1QZ8A

Crystal structure of sars coronavirus nsp9
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
b'ELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyprotein 1ab
publication title The severe acute respiratory syndrome-coronavirus replicative protein nsp9 is a single-stranded RNA-binding subunit unique in the RNA virus world.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Unknown function
total genus 20
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 1qz8A01
3EE7A 2J98A 5HIYA 1UW7A 1QZ8A 2J97A 5C94A 2J98B 5HIZA
chains in the Genus database with same CATH superfamily
1NC6A 3STIA 2GVFA 1CT2E 3UFAA 2ULLA 1C5PA 5EPNA 3SYJA 2FTLE 1NFYA 3A8BA 2AMPA 4A7IB 1P05A 2WSSD 3K65B 1HAXB 4DY7B 5EU8A 3S7HB 3LGTA 4ZHAA 2W3KA 3NCLA 1BRAA 4H42U 3A7XA 1C1VH 3FOAA 1HIAA 2F9UA 1NRQH 7GCHF 1P2NA 4YOJA 1MKWH 2G00A 2TGAA 3A86A 2CN0H 2XTTB 3RXRA 4DGJA 4DW2U 1CSOE 5EG4A 1HPGA 1SGYE 4Y7AA 2I6QA 1TONA 2FLBH 3KQEA 1G30B 4DT4A 1SGRE 3SU4A 4X1SU 1VGCC 5ESTE 4MTBA 3W1EA 2R9PA 1HXFH 5J4SA 3ZZCA 4A6LA 1E36B 1AO5A 3W95A 1WBGB 2B8OH 3VXFH 2YMSC 4CREA 1GBEA 1GHVH 5IYTA 2BLQA 1K1PA 3AAVA 4FUDA 1S5SA 1Y3UA 2UUKB 2GGVB 4Y76A 1IAUA 2EA3A 2ZTXA 4D76A 8ESTE 4ZHMU 1C1MA 2KCAA 3E3TA 2FS9A 2NU0E 5B6LA 3GCHB 2VIQA 1TNIA 1D9IA 2OTVA 1KLTA 1A0JA 2CJIA 1KXBA 3SHCH 2Z3CA 4VGCC 1AZZA 1CHOG 2Z6BD 3TNSA 4AC9A 3U8OH 4J1YA 2OBOA 1A7SA 1HLTH 3ELAH 1E37B 4K3JA 1KY9A 4RN6A 4FXGH 5F03A 3LJOA 1NRNH 2OD3B 2OC0A 3SQEE 2NU1E 1K1LA 1DXPA 2HWLB 1HAVA 1UTNA 2G8TA 4ZH8A 1Y5BT 4CRAA 1PYTD 2VH6A 4O9VA 1SQOA 2OLGA 3SW2B 1BOQA 1EP6A 1EOLA 1VJAU 1OWJA 1C4V2 2LELA 1AVGH 3CP7A 3R3GB 1SKYE 1ZPZA 3I77A 1P2MA 3DHKH 1O2WA 2VWNA 4FUHA 1GBAA 1QA7A 1C4U2 1HJ9A 2EI8A 3T2NA 2A0QB 4I8LA 2ZTYA 2QCYA 3SV6A 3SJOA 1FN6A 1ANEA 4ACBA 2JH6D 1SLWB 1BZXE 1NT1A 1AUJA 2BD9A 1LPKB 5B6OA 3OTPA 1YLDA 2RA0A 2BY8X 4IGDA 4IMZA 2QA9E 2OCVB 2ZF0H 4BAQB 2P59A 4X1PU 1GJCB 2GKVE 3U1IB 3UY9A 4ABFA 1HAOH 3R0FA 3MU1A 2FZZA 5A0BA 4B2CA 1BUIA 3SN8A 1A0HB 1RTLA 2BVSH 2OC7A 3PTNA 2XXLA 3SU1A 2FOHA 3MYWA 2ANKH 2R3YA 1XMNB 4MNXA 1TNHA 1AKSA 2V3MA 1UW7A 3GY3A 4B2AA 2QXJA 1XUHA 3PYHA 3A7YA 1GBFA 2ZDKA 3BIUH 4NSVA 1MAYA 1OXGA 2QF5A 3UWIA 1P2QA 3A7VA 5DGJA 1THRH 5LGOA 3GCTG 4OM9A 3A7ZA 1S85A 1QB6A 4X8UH 3HKJB 1DWBH 4CH2B 3WY8A 1VCPA 5E0JA 3VB4A 3EDXB 1ELDE 1EUFA 1H4WA 1T4VH 1IQNA 1D3QB 2EY4C 1XVMA 3MI4A 3BTDE 3MU5A 4ABEA 1AFQC 1EZQA 2OC1A 1W13U 3DSOA 2F43B 1ELCA 1TBRH 2W26A 1ZTLA 3GY8A 1WV7H 3LIWA 1FDPA 3A80A 2J97A 3H09A 4ABGA 3Q3YA 3SUDA 1C1NA 2BDIA 1J9CH 1O35A 1DXWA 1VITG 4AGKA 2UUJB 2P94A 1UHBB 4AFZA 1BMLA 1GG6C 4NWKA 1OWDA 2VIOA 3M3SA 3CS7A 4Q7YA 1QFKH 4BNRA 5EQRA 1MKXK 2W7SA 2PTNA 3MOCA 1NZQH 1GJ4H 4NA9H 1ZSLA 3RXAA 4CRFA 5A8YA 3T27A 2SNWA 2OXSA 4ISLA 3OTJE 1FI8A 2OUAA 1LO6A 1DUEA 5FPYA 2VGCB 3WWBA 3VFEA 4KTSA 2AHME 4GAWA 4U32A 4AYVB 2ODYB 3I29A 1MBQA 3Q77A 2FI5E 4ZHLU 3EE0B 1EAIA 1OP8A 2G4TA 1ZZZA 2G5NA 4MVNA 2VWMA 1CBWC 1DM4B 4YTAA 2PP6A 1MTVA 2SGDE 4RT0A 5ETXA 1TABE 4ZXYH 4LK4A 2BZ6H 2ZQ2A 1ZMJA 2PKAB 3FAOA 1GMDF 2ZCHP 3MU0A 4UFDH 1C5RA 3TJUA 1A1RA 1UCYH 1GI2A 2BM2A 4X6NA 1Z71A 1DOJA 2A4GA 4CHAB 1BRUP 1SQAA 5K7RA 4QT8C 1YWUA 3UNRA 1WSSH 3OYPA 2CXVA 1ACBE 2F9VA 4B75A 2AMQA 3RXOA 5EJLA 1HFDA 1O2JA 2OINA 2W6ID 2XC4A 1CVWH 1FAKH 1FUJA 2FI3E 1EATA 3RMNH 1EJAA 2ZIQH 2HGTH 3SV8A 4O3UA 4RSPA 1GMHG 3OU0A 1QBNA 4SGBE 1UMAH 3BV9B 1C5WB 1DX5M 1GL0E 1S0RA 2ALPA 2B5TB 3AW1A 1SHYA 1TOCB 3SNAA 2GV6A 1BIOA 3E6PH 2Q6FA 1O2HA 3IG6B 2A5AA 5CHBA 2AGIX 4X6OA 4CH8B 1EZSC 1Z8RA 1C5XB 3N99A 8LPRA 3DCLA 1Y3XA 2BLOA 4WVPE 1V6DA 5AFYH 2QAAA 1FMGA 1GHWH 1JMOH 6ESTA 3UR9A 2QY0B 1P06A 1EFRD 3EA7A 4INLA 1A3BH 4AFUA 2YMSB 4IN2A 5C5NA 1S6FA 3KF2A 4O03A 4O3TA 3QUMP 4YOGA 4LZ4B 1V2UT 1TALA 1QGFA 1XX9A 4OS2A 6CHAC 3U8RH 1O2YA 3LT3A 2M5TA 1C2GA 1P9UA 4IBLH 3UREA 3ZVEA 4ISHH 3P8FA 1MTNC 2VVCA 2B7DH 1OOKB 3ZZAA 3UPEA 2ZO3H 1CHOF 3T29A 2GDEH 1KDQA 4ABHA 5F6MA 4AOQA 5EW1H 4VGCB 1J15A 3FO8D 3OEED 4YT7H 2I6SA 4MQAA 5CHAC 1Z6JH 1A5HA 1HRTH 4KGAA 3ZZ4A 1PPEE 2BXUH 2QN5T 1QL9A 1C5OH 2BOHB 3F2GA 2V3HH 2WINI 2GP9B 9LPRA 3M5MA 5L2YH 1GVZA 5DO4H 1FN8A 1GWAA 5GCHF 2ZU1A 4DVAU 1CQQA 1DANH 1DSTA 1W3CA 4GLYA 3SUFA 3V7TA 3MNBA 5C1XA 1H1BA 3Q76A 1EP5A 1SGDE 2RCEA 1CT0E 4B74A 2BD7A 1BRBE 1HYLA 2L74A 1PQAA 1W11U 4YLQH 1ABJH 3JZ2B 2AIPA 2XBYA 1OWEA 4X1RU 1E34B 4WH8A 5F53A 1G2MA 3CS0A 2BDYA 1P03A 1TBQH 2C8XB 4Q80A 4UEHH 1FLEE 2A4QA 1UTMA 1AN1E 2BHGA 3GOVB 3E90B 3S9AA 3F0OA 2HVYB 2ZFPH 1WTHD 1OSSA 2F9PA 1S83A 2YMSD 2PV9B 1DPOA 2XRCA 5L30H 2SGAA 3UQVA 3UOUA 4X8SH 2ZA5A 3F2FA 3TK6A 1AU8A 2VVUA 1TFXA 4WY3A 5IK2D 4R0IA 1C5NH 1ZPBA 3SU2A 1YKTA 2R2WU 3NZIA 3GCTF 1MUEB 1TA2A 3KN2A 1MQ6A 2ZTZA 2PFEA 4H6TA 1GBMA 1KSNA 1JWTA 3FZDA 4B71A 4Q7ZA 4BXWA 1V2JT 4ISOA 4GPGA 1THSH 2Z3EA 5HGGA 4CBOA 4I8JA 3RXLA 1C5QA 2ZU4A 1GJBB 1K28D 1P57B 1CU1A 2BY5X 5JB8S 2BD2A 4AG2A 1AFQB 1O5CB 4I8GA 1YPGH 3MTYA 1NO9H 3AW0A 4Y7BA 4B73A 3M5NA 3SV9A 1C1SA 2EI7A 2Y5GA 1GJ9B 2ANYA 2XWBI 2BD4A 3BTGE 3KEEA 3TH2H 1YLNA 1SGIB 4DCDA 3SO3A 3V13A 2J38A 4FUJA 3V0XA 2AGGX 2ZPSA 2AGEX 3M7UA 3A8CA 4AZ2B 2H9EH 2J9NA 3M3VA 2YNAA 3ZVGA 1ZOMA 1B0FA 2FXRA 1KIGH 3RXEA 8GCHG 1LHEH 2JIZD 3PTBA 4ACAA 2OP9A 1GHXH 2K0QA 3ZV9A 2A1DB 5FBEA 1MTWA 4B76A 3UB0A 2FESH 4Q7XA 3EA8A 2FS8A 1C9TA 4I33A 4R8TB 1OKXA 3MH4A 1QNJA 2A2QH 1MKXH 5GXPA 1O3NA 1TGCA 5T6FA 4I7YH 3MO6A 1LVOA 5JPMH 2BLWA 