1O2IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA02
1G32B 1SVPA 1C4V2 4JYTA 2BQ7B 1HV7A 3BTTE 1Y5BT 4X2VA 1BTWA 4IMQA 2WYJA 1GJBB 1L4ZA 3MMGA 2HLCA 3M35A 4Y79A 1FY4A 3RLYH 1AFEH 2WYGA 1GHYH 3PROA 3K6ZA 4WJG2 3QDZB 3ZZ4A 4OS2A 1ZOMA 2PUQH 4FUEA 1NFYA 1O3FA 1C1TA 1ZLRA 1WU1A 1MAXA 2ODQA 4BAKB 1ZPBA 3TLOA 1HJAB 1WV7H 2F83A 1KDQA 3P8NA 2Y5HA 4MPUA 3TH4H 2PR3A 4X2WA 1EATA 2R2WU 2A4QA 3TK9A 2GZ7A 3ZV9A 3A7ZA 5EODA 1O2MA 2WPHS 3EDXB 1FUJA 1TPAE 5HXFA 1ELEE 1HAYB 4D7FA 1O3DA 4YESB 4AGJA 1QIXB 1ZPCA 1HIAB 3TPIZ 4X2YA 1QBVH 1NRSH 1XX9A 4MNVA 3AASA 4GCHF 1TABE 1ORFA 2WUCA 5A09A 1GI8B 2O8TA 3GYMA 1VCQA 2PKSB 4ABFA 1O2IA 1ZMJA 2PSYA 1SI5H 2VVVA 3SU0A 1YM0A 4E7NA 3ZV8A 1OWIA 3U9AH 3PLBA 3SV2H 4FUIA 3BTGE 1B0FA 4XBBA 1O3EA 5LGOA 2VWMA 3R0FA 1UTPA 4UE7H 3PMHB 4ISOA 1QQUA 2VINA 3ZYEA 1LVBA 1O33A 2XCFA 2BDGA 2WINI 1AI8H 1C5UA 3RXIA 4Y76A 2A4RA 2VWOA 1MQ6A 1ZSKA 1IAUA 5DP6A 4GAWA 3V0XA 1ANEA 4Z0KA 4BAOB 1A5IA 4ZKOU 2A5KA 5ABWA 2ZI2H 4GUXA 2GT7A 1JXPA 3LH3A 2ANWA 5DO4H 3TVJB 2ZGXH 6CHAB 1OWEA 2BD4A 1C9TA 2NWNA 2LPRA 1FQ3A 1Z8GA 1FAXA 1TX6A 2ZKSA 1G3CA 1O5GH 3SU4A 4ABEA 1A5HA 2H9HA 4PROA 2R2MB 1F2SE 1YLDA 5GDSH 4JZEH 1D3DB 1MCVA 2BY9X 3HKIB 4U32A 2W3IA 2JETB 2XWBI 4MPWA 5AHGH 1CA8B 3A82A 1SGDE 1ZHPA 2Z9KA 3A8AA 1GI6A 3T26A 1KTTB 4WWYA 1F5RA 4OS4A 1CHOG 3OSYA 1SR5C 1SQAA 1RTFB 3BEFB 4NFEA 2BY5X 2QIQA 1E0FD 4FUCA 1GHBG 4K8BA 1P3EA 3GCOA 1FY5A 3R3GB 2Y5FA 5E2PA 2Q6DA 2STBE 3HGPA 2XTTB 3QGJA 5DP8A 1C5YB 4O03A 1P02A 2ZU4A 2BLOA 4JMYA 2BDCA 3TH2H 1VCWA 3GDSA 1C1PA 2FLBH 1CHGA 1DITH 5FAHA 4K8YA 3RXTA 4INKA 5TJXA 5C3NA 1BTHH 4K5ZA 1T4UH 4FUHA 2XRCA 3H7OA 3M61U 1HXFH 3BTDE 1O36A 1T32A 2KAIA 3W94A 4KTUA 3TJNA 2SNVA 2XC5A 3ZZ7A 3SGBE 2OC8A 1O2PA 1MMJN 4UEHH 5DJ7A 3RXOA 4K3JA 1ZPZA 1C4Y2 1YPMH 1W8BH 5DP7A 4Y8ZA 4B75A 1BHXB 3JZ2B 5LH8A 3VFEA 1THPB 2OBQA 3E0NB 1SGFG 1FLEE 1AU8A 1CBWC 1HBTH 3EE0B 3L6PA 3RMMH 1W14U 3GISB 3P95A 3RXDA 1FIZA 1RS0A 2BXTH 2Z9IA 5EQQA 5HMAA 2ZGJA 2J2UA 3UOPA 3VEQB 3SNBA 1ZHMA 4A92A 1C2HA 5AF9H 7GCHG 1UHBB 2H9TH 1O3PB 4X8UH 5K0HA 2A45B 1QA7A 4CHAB 5AFYH 5T6GA 1XKBC 1BTYA 1BRAA 2AMPA 1FIWA 1EZQA 5FXLA 2G4TA 1O2QA 1HAVA 1N6XA 2SGFE 2BXUH 1ABIH 2PV9B 2CV3A 1P8VC 2W5EA 2ZP0H 4NIWA 1V2LT 1LPKB 1UCYH 3ATKA 1LMWB 1OYTH 4HZHA 2BOKA 1ZYOA 3MH7A 3SI4H 1N1LA 3RXHA 1FMGA 1EZUC 4TWWA 5A0CA 4AN7A 1P04A 2ZTXA 3RXQA 3DT0H 1C5MD 5T3HA 3ATMA 3PYHA 4WH8A 2GX4A 1HAZB 1V2PT 3PMJA 1UTJA 2P59A 1KDQB 1W10U 2BTCE 2VH0A 5TCCA 3RXVA 1O3JA 3A85A 2BD8A 1Z6JH 2ZGHA 1CA0B 2FPZA 1BBRK 3U1JB 1VZQH 4Y11E 1L2EA 4X8VH 1O5CB 2IOTA 1EZSC 1LHEH 2F9PA 4XOJA 1W7GH 2TGPZ 2BMGB 3T29A 3D65E 2OINA 2FWWA 3A7TA 1T7CA 1A5GH 1WSSH 1NN6A 1IOEA 2I6SA 1C2IA 3KNXA 2VVUA 2ZZUH 1TBRH 2JH0D 3LGVA 1PPZA 4JCNA 1NT1A 3QO6A 5C2ZA 2CGAA 3HKJB 3C1KA 1AHTH 1LHFH 2AFQB 4HI3A 1KXAA 2H6MA 3Q76A 1TNGA 1GMDG 3ZZBA 4NZLA 4INHA 2HGTH 3LU9B 4FUBA 5EQSA 2OC1A 3LGUA 2BX4A 4DY7B 1V2NT 1S5SA 1TGTA 1LKBA 1WTHD 1CBWB 4IGDA 1F0TA 2GKVE 3M3TA 3P92A 2F9OA 3BG8A 2ZWLH 1EUFA 2J95A 4OS6A 1K9OE 1O39A 6GCHG 1BRCE 3ZVAA 1GBTA 2ZA5A 1P2OA 1SGYE 1VCPA 4FUJA 3AW1A 3SV9A 4X6MA 2F9NA 5J4QA 1AWFH 2BB4A 2G5NA 5L2ZH 1ETRH 1W2KH 2AH4X 1ZRKA 3BTEE 4DIHH 3VB6A 3A83A 1C1RA 1HYLA 2DUCA 1PFXC 4CBNA 4K1TA 2AIQA 1RXPA 5F03A 4OS5A 5PTPA 2UWOA 2BOHB 3ATIA 1HXEH 5JBTA 4I8KA 1YF4A 3F6UH 3F9HA 1BMAA 2H9EH 4JZ1A 3NUMA 1GI5A 2QV1A 3QX5H 5GCHG 4BXWA 3ZZ8A 2FXRA 1ANCA 2GCHG 1GDUA 2AEIH 3M5OA 2WPIS 3MI4A 2FTMA 2ZU2A 4GHQA 1GJ8B 4XFQA 2Q6GA 1XUGA 3SV7A 3GCHC 4CREA 1BTXA 4F4OC 2ZU3A 5H4IB 4DVAU 3EYDA 5C5OA 2CMYA 1DS2E 3HK6B 3E8LA 1T8OA 2Y5GA 2FTLE 4O97A 1C1NA 1WQSA 4WXIA 1T8MA 1MZAA 1V2ST 1TGSZ 1EXFA 3D23A 2BY6X 5E2OA 3RXLA 5FCKA 2BD9A 1W12U 1NESE 4MTBA 4KTCA 2WPLS 4ESTE 1C2LA 1ZTJA 1UTQA 2VJ1A 3BEUA 2Z7FE 1QQ4A 3LJOA 4A7IB 2G8TA 2QAAA 3T25A 4LXBH 2BQWB 4THNH 1AFQB 1YPEH 1NTPA 2HPQH 2BZ6H 2KAIB 2A4OA 2TRMA 3K6YA 4NSVA 2ULLA 5EPNA 3GCNA 3E0PB 1C5SA 1IQLA 1C2DA 2VGCC 3SJOA 2Y7XA 4Q7XA 2JH5D 7GCHF 3SU1A 2BD7A 3BTHE 1F5LA 2F9UA 1QCPA 1AE5A 1ELBA 3KF2A 2ZNKH 1JMOH 3LDXH 1Y3YA 1BA8B 2FMJA 1K1LA 1QHRB 1GHVH 2TPIZ 4ZMAH 4AORA 2W7UA 1QTFA 2R9PA 1FY1A 1A0JA 1MH0A 4RN6A 1EJAA 1CE5A 1P06A 1TNIA 3KQDA 1YPHC 1OP2A 1HAGE 2UUJB 1P3CA 1GBMA 1NO9H 3Q3XA 4Y0ZE 1X7AC 3A81A 2C90B 2PTCE 4CRDA 5DP9A 