1QZ8A

Crystal structure of sars coronavirus nsp9
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
ELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyprotein 1ab
publication title The severe acute respiratory syndrome-coronavirus replicative protein nsp9 is a single-stranded RNA-binding subunit unique in the RNA virus world.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Unknown function
total genus 20
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 1qz8A01
5HIYA 2J98B 5C94A 3EE7A 5HIZA 2J97A 2J98A 1UW7A 1QZ8A
chains in the Genus database with same CATH superfamily
4YLUA 2VVUA 2QXJA 1D6WA 4NA8A 2ZTYA 1MD8A 3RXAA 2OLGA 2UWOA 1HLTH 3UQOA 5B6LA 2OBOA 1P2OA 2FOAA 3EE0B 5KEDA 1Y8TA 1ZTLA 1YLCA 2LELA 1XM1A 1J16A 2BOKA 4ISIH 3RM2H 1G3CA 2IOTA 2QN5T 1C5YB 3PMBB 1QFKH 1AVXA 1D3QB 1O32A 1HAZB 4Y11E 2GKVE 1LKBA 1THSH 3TGKE 1O2SA 1K1NA 1MQ5A 1OP0A 3D65E 1V2QT 4Y71A 2JKHA 1GJ9B 4TY6A 1BTZA 3LC5A 4A92A 3QGJA 3RXCA 2HPPH 3BN9A 2EI8A 4HTCH 1C2DA 4X1NU 4AB8A 2PUXB 1AVWA 1C5LH 4CHAB 3MFJA 2BXUH 4K1TA 2HNTF 1YPHC 2XYAA 4GUXA 4JZ1A 1AMHA 1ZTKA 2AYWA 1V2ST 1AZZA 4WMFA 5DG6A 1DWEH 3KQBA 2BHGA 1MBQA 1GI0A 1DVAH 3UQVA 2F3CE 1C5XB 2WPMS 2CK3D 2HOBA 2FOEA 1RGQA 5E0HA 2ZFQH 4F4OC 1KXCA 1ZMLA 1QJ6B 5I46H 2PTCE 4RKOB 3W94A 3B8JA 1O38A 3W1EA 1WQSA 1O5EH 1QRZA 3T62A 1P3EA 2VNTA 2UUKB 1P2NA 1GHVH 1YPHE 3A87A 2J97A 2J34A 5FCKA 1LQDB 3RXIA 4O97A 4UFDH 1IQFA 1YCPM 3QUMP 1N6XA 2ZDKA 1GI3A 1O37A 1A0LA 1MH0A 2A7JA 1FY1A 3L3TA 1V2TT 3QN7A 1DPOA 4B2CA 1VITH 3TGJE 1TX6A 4JYUH 2KAIB 1LHDH 3UPEA 3ZV9A 4DGJA 1G30B 1LVMA 1P10A 2ZA5A 1O35A 1A0HB 1S5SA 5E2PA 2VH6A 1G37A 4MNYA 3V7TA 1GDUA 4K60A 1GJDB 1SGDE 5EOKA 1C2HA 2JJ2D 4PROA 2AHME 2SNWA 1GCTB 2ZKSA 3ZVEA 2A31A 1V2MT 2VWOA 4FUGA 1ACBE 2R3UA 3TNSA 3RC6A 1P2IA 2K0QA 2CF8H 2GZ8A 3EGKH 2STBE 3N99A 4I32A 1TPPA 4H4FA 4ISOA 3AASA 3SU5A 3UUZA 2J98B 4I31A 2PKSC 1G9IE 3A7WA 3BIUH 2JETB 2VWLA 1K1MA 5F8TA 3M5MA 4CREA 1IQEA 5C2ZA 2J2UA 4OS2A 3RXVA 4YOIA 3RXJA 3F9FA 3RLWH 3PLPA 3QTVH 1GDNA 4YT6H 2P3TB 2FOCA 2ZHWH 3SNAA 4X8VH 4GCHF 5LPRA 2RFKC 3NWUA 3PO1C 4INHA 3STIA 5FPSA 2CF9H 3TVJB 3GY4A 4NZQA 4CH8B 4ZKOU 3RU4T 1PPGE 2VVVA 1FZZA 1ELFA 3BTGE 2BY6X 4JYVH 4QT8C 3FZDA 1G2MA 1RS0A 3AW1A 2DE9A 3Q77A 1WCZA 1KSNA 2ANYA 1C5VA 2AMPA 4TPYA 1SFQB 2FTLE 2BVRH 3U8RH 1CHOF 3D23A 2FOFA 1O5GH 1C1TA 1QTFA 2BDHA 2FOHA 4KP0A 2W5EA 4UEHH 2VJ1A 4BAKB 1SOTA 1E79D 4JZIA 1BT7A 1NN6A 1ZSJA 4OS6A 3ESTA 3TJOA 3Q3XA 3GY6A 4FUBA 1O3PB 2TBSA 4XOJA 5EQQA 4NCYA 1OP8A 1FONA 5ESTE 4E05H 3FOAA 2A5KA 4WJG2 5HM9A 4DIIH 2A45B 2AIPA 1DLEA 1ANBA 1HAIH 1VJAU 1P03A 1HAHH 5EJLA 4FVBA 1WTGH 3UFAA 3PRBA 2OQUA 1DITH 1E1QD 2C90B 2TRMA 1A0JA 3NPSA 1JRTA 1AVGH 3TJNA 2ZU4A 3GOVB 4YESB 4D8NA 5GIBA 2A5AA 3KHVA 4BOHA 3V13A 2QF5A 1W3CA 1O2VA 3VG8A 2I6SA 3RXRA 3WY8A 2ZWLH 2C93B 3A8BA 1T32A 4X8SH 1ESAA 1Z8GA 4U01A 1GMDF 1OWEA 1Y3VA 3BF6H 1SG8B 2YMSD 3KN2A 1BHXB 2A2QH 1J17T 1EAXA 1GWAA 1V2UT 1C2JA 2OC1A 2UUFB 2ZQ2A 2FEQH 2A2XH 2W7SA 2WINI 3HK3B 1SLVB 4K5ZA 2F9NA 3AW0A 3QDZB 4Y6DA 2BDAA 4YO9A 3VB6A 1S83A 1AN1E 1IQJA 4ZHLU 1TPOA 2GX4A 1NRQH 1P57B 3KCGH 3MH5A 4WXVA 1O2NA 3K6ZA 1OWDA 4BTTB 1MU8B 3RXPA 2A4OA 1P06A 3F0PA 1IQNA 1T7CA 5A2MH 1ETSH 1TE0A 1WSSH 4Y10E 2QF3A 1IHTH 1PFXC 2Y6TA 2CJIA 1GBAA 3JZ1B 7GCHG 5EJ1A 4E06H 1BMAA 3GYMA 1ZYOA 6ESTA 2WPDD 5EQRA 1Z8RA 1O3OA 1GI1A 1O5DH 1Z8JB 2P3FH 3PWCA 3RP2A 1T31A 2GMTB 2NU0E 4UE7H 2H5CA 4XFQA 1PJPA 1VGCC 3HKJB 3DD2H 1ELVA 2BY8X 2XCNA 4NA7A 3A81A 1MD7A 3BTFE 1O33A 3K6YA 2GTBA 1SVPA 1OYTH 1QNJA 3CENA 1AFEH 1JIMA 3OAAD 2PSYA 1W11U 4TYDA 3DFLA 4MG3A 5FBIA 1S0QA 3RXTA 2ANWA 3A7XA 2P93A 3KQ5A 1Y59T 1LHFH 5DSFA 1A46H 2ZO3H 5GXPA 5HGGA 1TA2A 4K3JA 4GPGA 2R2WU 2P95A 1ELEE 4K69A 4Y0ZE 3ZZ3A 1TBQH 1OWJA 1QHRB 1F5KU 1C1WH 1D9IA 4X1SU 1OPHB 1O30A 4MLFB 1SLXB 2LP6A 2KFWA 2KCAA 3P92A 2ODQA 4Q7ZA 2PSXA 1NS3A 3ATLA 1SGCA 2GCHG 2FI4E 1L4DA 1GHWH 4DT7B 4B74A 1K1LA 1CA0B 3RC5A 5L6NH 3LC3A 4SGAE 2GCTC 2BX3A 3A7VA 5C1YA 3N7OA 2IN2A 1C4V2 3U28C 1ETTH 1C2KA 3SU1A 1EAUA 3C27B 2TIOA 2ZZUH 2Z9JA 4ZROA 4JCNA 4WMDA 5F8ZA 3BTME 1B5GH 4IMZA 5DP5A 1VCPA 3V3MA 3VB7A 1GI8B 3MU0A 2GDEH 2OTVA 5AVDA 1K28D 4TWWA 1B0FA 1AWFH 4F55A 1VKYA 1K1PA 2F9BH 1P01A 1A5GH 3GCHB 1GG6C 1XUGA 1RTKA 4B2BA 2JDID 3EA8A 1DDJA 3VXFH 3TJUA 4DT4A 1SGEE 2EEKA 3ZZ5A 1E36B 3A8AA 4IBLH 1QA0A 1BHXF 2QXIA 1PPHE 1COWD 5DN6D 4CR5A 1GBDA 4X6OA 3DCLA 1VJ9U 2SNVA 2Y5HA 1DUEA 1V2JT 3ZVAA 1YLNA 4MNXA 1UMAH 5JBCS 5DP4A 2BZAA 1W2KH 4GHQA 4WH6A 1QRWA 2F91A 4I8LA 1Z6EA 4BXSA 3O8CA 5C5NA 1A7SA 1GGDC 1HGTH 1DSUA 4P02A 1V2PT 2R3YA 3EA7A 2GV6A 1Q2WA 2L74A 2J5UA 3OY6U 2CN0H 1B7XB 1GI2A 1TBZH 3SU3A 2PUQH 4B6FA 5C94A 4WXIA 4AZ2B 3PRDA 4Q2KA 2WYJA 4E7NA 1BDAA 2PR3A 3RXBA 4DVAU 1O34A 4A1TA 3P8FA 1BMFD 2HWLB 4NSVA 1W10U 1NROH 1HJAC 1MTUA 2ZDVH 1AY6H 1HXFH 1C1UH 1MAXA 4D76A 5L30H 4FOUC 3VEQB 1CGIE 4CBOA 1GI6A 3RMLH 1V2NT 3ATKA 4CRGA 3I78A 3EE7A 4YOJA 1GVLA 4THNH 1O3IA 1XXDA 1ZZZA 4TSFD 2OD3B 4E7RG 4AOQA 1LVOA 1YM0A 1LHCH 1O3GA 2ZIQH 2F4LA 3MH6A 3M7TA 3BTKE 4YT7H 2ZPRA 3NUMA 4UDWH 2BB4A 3M5OA 1JWTA 5G4BA 2EQNA 3O8RA 1HCGA 2VGCB 4X8UH 1S82A 3TNTA 1SMFE 2OC8A 1MKWK 3IG6B 1PPZA 3FO8D 2AGEX 2XC0A 2ZGCA 1JMOH 1BTPA 2SGAA 1FXYA 1YPEH 2G00A 1TNIA 3KL6A 2R9PA 3LGUA 1F0RA 3ODDA 1GJ8B 1UCYK 3GY8A 1C1RA 3A7ZA 1XUJA 2BY7X 1EJMA 3BTWE 4XSKU 4X1QU 2PKSB 1K2I1 3P8OA 1KTSB 