5E2OA 1TMTH 1NTPA 3PO1C 1LPZB 2TRMA 1FPCH 1O5DH 3TITA 5EIYA 1TIOA 2G4UA 1T7CA 1O3KA 4MNWA 3GYLB 1AVWA 4ZAEA 1O2RA 4K2YA 3RXUA 2J98B 1CBWB 1YPEH 2EC9H 1B0EA 1W7GH 1XXFA 1GHAF 1ELFA 1WQSA 1P11E 3C27B 3SJ8A 1O3CA 1P3EA 1EB1H 1V2ST 1HAZB 1O2QA 2SGQE 1FONA 1O31A 1XUKA 7ESTE 1GDQA 3LJJA 3A82A 2TBSA 1Y8TA 4Q4LA 3AAUA 3P95A 1BJVA 1DE7H 4Y0YE 1PQ8A 2BY7X 1GI6A 1GI5A 1D6RA 3KNXA 5EXMA 2ZECA 5GPIB 3CNRA 3RC4A 1GMHF 1C1QA 2ESTE 2LPRA 4FUIA 3RXSA 1GJ5H 5DP8A 4KTCA 1C5SA 2PHBA 2JJ1D 2J4IA 3MFJA 1S6LA 4XBCA 1UTLM 5CDFE 1O2KA 3EA9A 4D9QA 3BEFB 5C0TA 3PV2A 3F0PA 4XDEA 1Z1JA 4D7GA 5HMAA 1AB9B 1O3PB 3H7TA 1SGPE 5HM2A 1LVYA 1ZMNA 2NWNA 4ZKOU 1ZMLA 4NIVA 1ARCA 4M7GA 1MZAA 1LCYA 3URCA 2F9BH 1K1IA 1NRSH 1QIXB 3OY6U 1LPGB 2QE7D 3MNXA 2VBCA 3F1SB 4INKA 5C2ZA 3D62A 1DT2A 4TSFD 2C8ZB 3VB3A 3SOSA 1EXFA 1RJXB 1GI3A 3KHVA 4RI0A 1SGFA 4HFPB 3A83A 1UO6A 3RXIA 4MPWA 1OYQA 3O8DA 2AH4X 3SZNA 4ASHA 2EEKA 1XUJA 1HAIH 1Y3VA 4NFEA 1MTUA 6CHAB 3T5FH 1IQIA 1W12U 3KCGH 1EX3A 1N6XA 1P8VC 1MTNB 1C5ZB 1O36A 3QTOH 1GI1A 1TX8A 4Z0KA 2LP6A 1BBRE 2CMYA 4AFSA 1E38B 4KELA 3SQHE 1TA6A 2GJGA 5L6NH 3UQOA 4YM9A 1BTPA 1P0SH 5CHAB 4WMDA 1SFQB 4NGAH 2XOKD 1IQJA 3BTFE 1GBBA 2ZPRA 3E0PB 5AFZH 2BDBA 2OQ5A 3F9HA 4NSYA 4X2VA 3QWCH 5DG6A 1NU9A 3UUZA 2FIRH 1GPZA 2BDCA 1TB6H 1ZJDA 1FX0B 1OYTH 3STJA 2WV9A 2VIVA 1ELAA 1EZUC 3MNCA 2IJD1 1EAWA 2BY6X 5T1VA 2KR7A 1C2IA 4DIHH 2UWOA 2ZFRH 1LKAA 1SHHB 1OWHA 2ZZUH 3M3TA 3UAIC 1SG8B 1SOTA 2PSXA 2THFB 4F49A 3DA9B 2Z3DA 4NG9H 4TY6A 4X6PA 5GCHG 2CF9H 2DE8A 2V3OH 2ZDMA 2G55A 3ATMA 4FU8A 1SL3A 4K8BA 9ESTA 3E91A 3OSYA 2ILNA 1KMHB 3RU4T 2RDLA 1PFXC 2BD5A 4K8YA 4MNYA 1YPKH 1OP0A 3HK3B 1GJDB 2PWXA 1O5FH 1L1NA 2AS9A 4WMEA 1TYNA 1FPHH 1HIAB 1DFPA 5TCAA 3ZIAD 4GCHG 1O3MA 1H8DH 1HNEE 2H9TH 4IW4E 1VCWA 1C2LA 1SGTA 1K1NA 3UIRA 4F55A 4X8TH 1C2JA 2ZFSA 3F6UH 1O3DA 5A0AE 5TJXA 2BDGA 4LOYH 1LQDB 4Y8ZA 4WJG2 2RFKC 4NA8A 2SGFE 1YCPK 4ZKSU 4CRCA 5C94A 2FX6A 3IWMA 4FETA 1NROH 4GUXA 1FQ3A 1D3DB 1UVSH 1VITH 3TH4H 5EQQA 1C5MD 3PM3A 3A81A 3MH5A 1DWDH 3BTQE 5FXLA 5EOKA 1TGSZ 2WPJS 1QBVH 3PROA 2ZFQH 2ANWA 1ELTA 6GCHF 1G2LA 1ZHMA 2RDEA 3VGCC 5JDUB 2ZKSA 2ZNKH 1SMFE 5HM9A 3MU4A 5DP9A 1LMWB 4I8KA 2XBWA 3PWBA 2M2AA 1DICA 1LHDH 4OGYA 3TIUA 4LZ1H 1HAYB 1AGJA 5C1YA 2SNVA 2GCTC 1O2UA 1HDTH 3LH3A 3D49H 1QQ4A 2Y5HA 4E06H 3TNTA 1HAVB 1O3FA 3RXHA 4FUBA 1O39A 1XKAC 2A4RA 1GJAB 3DD2H 1BTXA 2ZHWH 3M61U 5EQSA 1MQ5A 1V2KT 1LTOA 1O2TA 2WPKS 5HIZA 3QLPH 1W10U 1Q3XA 2QGRA 1MCTA 1QB9A 8GCHF 1SLVB 2R0KA 3KYGA 3TK5A 3F3BA 4BOHA 2XCFA 1C5VA 2VIDA 1HJAC 1V2MT 4ZUHA 1L2EA 2A4OA 1ZTKA 4GSOA 2QIQA 2O8LA 4JK5A 4UFFH 3O8BA 2AYWA 2O8WA 3SV2H 1G37A 1V2VT 2ZQ1A 4Z1MD 3PV5A 1ESAA 3RXMA 1UVTH 7LPRA 1PPFE 1QURH 4UFEH 4X1QU 4GHQA 3SHAH 3B9FH 2IN2A 5LH8A 2D1JA 2STAE 2HPQH 3PO1B 4GVUA 1O3JA 4D8NA 4ESTE 1W7XH 1K1MA 5C20A 3QK1A 4NZQA 2F9NA 4ABBA 3KQCA 1MD7A 1CA0C 2TIOA 1F0RA 1Z8GA 1QCPA 3F9FA 1U6QA 2Z9KA 3Q3XA 4U01A 1SBWA 1TE0A 3RUOA 1FNIA 3EAJA 2DE9A 5DP4A 3A7WA 4BTTB 2FOBA 5DKMA 2ZFTA 4A1VA 1DVAH 1AKSB 1TNGA 1MU8B 2A7CA 2BX4A 1INCA 4TT3D 3TGJE 1QL7A 1BB0B 4FUCA 3PWCA 3U8TH 2O8TA 3PLBA 2Q1JA 2UUFB 2PR3A 1GHAG 1PPGE 5DSFA 1NESE 1YPMH 3K6ZA 3P6ZB 1BBRK 2C3SA 4INHA 5E2PA 5EXLA 2NU2E 1AQ7A 1O3OA 1GVKB 1BTWA 4Y8XA 4AB8A 1MCVA 1O2SA 1UTOA 5GIBA 5HXFA 1GCTC 3M7TA 4TPIZ 3DSPA 3GICB 3WW7A 2P95A 3RC6A 3ZZ7A 2KCOA 3HK6B 2JDID 4Z6AH 1WXRA 1MAXA 2TPIZ 4ABAA 3B23B 1GBIA 3N7EA 2PTCE 2Y81A 4TWYA 5J4QA 2A45B 4X2WA 2CHAC 1KXAA 3N7DA 1AD8H 1LDTT 3SNCA 7KMEH 3SGAE 2AFQB 1FV9A 3GDSA 2XNDD 4Y11E 1GMCG 3S7KB 3UNQA 1E0FD 2CF8H 1W0YH 1IHTH 1LVMA 4NA7A 2OBQA 1BHXF 2JJ2D 1GGDC 1RD3B 3LPRA 1MD8A 3RU4E 2ZU3A 1O2OA 1B5GH 4O97A 4AN7A 1X7AC 4UD9H 3ITIA 3ZZBA 1G3BA 5E8EH 1O2VA 4NIWA 3HGNA 4HZHA 4DURA 1YBWA 2ZFFH 1VGCB 1IQEA 2UWPA 2VH0A 5C3NA 4J2YB 3PMHB 1BHXB 1SSXA 1ZGVA 3ZZ9A 2FI4E 2P3FH 1IQKA 1LKBA 3SJIA 2GX4A 5JBAS 1GBHA 2PUQH 4K60A 1AVXA 1UK2A 1XXDA 2Y7ZA 3RXQA 1MKWK 2QC2A 1EB2A 3ZVDA 5IDKA 4RKOB 2O8UA 3RXVA 2HRVA 4WF8A 3F68H 4OS4A 3RXDA 2FYRA 2ZHEH 1QJ6B 2C8YB 1NBME 4AYYB 1W0ZU 4BANB 1PPBH 1W14U 1L4DA 3RXBA 1HAHH 2YOLA 1UJ1A 2GT8A 1Z1IA 1O5BB 1QR3E 3D65E 2FOEA 3BG4C 1RXPA 4H4FA 1MBMA 2C93B 1TRMA 2ODQA 3P8OA 1D4PB 1TOMH 1UCYE 1P10A 1UTQA 2GV7A 2XC5A 2ZGBH 1A5GH 4ZCNA 1UTKA 1AIXH 1O33A 2RG3A 1PPZA 1H9HE 1P2JA 1GI7B 5TCCA 3V3MA 5H4IB 3ZVCA 1CHGA 1SFIA 2PGBB 2A32A 1V3XA 2HOBA 1S84A 2WPHS 2ZDAH 4FUEA 1EZXC 2BZAA 3GY5A 1XKBC 5KGOA 2FOAA 1Z8IB 1A3EH 1KXDA 1V2OT 1KTSB 1AUTC 5A09A 1C1WH 2J2UA 4X0WU 1VCQA 2A7HA 5JBCS 1NPMA 3E16B 4XD7D 1A2CH 1O3IA 4GCHF 4DT7B 5EJ1A 3V12A 3TU7H 4AG1A 3QO6A 1SGFG 1TGNA 1RTFB 1L4ZA 1O0DH 3ZZ5A 2ZG0H 1V2LT 5GNDA 1RFNA 1OP2A 1Y5AT 3ZZDA 2K8IA 3VB6A 1ZTJA 1W0KD 1DWCH 2G5VA 3SU6A 1TBZH 1EOJA 1EJMA 5FBIA 1OWIA 2ZI2H 1DUAA 3FP8E 1H8IH 5JBTA 1NN6A 3MO3A 1T8LA 4E7RG 1BMMH 1SGNE 5E0HA 4ABJA 1ZSKA 3RC5A 2H9HA 2XCNA 2P16A 4FVDA 1O38A 1HGTH 1E1QD 2GZ9A 2Q6DA 1F7ZA 1FY4A 5C67A 3JZ1B 4KTUA 3LU9B 1T4UH 1BRCE 1UK4A 2F9OA 2TGPZ 3QZQA 2QF4A 1KDQB 4Y8YA 1MMJN 4A1XA 2WPLS 3ODFA 3M5OA 3SI4H 2GCHF 3ZV8A 1IQHA 4P02A 2VIPA 6GCHG 2GCTB 3T62A 3UR6A 3P8NA 2WUBA 3BN9A 3E0NB 3T28A 3MH7A 4HI3A 3RM2H 4Y71A 1SGQE 1BMAA 1NU7B 1O3GA 1TWXB 3C1KA 1ZJKA 2H5DA 1P3CA 3GY2A 1QTFA 3DUXH 3P92A 2VWLA 1T31A 1AMHA 1WUNH 2BX3A 2HPPH 5ABWA 2KAIA 1ZGIA 4IC6A 4AX9H 1EPTA 1GHBG 3U69H 5AF9H 8KME2 4F48B 3LONA 1UTJA 3SU3A 