1QZ8A

Crystal structure of sars coronavirus nsp9
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
ELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords polyprotein 1ab
publication title The severe acute respiratory syndrome-coronavirus replicative protein nsp9 is a single-stranded RNA-binding subunit unique in the RNA virus world.
pubmed doi rcsb
source organism Sars coronavirus
total genus 20
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 1qz8A01
1UW7A 5C94A 5HIZA 5HIYA 2J97A 1QZ8A 2J98B 3EE7A 2J98A
chains in the Genus database with same CATH superfamily
1NROH 2LPRA 3PB1E 5E0HA 1NRNH 3P8NA 4WH6A 3GYLB 3V3MA 1O2YA 1WTGH 4JK6A 4THNH 4XFQA 1SFQB 1O3IA 1WAYB 1XX9A 1GI1A 1HAXB 4QT8C 1MAXA 4AYYB 1O2MA 3UY9A 3TVJB 1HAGE 3SZNA 5DP9A 5FPTA 1Z1JA 4ZHAA 1C1OA 1MQ6A 3PO1C 4JZEH 4TPIZ 1O3EA 2XWAA 4ABIA 3TH3H 3RXQA 1NFYA 3TITA 2FOBA 5KEDA 4CRGA 2ZGBH 4X8SH 1YCPM 1ZMNA 3FP8E 4WJG2 4ZAEA 1ZTKA 3T62A 1Z1IA 2XBXA 3ZVDA 1XVOA 4ZKSU 3DA9B 4JYTA 5E0GA 2C8XB 3LJOA 3TLOA 4MNXA 2BD8A 1FMGA 2BLOA 1XUIA 3A7YA 5CMXH 2EQNA 3Q3KA 2JETC 3F2GA 2TPIZ 1BRBE 2BLWA 5DJ7A 2WYJA 1QY6A 2J4IA 3UQOA 1K1IA 4AFSA 1T31A 5DK1A 2ZNKH 1O3MA 4R0IA 1Z8GA 2OTVA 1MU8B 1PFXC 4O3UA 2QN5T 3SUDA 1O2NA 1XUGA 4YESB 2B5TB 4AN7A 1P11E 2GZ8A 3BIUH 3FO8D 2C8ZB 4Q63A 5DP4A 1XKAC 2VH0A 1DXWA 1O2IA 2ZU3A 3S9AA 3F0OA 1EJMA 2H9TH 2ZPRA 3PMJA 4D76A 1AUTC 1MQ5A 1J17T 1CQQA 1EZXC 2XYAA 4UEHH 4WMFA 4IC5A 4IBLH 4AOQA 2O8WA 5ABWA 1B0FA 2ASUB 1FY5A 3UB0A 3SORA 1MZDA 2QXIA 4FU8A 4CRCA 4AGJA 3DSOA 1EAXA 1GDNA 1Y3XA 5TJXA 4B2CA 1O3LA 1B5GH 1RGQA 3A88A 1H8IH 1SHYA 1PPGE 1F5LA 3UREA 1G9IE 2QF3A 1MD7A 2V3MA 3FFGA 3LGVA 2SGQE 3MO6A 3RXTA 2QA9E 2EC9H 2BHGA 4FUCA 2QF0A 3UR9A 5A0AE 1YPLH 3T26A 4AZ2B 1LQDB 1SGFA 1LCYA 1GJBB 5KECA 1DPOA 2KCOA 3LC5A 3RXSA 3F2HA 1ETSH 2IJOB 1N6YA 1E37B 2C8WB 1O3AA 3MWIU 4U01A 4XRNA 2A4GA 1GI3A 1C5WB 2VINA 4CH8B 4RKJB 1L1NA 1P0SH 4O9VA 3VG8A 1Y5AT 3P70B 3SGAE 1KLTA 3NK8A 5ESBA 1BTHH 3NWUA 3PLBA 3PMHB 1KMHB 1AY6H 1GI8B 1UMAH 4X8UH 3T29A 1C5LH 1TALA 2ZHQH 1EX3A 2XC0A 1LPZB 1BJUA 1UK3A 4KTCA 1YCPK 1Z7KA 1UTNA 1QBOA 4JCNA 1E1QD 4ISOA 4UONA 2PHBA 2Z9GA 1IQEA 3SJ9A 4I8KA 1KTTB 3LONA 3T2NA 1GMCG 3UNRA 1GBDA 3PRBA 2PKAB 2XNIA 3RMLH 5CDFE 1C2MA 5DP5A 3GCOA 4BTIB 3VB3A 2AEIH 3AVZA 1SHHB 1GGDB 3P8OA 2VH6A 1C1QA 5HIZA 1ESTA 1EKBB 2P3UB 5FX5A 1S81A 2VIDA 1FDPA 3QGNB 2P93A 3E16B 1A5GH 2FMJA 1D4PB 2BB4A 5C1YA 1QJ7B 4OS7A 3TNSA 3CS0A 2ILNA 2UUJB 3DUXH 3EA7A 4AORA 1TMTH 4OS5A 4GPGA 4U2WA 1PQAA 5BRRE 1V2VT 1GBFA 4XOJA 2ZHDA 4JZFH 4DGJA 1BMFD 1XUJA 3S69A 1K1MA 5J4QA 2BD5A 4NG9H 4XBDA 2SNWA 3ZVGA 1C2EA 1QBVH 4MVNA 3SJIA 3RXDA 2GTBA 2H5CA 1C9TA 3Q77A 1HFDA 1FNIA 2ODQA 2CN0H 1LMWB 1ZPZA 3LIWA 4YO9A 5KGOA 1F5RA 2TGTA 4ZXXH 3SU0A 1Z8RA 1W0JD 3EDXB 4UFGH 3AW0A 1EASA 1KXEA 3ZVEA 2PUQH 4ZMAH 3P8FA 1NM6A 2JETB 3MH5A 2AGGX 2A5AA 4Q7YA 3F9HA 3FN8A 1UVOA 2RG3A 4M9FA 1AKSA 1TBQH 3E1XB 3N7OA 1TABE 3GS9A 1JXPA 4B2AA 3QO6A 1C2DA 4DT4A 2EI6A 1HPGA 2OC0A 2FIRH 2J5UA 4YTAA 2F9BH 3OAAD 3URCA 3FZZA 1MKXK 3ATMA 3MU4A 3KQCA 5FXLA 2FOGA 1F92A 1O0DH 4YLUA 5DGJA 1UTJA 2ZFQH 4HTCH 2ZDLA 4B73A 2BDIA 4NFFA 3HKJB 1V2NT 1HLTH 2RCEA 3V13A 2OC7A 2SFAA 1SB1H 5FBIA 1BOQA 3SNBA 1TX7A 1UJ1A 1WSSH 1GL0E 1AO5A 1QQ4A 5A8XA 4P02A 2Y5FA 2ZFPH 4ACBA 4BAHB 1S85A 3O8CA 1SGFG 4FUFA 4K1EA 2HPQH 2O8UA 4J2YB 3TK5A 1E0FD 2PP6A 2QCYA 3PMBB 1CA0C 1FY1A 1GCDA 3MYWA 4FOUC 4YT6H 4NSYA 4KP0A 2PTNA 3EGKH 1EATA 1K2I1 3T27A 4KKDA 2KCPA 1Z6EA 2NU2E 2BTCE 2SGEE 3RXAA 3HGPA 2FZZA 1C5MD 2VIPA 1JIRA 1V2OT 4K3JA 5E8EH 4ZKRU 5DP6A 1WQVH 1FX0B 5IK2D 4LZ1H 1QB6A 3MH7A 4X6MA 2SGFE 4IS5A 4NA9H 4ABBA 8KME2 3DHKH 4WMEA 5TCAA 2Z9JA 3SNCA 1ARCA 4RSPA 1WV7H 4I7YH 1GBMA 3KN2A 3P95A 1YCPH 1P3CA 2JJ2D 4NFEA 2OINA 2V35A 1FXYA 2G5NA 3VFEA 3MQKC 3ZYEA 4IN2A 3ATLA 2OBQA 4MPWA 3SQHE 3SU5A 1CO7E 2JDID 2HOBA 3HK6B 2Y7XA 3M5MA 4MNVA 4NIWA 2F9NA 1QHRB 2HGTH 4X6NA 3UUZA 3VB6A 1IQMA 1UTPA 1T8NA 3M5LA 4JZDH 3GDSA 1G2LA 3OE7D 5T6FA 2F4LA 4GUXA 1NFWA 1ZRKA 1MD8A 1SQAA 1GJCB 1TGNA 2Q1JA 2ZPQA 1FLEE 3SV7A 2VWNA 3KNXA 4Y71A 2XWBI 1GI0A 2W26A 3GY2A 1GI4A 1QURH 3IITA 4FUEA 3KYGA 1CHOG 1Q31A 1Z71A 1C1UH 1IQJA 1CBWC 1CSOE 3MHWU 1HJAC 1Y3UA 1ESBA 4KELA 4CRBA 5EGMA 4A1TA 3M36A 3Q76A 2KCYA 3ATWA 1S0QA 1OWKA 1ELVA 4CRDA 5JBAS 3S7HB 2GGVB 4OS6A 1TPOA 4RT0A 2P8OB 4AB8A 3Q00A 3G01A 2QY0B 5EQQA 3BTQE 1QL8A 1NRQH 3I78A 2FOFA 4CREA 1E1RD 2R2MB 3L3TA 1Z6JH 3QDZB 3LJJA 3RXRA 2GP9B 4DURA 3RXJA 2GDDA 1UCYE 2F9UA 4NIVA 3F0PA 3RM2H 2O8TA 5F8TA 1MZAA 4I86A 1GHWH 1A3EH 1Y5UT 2ZPSA 1VITF 3A86A 1TAWA 3SI4H 3SV8A 1GBKA 1S0RA 2FODA 3F3BA 1GCTC 3ITIA 4Z6AH 3GY7A 3PRDA 4TWWA 4I32A 4BAQB 4WY3A 5ESTE 3O8DA 5DP8A 1O2UA 1W7XH 3W94A 1QRZA 2ODYB 4YT7H 1UW7A 1MKXH 4ABFA 2G51A 1IOEA 1VGCB 2V3OH 1G3CA 4ZHMU 1PYTD 3U28C 2HLDD 4BAKB 5GXPA 1VJAU 1ANBA 2RFKC 1C5QA 1BHXF 1LTOA 2M2AA 3KCGH 4F49A 1DX5M 1GJ6A 1BMNH 2WUBA 1TMBH 2A31A 5EPNA 1BA8B 1SQRA 2B7DH 3K9XB 1FAXA 1Y3VA 1TRMA 1YPJH 2ZDAH 5A2MH 5LPEA 4ZUHA 2A0QB 4U32A 3EYDA 5IDKA 5GIBA 1ID5H 1GMCF 3ZIAD 3M61U 1FIWA 3F9EA 1A0JA 2ZDKA 5EQSA 5F6MA 1QRWA 3BG4C 4X6PA 4CRAA 1ACBE 1FJSA 3CS7A 1AKSB 1MKWK 1ZHMA 2PKSC 4RN6A 1EPTC 5FL7D 1HRTH 3A7VA 1EOJA 1GPZA 4TY7A 1F0RA 2SGPE 4D9RA 1S5SA 1F0UA 1QZ8A 3WY8A 1W14U 1LKBA 3E0PB 1CA8B 1DS2E 2VWOA 3RXUA 1O2XA 2AHME 2PW8H 6LPRA 3SU3A 1D3QB 2L74A 3E0NB 1IQGA 4CBOA 1A61H 