3E6PH 2TGAA 1CHOG 1TX8A 1AHTH 3PB1E 5GDSH 3RU4D 2G51A 3SNCA 3SZNA 8LPRA 1ZTJA 1DXWA 3ZYDA 1MABB 1QGFA 2BQ6B 1A5IA 1KXBA 3FAOA 1MMJN 3MO9A 3SV6A 1WOFA 1GJBB 3M5NA 2J95A 4CRDA 2Q6FA 2Q1JA 3S7HB 3SORA 2H5DA 3MOCA 3QLPH 3ZVDA 3QZQA 3UOPA 3UAIC 3PO1B 1UTOA 2XBWA 7GCHF 2PWXA 1T8LA 1TONA 4B71A 1BBRH 1AE8H 1TABE 2FI5E 1NTPA 3SJIA 1MBMA 2GD4B 1GI7B 1CT0E 2BM2A 2FDAA 4J2YB 3T28A 5T6DA 2Y7XA 5FHTA 3SJKA 5HMAA 2UWLA 3T29A 5J4QA 1ZMNA 1FY3A 1QB1A 2VIVA 4ABEA 1GBBA 5CMXH 1A5HA 1FPHH 3ITIA 5I25A 3ATIA 3RXOA 2Z9GA 1QBVH 3I29A 3BTDE 1BRUP 1YPLH 3FP7E 2TGPZ 2Y80A 4HFPB 2A4GA 1Z7KA 1E34B 1L1GA 5DK1A 1RTFB 1C5PA 5C5OA 1TGBA 4MPWA 4H42U 1C5TA 1EZXC 3HGNA 2LPRA 1E38B 2R2MB 2FLBH 1L2EA 1O5BB 3PLKA 1SB1H 1GBTA 3A80A 4X2YA 1EASA 1FMGA 1O3CA 4IC6A 2BMGB 3PMAB 1TPAE 2JH0D 4AFQA 3A7YA 2KCYA 1AWHB 1GMHG 3RU4E 2ESTE 2KX4A 2VIQA 2GCHF 3BTQE 1GPZA 2RDLA 2Z3EA 1F92A 2ZG0H 2GDDA 4AB9A 1TNKA 1QB9A 3TPIZ 4HI3A 6LPRA 4LK4A 1TRYA 5ESBA 1D3PB 3A8DA 2XBYA 4XBBA 1O2ZA 1C4Y2 3BSQA 1IHSH 1UHBA 2XNIA 1O2LA 3A88A 1GVZA 3V0XA 3RUOA 2ZF0H 3DSPA 3P70B 3EA9A 1UW7A 1H8ED 1DE7H 1NFWA 4D9RA 1K22H 1IQLA 1UTPA 1FIZA 3SQHE 1GHBG 4FUHA 3SI4H 4B6EA 1GBEA 5TJXA 1IQHA 1QIXB 3TH3H 3LJOA 5ABWA 5TCCA 4UFEH 2CXVA 4INLA 2BD7A 1NU7B 1TMUH 1LO6A 4Z1MD 3S0NA 2FOGA 1ZPZA 4X2WA 1HV7A 2THFB 4FXGH 4KGAA 4ZKNU 1SGTA 4A6LA 4NWLA 3ZVFA 1FN8A 6CHAC 1CT4E 1SBWA 3GCNA 1ARCA 3MO6A 3O8BA 3SV9A 1Z71A 2ZCLP 2ZHEH 1H9LB 2P59A 1XVOA 1BB0B 1A3BH 2XOKD 1QBNA 1VGCB 1V2OT 1YF4A 4FUFA 1EB1H 2TGTA 8ESTE 5FPYA 1A2CH 5FX5A 1FIWA 1H8IH 1WAYB 1O2KA 3EDXB 4LOYH 4A7IB 2ZTZA 1C1SA 1G3BA 1IQGA 1BZXE 2W3KA 3LH3A 3MTYA 1N1LA 4Y7AA 3QGNB 1GHXH 1ABJH 4CH2B 5K7RA 2O8WA 3KQCA 3DSOA 1RFNA 1CVWH 1MTSA 5JBAS 8GCHG 2XC4A 3EAJA 3K2UA 1LQEA 1SOZA 3GCOA 1C5QA 3ODFA 1K1JA 5GJ4B 2BD4A 2IJD1 4RT1A 1H1BA 4BAHB 4ABBA 2Y5FA 3SV2H 4FETA 1YC0A 3E0NB 1UCYE 2PKAB 2DE8A 3MNBA 1V3XA 1T4VH 2BLOA 3IWMA 3M7QA 1CU1A 3M37A 1KDQB 1ZRKA 5L2YH 1QA7A 1DWDH 3PMHB 4U30A 4MNWA 2H1UA 4UFFH 1QCPA 2GCTB 3HK6B 1EKBB 1N6YA 1W0KD 2SGPE 3LIWA 1QL8A 4B75A 2ALPA 5EODA 2M5TA 2YOLA 3AVZA 2A32A 3SQEE 2WV5A 1C5UA 2YNBA 3TU7H 1CO7E 1MZDA 2VVCA 2R0LA 3TH2H 4ZUHA 1KY9A 1SGFA 2J38A 3M3SA 1OWKA 5IYTA 1ELGA 4YZUA 2HALA 1QL9A 3SHAH 1LHGH 3P17H 3BTTE 1Q3XA 1QL7A 1O2YA 2WPHS 1JBUH 1GG6B 5JBBS 1H9IE 2EY4C 1SQAA 3GCTF 1DICA 1W0YH 1SGYE 1TNGA 2G4UA 4NIVA 2QYIA 1G3EA 5DP6A 4ABDA 4JYTA 2CHAC 3OTPA 2GJGA 3HATH 4X1RU 4INKA 2ZU3A 2BX4A 1QJ7B 1LTOA 2OC7A 3GICB 4F49A 3A7TA 4LXBH 5CDFE 3MU1A 1HIAB 3BG4C 1O3HA 1C2GA 1T8MA 3PTNA 2H9EH 3SNDA 4MPUA 1KMHB 1RTLA 3B23B 1K9OE 1TOCB 4I8HA 1NFUA 1QY6A 2C4FH 1BA8B 1C2EA 3ZYEA 1C5NH 2ULLA 2WYGA 5BRRE 1Y5AT 2VIOA 1EPTC 1ZOMA 3PV5A 4Y8YA 2ZGHA 3JZ2B 1TRMA 1P2KA 4GSOA 1P9SA 1P09A 1QZ8A 2BDIA 1IOEA 2AH4X 5F8XA 4B1TA 1AGJA 2W3IA 1HXEH 1SR5C 1YGCH 3SGAE 2ODYB 1ELDE 3RMNH 2NU3E 3OTJE 1AFQC 5A8ZA 2B5TB 3P6ZB 1QQUA 3KNXA 4ABGA 2P8OC 2M2AA 1LKAA 1P05A 2EA3A 1XXFA 4ISNA 1DWCH 3PTBA 1GHAG 2SGQE 3RXKA 3NKKA 1EP5A 1OXGA 1C9PA 2JJ1D 1KXEA 5LPEA 2AMDA 2FX4A 2BQWB 2HPQH 1SQRA 3MWIU 4GLYA 1O3FA 3KQEA 2OUAA 1UO6A 1HJ9A 3VB4A 3Q3KA 5A0CA 3TGIE 3KEEA 4O3TA 1GMHF 5EXLA 2BLWA 5A0AE 1CA8B 2J9NA 5DP7A 2AEIH 1X7AC 1TRNA 1QB6A 3P95A 4AORA 2V6NA 4DOQA 3RXFA 1P3CA 1RJXB 5J4SA 1HAGE 1T8NA 3CS0A 2AGGX 3A82A 2Z3CA 4ISHH 1DSTA 3N7DA 1P11E 1XKAC 1E0FD 3PV2A 5A0BA 1KTTB 1GJ5H 1ANCA 4AFSA 1D3DB 4I8KA 1NY22 3LONA 4XE4A 2YMSC 4ESTE 1HAYB 3R0FA 2P3UB 1MQ6A 2Z6BD 3WWBA 1GHBF 1H9HE 1PPFE 2AFQB 1SC8U 2ASUB 2OP9A 3LGYA 1GJAB 1TMBH 3SNEA 3BEFB 5FL7D 4OS5A 5DPAA 3MU8A 3F1SB 1PQ7A 3RXEA 2PTNA 4Q7XA 1DANH 4IN1A 5EW2H 2G8TA 1W13U 4TT3D 3H7OA 4H6TA 3SUEA 4ACBA 3TIUA 3GY2A 4HZHA 2QXHA 3GISB 3EQ0H 2FODA 2A7HA 4OGYA 5F53A 2K1QA 1ESTA 1QR3E 2KZ4A 3PMJA 1K21H 1SHHB 2H2ZA 3UNQA 1O2UA 3TITA 1O5AB 1LPKB 3A85A 1O2XA 5CE1A 1AIXH 1GJCB 1INCA 2Z7FE 9LPRA 4IW4E 4DIHH 3UNSA 1IQMA 3MO3A 4FU9A 2ZECA 2IPQX 2PKAA 1AE5A 1AB9C 1BJVA 3C1KA 1QRXA 2XWBI 4OS4A 2ZGJA 1KDQA 2FS9A 4IC5A 4BAOB 2KR7A 1KXAA 1H8HD 3U1JB 8GCHF 2CMYA 1OWIA 1C9TA 1RXPA 4X2XA 4ABJA 1UTNA 3URDA 3MQKC 1LVBA 1P2JA 3FANA 2VH0A 4YLQH 1VITG 2VWNA 3R3GB 3O8DA 4U2WA 1HAOH 2WZQA 1F2SE 5EJZA 5E8EH 1EOJA 5KGOA 5K0HA 1NT1A 5HM2A 5C0TA 5LGOA 3RXMA 1G2LA 5GNDA 3HPTB 1O2RA 4K2YA 2KM0A 1CQQA 2JETC 1MTNC 2FYRA 1GCDA 4X2VA 1Z1IA 5FPTA 1BTUA 1NC6A 2PLXA 5AHGH 1TOMH 4ABIA 2ANKH 1FY5A 3DHKH 2BVSH 3FFGA 2B7DH 1TNJA 3F9EA 4Q7YA 2QE7D 3PROA 1NZQH 3BV9B 1BITA 1F7ZA 2CGAA 1O2QA 3CS7A 1GL1A 5TCAA 1CGJE 2XXLA 1J14A 5E0GA 1UHBB 2A1DB 4UFGH 1S6HA 5CHAC 1HAVA 3FP8E 1V2LT 2BYAX 1EZUC 1QURH 1AU8A 3F2HA 2QA9E 4X6PA 3E91A 1TGNA 3SJ8A 5HXFA 1G36A 1UVUH 1HIAA 4O9VA 1AO5A 3OY5U 4NA9H 4XBDA 2WSSD 5FAHA 4X8TH 4FVDA 3SGQE 1CGHA 1ZSLA 5H4IB 1SGFG 1PQ5A 1MCVA 2FPZA 3ZZCA 1NO9H 3A83A 3H5CB 1SGPE 2FS8A 1KLTA 2ZFFH 4Y8ZA 3M7UA 1G32B 1SHYA 1YPMH 1HRTH 3M5LA 3T5FH 2BD5A 4Y8XA 1ESBA 4Y0YE 2P16A 4K1SA 3LOXA 5JYIA 4KTUA 1SL3A 1BOQA 1S6LA 2F43B 4KELA 2ZCHP 4I8GA 1GDQA 3DSGA 1UTJA 2Z3DA 1GVKB 1B0EA 4ZKSU 2IJOB 2WPLS 2FTMA 4P00A 4A1VA 5EXNA 5DP3A 4LZ4B 3H09A 3ZVGA 1EAWA 1WBGB 4I86A 2ZP0H 8KME2 2Z9LA 5T6GA 5FBEA 1EOLA 1GBHA 2B0FA 4B73A 2F9OA 4K1EA 4ZHAA 4CRBA 1QBOA 4RI0A 1GBJA 1NM6A 3E3TA 2ILNA 2SGFE 1YWUA 3OYPA 1ANEA 3QZRA 4GVUA 2OC0A 1ZGIA 2OINA 4AC9A 3SBKA 1O3DA 1ZGVA 4YOGA 1Y3UA 3SW2B 3W95A 3LH1A 2QCYA 2ZC9H 2BOHB 2H9TH 1YKTA 4DG4A 1GHAF 1Z1JA 