2VJ1A 2BQ7B 2D8WA 4A92A 1BDAA 3PLKA 1GHYH 3SU5A 1E35B 1HJAB 1QA0A 1EQ9A 1TMBH 2BMGB 5FL7D 3OFND 2GMTC 1L0ZA 1TPAE 3KQDA 3SGBE 2ZU2A 2HLDD 1QRXA 4IMQA 1GG6B 4U2WA 5A2MH 1HAPH 3GCOA 4ABIA 4OS7A 1ZR0A 3TJVA 3NUMA 1OX1A 4RT1A 3LGVA 1LHFH 3SNDA 4OS6A 4U30A 1HBTH 1ZLRA 3PMBB 2F3CE 1JXPA 3MU8A 4CBNA 5EODA 1EAUA 1O3EA 1G3DA 1H8HD 4OS5A 1CA0B 4DJZB 2ODPA 2Q6GA 5FPTA 1PJPA 3A87A 5I25A 3SBKA 1YF4A 1DY8A 1QJ7B 3AVZA 1PQ5A 3ATWA 4KP0A 1DITH 1CGJE 4WXIA 1Z8JB 1MTSA 3GS9A 1O5GH 3BSQA 2SGPE 1E79D 2Y80A 4YOIA 5HYOA 1P9SA 4MPUA 1GI4A 1C5TA 4XBDA 1ANDA 3SV7A 2CGAA 2ALVA 5JB9S 4IS5A 1NFUA 1N8OC 1JIMA 2OQUA 4UE7H 3K2UA 1GBTA 5DP5A 1IQGA 2BQ6B 1ZHRA 3DFJA 1ANCA 2P8OC 1TAWA 2L6OA 5DP3A 3SNEA 3ZZ3A 2FMJA 1TLDA 1BBRH 1A5IA 1OWKA 5FX5A 1KLJH 1GCTB 3LGYA 1C1TA 3TH3H 1C2EA 4LXBH 2H5CA 1TRYA 2D26C 1RTKA 4HTCH 1CGHA 3A84A 4H6SB 3LKWA 1WOFA 2FOGA 2AEIH 1NRRH 1O30A 2Z9LA 1Y5UT 1O2MA 2CHAB 2WZQA 1ZSJA 2A5KA 1GMCF 1BTZA 2W3IA 1BCUH 1T8NA 2ANMH 1BTUA 3RLYH 3KGPA 3RLWH 1YLCA 3URDA 1UCYK 3U98H 4M9FA 1K21H 4NZLA 1GGDB 1J14A 1C2KA 4D7FA 1GVLA 1C1UH 1YCPM 4WMFA 3OX7U 3FP6E 1D3TB 2K1QA 3E1XB 4OGXA 1S82A 5CMXH 5BRRE 1EJNA 3UOPA 1O2XA 3ATIA 3DSGA 4OS1A 3BTTE 4Q63A 1A0LA 1ZRKA 2JH5D 4NIXA 3RXTA 1ID5H 1K9OE 1HV7A 3RMMH 1TNJA 2KM0A 5DPAA 5F8ZA 5LPRA 1QY6A 2VWOA 3RXPA 4BTUB 4JK6A 2CK3D 3KIDU 5ESBA 3SUEA 1V2PT 2FOFA 3ZZ8A 1N1LA 4DG4A 5E0GA 1GJ7B 4JYTA 3SGQE 1T8MA 1Y59T 2QF0A 2KZ4A 3S9BA 2BDAA 3MH6A 4E05H 1ZRBA 4XE4A 1TGBA 1O2LA 1ORFA 3E8LA 1BT7A 4AGJA 3SNBA 1DLEA 3QDZB 1C1OA 2HLCA 2GT7A 3BG4B 2BDHA 5FCRA 2WPDD 1EASA 3I78A 1LHGH 1P09A 4A5TS 1FY8E 5DK1A 1KLIH 1TQ7B 2IJOB 1O5AB 1UTPA 3MO9A 2BXTH 2LNCA 3QZRA 4XSKU 2PKSC 2ZU5A 2B0FA 1JRTA 1F92A 5FHTA 3SUGA 1J8AA 2G81E 3RXGA 4F4OC 1W2KH 2FTMA 3FP7E 1VKYA 3L33A 2BVXH 1IQFA 4MLFB 3TVJB 4FOUC 3U1JB 2ZHQH 2A7JA 4WH6A 1LVBA 1YPLH 3RM0H 2GTBA 1DY9A 1O2GH 2F91A 1GI9B 5HIYA 4XFQA 4SGAE 4YO9A 2HNTF 2W5EA 4AORA 2WYJA 4JZ1A 1M9UA 5F8TA 3RU4D 1NS3A 4IN1A 3ZZ6A 1XUFA 3UWJH 3LGUA 2BQWB 4FVBA 1AWFH 5JBBS 4MPVA 1VJ9U 1H9IE 2WV4A 3MMGA 4XOJA 1NFXA 4X2XA 4MG3A 1F5LA 3PB1E 1IHSH 2XYAA 1FY3A 5AVDA 1FZZA 1KYNA 2TGTA 2WPMS 4HG6A 4X2YA 1SQTA 4CR5A 4K1SA 2FP7B 5EPYA 1XUGA 2J92A 2GDDA 3UTUH 1G32B 1HB0B 1WDIA 3P8GA 1KXCA 4WXVA 1UHBA 3M7QA 4Y6DA 3BTKE 2F83A 5LPEA 3N7OA 4JYUH 3L6PA 4TPYA 1WYKA 3GY6A 4IC5A 3SU0A 1SLUB 4BAKB 4BTIB 2XWAA 2WV5A 3BEUA 3F9EA 1YPJH 2PGQB 3RDZA 1XVOA 1NY22 2XNIA 2WPIS 3OAAD 4Y10E 2OK5A 1NBMD 3RMOH 1LQEA 2IPHA 1TMUH 1A46H 1SC8U 4XBBA 2BOKA 3HGPA 1SVPA 1WQVH 3MNSA 2JETC 1D3PB 3U28C 3VXEH 2J95A 4BAHB 3NK8A 1KXEA 1J17T 2YNBA 4JMYA 4KKDA 5C1UA 4CRGA 1GBLA 1LHCH 2GCHG 2GZ7A 2PW8H 3MWIU 1S81A 1GHBF 4ZKNU 2G52A 1Q31A 2XBXA 1V2RT 3B8JA 5HKKD 4YT6H 2B9LA 2CV3A 3SI3H 3RXJA 2PKAA 4AFQA 1TQ0B 3NRLA 1O3LA 3LC5A 1AZ8A 1AI8H 2C90B 3PRBA 4NIYA 1SQRA 1T32A 4PROA 3TGIE 2Y6TA 2FYQA 1PQ7A 1QZ8A 2F4LA 3LGIA 1DS2E 1SLXB 3O8RA 3VB5A 1UVUH 1C5UA 1C4Y2 1P2IA 2GMTB 5FCKA 5JYIA 1EAXA 5K0HA 3QTVH 1C5LH 2BD8A 4I86A 4MDSA 1L1GA 2AIQA 1FJSA 5FX6A 1HXEH 1HCGA 2V0BA 1Z7KA 1JRSA 2ZGXH 1DSUA 2A2XH 1O2IA 2C8WB 1WU1A 3BIVH 2ZP0H 4RKJB 1SI5H 1YGCH 1DDJA 1O2NA 3LC3A 4JZEH 1S6HA 5GWZA 4MPXA 5FAHA 3OEHD 3HATH 3ZYEA 2Y82A 4B1TA 3EYDA 3A89A 3AK5A 2KX4A 3PLPA 1GI0A 3P70B 3TPIZ 1NM6A 1G3EA 1G9IE 3UNSA 2FOMB 4YXWD 1C2HA 1N8OB 2Z9GA 1HUTH 4X6MA 1QRWA 3BTEE 1FIWA 3HKIB 2H1UA 1VR1H 3FVFB 1ELGA 4JZIA 1BITA 1AHTH 1L1JA 1ZHPA 1MH0A 1P04A 1TGTA 3RXKA 2P8OB 1HJ8A 1TNKA 4XRNA 3BTWE 1YP9A 3ZVAA 2KCYA 1TPOA 1GCDA 1ZPCA 3FANA 3A85A 1QB1A 2J34A 2J94A 2ZGCA 4ABDA 2FOCA 1P01A 3NPSA 2ZC9H 3D23A 4P00A 4YESB 1Q2WA 1K22H 3KQBA 5C5OA 4ZKRU 1EKBB 1F2SE 1GBJA 1ABIH 1NRPH 1S0QA 1SB1H 1O5EH 1GL1A 1A4WH 2RA3A 1ETSH 1QRZA 1RIWC 4UDWH 2XW9A 1OPHB 4ASUD 3EQ0H 2Z94A 4NCYA 1GDUA 3FN8A 5EW2H 1EPTC 1C2MA 1TRNA 1V2WT 1ESTA 4I32A 4ISNA 2BB4A 3ATKA 4ISIH 1Z6EA 3BTHE 2BD3A 2GD4B 2NU4E 3H7OA 2ZGHA 1E1RD 1PYTC 3K6YA 3M35A 3QX5H 4JYVH 4NWLA 1C2FA 1P2OA 2P3TB 1YPHE 3LH1A 3LOXA 1BTYA 5C0UA 1FY1A 2G51A 1GBCA 1YPHC 1FY5A 1SPJA 2FM2A 1AB9C 1AY6H 3RMLH 4K5ZA 1MZDA 1BTHH 1GDNA 1BMFD 4FUGA 2UUYA 4TY7A 1WTGH 1OS8A 2O8MA 2ZHDA 3T26A 1P2KA 2P93A 3GDVA 5G4BA 1CGIE 3LDXH 1RRKA 1O34A 1ELBA 1Y3YA 4ZMAH 3PV4A 5AHGH 3DT0H 1ESBA 2ZDNA 4BXSA 3ODDA 7GCHG 1WAYB 4UFGH 3OE7D 3K9XB 2XBVA 2ZDVH 3VG8A 3FFGA 4HGCA 3ZVFA 1GBKA 2KFWA 3PMAB 1GI8B 3EE7A 3AASA 1K1OA 2IOTA 5EXNA 1YC0A 1W8BH 1HAGE 2PKSB 1V2QT 1IQLA 3NWUA 2QV1A 2R2MB 2V35A 4BAOB 1P02A 2FWWA 2WHXA 3ATLA 3NKKA 1YY3A 4Q2KA 3P17H 5LPFA 1Y3WA 3GCHC 1K0HA 1FAXA 4YZUA 1A61H 2WUCA 1JIRA 2R3UA 2D2DA 3A8DA 2PSYA 2V6NA 5T3HA 5I46H 1ELVA 1XUIA 2FEQH 1KTTB 2W6JD 2ZGJA 4B6EA 2BY9X 5GJ4B 5L2ZH 1TPSA 1SOZA 2XC0A 5SGAE 2BVRH 2PUXB 3FZZA 3IITA 1O2PA 2EQNA 1B7XB 1V2NT 3GY4A 2A5IA 4X8VH 1F0SA 3SZEA 1D6WA 1SGEE 2W7UA 2IPQX 2Y7XA 3TLOA 3F2HA 2V7QD 3G01A 1ETRH 1COWD 2BTCE 4DOQA 1GJ6A 3RXCA 2VIWA 3RP2A 1GJ8B 3QGJA 3VEQB 2ZCKP 3BF6H 4ZROA 1F5KU 1RGQA 1UK3A 1YCPH 5DP7A 5KECA 2HNTE 3M36A 5DJ7A 4FU9A 3GY7A 1TX6A 5T6DA 5CE1A 1RS0A 2R0LA 4YLUA 2HNTC 3VB7A 4A1TA 1UVPA 1FIZA 5BPEA 2A31A 3Q00A 1QHRB 2AERH 3GISB 3SORA 1PPHE 1TX7A 2Z9IA 3MHWU 1CA8B 4MNVA 3VGCB 3L3TA 1UVOA 2OC8A 1FXYA 1K1JA 2JETB 1TNLA 1CO7E 5EJZA 1GHZA 1AE5A 1C2DA 2VB0A 1AFEH 3KYFA 2HALA 1C1PA 3MQKC 3F9GA 1G3CA 2J98A 4JZFH 4FUFA 4TWWA 4Y79A 1AWHB 1DLKB 1QL8A 1ARBA 1PPCE 2ZEBA 2H6MA 3FKSD 3GDUA 