1KXCA 3GDUA 2QY0B 3QN7A 2OC7A 2PUXB 3VPKA 2SGQE 1K28D 1EOJA 2FOCA 4CRAA 1DE7H 4AG2A 1SGIB 3ITIA 2Y7ZA 1SG8B 1D9IA 1UTMA 2Y82A 1SGCA 2GV6A 2AYWA 3BF6H 1ZZZA 1OWKA 1LQDB 3H7TA 3PLKA 5A8XA 1HDTH 1Z8JB 1ANDA 4NA9H 5C20A 2FP7B 3ZZCA 1BOQA 1G3DA 3QTOH 4Y8YA 3QZQA 1EJMA 1Q3XA 3GY6A 3U1IB 4TPYA 3P70B 3V7TA 3GDVA 4AYVB 3NPSA 1MTNC 2A2QH 3GCHB 2ZIQH 1TE0A 1GJ4H 1C2KA 4SGBE 2RCEA 3E3TA 3M36A 1V2JT 4UFEH 3LH1A 9LPRA 2PHBA 5GIBA 4ZKNU 1DPOA 1IQKA 4WMEA 4BTTB 3MU5A 4YLUA 4ABIA 1GMDF 1H9HE 1QA0A 1DWEH 1ZGIA 1E37B 4ZXXH 3RXPA 1IQIA 1GWAA 1UCYE 4B2AA 1TONA 3MWIU 1W7XH 4YOGA 3DHKH 3O8CA 2ZDAH 1OSSA 4CR9A 5EXMA 1GBEA 3FP7E 4X1SU 2GMTB 1AZ8A 3MHWU 2GV7A 5GWZA 4K1EA 2WUBA 3ZVEA 4XDEA 3SUDA 2VGCB 3LT3A 3S0NA 6GCHF 2ODYB 3RXRA 5B6OA 1O2OA 2ZU5A 4YTAA 3EA8A 2F9BH 2QXGA 5EPYA 3SJ8A 5HM2A 4I8HA 2P93A 4XE4A 4FUFA 4ZHMU 3ZZAA 3IWMA 1P9SA 4CH8B 3QGNB 4CRFA 1YPGH 2ALPA 1ESBA 1V2TT 1LQEA 1PJPA 3MU0A 4BAMB 2VH6A 4ISIH 3SW2B 1MKWK 1Y5UT 1L1NA 5F8ZA 4NA7A 4B73A 1YBWA 3TJOA 2ZU1A 1L4DA 1S6HA 2ZFPH 4JZDH 1J8AA 3RXMA 3UREA 2VU8E 1TALA 2BD2A 1GCTB 1UVSH 1SGQE 1TMUH 1SSXA 2BHGA 1P9UA 1DLKB 2FOEA 1RTLA 2GCHF 1LO6A 1TIOA 1QL7A 8LPRA 2Q6FA 5EGMA 1B5GH 2PKAA 1GL1A 4VGCB 1P2KA 5C1UA 1PPCE 1LDTT 4UFDH 2FLRH 3FAOA 1HUTH 3PMAB 3V3MA 4IBLH 4YOIA 4MQAA 1OP0A 1MKXH 4FUGA 5A0BA 2VB0A 3RXSA 1YLCA 4K69A 1DXWA 1P2JA 1NS3A 2BDIA 1AVGH 4K2YA 2A1DB 1P2MA 5AVDA 3PO1C 1KIGH 5DPAA 3TJVA 2HVXA 4ABBA 1DSUA 1A46H 4WY3A 1ESAA 5A2MH 2IPHA 3F9GA 3BTME 4NCYA 3MH5A 1EPTC 2G55A 4X1PU 4YOJA 1O34A 1MTUA 2ILNA 1O2NA 2K1QA 5DKMA 1Z6EA 5LPFA 5DK1A 1G3BA 1A1RA 3E90B 3FANA 2OBOA 4JZIA 3ZZ3A 2EC9H 5F8TA 3NWUA 4X2XA 2GCTC 2BVXH 1GBFA 3LC3A 1LPGB 1QJ7B 1TWXB 1O2UA 1KXEA 1VJAU 2IN2A 5E8EH 2STAE 1JBUH 3M7QA 5IYTA 2OLGA 1GG6B 4X6NA 1SPJA 4R0IA 5I25A 2SGAA 1S82A 1GHAG 4DGJA 1GI4A 2Y80A 2FOMB 1SLWB 2A7JA 3LJJA 4IMZA 1Y3WA 3CP7A 4Y7BA 3BTQE 2OCVB 5SGAE 3SO3A 5JBCS 3SJKA 5TCAA 3DUXH 3GY2A 2PW8H 4BXSA 1EAUA 5FBIA 3A8DA 2C3SA 1TNJA 1ELVA 2ZECA 1GI2A 1SBWA 1UO6A 3BG4C 4DJZB 3A7WA 4A5TS 4NGAH 1AUJA 1GMHG 1FAKH 2CXVA 2QC2A 1ETTH 1RIWC 3O8BA 1GMCF 1W13U 4TYDA 1H9IE 1T4VH 3VGCC 1Z7KA 1S6FA 2V3HH 1K1JA 1Y8TA 2A7CA 1O35A 2FX6A 1ACBE 1TYNA 3SNAA 2A32A 2ANMH 4NG9H 4RKOB 1MBQA 3F9EA 3GCTG 4LZ1H 4NZQA 2ZHDA 3KQEA 4A1VA 1TNKA 1ZR0A 3GYLB 1TGNA 5DP4A 1B0EA 2ZC9H 4ASHA 1GI0A 2ALVA 2HNTE 2PLXA 2QA9E 2CHAC 1IQNA 2TGDA 3A89A 2OUAA 4DT7B 3Q00A 1L0ZA 1SGEE 3RXBA 1G36A 3JZ1B 3S9AA 2QGRA 5T6DA 1RD3B 4YT6H 2RA0A 3SUGA 1EOLA 1HB0B 4AG1A 2FOGA 1OYQA 3CS0A 3QK1A 2V35A 4NWLA 1JOUB 2DE8A 2GTBA 3ZZ5A 1YCPM 1BB0B 5EXLA 1D3QB 1NU9A 2HRVA 1QL8A 4MNYA 1MU8B 5EW2H 1C2EA 4U2WA 1GGDC 1THSH 2Z3EA 2O9QA 1A3EH 4IW4E 7KMEH 2ZDKA 3OU0A 1O3HA 2H2ZA 2ZHFH 3LGWA 4BAHB 2G4UA 1VGCC 1A4WH 1GDNA 3T27A 1C1UH 3SNCA 2FM2A 1ZMNA 1K22H 4BAQB 1GBCA 1NFXA 1FY8E 4ZXYH 1ELCA 5L30H 3AAUA 3UQOA 3ZVGA 3SUFA 3BTWE 3RXAA 3RP2A 3U8TH 1BTUA 1TX7A 2B8OH 2PTNA 4UFGH 2VIQA 2A31A 2BDHA 1RTKA 2NU4E 1GI3A 1WUNH 1O37A 3QLPH 2O8WA 5EU8A 1G37A 1FN8A 2TIOA 2AGIX 3HGNA 2DE9A 4I8JA 1DOJA 8ESTE 4WMFA 1YPHE 3A7VA 9ESTA 4Y71A 2QF3A 3EGKH 2VIVA 2JH6D 4YM9A 3RXEA 4Q2KA 1HFDA 2AIPA 2WPMS 1ZJKA 2C8WB 1PPBH 1RIWB 4CH2B 1O2TA 3T5FH 1DT2A 1O2YA 2QN5T 3AW0A 1SHHB 1TGBA 5L2YH 1H9LB 4B71A 1GJ7B 1PQ5A 3UWJH 2NU2E 5J4SA 3RXJA 1A0LA 1V6DA 4I7YH 4TPIZ 2F3CE 1MTWA 3MNCA 5EXNA 3SU3A 3UUZA 1ZSLA 2QXJA 2ESTE 1CU1A 1LHCH 1OS8A 4WH6A 4B1TA 2THFB 4K1SA 1AVXA 2NU3E 4AGKA 3BV9B 3ZZ6A 4AZ2B 5AFZH 1AQ7A 1ZSJA 2SGEE 2RA3A 1D3TB 2XC0A 3E16B 3RMOH 1TA2A 2HNTF 1PQAA 3EA9A 4X6PA 3F9FA 3UNSA 1FONA 2Y81A 1SQTA 2XW9A 4HTCH 2ZO3H 1BT7A 4D9RA 5HYOA 3STIA 1IQMA 1V2QT 4JK5A 5EW1H 2A5AA 2P94A 2PKAB 2FEQH 3O8DA 1DANH 1TRMA 3V13A 4INLA 5HM9A 2B0FA 1QBNA 1P05A 1GBJA 1C5XB 1PPFE 1YCPH 1O5BB 2D8WA 1AKSB 1SGNE 5A8YA 2SFAA 2ZCHP 3A80A 2FOFA 1JWTA 3NKKA 1F92A 1C1QA 4O3TA 2W26A 1TQ7B 2G51A 3S9CA 4FU7A 4HGCA 1O2WA 1KXFA 3U98H 1ZHRA 8KME2 2A4GA 3TGIE 4Q7YA 1GGDB 1SL3A 2VIOA 1W11U 1OP8A 3PLPA 4YT7H 4B74A 4SGAE 3SZNA 4AOQA 1GHAF 1QRWA 2M5TA 2FOAA 4H6SB 3ZZ9A 1O2HA 5JB8S 5A0AE 3KN2A 3KQCA 1QFKH 1NU7B 1FZZA 1UK2A 2WV4A 3RC5A 1KY9A 3UNRA 1ELTA 1V3XA 2GT8A 1CGHA 2GZ9A 1GI1A 2EI8A 1L1JA 1XMNB 1GMHF 1ZTLA 7ESTE 4KKDA 1CHOF 2O8LA 1XVMA 1DWCH 2C93B 2A2XH 1TPOA 2R3YA 4UONA 1G2LA 