3PV2A 2VGCC 3A84A 1GI9B 1AB9C 2KX4A 2NU4E 2VWMA 4TSFD 1JMOH 2F9PA 1EJNA 6GCHF 1LVOA 1KYNA 2AS9A 2DE9A 3VB7A 1HXEH 1MTNC 2R3UA 3GCNA 2GDEH 3SGQE 1BITA 2I6SA 3U1JB 4MNWA 3NRLA 2Q6GA 1N6XA 2GT8A 3NCLA 4X2YA 4AFQA 1DM4B 4E05H 3QZQA 5A8YA 1YM0A 1KLIH 2A7CA 5G4BA 3S9CA 1LPGB 1BTWA 1ELBA 2K0QA 4WF8A 2WPKS 2BD4A 3O8RA 1AVGH 2CK3D 1E79D 3U9AH 4K69A 4A1VA 1G36A 1ZRBA 3N7DA 1S6FA 1OYTH 1EXFA 1H8HD 1O34A 1PJPA 1GG6C 3AASA 1P9SA 1P2IA 2XW9A 1W7GH 3LC3A 3SJKA 4A6LA 2IOTA 3BTKE 2UWPA 1NTPA 1GDQA 1GHXH 1EJAA 1BRUP 1NFUA 3GCHB 5EG4A 2W6JD 2C93B 2FM2A 1JIMA 2ZQ1A 3KYFA 4FU9A 4BTUB 2VBCA 2XXLA 1IQKA 5JB8S 1AFQB 2PSXA 3A8CA 1WYKA 3EE7A 2QXHA 1GMHF 3CNRA 1KIGH 3P17H 5HIYA 4AB9A 3URDA 1T4VH 3UQVA 1O3HA 2HNTE 2GMTC 5DG6A 5CHAC 3PYHA 1K1LA 1H9LB 1MUEB 3KQ5A 2ZGHA 4OGXA 1GBJA 2F83A 1QJ1B 3LDXH 2YMSC 3EA9A 4CRFA 1CGJE 2FOEA 1HAYB 4GSOA 3N7EA 4CH2B 2TRMA 1G3EA 3SO3A 2WPIS 4B1TA 2BQWB 1THRH 5L2YH 1NN6A 1DWEH 2FEQH 1O2RA 4JYVH 1DUEA 5C20A 3E3TA 2DE8A 2ZTYA 4ISIH 1NC6A 2XTTB 1ZHRA 1GHZA 3SN8A 1O3PB 3LGUA 3HGNA 1GCTB 1S84A 1ZZZA 2PFEA 1J16A 1HV7A 2R0KA 2ZI2H 4I33A 9ESTA 3L6PA 4GHTA 4K2YA 1Q3XA 1OWEA 3MMGA 4YOGA 2JIZD 1UTLM 1NPMA 1V2TT 3TPIZ 5HMAA 2TGDA 1EP6A 1SG8B 1UVTH 1TGTA 5GPIB 3MNBA 3UIRA 1C1VH 3I29A 3ODDA 2P94A 2BQ7B 2D2DA 1O32A 1QB1A 2THFB 1MU6B 1Y59T 1NRSH 1GHAF 1TONA 1MKWH 4LK4A 1V2UT 1NS3A 4GAWA 1KXBA 1NY22 3FKSD 3SNAA 1C1MA 3SUEA 5JPMH 4X8TH 3ESTA 5AF9H 1GJ8B 1V2JT 2XCNA 1QQUA 2FDAA 3RU4D 3SBKA 3E6PH 1SGPE 2A1DB 2ZTXA 1NU9A 1WQSA 1CHOF 3RDZA 2Y7ZA 1Y3YA 1IHTH 1XKBC 1HJ8A 4YOIA 1GBCA 1ETTH 1L2EA 3A7WA 4B74A 1K22H 2PUXB 1S82A 1HCGA 5C5NA 1DICA 5K0HA 4Y79A 2BMGB 2FPZA 1AB9B 2OP9A 2XBYA 1H8DH 3U8TH 1KLJH 1NU7B 5I25A 2BX3A 3SGBE 1BBRE 1O2SA 1P2OA 3MU0A 1FIZA 4B71A 1DE7H 1CT2E 3FAOA 1UVSH 1VITG 5T3HA 4BAMB 5J4SA 1QCPA 4ABJA 1W3CA 1FPHH 1OP2A 4K5ZA 5EOKA 2BX4A 1G2MA 4NWKA 3SV9A 3Q3XA 4ISHH 4X1PU 1JRTA 3TJVA 2ZCHP 3OX7U 3ZVAA 2G4UA 1WTHD 3M35A 5E0JA 3RMOH 4WXIA 1ZMLA 3ZZ9A 1GBLA 4NIXA 3R0FA 1AVWA 1TMUH 2BDHA 1O2GH 2WV5A 2G52A 2W3IA 3BEIB 1H9HE 3GICB 1SGDE 5LPRA 1MABB 1WDIA 1NBME 2P95A 3SOSA 3Q3YA 2IJD1 1LHDH 1K1JA 4RT1A 1RIWB 4B6FA 1SQTA 4NZLA 5L30H 4LOYH 1COWD 3LKWA 5FPSA 1SBWA 1K1PA 3U98H 1VCWA 3BEUA 3PLKA 2BY7X 6CHAB 1DLEA 3I77A 3FZDA 2TBSA 1ARBA 1EP5A 1N8OB 1T8OA 2WZQA 1N1LA 1YC0A 1YPMH 1ZYOA 2H6MA 1LHCH 3OEHD 1TBRH 2BD7A 3ZZAA 5C94A 1V2WT 1P9UA 1YLCA 1XM1A 3JZ2B 2AGEX 2OCVB 3BG8A 2YMSB 1O37A 1IQNA 2P59A 1K21H 2GD4B 1DT2A 3KQBA 4IN1A 4ZKNU 2OQ5A 1D6WA 3QTOH 2XBWA 1EZSC 1O5AB 2IPQX 1GL1A 3QWCH 1ZHPA 2NU3E 4AX9H 1YLDA 2HRVA 2IPHA 2SNVA 3OSYA 4PROA 1DSTA 4H4FA 1OWHA 1D6RA 1VJ9U 2HNTF 3OU0A 5E2OA 6GCHG 4GCHF 4F4OC 1SKYE 3PO1B 4CR9A 1C5ZB 1G3BA 1TE0A 3SHAH 4JMYA 1YYY1 1HAPH 4IMZA 2ZG0H 3ZZ7A 1MCVA 1E36B 3MNSA 4BAOB 2GVFA 1C2KA 2BY8X 3UPEA 1YPGH 1SGCA 3ZZ8A 1VKYA 3BTHE 1ANDA 3QGJA 3UR6A 2WV4A 1LQEA 2WSSD 3KL6A 4XE4A 3UFAA 2FS9A 1EAIA 4FUBA 1SOTA 1ANEA 1MBQA 2BDCA 2ZF0H 2VIWA 3EAJA 2G5VA 1YY3A 3RXMA 1XXDA 1P01A 1GBTA 3BEFB 1MBMA 3VGCC 3UTUH 1QJ6B 4INHA 3E91A 5B6OA 1AIXH 2J9NA 3DCLA 3W95A 3FOAA 2W7UA 3GCTF 3ATIA 2KAIA 3OY5U 1O5FH 1B0EA 1C2GA 3BTME 3H7OA 1DY8A 2VU8E 2WPMS 3S0NA 4KTUA 1SVPA 1QBNA 1QTFA 1TGCA 3HK3B 2Z9KA 2QC2A 1KTSB 1PPEE 3ZZ3A 4WMDA 4Q80A 1A5HA 1ZJKA 1AU8A 1GMHG 2V6NA 2ANWA 3LT3A 3C1KA 1A4WH 3A7TA 3QN7A 1BQYA 3AAVA 3MTYA 3BTGE 2BY6X 3TJOA 4ACAA 1ELDE 1A3BH 1W12U 1WOFA 3RXKA 1LVYA 5HXFA 3OEED 2D1JA 1TNJA 3BF6H 1K9OE 1OOKB 8GCHF 1PQ8A 2F91A 4DIIH 2BDGA 2GZ9A 1O36A 2ANYA 1K28D 1SL3A 1BRAA 3KHVA 3W1EA 1O2HA 2ANMH 1AUJA 1UTKA 1Y5BT 1SLWB 4XSKU 3P92A 5JBTA 4E7RG 1DOJA 4X2VA 3E90B 5F53A 1TWXB 2Q6DA 4ZH8A 4BXSA 1EAUA 1T4UH 1FUJA 3QLPH 5ETXA 4X2XA 3SHCH 2Z6BD 2FO9A 5AFZH 3LGYA 4GLYA 1QNJA 2LNCA 1ZPBA 2BQ6B 1C1WH 2NU0E 4X2WA 5JDUB 1GBBA 4B76A 2NWNA 3H5CB 2VWLA 2Z3DA 1BB0B 3SZEA 1J15A 1QRXA 4ISNA 2KZ4A 3IG6B 3HATH 3RLWH 3HKIB 2V3HH 5HKKD 1GHAG 1W2KH 2BD9A 2FWWA 1WBGB 3SU6A 1MAYA 1T8LA 1L0ZA 4ABAA 1KDQA 2VB0A 4B2BA 1HAVA 5DP7A 5A09A 5DP3A 2A4RA 3RXFA 1DUAA 2H5DA 4F48B 5LGOA 1GBHA 2HNTC 1GDUA 2CHAC 2I6QA 5C1UA 2ZFTA 8ESTE 4Q4LA 2DUCA 2G55A 2G00A 2GCTC 1SQOA 1Z8JB 3R3GB 1CU1A 2XNDD 3A83A 5GWZA 1TYNA 1C2JA 1QFKH 4K1SA 1P12E 3B8JA 3DFJA 2ZGCA 3RC4A 1NT1A 3A82A 1F5KU 2SGAA 2Q6FA 4RKOB 5FHTA 4Y11E 5GCHF 1C2HA 4O3TA 3A87A 2A4QA 3TNTA 7KMEH 1AD8H 1IQFA 1UVUH 4Y8ZA 1O2WA 2CGAA 2OQUA 4IC6A 2ZU4A 2Z3CA 1MMJN 3SQEE 2ZIQH 9LPRA 2FOHA 3RC5A 4CHAC 1ELAA 1O3NA 1PPCE 4OM9A 2OK5A 1U6QA 2H9EH 1EZQA 5EXLA 1VCQA 3MO9A 3SNDA 3TGIE 4RI0A 3V12A 3VB5A 5HM2A 2ZO3H 1OWIA 4ZROA 3GY8A 1SFIA 5T6DA 5DPAA 1SLVB 1O2OA 1QIXB 2PLXA 1LO6A 1ZPCA 1THSH 2A4OA 3A7XA 4UFDH 4VGCC 3RXHA 3B9FH 1TGSZ 5F8ZA 4MLFB 2ZEBA 1CGIE 4O03A 4OS1A 3ZYDA 1EPTA 4D8NA 1F7ZA 1DLKB 1C5YB 1K1NA 3GY6A 4KTSA 1KY9A 4BTTB 5LPFA 3AK5A 4FUJA 1V6DA 2XC5A 1TNGA 2AIPA 4OS4A 2Z3EA 3RXCA 2PWXA 1BIOA 1P09A 3U8OH 3T28A 1EAWA 1MCTA 1NZQH 2ZHFH 3OFND 1ZSKA 4Q7ZA 3SUGA 3BTEE 4I8JA 3ODFA 3TJUA 1GBAA 4YM9A 5JBCS 1ZR0A 1O5CB 4A1XA 4YLQH 4K1TA 2IN2A 2OXSA 1A1RA 3EQ0H 2ZHWH 1JOUB 1UTQA 3KIDU 2FESH 1PYTC 2K8IA 1ORFA 2B9LA 1QGFA 4J1YA 1AZZA 2QF4A 3TU7H 1O3OA 1RD3B 2VVCA 4H6TA 3WWFA 1HDTH 1VZQH 3ZZ5A 5HGGA 2V7QD 5TCCA 5HM9A 1JRSA 1HAOH 1C2FA 3STIA 1A2CH 1CA0B 1GVZA 2KAIB 4X6OA 1HAIH 3LGWA 1W0ZU 5C3NA 3BTWE 2ZDMA 2EY4C 1K1OA 5GJ4B 1K0HA 2WPJS 4YZUA 1CT0E 1CT4E 4DY7B 1YPHC 2WPHS 