2IOTA

Clavulanic acid bound to elastase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title Elastase Inhibition by Clavulanic Acid, and Inhibitor of Bacterial b-lactamases: Mechanistic and Structural Studies
rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2iotA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2iotA01
1S84A 2ZGJA 1V2KT 2R0KA 1IQEA 1W12U 2BM2A 2WPJS 4MPUA 4OS1A 1G3DA 1ESAA 4MNYA 3BTDE 1CBWB 1O2IA 2ZFRH 3TGIE 4Q7XA 1OP2A 4NA9H 3OY5U 4K8BA 5JB8S 4A1TA 3LOXA 1HXEH 4AORA 1TOMH 3VB7A 2ALVA 1MAYA 1Z1IA 2ZDLA 5GIBA 4Q80A 1ARCA 1GBKA 1SI5H 1TBZH 2ZFPH 1SLVB 4BTUB 4B76A 1FMGA 2B7DH 1DM4B 1IQFA 4K8YA 3FFGA 1N8OC 3UOPA 3QTOH 3OYPA 5HM2A 1TA6A 3F9HA 2P95A 5FBEA 2JH5D 2R2WU 1GWAA 1ETTH 3Q3KA 1T32A 1DLKB 1V2VT 1GVKB 3KL6A 2P59A 1BRCE 1KXDA 3M35A 1W0ZU 2XTTB 4DY7B 1QRWA 3QDZB 3M3SA 4K2YA 4B73A 2HVXA 3A7XA 3GY7A 1TNHA 3P8NA 5C1YA 3T26A 1GJ4H 1OWEA 1ELDE 1AKSA 3RXJA 4FUIA 3TIUA 1OYQA 1C5LH 1C5XB 4FUDA 5L2ZH 3M7UA 3BF6H 1PQ7A 3SI4H 1EZQA 3RDZA 4ISOA 1LDTT 2XWAA 5FX6A 3MMGA 2IOTA 1O35A 5DP5A 1EQ9A 1EAXA 1W10U 1SVPA 2A1DB 3A80A 2VGCC 2FMJA 3E3TA 3P17H 4MG3A 1T8MA 5GXPA 3A87A 2OBQA 5F6MA 3DD2H 1O5BB 1HJAC 4UFDH 1EJNA 3DT0H 5DK1A 2P8OB 1C1NA 4JK6A 2CHAB 2CXVA 5LPFA 3SGQE 4NIVA 4BAOB 2AGEX 1Q31A 3IITA 1AUJA 2VIDA 3A7ZA 1RGQA 2PSXA 1BMMH 3RXTA 1J14A 3TLOA 1PQ5A 4NFEA 2ZQ2A 1GMCG 1FDPA 2JKHA 2ZHDA 3LIWA 1K22H 1P3EA 5F8TA 3ITIA 5ESTE 1C9TA 3GYLB 3GCTG 2BTCE 4JMYA 4X8SH 2NU4E 1SGPE 4X6NA 2BXUH 5JYIA 1D3PB 1W7GH 3NZIA 3UUZA 4CRAA 2W5EA 3TJNA 2Z9LA 4ABAA 4CRGA 1MAXA 2Y7ZA 2BD3A 2FPZA 5C3NA 3GYMA 1GMHG 3A81A 3CENA 3EGKH 3O8CA 3BTEE 2ZKSA 2Z7FE 1J17T 1GVZA 4X1PU 2C93B 1EXFA 1FY4A 1SLWB 3VEQB 5HYOA 1S85A 2G00A 1DXPA 1RIWB 1GG6C 2SNWA 4O9VA 1DFPA 1C5SA 2VWMA 1OWDA 3UIRA 2OINA 3BV9B 3EAJA 2QY0B 3LU9B 3ODFA 1V2QT 1C2FA 3Q3XA 2PUXB 5JBTA 3LGUA 1JIRA 4AGJA 1QL7A 1D4PB 4CR9A 4O3TA 5DG6A 3GY3A 2GV7A 3SU0A 1BITA 1L1NA 5FHTA 3FP6E 1C4Y2 1B7XB 1UK3A 3A85A 1O2OA 2B9LA 2PKSB 2B0FA 1O2ZA 3SNCA 2BLWA 1O39A 4I8KA 4GVUA 1H9LB 1YC0A 1C1UH 1TWXB 1SSXA 1UVSH 2VWNA 1A5HA 1TX7A 3TK6A 1RFNA 1YCPK 4FUHA 7GCHG 4NWLA 2AGIX 1KXAA 1A0JA 1GBFA 4MQAA 1G30B 1A7SA 1WU1A 2ANYA 1O30A 3RXOA 4AB8A 3VFEA 1K1PA 1D3QB 4JYTA 3SU6A 3SJOA 1GHXH 1A46H 3SGBE 1VZQH 4FU7A 3MTYA 2ZDAH 1PPGE 4HI3A 3UREA 2ZHFH 4OGYA 5FPSA 4BAHB 1QJ1B 3O8BA 3RXGA 3VB5A 2SNVA 1W14U 1AZ8A 1Z1JA 1XUKA 1OXGA 3PLKA 5DO4H 2G5NA 1PPZA 4ABGA 2ZTYA 3M3TA 2H9EH 1GBBA 1O5AB 3W95A 2XC4A 1UMAH 1VJAU 2HRVA 3MO6A 1DVAH 2C4FH 2BDBA 2ZU1A 4ZHLU 1O2VA 3HKIB 4Y71A 1C5UA 1EUFA 4IC6A 4BAKB 2BQWB 1CE5A 5CMXH 2YOLA 3E91A 4WH8A 3A89A 1BQYA 1CGJE 3MWIU 1PPCE 2I6QA 1K1LA 3PM3A 2QCYA 1PPHE 1LQEA 3H7TA 2F91A 2AGGX 3SV9A 3DFJA 3TK5A 3ZVDA 3QGNB 4KTUA 1XVOA 5E2PA 4FU8A 1FZZA 3ZYDA 3EQ0H 1O2PA 1V2RT 1KXFA 1WQSA 3STJA 2VVUA 2UUKB 1DWEH 1HJ8A 3SBKA 2ZHQH 1Z7KA 1ESTA 2BD2A 4YOIA 3RXIA 3SUGA 2ZHWH 2THFB 1V2OT 2HNTC 3STIA 4LZ1H 3GY8A 4UE7H 3TU7H 2ZP0H 1TA2A 1QJ7B 1PPEE 1HLTH 2Z3EA 2FDAA 1F92A 2BY5X 2ZO3H 1C1WH 2ZA5A 2ZU5A 1YF4A 1O3GA 1SL3A 3UNSA 3URCA 2PUQH 1KLIH 4XBDA 4ZXYH 4ABJA 3CP7A 1EASA 2W7UA 4HGCA 3G01A 1LVYA 1ANCA 5L30H 3LGYA 1O3HA 1XKAC 4E06H 1C2LA 2AMPA 5GCHF 1SGEE 2YNBA 3RXKA 1F5LA 3LGIA 2VNTA 1LPGB 4NA8A 3LC5A 4WVPE 3D62A 1IQHA 1SOTA 3VGCB 1AFEH 5CHAB 3RLWH 1VGCB 4KELA 2FI3E 1Y8TA 4F4OC 4IN1A 1C2IA 3RXHA 1AMHA 1MBMA 1P9UA 1Z8GA 5T6DA 1IQNA 2J4IA 3RXMA 2NU0E 1NRPH 1SFIA 1LO6A 2RCEA 1S0RA 4JCNA 1G36A 1KYNA 1B0FA 2HPPH 3S0NA 1BMNH 1YPLH 1ZJDA 2FOMB 2ZFTA 4OGXA 2PHBA 2CV3A 3GCTF 1TALA 4E7RG 1QRZA 1P2JA 5K0HA 1P3CA 1KLTA 2VVCA 1QB1A 1AB9C 1UTKA 1Y3YA 3TH2H 3TVJB 2YNAA 4X8TH 1LMWB 2P3FH 5EQSA 3MHWU 4TY7A 2AEIH 4DT7B 2ZFQH 3H5CB 3DHKH 1FPHH 1C1RA 3F9FA 1DICA 2FOAA 3GY5A 4UFGH 1ELCA 4CR5A 3RMNH 4B2CA 4IS5A 1TE0A 1DSUA 2FI5E 1HAOH 1ZPZA 4ABBA 2V35A 2VJ1A 1GMDG 2WYJA 1ZMLA 1CGHA 1GI8B 3ZZBA 3HGNA 3B23B 5E0JA 3QWCH 3U1JB 1S6HA 5CE1A 3GOVB 1KLJH 2FODA 4JK5A 2H1UA 4ISIH 2ZPRA 7ESTE 2K1QA 2PGBB 1YPEH 3A7WA 4K1TA 3ZVFA 1QFKH 3U8TH 1QTFA 2PV9B 1O2GH 1Z8IB 1N8OB 1C5OH 1GBHA 1RTLA 8LPRA 1AWFH 3D23A 3SU4A 4XDEA 4I8GA 1L0ZA 1LVMA 1W13U 2HALA 1A5GH 1FONA 2BZAA 1L4ZA 2FI4E 3ATIA 4DIIH 2AIQA 3MFJA 4INHA 5DJ7A 2OLGA 1MTSA 3UFAA 1OSSA 4H6TA 5T6FA 4LK4A 1CT0E 2W3IA 1K1MA 1TRMA 1KDQA 1QL8A 2GV6A 1V6DA 1C4V2 1SMFE 2BVXH 2STBE 3LJOA 3PMAB 2BQ7B 3T62A 4ESTE 1FI8A 1TOCB 3ZZDA 1TMUH 2TPIZ 3GDUA 2IPHA 1O2HA 1UCYK 2Y5GA 3NCLA 2BX3A 4H42U 1FJSA 4RSPA 4OS2A 4IC5A 4B74A 2P3UB 4FUCA 2Y5HA 2XWBI 1MU8B 2H9HA 1C5WB 2Q6FA 3M3VA 3HK3B 4A6LA 1O32A 3TJOA 3F9EA 1A0HB 1UTMA 1HJAB 2BXTH 1VCPA 2ZQ1A 4D7FA 9LPRA 4JZIA 3ZZCA 1MKWK 1TX8A 2V0BA 3LPRA 1O3OA 4JYVH 5DP7A 4YTAA 3TPIZ 5JBBS 3LONA 1PJPA 1Z8JB 3KCGH 3HK6B 1VITF 1MTNC 1Q3XA 1O3AA 1IQLA 2CGAA 3ZVBA 1HUTH 1IQGA 1GDUA 3MNSA 4DW2U 2BVSH 1P05A 1NRSH 2GZ9A 2QN5T 4IBLH 3S9CA 3RXRA 1UTLM 1KY9A 1Z8RA 2C8YB 1Y3XA 5DP3A 4Y79A 1O2JA 4Y10E 4CHAC 1BBRK 1HV7A 1CA0C 1O3IA 3SJ8A 3VPKA 3A86A 3A8BA 1DANH 3UQOA 1TGCA 1XUJA 2C8ZB 4U30A 1CT4E 1INCA 5ETXA 2QYIA 3A8DA 1QY6A 2BMGB 4I8HA 1ZSKA 1NU7B 3RXCA 4WXVA 3VB3A 