1ANBA 1ZYOA 1GBDA 2QXHA 2VNTA 1N6YA 3W94A 5F8XA 3PMJA 2VVVA 1AE8H 2PLXA 2JKHA 1MU6B 2ZDLA 5FPSA 3DFLA 3CENA 5A0CA 3BG8A 5A8XA 1IQMA 2FO9A 3LGWA 1YYY1 1OHHD 1ELEE 2UWLA 1TPPA 4THNH 4TYDA 3H5CB 2EI6A 1O3AA 3Q3KA 2VINA 5DP6A 3QGNB 1ETTH 4K69A 3TJOA 2ZPQA 1KXFA 4K1TA 3BTME 1BQYA 3GCNA 3ZYDA 2STBE 1O3HA 1SR5C 3S0NA 4BAMB 1H8ED 1VITF 3O8CA 1F0UA 1T8OA 2BYAX 2ZCLP 2H2ZA 4E7NA 2ZWLH 1YM0A 4JCNA 2Z9JA 3PRDA 3KQ5A 2NU3E 3SJ9A 1CE5A 4FU7A 2QXGA 3U9AH 5KEDA 3ZVBA 3TJNA 4UONA 1BA8B 3S69A 4DIIH 1W0JD 1VZQH 3OY5U 1MABB 1QQUA 1P12E 2ASUB 2AMDA 1O37A 3BEIB 3A8AA 4WWYA 4I8HA 2QXIA 2P3UB 3QN7A 1WCZA 1NFWA 1SGCA 4ZXXH 4GHTA 2DUCA 2QF3A 3A7TA 5C17A 2SGEE 1O3BA 2FPZA 1C9PA 1F0TA 4B6FA 5EGMA 3M5LA 1JBUH 4NFFA 1JOUB 3ESTA 2FDAA 5GDSH 2GZ8A 2ZHFH 3GYMA 2VGCC 3S9CA 1C1RA 1IOEA 2BLVA 4I31A 3WWFA 1BJUA 1CT4E 4CRDA 2FX4A 2VU8E 3HPTB 4B2BA 2TGDA 1DWEH 3TGKE 1C5YB 5T6GA 3KL6A 1BMNH 1K2I1 2J5UA 3RXFA 1XM1A 3SJKA 4X1NU 1RIWB 6LPRA 2KCPA 2JH0D 2WYGA 4JZDH 2QYIA 2KAIB 2O9QA 5A8ZA 2HVXA 1EPTB 4AB9A 3TK9A 2FLRH 3VPKA 1G36A 5DN6D 4D9RA 3T25A 2C4FH 1V2TT 1O32A 1H9LB 4CRBA 1GMDG 2SFAA 1THPB 3A88A 3M37A 1QJ1B 1O2ZA 4K1EA 4CHAC 2FODA 1J16A 3ENSB 1F5RA 2Y5FA 5PTPA 3NXPA 3EGKH 4Y0ZE 2Z7FE 1QBOA 4CR9A
chains in the Genus database with same CATH topology
3EE7A 2J98A 5HIYA 1UW7A 1QZ8A 2J97A 5C94A 2J98B 5HIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE7 A;  2J98 A;  5HIY A;  1UW7 A;  1QZ8 A;  2J97 A;  5C94 A;  2J98 B;  5HIZ A; 
#chains in the Genus database with same CATH topology
 1NC6 A;  3STI A;  2GVF A;  1CT2 E;  3UFA A;  2ULL A;  1C5P A;  5EPN A;  3SYJ A;  2FTL E;  1NFY A;  3A8B A;  2AMP A;  4A7I B;  1P05 A;  2WSS D;  3K65 B;  1HAX B;  4DY7 B;  5EU8 A;  3S7H B;  3LGT A;  4ZHA A;  2W3K A;  3NCL A;  1BRA A;  4H42 U;  3A7X A;  1C1V H;  3FOA A;  1HIA A;  2F9U A;  1NRQ H;  7GCH F;  1P2N A;  4YOJ A;  1MKW H;  2G00 A;  2TGA A;  3A86 A;  2CN0 H;  2XTT B;  3RXR A;  4DGJ A;  4DW2 U;  1CSO E;  5EG4 A;  1HPG A;  1SGY E;  4Y7A A;  2I6Q A;  1TON A;  2FLB H;  3KQE A;  1G30 B;  4DT4 A;  1SGR E;  3SU4 A;  4X1S U;  1VGC C;  5EST E;  4MTB A;  3W1E A;  2R9P A;  1HXF H;  5J4S A;  3ZZC A;  4A6L A;  1E36 B;  1AO5 A;  3W95 A;  1WBG B;  2B8O H;  3VXF H;  2YMS C;  4CRE A;  1GBE A;  1GHV H;  5IYT A;  2BLQ A;  1K1P A;  3AAV A;  4FUD A;  1S5S A;  1Y3U A;  2UUK B;  2GGV B;  4Y76 A;  1IAU A;  2EA3 A;  2ZTX A;  4D76 A;  8EST E;  4ZHM U;  1C1M A;  2KCA A;  3E3T A;  2FS9 A;  2NU0 E;  5B6L A;  3GCH B;  2VIQ A;  1TNI A;  1D9I A;  2OTV A;  1KLT A;  1A0J A;  2CJI A;  1KXB A;  3SHC H;  2Z3C A;  4VGC C;  1AZZ A;  1CHO G;  2Z6B D;  3TNS A;  4AC9 A;  3U8O H;  4J1Y A;  2OBO A;  1A7S A;  1HLT H;  3ELA H;  1E37 B;  4K3J A;  1KY9 A;  4RN6 A;  4FXG H;  5F03 A;  3LJO A;  1NRN H;  2OD3 B;  2OC0 A;  3SQE E;  2NU1 E;  1K1L A;  1DXP A;  2HWL B;  1HAV A;  1UTN A;  2G8T A;  4ZH8 A;  1Y5B T;  4CRA A;  1PYT D;  2VH6 A;  4O9V A;  1SQO A;  2OLG A;  3SW2 B;  1BOQ A;  1EP6 A;  1EOL A;  1VJA U;  1OWJ A;  1C4V 2;  2LEL A;  1AVG H;  3CP7 A;  3R3G B;  1SKY E;  1ZPZ A;  3I77 A;  1P2M A;  3DHK H;  1O2W A;  2VWN A;  4FUH A;  1GBA A;  1QA7 A;  1C4U 2;  1HJ9 A;  2EI8 A;  3T2N A;  2A0Q B;  4I8L A;  2ZTY A;  2QCY A;  3SV6 A;  3SJO A;  1FN6 A;  1ANE A;  4ACB A;  2JH6 D;  1SLW B;  1BZX E;  1NT1 A;  1AUJ A;  2BD9 A;  1LPK B;  5B6O A;  3OTP A;  1YLD A;  2RA0 A;  2BY8 X;  4IGD A;  4IMZ A;  2QA9 E;  2OCV B;  2ZF0 H;  4BAQ B;  2P59 A;  4X1P U;  1GJC B;  2GKV E;  3U1I B;  3UY9 A;  4ABF A;  1HAO H;  3R0F A;  3MU1 A;  2FZZ A;  5A0B A;  4B2C A;  1BUI A;  3SN8 A;  1A0H B;  1RTL A;  2BVS H;  2OC7 A;  3PTN A;  2XXL A;  3SU1 A;  2FOH A;  3MYW A;  2ANK H;  2R3Y A;  1XMN B;  4MNX A;  1TNH A;  1AKS A;  2V3M A;  1UW7 A;  3GY3 A;  4B2A A;  2QXJ A;  1XUH A;  3PYH A;  3A7Y A;  1GBF A;  2ZDK A;  3BIU H;  4NSV A;  1MAY A;  1OXG A;  2QF5 A;  3UWI A;  1P2Q A;  3A7V A;  5DGJ A;  1THR H;  5LGO A;  3GCT G;  4OM9 A;  3A7Z A;  1S85 A;  1QB6 A;  4X8U H;  3HKJ B;  1DWB H;  4CH2 B;  3WY8 A;  1VCP A;  5E0J A;  3VB4 A;  3EDX B;  1ELD E;  1EUF A;  1H4W A;  1T4V H;  1IQN A;  1D3Q B;  2EY4 C;  1XVM A;  3MI4 A;  3BTD E;  3MU5 A;  4ABE A;  1AFQ C;  1EZQ A;  2OC1 A;  1W13 U;  3DSO A;  2F43 B;  1ELC A;  1TBR H;  2W26 A;  1ZTL A;  3GY8 A;  1WV7 H;  3LIW A;  1FDP A;  3A80 A;  2J97 A;  3H09 A;  4ABG A;  3Q3Y A;  3SUD A;  1C1N A;  2BDI A;  1J9C H;  1O35 A;  1DXW A;  1VIT G;  4AGK A;  2UUJ B;  2P94 A;  1UHB B;  4AFZ A;  1BML A;  1GG6 C;  4NWK A;  1OWD A;  2VIO A;  3M3S A;  3CS7 A;  4Q7Y A;  1QFK H;  4BNR A;  5EQR A;  1MKX K;  2W7S A;  2PTN A;  3MOC A;  1NZQ H;  1GJ4 H;  4NA9 H;  1ZSL A;  3RXA A;  4CRF A;  5A8Y A;  3T27 A;  2SNW A;  2OXS A;  4ISL A;  3OTJ E;  1FI8 A;  2OUA A;  1LO6 A;  1DUE A;  5FPY A;  2VGC B;  3WWB A;  3VFE A;  4KTS A;  2AHM E;  4GAW A;  4U32 A;  4AYV B;  2ODY B;  3I29 A;  1MBQ A;  3Q77 A;  2FI5 E;  4ZHL U;  3EE0 B;  1EAI A;  1OP8 A;  2G4T A;  1ZZZ A;  2G5N A;  4MVN A;  2VWM A;  1CBW C;  1DM4 B;  4YTA A;  2PP6 A;  1MTV A;  2SGD E;  4RT0 A;  5ETX A;  1TAB E;  4ZXY H;  4LK4 A;  2BZ6 H;  2ZQ2 A;  1ZMJ A;  2PKA B;  3FAO A;  1GMD F;  2ZCH P;  3MU0 A;  4UFD H;  1C5R A;  3TJU A;  1A1R A;  1UCY H;  1GI2 A;  2BM2 A;  4X6N A;  1Z71 A;  1DOJ A;  2A4G A;  4CHA B;  1BRU P;  1SQA A;  5K7R A;  4QT8 C;  1YWU A;  