4INKA 4DIHH 3ZZ4A 2ZGXH 1O3FA 4GCHG 2A2QH 1SSXA 3ZVFA 1T32A 2FI3E 3B23B 3KQEA 4ZCNA 3FANA 1O3BA 3ZZ6A 4Y10E 1FY8E 3MU1A 3MOCA 3OY6U 1SI5H 5EPYA 2EI7A 3BTDE 4AC9A 3ATKA 2H9HA 1NRPH 2WINI 2EI8A 1P05A 2GKVE 5DN6D 1C9PA 1AZ8A 3PROA 4JYUH 3MU5A 1VCPA 1ZJDA 2ZKSA 3PLPA 3SUFA 3RP2A 5C5OA 2LELA 1V2PT 1C1PA 2O8LA 3NPSA 1SGYE 2PGQB 2Y81A 1FI8A 1FPCH 1UTOA 1H1BA 2CF9H 1BTZA 1C5RA 1FN8A 1UCYK 5L2ZH 2SGDE 1OX1A 1W10U 2W6ID 3SU4A 3U8RH 1GMDG 4MPVA 1G30B 5EJ1A 2FOAA 3GCTG 2QXJA 1IHSH 1BTYA 1RFNA 1ELGA 2UWOA 2CF8H 5AVDA 5AHGH 1HGTH 1FONA 1SLUB 3KGPA 1TPSA 1HYLA 1EB1H 1GHBF 2TGAA 2VIVA 4MQAA 2QIQA 1HB0B 2CXVA 2A7JA 2OUAA 4IW4E 2R0LA 2Z94A 3M5NA 2FOMB 1O3DA 1XUFA 3D65E 3QUMP 4GHQA 1O39A 3GYMA 5EXMA 2BZ6H 2O8MA 2UUYA 1CBWB 4NWLA 2WHXA 2UWLA 3F68H 1HJAB 1P3EA 1FN6A 1SLXB 1P2MA 4WVPE 1XVMA 2FX4A 3SNEA 1G32B 2BY9X 1UO6A 8GCHG 2YNBA 2ANKH 4JZIA 4DG4A 3D23A 1KDQB 4TY6A 1HAVB 1GVKB 1SGNE 2D8WA 1YGCH 1Y3WA 1L4ZA 3A8BA 3BIVH 2FTLE 1SMFE 2ULLA 1OKXA 2R2WU 2BVRH 3F6UH 3GDVA 1C5NH 2ZDNA 3BV9B 3VXFH 4E7NA 1C5OH 2W5EA 1C5VA 2FX6A 4DT7B 2PSYA 5IYTA 5EODA 2VVUA 2F3CE 4MNYA 1FAKH 5GDSH 1SGIB 1AHTH 3DT0H 4BANB 4MTBA 5EU8A 1P57B 1MTSA 3STJA 3RMNH 1TQ0B 3PWCA 3SV2H 2ALVA 5LH8A 2ZC9H 1ELEE 2XC4A 1RJXB 2GJGA 1SGEE 3LOXA 2ZFRH 2M5TA 1PQ7A 3GDUA 4FUGA 1TNIA 4OGYA 3MFJA 1AE5A 1O2JA 4NIYA 3TK6A 3SJOA 2J92A 1MTWA 2ZU5A 3FP6E 2C3SA 4H6SB 1C1SA 1J9CH 4FU7A 2P16A 1HJ9A 3CENA 5CE1A 1HBTH 1NESE 3GY5A 1ZMJA 1P2QA 1V2KT 2FI5E 1DITH 3BG4B 5FAHA 4FUHA 2AMQA 1OSSA 4MPXA 4Y76A 4ASUD 2PKSB 3V0XA 4TT3D 1EPTB 3FVFB 2TGPZ 4HFPB 1ZTJA 3DFLA 2J97A 2P3TB 5T1VA 5C17A 3RMMH 1O33A 1XMNB 3EE0B 4E06H 2C8YB 5GCHG 4Y0ZE 2HVYB 3A81A 4ZHLU 4FVBA 3M7UA 1M9UA 1O2QA 1HXFH 1BTXA 4GVUA 4YXWD 1NO9H 1TX8A 3RXOA 2WPDD 2FI4E 4AG2A 2VGCB 5FCRA 1C4Y2 1RTFB 3QTVH 5A0CA 3DD2H 1C5SA 3P8GA 5EW1H 1SGRE 1TRNA 5EW2H 1Y8TA 2JKHA 1P2JA 1G37A 1MTNB 4AFUA 1YPHE 1MTVA 3QK1A 2ZZUH 1BTPA 1ESAA 1HNEE 1C4V2 1UCYH 1XUHA 4O97A 1ELTA 3A8DA 2OLGA 5F03A 1WXRA 3NKKA 1AWHB 4A92A 5BPEA 1WU1A 3A89A 3VEQB 1UHBA 1TBZH 3VXEH 1NFXA 1A7SA 2FTMA 2HVXA 4SGAE 1TOMH 5A0BA 1GG6B 2CMYA 3BSQA 1TOCB 4I8HA 4NCYA 4ABEA 4JZ1A 1TIOA 1OWDA 3GISB 5JB9S 1LHGH 2BDBA 2XCFA 1TX6A 2BDYA 2ZFFH 4XDEA 2A7HA 1O2PA 4F55A 1HAHH 1PPHE 2Z9IA 3RXPA 2K1QA 4NA8A 1GI2A 1V2QT 5C1XA 1EFRD 3NUMA 1O5EH 3ZZCA 1C2LA 2HWLB 1BJVA 3P6ZB 2ZA5A 1SGTA 1O2VA 2WPLS 1YKTA 3ZVBA 4M7GA 3LH1A 1GI6A 2BM2A 1O31A 6ESTA 2GMTB 1GHVH 1QL9A 2JH0D 5CHAB 3ZV9A 4DJZB 4CR5A 1AI8H 3M37A 1EZUC 1NRRH 3SV6A 2C90B 1DSUA 3RXEA 2BXUH 1FY3A 4X0WU 1O38A 1AWFH 1H4WA 1Z8IB 4DW2U 2AERH 2QF5A 3H7TA 1O2TA 1O3GA 1LVMA 1OPHB 1W0KD 1BHXB 3ZZBA 4DOQA 3TIUA 1DY9A 2YOLA 1PQ5A 1YP9A 1W13U 1PPBH 1DWBH 3F2FA 1BMMH 1CHGA 4UD9H 1LKAA 1D3DB 3MNCA 4ABGA 1ELCA 2OC8A 5T6GA 1KXDA 2JJ1D 5L6NH 3QX5H 1QL7A 3ZZDA 1J14A 1TQ7B 3SW2B 4Z0KA 3V7TA 3UOPA 2Y80A 3RXIA 3OYPA 2FLRH 3RXLA 1RRKA 1O2KA 2GCHF 2V0BA 2VVVA 3GY4A 5EJLA 3K2UA 1OXGA 5C0TA 3SI3H 2P8OC 2BZAA 2Z7FE 1UTMA 2AYWA 2WYGA 1UVPA 3MO3A 4ISLA 1BBRK 1YLNA 2BLQA 2HALA 3M3VA 4TWYA 1GJ9B 2KM0A 3D49H 3SU2A 1TNKA 2WV9A 4XBCA 3RXBA 4ABDA 3VPKA 7GCHF 2Y82A 2A45B 3UAIC 1HIAA 1KXFA 2R3YA 4BOHA 1GMDF 4MDSA 2ZHEH 3M7TA 4BNRA 2B8OH 4INLA 1F2SE 1GHBG 1GBIA 1GHYH 3BN9A 1DVAH 2VIOA 1EUFA 3LGTA 3DSPA 1A46H 4TPYA 2ZECA 2BLVA 2XRCA 4K8BA 1YF4A 1KSNA 1AMHA 1VGCC 1EQ9A 2AGIX 4R8TB 2L6OA 2ZP0H 2J34A 1JWTA 2D26C 4ZKOU 1RS0A 1ZSJA 3TGKE 4KGAA 1MTUA 1LPKB 4D9QA 1UK2A 2OC1A 1O35A 1LHEH 1P02A 1G3DA 1WCZA 1P2NA 3GY3A 4UDWH 1FY4A 3DSGA 1SOZA 1L1GA 1O3CA 1YPKH 4X1QU 3T5FH 3S7KB 5HYOA 1TNHA 4MPUA 3TH2H 4NA7A 1Q2WA 1W8BH 4AFZA 2ZU1A 3SJ8A 1ZLRA 2OD3B 4X1SU 3A8AA 1CGHA 2RDLA 1DFPA 1C4U2 4UFFH 1ZGIA 1TRYA 5FCKA 4H42U 3RXGA 3RUOA 1RTLA 1ZTLA 5JBBS 2FP7B 1O5GH 1DANH 3M5OA 4LZ4B 4DVAU 1SGQE 1ZSLA 2EA3A 2QGRA 3PM3A 2J94A 3M7QA 3N99A 4X8VH 2AIQA 1TA2A 3RLYH 1FV9A 1TLDA 3TK9A 1O2LA 3RU4E 3F9GA 1S6LA 1H8ED 1UK4A 3KEEA 2FS8A 3K6ZA 3WW7A 2UUFB 4FUDA 2EEKA 7LPRA 2Z9LA 1TFXA 1W0YH 3O8BA 1QR3E 5SGAE 5B6LA 1F0TA 2WUCA 3JZ1B 1V3XA 2RDEA 2ZTZA 1RTKA 2QYIA 4YOJA 1LDTT 1V2LT 4WXVA 4D7GA 2AMPA 3UWIA 1ELFA 3GOVB 3U69H 3RC6A 2HLCA 1BUIA 1C5XB 5PTPA 3T25A 1P10A 3SYJA 2J98A 2ZGJA 1UHBB 3U1IB 3BTTE 1AVXA 1O3KA 4K8YA 1AGJA 1KXAA 4NGAH 1XXFA 1GJAB 2VNTA 2AFQB 2UUKB 2F9VA 2ZCLP 3K65B 2RA0A 3K6YA 4SGBE 1O2ZA 1E34B 1AE8H 1DWDH 4NZQA 3FP7E 2H2ZA 2FLBH 1AFEH 3CP7A 1J8AA 2BD2A 1GI5A 2Y5GA 3GCHC 4X1NU 3PTNA 1SPJA 1P03A 3BTFE 2P3FH 1H9IE 2GT7A 4A7IB 2ZWLH 1CE5A 3TJNA 4D7FA 2VJ1A 5C0UA 2BXTH 4U30A 3LU9B 1AFQC 2KCAA 4AGKA 1HUTH 2BDAA 3MH4A 1OS8A 5H4IB 2A32A 3KF2A 1BBRH 2A5KA 3TGJE 2GX4A 2GV6A 2G8TA 5JYIA 1F0SA 4A5TS 3LH3A 5GNDA 2FXRA 2BYAX 3OTPA 5AFYH 4P00A 4JK5A 5K7RA 1TPPA 1HAZB 3VGCB 1RXPA 3PWBA 1JBUH 2W3KA 4XBBA 2BD3A 2BOHB 2NU1E 1DXPA 1QA0A 1P8VC 3RU4T 1VR1H 1IQHA 1BMLA 1A0HB 2CV3A 1OP8A 3QZRA 1MH0A 4ASHA 1YPEH 5A8ZA 2A5IA 1L4DA 3NXPA 3MNXA 2J2UA 5DSFA 2BOKA 1T7CA 4I8GA 1O30A 3A7ZA 4HG6A 5I46H 5EIYA 4Q2KA 1C1NA 4CBNA 4UFEH 1LHFH 1TGBA 2CJIA 1GJ5H 1O5BB 4UE7H 1ZGVA 3L33A 2B0FA 3NZIA 5EJZA 1CVWH 2JH5D 1BRCE 2KR7A 1THPB 3EA8A 2C4FH 2STAE 5EXNA 1GVLA 1QA7A 4I31A 1A0LA 2PR3A 1TA6A 3TH4H 3M3SA 5E2PA 1GI7B 4AYVB 4DCDA 1HIAB 2QAAA 1QB9A 1FZZA 4ESTE 1EB2A 2F43B 2F9OA 4X1RU 2HPPH 1A5IA 3ZVCA 1SR5C 3MU8A 1ABIH 2PTCE 3RM0H 3H09A 2J38A 4HZHA 1BT7A 4IMQA 4Z1MD 1YWUA 1O5DH 1C1RA 1IQIA 1D3PB 2FOCA 