3ATWA 3QZRA 4WVPE 1GHBF 5FCRA 1UK4A 1BITA 3NK8A 3RDZA 1GJ5H 1NROH 1TBZH 2FI5E 3GCTF 2FS9A 5E0JA 3PMBB 3PWCA 2ANKH 1TAWA 3BIVH 3TH3H 1C5VA 1KXBA 1YKTA 1GVZA 2OC0A 1RGQA 1FN6A 3SQEE 3N7OA 1O38A 3I77A 2ZTYA 4H6TA 1JRSA 2BD3A 5JDUB 1Y59T 2R3UA 3UNQA 4GHTA 2HNTC 3UIRA 4ABDA 2P3FH 4RSPA 4YZUA 2C8ZB 2XBWA 1SLXB 4IS5A 4AB8A 1AO5A 3G01A 4J1YA 3NCLA 2VIDA 1GBBA 3PTBA 1ARCA 4J2YB 2WPKS 1SGFA 3GY3A 1PYTC 4MG3A 1QRXA 2OXSA 2BDYA 3VB3A 3ZZDA 1TBQH 4FXGH 1Z8RA 3FP6E 3SGQE 1P57B 3KHVA 4OGXA 2Z9JA 1UJ1A 3UWIA 4DURA 4AX9H 2FYQA 1EASA 1E35B 2QXIA 3BIUH 2ZPRA 4UFFH 1RFNA 2ZHWH 4I31A 1MUEB 1F0UA 1HAIH 1O2SA 2ZFFH 2P95A 2HWLB 4Y8XA 2AERH 1CQQA 1MAYA 2ZDLA 1F0RA 4WMDA 1C5LH 2ZQ2A 5BRRE 3FZDA 5DG6A 2W3KA 1P03A 1O30A 1EX3A 2FI3E 3LPRA 2V6NA 4F49A 5JBAS 3MYWA 4UD9H 5EOKA 2SNWA 3MNXA 3SV8A 4MPVA 2B5TB 1G30B 5F8XA 1A61H 4X1QU 2P16A 2PWXA 2PSXA 3H5CB 5ETXA 2ZPSA 4AFQA 4M7GA 3MNBA 4KTSA 1PPGE 1INCA 2FX4A 3DFLA 2B9LA 3T28A 1GJAB 1SGPE 1VJ9U 2O8UA 4IN2A 2BX3A 3E1XB 1GDQA 3TU7H 1UCYK 3QUMP 4U01A 4JZFH 2C4FH 1ID5H 1SOTA 2PGBB 1C1OA 3BN9A 3MOCA 4ZKSU 1O3NA 3M7TA 1TPPA 3FVFB 1NC6A 4Q7ZA 3SORA 1EP6A 1TNLA 3MFJA 4AFUA 1HJAC 4LK4A 4DCDA 2ANYA 1GBLA 1S0QA 1BIOA 2V3OH 3F1SB 1O2GH 2BZAA 1AVWA 1O0DH 1UTOA 1IQHA 3GY7A 3EA7A 2ZFRH 4I33A 3E6PH 1OX1A 2UWPA 2VNTA 1GBKA 2FO9A 1SLVB 5EQRA 1TMTH 5EG4A 2P8OC 3A8BA 1C5RA 1AGJA 1C5QA 1NY22 3RU4T 2F9VA 1EPTA 2A0QB 1QJ6B 1V2MT 2ZFSA 1HNEE 2G5VA 3ZVCA 1MD7A 1LVMA 2GP9B 2PKSC 1S85A 4R8TB 4JK6A 1MD8A 1NPMA 2G81E 2AMDA 2J34A 1V2WT 3S9BA 3SU5A 3I78A 3HATH 1ZGVA 3AVZA 1H1BA 1Q2WA 2EA3A 3KCGH 1P01A 1P11E 1UTLM 2QYIA 3SJ9A 1OWJA 1XKAC 3MU4A 1CT4E 4NSYA 4QT8C 3UFAA 1GCDA 4D9QA 4ABJA 1ELGA 1THRH 2UUYA 7LPRA 3RU4E 2PGQB 1WTGH 1M9UA 1AB9C 5FPYA 1GJ9B 1J9CH 3TNSA 2XBYA 1BTZA 4CBOA 2Q1JA 3RXFA 1J16A 3MNSA 2P3TB 4XBDA 5DP3A 4E05H 1O2KA 5FHTA 1B7XB 3EQ0H 2F91A 1MQ5A 1CT0E 1P2NA 4TY6A 3HPTB 1Z71A 1TFXA 1SB1H 1Y3VA 2P3UB 1SOZA 1N8OC 6CHAC 3ZYDA 2ZHEH 4ABAA 3RMNH 1WBGB 1EAWA 4XBCA 4WXVA 4NIYA 1XUJA 4AB9A 1K1IA 2HPPH 1GHZA 3P8GA 2AS9A 4GVUA 4ISNA 3RC6A 1XUKA 2JETC 1GL0E 1KYNA 6LPRA 1UVTH 6ESTA 5T6FA 5GCHF 1Y3XA 1Z1IA 1AD8H 4YLQH 5JB9S 1O5DH 2GDDA 3SI3H 2BLQA 2AMQA 1O31A 1DDJA 3QTVH 1EKBB 1BMMH 1SFQB 3SN8A 1OXGA 3ZVFA 1P2IA 5CMXH 4DIIH 4I8GA 2H5DA 1ARBA 1NFWA 3TGKE 2ZQ1A 1AKSA 1CO7E 3KGPA 3A84A 4OS1A 1BMLA 4D7GA 2CN0H 1O32A 2GZ8A 2J94A 3MU8A 1UVOA 1A2CH 3KL6A 1LTOA 2P8OB 3Q77A 1EB1H 1NRQH 2EI7A 1LVOA 1MZDA 1MTNB 1QJ1B 4WF8A 1LVYA 3B8JA 1DY9A 2ZEBA 1EZXC 1O5AB 3WY8A 3RXGA 5HGGA 1AUTC 3K2UA 2GDEH 4DOQA 1VITH 2FOHA 3URDA 1YC0A 4FVDA 3TIUA 1J14A 4I32A 1BBRH 3VB7A 4CRBA 2BM2A 1C5NH 1L1GA 2XWAA 1WAYB 1OOKB 1IQGA 3GY5A 3ELAH 3VB4A 1P2QA 2BDAA 1TNHA 1TRYA 3PTNA 1KLIH 3A7XA 3MU1A 3GICB 5E0GA 1LKAA 3KIDU 3SNEA 1V2VT 2BVRH 1GBDA 1AB9B 2BVSH 1QR3E 4KP0A 5JPMH 1W3CA 3SGAE 4ZH8A 2UUKB 2OQ5A 4DW2U 3RUOA 3RU4D 3SOSA 5DP5A 4IN1A 5GXPA 1K1MA 3B9FH 3OYPA 5BPEA 1UK3A 1TB6H 1GBHA 5ESBA 1QURH 3W95A 2CJIA 2ZGBH 5C67A 4MVNA 5DGJA 4CHAC 1V2OT 1N8OB 1WCZA 1JIRA 2WV5A 3SUEA 1HJ9A 5FBEA 3TJUA 3RM2H 8GCHG 1EQ9A 2XCNA 2WPJS 2UUFB 3E91A 1NZQH 1GJDB 5FPSA 1ZRBA 2ASUB 2H5CA 3MH4A 4D8NA 1O3KA 3A8CA 1EP5A 4ZAEA 1JIMA 3LGTA 2XC4A 1QGFA 1O3OA 3D49H 4GPGA 3U8OH 4ABGA 1CGJE 1V2RT 1ESTA 3M37A 1O2JA 3BEIB 4CRGA 3UQVA 4OS7A 1XUHA 1IHTH 1LPZB 1G3EA 3M5LA 3PV4A 3RXKA 4A1TA 3SHCH 1W0ZU 1C5WB 1WOFA 1G9IE 4ZUHA 1HAHH 1BQYA 1IHSH 1CA0C 3ENSB 3DA9B 1C5TA 4U30A 1DXPA 1C2MA 3PO1B 3P8FA 1K2I1 1J17T 3CS7A 1YPLH 4YO9A 3VXFH 1DUEA 1GJCB 1ETSH 1HJ8A 1EPTB 1TOMH 2GVFA 1C1VH 3TK6A 4HFPB 1C4U2 1GVLA 3F68H 1PQ8A 3FP8E 1DLEA 1QNJA 1TA6A 3EAJA 1SHYA 1ELDE 3ODFA 3UY9A 1BTPA 1YGCH 1WYKA 3GY8A 1TGCA 1DWDH 3A7YA 2G52A 2YOLA 1HAXB 3ATLA 2ZDVH 3MO6A 2GCTB 4XSKU 1DY8A 1HLTH 4ZKRU 4ZHLU 2ZDMA 1FY3A 1MTSA 1DM4B 2ZTZA 3TITA 2D2DA 1C2JA 4JYVH 1PPHE 1TMBH 1IQEA 3D62A 3IITA 2J92A 4OGYA 1ELFA 2OD3B 2FZZA 1UVUH 2VWNA 2XBVA 2SGPE 2JKHA 4LZ4B 3MO9A 3BTFE 1YPJH 1P0SH 1XM1A 3RM0H 3LGIA 4GSOA 1GI7B 3BG4B 1MTVA 2ZGCA 1DUAA 5JBBS 1ANBA 3S7HB 4DG4A 1HCGA 1NRRH 1JRTA 2VIWA 1J15A 2J38A 2YNAA 4O9VA 3M3VA 1RJXB 3VGCB 3M7UA 3RXCA 1SLUB 4CRCA 2BY7X 1CT2E 1O3AA 1BJVA 1FXYA 1WQVH 1O3MA 2UWLA 2AGGX 3URCA 3SBKA 1XUFA 2GGVB 3C27B 2Y6TA 1MKXK 1A3BH 1K1PA 1V2KT 3Q3YA 1GPZA 4AYYB 1G2MA 