2Y6TA 1HNEE 3RUOA 1YP9A 1TGBA 1Y3VA 1H4WA 1QHRB 1ZGVA 2HOBA 1P01A 3RU4E 1C1QA 2SGFE 1VITH 3MO9A 1GI7B 4XOJA 1GG6B 2BVRH 1SG8B 1A5IA 1D3DB 1TIOA 1O2TA 1V2JT 3EE0B 1LHDH 4ABHA 2D2DA 3ATMA 3PMHB 2J9NA 1O34A 4NIWA 1DUEA 2OBOA 1D3TB 1YPMH 1HAGE 3TJVA 1UHBA 1W3CA 1T4UH 2ZCHP 3B8JA 4MNWA 5GDSH 2BD8A 1Z71A 1YPJH 2BY8X 4UFEH 1DY9A 2PGQB 2H5CA 1Q2WA 2O8MA 4ABIA 1ZLRA 4LOYH 6GCHG 2Y80A 5T6GA 1A61H 2ZU2A 1U6QA 2BX4A 1E36B 1P12E 1C5RA 2O8TA 2ZU3A 3PROA 1YCPM 3A7VA 2D1JA 1UK4A 4ABEA 2FO9A 2V3OH 4NCYA 2BY7X 3PMJA 4ZKSU 4CREA 3HGPA 1EX3A 1OX1A 1GHWH 2Q1JA 3QLPH 1LHGH 2QA9E 1TPAE 1GI4A 4IW4E 1SGCA 1GJCB 4I8JA 1WUNH 3FZDA 1O2YA 1QL9A 1EAIA 5AFYH 1V2MT 3KGPA 3GISB 2OD3B 1Y5AT 1X7AC 1GI5A 1SB1H 1C1VH 1DXWA 3Q3YA 2A4GA 2G51A 5HMAA 1LPZB 2Q6GA 2JH6D 3I77A 2GTBA 1T8NA 2ZFFH 1QB6A 1ZJKA 4AX9H 2G8TA 1BBRH 1MMJN 1ZPBA 1O2XA 4R8TB 3UNQA 2GCHG 5EOKA 4A1VA 1K1NA 1F5RA 2C8WB 2TGTA 1E38B 3PLPA 4Y8ZA 4NZLA 5DGJA 1DSTA 8KME2 1GMDF 3MU8A 4K1SA 1JIMA 1P04A 3MU1A 2QGRA 3BTQE 4NZQA 4J1YA 5EXMA 1TAWA 1ZPCA 2FTMA 1P2IA 1DE7H 1A4WH 1ZZZA 2HGTH 5DP4A 2ZHEH 1THPB 3A88A 1O36A 1C5TA 4X2WA 1GJ7B 1HAZB 3BG4C 1FY3A 2PKAA 2XCFA 1ZTJA 2GVFA 1NO9H 2ZECA 4GHTA 4Y8YA 1M9UA 5AHGH 1RTKA 3MH4A 3NWUA 1EZXC 1V2PT 3A83A 1A1RA 3U8RH 3CS0A 1YBWA 3LH3A 2ZU4A 1CHGA 3ZZ8A 1PPBH 4ZKNU 1GBTA 3OY6U 3ATKA 3SJKA 1ELVA 4ZKOU 4AFQA 1ZOMA 1MTVA 3F6UH 4B2AA 1VR1H 1GI6A 2TGPZ 2VWLA 1OS8A 1VCWA 4Y6DA 5IYTA 4FVDA 3BN9A 1A3EH 1RS0A 3SGAE 3KQEA 3RU4D 2PWXA 4ZHAA 1UTOA 6CHAC 3SV8A 2QXHA 1MTUA 1OWJA 1KTSB 1HAIH 1OP0A 1Y3WA 1EZUC 1AZZA 1GJ5H 5BRRE 1IQIA 1HJ9A 1P0SH 1UVTH 1QGFA 4I32A 1SGNE 5ESBA 1NRRH 3QUMP 2GDDA 1TPPA 3RXLA 2FXRA 1EB1H 5GJ4B 3QGJA 4TWYA 1LHEH 1SHYA 3SO3A 1GL1A 2A5IA 4BOHA 3DA9B 3EA9A 2ODQA 1UTNA 2A2QH 2BDHA 1V2UT 2AIPA 1F0UA 2OC8A 3MNXA 1BJVA 4SGBE 3A82A 3E16B 2FYRA 3TITA 1J8AA 4H4FA 1G9IE 4FUFA 3FZZA 1ANDA 1DS2E 1K1OA 1HIAB 1TGNA 1FLEE 3KF2A 5EG4A 3WY8A 3RXFA 2RDLA 1PQ8A 3DFLA 5EPNA 1MD8A 3BTME 3M37A 1PQAA 3S7HB 5F8ZA 4NSVA 4X1SU 1PFXC 2C8XB 4YO9A 1AB9B 1HAVB 5I25A 1O3PB 3TH4H 5A09A 2EC9H 1K21H 1BTYA 1BUIA 4BANB 3KNXA 1GHVH 4Y11E 3U8OH 1ABJH 4O97A 1L4DA 2ILNA 3ZYEA 4YOJA 1G2MA 3O8RA 2KAIB 2SGQE 1GBMA 1K2I1 1W11U 2WPLS 1AGJA 1O5FH 4D8NA 1XMNB 3LGWA 2FOHA 1SLXB 3S7KB 3TNTA 1ZHRA 2H5DA 1HDTH 1W8BH 2QF3A 2BQ6B 4DVAU 1EKBB 1O33A 3ESTA 5TCCA 1FY5A 1C5VA 1O38A 3A7TA 1GBLA 2ZDNA 6LPRA 2A0QB 2GT8A 1B5GH 4ZXXH 2J2UA 5A2MH 2ZPSA 5E0GA 4GPGA 4NWKA 1QIXB 1NRNH 4A5TS 1C2JA 4IMQA 4FUEA 2GGVB 1GVLA 2C3SA 4UONA 4WY3A 4JZEH 4AFUA 3OX7U 3CS7A 3BTWE 2ZDMA 2F9VA 2BB4A 4A1XA 1BHXB 2F9BH 3F68H 1GBJA 3LT3A 2SGPE 2TIOA 3BIVH 1NFYA 5EW2H 4CH8B 3M5NA 1B0EA 1FQ3A 1GDQA 1NFUA 4UFFH 3SI3H 1ETRH 1FN8A 1MKXK 4X1RU 3U9AH 3TNSA 1ETSH 2ULLA 1HAYB 1FAXA 2ZC9H 3UNRA 2WYGA 1AKSB 2M5TA 1HB0B 1MCVA 2DE9A 4ZAEA 5A0BA 4AFZA 2BD7A 2PW8H 4Z6AH 4YLQH 2NU1E 5HGGA 1C4U2 3RM2H 5A8YA 1ZSJA 2OP9A 4XBCA 1GHYH 2CJIA 2Z6BD 2ESTE 1XXDA 5T3HA 1DT2A 2I6SA 3QO6A 3P95A 3KQDA 2ZGBH 3I78A 2F3CE 1MTNB 1ZRBA 3T28A 2RG3A 1CVWH 1EPTA 1FUJA 1G37A 1UCYE 3S9BA 1TNKA 3PO1C 1C2EA 4A92A 5A0AE 1HFDA 2VH6A 1P06A 1UVOA 2VWOA 3M7TA 4CHAB 2H2ZA 5FAHA 1CA0B 1YCPH 5JBAS 3RXQA 1C5NH 2UWPA 3SUEA 2HWLB 1ZRKA 5B6OA 4E05H 1H8IH 3OSYA 3RLYH 2VIWA 3PLBA 3V13A 4ZHMU 2AS9A 3T27A 2TRMA 4OS6A 2PR3A 2R3YA 3FANA 3MH7A 2ZEBA 3EA7A 1MUEB 4U01A 5AF9H 1ZMNA 1F2SE 1ABIH 2ASUB 3BIUH 4Y76A 1C2MA 2PSYA 3UWJH 5I46H 1SGYE 4TYDA 4YM9A 5L2YH 4WMFA 2XYAA 4OS7A 3RXBA 5A8ZA 3RC5A 1BBRE 4JZFH 2J95A 4IGDA 2XBYA 2Z9JA 2GCTC 2HNTF 3BTTE 1V2LT 4MNXA 1F0TA 4MVNA 1AU8A 2AERH 1GMCF 3Q77A 5PTPA 3ZVCA 1DDJA 1E37B 4U2WA 1KXEA 3GCHC 3L33A 3U1IB 3Q00A 2F9PA 1GCTC 1E35B 1GHAG 3KEEA 1P2NA 2BHGA 2J94A 2FIRH 1AFQC 2FTLE 4X1QU 2NWNA 1G2LA 1TGSZ 2XC5A 1UTJA 1HAPH 2OC7A 1BMAA 1SGFG 4JZDH 4YESB 1S0QA 1ELFA 3GY4A 3RMMH 3ZZ4A 1GMHF 1C2GA 1JBUH 2JETC 3E0NB 1LQDB 5DP9A 1K9OE 4GCHG 2CF9H 1T8LA 2FOBA 2F83A 4INKA 1MBQA 3SNDA 1CQQA 4TPIZ 1A2CH 1O31A 4MLFB 4MNVA 2P3TB 4ASHA 4K69A 1TNJA 2WUBA 3AAVA 2ZGXH 1HAHH 3MNCA 3VXFH 2BY9X 1O5DH 2WV5A 5FCKA 1BTPA 1LHCH 2FESH 3E1XB 4OS4A 2QXJA 3SNBA 2XCNA 1QB9A 2GDEH 2A45B 1TPSA 1AY6H 2GMTC 3M36A 1SGTA 2OUAA 2RA0A 1D6RA 1JRTA 1GGDC 1MZDA 2B5TB 2GZ7A 1GL0E 4Y0YE 3QN7A 1ID5H 4FUJA 1N6XA 3NUMA 2VINA 3MI4A 4TWWA 3C27B 5K7RA 1YM0A 3RM0H 1YLCA 3PWBA 3TH3H 4IMZA 3SUDA 2B8OH 2WPKS 3LDXH 7GCHF 1G3EA 2FM2A 2QIQA 3SOSA 2OC0A 3AW1A 3C1KA 1C5YB 3FP7E 4TPYA 2R0LA 2BD4A 4X1NU 3GDVA 1P2OA 3QX5H 3UOUA 1NFXA 3SQEE 1S6FA 2VIQA 2RA3A 3MH5A 4WMDA 1H9IE 1Y5BT 1ZHPA 1AD8H 1K28D 3NKKA 3BG4B 3RMOH 3URDA 2Z9KA 1K1JA 1ELTA 1NC6A 4WWYA 4K60A 2H9TH 6ESTA 1ORFA 4DG4A 2VGCB 1CGIE 4Y8XA 1GHBG 1QA0A 2BLQA 5HXFA 1GBAA 1C2KA 2EI8A 3T29A 1QCPA 4UEHH 4Y7BA 1DITH 1O3EA 1H1BA 3Q76A 4FUGA 2ZDVH 1O3DA 3SV6A 3RXAA 1P2KA 2GKVE 4AYVB 2ZIQH 1AN1E 2XRCA 4THNH 1LVBA 3VB6A 2A4OA 2R2MB 4FVBA 4YOGA 1ZHMA 5GPIB 3ZZ6A 2FLBH 2A31A 2A5KA 3M5MA 4R0IA 1GJAB 2FOCA 1O37A 4DOQA 1XUHA 1BHXF 6CHAB 2G52A 5EW1H 5C67A 1O2RA 1GBCA 4WF8A 2FWWA 5A0CA 2GZ8A 4X2YA 3ZVEA 3PMBB 1O0DH 1GJ9B 3FAOA 4FUBA 1RD3B 1GI0A 3JZ1B 3SUFA 2Z9IA 3AVZA 