4BXWA 1EX3A 1FDPA 1ZSKA 1GMCG 1EP6A 1F5LA 2ZHFH 3BEUA 3F6UH 4NSYA 2GZ7A 3GCTG 2LNCA 1CBWC 3N7EA 2ZU2A 1L1NA 1FV9A 1O2WA 4FUCA 1F0UA 3DT0H 4KTSA 2KCPA 1UTQA 3U9AH 1BRBE 2F9VA 1KLIH 1FAKH 1K0HA 3L33A 2BLQA 1A4WH 4MNVA 3SV8A 2ZNKH 3KYGA 3TK6A 3UIRA 1ZHMA 1V6DA 2F9PA 4BTUB 3F9GA 1Y3XA 3UREA 5JPMH 4WMEA 3SU2A 2QXGA 1BJUA 1Z8IB 3RXLA 1L1JA 5IK2D 3CP7A 3S69A 5GCHG 3F3BA 2BVXH 1O2PA 4NFFA 1RIWC 2PHBA 2V35A 1C5ZB 4AGJA 2B8OH 4VGCC 1PQ8A 1ZHPA 2DUCA 1XUHA 1OP2A 4Y7BA 5LPFA 4A1XA 2JIZD 1SSXA 4R8TB 1WQVH 1ZPBA 2QY0B 1KLJH 2ZI2H 1O2MA 3T25A 2ZPSA 1FX0B 2L6OA 2QGRA 3SV7A 2J94A 3OE7D 4RSPA 1FPCH 1HJ8A 3GS9A 5JB8S 2C3SA 3T2NA 5BPEA 4MTBA 2BD8A 1TGSZ 6GCHG 4Q4LA 2HVXA 3UOUA 1DX5M 2QAAA 4Z0KA 3U69H 3M3TA 1FQ3A 1CT2E 4FUJA 2G81E 1M9UA 1EZQA 2ALVA 1UK3A 2ZCKP 1EATA 4B76A 2G52A 3LGVA 3VFEA 1TFXA 4CRFA 1YLDA 5C17A 1BRCE 3CNRA 3RC4A 4U32A 4OM9A 3G01A 3NZIA 2C8ZB 4NGAH 1CA0C 3QWCH 1QJ1B 1EPTB 1DUAA 1UTMA 5DO4H 1KIGH 3LT3A 1YPJH 1O5CB 2D1JA 2GGVB 3ZZ9A 2O9QA 1MZAA 1W7GH 2ZTXA 1OS8A 5AFYH 1ARBA 1WDIA 1HFDA 1OOKB 1PPCE 5C0UA 1YY3A 2ZFSA 2HRVA 1AI8H 2P8OB 1UK2A 1VITF 1NRSH 1AUJA 2BTCE 2UWPA 3VPKA 1JIRA 1EJNA 2TGDA 2VU8E 1C5WB 2ZDLA 4A5TS 1W12U 3RXQA 1C1MA 2XW9A 3GCHC 2QV1A 4MPVA 3T26A 2RA0A 5LH8A 4IS5A 2FX6A 1O0DH 4TY7A 5FXLA 4AFUA 1GBMA 2RCEA 3GDVA 1V2VT 3RXUA 3NCLA 4RT0A 2NU1E 4YXWD 1AKSB 1C1QA 4F48B 1SQOA 3A89A 1VCWA 1F5RA 2O8MA 2PW8H 3MNCA 3VB5A 1C5RA 3SOSA 2G5VA 1UVSH 1BQYA 2NU4E 2ZU1A 3B9FH 1L4ZA 2A7CA 2BDYA 1FI8A 4FUIA 1N8OC 5EXMA 2F83A 2BDBA 1FY8E 1SKYE 1HAPH 3KYFA 1EB2A 1OKXA 3ZV8A 1SGIB 4RN6A 1O3EA 2XCFA 1XUFA 4KKDA 4ISLA 3SNBA 1ZJKA 2BDCA 1A1RA 3LJJA 4CR9A 2YMSB 4WY3A 2Z9KA 2PP6A 5DP9A 1SGNE 1RD3B 3WWFA 2WPKS 1W8BH 3GDSA 2ZU5A 1AUTC 1E35B 1WU1A 3E1XB 2NWNA 1NPMA 4FU7A 1C1VH 3SGBE 2YNAA 4WF8A 1U6QA 2ZHDA 1C1NA 1IQKA 4FUDA 1T4UH 2D2DA 5HIZA 2J4IA 2W6JD 7KMEH 4ZXYH 1ELAA 5SGAE 2A0QB 1FJSA 4MPXA 1W0ZU 2K8IA 3D62A 1JOUB 1P0SH 3MH4A 4I33A 2GV7A 2WV4A 4I7YH 2V3HH 1ORFA 4X6MA 3S9BA 1G3DA 3WW7A 1UTKA 2ANMH 3AAVA 3LGIA 1MCTA 3LDXH 4AN7A 5HIYA 1MKWH 2G55A 1HBTH 2Y82A 1XKBC 1BRAA 1O2TA 4NIXA 4GHTA 4J1YA 1NU9A 3QTOH 4ABHA 2BY9X 1AB9B 1DFPA 1YBWA 1UVTH 1UVOA 2HNTC 1GBKA 1VR1H 1TX7A 2VGCC 4OS7A 2FLRH 1ZRBA 3ZZBA 1UCYH 1MTVA 1TBRH 2Q6DA 3ZZ4A 1DS2E 2ZGXH 3TLOA 4DW2U 1MTWA 1C4U2 3PM3A 2QC2A 1ZLRA 2SFAA 4H6SB 4XBCA 1O3MA 4DJZB 3QO6A 2BXTH 5C67A 4ZHMU 3P8GA 1IQIA 4FUEA 4I8JA 1GL0E 4DY7B 1TNHA 3ZVCA 2OXSA 5C1XA 4HG6A 4X0WU 4BTIB 3DUXH 5EG4A 2OK5A 1KXFA 4TPIZ 1NESE 1WUNH 2VIPA 2Y81A 3E16B 3Q3YA 1MTNB 1E1RD 1C2FA 2Z94A 3ATWA 2VIDA 2WV9A 1O36A 3GY3A 3VGCC 1Y3WA 3S9CA 2HNTE 4CRAA 2O8TA 1GMCF 3SI3H 3TK9A 3U8OH 1H8DH 2AGIX 5L2ZH 1O3KA 1P9UA 1ID5H 1DOJA 4O03A 4YM9A 1BTWA 3DA9B 3H7TA 3UTUH 4NIYA 7ESTE 1GBFA 1CE5A 1P12E 1TQ7B 4MVNA 4UONA 2RA3A 3PYHA 3GY7A 1HAVB 3TH4H 1YP9A 5CHAB 4XD7D 2ZHQH 1O31A 1TA6A 1H4WA 3ELAH 1GBIA 1P8VC 4BAQB 1P2QA 2BQ7B 2ZFTA 5DJ7A 1BIOA 5GCHF 1LVYA 1ZHRA 1ABIH 3E0PB 1GJ7B 1BTHH 3F2GA 1LMWB 1L0ZA 3ZZ7A 1GGDB 1YCPH 1EJAA 2STAE 3GY5A 4X1PU 3RM0H 4D9QA 1DWBH 2WPIS 1LCYA 2ZDNA 2V3MA 1MKXH 2BDGA 1GJ6A 3K65B 1DY9A 1J8AA 1EPTA 3E90B 3DFJA 3URCA 3M61U 3A84A 1XX9A 3LPRA 4ACAA 6GCHF 5A8YA 1HAXB 4BANB 5EPNA 4ZMAH 7LPRA 2FWWA 5C3NA 2QF0A 1VZQH 4JZFH 2G4TA 4AFZA 1Y5UT 4ZKRU 1HJAB 1NFYA 4TWYA 3MYWA 4ZH8A 2FOBA 1BUIA 3FZZA 3MNSA 5E0JA 3F68H 4Y79A 2V7QD 4IMQA 2BLVA 1W14U 2GP9B 1FLEE 1TLDA 2TPIZ 5EW1H 1IAUA 1SLWB 2P94A 3HGPA 5GWZA 2W7UA 1TQ0B 1AQ7A 9ESTA 1ELTA 1AKSA 2PFEA 1YYY1 4ABFA 1TGCA 2QIQA 3U1IB 2OQ5A 3V12A 4ZCNA 1EZSC 4SGBE 2FIRH 3BTHE 4NIWA 5IDKA 1XUIA 3FN8A 3P8NA 3BG8A 2FZZA 3S7KB 2UUJB 3RXGA 3UNRA 1MU6B 2V0BA 1PPBH 4NZLA 2FOMB 2PGQB 4XDEA 3STJA 4CHAC 4FU8A 2SGDE 3VB3A 3SU0A 1O5FH 5HKKD 1FAXA 4MDSA 5EU8A 1W7XH 4AYVB 1HPGA 1CBWB 3MHWU 4AX9H 1ELBA 1C2MA 1EXFA 1LPGB 3OEHD 1TMTH 5C1UA 3A8CA 5JBTA 4BNRA 3QK1A 2EI7A 1WYKA 1HUTH 1AD8H 1O2IA 1FY4A 4OGXA 2FXRA 5F03A 1CHGA 4WVPE 1TPSA 1NBMD 3M36A 4RKJB 4WWYA 3AAUA 1Z6JH 1DY8A 2ZGBH 1FNIA 1RIWB 1TALA 1VCQA 2H6MA 1C2LA 2BD3A 4VGCB 2RDEA 2AMQA 1FUJA 2Y5GA 3SU4A 5A8XA 1RRKA 1TAWA 3UWIA 3ZIAD 1CSOE 1A3EH 1E37B 1GHYH 2OCVB 1BBRK 2FESH 5C20A 1O39A 2JH5D 2WPJS 2FMJA 1SI5H 1V2KT 2GVFA 3UY9A 2KAIA 1Y5BT 2VBCA 1O2GH 5AF9H 2B9LA 1MAYA 3RXHA 4KTCA 3NK8A 2A4QA 2BY5X 4CRCA 2C8WB 1SGRE 2GT7A 3OEED 1THRH 1O2OA 5T1VA 3AK5A 1GCTC 4Q63A 3UB0A 1BMLA 3MH7A 1THPB 4D7GA 1S81A 3ENSB 3UR6A 1C1OA 1YPGH 4IGDA 2J98A 3A86A 1BTXA 1HYLA 5EIYA 4R0IA 2VIWA 3E8LA 2ZDAH 1O3JA 5F6MA 3F9HA 4JZDH 1C5SA 3BIVH 1K1IA 1V2WT 1F0SA 4CBNA 1A61H 3RMOH 3SJOA 1S85A 3OU0A 1SFIA 1TIOA 3MU4A 2PV9B 2FO9A 3RXSA 5KECA 1J9CH 3RXDA 1ELCA 1LPZB 4AG1A 1ETRH 3FKSD 1NBME 1C5OH 4O3UA 2ZDMA 1ZJDA 1KYNA 1HNEE 2ZEBA 2VINA 3FP6E 3ZVBA 1DLKB 1TWXB 2OBQA 3Q00A 4WH8A 5AFZH 2HVYB 4MQAA 1WTHD 4M7GA 1EQ9A 1PYTD 4NWKA 3Q76A 1GHZA 1Y3YA 3LKWA 4JMYA 1UVPA 5T6FA 3ZZAA 2FM2A 3BTEE 4NFEA 2G5NA 3MMGA 1SPJA 5CHBA 1D3TB 1SGQE 1N8OB 2R0KA 1O2JA 2ZQ1A 4ZAEA 3PWBA 3KF2A 4Z6AH 2AERH 6CHAB 2EC9H 2HLDD 4GAWA 3I77A 5FCRA 2D8WA 3QX5H 3UR9A 2AIQA 1SQTA 4AG2A 3SYJA 3L6PA 3SU6A 4D7FA 1XVMA 2NU2E 4X6NA 2WUCA 4DURA 2WUBA 4ZXXH 1W0JD 4B2AA 5EPYA 1GBCA 5DP8A 2ZFRH 1GI9B 5PTPA 2A5IA 2GT8A 2JH6D 1GI5A 1TNLA 4JK6A 2F9UA 1PYTC 2ODPA 2UUYA 3TK5A 1Q31A 2ZFPH 1JRSA 2XBVA 2A4RA 3GYLB 1TGTA 3M3VA 4YTAA 2FI3E 3K9XB 4HGCA 3MU5A 3LGTA 4ASHA 1YPKH 2Y7ZA 5JDUB 5DKMA 