1S83A 1DWBH 1VITG 1W0YH 5ESTE 2ZHQH 3MO3A 1BJUA 4GLYA 2FS8A 2TGTA 2CHAB 1O3BA 3B23B 3CENA 5E0HA 1EAXA 3S7KB 2B7DH 1MU6B 2XBXA 4Z6AH 4BOHA 4X1NU 2QF0A 2A7HA 1SC8U 1GI9B 3OY5U 5GPIB 5K7RA 4NFFA 1C5PA 1AMHA 3T2NA 3GY4A 1V2UT 1BDAA 4ISLA 1TLDA 4UDWH 3U69H 3MTYA 2G00A 3FFGA 1PYTD 4X6OA 1E38B 1AE8H 4KELA 4BTUB 1OWDA 1QB1A 3UR6A 3SJIA 1D6RA 2OTVA 2VWLA 1CGIE 2SGDE 3TNTA 1UTNA 1FPCH 3ESTA 3NXPA 1S0RA 1FPHH 1VR1H 2VIPA 1AFQC 1Q31A 1CVWH 2Z94A 3RMLH 2CF9H 3LGYA 3KEEA 1VGCB 3QWCH 2Z9GA 3RLWH 2EEKA 1KLTA 4O3UA 3OTJE 4BTIB 3TK5A 1HPGA 4TWYA 1ZTKA 1O2RA 4H42U 3KQBA 1NRPH 2A5IA 1O3LA 2GD4B 3SV6A 8GCHF 1FDPA 1C2FA 3LOXA 5CHAC 3GOVB 4CR5A 3ODDA 4X0WU 1K1NA 3UR9A 1E34B 2BDBA 3P8OA 3BSQA 2XXLA 1Z1JA 3PWBA 4X8TH 2D26C 3SQHE 1QB6A 1AY6H 1MCTA 2QCYA 2RDLA 2VVCA 5FX6A 1BZXE 1SGRE 1C1MA 4E7RG 4IC6A 1BBRE 3I29A 4KGAA 2H1UA 2ZPQA 3A87A 1O5EH 1KSNA 1MKWH 1HIAA 1SGTA 1O3CA 1H8IH 1F7ZA 4FU8A 2HALA 3A86A 1O3GA 1F5KU 2D1JA 1C5ZB 1BRBE 1P12E 2FIRH 3HK3B 5I46H 1FI8A 1NRNH 1TRNA 4Y7AA 1ELAA 1QL9A 4A1XA 4NA8A 2ZCKP 1XUIA 5A8ZA 3DD2H 1K1OA 4NIXA 1BCUH 5FPTA 1O2LA 1XXFA 1A7SA 1O5FH 3MH6A 4K60A 4A6LA 1EJNA 1D4PB 2BLVA 1AIXH 4FVBA 5LPEA 1S81A 3K65B 1AZZA 3SNDA 3SU6A 1Y3UA 1ZJDA 2CF8H 3P6ZB 3ZVBA 1E36B 5F6MA 1ZMLA 4GCHG 5LPRA 1P10A 2Z3CA 2ZFTA 1BMNH 5IDKA 2I6QA 3LIWA 1QY6A 4MLFB 4ZROA 1S84A 1KXDA 3PB1E 1YP9A 1FNIA 1OWHA 1HAOH 4NWKA 1NM6A 3L3TA 1CSOE 4ABHA 1HRTH 3LONA 3UTUH 3T62A 3VXEH 3VB5A 1LHDH 1IQFA 1C5OH 1ABJH 1PPEE 1YPKH 1RRKA 2GMTC 4FUDA 2BQ6B 3A88A 2FYRA 3Q3KA 4I8LA 4AFSA 1FJSA 1KLJH 1MBMA 4FU9A 2LNCA 1TPSA 3IG6B 1C2GA 3L33A 3M5MA 1DX5M 2Z6BD 4TY7A 1H4WA 2BY8X 2QXHA 1QRZA 5G4BA 1LHGH 1O2VA 2OP9A 3AAVA 1P09A 1AWHB 2ZF0H 3OX7U 1XVOA 2J4IA 1OPHB 3NZIA 3SU2A 1HAPH 2EI6A 2C8YB 4JYUH 1U6QA 3P17H 1TOCB 4MNXA 5CHAB 4BNRA 1T31A 2C8XB 1GBAA 5GJ4B 1GBIA 2V0BA 4MNWA 3STJA 1K21H 3FZZA 3M5NA 1TX8A 2ZG0H 4IC5A 4B76A 1T8NA 1OKXA 1TQ0B 2NU0E 1NFUA 1IQJA 1BRUP 2OQUA 3M3SA 2W7SA 1SMFE 1KTSB 2FDAA 3BTKE 4NIVA 4X1RU 1GCTC 1SFIA 1VITF 5C1YA 1UVPA 1N6YA 3TGJE 3O8RA 2FESH 1C9PA 3ZVDA 1O2ZA 1C1WH 1GHWH 4B2CA 1DVAH 1GMCG 1SQOA 4Y6DA 1DFPA 5JYIA 4H4FA 2XNIA 3V12A 1HAVB 2PFEA 2FOBA 4X8SH 4Y0YE 4VGCC 3K9XB 1EAIA 2BLWA 1UMAH 4D76A 5C5NA 4ZHAA 1DICA 2ODPA 1F0SA 2FODA 1YCPK 2Z3DA 1H8DH 5C1XA 3U8RH 1FV9A 1O2XA 1XXDA 1BUIA 2TGAA 1UTKA 2AGEX 3OY6U 2ZCLP 4ISHH 3RC4A 5CE1A 5FX5A 2BD5A 1AN1E 1PQ7A 2TBSA 2Z9LA 4MDSA 1Y5AT 1QBOA 2FI4E 1T8LA 2R0KA 1GHXH 2ZDNA 1HGTH 1LCYA 2RG3A 2NU1E 1DSTA 4E06H 3S69A 2R0LA 3UPEA 2YNBA 1A0HB 4Q80A 1YYY1 3SHAH 2IJOB 3LC5A 2J9NA 2XYAA 2BYAX 4MPXA 4BANB 1BHXF 5L6NH 1GJ6A 1UHBA 2HOBA 1GVKB 1QB9A 1EB2A 4LOYH 4Y10E 1C1SA 3UOUA 2ZFQH 4B2BA 4AFZA 1GG6C 3PM3A 3LKWA 2O8MA 1D3PB 4RKJB 3RXUA 1D6WA 1Z8IB 3DFJA 1O3IA
chains in the Genus database with same CATH superfamily
1G32B 1SVPA 1C4V2 4JYTA 2BQ7B 1HV7A 3BTTE 1Y5BT 4X2VA 1BTWA 4IMQA 2WYJA 1GJBB 1L4ZA 3MMGA 2HLCA 3M35A 4Y79A 1FY4A 3RLYH 1AFEH 2WYGA 1GHYH 3PROA 3K6ZA 4WJG2 3QDZB 3ZZ4A 4OS2A 1ZOMA 2PUQH 4FUEA 1NFYA 1O3FA 1C1TA 1ZLRA 1WU1A 1MAXA 2ODQA 4BAKB 1ZPBA 1E1QD 3TLOA 1HJAB 1WV7H 2F83A 3F2FA 1KDQA 3P8NA 2Y5HA 4MPUA 3TH4H 2PR3A 4X2WA 1EATA 2R2WU 2A4QA 3TK9A 2GZ7A 3ZV9A 3A7ZA 5EODA 1O2MA 2WPHS 3EDXB 1FUJA 1TPAE 5HXFA 1ELEE 1HAYB 4D7FA 1O3DA 4YESB 4AGJA 1QIXB 1ZPCA 1HIAB 3TPIZ 4X2YA 1QBVH 1NRSH 1XX9A 4MNVA 3AASA 4GCHF 1TABE 1ORFA 2WUCA 1COWD 5A09A 4XRNA 1GI8B 2O8TA 3GYMA 1VCQA 2PKSB 4ABFA 1O2IA 1ZMJA 2PSYA 1SI5H 3OEHD 2VVVA 3SU0A 1YM0A 4E7NA 3ZV8A 1OWIA 3U9AH 3PLBA 3SV2H 4FUIA 3BTGE 1B0FA 4XBBA 1O3EA 5LGOA 2VWMA 3R0FA 1UTPA 4UE7H 3PMHB 4ISOA 1QQUA 2VINA 3WWBA 3ZYEA 3FOAA 1LVBA 1O33A 2XCFA 2BDGA 2WINI 1AI8H 4P02A 1C5UA 2J98A 3RXIA 4Y76A 2A4RA 2VWOA 1MQ6A 1ZSKA 1IAUA 5DP6A 4GAWA 3V0XA 1ANEA 4Z0KA 4BAOB 1A5IA 4ZKOU 2A5KA 5ABWA 2ZI2H 4GUXA 2GT7A 5KEDA 1JXPA 3LH3A 2ANWA 5DO4H 3TVJB 2ZGXH 6CHAB 1OWEA 2BD4A 3EE7A 1C9TA 2NWNA 2LPRA 1FQ3A 1Z8GA 1FAXA 1TX6A 2ZKSA 1G3CA 1O5GH 3SU4A 4ABEA 1A5HA 2H9HA 4PROA 2R2MB 1F2SE 1YLDA 5GDSH 4JZEH 3OAAD 1D3DB 1MCVA 2BY9X 3HKIB 4U32A 2W3IA 2JETB 2XWBI 4MPWA 5AHGH 1CA8B 3A82A 1SGDE 1ZHPA 2Z9KA 3A8AA 1GI6A 3T26A 1KTTB 4WWYA 1F5RA 3CNRA 4OS4A 1CHOG 3OSYA 1SR5C 1SQAA 1RTFB 3BEFB 4NFEA 2BY5X 2QIQA 1E0FD 4FUCA 1GHBG 4K8BA 1P3EA 2RFKC 3GCOA 1FY5A 