3UNR A;  1WSS H;  3OYP A;  2CXV A;  1ACB E;  2F9V A;  4B75 A;  2AMQ A;  3RXO A;  5EJL A;  1HFD A;  1O2J A;  2OIN A;  2W6I D;  2XC4 A;  1CVW H;  1FAK H;  1FUJ A;  2FI3 E;  1EAT A;  3RMN H;  1EJA A;  2ZIQ H;  2HGT H;  3SV8 A;  4O3U A;  4RSP A;  1GMH G;  3OU0 A;  1QBN A;  4SGB E;  1UMA H;  3BV9 B;  1C5W B;  1DX5 M;  1GL0 E;  1S0R A;  2ALP A;  2B5T B;  3AW1 A;  1SHY A;  1TOC B;  3SNA A;  2GV6 A;  1BIO A;  3E6P H;  2Q6F A;  1O2H A;  3IG6 B;  2A5A A;  5CHB A;  2AGI X;  4X6O A;  4CH8 B;  1EZS C;  1Z8R A;  1C5X B;  3N99 A;  8LPR A;  3DCL A;  1Y3X A;  2BLO A;  4WVP E;  1V6D A;  5AFY H;  2QAA A;  1FMG A;  1GHW H;  1JMO H;  6EST A;  3UR9 A;  2QY0 B;  1P06 A;  1EFR D;  3EA7 A;  4INL A;  1A3B H;  4AFU A;  2YMS B;  4IN2 A;  5C5N A;  1S6F A;  3KF2 A;  4O03 A;  4O3T A;  3QUM P;  4YOG A;  4LZ4 B;  1V2U T;  1TAL A;  1QGF A;  1XX9 A;  4OS2 A;  6CHA C;  3U8R H;  1O2Y A;  3LT3 A;  2M5T A;  1C2G A;  1P9U A;  4IBL H;  3URE A;  3ZVE A;  4ISH H;  3P8F A;  1MTN C;  2VVC A;  2B7D H;  1OOK B;  3ZZA A;  3UPE A;  2ZO3 H;  1CHO F;  3T29 A;  2GDE H;  1KDQ A;  4ABH A;  5F6M A;  4AOQ A;  5EW1 H;  4VGC B;  1J15 A;  3FO8 D;  3OEE D;  4YT7 H;  2I6S A;  4MQA A;  5CHA C;  1Z6J H;  1A5H A;  1HRT H;  4KGA A;  3ZZ4 A;  1PPE E;  2BXU H;  2QN5 T;  1QL9 A;  1C5O H;  2BOH B;  3F2G A;  2V3H H;  2WIN I;  2GP9 B;  9LPR A;  3M5M A;  5L2Y H;  1GVZ A;  5DO4 H;  1FN8 A;  1GWA A;  5GCH F;  2ZU1 A;  4DVA U;  1CQQ A;  1DAN H;  1DST A;  1W3C A;  4GLY A;  3SUF A;  3V7T A;  3MNB A;  5C1X A;  1H1B A;  3Q76 A;  1EP5 A;  1SGD E;  2RCE A;  1CT0 E;  4B74 A;  2BD7 A;  1BRB E;  1HYL A;  2L74 A;  1PQA A;  1W11 U;  4YLQ H;  1ABJ H;  3JZ2 B;  2AIP A;  2XBY A;  1OWE A;  4X1R U;  1E34 B;  4WH8 A;  5F53 A;  1G2M A;  3CS0 A;  2BDY A;  1P03 A;  1TBQ H;  2C8X B;  4Q80 A;  4UEH H;  1FLE E;  2A4Q A;  1UTM A;  1AN1 E;  2BHG A;  3GOV B;  3E90 B;  3S9A A;  3F0O A;  2HVY B;  2ZFP H;  1WTH D;  1OSS A;  2F9P A;  1S83 A;  2YMS D;  2PV9 B;  1DPO A;  2XRC A;  5L30 H;  2SGA A;  3UQV A;  3UOU A;  4X8S H;  2ZA5 A;  3F2F A;  3TK6 A;  1AU8 A;  2VVU A;  1TFX A;  4WY3 A;  5IK2 D;  4R0I A;  1C5N H;  1ZPB A;  3SU2 A;  1YKT A;  2R2W U;  3NZI A;  3GCT F;  1MUE B;  1TA2 A;  3KN2 A;  1MQ6 A;  2ZTZ A;  2PFE A;  4H6T A;  1GBM A;  1KSN A;  1JWT A;  3FZD A;  4B71 A;  4Q7Z A;  4BXW A;  1V2J T;  4ISO A;  4GPG A;  1THS H;  2Z3E A;  5HGG A;  4CBO A;  4I8J A;  3RXL A;  1C5Q A;  2ZU4 A;  1GJB B;  1K28 D;  1P57 B;  1CU1 A;  2BY5 X;  5JB8 S;  2BD2 A;  4AG2 A;  1AFQ B;  1O5C B;  4I8G A;  1YPG H;  3MTY A;  1NO9 H;  3AW0 A;  4Y7B A;  4B73 A;  3M5N A;  3SV9 A;  1C1S A;  2EI7 A;  2Y5G A;  1GJ9 B;  2ANY A;  2XWB I;  2BD4 A;  3BTG E;  3KEE A;  3TH2 H;  1YLN A;  1SGI B;  4DCD A;  3SO3 A;  3V13 A;  2J38 A;  4FUJ A;  3V0X A;  2AGG X;  2ZPS A;  2AGE X;  3M7U A;  3A8C A;  4AZ2 B;  2H9E H;  2J9N A;  3M3V A;  2YNA A;  3ZVG A;  1ZOM A;  1B0F A;  2FXR A;  1KIG H;  3RXE A;  8GCH G;  1LHE H;  2JIZ D;  3PTB A;  4ACA A;  2OP9 A;  1GHX H;  2K0Q A;  3ZV9 A;  2A1D B;  5FBE A;  1MTW A;  4B76 A;  3UB0 A;  2FES H;  4Q7X A;  3EA8 A;  2FS8 A;  1C9T A;  4I33 A;  4R8T B;  1OKX A;  3MH4 A;  1QNJ A;  2A2Q H;  1MKX H;  5GXP A;  1O3N A;  1TGC A;  5T6F A;  4I7Y H;  3MO6 A;  1LVO A;  5JPM H;  2BLW A;  5E2O A;  1TMT H;  1NTP A;  3PO1 C;  1LPZ B;  2TRM A;  1FPC H;  1O5D H;  3TIT A;  5EIY A;  1TIO A;  2G4U A;  1T7C A;  1O3K A;  4MNW A;  3GYL B;  1AVW A;  4ZAE A;  1O2R A;  4K2Y A;  3RXU A;  2J98 B;  1CBW B;  1YPE H;  2EC9 H;  1B0E A;  1W7G H;  1XXF A;  1GHA F;  1ELF A;  1WQS A;  1P11 E;  3C27 B;  3SJ8 A;  1O3C A;  1P3E A;  1EB1 H;  1V2S T;  1HAZ B;  1O2Q A;  2SGQ E;  1FON A;  1O31 A;  1XUK A;  7EST E;  1GDQ A;  3LJJ A;  3A82 A;  2TBS A;  1Y8T A;  4Q4L A;  3AAU A;  3P95 A;  1BJV A;  1DE7 H;  4Y0Y E;  1PQ8 A;  2BY7 X;  1GI6 A;  1GI5 A;  1D6R A;  3KNX A;  5EXM A;  2ZEC A;  5GPI B;  3CNR A;  3RC4 A;  1GMH F;  1C1Q A;  2EST E;  2LPR A;  4FUI A;  3RXS A;  1GJ5 H;  5DP8 A;  4KTC A;  1C5S A;  2PHB A;  2JJ1 D;  2J4I A;  3MFJ A;  1S6L A;  4XBC A;  1UTL M;  5CDF E;  1O2K A;  3EA9 A;  4D9Q A;  3BEF B;  5C0T A;  3PV2 A;  3F0P A;  4XDE A;  1Z1J A;  4D7G A;  5HMA A;  1AB9 B;  1O3P B;  3H7T A;  1SGP E;  5HM2 A;  1LVY A;  1ZMN A;  2NWN A;  4ZKO U;  1ZML A;  4NIV A;  1ARC A;  4M7G A;  1MZA A;  1LCY A;  3URC A;  2F9B H;  1K1I A;  1NRS H;  1QIX B;  3OY6 U;  1LPG B;  2QE7 D;  3MNX A;  2VBC A;  3F1S B;  4INK A;  5C2Z A;  3D62 A;  1DT2 A;  4TSF D;  2C8Z B;  3VB3 A;  3SOS A;  1EXF A;  1RJX B;  1GI3 A;  3KHV A;  4RI0 A;  1SGF A;  4HFP B;  3A83 A;  1UO6 A;  3RXI A;  4MPW A;  1OYQ A;  3O8D A;  2AH4 X;  3SZN A;  4ASH A;  2EEK A;  1XUJ A;  1HAI H;  1Y3V A;  4NFE A;  1MTU A;  6CHA B;  3T5F H;  1IQI A;  1W12 U;  3KCG H;  1EX3 A;  1N6X A;  1P8V C;  1MTN B;  1C5Z B;  1O36 A;  3QTO H;  1GI1 A;  1TX8 A;  4Z0K A;  2LP6 A;  1BBR E;  2CMY A;  4AFS A;  1E38 B;  4KEL A;  3SQH E;  1TA6 A;  2GJG A;  5L6N H;  3UQO A;  4YM9 A;  1BTP A;  1P0S H;  5CHA B;  4WMD A;  1SFQ B;  4NGA H;  2XOK D;  1IQJ A;  3BTF E;  1GBB A;  2ZPR A;  3E0P B;  5AFZ H;  2BDB A;  2OQ5 A;  3F9H A;  4NSY A;  4X2V A;  3QWC H;  5DG6 A;  1NU9 A;  3UUZ A;  2FIR H;  1GPZ A;  2BDC A;  1TB6 H;  1ZJD A;  1FX0 B;  1OYT H;  3STJ A;  2WV9 A;  2VIV A;  1ELA A;  1EZU C;  3MNC A;  2IJD 1;  1EAW A;  2BY6 X;  