1T8OA 3OSYA 1OSSA 1NRNH 3ZZ6A 1LDTT 3KGPA 2Q6GA 4IN2A 3LGWA 3SHCH 1KXDA 1OHHD 1D6RA 1V2RT 1BMNH 2W6ID 2BZ6H 2XWAA 5E2OA 5EQSA 3BEIB 2CV3A 1NFXA 4NG9H 2C8YB 2D26C 5JB9S 1QQ4A 1DM4B 2ZPQA 1O3LA 3SUGA 2W26A 2XTTB 1JXPA 5EGMA 1EUFA 1OX1A 3ATMA 1OYQA 1O3BA 1TYNA 3EYDA 3UWJH 4GCHG 1LHEH 2AS9A 3MNXA 1DT2A 5T3HA 3LU9B 4BAMB 1S6FA 3M35A 1ZPCA 4XRNA 4DCDA 2XNDD 2XC5A 4AYYB 4OS1A 1UK4A 1ZR0A 1PQAA 3TJVA 3VXEH 1P04A 4UD9H 5A09A 4K8BA 3KIDU 2VB0A 2IPHA 1GBLA 3SZEA 1AZ8A 1XUKA 1NRRH 3PV4A 2GMTC 3SO3A 2O8LA 2I6QA 3NXPA 1C1PA 1MUEB 1OWHA 1F0TA 3U98H 3VGCB 3MI4A 3RMMH 4Y76A 1HDTH 4JK5A 3OFND 5ETXA 1P02A 1UJ1A 5FX6A 1WXRA 1C5MD 1TB6H 1BCUH 1O2HA 1BBRE 3RLYH 3ZZDA 2XBXA 1EFRD 5GPIB 2RG3A 1D4PB 1ZMJA 1XMNB 3ZZ8A 1GJ4H 2SGEE 1S84A 2CHAB 2H9HA 1S0RA 4ASUD 3T27A 2HGTH 3GDUA 3NRLA 3SUDA 3SN8A 2GZ9A 4K8YA 2BD9A 1EAIA 1FN6A 3BG4B 1WV7H 2O8UA 3D49H 3KQDA 1SLUB 2Z9IA 5B6OA 1P2MA 3HKIB 2BD2A 1O3AA 4JZEH 1NRPH 2C8XB 2V3OH 4Q80A 4AGKA 1ANDA 3SJ9A 1HB0B 1UTLM 1BTYA 4LZ1H 5DGJA 1PPEE 1J15A 1BMMH 3F0OA 3FVFB 3F2FA 3SUFA 2EI6A 5HYOA 2FP7B 1GI4A 1DXPA 1GMDG 3IITA 1C2IA 2J92A 2PGBB 1K1OA 3PLBA 3U8TH 4M9FA 1YCPK 2FYQA 2XRCA 2KCOA 3RDZA 1MKXK 4ABAA 2WHXA 3S9AA 1AFQB 1O3NA 2HLCA 3OX7U 2QF4A 2VWMA
chains in the Genus database with same CATH topology
5HIYA 2J98B 5C94A 3EE7A 5HIZA 2J97A 2J98A 1UW7A 1QZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIY A;  2J98 B;  5C94 A;  3EE7 A;  5HIZ A;  2J97 A;  2J98 A;  1UW7 A;  1QZ8 A; 
#chains in the Genus database with same CATH topology
 4YLU A;  2VVU A;  2QXJ A;  1D6W A;  4NA8 A;  2ZTY A;  1MD8 A;  3RXA A;  2OLG A;  2UWO A;  1HLT H;  3UQO A;  5B6L A;  2OBO A;  1P2O A;  2FOA A;  3EE0 B;  5KED A;  1Y8T A;  1ZTL A;  1YLC A;  2LEL A;  1XM1 A;  1J16 A;  2BOK A;  4ISI H;  3RM2 H;  1G3C A;  2IOT A;  2QN5 T;  1C5Y B;  3PMB B;  1QFK H;  1AVX A;  1D3Q B;  1O32 A;  1HAZ B;  4Y11 E;  2GKV E;  1LKB A;  1THS H;  3TGK E;  1O2S A;  1K1N A;  1MQ5 A;  1OP0 A;  3D65 E;  1V2Q T;  4Y71 A;  2JKH A;  1GJ9 B;  4TY6 A;  1BTZ A;  3LC5 A;  4A92 A;  3QGJ A;  3RXC A;  2HPP H;  3BN9 A;  2EI8 A;  4HTC H;  1C2D A;  4X1N U;  4AB8 A;  2PUX B;  1AVW A;  1C5L H;  4CHA B;  3MFJ A;  2BXU H;  4K1T A;  2HNT F;  1YPH C;  2XYA A;  4GUX A;  4JZ1 A;  1AMH A;  1ZTK A;  2AYW A;  1V2S T;  1AZZ A;  4WMF A;  5DG6 A;  1DWE H;  3KQB A;  2BHG A;  1MBQ A;  1GI0 A;  1DVA H;  3UQV A;  2F3C E;  1C5X B;  2WPM S;  2CK3 D;  2HOB A;  2FOE A;  1RGQ A;  5E0H A;  2ZFQ H;  4F4O C;  1KXC A;  1ZML A;  1QJ6 B;  5I46 H;  2PTC E;  4RKO B;  3W94 A;  3B8J A;  1O38 A;  3W1E A;  1WQS A;  1O5E H;  1QRZ A;  3T62 A;  1P3E A;  2VNT A;  2UUK B;  1P2N A;  1GHV H;  1YPH E;  3A87 A;  2J97 A;  2J34 A;  5FCK A;  1LQD B;  3RXI A;  4O97 A;  4UFD H;  1IQF A;  1YCP M;  3QUM P;  1N6X A;  2ZDK A;  1GI3 A;  1O37 A;  1A0L A;  1MH0 A;  2A7J A;  1FY1 A;  3L3T A;  1V2T T;  3QN7 A;  1DPO A;  4B2C A;  1VIT H;  3TGJ E;  1TX6 A;  4JYU H;  2KAI B;  1LHD H;  3UPE A;  3ZV9 A;  4DGJ A;  1G30 B;  1LVM A;  1P10 A;  2ZA5 A;  1O35 A;  1A0H B;  1S5S A;  5E2P A;  2VH6 A;  1G37 A;  4MNY A;  3V7T A;  1GDU A;  4K60 A;  1GJD B;  1SGD E;  5EOK A;  1C2H A;  2JJ2 D;  4PRO A;  2AHM E;  2SNW A;  1GCT B;  2ZKS A;  3ZVE A;  2A31 A;  1V2M T;  2VWO A;  4FUG A;  1ACB E;  2R3U A;  3TNS A;  3RC6 A;  1P2I A;  2K0Q A;  2CF8 H;  2GZ8 A;  3EGK H;  2STB E;  3N99 A;  4I32 A;  1TPP A;  4H4F A;  4ISO A;  3AAS A;  3SU5 A;  3UUZ A;  2J98 B;  4I31 A;  2PKS C;  1G9I E;  3A7W A;  3BIU H;  2JET B;  2VWL A;  1K1M A;  5F8T A;  3M5M A;  4CRE A;  1IQE A;  5C2Z A;  2J2U A;  4OS2 A;  3RXV A;  4YOI A;  3RXJ A;  3F9F A;  3RLW H;  3PLP A;  3QTV H;  1GDN A;  4YT6 H;  2P3T B;  2FOC A;  2ZHW H;  3SNA A;  4X8V H;  4GCH F;  5LPR A;  2RFK C;  3NWU A;  3PO1 C;  4INH A;  3STI A;  5FPS A;  2CF9 H;  3TVJ B;  3GY4 A;  4NZQ A;  4CH8 B;  4ZKO U;  3RU4 T;  1PPG E;  2VVV A;  1FZZ A;  1ELF A;  3BTG E;  2BY6 X;  4JYV H;  4QT8 C;  3FZD A;  1G2M A;  1RS0 A;  3AW1 A;  2DE9 A;  3Q77 A;  1WCZ A;  1KSN A;  2ANY A;  1C5V A;  2AMP A;  4TPY A;  1SFQ B;  2FTL E;  2BVR H;  3U8R H;  1CHO F;  3D23 A;  2FOF A;  1O5G H;  1C1T A;  1QTF A;  2BDH A;  2FOH A;  4KP0 A;  2W5E A;  4UEH H;  2VJ1 A;  4BAK B;  1SOT A;  1E79 D;  4JZI A;  1BT7 A;  1NN6 A;  1ZSJ A;  4OS6 A;  3EST A;  3TJO A;  3Q3X A;  3GY6 A;  4FUB A;  1O3P B;  2TBS A;  4XOJ A;  5EQQ A;  4NCY A;  1OP8 A;  1FON A;  5EST E;  4E05 H;  3FOA A;  2A5K A;  4WJG 2;  5HM9 A;  4DII H;  2A45 B;  2AIP A;  1DLE A;  1ANB A;  1HAI H;  1VJA U;  1P03 A;  1HAH H;  5EJL A;  4FVB A;  1WTG H;  3UFA A;  3PRB A;  2OQU A;  1DIT H;  1E1Q D;  2C90 B;  2TRM A;  1A0J A;  3NPS A;  1JRT A;  1AVG H;  3TJN A;  2ZU4 A;  3GOV B;  4YES B;  4D8N A;  5GIB A;  2A5A A;  3KHV A;  4BOH A;  3V13 A;  2QF5 A;  1W3C A;  1O2V A;  3VG8 A;  2I6S A;  3RXR A;  3WY8 A;  2ZWL H;  2C93 B;  3A8B A;  1T32 A;  4X8S H;  1ESA A;  1Z8G A;  4U01 A;  1GMD F;  1OWE A;  1Y3V A;  3BF6 H;  1SG8 B;  2YMS D;  3KN2 A;  1BHX B;  2A2Q H;  1J17 T;  1EAX A;  1GWA A;  1V2U T;  1C2J A;  2OC1 A;  2UUF B;  2ZQ2 A;  2FEQ H;  2A2X H;  2W7S A;  2WIN I;  3HK3 B;  1SLV B;  4K5Z A;  2F9N A;  3AW0 A;  3QDZ B;  4Y6D A;  2BDA A;  4YO9 A;  3VB6 A;  1S83 A;  1AN1 E;  1IQJ A;  4ZHL U;  1TPO A;  2GX4 A;  1NRQ H;  1P57 B;  3KCG H;  3MH5 A;  4WXV A;  1O2N A;  3K6Z A;  1OWD