4WWYA 1V2ST 3AW1A 3MI4A 3PMAB 1AQ7A 1VITH 2O9QA 1E35B 1FQ3A 1IQLA 4Y8XA 1T8MA 4I8LA 1OHHD 3ZV8A 4BXWA 1YBWA 3MH6A 4Y8YA 2QV1A 4B6EA 4Q7XA 1V2MT 5FPYA 1ZOMA 2ALPA 1NBMD 2QE7D 2GCHG 1WUNH 3VB4A 2RA3A 3HPTB 1GJ7B 1C2IA 1P04A 4XD7D 5CHBA 2ZFSA 1TPAE 2XOKD 1S6HA 2BY5X 1C5TA 4HGCA 4Y6DA 2A2XH 7GCHG 3WWBA 1BMAA 1DWCH 4MG3A 4TYDA 2ZU2A 1IAUA 4FETA 4Y7BA 1BZXE 4FXGH 3D62A 3C27B 2OBOA 2BVXH 4FVDA 3LPRA 2AMDA 2W7SA 2QXGA 1GBEA 1KXCA 2PKAA 2JH6D 1ABJH 1S83A 2KFWA 1XUKA 2GZ7A 3ELAH 1BTUA 2STBE 5C2ZA 5FX6A 4AG1A 1OYQA 2CHAB 2H1UA 1GJ4H 3RXVA 1E38B 4Y7AA 4K60A 2ZQ2A 4WH8A 3F1SB 2GV7A 5F8XA 2GCTB 1P06A 5C67A 2PGBB 3PTBA 7ESTE 2FYRA 2J95A 1EOLA 1D3TB 2ZDVH 1B7XB 5DKMA 3KQDA 4FUIA 2Y6TA 2XBVA 3PV5A 3UNSA 4ABHA 2ZCKP 1V2RT 3S9BA 2G4TA 2Y5HA 3A85A 4B75A 1RIWC 3E8LA 1AN1E 2YMSD 2AH4X 5FBEA 1LVBA 1W11U 1D9IA 4IGDA 3IWMA 2BVSH 3OTJE 1GJDB 1OWJA 1C5PA 4Y0YE 1TNLA 2ESTE 1ETRH 6CHAC 2R9PA 2LP6A 4HI3A 1C1TA 2ODPA 5DO4H 4ZXYH 1INCA 4CHAB 4LXBH 2J98B 3A80A 1N8OC 1GGDC 1BDAA 1OP0A 1L1JA 1P2KA 3AAUA 3UNQA 2TIOA 1SC8U 3UOUA 1ANCA 3UWJH 3LGIA 1GWAA 2G81E 8LPRA 3M3TA 3F9FA 1C5UA 1O3JA 2PV9B 1PPZA 2VIQA 4NSVA 2YNAA 3ENSB 1DDJA 1BCUH 5EQRA 4OS2A 1TB6H 2FYQA 4VGCB 1X7AC 3SU1A 3PV4A 1PPFE
chains in the Genus database with same CATH topology
1UW7A 5C94A 5HIZA 5HIYA 2J97A 1QZ8A 2J98B 3EE7A 2J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW7 A;  5C94 A;  5HIZ A;  5HIY A;  2J97 A;  1QZ8 A;  2J98 B;  3EE7 A;  2J98 A; 
#chains in the Genus database with same CATH topology
 1NRO H;  2LPR A;  3PB1 E;  5E0H A;  1NRN H;  3P8N A;  4WH6 A;  3GYL B;  3V3M A;  1O2Y A;  1WTG H;  4JK6 A;  4THN H;  4XFQ A;  1SFQ B;  1O3I A;  1WAY B;  1XX9 A;  1GI1 A;  1HAX B;  4QT8 C;  1MAX A;  4AYY B;  1O2M A;  3UY9 A;  3TVJ B;  1HAG E;  3SZN A;  5DP9 A;  5FPT A;  1Z1J A;  4ZHA A;  1C1O A;  1MQ6 A;  3PO1 C;  4JZE H;  4TPI Z;  1O3E A;  2XWA A;  4ABI A;  3TH3 H;  3RXQ A;  1NFY A;  3TIT A;  2FOB A;  5KED A;  4CRG A;  2ZGB H;  4X8S H;  1YCP M;  1ZMN A;  3FP8 E;  4WJG 2;  4ZAE A;  1ZTK A;  3T62 A;  1Z1I A;  2XBX A;  3ZVD A;  1XVO A;  4ZKS U;  3DA9 B;  4JYT A;  5E0G A;  2C8X B;  3LJO A;  3TLO A;  4MNX A;  2BD8 A;  1FMG A;  2BLO A;  1XUI A;  3A7Y A;  5CMX H;  2EQN A;  3Q3K A;  2JET C;  3F2G A;  2TPI Z;  1BRB E;  2BLW A;  5DJ7 A;  2WYJ A;  1QY6 A;  2J4I A;  3UQO A;  1K1I A;  4AFS A;  1T31 A;  5DK1 A;  2ZNK H;  1O3M A;  4R0I A;  1Z8G A;  2OTV A;  1MU8 B;  1PFX C;  4O3U A;  2QN5 T;  3SUD A;  1O2N A;  1XUG A;  4YES B;  2B5T B;  4AN7 A;  1P11 E;  2GZ8 A;  3BIU H;  3FO8 D;  2C8Z B;  4Q63 A;  5DP4 A;  1XKA C;  2VH0 A;  1DXW A;  1O2I A;  2ZU3 A;  3S9A A;  3F0O A;  1EJM A;  2H9T H;  2ZPR A;  3PMJ A;  4D76 A;  1AUT C;  1MQ5 A;  1J17 T;  1CQQ A;  1EZX C;  2XYA A;  4UEH H;  4WMF A;  4IC5 A;  4IBL H;  4AOQ A;  2O8W A;  5ABW A;  1B0F A;  2ASU B;  1FY5 A;  3UB0 A;  3SOR A;  1MZD A;  2QXI A;  4FU8 A;  4CRC A;  4AGJ A;  3DSO A;  1EAX A;  1GDN A;  1Y3X A;  5TJX A;  4B2C A;  1O3L A;  1B5G H;  1RGQ A;  3A88 A;  1H8I H;  1SHY A;  1PPG E;  1F5L A;  3URE A;  1G9I E;  2QF3 A;  1MD7 A;  2V3M A;  3FFG A;  3LGV A;  2SGQ E;  3MO6 A;  3RXT A;  2QA9 E;  2EC9 H;  2BHG A;  4FUC A;  2QF0 A;  3UR9 A;  5A0A E;  1YPL H;  3T26 A;  4AZ2 B;  1LQD B;  1SGF A;  1LCY A;  1GJB B;  5KEC A;  1DPO A;  2KCO A;  3LC5 A;  3RXS A;  3F2H A;  1ETS H;  2IJO B;  1N6Y A;  1E37 B;  2C8W B;  1O3A A;  3MWI U;  4U01 A;  4XRN A;  2A4G A;  1GI3 A;  1C5W B;  2VIN A;  4CH8 B;  4RKJ B;  1L1N A;  1P0S H;  4O9V A;  3VG8 A;  1Y5A T;  3P70 B;  3SGA E;  1KLT A;  3NK8 A;  5ESB A;  1BTH H;  3NWU A;  3PLB A;  3PMH B;  1KMH B;  1AY6 H;  1GI8 B;  1UMA H;  4X8U H;  3T29 A;  1C5L H;  1TAL A;  2ZHQ H;  1EX3 A;  2XC0 A;  1LPZ B;  1BJU A;  1UK3 A;  4KTC A;  1YCP K;  1Z7K A;  1UTN A;  1QBO A;  4JCN A;  1E1Q D;  4ISO A;  4UON A;  2PHB A;  2Z9G A;  1IQE A;  3SJ9 A;  4I8K A;  1KTT B;  3LON A;  3T2N A;  1GMC G;  3UNR A;  1GBD A;  3PRB A;  2PKA B;  2XNI A;  3RML H;  5CDF E;  1C2M A;  5DP5 A;  3GCO A;  4BTI B;  3VB3 A;  2AEI H;  3AVZ A;  1SHH B;  1GGD B;  3P8O A;  2VH6 A;  1C1Q A;  5HIZ A;  1EST A;  1EKB B;  2P3U B;  5FX5 A;  1S81 A;  2VID A;  1FDP A;  3QGN B;  2P93 A;  3E16 B;  1A5G H;  2FMJ A;  1D4P B;  2BB4 A;  5C1Y A;  1QJ7 B;  4OS7 A;  3TNS A;  3CS0 A;  2ILN A;  2UUJ B;  3DUX H;  3EA7 A;  4AOR A;  1TMT H;  4OS5 A;  4GPG A;  4U2W A;  1PQA A;  5BRR E;  1V2V T;  1GBF A;  4XOJ A;  2ZHD A;  4JZF H;  4DGJ A;  1BMF D;  1XUJ A;  3S69 A;  1K1M A;  5J4Q A;  2BD5 A;  4NG9 H;  4XBD A;  2SNW A;  3ZVG A;  1C2E A;  1QBV H;  4MVN A;  3SJI A;  3RXD A;  2GTB A;  2H5C A;  1C9T A;  3Q77 A;  1HFD A;  1FNI A;  2ODQ A;  2CN0 H;  1LMW B;  1ZPZ A;  3LIW A;  4YO9 A;  5KGO A;  1F5R A;  2TGT A;  4ZXX H;  3SU0 A;  1Z8R A;  1W0J D;  3EDX B;  4UFG H;  3AW0 A;  1EAS A;  1KXE A;  3ZVE A;  2PUQ H;  4ZMA H;  3P8F A;  1NM6 A;  2JET B;  3MH5 A;  2AGG X;  2A5A A;  4Q7Y A;  3F9H A;  3FN8 A;  1UVO A;  2RG3 A;  4M9F A;  1AKS A;  1TBQ H;  3E1X B;  3N7O A;  1TAB E;  3GS9 A;  1JXP A;  4B2A A;  3QO6 A;  1C2D A;  4DT4 A;  2EI6 A;  1HPG A;  2OC0 A;  2FIR H;  2J5U A;  4YTA A;  2F9B H;  3OAA D;  3URC A;  3FZZ A;  1MKX K;  3ATM A;  3MU4 A;  3KQC A;  5FXL A;  2FOG A;  1F92 A;  1O0D H;  4YLU A;  5DGJ A;  1UTJ A;  2ZFQ H;  4HTC H;  2ZDL A;  4B73 A;  2BDI A;  4NFF A;  