LPRA 4ZHMU 4BTUB 1Z8IB 1BDAA 1GJ8B 1BOQA 5A09A 2HPPH 1AVGH 4WJG2 3ZYEA 2ZCHP 4FUJA 3VGCC 2G81E 8GCHF 2BXUH 5I46H 1SOZA 4B76A 1P8VC 2F3CE 3SGAE 1IQEA 4B73A 1YPLH 3F9EA 3BTKE 1KXBA 1W14U 2FEQH 2PWXA 2UUFB 3UNSA 1LDTT 2GP9B 3EAJA 1OSSA 3SQHE 2H1UA 1O3GA 1WTHD 3SJKA 1AUJA 3ITIA 3NK8A 1A4WH 2XWBI 1KLJH 1NN6A 1MKXH 2FIRH 1GHVH 1QRWA 3NPSA 1Y8TA 1SLXB 1SQAA 3MO3A 2B9LA 1UHBA 3ZZ8A 3DD2H 1W3CA 3GY4A 2ZHWH 2JETB 4AFZA 2O8TA 2G00A 5A8YA 4U01A 4IC6A 2ZEBA 1YPMH 2FOCA 1WYKA 1BTYA 1KLTA 1Z1IA 1O5DH 1TRMA 2BY9X 2FI5E 2G52A 1C5RA 1YBWA 1H8DH 2A2QH 1Z8RA 3BIUH 3GDVA 2NWNA 1SGYE 5C67A 3ZVBA 2CJIA 4I31A 4K3JA 1O2YA 2A4OA 4JZEH 3BEIB 1UTNA 3ESTA 4AYYB 1GMDF 1O31A 4AX9H 1DFPA 2OTVA 4DVAU 1JIMA 5DP7A 3M5MA 4BAQB 1YM0A 1ZOMA 2J38A 3UOUA 3FZDA 4YTAA 1EZUC 5AFYH 1HAYB 4K1SA 4UEHH 3MMGA 3T29A 1MCVA 2FOMB 1O36A 4X2WA 1DWEH 4RKOB 1RS0A 1C2LA 1EOLA 1RRKA 4ABAA 2DE8A 3PM3A 4FVBA 3ATWA 1GJ9B 4WVPE 4LK4A 5DP9A 3RUOA 3LJJA 1LVYA 1MU8B 1A0HB 2GZ9A 1O33A 2FOHA 2JH0D 3BTHE 4MPVA 3SU5A 2PW8H 1D3TB 1S5SA 3A82A 4TWWA 1DT2A 4SGBE 1V2RT 4ABGA 3MH6A 1O3BA 3OU0A 3HK3B 4I8LA 3H7OA 3TNTA 4NWLA 1O3LA 2QAAA 1CT2E 2H5CA 1D3DB 1TPOA 1OWEA 2A45B 4YLUA 1O5FH 1ZJKA 3NCLA 4JCNA 5DGJA 3T26A 4CH2B 5K7RA 1QJ6B 4Y0YE 3U69H 1MTSA 1QL9A 1RTFB 1OYTH 2Z94A 1ZRKA 4HFPB 2H5DA 2ZI2H 1AO5A 1O39A 1C1UH 2OINA 2G8TA 2Z3EA 4WXIA 7GCHF 2K1QA 5JYIA 2ZU3A 3V7TA 1F92A 1ELFA 1GJCB 1P2OA 3TU7H 5A8XA 2P95A 1V2UT 3K65B 3SQEE 3DFJA 1O2OA 1YPHE 3UY9A 4DURA 2TIOA 2ZQ1A 3RLWH 1FY1A 1YCPM 1C1QA 2V35A 2XC0A 1CGIE 3URCA 3A7WA 2C3SA 1VGCB 2ZDVH 2HLCA 1DM4B 1EZXC 2P94A 1ZRBA 1XUGA 1IAUA 1O32A 2D26C 3GOVB 4K60A 1C5TA 2A32A 1BTPA 1CT0E 2Y82A 4ZKSU 5BRRE 2WV4A 4X1SU 2FOBA 1MZAA 1GL0E 2Q6DA 3IITA 3MH7A 1DY8A 1TGCA 4NA9H 3UWJH 4D76A 3QTOH 2PGQB 1RJXB 1Z71A 3TIUA 3E1XB 3AW1A 1TPAE 5PTPA 4U30A 3EA7A 2H9TH 3LGTA 1QURH 1TNHA 2BX3A 3SGQE 2GX4A 1MTNC 1V2LT 2XBYA 4ABHA 1NFYA 3G01A 5EG4A 4E7NA 1EB2A 2XBWA 1BMMH 1WCZA 1QCPA 1XUIA 1ETRH 1QQUA 1GBLA 2WV5A 1BRBE 4X6MA 1VCPA 1EASA 1G3EA 1CVWH 2ODQA 4IGDA 5EU8A 3U8RH 3BTFE 3GCHC 4Y6DA 1TNKA 3PB1E 1IQNA 3NZIA 1LHFH 2HGTH 3KQCA 1P0SH 1TGBA 3UNQA 3VB7A 1NTPA 2FOAA 1ZGVA 3MI4A 2OC1A 2VWMA 4J1YA 2Z9GA 1C2GA 2ZDKA 5EOKA 1P3EA 3M3SA 1CQQA 1DITH 3RXQA 1LKBA 2PLXA 3RU4D 5LPFA 1NU7B 3M37A 3KQBA 2VJ1A 2FZZA 1Y5UT 1Q2WA 3LGIA 4ABIA 2VIVA 1TB6H 4JK6A 3U8TH 3UPEA 4ABBA 3MU4A 1F0RA 1CBWB 4DT7B 2ZGJA 1NFXA 5F8XA 1V2WT 4VGCB 3ZV9A 1YGCH 1N8OC 2BB4A 4AGJA 4MNXA 1BTZA 5FPTA 1S81A 2VU8E 5EXLA 1ESAA 2AH4X 4CRCA 1HBTH 1P2IA 3TH3H 4E05H 4CH8B 2PTCE 5EQRA 1XVOA 2BDCA 5HXFA 3RP2A 1ZYOA 3P95A 3TH4H 1A46H 4XBDA 1AHTH 1C1MA 1ELAA 2ZPSA 1GHYH 1INCA 1PPHE 1ETTH 3JZ2B 3MU5A 2ULLA 1BQYA 4X8VH 2LNCA 1B5GH 1H9IE 3AAUA 3U98H 4I8GA 3DHKH 1QGFA 1QNJA 2P3UB 2BQ7B 2SGPE </