3R3GB 2Y5FA 5E2PA 4DT4A 2Q6DA 2STBE 3HGPA 2XTTB 3QGJA 5DP8A 1S6LA 1C5YB 4O03A 1H8ED 1P02A 2ZU4A 2BLOA 4JMYA 2BDCA 3TH2H 1VCWA 3GDSA 1C1PA 2FLBH 1CHGA 1DITH 5FAHA 4K8YA 3RXTA 4INKA 5TJXA 5C3NA 1BTHH 4K5ZA 1T4UH 4FUHA 2XRCA 3PV2A 3H7OA 3M61U 1HXFH 3BTDE 1O36A 1T32A 2KAIA 2LP6A 3W94A 4KTUA 3TJNA 2SNVA 2XC5A 3ZZ7A 3SGBE 2OC8A 1O2PA 1MMJN 4UEHH 5DJ7A 3RXOA 2QF5A 4K3JA 1ZPZA 1C4Y2 1VKYA 1YPMH 1W8BH 5DP7A 4Y8ZA 4B75A 1BHXB 1FX0B 3JZ2B 5LH8A 4ACAA 3VFEA 1THPB 2OBQA 1K0HA 3E0NB 4XD7D 1SGFG 4OM9A 1FLEE 1AU8A 1CBWC 1HBTH 3EE0B 3L6PA 3RMMH 1W14U 3GISB 3P95A 3RXDA 1FIZA 1RS0A 2BXTH 2Z9IA 5EQQA 5HMAA 2ZGJA 2J2UA 3UOPA 3VEQB 3SNBA 1ZHMA 4A92A 1C2HA 5AF9H 7GCHG 1UHBB 4Q63A 2H9TH 1O3PB 4X8UH 5K0HA 2A45B 1QA7A 4CHAB 5AFYH 5T6GA 1XKBC 1BTYA 1BRAA 2AMPA 1FIWA 1EZQA 5FXLA 2G4TA 1O2QA 1HAVA 5GNDA 1N6XA 2SGFE 2BXUH 1ABIH 2PV9B 2CV3A 1P8VC 2IJD1 2W5EA 2ZP0H 4NIWA 1V2LT 1LPKB 1UCYH 3ATKA 1LMWB 1OYTH 4HZHA 2BOKA 1ZYOA 3MH7A 3SI4H 1N1LA 3RXHA 1FMGA 1EZUC 4TWWA 5A0CA 4AN7A 1P04A 2ZTXA 3RXQA 3DT0H 1C5MD 5T3HA 3ATMA 3PYHA 4WH8A 2GX4A 1HAZB 1V2PT 3PMJA 1UTJA 2P59A 1KDQB 1W10U 2BTCE 2VH0A 5TCCA 3RXVA 1O3JA 3A85A 2BD8A 1Z6JH 2ZGHA 1CA0B 2FPZA 1BBRK 3U1JB 1VZQH 4Y11E 1L2EA 4X8VH 1O5CB 2IOTA 1EZSC 1LHEH 2F9PA 4XOJA 1W7GH 2TGPZ 2BMGB 3T29A 3D65E 2OINA 2FWWA 3A7TA 1T7CA 1A5GH 1WSSH 1NN6A 1IOEA 2I6SA 1C2IA 3KNXA 2VVUA 2EY4C 2ZZUH 1TBRH 2JH0D 3LGVA 1PPZA 4JCNA 1NT1A 3QO6A 5C2ZA 2CGAA 3HKJB 3C1KA 1AHTH 1LHFH 2AFQB 4HI3A 1KXAA 2H6MA 3Q76A 1TNGA 1GMDG 3ZZBA 4NZLA 4INHA 2HGTH 3LU9B 4FUBA 5EQSA 2OC1A 3LGUA 2BX4A 4DY7B 1V2NT 1S5SA 1TGTA 1LKBA 1WTHD 1CBWB 4IGDA 1F0TA 2GKVE 3M3TA 3P92A 2F9OA 3BG8A 2J98B 2ZWLH 1EUFA 2J95A 4OS6A 1K9OE 1O39A 6GCHG 1BRCE 3ZVAA 1GBTA 2ZA5A 1P2OA 1SGYE 1VCPA 4FUJA 3AW1A 3SV9A 4X6MA 2F9NA 5J4QA 1KMHB 1AWFH 2BB4A 2G5NA 2J97A 1ETRH 1W2KH 2AH4X 5L2ZH 1ZRKA 3BTEE 4DIHH 3VB6A 1NBME 3A83A 1C1RA 1HYLA 2DUCA 1PFXC 4CBNA 4K1TA 2AIQA 1RXPA 5IK2D 5F03A 4OS5A 5PTPA 2UWOA 2BOHB 3ATIA 1HXEH 5JBTA 4I8KA 1YF4A 3F6UH 3F9HA 1BMAA 2H9EH 4JZ1A 3NUMA 1GI5A 2QV1A 3QX5H 5GCHG 3DSPA 4BXWA 3ZZ8A 2FXRA 1ANCA 2GCHG 1GDUA 2AEIH 3M5OA 2WPIS 3MI4A 2FTMA 2ZU2A 4GHQA 1GJ8B 4XFQA 2Q6GA 1XUGA 3SV7A 3GCHC 4CREA 1BTXA 4F4OC 2ZU3A 5H4IB 4DVAU 3EYDA 5C5OA 2W6JD 2CMYA 1DS2E 3HK6B 3E8LA 1T8OA 2Y5GA 2FTLE 4O97A 1C1NA 1WQSA 4WXIA 1T8MA 1MZAA 1V2ST 1TGSZ 1EXFA 3D23A 2BY6X 5E2OA 3RXLA 5FCKA 2BD9A 1W12U 1NESE 4MTBA 1W0KD 4KTCA 2WPLS 4ESTE 2WHXA 1C2LA 1ZTJA 1UTQA 2VJ1A 3BEUA 2Z7FE 1QQ4A 3LJOA 4A7IB 2G8TA 2QAAA 3T25A 4LXBH 2BQWB 4THNH 1AFQB 1YPEH 1NTPA 2HPQH 2BZ6H 2KAIB 2A4OA 2TRMA 3K6YA 4NSVA 2QF4A 2ULLA 5EPNA 3GCNA 1YY3A 3E0PB 1C5SA 1IQLA 1C2DA 2VGCC 3SJOA 4F48B 2Y7XA 4Q7XA 2JH5D 2M2AA 7GCHF 3SU1A 2BD7A 3BTHE 1F5LA 2F9UA 1QCPA 1AE5A 1ELBA 3KF2A 2ZNKH 1JMOH 3LDXH 1Y3YA 1BA8B 2FMJA 4F55A 1K1LA 1QHRB 1GHVH 2TPIZ 3DSOA 4ZMAH 4AORA 2W7UA 1QTFA 2R9PA 1FY1A 1A0JA 1MH0A 4RN6A 1EJAA 1CE5A 1P06A 1TNIA 3KQDA 1YPHC 1OP2A 1HAGE 2UUJB 1P3CA 1GBMA 1NO9H 3Q3XA 4Y0ZE 1X7AC 1YWUA 2AHME 3A81A 2C90B 2PTCE 4CRDA 5DP9A 1KXCA 5HKKD 3GDUA 2QY0B 3QN7A 2OC7A 2PUXB 3VPKA 2SGQE 1K28D 1EOJA 2KR7A 2FOCA 4CRAA 1DE7H 4AG2A 1SGIB 3ITIA 2Y7ZA 1SG8B 1D9IA 5EJ1A 1NBMD 1UTMA 2Y82A 1SGCA 2GV6A 2AYWA 3BF6H 1ZZZA 3PV5A 1OWKA 1LQDB 3H7TA 3PLKA 3OFND 5A8XA 1HDTH 1Z8JB 2EQNA 1ANDA 4NA9H 5C20A 2FP7B 3ZZCA 1BOQA 1G3DA 3QTOH 4Y8YA 3QZQA 1EJMA 1Q3XA 3GY6A 3U1IB 4TPYA 3P70B 3V7TA 3GDVA 4AYVB 3NPSA 1MTNC 2A2QH 3GCHB 2ZIQH 1TE0A 1GJ4H 1C2KA 4SGBE 2RCEA 3E3TA 3M36A 1V2JT 4UFEH 3LH1A 9LPRA 2PHBA 5GIBA 4ZKNU 1DPOA 1IQKA 4WMEA 4BTTB 3MU5A 4YLUA 4ABIA 1GMDF 1H9HE 1QA0A 1DWEH 1ZGIA 1E37B 4ZXXH 3RXPA 1IQIA 1GWAA 1UCYE 4B2AA 1TONA 3MWIU 1W7XH 4YOGA 3DHKH 3O8CA 2ZDAH 1OSSA 4CR9A 5EXMA 1GBEA 3FP7E 4X1SU 2GMTB 1AZ8A 3MHWU 2GV7A 5GWZA 4K1EA 2WUBA 3ZVEA 4XDEA 3SUDA 2VGCB 3LT3A 3S0NA 6GCHF 5C94A 2ODYB 3RXRA 5B6OA 1O2OA 2ZU5A 4YXWD 4YTAA 3EA8A 2F9BH 2QXGA 5EPYA 3SJ8A 5HM2A 3SYJA 3N7DA 4I8HA 2P93A 4XE4A 4FUFA 4ZHMU 3ZZAA 3IWMA 1P9SA 4CH8B 3QGNB 4CRFA 1YPGH 2ALPA 1ESBA 1V2TT 1LQEA 1PJPA 3MU0A 4BAMB 2VH6A 4ISIH 3SW2B 1MKWK 5F53A 1Y5UT 1L1NA 5F8ZA 4NA7A 4B73A 1YBWA 3TJOA 2ZU1A 1L4DA 1S6HA 2ZFPH 4JZDH 1J8AA 3RXMA 3UREA 2VU8E 1TALA 3OE7D 2BD2A 1GCTB 1UVSH 1SGQE 2W6ID 1TMUH 1SSXA 2XNDD 2BHGA 