A;  4BTT B;  1MU8 B;  3RXP A;  2A4O A;  1P06 A;  3F0P A;  1IQN A;  1T7C A;  5A2M H;  1ETS H;  1TE0 A;  1WSS H;  4Y10 E;  2QF3 A;  1IHT H;  1PFX C;  2Y6T A;  2CJI A;  1GBA A;  3JZ1 B;  7GCH G;  5EJ1 A;  4E06 H;  1BMA A;  3GYM A;  1ZYO A;  6EST A;  2WPD D;  5EQR A;  1Z8R A;  1O3O A;  1GI1 A;  1O5D H;  1Z8J B;  2P3F H;  3PWC A;  3RP2 A;  1T31 A;  2GMT B;  2NU0 E;  4UE7 H;  2H5C A;  4XFQ A;  1PJP A;  1VGC C;  3HKJ B;  3DD2 H;  1ELV A;  2BY8 X;  2XCN A;  4NA7 A;  3A81 A;  1MD7 A;  3BTF E;  1O33 A;  3K6Y A;  2GTB A;  1SVP A;  1OYT H;  1QNJ A;  3CEN A;  1AFE H;  1JIM A;  3OAA D;  2PSY A;  1W11 U;  4TYD A;  3DFL A;  4MG3 A;  5FBI A;  1S0Q A;  3RXT A;  2ANW A;  3A7X A;  2P93 A;  3KQ5 A;  1Y59 T;  1LHF H;  5DSF A;  1A46 H;  2ZO3 H;  5GXP A;  5HGG A;  1TA2 A;  4K3J A;  4GPG A;  2R2W U;  2P95 A;  1ELE E;  4K69 A;  4Y0Z E;  3ZZ3 A;  1TBQ H;  1OWJ A;  1QHR B;  1F5K U;  1C1W H;  1D9I A;  4X1S U;  1OPH B;  1O30 A;  4MLF B;  1SLX B;  2LP6 A;  2KFW A;  2KCA A;  3P92 A;  2ODQ A;  4Q7Z A;  2PSX A;  1NS3 A;  3ATL A;  1SGC A;  2GCH G;  2FI4 E;  1L4D A;  1GHW H;  4DT7 B;  4B74 A;  1K1L A;  1CA0 B;  3RC5 A;  5L6N H;  3LC3 A;  4SGA E;  2GCT C;  2BX3 A;  3A7V A;  5C1Y A;  3N7O A;  2IN2 A;  1C4V 2;  3U28 C;  1ETT H;  1C2K A;  3SU1 A;  1EAU A;  3C27 B;  2TIO A;  2ZZU H;  2Z9J A;  4ZRO A;  4JCN A;  4WMD A;  5F8Z A;  3BTM E;  1B5G H;  4IMZ A;  5DP5 A;  1VCP A;  3V3M A;  3VB7 A;  1GI8 B;  3MU0 A;  2GDE H;  2OTV A;  5AVD A;  1K28 D;  4TWW A;  1B0F A;  1AWF H;  4F55 A;  1VKY A;  1K1P A;  2F9B H;  1P01 A;  1A5G H;  3GCH B;  1GG6 C;  1XUG A;  1RTK A;  4B2B A;  2JDI D;  3EA8 A;  1DDJ A;  3VXF H;  3TJU A;  4DT4 A;  1SGE E;  2EEK A;  3ZZ5 A;  1E36 B;  3A8A A;  4IBL H;  1QA0 A;  1BHX F;  2QXI A;  1PPH E;  1COW D;  5DN6 D;  4CR5 A;  1GBD A;  4X6O A;  3DCL A;  1VJ9 U;  2SNV A;  2Y5H A;  1DUE A;  1V2J T;  3ZVA A;  1YLN A;  4MNX A;  1UMA H;  5JBC S;  5DP4 A;  2BZA A;  1W2K H;  4GHQ A;  4WH6 A;  1QRW A;  2F91 A;  4I8L A;  1Z6E A;  4BXS A;  3O8C A;  5C5N A;  1A7S A;  1GGD C;  1HGT H;  1DSU A;  4P02 A;  1V2P T;  2R3Y A;  3EA7 A;  2GV6 A;  1Q2W A;  2L74 A;  2J5U A;  3OY6 U;  2CN0 H;  1B7X B;  1GI2 A;  1TBZ H;  3SU3 A;  2PUQ H;  4B6F A;  5C94 A;  4WXI A;  4AZ2 B;  3PRD A;  4Q2K A;  2WYJ A;  4E7N A;  1BDA A;  2PR3 A;  3RXB A;  4DVA U;  1O34 A;  4A1T A;  3P8F A;  1BMF D;  2HWL B;  4NSV A;  1W10 U;  1NRO H;  1HJA C;  1MTU A;  2ZDV H;  1AY6 H;  1HXF H;  1C1U H;  1MAX A;  4D76 A;  5L30 H;  4FOU C;  3VEQ B;  1CGI E;  4CBO A;  1GI6 A;  3RML H;  1V2N T;  3ATK A;  4CRG A;  3I78 A;  3EE7 A;  4YOJ A;  1GVL A;  4THN H;  1O3I A;  1XXD A;  1ZZZ A;  4TSF D;  2OD3 B;  4E7R G;  4AOQ A;  1LVO A;  1YM0 A;  1LHC H;  1O3G A;  2ZIQ H;  2F4L A;  3MH6 A;  3M7T A;  3BTK E;  4YT7 H;  2ZPR A;  3NUM A;  4UDW H;  2BB4 A;  3M5O A;  1JWT A;  5G4B A;  2EQN A;  3O8R A;  1HCG A;  2VGC B;  4X8U H;  1S82 A;  3TNT A;  1SMF E;  2OC8 A;  1MKW K;  3IG6 B;  1PPZ A;  3FO8 D;  2AGE X;  2XC0 A;  2ZGC A;  1JMO H;  1BTP A;  2SGA A;  1FXY A;  1YPE H;  2G00 A;  1TNI A;  3KL6 A;  2R9P A;  3LGU A;  1F0R A;  3ODD A;  1GJ8 B;  1UCY K;  3GY8 A;  1C1R A;  3A7Z A;  1XUJ A;  2BY7 X;  1EJM A;  3BTW E;  4XSK U;  4X1Q U;  2PKS B;  1K2I 1;  3P8O A;  1KTS B;  3E6P H;  2TGA A;  1CHO G;  1TX8 A;  1AHT H;  3PB1 E;  5GDS H;  3RU4 D;  2G51 A;  3SNC A;  3SZN A;  8LPR A;  1ZTJ A;  1DXW A;  3ZYD A;  1MAB B;  1QGF A;  2BQ6 B;  1A5I A;  1KXB A;  3FAO A;  1MMJ N;  3MO9 A;  3SV6 A;  1WOF A;  1GJB B;  3M5N A;  2J95 A;  4CRD A;  2Q6F A;  2Q1J A;  3S7H B;  3SOR A;  2H5D A;  3MOC A;  3QLP H;  3ZVD A;  3QZQ A;  3UOP A;  3UAI C;  3PO1 B;  1UTO A;  2XBW A;  7GCH F;  2PWX A;  1T8L A;  1TON A;  4B71 A;  1BBR H;  1AE8 H;  1TAB E;  2FI5 E;  1NTP A;  3SJI A;  1MBM A;  2GD4 B;  1GI7 B;  1CT0 E;  2BM2 A;  2FDA A;  4J2Y B;  3T28 A;  5T6D A;  2Y7X A;  5FHT A;  3SJK A;  5HMA A;  2UWL A;  3T29 A;  5J4Q A;  1ZMN A;  1FY3 A;  1QB1 A;  2VIV A;  4ABE A;  1GBB A;  5CMX H;  1A5H A;  1FPH H;  3ITI A;  5I25 A;  3ATI A;  3RXO A;  2Z9G A;  1QBV H;  3I29 A;  3BTD E;  1BRU P;  1YPL H;  3FP7 E;  2TGP Z;  2Y80 A;  4HFP B;  2A4G A;  1Z7K A;  1E34 B;  1L1G A;  5DK1 A;  1RTF B;  1C5P A;  5C5O A;  1TGB A;  4MPW A;  4H42 U;  1C5T A;  1EZX C;  3HGN A;  2LPR A;  1E38 B;  2R2M B;  2FLB H;  1L2E A;  1O5B B;  3PLK A;  1SB1 H;  1GBT A;  3A80 A;  4X2Y A;  1EAS A;  1FMG A;  1O3C A;  4IC6 A;  2BMG B;  3PMA B;  1TPA E;  2JH0 D;  4AFQ A;  3A7Y A;  2KCY A;  1AWH B;  1GMH G;  3RU4 E;  2EST E;  2KX4 A;  2VIQ A;  2GCH F;  3BTQ E;  1GPZ A;  2RDL A;  2Z3E A;  1F92 A;  2ZG0 H;  2GDD A;  4AB9 A;  1TNK A;  1QB9 A;  3TPI Z;  4HI3 A;  6LPR A;  4LK4 A;  1TRY A;  5ESB A;  1D3P B;  3A8D A;  2XBY A;  4XBB A;  1O2Z A;  1C4Y 2;  3BSQ A;  1IHS H;  1UHB A;  2XNI A;  1O2L A;  3A88 A;  1GVZ A;  3V0X A;  3RUO A;  2ZF0 H;  3DSP A;  3P70 B;  3EA9 A;  1UW7 A;  1H8E D;  1DE7 H;  1NFW A;  4D9R A;  1K22 H;  1IQL A;  1UTP A;  1FIZ A;  3SQH E;  1GHB G;  4FUH A;  3SI4 H;  4B6E A;  1GBE A;  5TJX A;  1IQH A;  1QIX B;  3TH3 H;  3LJO A;  5ABW A;  5TCC A;  4UFE H;  2CXV A;  4INL A;  2BD7 A;  1NU7 B;  1TMU H;  1LO6 A;  4Z1M D;  3S0N A;  2FOG A;  1ZPZ A;  4X2W A;  1HV7 A;  2THF B;  4FXG H;  4KGA A;  4ZKN U;  1SGT A;  4A6L A;  4NWL A;  3ZVF A;  1FN8 A;  6CHA C;  1CT4 E;  