4MDSA 1YKTA 3ZZ3A 3KQCA 4BNRA 5C1UA 1C1PA 1SLUB 1JOUB 3A84A 1ANBA 3E8LA 5FPTA 5TJXA 2G5VA 1PYTD 2ZTZA 3RXDA 5C2ZA 2NU3E 3SNAA 1SPJA 4NIXA 4KTCA 1TQ7B 1CA8B 3QK1A 1C1TA 1TB6H 1KTTB 1V2NT 4QT8C 1IHTH 3T2NA 3K2UA 4OS5A 2OQUA 4GLYA 4X6MA 2GD4B 1CT2E 2BDCA 1TNLA 4BXWA 2J38A 3U69H 1DLEA 2BYAX 4AB9A 2C90B 2R3UA 2ZGCA 4LZ4B 2OTVA 1OOKB 3O8DA 3LKWA 4NA7A 1H9HE 2Y82A 1GBEA 4HFPB 2PTCE 1O3CA 3RC4A 3ZZ9A 1LHFH 2BOHB 2VIPA 1O3KA 3RXVA 4I33A 1OWIA 2W3KA 3FVFB 3PTNA 2FYQA 1MTWA 1SQAA 1MD7A 4Q7YA 1PYTC 1S81A 2F9UA 1UTPA 5H4IB 2AFQB 4UDWH 1BRAA 3OTJE 2EI7A 1DPOA 4ISLA 3BTGE 4SGAE 3SU2A 3E6PH 5E8EH 3SV7A 2CN0H 3SU1A 1UCYH 2PTNA 2O9QA 1O5EH 3BSQA 1UVPA 4ISHH 4X2XA 1QR3E 1BTUA 1GJDB 1GJ6A 1RJXB 1AWHB 1GI9B 3GICB 3UQVA 1LCYA 2FOGA 1EJMA 3IG6B 3MYWA 2G4TA 4ISNA 4NG9H 3EDXB 1FN6A 5BPEA 2ZTXA 1LKBA 3E90B 1BRBE 1MKWH 4NSYA 1T31A 2AH4X 4AZ2B 3E0PB 5DKMA 2EA3A 1EOLA 1OKXA 1GHAF 4KP0A 1TPOA 2GP9B 4UD9H 3A8CA 4U32A 3P92A 3UY9A 1V2ST 2FS8A 1DWCH 2BDGA 5AVDA 1ACBE 1O3FA 2ODPA 8GCHG 4GCHF 3EA8A 2WUCA 4KGAA 1GJBB 4Y7AA 1IOEA 2VB0A 1O2NA 2AYWA 2IN2A 4ABFA 3V3MA 3OU0A 1EOJA 4WMEA 4X8UH 2VH0A 2SGEE 2EI6A 3K65B 5SGAE 1HGTH 1D9IA 2XW9A 1LTOA 2XBVA 1L1GA 5EODA 2GX4A 4NFFA 5E0HA 4B75A 1QBOA 1XUFA 3I29A 1KDQB 2A7JA 5A8XA 3ELAH 1SHHB 3BEFB 4XE4A 1F7ZA 3T25A 3ZZ7A 3ZVGA 1W2KH 1TMTH 3PTBA 3A8AA 5FPYA 4JZ1A 1G32B 1ELAA 1ZTLA 3M61U 1TMBH 4BXSA 2PFEA 4ABDA 1BJUA 1ELEE 2ZI2H 1S5SA 1A3BH 1BZXE 3UPEA 2UUJB 1FV9A 1TONA 3PO1B 2H6MA 3K9XB 1CU1A 1IQMA 5FCRA 5C1XA 1P9SA 1FNIA 3UR6A 4Z0KA 3P8FA 4TY6A 5GCHG 3V12A 5EU8A 1GJ8B 1P8VC 2ZNKH 1WQVH 2SGAA 2STAE 1BRUP 1SOZA 2HNTE 1YPGH 4AFSA 4F49A 1LKAA 1EPTC 2A32A 1FY8E 4DJZB 1NZQH 1ELGA 2BD9A 1GHZA 1GHBF 3M5LA 1KXCA 1ZYOA 5IDKA 2BLOA 1YPKH 4MPWA 1SC8U 1BTZA 1ZR0A 3AASA 2XBXA 4KKDA 3PWCA 5FBIA 3SW2B 1FIZA 1UTQA 5EQQA 1AVXA 1ANEA 1V3XA 2O8UA 4CRCA 2GCTB 3TGKE 3UTUH 1SQTA 2JH0D 3IWMA 5EXNA 4J2YB 1YPHE 1G3CA 1JWTA 2FP7B 2DE8A 3H7OA 1P02A 2P94A 1EJAA 4MPXA 1Y5UT 3A7YA 3GCHB 2GT7A 1MZAA 1AQ7A 3GY6A 1O2MA 1GCTB 1NPMA 2XC0A 3GY2A 1FY1A 3EYDA 2FOFA 1HYLA 2QF0A 2R9PA 3GCNA 3MH6A 3D65E 1JMOH 1PPFE 1NM6A 1TNIA 2QAAA 4Y0ZE 4MPVA 1AFQB 3PYHA 1KXBA 4VGCC 5ABWA 1SGFA 1O3JA 3UR9A 1UHBB 1YLDA 4RN6A 1HAXB 2ZF0H 3BTHE 2JETB 1KSNA 5FX5A 4A7IB 3QZQA 2Z9GA 3SORA 8ESTE 1ZMJA 2FLRH 1TRNA 4B71A 4I7YH 5GWZA 2OQ5A 2LNCA 1RRKA 2Y81A 4HZHA 1MCTA 2FX6A 3F1SB 1GPZA 5EGMA 1E34B 2HLCA 3KIDU 1FXYA 1P57B 1BOQA 1AVWA 2ZWLH 3LH1A 1OP8A 1GDNA 1NU9A 2BLVA 1DX5M 3ZZAA 1C9PA 5DP8A 1N1LA 1TGTA 1QA7A 2Z3CA 2ZDKA 3RP2A 5J4SA 1IAUA 2XNIA 2GMTB 3SU3A 3NPSA 1GGDB 2SGDE 1G3BA 2A4QA 3M7QA 1O5CB 6GCHF 1BA8B 1CBWC 2ZG0H 3MU5A 1C1MA 4INLA 4X2VA 2UUYA 1HPGA 4AGKA 1CO7E 1O5GH 3ZV8A 2DUCA 5JBCS 1FIWA 1SGQE 1F0SA 2WV4A 1C1SA 2ZGHA 1OPHB 3N7OA 1MU6B 3ZZ5A 4B1TA 2UWLA 1WBGB 1WTHD 3KHVA 5C20A 2FZZA 2ODYB 1CSOE 1Y59T 1RXPA 1TABE 4YLUA 1BT7A 4CRFA 1BTHH 4CBOA 1UVUH 1C1OA 4K1EA 1EB2A 3SHAH 1DWDH 2IJOB 4AG1A 3K6YA 5HM9A 1QJ6B 1NN6A 1C5MD 1SQOA 1TNGA 3M5OA 2G4UA 1TBQH 5JPMH 2WPHS 3FP8E 1VITG 1HRTH 3T5FH 5DP6A 2UWOA 1C5PA 3F9GA 1HBTH 1T8OA 4M7GA 5C5OA 1QURH 1P10A 4CH2B 2PKAB 2OXSA 1ZGIA 1O2QA 3NK8A 8GCHF 2GCHF 1FAKH 4LXBH 1QNJA 2V6NA 2LPRA 3ODDA 2Z3DA 4CBNA 3MO3A 3S9AA 2HPQH 1TRYA 3VXEH 1GCDA 1EATA 1MQ6A 2BOKA 2FX4A 4O3UA 1BTXA 2G81E 4K3JA 2XBWA 4ZMAH 2BY6X 1CHOG 2OC1A 3P8GA 4MTBA 3SQHE 1T4VH 3QZRA 4DURA 1XVMA 3GDSA 3JZ2B 1P09A 1GI2A 1QQ4A 4Q2KA 4X8VH 1AI8H 9ESTA 3HPTB 3SJ9A 1D6WA 1EAWA 1C5QA 3P70B 4GAWA 1Z6EA 3LGVA 4FU9A 2BD5A 4GSOA 3RXUA 1O3NA 2P8OC 3AAUA 2CHAC 3RC6A 1HCGA 1V2WT 3LJJA 4GHQA 4WH6A 4ZROA 1OYTH 4JYUH 3BTFE 1J15A 5EQRA 1O2LA 1TBRH 2FOEA 1O2SA 1VCQA 2ANWA 1AVGH 3AW0A 1WYKA 3V7TA 1S82A 4AOQA 5E2OA 3SZNA 2QC2A 4I8LA 3K6ZA 4ZUHA 3P6ZB 1GI1A 3BTKE 1AO5A 2A7CA 1YPHC 3VB4A 1S83A 2D26C 1AE5A 4X6OA 2QXIA 1SBWA 3D49H 5LPRA 2FEQH 3R3GB 5EXLA 1W0YH 1MH0A 3DUXH 3NXPA 3TJUA 1DY8A 3RMLH 4X0WU 1MKXH 1QBNA 1YYY1 2W26A 2O8LA 2BDYA 4CRBA 1RIWC 1GI3A 3LGTA 2ZFSA 1EP5A 4X6PA 3SN8A 1O2UA 2O8WA 3ATLA 4YZUA 1XXFA 4XBBA 5DPAA 1YGCH 1AIXH 2CF8H 1THRH 1BCUH 2BZ6H 3ZVAA 1NFWA 1P11E 3BG8A 2CMYA 3UWIA 1TFXA 2AMDA 4D76A 2VIOA 3U98H 1SGIB 1O3MA 1V2TT 4AG2A 1AUTC 5JDUB 1AE8H 2QXGA 5J4QA 1NROH 2PKSC 1ESBA 1WOFA 4YT6H 1DOJA 1OWHA 4YT7H 1WTGH 1WV7H 3SU5A 1XUGA 1IQKA 1SR5C 4B2BA 3PV4A 1UJ1A 1C2DA 1ELBA 2Z94A 3L6PA 2J34A 3W94A 3GCOA 2P93A 3ZV9A 1DUAA 1BDAA 2P16A 3L3TA 2W7SA 1BTWA 2ANKH 2AMQA 1IQJA 5L6NH 1EZSC 2TBSA 4CRDA 7LPRA 2A2XH 3B9FH 1NESE 2VVVA 1TLDA 2F9NA 4O03A 2A4RA 5TCAA 4ZH8A 3RXSA 4RKJB 1JRSA 2XXLA 1A0LA 1WAYB 3QTVH 1WCZA 2D8WA 1XM1A 4WJG2 4BTIB 1QQUA 4RKOB 2A7HA 1OWKA 5FXLA 4DGJA 1SGDE 2WPMS 2ALPA 1L2EA 2J92A 2SFAA 3HATH 1QRXA 3KQBA 3LC3A 4D9QA 1T7CA 1ZSLA 4PROA 3RXEA 3RXPA 4DIHH 3KN2A 2BDIA 2VIVA 4FXGH 4IN2A 1ARBA 1P03A 1N6YA 3TK9A 1FPCH 1K1IA 1XX9A 1Y3UA 4KTSA 1KIGH 2F9OA 3P8OA 1IHSH 1L1JA 2TGDA 4K5ZA 5AFZH 5LGOA 1O2WA 1P2MA 4H6SB 2ZCKP 1TQ0B 4I31A 5G4BA 1THSH 1Z6JH 3MU4A 2ZPQA 1EPTB 1XUIA 3PB1E 1F5KU 3TGJE 1DWBH 2Y7XA 1C2HA 1AHTH 2QV1A 2OCVB 2G55A 4AN7A 4D9RA 3BEIB 2V3HH 3BEUA 1NS3A 1H8DH 3ATWA 3SJIA 3V0XA 1HXFH 1EAUA 1BB0B 1GBIA 4Q7ZA 3MNBA 1NT1A 2EEKA 1GBDA 1RTFB 2WINI 4NGAH 1W7XH 2FS9A 1NY22 4ZKRU 1MQ5A 2VU8E 1UK2A 1SGRE 1BIOA 5JB9S 1QBVH 1E0FD 1CHOF 1O3LA 3ENSB 5F8XA 3MU0A 3S69A 4XFQA 2ZCLP 4DCDA 4D7GA 1SFQB 4GUXA 1TX6A 1J16A 1J9CH 3HKJB 4E7NA 1EP6A 1HIAA 1WSSH 4HTCH 2Q6DA 4BTTB 3VGCC 4VGCB 3SNEA 7KMEH 1BMLA 2TGAA 5CHAC 5LPEA 1P2QA 1VGCC 4BAQB 4WXIA 3R0FA 4AYYB 1LPKB 1UO6A 2PLXA 5C5NA 1VJ9U 1HAVA 5EPYA 3RU4T 3SHCH 3MOCA 4XSKU 2NU2E 1TYNA 2WPIS 2Y5FA 1O3BA 1JXPA 1LVOA 2ZZUH 3SV2H 2UUFB 1NTPA 2KAIA 4BAMB 1NRQH 4NIYA 5LH8A 2ANMH 2BDAA 1XKBC 1F0RA 1C5ZB 1O2KA 1ZTKA 5F03A 2A5AA