1P9UA 1DLKB 2FOEA 1WDIA 1RTLA 2GCHF 1LO6A 1TIOA 1QL7A 8LPRA 2Q6FA 5EGMA 1B5GH 2PKAA 1GL1A 4VGCB 1P2KA 5C1UA 1PPCE 1LDTT 4UFDH 2FLRH 3FAOA 1HUTH 3PMAB 3V3MA 2K0QA 4IBLH 4YOIA 4MQAA 1OP0A 1MKXH 4FUGA 5A0BA 2VB0A 3RXSA 1YLCA 4K69A 1DXWA 1P2JA 1NS3A 2BDIA 5CHBA 1AVGH 4K2YA 2A1DB 1P2MA 4RT0A 5AVDA 3PO1C 1KIGH 5DPAA 3TJVA 2HVXA 4ABBA 1DSUA 1A46H 4WY3A 1ESAA 5A2MH 2IPHA 3F9GA 4AC9A 3BTME 4NCYA 3MH5A 1EPTC 2G55A 4X1PU 4YOJA 1O34A 1MTUA 2ILNA 1O2NA 2K1QA 5DKMA 1Z6EA 5LPFA 5DK1A 1G3BA 1A1RA 3E90B 3FANA 2OBOA 4JZIA 2JJ2D 3ZZ3A 2EC9H 5F8TA 3NWUA 4X2XA 2GCTC 2BVXH 3KYGA 1GBFA 3LC3A 1LPGB 1QJ7B 3OEED 3UB0A 1TWXB 1O2UA 1KXEA 3PRDA 1VJAU 2IN2A 1YLNA 5E8EH 2STAE 1JBUH 3M7QA 5IYTA 1SQRA 2OLGA 1GG6B 4X6NA 1SPJA 4R0IA 5C17A 5I25A 2SGAA 1S82A 1GHAG 4DGJA 1GI4A 2Y80A 2FOMB 1SLWB 2A7JA 3LJJA 4IMZA 1Y3WA 3CP7A 4Y7BA 3BTQE 2OCVB 5SGAE 3SO3A 5JBCS 3SJKA 5TCAA 3DUXH 3GY2A 2PW8H 4BXSA 1EAUA 5FBIA 3A8DA 2C3SA 1TNJA 1ELVA 2ZECA 1GI2A 1SBWA 1UO6A 3BG4C 4DJZB 3A7WA 4A5TS 4NGAH 1AUJA 1GMHG 1FAKH 2CXVA 2QC2A 1ETTH 1RIWC 3O8BA 1GMCF 1W13U 4TYDA 1H9IE 1T4VH 3VGCC 1Z7KA 1S6FA 2V3HH 1K1JA 1Y8TA 2A7CA 2FX6A 1O35A 1ACBE 1TYNA 2F43B 3SNAA 5C0UA 2A32A 2ANMH 4NG9H 4RKOB 1MBQA 3F9EA 3GCTG 4LZ1H 4NZQA 2ZHDA 3KQEA 4A1VA 1TNKA 1ZR0A 3GYLB 4Q4LA 2KCAA 1TGNA 5DP4A 1B0EA 2ZC9H 4ASHA 1GI0A 2ALVA 2HNTE 2PLXA 2QA9E 2CHAC 1IQNA 2TGDA 3A89A 2OUAA 4DT7B 3Q00A 4I86A 1L0ZA 1SGEE 3RXBA 1G36A 3JZ1B 3S9AA 2QGRA 5T6DA 1RD3B 4YT6H 2RA0A 3SUGA 1EOLA 1HB0B 4AG1A 2FOGA 1OYQA 3CS0A 2L6OA 3QK1A 2V35A 2KZ4A 4NWLA 1JOUB 2DE8A 2GTBA 3ZZ5A 1YCPM 1BB0B 5EXLA 1D3QB 1NU9A 2HRVA 1QL8A 4MNYA 1MU8B 5EW2H 1C2EA 2WV9A 4U2WA 1GGDC 1THSH 2Z3EA 2O9QA 1A3EH 4IW4E 7KMEH 2ZDKA 3OU0A 1O3HA 2H2ZA 2ZHFH 3LGWA 4BAHB 2G4UA 1VGCC 1A4WH 1GDNA 3T27A 1C1UH 3SNCA 2FM2A 1ZMNA 1K22H 4BAQB 1GBCA 3KQ5A 1NFXA 1FY8E 4ZXYH 1ELCA 5L30H 3AAUA 3UQOA 3ZVGA 3SUFA 3BTWE 3RXAA 3RP2A 3U8TH 1BTUA 2WZQA 1TX7A 2B8OH 2PTNA 4UFGH 4TT3D 2VIQA 2A31A 2BDHA 1RTKA 2NU4E 1GI3A 5DN6D 1WUNH 1O37A 3QLPH 2O8WA 5EU8A 1G37A 1FN8A 2TIOA 2AGIX 3HGNA 2DE9A 4I8JA 1DOJA 8ESTE 4WMFA 1YPHE 3A7VA 9ESTA 4Y71A 2QF3A 3EGKH 2QE7D 2VIVA 2JH6D 4YM9A 3RXEA 4Q2KA 1HFDA 2AIPA 2WPMS 1ZJKA 2C8WB 1PPBH 1RIWB 4CH2B 1O2TA 3T5FH 1DT2A 1O2YA 2QN5T 3AW0A 1SHHB 1TGBA 5L2YH 1H9LB 4B71A 1GJ7B 1PQ5A 3UWJH 2NU2E 5J4SA 3RXJA 1A0LA 1V6DA 4I7YH 4TPIZ 2F3CE 1MTWA 3MNCA 5EXNA 3SU3A 3UUZA 1ZSLA 2QXJA 2ESTE 1CU1A 1LHCH 1OS8A 4WH6A 4B1TA 2THFB 4K1SA 1AVXA 2NU3E 4AGKA 3BV9B 3ZZ6A 4AZ2B 5AFZH 1AQ7A 1ZSJA 2SGEE 2RA3A 1D3TB 2XC0A 3E16B 3RMOH 1TA2A 2HNTF 1PQAA 3EA9A 4X6PA 3F9FA 3UNSA 1FONA 2Y81A 1SQTA 2XW9A 4HTCH 2ZO3H 1BT7A 4D9RA 5HYOA 3STIA 1IQMA 1V2QT 4JK5A 5EW1H 2A5AA 2P94A 2PKAB 2OK5A 2FEQH 3O8DA 1DANH 1TRMA 4HG6A 3V13A 4INLA 5HM9A 2B0FA 1QBNA 1P05A 1GBJA 1C5XB 1PPFE 1YCPH 1O5BB 2D8WA 1AKSB 1SGNE 5A8YA 2SFAA 2ZCHP 3A80A 2FOFA 1JWTA 3NKKA 1F92A 1C1QA 4O3TA 2W26A 1TQ7B 2G51A 3S9CA 4FU7A 4HGCA 1O2WA 1KXFA 3U98H 1ZHRA 2IPQX 8KME2 2A4GA 3TGIE 4Q7YA 1GGDB 1SL3A 2VIOA 1W11U 1OP8A 3PLPA 4YT7H 4B74A 4SGAE 3SZNA 4AOQA 1GHAF 1QRWA 2M5TA 2FOAA 4H6SB 3ZZ9A 1O2HA 5JB8S 5A0AE 3KN2A 3KQCA 3GS9A 1QFKH 1NU7B 1FZZA 1UK2A 2WV4A 3RC5A 1KY9A 3UNRA 1ELTA 1V3XA 2GT8A 1CGHA 3N7EA 2GZ9A 1GI1A 2EI8A 1L1JA 1XMNB 1GMHF 1ZTLA 5CDFE 7ESTE 5FL7D 4KKDA 1CHOF 2O8LA 1XVMA 1DWCH 2C93B 2A2XH 1TPOA 2R3YA 4UONA 1G2LA 3ATWA 3QZRA 4WVPE 1GHBF 5FCRA 1UK4A 1BITA 3NK8A 3RDZA 1GJ5H 1NROH 1TBZH 2FI5E 3GCTF 1E1RD 2FS9A 5E0JA 3PMBB 3PWCA 2ANKH 1TAWA 3BIVH 3TH3H 1C5VA 1KXBA 1YKTA 1GVZA 2OC0A 1RGQA 1FN6A 3SQEE 2KCYA 3N7OA 1O38A 3I77A 2ZTYA 4H6TA 1JRSA 1WXRA 2BD3A 5JDUB 1Y59T 2R3UA 3UNQA 4GHTA 2HNTC 3UIRA 4ABDA 2P3FH 4RSPA 4YZUA 2C8ZB 2XBWA 1SLXB 4IS5A 3VG8A 4AB8A 1AO5A 3G01A 4J1YA 3NCLA 2VIDA 1GBBA 3PTBA 1ARCA 3F0OA 4J2YB 2WPKS 1SGFA 3GY3A 1PYTC 4MG3A 1QRXA 2OXSA 2BDYA 3VB3A 3ZZDA 1TBQH 4FXGH 1Z8RA 3FP6E 3F2HA 3SGQE 1P57B 3KHVA 4OGXA 4RI0A 2Z9JA 1UJ1A 3UWIA 3OTPA 4AX9H 4DURA 2FYQA 1EASA 1E35B 2QXIA 3BIUH 5HIZA 2ZPRA 4UFFH 1RFNA 2ZHWH 4I31A 1MUEB 1F0UA 1HAIH 1O2SA 2KCPA 2V3MA 2P95A 2ZFFH 2HWLB 4Y8XA 2AERH 1CQQA 1MAYA 2ZDLA 1F0RA 4WMDA 4ASUD 2KM0A 1C5LH 2ZQ2A 5BRRE 3FZDA 5DG6A 2W3KA 1P03A 1O30A 5B6LA 1EX3A 2FI3E 3LPRA 2V6NA 4F49A 5JBAS 3MYWA 4UD9H 5EOKA 2SNWA 3MNXA 3SV8A 4MPVA 