5T1V A;  2KR7 A;  1C2I A;  4DIH H;  2UWO A;  2ZFR H;  1LKA A;  1SHH B;  1OWH A;  2ZZU H;  3M3T A;  3UAI C;  1SG8 B;  1SOT A;  2PSX A;  2THF B;  4F49 A;  3DA9 B;  2Z3D A;  4NG9 H;  4TY6 A;  4X6P A;  5GCH G;  2CF9 H;  2DE8 A;  2V3O H;  2ZDM A;  2G55 A;  3ATM A;  4FU8 A;  1SL3 A;  4K8B A;  9EST A;  3E91 A;  3OSY A;  2ILN A;  1KMH B;  3RU4 T;  2RDL A;  1PFX C;  2BD5 A;  4K8Y A;  4MNY A;  1YPK H;  1OP0 A;  3HK3 B;  1GJD B;  2PWX A;  1O5F H;  1L1N A;  2AS9 A;  4WME A;  1TYN A;  1FPH H;  1HIA B;  1DFP A;  5TCA A;  3ZIA D;  4GCH G;  1O3M A;  1H8D H;  1HNE E;  2H9T H;  4IW4 E;  1VCW A;  1C2L A;  1SGT A;  1K1N A;  3UIR A;  4F55 A;  4X8T H;  1C2J A;  2ZFS A;  3F6U H;  1O3D A;  5A0A E;  5TJX A;  2BDG A;  4LOY H;  1LQD B;  4Y8Z A;  4WJG 2;  2RFK C;  4NA8 A;  2SGF E;  1YCP K;  4ZKS U;  4CRC A;  5C94 A;  2FX6 A;  3IWM A;  4FET A;  1NRO H;  4GUX A;  1FQ3 A;  1D3D B;  1UVS H;  1VIT H;  3TH4 H;  5EQQ A;  1C5M D;  3PM3 A;  3A81 A;  3MH5 A;  1DWD H;  3BTQ E;  5FXL A;  5EOK A;  1TGS Z;  2WPJ S;  1QBV H;  3PRO A;  2ZFQ H;  2ANW A;  1ELT A;  6GCH F;  1G2L A;  1ZHM A;  2RDE A;  3VGC C;  5JDU B;  2ZKS A;  2ZNK H;  1SMF E;  5HM9 A;  3MU4 A;  5DP9 A;  1LMW B;  4I8K A;  2XBW A;  3PWB A;  2M2A A;  1DIC A;  1LHD H;  4OGY A;  3TIU A;  4LZ1 H;  1HAY B;  1AGJ A;  5C1Y A;  2SNV A;  2GCT C;  1O2U A;  1HDT H;  3LH3 A;  3D49 H;  1QQ4 A;  2Y5H A;  4E06 H;  3TNT A;  1HAV B;  1O3F A;  3RXH A;  4FUB A;  1O39 A;  1XKA C;  2A4R A;  1GJA B;  3DD2 H;  1BTX A;  2ZHW H;  3M61 U;  5EQS A;  1MQ5 A;  1V2K T;  1LTO A;  1O2T A;  2WPK S;  5HIZ A;  3QLP H;  1W10 U;  1Q3X A;  2QGR A;  1MCT A;  1QB9 A;  8GCH F;  1SLV B;  2R0K A;  3KYG A;  3TK5 A;  3F3B A;  4BOH A;  2XCF A;  1C5V A;  2VID A;  1HJA C;  1V2M T;  4ZUH A;  1L2E A;  2A4O A;  1ZTK A;  4GSO A;  2QIQ A;  2O8L A;  4JK5 A;  4UFF H;  3O8B A;  2AYW A;  2O8W A;  3SV2 H;  1G37 A;  1V2V T;  2ZQ1 A;  4Z1M D;  3PV5 A;  1ESA A;  3RXM A;  1UVT H;  7LPR A;  1PPF E;  1QUR H;  4UFE H;  4X1Q U;  4GHQ A;  3SHA H;  3B9F H;  2IN2 A;  5LH8 A;  2D1J A;  2STA E;  2HPQ H;  3PO1 B;  4GVU A;  1O3J A;  4D8N A;  4EST E;  1W7X H;  1K1M A;  5C20 A;  3QK1 A;  4NZQ A;  2F9N A;  4ABB A;  3KQC A;  1MD7 A;  1CA0 C;  2TIO A;  1F0R A;  1Z8G A;  1QCP A;  3F9F A;  1U6Q A;  2Z9K A;  3Q3X A;  4U01 A;  1SBW A;  1TE0 A;  3RUO A;  1FNI A;  3EAJ A;  2DE9 A;  5DP4 A;  3A7W A;  4BTT B;  2FOB A;  5DKM A;  2ZFT A;  4A1V A;  1DVA H;  1AKS B;  1TNG A;  1MU8 B;  2A7C A;  2BX4 A;  1INC A;  4TT3 D;  3TGJ E;  1QL7 A;  1BB0 B;  4FUC A;  3PWC A;  3U8T H;  2O8T A;  3PLB A;  2Q1J A;  2UUF B;  2PR3 A;  1GHA G;  1PPG E;  5DSF A;  1NES E;  1YPM H;  3K6Z A;  3P6Z B;  1BBR K;  2C3S A;  4INH A;  5E2P A;  5EXL A;  2NU2 E;  1AQ7 A;  1O3O A;  1GVK B;  1BTW A;  4Y8X A;  4AB8 A;  1MCV A;  1O2S A;  1UTO A;  5GIB A;  5HXF A;  1GCT C;  3M7T A;  4TPI Z;  3DSP A;  3GIC B;  3WW7 A;  2P95 A;  3RC6 A;  3ZZ7 A;  2KCO A;  3HK6 B;  2JDI D;  4Z6A H;  1WXR A;  1MAX A;  2TPI Z;  4ABA A;  3B23 B;  1GBI A;  3N7E A;  2PTC E;  2Y81 A;  4TWY A;  5J4Q A;  2A45 B;  4X2W A;  2CHA C;  1KXA A;  3N7D A;  1AD8 H;  1LDT T;  3SNC A;  7KME H;  3SGA E;  2AFQ B;  1FV9 A;  3GDS A;  2XND D;  4Y11 E;  1GMC G;  3S7K B;  3UNQ A;  1E0F D;  2CF8 H;  1W0Y H;  1IHT H;  1LVM A;  4NA7 A;  2OBQ A;  1BHX F;  2JJ2 D;  1GGD C;  1RD3 B;  3LPR A;  1MD8 A;  3RU4 E;  2ZU3 A;  1O2O A;  1B5G H;  4O97 A;  4AN7 A;  1X7A C;  4UD9 H;  3ITI A;  3ZZB A;  1G3B A;  5E8E H;  1O2V A;  4NIW A;  3HGN A;  4HZH A;  4DUR A;  1YBW A;  2ZFF H;  1VGC B;  1IQE A;  2UWP A;  2VH0 A;  5C3N A;  4J2Y B;  3PMH B;  1BHX B;  1SSX A;  1ZGV A;  3ZZ9 A;  2FI4 E;  2P3F H;  1IQK A;  1LKB A;  3SJI A;  2GX4 A;  5JBA S;  1GBH A;  2PUQ H;  4K60 A;  1AVX A;  1UK2 A;  1XXD A;  2Y7Z A;  3RXQ A;  1MKW K;  2QC2 A;  1EB2 A;  3ZVD A;  5IDK A;  4RKO B;  2O8U A;  3RXV A;  2HRV A;  4WF8 A;  3F68 H;  4OS4 A;  3RXD A;  2FYR A;  2ZHE H;  1QJ6 B;  2C8Y B;  1NBM E;  4AYY B;  1W0Z U;  4BAN B;  1PPB H;  1W14 U;  1L4D A;  3RXB A;  1HAH H;  2YOL A;  1UJ1 A;  2GT8 A;  1Z1I A;  1O5B B;  1QR3 E;  3D65 E;  2FOE A;  3BG4 C;  1RXP A;  4H4F A;  1MBM A;  2C93 B;  1TRM A;  2ODQ A;  3P8O A;  1D4P B;  1TOM H;  1UCY E;  1P10 A;  1UTQ A;  2GV7 A;  2XC5 A;  2ZGB H;  1A5G H;  4ZCN A;  1UTK A;  1AIX H;  1O33 A;  2RG3 A;  1PPZ A;  1H9H E;  1P2J A;  1GI7 B;  5TCC A;  3V3M A;  5H4I B;  3ZVC A;  1CHG A;  1SFI A;  2PGB B;  2A32 A;  1V3X A;  2HOB A;  1S84 A;  2WPH S;  2ZDA H;  4FUE A;  1EZX C;  2BZA A;  3GY5 A;  1XKB C;  5KGO A;  2FOA A;  1Z8I B;  1A3E H;  1KXD A;  1V2O T;  1KTS B;  1AUT C;  5A09 A;  1C1W H;  2J2U A;  4X0W U;  1VCQ A;  2A7H A;  5JBC S;  1NPM A;  3E16 B;  4XD7 D;  1A2C H;  1O3I A;  4GCH F;  4DT7 B;  5EJ1 A;  3V12 A;  3TU7 H;  4AG1 A;  3QO6 A;  1SGF G;  1TGN A;  1RTF B;  1L4Z A;  1O0D H;  3ZZ5 A;  2ZG0 H;  1V2L T;  5GND A;  1RFN A;  1OP2 A;  1Y5A T;  3ZZD A;  2K8I A;  3VB6 A;  1ZTJ A;  1W0K D;  1DWC H;  2G5V A;  3SU6 A;  1TBZ H;  1EOJ A;  1EJM A;  5FBI A;  1OWI A;  2ZI2 H;  1DUA A;  3FP8 E;  1H8I H;  5JBT A;  1NN6 A;  3MO3 A;  1T8L A;  4E7R G;  1BMM H;  1SGN E;  5E0H A;  4ABJ A;  1ZSK A;  3RC5 A;  2H9H A;  2XCN A;  2P16 A;  4FVD A;  1O38 A;  1HGT H;  1E1Q D;  2GZ9 A;  2Q6D A;  1F7Z A;  1FY4 A;  5C67 A;  3JZ1 B;  4KTU A;  3LU9 B;  1T4U H;  1BRC