chains in the Genus database with same CATH superfamily
1S84A 2ZGJA 1V2KT 2R0KA 1IQEA 1W12U 2BM2A 2WPJS 4MPUA 4OS1A 1G3DA 1ESAA 4MNYA 3BTDE 1CBWB 1O2IA 2ZFRH 3TGIE 2WSSD 4Q7XA 1OP2A 4NA9H 3OY5U 4K8BA 5JB8S 4A1TA 3LOXA 1HXEH 1WDIA 1TOMH 4AORA 3VB7A 2ALVA 1MAYA 1Z1IA 2ZDLA 5GIBA 4Q80A 1ARCA 1GBKA 1WXRA 3OE7D 1SI5H 1TBZH 3UB0A 2ZFPH 1SLVB 4BTUB 4B76A 1FMGA 2B7DH 1DM4B 1IQFA 2KCYA 4K8YA 3FFGA 1N8OC 3UOPA 3QTOH 3OYPA 5HM2A 5C94A 1TA6A 3F9HA 2P95A 5FBEA 2JH5D 2R2WU 1GWAA 1ETTH 3Q3KA 4ACAA 1T32A 1DLKB 1V2VT 1GVKB 3KL6A 2P59A 1BRCE 1KXDA 3M35A 1W0ZU 2XTTB 4DY7B 1QRWA 3QDZB 3M3SA 4K2YA 4B73A 2HVXA 3A7XA 5EIYA 3GY7A 1TNHA 3P8NA 2AHME 5C1YA 3T26A 1GJ4H 1OWEA 1ELDE 1AKSA 3RXJA 4FUIA 3TIUA 1OYQA 1C5LH 1C5XB 4FUDA 5L2ZH 3M7UA 3BF6H 1PQ7A 3SI4H 1EZQA 3RDZA 4ISOA 1LDTT 2XWAA 5FX6A 3MMGA 2IOTA 1O35A 5DP5A 1EQ9A 1EAXA 1W10U 1SVPA 2A1DB 3A80A 2VGCC 2FMJA 3E3TA 4B6FA 3P17H 4MG3A 1T8MA 5GXPA 3A87A 2OBQA 5F6MA 3DD2H 1O5BB 1HJAC 1H8ED 4UFDH 3PRDA 1EJNA 3DT0H 5DK1A 2P8OB 1C1NA 4JK6A 2CHAB 2CXVA 5LPFA 3SGQE 4NIVA 4BAOB 2AGEX 1Q31A 3IITA 2HVYB 1AUJA 2VIDA 3A7ZA 1RGQA 2PSXA 1BMMH 3RXTA 1J14A 3TLOA 1PQ5A 4NFEA 2ZQ2A 1GMCG 1FDPA 3UAIC 2JKHA 2ZHDA 3LIWA 1K22H 1P3EA 5F8TA 3ITIA 5ESTE 1C9TA 3GYLB 3GCTG 2BTCE 4JMYA 4X8SH 2NU4E 1SGPE 4X6NA 2BXUH 5JYIA 1D3PB 1W7GH 3NZIA 3UUZA 4CRAA 2W5EA 3TJNA 2Z9LA 4ABAA 4CRGA 1MAXA 2Y7ZA 2BD3A 2FPZA 5C3NA 3GYMA 1GMHG 3A81A 3CENA 3EGKH 3O8CA 3BTEE 2ZKSA 2Z7FE 1J17T 1GVZA 4X1PU 2C93B 1EXFA 1FY4A 1SLWB 3VEQB 5HYOA 1S85A 3KQ5A 2G00A 1DXPA 1RIWB 1GG6C 2SNWA 4O9VA 1DFPA 1C5SA 2VWMA 1OWDA 3UIRA 2OINA 3BV9B 3EAJA 2QY0B 3LU9B 3ODFA 1V2QT 1C2FA 3Q3XA 2PUXB 5JBTA 3LGUA 1JIRA 4AGJA 1QL7A 1D4PB 4CR9A 4O3TA 5DG6A 3GY3A 2GV7A 3SU0A 1COWD 1BITA 1L1NA 5FHTA 3FP6E 1C4Y2 1B7XB 1UK3A 3A85A 1O2OA 2B9LA 2PKSB 2B0FA 1O2ZA 3SNCA 2BLWA 1O39A 4I8KA 4GVUA 1H9LB 1YC0A 1C1UH 1TWXB 1SSXA 1UVSH 2VWNA 1A5HA 1TX7A 3TK6A 1RFNA 1YCPK 4FUHA 7GCHG 4NWLA 2AGIX 1KXAA 2K8IA 1A0JA 1GBFA 4MQAA 1G30B 1A7SA 1WU1A 2ANYA 1O30A 3RXOA 4AB8A 3VFEA 1K1PA 1D3QB 4JYTA 3OAAD 3SU6A 3SJOA 1GHXH 3PV5A 1A46H 3SGBE 1VZQH 4FU7A 3MTYA 4P02A 2ZDAH 1PPGE 4HI3A 3UREA 2ZHFH 4OGYA 5FPSA 2KX4A 4BAHB 2JJ1D 1QJ1B 3O8BA 3RXGA 3VB5A 2SNVA 1W14U 1AZ8A 1Z1JA 1XUKA 1OXGA 3PLKA 5DO4H 2G5NA 1PPZA 2KM0A 4ABGA 2ZTYA 3M3TA 2H9EH 1GBBA 3OEHD 1O5AB 3W95A 2XC4A 1UMAH 1VJAU 2HRVA 3MO6A 1DVAH 2C4FH 2BDBA 2ZU1A 4ZHLU 1O2VA 2V7QD 3HKIB 4Y71A 1C5UA 1EUFA 4TT3D 4IC6A 4BAKB 2BQWB 1CE5A 5CMXH 2YOLA 3E91A 4WH8A 3A89A 1BQYA 1CGJE 3MWIU 1PPCE 2I6QA 1K1LA 3PM3A 2KCPA 2QCYA 1PPHE 1LQEA 3H7TA 2F91A 2AGGX 3SV9A 3DFJA 3TK5A 3ZVDA 3QGNB 4TSFD 4KTUA 1XVOA 5E2PA 2EY4C 4FU8A 1FZZA 3ZYDA 3EQ0H 1O2PA 1V2RT 1KXFA 1WQSA 3STJA 2VVUA 2UUKB 1DWEH 1HJ8A 3SBKA 2ZHQH 2LELA 1Z7KA 1ESTA 2BD2A 4YOIA 3RXIA 3SUGA 2ZHWH 2THFB 1V2OT 2HNTC 3STIA 4LZ1H 3GY8A 4UE7H 3TU7H 2ZP0H 1TA2A 1QJ7B 1PPEE 1HLTH 2Z3EA 2FDAA 1F92A 2BY5X 2ZO3H 1C1WH 2ZA5A 2ZU5A 1YF4A 1O3GA 1SL3A 3UNSA 3URCA 2PUQH 1KLIH 4XBDA 4ZXYH 4ABJA 3CP7A 1EASA 2W7UA 4HGCA 3G01A 1LVYA 1ANCA 5L30H 3LGYA 1O3HA 1XKAC 4E06H 1C2LA 2AMPA 5GCHF 1SGEE 2YNBA 3RXKA 1F5LA 3LGIA 2VNTA 3WWBA 1LPGB 4NA8A 3LC5A 4WVPE 3D62A 1IQHA 1SOTA 3VGCB 1AFEH 5CHAB 3RLWH 1VGCB 2KCAA 4KELA 2FI3E 1Y8TA 4F4OC 4IN1A 1C2IA 3RXHA 1AMHA 1MBMA 1P9UA 1Z8GA 5T6DA 1IQNA 2J4IA 3RXMA 2NU0E 1NRPH 1SFIA 1LO6A 2RCEA 1S0RA 4JCNA 1G36A 1KYNA 1B0FA 2HPPH 3S0NA 1BMNH 1YPLH 1ZJDA 2FOMB 2ZFTA 4OGXA 2PHBA 2CV3A 3GCTF 1TALA 4E7RG 1QRZA 1P2JA 5K0HA 1P3CA 1KLTA 2VVCA 1QB1A 1AB9C 1UTKA 1W0KD 1Y3YA 3TH2H 3TVJB 2YNAA 4X8TH 1LMWB 2P3FH 5EQSA 3MHWU 4TY7A 2AEIH 4DT7B 2ZFQH 3H5CB 3DHKH 1FPHH 1C1RA 3F9FA 1DICA 2FOAA 3GY5A 4UFGH 1ELCA 4CR5A 3RMNH 4B2CA 4IS5A 1TE0A 1DSUA 2FI5E 1HAOH 1ZPZA 4ABBA 2V35A 3FN8A 2VJ1A 1GMDG 2WYJA 1ZMLA 1CGHA 1GI8B 3ZZBA 3HGNA 3B23B 5E0JA 3QWCH 3U1JB 1S6HA 3FKSD 3GOVB 5CE1A 1KLJH 2FODA 4JK5A 2H1UA 4ISIH 2ZPRA 7ESTE 2K1QA 2PGBB 1YPEH 3A7WA 4K1TA 3ZVFA 1QFKH 3U8TH 1QTFA 2PV9B 1O2GH 1Z8IB 1N8OB 1C5OH 1GBHA 1RTLA 8LPRA 1AWFH 3D23A 3SU4A 4XDEA 4I8GA 1L0ZA 1LVMA 1W13U 2HALA 1A5GH 1FONA 2BZAA 1L4ZA 2FI4E 3ATIA 4DIIH 2AIQA 3MFJA 4INHA 5DJ7A 1MTSA 2OLGA 3UFAA 1OSSA 4H6TA 5T6FA 4LK4A 1CT0E 2W3IA 1K1MA 1TRMA 1KDQA 1QL8A 2GV6A 1V6DA 1C4V2 1SMFE 2BVXH 2STBE 3LJOA 3NRLA 3PMAB 2BQ7B 3T62A 4ESTE 1FI8A 1TOCB 3ZZDA 1TMUH 2TPIZ 3GDUA 2IPHA 1O2HA 1UCYK 2XNDD 2Y5GA 3NCLA 2BX3A 4H42U 1FJSA 4RSPA 4OS2A 4IC5A 4B74A 2P3UB 2IJD1 4FUCA 2Y5HA 2XWBI 1MU8B 2H9HA 1C5WB 2Q6FA 3M3VA 3HK3B 4A6LA 1O32A 3TJOA 3F9EA 1A0HB 1UTMA 1HJAB 2BXTH 1VCPA 2ZQ1A 4D7FA 9LPRA 4JZIA 3ZZCA 1MKWK 1TX8A 2V0BA 3LPRA 5C0TA 1O3OA 4JYVH 5DP7A 4YTAA 3TPIZ 5JBBS 3LONA 1PJPA 1Z8JB 3KCGH 3HK6B 1VITF 4P00A 1MTNC 1Q3XA 5FL7D 1O3AA 1IQLA 2CGAA 3ZVBA 1HUTH 1IQGA 1GDUA 3MNSA 4DW2U 2BVSH 1P05A 1NRSH 2GZ9A 2QN5T 4IBLH 2J98A 3S9CA 3RXRA 1UTLM 1KY9A 1Z8RA 2C8YB 1Y3XA 5DP3A 4Y79A 1O2JA 4Y10E 4CHAC 1BBRK 2CK3D 1HV7A 1CA0C 1O3IA 3SJ8A 3VPKA 3A86A 3A8BA 1DANH 3UQOA 1TGCA 1XUJA 1NBME 2C8ZB 4U30A 1CT4E 1INCA 5ETXA 2QYIA 3A8DA 1QY6A 2BMGB 4I8HA 1ZSKA 1NU7B 3RXCA 4WXVA 3F2HA 3VB3A 2Y6TA 1HNEE 3RUOA 1YP9A 1TGBA 1Y3VA 2XOKD 1H4WA 1QHRB 1ZGVA 2HOBA 1P01A 3RU4E 4AC9A 1C1QA 2SGFE 1VITH 1SQRA 3MO9A 1GI7B 4XOJA 1GG6B 2BVRH 3H09A 1SG8B 1A5IA 1D3DB 1TIOA 1O2TA 1V2JT 3EE0B 1LHDH 4ABHA 2D2DA 3ATMA 3PMHB 2J9NA 1O34A 4NIWA 1DUEA 2OBOA 1D3TB 1YPMH 1E79D 1HAGE 3TJVA 1UHBA 1W3CA 1T4UH 2ZCHP 3B8JA 4MNWA 5GDSH 2BD8A 1Z71A 1YPJH 2BY8X 4RT0A 4UFEH 1DY9A 2PGQB 2H5CA 1Q2WA 2O8MA 4ABIA 1ZLRA 4LOYH 6GCHG 2Y80A 5T6GA 1A61H 2ZU2A 1U6QA 2BX4A 1E36B 1P12E 1C5RA 2O8TA 2ZU3A 3PROA 1YCPM 3A7VA 2D1JA 1UK4A 4ABEA 2FO9A 2V3OH 4ACBA 4NCYA 2BY7X 3PMJA 4ZKSU 4CREA 3HGPA 1EX3A 1OX1A 1GHWH 2Q1JA 3QLPH 1LHGH 2QA9E 1TPAE 1GI4A 4IW4E 1SGCA 1GJCB 4I8JA 1WUNH 3FZDA 1O2YA 1QL9A 1EAIA 5AFYH 3F0OA 3CNRA 2JIZD 1V2MT 3FOAA 3KGPA 3GISB 2OD3B 2WV9A 3WW7A 1Y5AT 1X7AC 1GI5A 1SB1H 1C1VH 1DXWA 3Q3YA 2A4GA 2G51A 5HMAA 1LPZB 2Q6GA 2JH6D 3I77A 2GTBA 1T8NA 2ZFFH 1QB6A 1ZJKA 4AX9H 2G8TA 1BBRH 1MMJN 1ZPBA 1O2XA 4R8TB 3UNQA 2GCHG 5EOKA 4A1VA 1K1NA 1F5RA 2C8WB 2TGTA 1E38B 3PLPA 3DSGA 4Y8ZA 4NZLA 5DGJA 1DSTA 8KME2 1GMDF 3MU8A 4K1SA 1JIMA 1P04A 3MU1A 2QGRA 3BTQE 1EFRD 4NZQA 3N7EA 4J1YA 5EXMA 1TAWA 1ZPCA 2FTMA 1P2IA 1DE7H 2KZ4A 1A4WH 1ZZZA 2HGTH 5DP4A 2ZHEH 1THPB 3A88A 1O36A 1C5TA 4X2WA 1GJ7B 1HAZB 3BG4C 1FY3A 2PKAA 2XCFA 1ZTJA 2GVFA 1NO9H 2ZECA 4GHTA 4Y8YA 3KYGA 1M9UA 5AHGH 1RTKA 3MH4A 3NWUA 1EZXC 1V2PT 3A83A 1A1RA 3U8RH 3CS0A 1YBWA 3LH3A 2ZU4A 1CHGA 3ZZ8A 1PPBH 4ZKNU 1GBTA 3OY6U 1NBMD 3ATKA 3SJKA 1ELVA 4ZKOU 4AFQA 1ZOMA 1MTVA 3F6UH 4B2AA 1VR1H 3VG8A 1GI6A 2TGPZ 4B6EA 2VWLA 1OS8A 1VCWA 4Y6DA 5IYTA 4FVDA 3BN9A 1A3EH 1RS0A 3SGAE 3KQEA 3RU4D 2PWXA 4ZHAA 1UTOA 2KFWA 6CHAC 3SV8A 3ZIAD 2QXHA 1MTUA 1OWJA 1KTSB 1HAIH 1OP0A 1Y3WA 1EZUC 1AZZA 1GJ5H 5BRRE 1IQIA 1HJ9A 1P0SH 1UVTH 1QGFA 2GJGA 4I32A 1SGNE 5ESBA 1NRRH 3QUMP 2GDDA 1TPPA 3RXLA 2FXRA 1EB1H 4F48B 5GJ4B 3QGJA 4TWYA 1LHEH 1SHYA 3SO3A 1GL1A 2A5IA 4BOHA 2PP6A 3DA9B 3EA9A 2ODQA 1UTNA 2A2QH 2BDHA 1V2UT 2AIPA 1F0UA 2OC8A 3MNXA 1BJVA 4SGBE 3A82A 3E16B 2FYRA 3TITA 1J8AA 4H4FA 1G9IE 4FUFA 3FZZA 1ANDA 1DS2E 1K1OA 1HIAB 1TGNA 1FLEE 3KF2A 5EG4A 3WY8A 3RXFA 2RDLA 1PQ8A 2J97A 3DFLA 5EPNA 1MD8A 3BTME 3M37A 1PQAA 3S7HB 5F8ZA 4NSVA 4X1SU 1PFXC 2C8XB 4YO9A 1AB9B 1HAVB 5I25A 1E1QD 1O3PB 3TH4H 5A09A 2EC9H 1K21H 1BTYA 1BUIA 4BANB 3KNXA 1GHVH 4Y11E 3U8OH 1ABJH 4O97A 1L4DA 2ILNA 3ZYEA 4YOJA 1G2MA 3O8RA 2KAIB 2SGQE 5CDFE 1GBMA 1K2I1 1W11U 5C17A 2WPLS 1AGJA 1O5FH 3WWFA 4D8NA 1XMNB 3LGWA 2FOHA 1SLXB 3S7KB 3TNTA 1ZHRA 2H5DA 1HDTH 1W8BH 2QF3A 2BQ6B 4DVAU 1EKBB 1O33A 3ESTA 5TCCA 1FY5A 1C5VA 1O38A 3A7TA 1GBLA 2L6OA 2ZDNA 6LPRA 2A0QB 2GT8A 1B5GH 3N7DA 4ZXXH 2J2UA 5A2MH 2ZPSA 5E0GA 4GPGA 4NWKA 1QIXB 1NRNH 4A5TS 1C2JA 4IMQA 4FUEA 2GGVB 1GVLA 2C3SA 4UONA 4WY3A 4JZEH 4AFUA 3OX7U 3CS7A 3BTWE 2ZDMA 2F9VA 2BB4A 4A1XA 1BHXB 2F9BH 3F68H 1GBJA 3LT3A 2SGPE 2TIOA 3BIVH 1NFYA 5EW2H 4CH8B 3M5NA 1B0EA 1FQ3A 1W0JD 1GDQA 1NFUA 4UFFH 3SI3H 1ETRH 1FN8A 1MKXK 4X1RU 3U9AH 3TNSA 1ETSH 3PV2A 2ULLA 1HAYB 1FAXA 2ZC9H 3UNRA 2WYGA 1AKSB 2M5TA 1HB0B 1MCVA 2DE9A 4ZAEA 5A0BA 4AFZA 2BD7A 2PW8H 4Z6AH 4YLQH 2NU1E 5HGGA 1C4U2 3RM2H 5A8YA 1ZSJA 2OP9A 4XBCA 1GHYH 2CJIA 2Z6BD 2ESTE 1XXDA 5T3HA 1DT2A 2I6SA 3QO6A 3P95A 5DSFA 3DSOA 3KQDA 2ZGBH 3I78A 2F3CE 1MTNB 5GNDA 1ZRBA 3T28A 2RG3A 1CVWH 1EPTA 1FUJA 1G37A 1UCYE 3S9BA 1TNKA 3PO1C 5KGOA 1C2EA 1MABB 4A92A 5A0AE 1HFDA 2VH6A 1P06A 1UVOA 1H8HD 2VWOA 3M7TA 4CHAB 2H2ZA 5FAHA 1CA0B 1YCPH 5JBAS 3RXQA 1C5NH 2UWPA 3SUEA 2HWLB 1ZRKA 5B6OA 4E05H 1H8IH 3OSYA 3RLYH 2VIWA 2RDEA 3PLBA 4ZHMU 3V13A 2AS9A 3T27A 2TRMA 4OS6A 2PR3A 2R3YA 3FANA 3MH7A 2ZEBA 3EA7A 1MUEB 4U01A 5AF9H 1ZMNA 1F2SE 1ABIH 2ASUB 3BIUH 4Y76A 1C2MA 5KEDA 2PSYA 2VBCA 3UWJH 5I46H 1SGYE 4TYDA 4YM9A 5L2YH 4WMFA 5T1VA 2XYAA 4OS7A 3RXBA 5A8ZA 3RC5A 1BBRE 4JZFH 2J95A 4IGDA 2XBYA 2Z9JA 2GCTC 2HNTF 3BTTE 1V2LT 4MNXA 4RI0A 1F0TA 4MVNA 1AU8A 4DT4A 2AERH 1GMCF 3Q77A 5PTPA 3ZVCA 1DDJA 1E37B 4U2WA 1KXEA 3GCHC 3L33A 3U1IB 3Q00A 2F9PA 1GCTC 1E35B 1GHAG 3KEEA 1P2NA 2BHGA 2J94A 3U28C 2FIRH 1AFQC 2FTLE 4X1QU 2NWNA 1G2LA 1TGSZ 2XC5A 1UTJA 1HAPH 2OC7A 3EE7A 1BMAA 1SGFG 4JZDH 4YESB 1S0QA 1ELFA 3GY4A 3RMMH 3ZZ4A 1GMHF 1C2GA 4Q63A 1JBUH 2JETC 3E0NB 1LQDB 5DP9A 1K9OE 4GCHG 2CF9H 1T8LA 2FOBA 2F83A 4INKA 1MBQA 3SNDA 1CQQA 4TPIZ 1A2CH 1O31A 4FOUC 4MLFB 4MNVA 2P3TB 4ASHA 4K69A 1TNJA 2WUBA 3AAVA 2ZGXH 1HAHH 3MNCA 3VXFH 2QE7D 2BY9X 1O5DH 2WV5A 5FCKA 1BTPA 3OTPA 3AK5A 1LHCH 2FESH 3E1XB 4OS4A 2QXJA 3SNBA 2XCNA 1QB9A 2GDEH 2A45B 