2B5TB 1G30B 3W1EA 5F8XA 1A61H 3DCLA 4X1QU 1W0JD 2P16A 2PWXA 2PSXA 3H5CB 5ETXA 2ZPSA 4AFQA 2KX4A 4M7GA 3MNBA 4KTSA 1PPGE 1INCA 2FX4A 3DFLA 2B9LA 4RT1A 3T28A 1GJAB 1SGPE 1VJ9U 2O8UA 4IN2A 2BX3A 3E1XB 3WW7A 1GDQA 3TU7H 1UCYK 3QUMP 4U01A 4JZFH 2C4FH 1ID5H 1SOTA 2PGBB 1C1OA 3BN9A 3MOCA 4ZKSU 1O3NA 3M7TA 1TPPA 3FVFB 2WPDD 2YMSC 1NC6A 4Q7ZA 3SORA 1EP6A 1TNLA 3MFJA 4AFUA 1HJAC 4LK4A 4DCDA 2ANYA 1GBLA 1S0QA 4ACBA 1BIOA 2V3OH 3F1SB 1O2GH 2BZAA 1AVWA 1O0DH 1UTOA 1IQHA 3GY7A 3EA7A 2LELA 2ZFRH 4I33A 3E6PH 1OX1A 2UWPA 2VNTA 1GBKA 2FO9A 1SLVB 5EQRA 1TMTH 5EG4A 2P8OC 3A8BA 1C5RA 1AGJA 1C5QA 1NY22 3RU4T 2F9VA 1EPTA 2A0QB 1QJ6B 2J5UA 1V2MT 2ZFSA 1HNEE 2G5VA 3ZVCA 1MD7A 1LVMA 2GP9B 2PKSC 1S85A 2F4LA 4R8TB 4JK6A 1MD8A 1NPMA 2G81E 2AMDA 5C0TA 2J34A 1V2WT 3S9BA 3SU5A 3I78A 3HATH 1ZGVA 3AVZA 1H1BA 1Q2WA 2EA3A 3KCGH 1P01A 4M9FA 1P11E 1UTLM 2QYIA 3SJ9A 1OWJA 1XKAC 3MU4A 1CT4E 4NSYA 4QT8C 3UFAA 1GCDA 4D9QA 4ABJA 1ELGA 1THRH 2UUYA 7LPRA 3RU4E 2PGQB 1WTGH 1M9UA 1AB9C 5FPYA 1GJ9B 2L74A 1J9CH 3TNSA 2XBYA 1BTZA 4CBOA 2Q1JA 3RXFA 3FN8A 1J16A 3MNSA 2P3TB 4XBDA 5DP3A 4E05H 1O2KA 5FHTA 1B7XB 3EQ0H 2F91A 1MQ5A 1CT0E 1P2NA 1MABB 4TY6A 3HPTB 1Z71A 1TFXA 1SB1H 1Y3VA 2P3UB 1SOZA 1N8OC 6CHAC 3ZYDA 2ZHEH 4ABAA 3RMNH 1WBGB 1EAWA 4XBCA 4WXVA 4NIYA 1XUJA 4AB9A 1K1IA 2HPPH 1GHZA 3P8GA 2AS9A 4GVUA 4ISNA 3RC6A 4B6EA 1XUKA 2JETC 1GL0E 1KYNA 6LPRA 1UVTH 6ESTA 5T6FA 5GCHF 1Y3XA 1Z1IA 1AD8H 2HLDD 3F2GA 2YMSB 4YLQH 5JB9S 1O5DH 2GDDA 3SI3H 2BLQA 2AMQA 1O31A 1DDJA 3QTVH 1EKBB 1BMMH 1SFQB 1OHHD 3SN8A 1OXGA 3ZVFA 1P2IA 5CMXH 4DIIH 4I8GA 2H5DA 1ARBA 1NFWA 3TGKE 2ZQ1A 1AKSA 1CO7E 3KGPA 3A84A 4OS1A 1BMLA 4D7GA 2CN0H 3MQKC 1O32A 2GZ8A 2J94A 3MU8A 1UVOA 1A2CH 3KL6A 1LTOA 2P8OB 3Q77A 1EB1H 1NRQH 2EI7A 1LVOA 1MZDA 1MTNB 1QJ1B 4WF8A 4ZCNA 1LVYA 3B8JA 1DY9A 2ZEBA 1EZXC 1O5AB 3WY8A 3RXGA 5HGGA 1AUTC 3K2UA 2GDEH 4DOQA 1VITH 2FOHA 3URDA 1YC0A 4FVDA 3TIUA 1J14A 4I32A 1BBRH 3VB7A 4CRBA 3UAIC 2BM2A 1C5NH 1L1GA 2XWAA 1WAYB 1EFRD 1OOKB 1IQGA 3GY5A 3ELAH 3VB4A 1P2QA 2BDAA 1TNHA 1TRYA 3PTNA 1KLIH 3A7XA 2XOKD 3MU1A 3GICB 5E0GA 1LKAA 3KIDU 3SNEA 4Z1MD 1V2VT 3AK5A 2BVRH 1GBDA 5EJZA 1AB9B 2BVSH 1QR3E 4KP0A 5JPMH 1W3CA 3SGAE 4ZH8A 2UUKB 2OQ5A 4DW2U 4FOUC 3RUOA 3RU4D 3SOSA 5DP5A 4IN1A 5GXPA 1K1MA 3B9FH 3OYPA 5BPEA 1UK3A 1TB6H 1GBHA 5ESBA 3U28C 1QURH 3W95A 2CJIA 2ZGBH 3F3BA 5C67A 4MVNA 5DGJA 4CHAC 1V2OT 1N8OB 1WCZA 1JIRA 2WV5A 3SUEA 1HJ9A 5FBEA 3TJUA 3RM2H 8GCHG 1EQ9A 2XCNA 2WPJS 2UUFB 3E91A 1NZQH 1GJDB 5FPSA 1ZRBA 2ASUB 2H5CA 3MH4A 4D8NA 1O3KA 3A8CA 1EP5A 4ZAEA 1JIMA 3LGTA 2XC4A 1QGFA 1O3OA 3D49H 4GPGA 3U8OH 4ABGA 1CGJE 1V2RT 1ESTA 3M37A 1O2JA 3BEIB 4CRGA 3UQVA 3KYFA 4OS7A 1XUHA 1IHTH 1LPZB 1G3EA 3M5LA 3PV4A 3RXKA 4A1TA 3SHCH 1W0ZU 5KGOA 1C5WB 1WOFA 1G9IE 4ZUHA 1HAHH 1BQYA 1IHSH 1CA0C 3ENSB 3DA9B 1C5TA 4U30A 3F0PA 1DXPA 1C2MA 3PO1B 3P8FA 1BMFD 1K2I1 1J17T 3CS7A 5EIYA 1YPLH 4YO9A 3VXFH 1DUEA 1GJCB 1ETSH 1HJ8A 1EPTB 1QZ8A 1TOMH 1C1VH 2GVFA 3TK6A 4HFPB 1C4U2 1GVLA 3F68H 1PQ8A 3FP8E 1DLEA 1QNJA 1TA6A 3EAJA 1SHYA 1ELDE 3ODFA 3UY9A 1BTPA 1YGCH 1WYKA 3FO8D 1TGCA 3GY8A 1DWDH 3A7YA 2G52A 2YOLA 1HAXB 3ATLA 2ZDVH 3MO6A 2GCTB 4XSKU 1DY8A 1HLTH 4ZKRU 4ZHLU 2ZDMA 1FY3A 1MTSA 1DM4B 2ZTZA 3TITA 2D2DA 1C2JA 4JYVH 1PPHE 1TMBH 1IQEA 3D62A 3IITA 2J92A 4OGYA 1ELFA 2OD3B 2FZZA 3FKSD 1UVUH 2VWNA 2XBVA 2SGPE 2JKHA 4LZ4B 3MO9A 3BTFE 1YPJH 1P0SH 1XM1A 3RM0H 3LGIA 4GSOA 2RDEA 1GI7B 3BG4B 1MTVA 2ZGCA 1DUAA 5JBBS 1ANBA 3S7HB 4DG4A 1HCGA 1NRRH 1JRTA 2VIWA 2WSSD 1J15A 2J38A 2YNAA 4O9VA 3M3VA 1RJXB 3VGCB 3M7UA 3RXCA 1SLUB 4CRCA 2BY7X 1CT2E 1O3AA 1BJVA 1FXYA 1WQVH 1O3MA 2UWLA 2AGGX 3URCA 2VBCA 3SBKA 1XUFA 2GGVB 3C27B 2Y6TA 1E79D 1MKXK 1A3BH 1K1PA 3WWFA 1V2KT 3Q3YA 1GPZA 4AYYB 1G2MA 1S83A 1DWBH 1VITG 1W0YH 5ESTE 2ZHQH 3MO3A 1BJUA 4GLYA 2FS8A 2TGTA 2CHAB 1O3BA 3B23B 3CENA 5E0HA 1EAXA 3S7KB 2B7DH 1MU6B 2XBXA 4Z6AH 4BOHA 4X1NU 2QF0A 2A7HA 1SC8U 2JDID 1GI9B 3OY5U 5GPIB 5K7RA 4NFFA 1C5PA 1AMHA 3T2NA 3GY4A 1V2UT 1BDAA 4ISLA 1TLDA 4FETA 4UDWH 3U69H 3MTYA 3NRLA 2G00A 3FFGA 1PYTD 4X6OA 1E38B 1AE8H 4KELA 4BTUB 1OWDA 1QB1A 3UR6A 3SJIA 1D6RA 1H8HD 2OTVA 2VWLA 1CGIE 2SGDE 3TNTA 1UTNA 1FPCH 3ESTA 3NXPA 1S0RA 1FPHH 1VR1H 2VIPA 1AFQC 1Q31A 1CVWH 2Z94A 3RMLH 2CF9H 3LGYA 3KEEA 1VGCB 3QWCH 2Z9GA 