E;  1UK4 A;  2F9O A;  2TGP Z;  3QZQ A;  2QF4 A;  1KDQ B;  4Y8Y A;  1MMJ N;  4A1X A;  2WPL S;  3ODF A;  3M5O A;  3SI4 H;  2GCH F;  3ZV8 A;  1IQH A;  4P02 A;  2VIP A;  6GCH G;  2GCT B;  3T62 A;  3UR6 A;  3P8N A;  2WUB A;  3BN9 A;  3E0N B;  3T28 A;  3MH7 A;  4HI3 A;  3RM2 H;  4Y71 A;  1SGQ E;  1BMA A;  1NU7 B;  1O3G A;  1TWX B;  3C1K A;  1ZJK A;  2H5D A;  1P3C A;  3GY2 A;  1QTF A;  3DUX H;  3P92 A;  2VWL A;  1T31 A;  1AMH A;  1WUN H;  2BX3 A;  2HPP H;  5ABW A;  2KAI A;  1ZGI A;  4IC6 A;  4AX9 H;  1EPT A;  1GHB G;  3U69 H;  5AF9 H;  8KME 2;  4F48 B;  3LON A;  1UTJ A;  3SU3 A;  2VJ1 A;  2BQ7 B;  2D8W A;  4A92 A;  1BDA A;  3PLK A;  1GHY H;  3SU5 A;  1E35 B;  1HJA B;  1QA0 A;  1EQ9 A;  1TMB H;  2BMG B;  5FL7 D;  3OFN D;  2GMT C;  1L0Z A;  1TPA E;  3KQD A;  3SGB E;  2ZU2 A;  2HLD D;  1QRX A;  4IMQ A;  1GG6 B;  4U2W A;  5A2M H;  1HAP H;  3GCO A;  4ABI A;  4OS7 A;  1ZR0 A;  3TJV A;  3NUM A;  1OX1 A;  4RT1 A;  3LGV A;  1LHF H;  3SND A;  4OS6 A;  4U30 A;  1HBT H;  1ZLR A;  3PMB B;  2F3C E;  1JXP A;  3MU8 A;  4CBN A;  5EOD A;  1EAU A;  1O3E A;  1G3D A;  1H8H D;  4OS5 A;  1CA0 B;  4DJZ B;  2ODP A;  2Q6G A;  5FPT A;  1PJP A;  3A87 A;  5I25 A;  3SBK A;  1YF4 A;  1DY8 A;  1QJ7 B;  3AVZ A;  1PQ5 A;  3ATW A;  4KP0 A;  1DIT H;  1CGJ E;  4WXI A;  1Z8J B;  1MTS A;  3GS9 A;  1O5G H;  3BSQ A;  2SGP E;  1E79 D;  2Y80 A;  4YOI A;  5HYO A;  1P9S A;  4MPU A;  1GI4 A;  1C5T A;  4XBD A;  1AND A;  3SV7 A;  2CGA A;  2ALV A;  5JB9 S;  4IS5 A;  1NFU A;  1N8O C;  1JIM A;  2OQU A;  4UE7 H;  3K2U A;  1GBT A;  5DP5 A;  1IQG A;  2BQ6 B;  1ZHR A;  3DFJ A;  1ANC A;  2P8O C;  1TAW A;  2L6O A;  5DP3 A;  3SNE A;  3ZZ3 A;  2FMJ A;  1TLD A;  1BBR H;  1A5I A;  1OWK A;  5FX5 A;  1KLJ H;  1GCT B;  3LGY A;  1C1T A;  3TH3 H;  1C2E A;  4LXB H;  2H5C A;  1TRY A;  2D26 C;  1RTK A;  4HTC H;  1CGH A;  3A84 A;  4H6S B;  3LKW A;  1WOF A;  2FOG A;  2AEI H;  1NRR H;  1O30 A;  2Z9L A;  1Y5U T;  1O2M A;  2CHA B;  2WZQ A;  1ZSJ A;  2A5K A;  1GMC F;  1BTZ A;  2W3I A;  1BCU H;  1T8N A;  2ANM H;  1BTU A;  3RLY H;  3KGP A;  3RLW H;  1YLC A;  3URD A;  1UCY K;  3U98 H;  4M9F A;  1K21 H;  4NZL A;  1GGD B;  1J14 A;  1C2K A;  4D7F A;  1GVL A;  1C1U H;  1YCP M;  4WMF A;  3OX7 U;  3FP6 E;  1D3T B;  2K1Q A;  3E1X B;  4OGX A;  1S82 A;  5CMX H;  5BRR E;  1EJN A;  3UOP A;  1O2X A;  3ATI A;  3DSG A;  4OS1 A;  3BTT E;  4Q63 A;  1A0L A;  1ZRK A;  2JH5 D;  4NIX A;  3RXT A;  1ID5 H;  1K9O E;  1HV7 A;  3RMM H;  1TNJ A;  2KM0 A;  5DPA A;  5F8Z A;  5LPR A;  1QY6 A;  2VWO A;  3RXP A;  4BTU B;  4JK6 A;  2CK3 D;  3KID U;  5ESB A;  3SUE A;  1V2P T;  2FOF A;  3ZZ8 A;  1N1L A;  4DG4 A;  5E0G A;  1GJ7 B;  4JYT A;  3SGQ E;  1T8M A;  1Y59 T;  2QF0 A;  2KZ4 A;  3S9B A;  2BDA A;  3MH6 A;  4E05 H;  1ZRB A;  4XE4 A;  1TGB A;  1O2L A;  1ORF A;  3E8L A;  1BT7 A;  4AGJ A;  3SNB A;  1DLE A;  3QDZ B;  1C1O A;  2HLC A;  2GT7 A;  3BG4 B;  2BDH A;  5FCR A;  2WPD D;  1EAS A;  3I78 A;  1LHG H;  1P09 A;  4A5T S;  1FY8 E;  5DK1 A;  1KLI H;  1TQ7 B;  2IJO B;  1O5A B;  1UTP A;  3MO9 A;  2BXT H;  2LNC A;  3QZR A;  4XSK U;  2PKS C;  2ZU5 A;  2B0F A;  1JRT A;  1F92 A;  5FHT A;  3SUG A;  1J8A A;  2G81 E;  3RXG A;  4F4O C;  1W2K H;  2FTM A;  3FP7 E;  1VKY A;  3L33 A;  2BVX H;  1IQF A;  4MLF B;  3TVJ B;  4FOU C;  3U1J B;  2ZHQ H;  2A7J A;  4WH6 A;  1LVB A;  1YPL H;  3RM0 H;  2GTB A;  1DY9 A;  1O2G H;  2F91 A;  1GI9 B;  5HIY A;  4XFQ A;  4SGA E;  4YO9 A;  2HNT F;  2W5E A;  4AOR A;  2WYJ A;  4JZ1 A;  1M9U A;  5F8T A;  3RU4 D;  1NS3 A;  4IN1 A;  3ZZ6 A;  1XUF A;  3UWJ H;  3LGU A;  2BQW B;  4FVB A;  1AWF H;  5JBB S;  4MPV A;  1VJ9 U;  1H9I E;  2WV4 A;  3MMG A;  4XOJ A;  1NFX A;  4X2X A;  4MG3 A;  1F5L A;  3PB1 E;  1IHS H;  2XYA A;  1FY3 A;  5AVD A;  1FZZ A;  1KYN A;  2TGT A;  2WPM S;  4HG6 A;  4X2Y A;  1SQT A;  4CR5 A;  4K1S A;  2FP7 B;  5EPY A;  1XUG A;  2J92 A;  2GDD A;  3UTU H;  1G32 B;  1HB0 B;  1WDI A;  3P8G A;  1KXC A;  4WXV A;  1UHB A;  3M7Q A;  4Y6D A;  3BTK E;  2F83 A;  5LPE A;  3N7O A;  4JYU H;  3L6P A;  4TPY A;  1WYK A;  3GY6 A;  4IC5 A;  3SU0 A;  1SLU B;  4BAK B;  4BTI B;  2XWA A;  2WV5 A;  3BEU A;  3F9E A;  1YPJ H;  2PGQ B;  3RDZ A;  1XVO A;  1NY2 2;  2XNI A;  2WPI S;  3OAA D;  4Y10 E;  2OK5 A;  1NBM D;  3RMO H;  1LQE A;  2IPH A;  1TMU H;  1A46 H;  1SC8 U;  4XBB A;  2BOK A;  3HGP A;  1SVP A;  1WQV H;  3MNS A;  2JET C;  1D3P B;  3U28 C;  3VXE H;  2J95 A;  4BAH B;  3NK8 A;  1KXE A;  1J17 T;  2YNB A;  4JMY A;  4KKD A;  5C1U A;  4CRG A;  1GBL A;  1LHC H;  2GCH G;  2GZ7 A;  2PW8 H;  3MWI U;  1S81 A;  1GHB F;  4ZKN U;  2G52 A;  1Q31 A;  2XBX A;  1V2R T;  3B8J A;  5HKK D;  4YT6 H;  2B9L A;  2CV3 A;  3SI3 H;  3RXJ A;  2PKA A;  4AFQ A;  1TQ0 B;  3NRL A;  1O3L A;  3LC5 A;  1AZ8 A;  1AI8 H;  2C90 B;  3PRB A;  4NIY A;  1SQR A;  1T32 A;  4PRO A;  3TGI E;  2Y6T A;  2FYQ A;  1PQ7 A;  1QZ8 A;  2F4L A;  3LGI A;  1DS2 E;  1SLX B;  3O8R A;  3VB5 A;  1UVU H;  1C5U A;  1C4Y 2;  1P2I A;  2GMT B;  5FCK A;  5JYI A;  1EAX A;  5K0H A;  3QTV H;  1C5L H;  2BD8 A;  4I86 A;  4MDS A;  1L1G A;  2AIQ A;  1FJS A;  5FX6 A;  1HXE H;  1HCG A;  2V0B A;  1Z7K A;  1JRS A;  2ZGX H;  1DSU A;  2A2X H;  1O2I A;  2C8W B;  1WU1 A;  3BIV H;  2ZP0 H;  4RKJ B;  1SI5 H;  1YGC H;  1DDJ A;  1O2N A;  3LC3 A;  4JZE H;  1S6H A;  