1TPSA 1AY6H 2GMTC 3M36A 4OM9A 1SGTA 2OUAA 2RA0A 1D6RA 1JRTA 1GGDC 1MZDA 2B5TB 2GZ7A 1GL0E 4Y0YE 3QN7A 1ID5H 4FUJA 1N6XA 3NUMA 2EQNA 2VINA 3MI4A 4TWWA 3C27B 5K7RA 1YM0A 3RM0H 1YLCA 3PWBA 3TH3H 4IMZA 3SUDA 4ZCNA 2B8OH 2WPKS 3LDXH 7GCHF 1G3EA 2FM2A 2QIQA 3SOSA 2OC0A 3AW1A 3C1KA 1C5YB 3FP7E 4TPYA 2R0LA 2BD4A 4X1NU 3GDVA 1P2OA 3QX5H 3UOUA 1NFXA 3N99A 3SQEE 1S6FA 2VIQA 4XRNA 2RA3A 3MH5A 1YLNA 4WMDA 1H9IE 1Y5BT 1ZHPA 1AD8H 1K28D 3NKKA 3BG4B 1BMFD 3RMOH 3URDA 2Z9KA 1K1JA 1ELTA 1NC6A 4WWYA 4K60A 2H9TH 6ESTA 1ORFA 4DG4A 2VGCB 1CGIE 2QF4A 1GHBG 1QA0A 2BLQA 1UW7A 4Y8XA 1GBAA 5HXFA 1C2KA 2EI8A 3T29A 1QCPA 4UEHH 4Y7BA 1DITH 1O3EA 1H1BA 3Q76A 4FUGA 2ZDVH 1O3DA 3SV6A 3RXAA 1P2KA 2GKVE 4AYVB 2ZIQH 1AN1E 2XRCA 4THNH 1LVBA 3VB6A 2A4OA 2R2MB 4FVBA 4YOGA 4M9FA 1ZHMA 5GPIB 3ZZ6A 2FLBH 2A31A 2A5KA 3M5MA 4R0IA 1GJAB 2FOCA 1O37A 4DOQA 1XUHA 1BHXF 6CHAB 2G52A 5EW1H 5C67A 1FX0B 1GBCA 1O2RA 4WF8A 2FWWA 5A0CA 2GZ8A 4X2YA 3ZVEA 3PMBB 1O0DH 1GJ9B 3FAOA 4FUBA 1RD3B 1GI0A 3JZ1B 2JDID 3SUFA 2Z9IA 3AVZA 4MDSA 1YKTA 3ZZ3A 3KQCA 4BNRA 5C1UA 1C1PA 1SLUB 1JOUB 3A84A 1ANBA 3E8LA 5FPTA 5TJXA 2G5VA 1PYTD 2ZTZA 3RXDA 5C2ZA 2NU3E 3SNAA 1SPJA 4NIXA 4KTCA 1TQ7B 2KR7A 1CA8B 3QK1A 1C1TA 1TB6H 1KTTB 1V2NT 4QT8C 5B6LA 1IHTH 3T2NA 3K2UA 2QF5A 4OS5A 2OQUA 4GLYA 4X6MA 2GD4B 1CT2E 2BDCA 1TNLA 4BXWA 2IPQX 2J38A 3U69H 1DLEA 2BYAX 4AB9A 2C90B 2R3UA 2ZGCA 4LZ4B 2OTVA 1OOKB 3O8DA 3LKWA 2J5UA 1H9HE 2Y82A 1GBEA 4HFPB 2PTCE 1O3CA 4NA7A 3RC4A 3ZZ9A 1LHFH 2BOHB 2VIPA 1O3KA 3RXVA 4I33A 1OWIA 2W3KA 3FVFB 3PTNA 2FYQA 1MTWA 1SQAA 1MD7A 4Q7YA 1PYTC 4ASUD 1S81A 2F9UA 1UTPA 5H4IB 2AFQB 4UDWH 1BRAA 3OTJE 2EI7A 1DPOA 4ISLA 3BTGE 4SGAE 3SU2A 3E6PH 5E8EH 3SV7A 2CN0H 3SU1A 1UCYH 2PTNA 2O9QA 1O5EH 5HIYA 3DCLA 3BSQA 1UVPA 4ISHH 4X2XA 1QR3E 1BTUA 1GJDB 1GJ6A 1RJXB 1AWHB 2WZQA 1GI9B 3GICB 3UQVA 1LCYA 2FOGA 1EJMA 3IG6B 3MYWA 2G4TA 4ISNA 4NG9H 3EDXB 1FN6A 5BPEA 2ZTXA 1LKBA 3E90B 1BRBE 1MKWH 4NSYA 1T31A 1SKYE 2AH4X 4AZ2B 3E0PB 5DKMA 2EA3A 1EOLA 1K0HA 1OKXA 1GHAF 4KP0A 1TPOA 2GP9B 4UD9H 3A8CA 4U32A 3P92A 5HKKD 3UY9A 1V2ST 2FS8A 1DWCH 2BDGA 5AVDA 1ACBE 1O3FA 2YMSD 2ODPA 8GCHG 4GCHF 3EA8A 2WUCA 4KGAA 1GJBB 4Y7AA 1IOEA 2VB0A 1O2NA 2AYWA 2IN2A 4ABFA 3V3MA 3OU0A 1EOJA 4WMEA 4X8UH 2VH0A 2SGEE 2EI6A 3K65B 5SGAE 1HGTH 1D9IA 2XW9A 1LTOA 2XBVA 1L1GA 5EODA 2GX4A 4NFFA 5E0HA 4B75A 1QBOA 1XUFA 3I29A 1KDQB 2A7JA 5A8XA 3ELAH 1SHHB 3BEFB 4XE4A 1F7ZA 3T25A 3ZZ7A 3ZVGA 1W2KH 1TMTH 3OFND 3PTBA 2YMSC 3A8AA 5FPYA 4JZ1A 1G32B 1ELAA 1ZTLA 3M61U 1TMBH 4BXSA 2PFEA 4ABDA 1BJUA 1ELEE 2ZI2H 1S5SA 1A3BH 1BZXE 3UPEA 2UUJB 1FV9A 1TONA 5EJLA 3PO1B 2H6MA 2RFKC 3K9XB 4F55A 1CU1A 1IQMA 5FCRA 5C1XA 1P9SA 1S6LA 3F0PA 1FNIA 3UR6A 4Z0KA 3P8FA 4TY6A 5GCHG 3V12A 5EU8A 1GJ8B 1P8VC 2ZNKH 1WQVH 2SGAA 2STAE 1BRUP 1SOZA 2HNTE 4YXWD 1YPGH 4AFSA 3W1EA 4F49A 1LKAA 1EPTC 2A32A 1FY8E 5CHBA 4DJZB 1NZQH 1ELGA 2BD9A 2J98B 1GHZA 1GHBF 4FETA 3M5LA 1KXCA 1ZYOA 5IDKA 2BLOA 1YPKH 4MPWA 1SC8U 1BTZA 1ZR0A 3AASA 2XBXA 4KKDA 3PWCA 5FBIA 3SW2B 1FIZA 1UTQA 5EQQA 1AVXA 1ANEA 1V3XA 3PRBA 1E1RD 2O8UA 4CRCA 2GCTB 2V3MA 3TGKE 3UTUH 1SQTA 2JH0D 3IWMA 5EXNA 4J2YB 1YPHE 1G3CA 1JWTA 2FP7B 2DE8A 3H7OA 1P02A 2P94A 1EJAA 4MPXA 1Y5UT 3A7YA 3GCHB 2GT7A 1MZAA 1AQ7A 3GY6A 1O2MA 2WHXA 1GCTB 1NPMA 2XC0A 3GY2A 1FY1A 3EYDA 2FOFA 1HYLA 2QF0A 2R9PA 3GCNA 3MH6A 3D65E 1JMOH 1PPFE 1NM6A 1TNIA 2QAAA 4Y0ZE 4MPVA 1AFQB 3PYHA 3F2GA 1KXBA 4VGCC 5ABWA 1SGFA 1O3JA 3UR9A 1UHBB 1YLDA 4RN6A 1HAXB 2ZF0H 3BTHE 2JETB 1KSNA 5FX5A 4A7IB 3QZQA 2Z9GA 3SORA 8ESTE 1ZMJA 2FLRH 2L74A 1TRNA 4B71A 4I7YH 5GWZA 2OQ5A 2LNCA 1RRKA 2Y81A 4HZHA 1MCTA 2FX6A 3F1SB 1GPZA 5EGMA 1E34B 2HLCA 3KIDU 1FXYA 1P57B 1BOQA 1AVWA 2ZWLH 3LH1A 1OP8A 1GDNA 1NU9A 2BLVA 1DX5M 3ZZAA 1C9PA 5DP8A 1N1LA 1TGTA 2HLDD 1QA7A 2Z3CA 2ZDKA 3RP2A 5J4SA 1IAUA 2XNIA 2GMTB 3SU3A 3NPSA 1GGDB 2SGDE 1G3BA 2A4QA 3M7QA 1O5CB 3MQKC 6GCHF 1BA8B 1CBWC 2ZG0H 3MU5A 1C1MA 4INLA 4X2VA 2UUYA 1HPGA 4AGKA 1CO7E 1O5GH 3ZV8A 2DUCA 5JBCS 1FIWA 1SGQE 1F0SA 2WV4A 1C1SA 2ZGHA 1OPHB 3N7OA 1MU6B 3ZZ5A 4B1TA 2UWLA 1WBGB 1WTHD 3KHVA 5C20A 2FZZA 2ODYB 1CSOE 1Y59T 1RXPA 1TABE 4YLUA 1BT7A 4CRFA 1BTHH 2WPDD 4CBOA 1UVUH 1C1OA 4K1EA 1EB2A 3SHAH 1DWDH 2IJOB 4AG1A 3K6YA 5HM9A 1QJ6B 1NN6A 1C5MD 1SQOA 1TNGA 3M5OA 2G4UA 1TBQH 5JPMH 2WPHS 3FP8E 1VITG 1HRTH 3T5FH 4XD7D 5DP6A 2UWOA 1C5PA 3F9GA 1HBTH 1T8OA 2M2AA 4M7GA 1QURH 1P10A 5C5OA 4CH2B 2PKAB 2OXSA 1ZGIA 1O2QA 3NK8A 8GCHF 2F4LA 2GCHF 1FAKH 4LXBH 1QNJA 2V6NA 2LPRA 3ODDA 2Z3DA 4CBNA 3MO3A 3S9AA 2HPQH 1TRYA 2KCOA 3VXEH 1GCDA 1EATA 1MQ6A 2BOKA 2FX4A 3KYFA 1BTXA 4O3UA 2G81E 4K3JA 2XBWA 5KECA 4ZMAH 2BY6X 1CHOG 2OC1A 3P8GA 4MTBA 3SQHE 1T4VH 3QZRA 3SZEA 4DURA 1XVMA 3GDSA 3JZ2B 1P09A 5F53A 1GI2A 1QQ4A 4Q2KA 4X8VH 1AI8H 9ESTA 3HPTB 2W6ID 1D6WA 3SJ9A 1EAWA 1C5QA 3P70B 4GAWA 1Z6EA 3LGVA 3SYJA 4FU9A 2BD5A 4GSOA 3RXUA 1O3NA 2P8OC 3AAUA 2CHAC 3RC6A 1HCGA 1V2WT 3LJJA 4GHQA 4WH6A 4ZROA 1OYTH 4JYUH 3BTFE 1J15A 5EQRA 1O2LA 1TBRH 2FOEA 1O2SA 1VCQA 2ANWA 1AVGH 3AW0A 1WYKA 3V7TA 1S82A 5IK2D 4AOQA 4Q4LA 5E2OA 3SZNA 2QC2A 4I8LA 3K6ZA 4ZUHA 2W6JD 3P6ZB 