1SBW A;  3GCN A;  1ARC A;  3MO6 A;  3O8B A;  3SV9 A;  1Z71 A;  2ZCL P;  2ZHE H;  1H9L B;  2P59 A;  1XVO A;  1BB0 B;  1A3B H;  2XOK D;  1QBN A;  1VGC B;  1V2O T;  1YF4 A;  4FUF A;  1EB1 H;  2TGT A;  8EST E;  5FPY A;  1A2C H;  5FX5 A;  1FIW A;  1H8I H;  1WAY B;  1O2K A;  3EDX B;  4LOY H;  4A7I B;  2ZTZ A;  1C1S A;  1G3B A;  1IQG A;  1BZX E;  2W3K A;  3LH3 A;  3MTY A;  1N1L A;  4Y7A A;  3QGN B;  1GHX H;  1ABJ H;  4CH2 B;  5K7R A;  2O8W A;  3KQC A;  3DSO A;  1RFN A;  1CVW H;  1MTS A;  5JBA S;  8GCH G;  2XC4 A;  3EAJ A;  3K2U A;  1LQE A;  1SOZ A;  3GCO A;  1C5Q A;  3ODF A;  1K1J A;  5GJ4 B;  2BD4 A;  2IJD 1;  4RT1 A;  1H1B A;  4BAH B;  4ABB A;  2Y5F A;  3SV2 H;  4FET A;  1YC0 A;  3E0N B;  1UCY E;  2PKA B;  2DE8 A;  3MNB A;  1V3X A;  1T4V H;  2BLO A;  3IWM A;  3M7Q A;  1CU1 A;  3M37 A;  1KDQ B;  1ZRK A;  5L2Y H;  1QA7 A;  1DWD H;  3PMH B;  4U30 A;  4MNW A;  2H1U A;  4UFF H;  1QCP A;  2GCT B;  3HK6 B;  1EKB B;  1N6Y A;  1W0K D;  2SGP E;  3LIW A;  1QL8 A;  4B75 A;  2ALP A;  5EOD A;  2M5T A;  2YOL A;  3AVZ A;  2A32 A;  3SQE E;  2WV5 A;  1C5U A;  2YNB A;  3TU7 H;  1CO7 E;  1MZD A;  2VVC A;  2R0L A;  3TH2 H;  4ZUH A;  1KY9 A;  1SGF A;  2J38 A;  3M3S A;  1OWK A;  5IYT A;  1ELG A;  4YZU A;  2HAL A;  1QL9 A;  3SHA H;  1LHG H;  3P17 H;  3BTT E;  1Q3X A;  1QL7 A;  1O2Y A;  2WPH S;  1JBU H;  1GG6 B;  5JBB S;  1H9I E;  2EY4 C;  1SQA A;  3GCT F;  1DIC A;  1W0Y H;  1SGY E;  1TNG A;  2G4U A;  4NIV A;  2QYI A;  1G3E A;  5DP6 A;  4ABD A;  4JYT A;  2CHA C;  3OTP A;  2GJG A;  3HAT H;  4X1R U;  4INK A;  2ZU3 A;  2BX4 A;  1QJ7 B;  1LTO A;  2OC7 A;  3GIC B;  4F49 A;  3A7T A;  4LXB H;  5CDF E;  3MU1 A;  1HIA B;  3BG4 C;  1O3H A;  1C2G A;  1T8M A;  3PTN A;  2H9E H;  3SND A;  4MPU A;  1KMH B;  1RTL A;  3B23 B;  1K9O E;  1TOC B;  4I8H A;  1NFU A;  1QY6 A;  2C4F H;  1BA8 B;  1C2E A;  3ZYE A;  1C5N H;  2ULL A;  2WYG A;  5BRR E;  1Y5A T;  2VIO A;  1EPT C;  1ZOM A;  3PV5 A;  4Y8Y A;  2ZGH A;  3JZ2 B;  1TRM A;  1P2K A;  4GSO A;  1P9S A;  1P09 A;  1QZ8 A;  2BDI A;  1IOE A;  2AH4 X;  5F8X A;  4B1T A;  1AGJ A;  2W3I A;  1HXE H;  1SR5 C;  1YGC H;  3SGA E;  2ODY B;  1ELD E;  3RMN H;  2NU3 E;  3OTJ E;  1AFQ C;  5A8Z A;  2B5T B;  3P6Z B;  1QQU A;  3KNX A;  4ABG A;  2P8O C;  2M2A A;  1LKA A;  1P05 A;  2EA3 A;  1XXF A;  4ISN A;  1DWC H;  3PTB A;  1GHA G;  2SGQ E;  3RXK A;  3NKK A;  1EP5 A;  1OXG A;  1C9P A;  2JJ1 D;  1KXE A;  5LPE A;  2AMD A;  2FX4 A;  2BQW B;  2HPQ H;  1SQR A;  3MWI U;  4GLY A;  1O3F A;  3KQE A;  2OUA A;  1UO6 A;  1HJ9 A;  3VB4 A;  3Q3K A;  5A0C A;  3TGI E;  3KEE A;  4O3T A;  1GMH F;  5EXL A;  2BLW A;  5A0A E;  1CA8 B;  2J9N A;  5DP7 A;  2AEI H;  1X7A C;  1TRN A;  1QB6 A;  3P95 A;  4AOR A;  2V6N A;  4DOQ A;  3RXF A;  1P3C A;  1RJX B;  5J4S A;  1HAG E;  1T8N A;  3CS0 A;  2AGG X;  3A82 A;  2Z3C A;  4ISH H;  1DST A;  3N7D A;  1P11 E;  1XKA C;  1E0F D;  3PV2 A;  5A0B A;  1KTT B;  1GJ5 H;  1ANC A;  4AFS A;  1D3D B;  4I8K A;  1NY2 2;  3LON A;  4XE4 A;  2YMS C;  4EST E;  1HAY B;  3R0F A;  2P3U B;  1MQ6 A;  2Z6B D;  3WWB A;  1GHB F;  1H9H E;  1PPF E;  2AFQ B;  1SC8 U;  2ASU B;  2OP9 A;  3LGY A;  1GJA B;  1TMB H;  3SNE A;  3BEF B;  5FL7 D;  4OS5 A;  5DPA A;  3MU8 A;  3F1S B;  1PQ7 A;  3RXE A;  2PTN A;  4Q7X A;  1DAN H;  4IN1 A;  5EW2 H;  2G8T A;  1W13 U;  4TT3 D;  3H7O A;  4H6T A;  3SUE A;  4ACB A;  3TIU A;  3GY2 A;  4HZH A;  2QXH A;  3GIS B;  3EQ0 H;  2FOD A;  2A7H A;  4OGY A;  5F53 A;  2K1Q A;  1EST A;  1QR3 E;  2KZ4 A;  3PMJ A;  1K21 H;  1SHH B;  2H2Z A;  3UNQ A;  1O2U A;  3TIT A;  1O5A B;  1LPK B;  3A85 A;  1O2X A;  5CE1 A;  1AIX H;  1GJC B;  1INC A;  2Z7F E;  9LPR A;  4IW4 E;  4DIH H;  3UNS A;  1IQM A;  3MO3 A;  4FU9 A;  2ZEC A;  2IPQ X;  2PKA A;  1AE5 A;  1AB9 C;  1BJV A;  3C1K A;  1QRX A;  2XWB I;  4OS4 A;  2ZGJ A;  1KDQ A;  2FS9 A;  4IC5 A;  4BAO B;  2KR7 A;  1KXA A;  1H8H D;  3U1J B;  8GCH F;  2CMY A;  1OWI A;  1C9T A;  1RXP A;  4X2X A;  4ABJ A;  1UTN A;  3URD A;  3MQK C;  1LVB A;  1P2J A;  3FAN A;  2VH0 A;  4YLQ H;  1VIT G;  2VWN A;  3R3G B;  3O8D A;  4U2W A;  1HAO H;  2WZQ A;  1F2S E;  5EJZ A;  5E8E H;  1EOJ A;  5KGO A;  5K0H A;  1NT1 A;  5HM2 A;  5C0T A;  5LGO A;  3RXM A;  1G2L A;  5GND A;  3HPT B;  1O2R A;  4K2Y A;  2KM0 A;  1CQQ A;  2JET C;  1MTN C;  2FYR A;  1GCD A;  4X2V A;  1Z1I A;  5FPT A;  1BTU A;  1NC6 A;  2PLX A;  5AHG H;  1TOM H;  4ABI A;  2ANK H;  1FY5 A;  3DHK H;  2BVS H;  3FFG A;  2B7D H;  1TNJ A;  3F9E A;  4Q7Y A;  2QE7 D;  3PRO A;  1NZQ H;  3BV9 B;  1BIT A;  1F7Z A;  2CGA A;  1O2Q A;  3CS7 A;  1GL1 A;  5TCA A;  1CGJ E;  2XXL A;  1J14 A;  5E0G A;  1UHB B;  2A1D B;  4UFG H;  1S6H A;  5CHA C;  1HAV A;  3FP8 E;  1V2L T;  2BYA X;  1EZU C;  1QUR H;  1AU8 A;  3F2H A;  2QA9 E;  4X6P A;  3E91 A;  1TGN A;  3SJ8 A;  5HXF A;  1G36 A;  1UVU H;  1HIA A;  4O9V A;  1AO5 A;  3OY5 U;  4NA9 H;  4XBD A;  2WSS D;  5FAH A;  4X8T H;  4FVD A;  3SGQ E;  1CGH A;  1ZSL A;  5H4I B;  1SGF G;  1PQ5 A;  1MCV A;  2FPZ A;  3ZZC A;  1NO9 H;  3A83 A;  3H5C B;  1SGP E;  2FS8 A;  1KLT A;  2ZFF H;  4Y8Z A;  3M7U A;  1G32 B;  1SHY A;  1YPM H;  1HRT H;  3M5L A;  3T5F H;  2BD5 A;  4Y8X A;  1ESB A;  4Y0Y E;  2P16 A;  4K1S A;  3LOX A;  5JYI A;  4KTU A;  1SL3 A;  1BOQ A;  1S6L A;  2F43 B;  4KEL A;  2ZCH P;  4I8G A;  1GDQ A;  3DSG A;  1UTJ A;  2Z3D A;  1GVK B;  1B0E A;  4ZKS U;  2IJO B;  2WPL S;  2FTM A;  4P00 A;  4A1V A;  5EXN A;  5DP3 A;  4LZ4 B;  3H09 A;  3ZVG A;  1EAW A;  1WBG B;  4I86 A;  2ZP0 H;  8KME 2;  2Z9L A;  5T6G A;  5FBE A;  1EOL A;  1GBH A;  2B0F A;  4B73 A;  2F9O A;  4K1E A;  4ZHA A;  4CRB A;  1QBO A;  4RI0 A;  1GBJ A;  1NM6 A;  3E3T A;  2ILN A;  2SGF E;  1YWU A;  3OYP A;  1ANE A;  3QZR A;  4GVU A;  2OC0 A;  1ZGI A;  2OIN A;  4AC9 A;  3SBK A;  1O3D A;  1ZGV A;  4YOG A;  1Y3U A;  3SW2 B;  3W95 A;  3LH1 A;  2QCY A;  2ZC9 H;  2BOH B;  2H9T H;  1YKT A;  4DG4 A;  1GHA F;  1Z1J A;  4BXW A;  1EX3 A;  1FDP A;  1ZSK A;  1GMC G;  1EP6 A;  1F5L A;  2ZHF H;  3BEU A;  3F6U H;  4NSY A;  2GZ7 A;  3GCT G;  2LNC A;  1CBW C;  3N7E A;  2ZU2 A;  1L1N A;  1FV9 A;  1O2W A;  4FUC A;  1F0U A;  3DT0 H;  4KTS A;  2KCP A;  1UTQ A;  3U9A H;  1BRB E;  2F9V A;  1KLI H;  1FAK H;  1K0H A;  3L33 A;  2BLQ A;  1A4W H;  4MNV A;  3SV8 A;  2ZNK H;  3KYG A;  3TK6 A;  3UIR A;  1ZHM A;  1V6D A;  2F9P A;  4BTU B;  3F9G A;  1Y3X A;  3URE A;  5JPM H;  4WME A;  3SU2 A;  2QXG A;  1BJU A;  1Z8I B;  3RXL A;  1L1J A;  5IK2 D;  3CP7 A;  3S69 A;  5GCH G;  3F3B A;  2BVX H;  1O2P A;  4NFF A;  1RIW C;  2PHB A;  2V35 A;  1C5Z B;  4AGJ A;  2B8O H;  4VGC C;  1PQ8 A;  1ZHP A;  2DUC A;  1XUH A;  1OP2 A;  4Y7B A;  5LPF A;  4A1X A;  2JIZ D;  1SSX A;  4R8T B;  1WQV H;  1ZPB A;  2QY0 B;  1KLJ H;  2ZI2 H;  1O2M A;  3T25 A;  2ZPS A;  1FX0 B;  2L6O A;  2QGR A;  3SV7 A;  2J94 A;  3OE7 D;  4RSP A;  1FPC H;  1HJ8 A;  3GS9 A;  5JB8 S;  2C3S A;  3T2N A;  5BPE A;  4MTB A;  2BD8 A;  1TGS Z;  6GCH G;  4Q4L A;  2HVX A;  3UOU A;  1DX5 M;  2QAA A;  4Z0K A;  3U69 H;  3M3T A;  1FQ3 A;  1CT2 E;  4FUJ A;  2G81 E;  1M9U A;  1EZQ A;  2ALV A;  1UK3 A;  2ZCK P;  1EAT A;  4B76 A;  2G52 A;  3LGV A;  3VFE A;  1TFX A;  4CRF A;  1YLD A;  5C17 A;  1BRC E;  3CNR A;  3RC4 A;  4U32 A;  4OM9 A;  3G01 A;  3NZI A;  2C8Z B;  4NGA H;  1CA0 C;  3QWC H;  1QJ1 B;  1EPT B;  1DUA A;  1UTM A;  5DO4 H;  1KIG H;  3LT3 A;  1YPJ H;  1O5C B;  2D1J A;  2GGV B;  3ZZ9 A;  2O9Q A;  1MZA A;  1W7G H;  2ZTX A;  1OS8 A;  5AFY H;  1ARB A;  1WDI A;  1HFD A;  1OOK B;  1PPC E;  5C0U A;  1YY3 A;  2ZFS A;  2HRV A;  1AI8 H;  2P8O B;  1UK2 A;  1VIT F;  1NRS H;  1AUJ A;  2BTC E;  2UWP A;  3VPK A;  1JIR A;  1EJN A;  2TGD A;  2VU8 E;  1C5W B;  2ZDL A;  4A5T S;  1W12 U;  3RXQ A;  1C1M A;  2XW9 A;  3GCH C;  2QV1 A;  4MPV A;  3T26 A;  2RA0 A;  5LH8 A;  4IS5 A;  2FX6 A;  1O0D H;  4TY7 A;  5FXL A;  4AFU A;  1GBM A;  2RCE A;  3GDV A;  1V2V T;  3RXU A;  3NCL A;  4RT0 A;  2NU1 E;  4YXW D;  1AKS B;  1C1Q A;  4F48 B;  1SQO A;  3A89 A;  1VCW A;  1F5R A;  2O8M A;  2PW8 H;  3MNC A;  3VB5 A;  1C5R A;  3SOS A;  2G5V A;  1UVS H;  1BQY A;  2NU4 E;  2ZU1 A;  3B9F H;  1L4Z A;  2A7C A;  2BDY A;  1FI8 A;  4FUI A;  1N8O C;  5EXM A;  2F83 A;  2BDB A;  1FY8 E;  1SKY E;  1HAP H;  3KYF A;  1EB2 A;  1OKX A;  3ZV8 A;  1SGI B;  4RN6 A;  1O3E A;  2XCF A;  1XUF A;  4KKD A;  4ISL A;  3SNB A;  1ZJK A;  2BDC A;  1A1R A;  3LJJ A;  4CR9 A;  2YMS B;  4WY3 A;  2Z9K A;  2PP6 A;  5DP9 A;  1SGN E;  1RD3 B;  3WWF A;  2WPK S;  1W8B H;  3GDS A;  2ZU5 A;  1AUT C;  1E35 B;  1WU1 A;  3E1X B;  2NWN A;  1NPM A;  4FU7 A;  1C1V H;  3SGB E;  2YNA A;  4WF8 A;  1U6Q A;  2ZHD A;  1C1N A;  1IQK A;  4FUD A;  1T4U H;  2D2D A;  5HIZ A;  2J4I A;  2W6J D;  7KME H;  4ZXY H;  1ELA A;  5SGA E;  2A0Q B;  1FJS A;  4MPX A;  1W0Z U;  2K8I A;  3D62 A;  1JOU B;  1P0S H;  3MH4 A;  4I33 A;  2GV7 A;  2WV4 A;  4I7Y H;  2V3H H;  1ORF A;  4X6M A;  3S9B A;  1G3D A;  3WW7 A;  1UTK A;  2ANM H;  3AAV A;  3LGI A;  1MCT A;  3LDX H;  4AN7 A;  5HIY A;  1MKW H;  2G55 A;  1HBT H;  2Y82 A;  1XKB C;  1BRA A;  1O2T A;  4NIX A;  4GHT A;  4J1Y A;  1NU9 A;  3QTO H;  4ABH A;  2BY9 X;  1AB9 B;  1DFP A;  1YBW A;  1UVT H;  1UVO A;  2HNT C;  1GBK A;  1VR1 H;  1TX7 A;  2VGC C;  4OS7 A;  2FLR H;  1ZRB A;  3ZZB A;  1UCY H;  1MTV A;  1TBR H;  2Q6D A;  3ZZ4 A;  1DS2 E;  2ZGX H;  3TLO A;  4DW2 U;  1MTW A;  1C4U 2;  3PM3 A;  2QC2 A;  1ZLR A;  2SFA A;  4H6S B;  4XBC A;  1O3M A;  4DJZ B;  3QO6 A;  2BXT H;  5C67 A;  4ZHM U;  3P8G A;  1IQI A;  4FUE A;  4I8J A;  1GL0 E;  4DY7 B;  1TNH A;  3ZVC A;  2OXS A;  5C1X A;  4HG6 A;  4X0W U;  4BTI B;  3DUX H;  5EG4 A;  2OK5 A;  1KXF A;  4TPI Z;  1NES E;  1WUN H;  2VIP A;  2Y81 A;  3E16 B;  3Q3Y A;  1MTN B;  1E1R D;  1C2F A;  2Z94 A;  3ATW A;  2VID A;  2WV9 A;  1O36 A;  3GY3 A;  3VGC C;  1Y3W A;  3S9C A;  2HNT E;  4CRA A;  2O8T A;  1GMC F;  3SI3 H;  3TK9 A;  3U8O H;  1H8D H;  2AGI X;  5L2Z H;  1O3K A;  1P9U A;  1ID5 H;  1DOJ A;  4O03 A;  4YM9 A;  1BTW A;  3DA9 B;  3H7T A;  3UTU H;  4NIY A;  7EST E;  1GBF A;  1CE5 A;  1P12 E;  1TQ7 B;  4MVN A;  4UON A;  2RA3 A;  3PYH A;  3GY7 A;  1HAV B;  3TH4 H;  1YP9 A;  5CHA B;  4XD7 D;  2ZHQ H;  1O31 A;  1TA6 A;  1H4W A;  3ELA H;  1GBI A;  1P8V C;  4BAQ B;  1P2Q A;  2BQ7 B;  2ZFT A;  5DJ7 A;  1BIO A;  5GCH F;  1LVY A;  1ZHR A;  1ABI H;  3E0P B;  1GJ7 B;  1BTH H;  3F2G A;  1LMW B;  1L0Z A;  3ZZ7 A;  1GGD B;  1YCP H;  1EJA A;  2STA E;  3GY5 A;  4X1P U;  3RM0 H;  4D9Q A;  1DWB H;  2WPI S;  1LCY A;  2ZDN A;  2V3M A;  1MKX H;  2BDG A;  1GJ6 A;  3K65 B;  1DY9 A;  1J8A A;  1EPT A;  3E90 B;  3DFJ A;  3URC A;  3M61 U;  3A84 A;  1XX9 A;  