3HKJ B;  1V2N T;  1HLT H;  2RCE A;  3V13 A;  2OC7 A;  2SFA A;  1SB1 H;  5FBI A;  1BOQ A;  3SNB A;  1TX7 A;  1UJ1 A;  1WSS H;  1GL0 E;  1AO5 A;  1QQ4 A;  5A8X A;  4P02 A;  2Y5F A;  2ZFP H;  4ACB A;  4BAH B;  1S85 A;  3O8C A;  1SGF G;  4FUF A;  4K1E A;  2HPQ H;  2O8U A;  4J2Y B;  3TK5 A;  1E0F D;  2PP6 A;  2QCY A;  3PMB B;  1CA0 C;  1FY1 A;  1GCD A;  3MYW A;  4FOU C;  4YT6 H;  4NSY A;  4KP0 A;  2PTN A;  3EGK H;  1EAT A;  1K2I 1;  3T27 A;  4KKD A;  2KCP A;  1Z6E A;  2NU2 E;  2BTC E;  2SGE E;  3RXA A;  3HGP A;  2FZZ A;  1C5M D;  2VIP A;  1JIR A;  1V2O T;  4K3J A;  5E8E H;  4ZKR U;  5DP6 A;  1WQV H;  1FX0 B;  5IK2 D;  4LZ1 H;  1QB6 A;  3MH7 A;  4X6M A;  2SGF E;  4IS5 A;  4NA9 H;  4ABB A;  8KME 2;  3DHK H;  4WME A;  5TCA A;  2Z9J A;  3SNC A;  1ARC A;  4RSP A;  1WV7 H;  4I7Y H;  1GBM A;  3KN2 A;  3P95 A;  1YCP H;  1P3C A;  2JJ2 D;  4NFE A;  2OIN A;  2V35 A;  1FXY A;  2G5N A;  3VFE A;  3MQK C;  3ZYE A;  4IN2 A;  3ATL A;  2OBQ A;  4MPW A;  3SQH E;  3SU5 A;  1CO7 E;  2JDI D;  2HOB A;  3HK6 B;  2Y7X A;  3M5M A;  4MNV A;  4NIW A;  2F9N A;  1QHR B;  2HGT H;  4X6N A;  3UUZ A;  3VB6 A;  1IQM A;  1UTP A;  1T8N A;  3M5L A;  4JZD H;  3GDS A;  1G2L A;  3OE7 D;  5T6F A;  2F4L A;  4GUX A;  1NFW A;  1ZRK A;  1MD8 A;  1SQA A;  1GJC B;  1TGN A;  2Q1J A;  2ZPQ A;  1FLE E;  3SV7 A;  2VWN A;  3KNX A;  4Y71 A;  2XWB I;  1GI0 A;  2W26 A;  3GY2 A;  1GI4 A;  1QUR H;  3IIT A;  4FUE A;  3KYG A;  1CHO G;  1Q31 A;  1Z71 A;  1C1U H;  1IQJ A;  1CBW C;  1CSO E;  3MHW U;  1HJA C;  1Y3U A;  1ESB A;  4KEL A;  4CRB A;  5EGM A;  4A1T A;  3M36 A;  3Q76 A;  2KCY A;  3ATW A;  1S0Q A;  1OWK A;  1ELV A;  4CRD A;  5JBA S;  3S7H B;  2GGV B;  4OS6 A;  1TPO A;  4RT0 A;  2P8O B;  4AB8 A;  3Q00 A;  3G01 A;  2QY0 B;  5EQQ A;  3BTQ E;  1QL8 A;  1NRQ H;  3I78 A;  2FOF A;  4CRE A;  1E1R D;  2R2M B;  3L3T A;  1Z6J H;  3QDZ B;  3LJJ A;  3RXR A;  2GP9 B;  4DUR A;  3RXJ A;  2GDD A;  1UCY E;  2F9U A;  4NIV A;  3F0P A;  3RM2 H;  2O8T A;  5F8T A;  1MZA A;  4I86 A;  1GHW H;  1A3E H;  1Y5U T;  2ZPS A;  1VIT F;  3A86 A;  1TAW A;  3SI4 H;  3SV8 A;  1GBK A;  1S0R A;  2FOD A;  3F3B A;  1GCT C;  3ITI A;  4Z6A H;  3GY7 A;  3PRD A;  4TWW A;  4I32 A;  4BAQ B;  4WY3 A;  5EST E;  3O8D A;  5DP8 A;  1O2U A;  1W7X H;  3W94 A;  1QRZ A;  2ODY B;  4YT7 H;  1UW7 A;  1MKX H;  4ABF A;  2G51 A;  1IOE A;  1VGC B;  2V3O H;  1G3C A;  4ZHM U;  1PYT D;  3U28 C;  2HLD D;  4BAK B;  5GXP A;  1VJA U;  1ANB A;  2RFK C;  1C5Q A;  1BHX F;  1LTO A;  2M2A A;  3KCG H;  4F49 A;  1DX5 M;  1GJ6 A;  1BMN H;  2WUB A;  1TMB H;  2A31 A;  5EPN A;  1BA8 B;  1SQR A;  2B7D H;  3K9X B;  1FAX A;  1Y3V A;  1TRM A;  1YPJ H;  2ZDA H;  5A2M H;  5LPE A;  4ZUH A;  2A0Q B;  4U32 A;  3EYD A;  5IDK A;  5GIB A;  1ID5 H;  1GMC F;  3ZIA D;  3M61 U;  1FIW A;  3F9E A;  1A0J A;  2ZDK A;  5EQS A;  5F6M A;  1QRW A;  3BG4 C;  4X6P A;  4CRA A;  1ACB E;  1FJS A;  3CS7 A;  1AKS B;  1MKW K;  1ZHM A;  2PKS C;  4RN6 A;  1EPT C;  5FL7 D;  1HRT H;  3A7V A;  1EOJ A;  1GPZ A;  4TY7 A;  1F0R A;  2SGP E;  4D9R A;  1S5S A;  1F0U A;  1QZ8 A;  3WY8 A;  1W14 U;  1LKB A;  3E0P B;  1CA8 B;  1DS2 E;  2VWO A;  3RXU A;  1O2X A;  2AHM E;  2PW8 H;  6LPR A;  3SU3 A;  1D3Q B;  2L74 A;  3E0N B;  1IQG A;  4CBO A;  1A61 H;  3PV2 A;  2VGC C;  3A84 A;  1GI9 B;  1AB9 C;  2KX4 A;  2NU4 E;  2VWM A;  4TSF D;  1JMO H;  2F9P A;  1EJN A;  6GCH F;  1LVO A;  1KYN A;  2AS9 A;  2DE9 A;  3VB7 A;  1HXE H;  1MTN C;  2R3U A;  3GCN A;  2GDE H;  3SGQ E;  1BIT A;  2I6S A;  3U1J B;  4MNW A;  3NRL A;  2Q6G A;  1N6X A;  2GT8 A;  3NCL A;  4X2Y A;  4AFQ A;  1DM4 B;  4E05 H;  3QZQ A;  5A8Y A;  1YM0 A;  1KLI H;  2A7C A;  5G4B A;  3S9C A;  1LPG B;  1BTW A;  1ELB A;  2K0Q A;  4WF8 A;  2WPK S;  2BD4 A;  3O8R A;  1AVG H;  2CK3 D;  1E79 D;  3U9A H;  4K69 A;  4A1V A;  1G36 A;  1ZRB A;  3N7D A;  1S6F A;  1OYT H;  1EXF A;  1H8H D;  1O34 A;  1PJP A;  1GG6 C;  3AAS A;  1P9S A;  1P2I A;  2XW9 A;  1W7G H;  3LC3 A;  3SJK A;  4A6L A;  2IOT A;  3BTK E;  2UWP A;  1NTP A;  1GDQ A;  1GHX H;  1EJA A;  1BRU P;  1NFU A;  3GCH B;  5EG4 A;  2W6J D;  2C93 B;  2FM2 A;  1JIM A;  2ZQ1 A;  3KYF A;  4FU9 A;  4BTU B;  2VBC A;  2XXL A;  1IQK A;  5JB8 S;  1AFQ B;  2PSX A;  3A8C A;  1WYK A;  3EE7 A;  2QXH A;  1GMH F;  3CNR A;  1KIG H;  3P17 H;  5HIY A;  4AB9 A;  3URD A;  1T4V H;  3UQV A;  1O3H A;  2HNT E;  2GMT C;  5DG6 A;  5CHA C;  3PYH A;  1K1L A;  1H9L B;  1MUE B;  3KQ5 A;  2ZGH A;  4OGX A;  1GBJ A;  2F83 A;  1QJ1 B;  3LDX H;  2YMS C;  3EA9 A;  4CRF A;  1CGJ E;  2FOE A;  1HAY B;  4GSO A;  3N7E A;  4CH2 B;  2TRM A;  1G3E A;  3SO3 A;  2WPI S;  4B1T A;  2BQW B;  1THR H;  5L2Y H;  1NN6 A;  1DWE H;  2FEQ H;  1O2R A;  4JYV H;  1DUE A;  5C20 A;  3E3T A;  2DE8 A;  2ZTY A;  4ISI H;  1NC6 A;  2XTT B;  1ZHR A;  1GHZ A;  3SN8 A;  1O3P B;  3LGU A;  3HGN A;  1GCT B;  1S84 A;  1ZZZ A;  2PFE A;  1J16 A;  1HV7 A;  2R0K A;  2ZI2 H;  4I33 A;  9EST A;  3L6P A;  4GHT A;  4K2Y A;  1Q3X A;  1OWE A;  3MMG A;  4YOG A;  2JIZ D;  1UTL M;  1NPM A;  1V2T T;  3TPI Z;  5HMA A;  2TGD A;  1EP6 A;  1SG8 B;  1UVT H;  1TGT A;  5GPI B;  3MNB A;  3UIR A;  1C1V H;  3I29 A;  3ODD A;  2P94 A;  2BQ7 B;  2D2D A;  1O32 A;  1QB1 A;  2THF B;  1MU6 B;  1Y59 T;  1NRS H;  1GHA F;  1TON A;  1MKW H;  4LK4 A;  1V2U T;  1NS3 A;  4GAW