1GI1A 3BTKE 1AO5A 2A7CA 1YPHC 3VB4A 1S83A 2D26C 1AE5A 4X6OA 2QXIA 1SBWA 3D49H 5LPRA 4I86A 2FEQH 3R3GB 5EXLA 1W0YH 1MH0A 3DUXH 3NXPA 3TJUA 1DY8A 3RMLH 4X0WU 1MKXH 1QBNA 1YYY1 2W26A 2O8LA 2BDYA 4CRBA 1RIWC 1GI3A 3LGTA 2ZFSA 1EP5A 4X6PA 3SN8A 1O2UA 2O8WA 3ATLA 2K0QA 4YZUA 1XXFA 4XBBA 5DPAA 1YGCH 1AIXH 2CF8H 1THRH 1BCUH 2BZ6H 3ZVAA 1NFWA 1P11E 3BG8A 2CMYA 3UWIA 1TFXA 2AMDA 4D76A 2VIOA 3F3BA 3U98H 1SGIB 1YY3A 1O3MA 1V2TT 5HIZA 1AUTC 1OHHD 4AG2A 5JDUB 1AE8H 2QXGA 3GS9A 5J4QA 1NROH 2PKSC 1ESBA 1WOFA 4YT6H 1DOJA 1OWHA 4YT7H 1VKYA 1WTGH 1WV7H 3SU5A 1XUGA 1IQKA 1SR5C 4B2BA 3PV4A 1UJ1A 1C2DA 1ELBA 2Z94A 3L6PA 2J34A 3W94A 3GCOA 2P93A 3ZV9A 1DUAA 1BDAA 2F43B 2P16A 3L3TA 2W7SA 1BTWA 2ANKH 2AMQA 1IQJA 5L6NH 1EZSC 2TBSA 4CRDA 7LPRA 2A2XH 3B9FH 1NESE 2VVVA 1TLDA 2F9NA 4O03A 2A4RA 5TCAA 4ZH8A 3RXSA 4RKJB 1JRSA 2XXLA 1A0LA 1WAYB 3QTVH 1WCZA 2D8WA 1XM1A 4WJG2 4HG6A 4BTIB 1QQUA 2OK5A 4RKOB 2A7HA 1OWKA 2YMSB 5FXLA 4DGJA 1SGDE 2WPMS 2ALPA 1L2EA 2J92A 2SFAA 3HATH 1QRXA 3KQBA 3LC3A 4D9QA 1T7CA 1ZSLA 4PROA 3RXEA 3RXPA 4DIHH 3KN2A 2BDIA 2VIVA 4FXGH 4IN2A 1ARBA 1P03A 1N6YA 3TK9A 1FPCH 1K1IA 1XX9A 1Y3UA 4KTSA 1KIGH 2F9OA 3P8OA 1IHSH 1L1JA 2TGDA 4K5ZA 5AFZH 5LGOA 1O2WA 1P2MA 4H6SB 2ZCKP 2LP6A 1TQ0B 4I31A 5G4BA 1THSH 1Z6JH 3MU4A 2ZPQA 1EPTB 4Z1MD 1XUIA 1QZ8A 1F5KU 3PB1E 3TGJE 1DWBH 1YWUA 2Y7XA 1C2HA 1AHTH 2QV1A 2OCVB 2G55A 4AN7A 4D9RA 3BEIB 2V3HH 5DN6D 3BEUA 1NS3A 4RT1A 1H8DH 3ATWA 3SJIA 3V0XA 1HXFH 1EAUA 1BB0B 1GBIA 4Q7ZA 3MNBA 1NT1A 2EEKA 1GBDA 1RTFB 2WINI 4NGAH 1W7XH 2FS9A 1NY22 4ZKRU 1MQ5A 2VU8E 1UK2A 1SGRE 1BIOA 5JB9S 1QBVH 1E0FD 1CHOF 1O3LA 3ENSB 5F8XA 3MU0A 3S69A 4XFQA 2ZCLP 4DCDA 4D7GA 1SFQB 5EJ1A 4GUXA 1TX6A 1J16A 1J9CH 3F2FA 3HKJB 5EJZA 4E7NA 1EP6A 1HIAA 1WSSH 4HTCH 2Q6DA 4BTTB 3VGCC 4VGCB 3SNEA 7KMEH 1BMLA 2TGAA 5CHAC 5C0UA 5LPEA 1P2QA 1VGCC 3DSPA 4BAQB 4WXIA 3R0FA 4AYYB 3OEED 1LPKB 1UO6A 2PLXA 5C5NA 1VJ9U 1HAVA 2JJ2D 5EPYA 3RU4T 3SHCH 3MOCA 4XSKU 1KMHB 2NU2E 1TYNA 2WPIS 2Y5FA 1O3BA 1JXPA 1LVOA 2ZZUH 3SV2H 2UUFB 1NTPA 2KAIA 4BAMB 1NRQH 4NIYA 5LH8A 2ANMH 2BDAA 1XKBC 1F0RA 3FO8D 1C5ZB 1O2KA 1ZTKA 5F03A 2A5AA
chains in the Genus database with same CATH topology
1S84A 2ZGJA 1V2KT 2R0KA 1IQEA 1W12U 2BM2A 2WPJS 4MPUA 4OS1A 1G3DA 1ESAA 4MNYA 3BTDE 1CBWB 1O2IA 2ZFRH 3TGIE 4Q7XA 1OP2A 4NA9H 3OY5U 4K8BA 5JB8S 4A1TA 3LOXA 1HXEH 4AORA 1TOMH 3VB7A 2ALVA 1MAYA 1Z1IA 2ZDLA 5GIBA 4Q80A 1ARCA 1GBKA 1SI5H 1TBZH 2ZFPH 1SLVB 4BTUB 4B76A 1FMGA 2B7DH 1DM4B 1IQFA 4K8YA 3FFGA 1N8OC 3UOPA 3QTOH 3OYPA 5HM2A 1TA6A 3F9HA 2P95A 5FBEA 2JH5D 2R2WU 1GWAA 1ETTH 3Q3KA 1T32A 1DLKB 1V2VT 1GVKB 3KL6A 2P59A 1BRCE 1KXDA 3M35A 1W0ZU 2XTTB 4DY7B 1QRWA 3QDZB 3M3SA 4K2YA 4B73A 2HVXA 3A7XA 3GY7A 1TNHA 3P8NA 5C1YA 3T26A 1GJ4H 1OWEA 1ELDE 1AKSA 3RXJA 4FUIA 3TIUA 1OYQA 1C5LH 1C5XB 4FUDA 5L2ZH 3M7UA 3BF6H 1PQ7A 3SI4H 1EZQA 3RDZA 4ISOA 1LDTT 2XWAA 5FX6A 3MMGA 2IOTA 1O35A 5DP5A 1EQ9A 1EAXA 1W10U 1SVPA 2A1DB 3A80A 2VGCC 2FMJA 3E3TA 3P17H 4MG3A 1T8MA 5GXPA 3A87A 2OBQA 5F6MA 3DD2H 1O5BB 1HJAC 4UFDH 1EJNA 3DT0H 5DK1A 2P8OB 1C1NA 4JK6A 2CHAB 2CXVA 5LPFA 3SGQE 4NIVA 4BAOB 2AGEX 1Q31A 3IITA 1AUJA 2VIDA 3A7ZA 1RGQA 2PSXA 1BMMH 3RXTA 1J14A 3TLOA 1PQ5A 4NFEA 2ZQ2A 1GMCG 1FDPA 2JKHA 2ZHDA 3LIWA 1K22H 1P3EA 5F8TA 3ITIA 5ESTE 1C9TA 3GYLB 3GCTG 2BTCE 4JMYA 4X8SH 2NU4E 1SGPE 4X6NA 2BXUH 5JYIA 1D3PB 1W7GH 3NZIA 3UUZA 4CRAA 2W5EA 3TJNA 2Z9LA 4ABAA 4CRGA 1MAXA 2Y7ZA 2BD3A 2FPZA 5C3NA 3GYMA 1GMHG 3A81A 3CENA 3EGKH 3O8CA 3BTEE 2ZKSA 2Z7FE 1J17T 1GVZA 4X1PU 2C93B 1EXFA 1FY4A 1SLWB 3VEQB 5HYOA 1S85A 2G00A 1DXPA 1RIWB 1GG6C 2SNWA 4O9VA 1DFPA 1C5SA 2VWMA 1OWDA 3UIRA 2OINA 3BV9B 3EAJA 2QY0B 3LU9B 3ODFA 1V2QT 1C2FA 3Q3XA 2PUXB 5JBTA 3LGUA 1JIRA 4AGJA 1QL7A 1D4PB 4CR9A 4O3TA 5DG6A 3GY3A 2GV7A 3SU0A 1BITA 1L1NA 5FHTA 3FP6E 1C4Y2 1B7XB 1UK3A 3A85A 1O2OA 2B9LA 2PKSB 2B0FA 1O2ZA 3SNCA 2BLWA 1O39A 4I8KA 4GVUA 1H9LB 1YC0A 1C1UH 1TWXB 1SSXA 1UVSH 2VWNA 1A5HA 1TX7A 3TK6A 1RFNA 1YCPK 4FUHA 7GCHG 4NWLA 2AGIX 1KXAA 1A0JA 1GBFA 4MQAA 1G30B 1A7SA 1WU1A 2ANYA 1O30A 3RXOA 4AB8A 3VFEA 1K1PA 1D3QB 4JYTA 3SU6A 3SJOA 1GHXH 1A46H 3SGBE 1VZQH 4FU7A 3MTYA 2ZDAH 1PPGE 4HI3A 3UREA 2ZHFH 4OGYA 5FPSA 4BAHB 1QJ1B 3O8BA 3RXGA 3VB5A 2SNVA 1W14U 1AZ8A 1Z1JA 1XUKA 1OXGA 3PLKA 5DO4H 2G5NA 1PPZA 4ABGA 2ZTYA 3M3TA 2H9EH 1GBBA 1O5AB 3W95A 2XC4A 1UMAH 1VJAU 2HRVA 3MO6A 1DVAH 2C4FH 2BDBA 2ZU1A 4ZHLU 1O2VA 3HKIB 4Y71A 1C5UA 1EUFA 4IC6A 4BAKB 2BQWB 1CE5A 5CMXH 2YOLA 3E91A 4WH8A 3A89A 1BQYA 1CGJE 3MWIU 1PPCE 2I6QA 1K1LA 3PM3A 2QCYA 1PPHE 1LQEA 3H7TA 2F91A 2AGGX 3SV9A 3DFJA 3TK5A 3ZVDA 3QGNB 4KTUA 1XVOA 5E2PA 4FU8A 1FZZA 3ZYDA 3EQ0H 1O2PA 1V2RT 1KXFA 1WQSA 3STJA 2VVUA 2UUKB 1DWEH 1HJ8A 3SBKA 2ZHQH 1Z7KA 1ESTA 2BD2A 4YOIA 3RXIA 3SUGA 2ZHWH 2THFB 1V2OT 2HNTC 3STIA 4LZ1H 3GY8A 4UE7H 3TU7H 2ZP0H 1TA2A 1QJ7B 1PPEE 1HLTH 2Z3EA 2FDAA 1F92A 2BY5X 2ZO3H 1C1WH 2ZA5A 2ZU5A 1YF4A 1O3GA 1SL3A 3UNSA 3URCA 2PUQH 1KLIH 4XBDA 4ZXYH 4ABJA 3CP7A 1EASA 2W7UA 4HGCA 3G01A 1LVYA 1ANCA 5L30H 3LGYA 1O3HA 1XKAC 4E06H 1C2LA 2AMPA 5GCHF 1SGEE 2YNBA 3RXKA 1F5LA 3LGIA 2VNTA 