3LPR A;  4ACA A;  6GCH F;  5A8Y A;  1HAX B;  4BAN B;  5EPN A;  4ZMA H;  7LPR A;  2FWW A;  5C3N A;  2QF0 A;  1VZQ H;  4JZF H;  2G4T A;  4AFZ A;  1Y5U T;  4ZKR U;  1HJA B;  1NFY A;  4TWY A;  3MYW A;  4ZH8 A;  2FOB A;  1BUI A;  3FZZ A;  3MNS A;  5E0J A;  3F68 H;  4Y79 A;  2V7Q D;  4IMQ A;  2BLV A;  1W14 U;  2GP9 B;  1FLE E;  1TLD A;  2TPI Z;  5EW1 H;  1IAU A;  1SLW B;  2P94 A;  3HGP A;  5GWZ A;  2W7U A;  1TQ0 B;  1AQ7 A;  9EST A;  1ELT A;  1AKS A;  2PFE A;  1YYY 1;  4ABF A;  1TGC A;  2QIQ A;  3U1I B;  2OQ5 A;  3V12 A;  4ZCN A;  1EZS C;  4SGB E;  2FIR H;  3BTH E;  4NIW A;  5IDK A;  1XUI A;  3FN8 A;  3P8N A;  3BG8 A;  2FZZ A;  3S7K B;  2UUJ B;  3RXG A;  3UNR A;  1MU6 B;  2V0B A;  1PPB H;  4NZL A;  2FOM B;  2PGQ B;  4XDE A;  3STJ A;  4CHA C;  4FU8 A;  2SGD E;  3VB3 A;  3SU0 A;  1O5F H;  5HKK D;  1FAX A;  4MDS A;  5EU8 A;  1W7X H;  4AYV B;  1HPG A;  1CBW B;  3MHW U;  4AX9 H;  1ELB A;  1C2M A;  1EXF A;  1LPG B;  3OEH D;  1TMT H;  5C1U A;  3A8C A;  5JBT A;  4BNR A;  3QK1 A;  2EI7 A;  1WYK A;  1HUT H;  1AD8 H;  1O2I A;  1FY4 A;  4OGX A;  2FXR A;  5F03 A;  1CHG A;  4WVP E;  1TPS A;  1NBM D;  3M36 A;  4RKJ B;  4WWY A;  3AAU A;  1Z6J H;  1DY8 A;  2ZGB H;  1FNI A;  1RIW B;  1TAL A;  1VCQ A;  2H6M A;  1C2L A;  2BD3 A;  4VGC B;  2RDE A;  2AMQ A;  1FUJ A;  2Y5G A;  3SU4 A;  5A8X A;  1RRK A;  1TAW A;  3UWI A;  3ZIA D;  1CSO E;  1A3E H;  1E37 B;  1GHY H;  2OCV B;  1BBR K;  2FES H;  5C20 A;  1O39 A;  2JH5 D;  2WPJ S;  2FMJ A;  1SI5 H;  1V2K T;  2GVF A;  3UY9 A;  2KAI A;  1Y5B T;  2VBC A;  1O2G H;  5AF9 H;  2B9L A;  1MAY A;  3RXH A;  4KTC A;  3NK8 A;  2A4Q A;  2BY5 X;  4CRC A;  2C8W B;  1SGR E;  2GT7 A;  3OEE D;  1THR H;  1O2O A;  5T1V A;  3AK5 A;  1GCT C;  4Q63 A;  3UB0 A;  1BML A;  3MH7 A;  1THP B;  4D7G A;  1S81 A;  3ENS B;  3UR6 A;  1C1O A;  1YPG H;  4IGD A;  2J98 A;  3A86 A;  1BTX A;  1HYL A;  5EIY A;  4R0I A;  2VIW A;  3E8L A;  2ZDA H;  1O3J A;  5F6M A;  3F9H A;  4JZD H;  1C5S A;  3BIV H;  1K1I A;  1V2W T;  1F0S A;  4CBN A;  1A61 H;  3RMO H;  3SJO A;  1S85 A;  3OU0 A;  1SFI A;  1TIO A;  3MU4 A;  2PV9 B;  2FO9 A;  3RXS A;  5KEC A;  1J9C H;  3RXD A;  1ELC A;  1LPZ B;  4AG1 A;  1ETR H;  3FKS D;  1NBM E;  1C5O H;  4O3U A;  2ZDM A;  1ZJD A;  1KYN A;  1HNE E;  2ZEB A;  2VIN A;  3FP6 E;  3ZVB A;  1DLK B;  1TWX B;  2OBQ A;  3Q00 A;  4WH8 A;  5AFZ H;  2HVY B;  4MQA A;  1WTH D;  4M7G A;  1EQ9 A;  1PYT D;  4NWK A;  3Q76 A;  1GHZ A;  1Y3Y A;  3LKW A;  4JMY A;  1UVP A;  5T6F A;  3ZZA A;  2FM2 A;  3BTE E;  4NFE A;  2G5N A;  3MMG A;  1SPJ A;  5CHB A;  1D3T B;  1SGQ E;  1N8O B;  2R0K A;  1O2J A;  2ZQ1 A;  4ZAE A;  3PWB A;  3KF2 A;  4Z6A H;  2AER H;  6CHA B;  2EC9 H;  2HLD D;  4GAW A;  3I77 A;  5FCR A;  2D8W A;  3QX5 H;  3UR9 A;  2AIQ A;  1SQT A;  4AG2 A;  3SYJ A;  3L6P A;  3SU6 A;  4D7F A;  1XVM A;  2NU2 E;  4X6N A;  2WUC A;  4DUR A;  2WUB A;  4ZXX H;  1W0J D;  4B2A A;  5EPY A;  1GBC A;  5DP8 A;  2ZFR H;  1GI9 B;  5PTP A;  2A5I A;  2GT8 A;  2JH6 D;  1GI5 A;  1TNL A;  4JK6 A;  2F9U A;  1PYT C;  2ODP A;  2UUY A;  3TK5 A;  1Q31 A;  2ZFP H;  1JRS A;  2XBV A;  2A4R A;  3GYL B;  1TGT A;  3M3V A;  4YTA A;  2FI3 E;  3K9X B;  4HGC A;  3MU5 A;  3LGT A;  4ASH A;  1YPK H;  2Y7Z A;  5JDU B;  5DKM A;  1T8O A;  3OSY A;  1OSS A;  1NRN H;  3ZZ6 A;  1LDT T;  3KGP A;  2Q6G A;  4IN2 A;  3LGW A;  3SHC H;  1KXD A;  1OHH D;  1D6R A;  1V2R T;  1BMN H;  2W6I D;  2BZ6 H;  2XWA A;  5E2O A;  5EQS A;  3BEI B;  2CV3 A;  1NFX A;  4NG9 H;  2C8Y B;  2D26 C;  5JB9 S;  1QQ4 A;  1DM4 B;  2ZPQ A;  1O3L A;  3SUG A;  2W26 A;  2XTT B;  1JXP A;  5EGM A;  1EUF A;  1OX1 A;  3ATM A;  1OYQ A;  1O3B A;  1TYN A;  3EYD A;  3UWJ H;  4GCH G;  1LHE H;  2AS9 A;  3MNX A;  1DT2 A;  5T3H A;  3LU9 B;  4BAM B;  1S6F A;  3M35 A;  1ZPC A;  4XRN A;  4DCD A;  2XND D;  2XC5 A;  4AYY B;  4OS1 A;  1UK4 A;  1ZR0 A;  1PQA A;  3TJV A;  3VXE H;  1P04 A;  4UD9 H;  5A09 A;  4K8B A;  3KID U;  2VB0 A;  2IPH A;  1GBL A;  3SZE A;  1AZ8 A;  1XUK A;  1NRR H;  3PV4 A;  2GMT C;  3SO3 A;  2O8L A;  2I6Q A;  3NXP A;  1C1P A;  1MUE B;  1OWH A;  1F0T A;  3U98 H;  3VGC B;  3MI4 A;  3RMM H;  4Y76 A;  1HDT H;  4JK5 A;  3OFN D;  5ETX A;  1P02 A;  1UJ1 A;  5FX6 A;  1WXR A;  1C5M D;  1TB6 H;  1BCU H;  1O2H A;  1BBR E;  3RLY H;  3ZZD A;  2XBX A;  1EFR D;  5GPI B;  2RG3 A;  1D4P B;  1ZMJ A;  1XMN B;  3ZZ8 A;  1GJ4 H;  2SGE E;  1S84 A;  2CHA B;  2H9H A;  1S0R A;  4ASU D;  3T27 A;  2HGT H;  3GDU A;  3NRL A;  3SUD A;  3SN8 A;  2GZ9 A;  4K8Y A;  2BD9 A;  1EAI A;  1FN6 A;  3BG4 B;  1WV7 H;  2O8U A;  3D49 H;  3KQD A;  1SLU B;  2Z9I A;  5B6O A;  1P2M A;  3HKI B;  2BD2 A;  1O3A A;  4JZE H;  1NRP H;  2C8X B;  2V3O H;  4Q80 A;  4AGK A;  1AND A;  3SJ9 A;  1HB0 B;  1UTL M;  1BTY A;  4LZ1 H;  5DGJ A;  1PPE E;  1J15 A;  1BMM H;  3F0O A;  3FVF B;  3F2F A;  3SUF A;  2EI6 A;  5HYO A;  2FP7 B;  1GI4 A;  1DXP A;  1GMD G;  3IIT A;  1C2I A;  2J92 A;  2PGB B;  1K1O A;  3PLB A;  3U8T H;  4M9F A;  1YCP K;  2FYQ A;  2XRC A;  2KCO A;  3RDZ A;  1MKX K;  4ABA A;  2WHX A;  3S9A A;  1AFQ B;  1O3N A;  2HLC A;  3OX7 U;  2QF4 A;  2VWM A; 
#chains in the Genus database with same CATH homology
 5HIY A;  2J98 B;  5C94 A;  3EE7 A;  5HIZ A;  2J97 A;  2J98 A;  1UW7 A;  1QZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...