A;  1KXB A;  1NY2 2;  3FKS D;  3SNA A;  1C1M A;  3SUE A;  5JPM H;  4X8T H;  3EST A;  5AF9 H;  1GJ8 B;  1V2J T;  2XCN A;  1QQU A;  2FDA A;  3RU4 D;  3SBK A;  3E6P H;  1SGP E;  2A1D B;  2ZTX A;  1NU9 A;  1WQS A;  1CHO F;  3RDZ A;  2Y7Z A;  1Y3Y A;  1IHT H;  1XKB C;  1HJ8 A;  4YOI A;  1GBC A;  1ETT H;  1L2E A;  3A7W A;  4B74 A;  1K22 H;  2PUX B;  1S82 A;  1HCG A;  5C5N A;  1DIC A;  5K0H A;  4Y79 A;  2BMG B;  2FPZ A;  1AB9 B;  2OP9 A;  2XBY A;  1H8D H;  3U8T H;  1KLJ H;  1NU7 B;  5I25 A;  2BX3 A;  3SGB E;  1BBR E;  1O2S A;  1P2O A;  3MU0 A;  1FIZ A;  4B71 A;  1DE7 H;  1CT2 E;  3FAO A;  1UVS H;  1VIT G;  5T3H A;  4BAM B;  5J4S A;  1QCP A;  4ABJ A;  1W3C A;  1FPH H;  1OP2 A;  4K5Z A;  5EOK A;  2BX4 A;  1G2M A;  4NWK A;  3SV9 A;  3Q3X A;  4ISH H;  4X1P U;  1JRT A;  3TJV A;  2ZCH P;  3OX7 U;  3ZVA A;  2G4U A;  1WTH D;  3M35 A;  5E0J A;  3RMO H;  4WXI A;  1ZML A;  3ZZ9 A;  1GBL A;  4NIX A;  3R0F A;  1AVW A;  1TMU H;  2BDH A;  1O2G H;  2WV5 A;  2G52 A;  2W3I A;  3BEI B;  1H9H E;  3GIC B;  1SGD E;  5LPR A;  1MAB B;  1WDI A;  1NBM E;  2P95 A;  3SOS A;  3Q3Y A;  2IJD 1;  1LHD H;  1K1J A;  4RT1 A;  1RIW B;  4B6F A;  1SQT A;  4NZL A;  5L30 H;  4LOY H;  1COW D;  3LKW A;  5FPS A;  1SBW A;  1K1P A;  3U98 H;  1VCW A;  3BEU A;  3PLK A;  2BY7 X;  6CHA B;  1DLE A;  3I77 A;  3FZD A;  2TBS A;  1ARB A;  1EP5 A;  1N8O B;  1T8O A;  2WZQ A;  1N1L A;  1YC0 A;  1YPM H;  1ZYO A;  2H6M A;  1LHC H;  3OEH D;  1TBR H;  2BD7 A;  3ZZA A;  5C94 A;  1V2W T;  1P9U A;  1YLC A;  1XM1 A;  3JZ2 B;  2AGE X;  2OCV B;  3BG8 A;  2YMS B;  1O37 A;  1IQN A;  2P59 A;  1K21 H;  2GD4 B;  1DT2 A;  3KQB A;  4IN1 A;  4ZKN U;  2OQ5 A;  1D6W A;  3QTO H;  2XBW A;  1EZS C;  1O5A B;  2IPQ X;  1GL1 A;  3QWC H;  1ZHP A;  2NU3 E;  4AX9 H;  1YLD A;  2HRV A;  2IPH A;  2SNV A;  3OSY A;  4PRO A;  1DST A;  4H4F A;  1OWH A;  1D6R A;  1VJ9 U;  2HNT F;  3OU0 A;  5E2O A;  6GCH G;  4GCH F;  4F4O C;  1SKY E;  3PO1 B;  4CR9 A;  1C5Z B;  1G3B A;  1TE0 A;  3SHA H;  4JMY A;  1YYY 1;  1HAP H;  4IMZ A;  2ZG0 H;  3ZZ7 A;  1MCV A;  1E36 B;  3MNS A;  4BAO B;  2GVF A;  1C2K A;  2BY8 X;  3UPE A;  1YPG H;  1SGC A;  3ZZ8 A;  1VKY A;  3BTH E;  1AND A;  3QGJ A;  3UR6 A;  2WV4 A;  1LQE A;  2WSS D;  3KL6 A;  4XE4 A;  3UFA A;  2FS9 A;  1EAI A;  4FUB A;  1SOT A;  1ANE A;  1MBQ A;  2BDC A;  2ZF0 H;  2VIW A;  3EAJ A;  2G5V A;  1YY3 A;  3RXM A;  1XXD A;  1P01 A;  1GBT A;  3BEF B;  1MBM A;  3VGC C;  3UTU H;  1QJ6 B;  4INH A;  3E91 A;  5B6O A;  1AIX H;  2J9N A;  3DCL A;  3W95 A;  3FOA A;  2W7U A;  3GCT F;  3ATI A;  2KAI A;  3OY5 U;  1O5F H;  1B0E A;  1C2G A;  3BTM E;  3H7O A;  1DY8 A;  2VU8 E;  2WPM S;  3S0N A;  4KTU A;  1SVP A;  1QBN A;  1QTF A;  1TGC A;  3HK3 B;  2Z9K A;  2QC2 A;  1KTS B;  1PPE E;  3ZZ3 A;  4WMD A;  4Q80 A;  1A5H A;  1ZJK A;  1AU8 A;  1GMH G;  2V6N A;  2ANW A;  3LT3 A;  3C1K A;  1A4W H;  3A7T A;  3QN7 A;  1BQY A;  3AAV A;  3MTY A;  3BTG E;  2BY6 X;  3TJO A;  4ACA A;  1ELD E;  1A3B H;  1W12 U;  1WOF A;  3RXK A;  1LVY A;  5HXF A;  3OEE D;  2D1J A;  1TNJ A;  3BF6 H;  1K9O E;  1OOK B;  8GCH F;  1PQ8 A;  2F91 A;  4DII H;  2BDG A;  2GZ9 A;  1O36 A;  2ANY A;  1K28 D;  1SL3 A;  1BRA A;  3KHV A;  3W1E A;  1O2H A;  2ANM H;  1AUJ A;  1UTK A;  1Y5B T;  1SLW B;  4XSK U;  3P92 A;  5JBT A;  4E7R G;  1DOJ A;  4X2V A;  3E90 B;  5F53 A;  1TWX B;  2Q6D A;  4ZH8 A;  4BXS A;  1EAU A;  1T4U H;  1FUJ A;  3QLP H;  5ETX A;  4X2X A;  3SHC H;  2Z6B D;  2FO9 A;  5AFZ H;  3LGY A;  4GLY A;  1QNJ A;  2LNC A;  1ZPB A;  2BQ6 B;  1C1W H;  2NU0 E;  4X2W A;  5JDU B;  1GBB A;  4B76 A;  2NWN A;  3H5C B;  2VWL A;  2Z3D A;  1BB0 B;  3SZE A;  1J15 A;  1QRX A;  4ISN A;  2KZ4 A;  3IG6 B;  3HAT H;  3RLW H;  3HKI B;  2V3H H;  5HKK D;  1GHA G;  1W2K H;  2BD9 A;  2FWW A;  1WBG B;  3SU6 A;  1MAY A;  1T8L A;  1L0Z A;  4ABA A;  1KDQ A;  2VB0 A;  4B2B A;  1HAV A;  5DP7 A;  5A09 A;  5DP3 A;  2A4R A;  3RXF A;  1DUA A;  2H5D A;  4F48 B;  5LGO A;  1GBH A;  2HNT C;  1GDU A;  2CHA C;  2I6Q A;  5C1U A;  2ZFT A;  8EST E;  4Q4L A;  2DUC A;  2G55 A;  2G00 A;  2GCT C;  1SQO A;  1Z8J B;  3R3G B;  1CU1 A;  2XND D;  3A83 A;  5GWZ A;  1TYN A;  1C2J A;  1QFK H;  4K1S A;  1P12 E;  3B8J A;  3DFJ A;  2ZGC A;  3RC4 A;  1NT1 A;  3A82 A;  1F5K U;  2SGA A;  2Q6F A;  4RKO B;  5FHT A;  4Y11 E;  5GCH F;  1C2H A;  4O3T A;  3A87 A;  2A4Q A;  3TNT A;  7KME H;  1AD8 H;  1IQF A;  1UVU H;  4Y8Z A;  1O2W A;  2CGA A;  2OQU A;  4IC6 A;  2ZU4 A;  2Z3C A;  1MMJ N;  3SQE E;  2ZIQ H;  9LPR A;  2FOH A;  3RC5 A;  4CHA C;  1ELA A;  1O3N A;  1PPC E;  4OM9 A;  2OK5 A;  1U6Q A;  2H9E H;  1EZQ A;  5EXL A;  1VCQ A;  3MO9 A;  3SND A;  3TGI E;  4RI0 A;  3V12 A;  3VB5 A;  5HM2 A;  2ZO3 H;  1OWI A;  4ZRO A;  3GY8 A;  1SFI A;  5T6D A;  5DPA A;  1SLV B;  1O2O A;  1QIX B;  2PLX A;  1LO6 A;  1ZPC A;  1THS H;  2A4O A;  3A7X A;  4UFD H;  4VGC C;  3RXH A;  3B9F H;  1TGS Z;  5F8Z A;  4MLF B;  2ZEB A;  1CGI E;  4O03 A;  4OS1 A;  3ZYD A;  1EPT A;  4D8N A;  1F7Z A;  1DLK B;  1C5Y B;  1K1N A;  3GY6 A;  4KTS A;  1KY9 A;  4BTT B;  5LPF A;  3AK5 A;  4FUJ A;  1V6D A;  2XC5 A;  1TNG A;  2AIP A;  4OS4 A;  2Z3E A;  3RXC A;  2PWX A;  1BIO A;  1P09 A;  3U8O H;  3T28 A;  1EAW A;  1MCT A;  1NZQ H;  2ZHF H;  3OFN D;  1ZSK A;  4Q7Z A;  3SUG A;  3BTE E;  4I8J A;  3ODF A;  