1LPGB 4NA8A 3LC5A 4WVPE 3D62A 1IQHA 1SOTA 3VGCB 1AFEH 5CHAB 3RLWH 1VGCB 4KELA 2FI3E 1Y8TA 4F4OC 4IN1A 1C2IA 3RXHA 1AMHA 1MBMA 1P9UA 1Z8GA 5T6DA 1IQNA 2J4IA 3RXMA 2NU0E 1NRPH 1SFIA 1LO6A 2RCEA 1S0RA 4JCNA 1G36A 1KYNA 1B0FA 2HPPH 3S0NA 1BMNH 1YPLH 1ZJDA 2FOMB 2ZFTA 4OGXA 2PHBA 2CV3A 3GCTF 1TALA 4E7RG 1QRZA 1P2JA 5K0HA 1P3CA 1KLTA 2VVCA 1QB1A 1AB9C 1UTKA 1Y3YA 3TH2H 3TVJB 2YNAA 4X8TH 1LMWB 2P3FH 5EQSA 3MHWU 4TY7A 2AEIH 4DT7B 2ZFQH 3H5CB 3DHKH 1FPHH 1C1RA 3F9FA 1DICA 2FOAA 3GY5A 4UFGH 1ELCA 4CR5A 3RMNH 4B2CA 4IS5A 1TE0A 1DSUA 2FI5E 1HAOH 1ZPZA 4ABBA 2V35A 2VJ1A 1GMDG 2WYJA 1ZMLA 1CGHA 1GI8B 3ZZBA 3HGNA 3B23B 5E0JA 3QWCH 3U1JB 1S6HA 5CE1A 3GOVB 1KLJH 2FODA 4JK5A 2H1UA 4ISIH 2ZPRA 7ESTE 2K1QA 2PGBB 1YPEH 3A7WA 4K1TA 3ZVFA 1QFKH 3U8TH 1QTFA 2PV9B 1O2GH 1Z8IB 1N8OB 1C5OH 1GBHA 1RTLA 8LPRA 1AWFH 3D23A 3SU4A 4XDEA 4I8GA 1L0ZA 1LVMA 1W13U 2HALA 1A5GH 1FONA 2BZAA 1L4ZA 2FI4E 3ATIA 4DIIH 2AIQA 3MFJA 4INHA 5DJ7A 2OLGA 1MTSA 3UFAA 1OSSA 4H6TA 5T6FA 4LK4A 1CT0E 2W3IA 1K1MA 1TRMA 1KDQA 1QL8A 2GV6A 1V6DA 1C4V2 1SMFE 2BVXH 2STBE 3LJOA 3PMAB 2BQ7B 3T62A 4ESTE 1FI8A 1TOCB 3ZZDA 1TMUH 2TPIZ 3GDUA 2IPHA 1O2HA 1UCYK 2Y5GA 3NCLA 2BX3A 4H42U 1FJSA 4RSPA 4OS2A 4IC5A 4B74A 2P3UB 4FUCA 2Y5HA 2XWBI 1MU8B 2H9HA 1C5WB 2Q6FA 3M3VA 3HK3B 4A6LA 1O32A 3TJOA 3F9EA 1A0HB 1UTMA 1HJAB 2BXTH 1VCPA 2ZQ1A 4D7FA 9LPRA 4JZIA 3ZZCA 1MKWK 1TX8A 2V0BA 3LPRA 1O3OA 4JYVH 5DP7A 4YTAA 3TPIZ 5JBBS 3LONA 1PJPA 1Z8JB 3KCGH 3HK6B 1VITF 1MTNC 1Q3XA 1O3AA 1IQLA 2CGAA 3ZVBA 1HUTH 1IQGA 1GDUA 3MNSA 4DW2U 2BVSH 1P05A 1NRSH 2GZ9A 2QN5T 4IBLH 3S9CA 3RXRA 1UTLM 1KY9A 1Z8RA 2C8YB 1Y3XA 5DP3A 4Y79A 1O2JA 4Y10E 4CHAC 1BBRK 1HV7A 1CA0C 1O3IA 3SJ8A 3VPKA 3A86A 3A8BA 1DANH 3UQOA 1TGCA 1XUJA 2C8ZB 4U30A 1CT4E 1INCA 5ETXA 2QYIA 3A8DA 1QY6A 2BMGB 4I8HA 1ZSKA 1NU7B 3RXCA 4WXVA 3VB3A 2Y6TA 1HNEE 3RUOA 1YP9A 1TGBA 1Y3VA 1H4WA 1QHRB 1ZGVA 2HOBA 1P01A 3RU4E 1C1QA 2SGFE 1VITH 3MO9A 1GI7B 4XOJA 1GG6B 2BVRH 1SG8B 1A5IA 1D3DB 1TIOA 1O2TA 1V2JT 3EE0B 1LHDH 4ABHA 2D2DA 3ATMA 3PMHB 2J9NA 1O34A 4NIWA 1DUEA 2OBOA 1D3TB 1YPMH 1HAGE 3TJVA 1UHBA 1W3CA 1T4UH 2ZCHP 3B8JA 4MNWA 5GDSH 2BD8A 1Z71A 1YPJH 2BY8X 4UFEH 1DY9A 2PGQB 2H5CA 1Q2WA 2O8MA 4ABIA 1ZLRA 4LOYH 6GCHG 2Y80A 5T6GA 1A61H 2ZU2A 1U6QA 2BX4A 1E36B 1P12E 1C5RA 2O8TA 2ZU3A 3PROA 1YCPM 3A7VA 2D1JA 1UK4A 4ABEA 2FO9A 2V3OH 4NCYA 2BY7X 3PMJA 4ZKSU 4CREA 3HGPA 1EX3A 1OX1A 1GHWH 2Q1JA 3QLPH 1LHGH 2QA9E 1TPAE 1GI4A 4IW4E 1SGCA 1GJCB 4I8JA 1WUNH 3FZDA 1O2YA 1QL9A 1EAIA 5AFYH 1V2MT 3KGPA 3GISB 2OD3B 1Y5AT 1X7AC 1GI5A 1SB1H 1C1VH 1DXWA 3Q3YA 2A4GA 2G51A 5HMAA 1LPZB 2Q6GA 2JH6D 3I77A 2GTBA 1T8NA 2ZFFH 1QB6A 1ZJKA 4AX9H 2G8TA 1BBRH 1MMJN 1ZPBA 1O2XA 4R8TB 3UNQA 2GCHG 5EOKA 4A1VA 1K1NA 1F5RA 2C8WB 2TGTA 1E38B 3PLPA 4Y8ZA 4NZLA 5DGJA 1DSTA 8KME2 1GMDF 3MU8A 4K1SA 1JIMA 1P04A 3MU1A 2QGRA 3BTQE 4NZQA 4J1YA 5EXMA 1TAWA 1ZPCA 2FTMA 1P2IA 1DE7H 1A4WH 1ZZZA 2HGTH 5DP4A 2ZHEH 1THPB 3A88A 1O36A 1C5TA 4X2WA 1GJ7B 1HAZB 3BG4C 1FY3A 2PKAA 2XCFA 1ZTJA 2GVFA 1NO9H 2ZECA 4GHTA 4Y8YA 1M9UA 5AHGH 1RTKA 3MH4A 3NWUA 1EZXC 1V2PT 3A83A 1A1RA 3U8RH 3CS0A 1YBWA 3LH3A 2ZU4A 1CHGA 3ZZ8A 1PPBH 4ZKNU 1GBTA 3OY6U 3ATKA 3SJKA 1ELVA 4ZKOU 4AFQA 1ZOMA 1MTVA 3F6UH 4B2AA 1VR1H 1GI6A 2TGPZ 2VWLA 1OS8A 1VCWA 4Y6DA 5IYTA 4FVDA 3BN9A 1A3EH 1RS0A 3SGAE 3KQEA 3RU4D 2PWXA 4ZHAA 1UTOA 6CHAC 3SV8A 2QXHA 1MTUA 1OWJA 1KTSB 1HAIH 1OP0A 1Y3WA 1EZUC 1AZZA 1GJ5H 5BRRE 1IQIA 1HJ9A 1P0SH 1UVTH 1QGFA 4I32A 1SGNE 5ESBA 1NRRH 3QUMP 2GDDA 1TPPA 3RXLA 2FXRA 1EB1H 5GJ4B 3QGJA 4TWYA 1LHEH 1SHYA 3SO3A 1GL1A 2A5IA 4BOHA 3DA9B 3EA9A 2ODQA 1UTNA 2A2QH 2BDHA 1V2UT 2AIPA 1F0UA 2OC8A 3MNXA 1BJVA 4SGBE 3A82A 3E16B 2FYRA 3TITA 1J8AA 4H4FA 1G9IE 4FUFA 3FZZA 1ANDA 1DS2E 1K1OA 1HIAB 1TGNA 1FLEE 3KF2A 5EG4A 3WY8A 3RXFA 2RDLA 1PQ8A 3DFLA 5EPNA 1MD8A 3BTME 3M37A 1PQAA 3S7HB 5F8ZA 4NSVA 4X1SU 1PFXC 2C8XB 4YO9A 1AB9B 1HAVB 5I25A 1O3PB 3TH4H 5A09A 2EC9H 1K21H 1BTYA 1BUIA 4BANB 3KNXA 1GHVH 4Y11E 3U8OH 1ABJH 4O97A 1L4DA 2ILNA 3ZYEA 4YOJA 1G2MA 3O8RA 2KAIB 2SGQE 1GBMA 1K2I1 1W11U 2WPLS 1AGJA 1O5FH 4D8NA 1XMNB 3LGWA 2FOHA 1SLXB 3S7KB 3TNTA 1ZHRA 2H5DA 1HDTH 1W8BH 2QF3A 2BQ6B 4DVAU 1EKBB 1O33A 3ESTA 5TCCA 1FY5A 1C5VA 1O38A 3A7TA 1GBLA 2ZDNA 6LPRA 2A0QB 2GT8A 1B5GH 4ZXXH 2J2UA 5A2MH 2ZPSA 5E0GA 4GPGA 4NWKA 1QIXB 1NRNH 4A5TS 1C2JA 4IMQA 4FUEA 2GGVB 1GVLA 2C3SA 4UONA 4WY3A 4JZEH 4AFUA 3OX7U 3CS7A 3BTWE 2ZDMA 2F9VA 2BB4A 4A1XA 1BHXB 2F9BH 3F68H 1GBJA 3LT3A 2SGPE 2TIOA 3BIVH 1NFYA 5EW2H 4CH8B 3M5NA 1B0EA 1FQ3A 1GDQA 1NFUA 4UFFH 3SI3H 1ETRH 1FN8A 1MKXK 4X1RU 3U9AH 3TNSA 1ETSH 2ULLA 1HAYB 1FAXA 2ZC9H 3UNRA 2WYGA 1AKSB 2M5TA 1HB0B 1MCVA 2DE9A 4ZAEA 5A0BA 4AFZA 2BD7A 2PW8H 4Z6AH 4YLQH 2NU1E 5HGGA 1C4U2 3RM2H 5A8YA 1ZSJA 2OP9A 4XBCA 1GHYH 2CJIA 2Z6BD 2ESTE 1XXDA 5T3HA 1DT2A 2I6SA 3QO6A 3P95A 3KQDA 2ZGBH 3I78A 2F3CE 1MTNB 1ZRBA 3T28A 2RG3A 1CVWH 1EPTA 1FUJA 1G37A 1UCYE 3S9BA 1TNKA 3PO1C 1C2EA 4A92A 5A0AE 1HFDA 2VH6A 1P06A 1UVOA 2VWOA 3M7TA 4CHAB 2H2ZA 5FAHA 1CA0B 1YCPH 5JBAS 3RXQA 1C5NH 2UWPA 3SUEA 2HWLB 1ZRKA 5B6OA 4E05H 1H8IH 3OSYA 3RLYH 2VIWA