5GWZ A;  4MPX A;  5FAH A;  3OEH D;  3HAT H;  3ZYE A;  2Y82 A;  4B1T A;  3EYD A;  3A89 A;  3AK5 A;  2KX4 A;  3PLP A;  1GI0 A;  3P70 B;  3TPI Z;  1NM6 A;  1G3E A;  1G9I E;  3UNS A;  2FOM B;  4YXW D;  1C2H A;  1N8O B;  2Z9G A;  1HUT H;  4X6M A;  1QRW A;  3BTE E;  1FIW A;  3HKI B;  2H1U A;  1VR1 H;  3FVF B;  1ELG A;  4JZI A;  1BIT A;  1AHT H;  1L1J A;  1ZHP A;  1MH0 A;  1P04 A;  1TGT A;  3RXK A;  2P8O B;  1HJ8 A;  1TNK A;  4XRN A;  3BTW E;  1YP9 A;  3ZVA A;  2KCY A;  1TPO A;  1GCD A;  1ZPC A;  3FAN A;  3A85 A;  1QB1 A;  2J34 A;  2J94 A;  2ZGC A;  4ABD A;  2FOC A;  1P01 A;  3NPS A;  2ZC9 H;  3D23 A;  4P00 A;  4YES B;  1Q2W A;  1K22 H;  3KQB A;  5C5O A;  4ZKR U;  1EKB B;  1F2S E;  1GBJ A;  1ABI H;  1NRP H;  1S0Q A;  1SB1 H;  1O5E H;  1GL1 A;  1A4W H;  2RA3 A;  1ETS H;  1QRZ A;  1RIW C;  4UDW H;  2XW9 A;  1OPH B;  4ASU D;  3EQ0 H;  2Z94 A;  4NCY A;  1GDU A;  3FN8 A;  5EW2 H;  1EPT C;  1C2M A;  1TRN A;  1V2W T;  1EST A;  4I32 A;  4ISN A;  2BB4 A;  3ATK A;  4ISI H;  1Z6E A;  3BTH E;  2BD3 A;  2GD4 B;  2NU4 E;  3H7O A;  2ZGH A;  1E1R D;  1PYT C;  3K6Y A;  3M35 A;  3QX5 H;  4JYV H;  4NWL A;  1C2F A;  1P2O A;  2P3T B;  1YPH E;  3LH1 A;  3LOX A;  1BTY A;  5C0U A;  1FY1 A;  2G51 A;  1GBC A;  1YPH C;  1FY5 A;  1SPJ A;  2FM2 A;  1AB9 C;  1AY6 H;  3RML H;  4K5Z A;  1MZD A;  1BTH H;  1GDN A;  1BMF D;  4FUG A;  2UUY A;  4TY7 A;  1WTG H;  1OS8 A;  2O8M A;  2ZHD A;  3T26 A;  1P2K A;  2P93 A;  3GDV A;  5G4B A;  1CGI E;  3LDX H;  1RRK A;  1O34 A;  1ELB A;  1Y3Y A;  4ZMA H;  3PV4 A;  5AHG H;  3DT0 H;  1ESB A;  2ZDN A;  4BXS A;  3ODD A;  7GCH G;  1WAY B;  4UFG H;  3OE7 D;  3K9X B;  2XBV A;  2ZDV H;  3VG8 A;  3FFG A;  4HGC A;  3ZVF A;  1GBK A;  2KFW A;  3PMA B;  1GI8 B;  3EE7 A;  3AAS A;  1K1O A;  2IOT A;  5EXN A;  1YC0 A;  1W8B H;  1HAG E;  2PKS B;  1V2Q T;  1IQL A;  3NWU A;  2QV1 A;  2R2M B;  2V35 A;  4BAO B;  1P02 A;  2FWW A;  2WHX A;  3ATL A;  3NKK A;  1YY3 A;  4Q2K A;  3P17 H;  5LPF A;  1Y3W A;  3GCH C;  1K0H A;  1FAX A;  4YZU A;  1A61 H;  2WUC A;  1JIR A;  2R3U A;  2D2D A;  3A8D A;  2PSY A;  2V6N A;  5T3H A;  5I46 H;  1ELV A;  1XUI A;  2FEQ H;  1KTT B;  2W6J D;  2ZGJ A;  4B6E A;  2BY9 X;  5GJ4 B;  5L2Z H;  1TPS A;  1SOZ A;  2XC0 A;  5SGA E;  2BVR H;  2PUX B;  3FZZ A;  3IIT A;  1O2P A;  2EQN A;  1B7X B;  1V2N T;  3GY4 A;  2A5I A;  4X8V H;  1F0S A;  3SZE A;  1D6W A;  1SGE E;  2W7U A;  2IPQ X;  2Y7X A;  3TLO A;  3F2H A;  2V7Q D;  3G01 A;  1ETR H;  1COW D;  2BTC E;  4DOQ A;  1GJ6 A;  3RXC A;  2VIW A;  3RP2 A;  1GJ8 B;  3QGJ A;  3VEQ B;  2ZCK P;  3BF6 H;  4ZRO A;  1F5K U;  1RGQ A;  1UK3 A;  1YCP H;  5DP7 A;  5KEC A;  2HNT E;  3M36 A;  5DJ7 A;  4FU9 A;  3GY7 A;  1TX6 A;  5T6D A;  5CE1 A;  1RS0 A;  2R0L A;  4YLU A;  2HNT C;  3VB7 A;  4A1T A;  1UVP A;  1FIZ A;  5BPE A;  2A31 A;  3Q00 A;  1QHR B;  2AER H;  3GIS B;  3SOR A;  1PPH E;  1TX7 A;  2Z9I A;  3MHW U;  1CA8 B;  4MNV A;  3VGC B;  3L3T A;  1UVO A;  2OC8 A;  1FXY A;  1K1J A;  2JET B;  1TNL A;  1CO7 E;  5EJZ A;  1GHZ A;  1AE5 A;  1C2D A;  2VB0 A;  1AFE H;  3KYF A;  2HAL A;  1C1P A;  3MQK C;  3F9G A;  1G3C A;  2J98 A;  4JZF H;  4FUF A;  4TWW A;  4Y79 A;  1AWH B;  1DLK B;  1QL8 A;  1ARB A;  1PPC E;  2ZEB A;  2H6M A;  3FKS D;  3GDU A;  1ANB A;  1ZYO A;  1GBD A;  2QXH A;  2VNT A;  1N6Y A;  3W94 A;  5F8X A;  3PMJ A;  2VVV A;  1AE8 H;  2PLX A;  2JKH A;  1MU6 B;  2ZDL A;  5FPS A;  3DFL A;  3CEN A;  5A0C A;  3BG8 A;  5A8X A;  1IQM A;  2FO9 A;  3LGW A;  1YYY 1;  1OHH D;  1ELE E;  2UWL A;  1TPP A;  4THN H;  4TYD A;  3H5C B;  2EI6 A;  1O3A A;  3Q3K A;  2VIN A;  5DP6 A;  3QGN B;  1ETT H;  4K69 A;  3TJO A;  2ZPQ A;  1KXF A;  4K1T A;  3BTM E;  1BQY A;  3GCN A;  3ZYD A;  2STB E;  1O3H A;  1SR5 C;  3S0N A;  4BAM B;  1H8E D;  1VIT F;  3O8C A;  1F0U A;  1T8O A;  2BYA X;  2ZCL P;  2H2Z A;  4E7N A;  2ZWL H;  1YM0 A;  4JCN A;  2Z9J A;  3PRD A;  3KQ5 A;  2NU3 E;  3SJ9 A;  1CE5 A;  4FU7 A;  2QXG A;  3U9A H;  5KED A;  3ZVB A;  3TJN A;  4UON A;  1BA8 B;  3S69 A;  4DII H;  1W0J D;  1VZQ H;  3OY5 U;  1MAB B;  1QQU A;  1P12 E;  2ASU B;  2AMD A;  1O37 A;  3BEI B;  3A8A A;  4WWY A;  4I8H A;  2QXI A;  2P3U B;  3QN7 A;  1WCZ A;  1NFW A;  1SGC A;  4ZXX H;  4GHT A;  2DUC A;  2QF3 A;  3A7T A;  5C17 A;  2SGE E;  1O3B A;  2FPZ A;  1C9P A;  1F0T A;  4B6F A;  5EGM A;  3M5L A;  1JBU H;  4NFF A;  1JOU B;  3EST A;  2FDA A;  5GDS H;  2GZ8 A;  2ZHF H;  3GYM A;  2VGC C;  3S9C A;  1C1R A;  1IOE A;  2BLV A;  4I31 A;  3WWF A;  1BJU A;  1CT4 E;  4CRD A;  2FX4 A;  2VU8 E;  3HPT B;  4B2B A;  2TGD A;  1DWE H;  3TGK E;  1C5Y B;  5T6G A;  3KL6 A;  1BMN H;  1K2I 1;  2J5U A;  3RXF A;  1XM1 A;  3SJK A;  4X1N U;  1RIW B;  6LPR A;  2KCP A;  2JH0 D;  2WYG A;  4JZD H;  2QYI A;  2KAI B;  2O9Q A;  5A8Z A;  2HVX A;  1EPT B;  4AB9 A;  3TK9 A;  2FLR H;  3VPK A;  1G36 A;  5DN6 D;  4D9R A;  3T25 A;  2C4F H;  1V2T T;  1O32 A;  1H9L B;  4CRB A;  1GMD G;  2SFA A;  1THP B;  3A88 A;  3M37 A;  1QJ1 B;  1O2Z A;  4K1E A;  4CHA C;  2FOD A;  1J16 A;  3ENS B;  1F5R A;  2Y5F A;  5PTP A;  3NXP A;  3EGK H;  4Y0Z E;  2Z7F E;  1QBO A;  4CR9 A; 
#chains in the Genus database with same CATH homology
 3EE7 A;  2J98 A;  5HIY A;  1UW7 A;  1QZ8 A;  2J97 A;  5C94 A;  2J98 B;  5HIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...