3TJU A;  1GBA A;  4YM9 A;  5JBC S;  1ZR0 A;  1O5C B;  4A1X A;  4YLQ H;  4K1T A;  2IN2 A;  2OXS A;  1A1R A;  3EQ0 H;  2ZHW H;  1JOU B;  1UTQ A;  3KID U;  2FES H;  1PYT C;  2K8I A;  1ORF A;  2B9L A;  1QGF A;  4J1Y A;  1AZZ A;  2QF4 A;  3TU7 H;  1O3O A;  1RD3 B;  2VVC A;  4H6T A;  3WWF A;  1HDT H;  1VZQ H;  3ZZ5 A;  5HGG A;  2V7Q D;  5TCC A;  5HM9 A;  1JRS A;  1HAO H;  1C2F A;  3STI A;  1A2C H;  1CA0 B;  1GVZ A;  2KAI B;  4X6O A;  1HAI H;  3LGW A;  1W0Z U;  5C3N A;  3BTW E;  2ZDM A;  2EY4 C;  1K1O A;  5GJ4 B;  1K0H A;  2WPJ S;  4YZU A;  1CT0 E;  1CT4 E;  4DY7 B;  1YPH C;  2WPH S;  4INK A;  4DIH H;  3ZZ4 A;  2ZGX H;  1O3F A;  4GCH G;  2A2Q H;  1SSX A;  3ZVF A;  1T32 A;  2FI3 E;  3B23 B;  3KQE A;  4ZCN A;  3FAN A;  1O3B A;  3ZZ6 A;  4Y10 E;  1FY8 E;  3MU1 A;  3MOC A;  3OY6 U;  1SI5 H;  5EPY A;  2EI7 A;  3BTD E;  4AC9 A;  3ATK A;  2H9H A;  1NRP H;  2WIN I;  2EI8 A;  1P05 A;  2GKV E;  5DN6 D;  1C9P A;  1AZ8 A;  3PRO A;  4JYU H;  3MU5 A;  1VCP A;  1ZJD A;  2ZKS A;  3PLP A;  3SUF A;  3RP2 A;  5C5O A;  2LEL A;  1V2P T;  1C1P A;  2O8L A;  3NPS A;  1SGY E;  2PGQ B;  2Y81 A;  1FI8 A;  1FPC H;  1UTO A;  1H1B A;  2CF9 H;  1BTZ A;  1C5R A;  1FN8 A;  1UCY K;  5L2Z H;  2SGD E;  1OX1 A;  1W10 U;  2W6I D;  3SU4 A;  3U8R H;  1GMD G;  4MPV A;  1G30 B;  5EJ1 A;  2FOA A;  3GCT G;  2QXJ A;  1IHS H;  1BTY A;  1RFN A;  1ELG A;  2UWO A;  2CF8 H;  5AVD A;  5AHG H;  1HGT H;  1FON A;  1SLU B;  3KGP A;  1TPS A;  1HYL A;  1EB1 H;  1GHB F;  2TGA A;  2VIV A;  4MQA A;  2QIQ A;  1HB0 B;  2CXV A;  2A7J A;  2OUA A;  4IW4 E;  2R0L A;  2Z94 A;  3M5N A;  2FOM B;  1O3D A;  1XUF A;  3D65 E;  3QUM P;  4GHQ A;  1O39 A;  3GYM A;  5EXM A;  2BZ6 H;  2O8M A;  2UUY A;  1CBW B;  4NWL A;  2WHX A;  2UWL A;  3F68 H;  1HJA B;  1P3E A;  1FN6 A;  1SLX B;  1P2M A;  4WVP E;  1XVM A;  2FX4 A;  3SNE A;  1G32 B;  2BY9 X;  1UO6 A;  8GCH G;  2YNB A;  2ANK H;  4JZI A;  4DG4 A;  3D23 A;  1KDQ B;  4TY6 A;  1HAV B;  1GVK B;  1SGN E;  2D8W A;  1YGC H;  1Y3W A;  1L4Z A;  3A8B A;  3BIV H;  2FTL E;  1SMF E;  2ULL A;  1OKX A;  2R2W U;  2BVR H;  3F6U H;  3GDV A;  1C5N H;  2ZDN A;  3BV9 B;  3VXF H;  4E7N A;  1C5O H;  2W5E A;  1C5V A;  2FX6 A;  4DT7 B;  2PSY A;  5IYT A;  5EOD A;  2VVU A;  2F3C E;  4MNY A;  1FAK H;  5GDS H;  1SGI B;  1AHT H;  3DT0 H;  4BAN B;  4MTB A;  5EU8 A;  1P57 B;  1MTS A;  3STJ A;  3RMN H;  1TQ0 B;  3PWC A;  3SV2 H;  2ALV A;  5LH8 A;  2ZC9 H;  1ELE E;  2XC4 A;  1RJX B;  2GJG A;  1SGE E;  3LOX A;  2ZFR H;  2M5T A;  1PQ7 A;  3GDU A;  4FUG A;  1TNI A;  4OGY A;  3MFJ A;  1AE5 A;  1O2J A;  4NIY A;  3TK6 A;  3SJO A;  2J92 A;  1MTW A;  2ZU5 A;  3FP6 E;  2C3S A;  4H6S B;  1C1S A;  1J9C H;  4FU7 A;  2P16 A;  1HJ9 A;  3CEN A;  5CE1 A;  1HBT H;  1NES E;  3GY5 A;  1ZMJ A;  1P2Q A;  1V2K T;  2FI5 E;  1DIT H;  3BG4 B;  5FAH A;  4FUH A;  2AMQ A;  1OSS A;  4MPX A;  4Y76 A;  4ASU D;  2PKS B;  3V0X A;  4TT3 D;  1EPT B;  3FVF B;  2TGP Z;  4HFP B;  1ZTJ A;  3DFL A;  2J97 A;  2P3T B;  5T1V A;  5C17 A;  3RMM H;  1O33 A;  1XMN B;  3EE0 B;  4E06 H;  2C8Y B;  5GCH G;  4Y0Z E;  2HVY B;  3A81 A;  4ZHL U;  4FVB A;  3M7U A;  1M9U A;  1O2Q A;  1HXF H;  1BTX A;  4GVU A;  4YXW D;  1NO9 H;  1TX8 A;  3RXO A;  2WPD D;  2FI4 E;  4AG2 A;  2VGC B;  5FCR A;  1C4Y 2;  1RTF B;  3QTV H;  5A0C A;  3DD2 H;  1C5S A;  3P8G A;  5EW1 H;  1SGR E;  1TRN A;  5EW2 H;  1Y8T A;  2JKH A;  1P2J A;  1G37 A;  1MTN B;  4AFU A;  1YPH E;  1MTV A;  3QK1 A;  2ZZU H;  1BTP A;  1ESA A;  1HNE E;  1C4V 2;  1UCY H;  1XUH A;  4O97 A;  1ELT A;  3A8D A;  2OLG A;  5F03 A;  1WXR A;  3NKK A;  1AWH B;  4A92 A;  5BPE A;  1WU1 A;  3A89 A;  3VEQ B;  1UHB A;  1TBZ H;  3VXE H;  1NFX A;  1A7S A;  2FTM A;  2HVX A;  4SGA E;  1TOM H;  5A0B A;  1GG6 B;  2CMY A;  3BSQ A;  1TOC B;  4I8H A;  4NCY A;  4ABE A;  4JZ1 A;  1TIO A;  1OWD A;  3GIS B;  5JB9 S;  1LHG H;  2BDB A;  2XCF A;  1TX6 A;  2BDY A;  2ZFF H;  4XDE A;  2A7H A;  1O2P A;  4F55 A;  1HAH H;  1PPH E;  2Z9I A;  3RXP A;  2K1Q A;  4NA8 A;  1GI2 A;  1V2Q T;  5C1X A;  1EFR D;  3NUM A;  1O5E H;  3ZZC A;  1C2L A;  2HWL B;  1BJV A;  3P6Z B;  2ZA5 A;  1SGT A;  1O2V A;  2WPL S;  1YKT A;  3ZVB A;  4M7G A;  3LH1 A;  1GI6 A;  2BM2 A;  1O31 A;  6EST A;  2GMT B;  1GHV H;  1QL9 A;  2JH0 D;  5CHA B;  3ZV9 A;  4DJZ B;  4CR5 A;  1AI8 H;  3M37 A;  1EZU C;  1NRR H;  3SV6 A;  2C90 B;  1DSU A;  3RXE A;  2BXU H;  1FY3 A;  4X0W U;  1O38 A;  1AWF H;  1H4W A;  1Z8I B;  4DW2 U;  2AER H;  2QF5 A;  3H7T A;  1O2T A;  1O3G A;  1LVM A;  1OPH B;  1W0K D;  1BHX B;  3ZZB A;  4DOQ A;  3TIU A;  1DY9 A;  2YOL A;  1PQ5 A;  1YP9 A;  1W13 U;  1PPB H;  1DWB H;  3F2F A;  1BMM H;  1CHG A;  4UD9 H;  1LKA A;  1D3D B;  3MNC A;  4ABG A;  1ELC A;  2OC8 A;  5T6G A;  1KXD A;  2JJ1 D;  5L6N H;  3QX5 H;  1QL7 A;  3ZZD A;  1J14 A;  1TQ7 B;  3SW2 B;  4Z0K A;  3V7T A;  3UOP A;  2Y80 A;  3RXI A;  3OYP A;  2FLR H;  3RXL A;  1RRK A;  1O2K A;  2GCH F;  2V0B A;  2VVV A;  3GY4 A;  5EJL A;  3K2U A;  1OXG A;  5C0T A;  3SI3 H;  2P8O C;  2BZA A;  2Z7F E;  1UTM A;  2AYW A;  2WYG A;  1UVP A;  3MO3 A;  4ISL A;  1BBR K;  1YLN A;  2BLQ A;  2HAL A;  3M3V A;  4TWY A;  1GJ9 B;  2KM0 A;  3D49 H;  3SU2 A;  1TNK A;  2WV9 A;  4XBC A;  3RXB A;  4ABD A;  3VPK A;  7GCH F;  2Y82 A;  2A45 B;  3UAI C;  1HIA A;  1KXF A;  2R3Y A;  4BOH A;  1GMD F;  4MDS A;  2ZHE H;  3M7T A;  4BNR A;  2B8O H;  4INL A;  1F2S E;  1GHB G;  1GBI A;  1GHY H;  3BN9 A;  1DVA H;  2VIO A;  1EUF A;  3LGT A;  3DSP A;  1A46 H;  4TPY A;  2ZEC A;  2BLV A;  2XRC A;  4K8B A;  1YF4 A;  1KSN A;  1AMH A;  1VGC C;  1EQ9 A;  2AGI X;  4R8T B;  2L6O A;  2ZP0 H;  2J34 A;  1JWT A;  2D26 C;  4ZKO U;  1RS0 A;  1ZSJ A;  3TGK E;  4KGA A;  1MTU A;  1LPK B;  4D9Q A;  1UK2 A;  2OC1 A;  1O35 A;  1LHE H;  1P02 A;  1G3D A;  1WCZ A;  1P2N A;  3GY3 A;  4UDW H;  1FY4 A;  3DSG A;  1SOZ A;  1L1G A;  1O3C A;  1YPK H;  4X1Q U;  3T5F H;  3S7K B;  5HYO A;  1TNH A;  4MPU A;  3TH2 H;  4NA7 A;  1Q2W A;  1W8B H;  4AFZ A;  2ZU1 A;  3SJ8 A;  1ZLR A;  2OD3 B;  4X1S U;  3A8A A;  1CGH A;  2RDL A;  1DFP A;  1C4U 2;  4UFF H;  1ZGI A;  1TRY A;  5FCK A;  4H42 U;  3RXG A;  3RUO A;  1RTL A;  1ZTL A;  5JBB S;  2FP7 B;  1O5G H;  1DAN H;  3M5O A;  4LZ4 B;  4DVA U;  1SGQ E;  1ZSL A;  2EA3 A;  2QGR A;  3PM3 A;  2J94 A;  3M7Q A;  3N99 A;  4X8V H;  2AIQ A;  1TA2 A;  3RLY H;  1FV9 A;  1TLD A;  3TK9 A;  1O2L A;  3RU4 E;  3F9G A;  1S6L A;  1H8E D;  1UK4 A;  3KEE A;  2FS8 A;  3K6Z A;  3WW7 A;  2UUF B;  4FUD A;  2EEK A;  7LPR A;  2Z9L A;  1TFX A;  1W0Y H;  3O8B A;  1QR3 E;  5SGA E;  5B6L A;  1F0T A;  2WUC A;  3JZ1 B;  1V3X A;  2RDE A;  2ZTZ A;  1RTK A;  2QYI A;  4YOJ A;  1LDT T;  1V2L T;  4WXV A;  4D7G A;  2AMP A;  3UWI A;  1ELF A;  3GOV B;  3U69 H;  3RC6 A;  2HLC A;  1BUI A;  1C5X B;  5PTP A;  3T25 A;  1P10 A;  3SYJ A;  2J98 A;  2ZGJ A;  1UHB B;  3U1I B;  3BTT E;  1AVX A;  1O3K A;  4K8Y A;  1AGJ A;  1KXA A;  4NGA H;  1XXF A;  1GJA B;  2VNT A;  2AFQ B;  2UUK B;  2F9V A;  2ZCL P;  3K65 B;  2RA0 A;  3K6Y A;  4SGB E;  1O2Z A;  1E34 B;  1AE8 H;  1DWD H;  4NZQ A;  3FP7 E;  2H2Z A;  2FLB H;  1AFE H;  3CP7 A;  1J8A A;  2BD2 A;  1GI5 A;  2Y5G A;  3GCH C;  4X1N U;  3PTN A;  1SPJ A;  1P03 A;  3BTF E;  2P3F H;  1H9I E;  2GT7 A;  4A7I B;  2ZWL H;  1CE5 A;  3TJN A;  4D7F A;  2VJ1 A;  5C0U A;  2BXT H;  4U30 A;  3LU9 B;  1AFQ C;  2KCA A;  4AGK A;  1HUT H;  2BDA A;  3MH4 A;  1OS8 A;  5H4I B;  2A32 A;  3KF2 A;  1BBR H;  2A5K A;  3TGJ E;  2GX4 A;  2GV6 A;  2G8T A;  5JYI A;  1F0S A;  4A5T S;  3LH3 A;  5GND A;  2FXR A;  2BYA X;  3OTP A;  5AFY H;  4P00 A;  4JK5 A;  5K7R A;  1TPP A;  1HAZ B;  3VGC B;  1RXP A;  3PWB A;  1JBU H;  2W3K A;  4XBB A;  2BD3 A;  2BOH B;  2NU1 E;  1DXP A;  1QA0 A;  1P8V C;  3RU4 T;  1VR1 H;  1IQH A;  1BML A;  1A0H B;  2CV3 A;  1OP8 A;  3QZR A;  1MH0 A;  4ASH A;  1YPE H;  5A8Z A;  2A5I A;  1L4D A;  3NXP A;  3MNX A;  2J2U A;  5DSF A;  2BOK A;  1T7C A;  4I8G A;  1O30 A;  3A7Z A;  4HG6 A;  5I46 H;  5EIY A;  4Q2K A;  1C1N A;  4CBN A;  4UFE H;  1LHF H;  1TGB A;  2CJI A;  1GJ5 H;  1O5B B;  4UE7 H;  1ZGV A;  3L33 A;  2B0F A;  3NZI A;  5EJZ A;  1CVW H;  2JH5 D;  1BRC E;  2KR7 A;  1THP B;  3EA8 A;  2C4F H;  2STA E;  5EXN A;  1GVL A;  1QA7 A;  4I31 A;  1A0L A;  2PR3 A;  1TA6 A;  3TH4 H;  3M3S A;  5E2P A;  1GI7 B;  4AYV B;  4DCD A;  1HIA B;  2QAA A;  1QB9 A;  1FZZ A;  4EST E;  1EB2 A;  2F43 B;  2F9O A;  4X1R U;  2HPP H;  1A5I A;  3ZVC A;  1SR5 C;  3MU8 A;  1ABI H;  2PTC E;  3RM0 H;  3H09 A;  2J38 A;  4HZH A;  1BT7 A;  4IMQ A;  4Z1M D;  1YWU A;  1O5D H;  1C1R A;  1IQI A;  1D3P B;  2FOC A;  4WWY A;  1V2S T;  3AW1 A;  3MI4 A;  3PMA B;  1AQ7 A;  1VIT H;  2O9Q A;  1E35 B;  1FQ3 A;  1IQL A;  4Y8X A;  1T8M A;  4I8L A;  1OHH D;  3ZV8 A;  4BXW A;  1YBW A;  3MH6 A;  4Y8Y A;  2QV1 A;  4B6E A;  4Q7X A;  1V2M T;  5FPY A;  1ZOM A;  2ALP A;  1NBM D;  2QE7 D;  2GCH G;  1WUN H;  3VB4 A;  2RA3 A;  3HPT B;  1GJ7 B;  1C2I A;  1P04 A;  4XD7 D;  5CHB A;  2ZFS A;  1TPA E;  2XOK D;  1S6H A;  2BY5 X;  1C5T A;  4HGC A;  4Y6D A;  2A2X H;  7GCH G;  3WWB A;  1BMA A;  1DWC H;  4MG3 A;  4TYD A;  2ZU2 A;  1IAU A;  4FET A;  4Y7B A;  1BZX E;  4FXG H;  3D62 A;  3C27 B;  2OBO A;  2BVX H;  4FVD A;  3LPR A;  2AMD A;  2W7S A;  2QXG A;  1GBE A;  1KXC A;  2PKA A;  2JH6 D;  1ABJ H;  1S83 A;  2KFW A;  1XUK A;  2GZ7 A;  3ELA H;  1BTU A;  2STB E;  5C2Z A;  5FX6 A;  4AG1 A;  1OYQ A;  2CHA B;  2H1U A;  1GJ4 H;  3RXV A;  1E38 B;  4Y7A A;  4K60 A;  2ZQ2 A;  4WH8 A;  3F1S B;  2GV7 A;  5F8X A;  2GCT B;  1P06 A;  5C67 A;  2PGB B;  3PTB A;  7EST E;  2FYR A;  2J95 A;  1EOL A;  1D3T B;  2ZDV H;  1B7X B;  5DKM A;  3KQD A;  4FUI A;  2Y6T A;  2XBV A;  3PV5 A;  3UNS A;  4ABH A;  2ZCK P;  1V2R T;  3S9B A;  2G4T A;  2Y5H A;  3A85 A;  4B75 A;  1RIW C;  3E8L A;  1AN1 E;  2YMS D;  2AH4 X;  5FBE A;  1LVB A;  1W11 U;  1D9I A;  4IGD A;  3IWM A;  2BVS H;  3OTJ E;  1GJD B;  1OWJ A;  1C5P A;  4Y0Y E;  1TNL A;  2EST E;  1ETR H;  6CHA C;  2R9P A;  2LP6 A;  4HI3 A;  1C1T A;  2ODP A;  5DO4 H;  4ZXY H;  1INC A;  4CHA B;  4LXB H;  2J98 B;  3A80 A;  1N8O C;  1GGD C;  1BDA A;  1OP0 A;  1L1J A;  1P2K A;  3AAU A;  3UNQ A;  2TIO A;  1SC8 U;  3UOU A;  1ANC A;  3UWJ H;  3LGI A;  1GWA A;  2G81 E;  8LPR A;  3M3T A;  3F9F A;  1C5U A;  1O3J A;  2PV9 B;  1PPZ A;  2VIQ A;  4NSV A;  2YNA A;  3ENS B;  1DDJ A;  1BCU H;  5EQR A;  4OS2 A;  1TB6 H;  2FYQ A;  4VGC B;  1X7A C;  3SU1 A;  3PV4 A;  1PPF E; 
#chains in the Genus database with same CATH homology
 1UW7 A;  5C94 A;  5HIZ A;  5HIY A;  2J97 A;  1QZ8 A;  2J98 B;  3EE7 A;  2J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...