3RLWH 2EEKA 1KLTA 4O3UA 3OTJE 4BTIB 3TK5A 5KECA 1HPGA 4TWYA 1ZTKA 1O2RA 4H42U 3KQBA 1NRPH 2A5IA 1SKYE 1O3LA 2GD4B 3SV6A 8GCHF 1FDPA 1C2FA 2JIZD 3LOXA 5CHAC 3GOVB 2V7QD 4CR5A 3ODDA 4X0WU 1K1NA 3UR9A 1E34B 2BDBA 3P8OA 3BSQA 2XXLA 1Z1JA 5EJLA 2PP6A 3PWBA 4X8TH 2D26C 3SQHE 1QB6A 1AY6H 1MCTA 2QCYA 2RDLA 2VVCA 3DSGA 5FX6A 1BZXE 1SGRE 1C1MA 4E7RG 4IC6A 1BBRE 3I29A 4KGAA 5HIYA 2H1UA 2ZPQA 3A87A 1O5EH 1KSNA 1MKWH 1HIAA 1SGTA 4P00A 1O3CA 1H8IH 1F7ZA 4FU8A 2HALA 3A86A 1O3GA 1F5KU 2D1JA 1C5ZB 2YMSD 1BRBE 1P12E 2FIRH 3HK3B 5I46H 1FI8A 2HVYB 1NRNH 1TRNA 4Y7AA 1ELAA 1QL9A 4A1XA 4NA8A 2ZCKP 1XUIA 5A8ZA 3DD2H 1K1OA 4NIXA 1BCUH 5FPTA 1O2LA 1XXFA 1A7SA 1O5FH 3MH6A 4K60A 2KFWA 4A6LA 1EJNA 1D4PB 2BLVA 1AIXH 4FVBA 5LPEA 1S81A 3K65B 1AZZA 3SNDA 3SU6A 1Y3UA 1ZJDA 2CF8H 2KCOA 3P6ZB 3ZVBA 1E36B 5F6MA 1ZMLA 4GCHG 5LPRA 1P10A 2Z3CA 2ZFTA 5T1VA 1BMNH 5IDKA 2I6QA 3LIWA 1QY6A 4MLFB 4ZROA 1S84A 1KXDA 3PB1E 3PRBA 1YP9A 1FNIA 1OWHA 1HAOH 4NWKA 1NM6A 1UW7A 3L3TA 1CSOE 4ABHA 1HRTH 3LONA 3UTUH 3T62A 3VXEH 3VB5A 1LHDH 1IQFA 1C5OH 1ABJH 1PPEE 1YPKH 1RRKA 2GMTC 4FUDA 2BQ6B 5DSFA 3A88A 2FYRA 3Q3KA 4I8LA 4AFSA 1FJSA 1KLJH 1MBMA 4FU9A 2LNCA 1TPSA 3IG6B 1C2GA 3L33A 3M5MA 1DX5M 2Z6BD 4TY7A 1H4WA 2BY8X 2QXHA 1QRZA 5G4BA 1LHGH 1O2VA 2OP9A 3AAVA 1P09A 1AWHB 2ZF0H 3OX7U 1XVOA 2J4IA 1OPHB 3NZIA 3SU2A 1HAPH 2EI6A 2C8YB 4JYUH 1U6QA 3P17H 1TOCB 4MNXA 5CHAB 4BNRA 1T31A 2C8XB 1GBAA 5GJ4B 1GBIA 2V0BA 4MNWA 3STJA 1K21H 3FZZA 3M5NA 1TX8A 2ZG0H 4IC5A 4B76A 1T8NA 1OKXA 1TQ0B 2NU0E 1NFUA 1IQJA 1BRUP 2OQUA 3M3SA 2W7SA 1SMFE 1KTSB 2FDAA 3BTKE 4NIVA 4X1RU 1GCTC 1SFIA 1VITF 5C1YA 1UVPA 1N6YA 2CK3D 3TGJE 3O8RA 2FESH 1C9PA 3ZVDA 1O2ZA 1C1WH 1GHWH 2K8IA 4B2CA 1DVAH 1GMCG 1SQOA 4Y6DA 1DFPA 5JYIA 4H4FA 2XNIA 2GJGA 3V12A 1HAVB 2PFEA 2FOBA 4X8SH 4Y0YE 4VGCC 3K9XB 1EAIA 2BLWA 1UMAH 4D76A 5C5NA 4TSFD 4ZHAA 1DICA 2ODPA 1F0SA 2FODA 1YCPK 2Z3DA 1H8DH 5C1XA 3U8RH 1FV9A 1O2XA 1XXDA 3N99A 1BUIA 2TGAA 1UTKA 2AGEX 3OY6U 2ZCLP 4ISHH 3RC4A 5CE1A 5FX5A 2BD5A 1AN1E 1PQ7A 2TBSA 2Z9LA 4MDSA 1Y5AT 1QBOA 2FI4E 1T8LA 2R0KA 1GHXH 2ZDNA 1HGTH 1LCYA 2RG3A 2NU1E 1DSTA 4E06H 3S69A 2R0LA 3UPEA 2YNBA 1A0HB 4Q80A 1YYY1 3SHAH 2IJOB 3LC5A 2J9NA 2XYAA 2BYAX 4MPXA 4BANB 3SZEA 1BHXF 5L6NH 1GJ6A 1UHBA 2HOBA 1GVKB 3ZIAD 1QB9A 1EB2A 4B6FA 4LOYH 4Y10E 1C1SA 3UOUA 2ZFQH 4B2BA 3H09A 4AFZA 1GG6C 3PM3A 3LKWA 2O8MA 1D3PB 2JJ1D 4RKJB 3RXUA 1D6WA 1Z8IB 3DFJA 1O3IA
chains in the Genus database with same CATH topology
1G32B 1SVPA 1C4V2 4JYTA 2BQ7B 1HV7A 3BTTE 1Y5BT 4X2VA 1BTWA 4IMQA 2WYJA 1GJBB 1L4ZA 3MMGA 2HLCA 3M35A 4Y79A 1FY4A 3RLYH 1AFEH 2WYGA 1GHYH 3PROA 3K6ZA 4WJG2 3QDZB 3ZZ4A 4OS2A 1ZOMA 2PUQH 4FUEA 1NFYA 1O3FA 1C1TA 1ZLRA 1WU1A 1MAXA 2ODQA 4BAKB 1ZPBA 3TLOA 1HJAB 1WV7H 2F83A 1KDQA 3P8NA 2Y5HA 4MPUA 3TH4H 2PR3A 4X2WA 1EATA 2R2WU 2A4QA 3TK9A 2GZ7A 3ZV9A 3A7ZA 5EODA 1O2MA 2WPHS 3EDXB 1FUJA 1TPAE 5HXFA 1ELEE 1HAYB 4D7FA 1O3DA 4YESB 4AGJA 1QIXB 1ZPCA 1HIAB 3TPIZ 4X2YA 1QBVH 1NRSH 1XX9A 4MNVA 3AASA 4GCHF 1TABE 1ORFA 2WUCA 5A09A 1GI8B 2O8TA 3GYMA 1VCQA 2PKSB 4ABFA 1O2IA 1ZMJA 2PSYA 1SI5H 2VVVA 3SU0A 1YM0A 4E7NA 3ZV8A 1OWIA 3U9AH 3PLBA 3SV2H 4FUIA 3BTGE 1B0FA 4XBBA 1O3EA 5LGOA 2VWMA 3R0FA 1UTPA 4UE7H 3PMHB 4ISOA 1QQUA 2VINA 3ZYEA 1LVBA 1O33A 2XCFA 2BDGA 2WINI 1AI8H 1C5UA 3RXIA 4Y76A 2A4RA 2VWOA 1MQ6A 1ZSKA 1IAUA 5DP6A 4GAWA 3V0XA 1ANEA 4Z0KA 4BAOB 1A5IA 4ZKOU 2A5KA 5ABWA 2ZI2H 4GUXA 2GT7A 1JXPA 3LH3A 2ANWA 5DO4H 3TVJB 2ZGXH 6CHAB 1OWEA 2BD4A 1C9TA 2NWNA 2LPRA 1FQ3A 1Z8GA 1FAXA 1TX6A 2ZKSA 1G3CA 1O5GH 3SU4A 4ABEA 1A5HA 2H9HA 4PROA 2R2MB 1F2SE 1YLDA 5GDSH 4JZEH 1D3DB 1MCVA 2BY9X 3HKIB 4U32A 2W3IA 2JETB 2XWBI 4MPWA 5AHGH 1CA8B 3A82A 1SGDE 1ZHPA 2Z9KA 3A8AA 1GI6A 3T26A 1KTTB 4WWYA 1F5RA 4OS4A 1CHOG 3OSYA 1SR5C 1SQAA 1RTFB 3BEFB 4NFEA 2BY5X 2QIQA 1E0FD 4FUCA 1GHBG 4K8BA 1P3EA 3GCOA 1FY5A 3R3GB 2Y5FA 5E2PA 2Q6DA 2STBE 3HGPA 2XTTB 3QGJA 5DP8A 1C5YB 4O03A 1P02A 2ZU4A 2BLOA 4JMYA 2BDCA 3TH2H 1VCWA 3GDSA 1C1PA 2FLBH 1CHGA 1DITH 5FAHA 4K8YA 3RXTA 4INKA 5TJXA 5C3NA 1BTHH 4K5ZA 1T4UH 4FUHA 2XRCA 3H7OA 3M61U 1HXFH 3BTDE 1O36A 1T32A 2KAIA 3W94A 4KTUA 3TJNA 2SNVA 2XC5A 3ZZ7A 3SGBE 2OC8A 1O2PA 1MMJN 4UEHH 5DJ7A 3RXOA 4K3JA 1ZPZA 1C4Y2 1YPMH 1W8BH 5DP7A 4Y8ZA 4B75A 1BHXB 3JZ2B 5LH8A 3VFEA 1THPB 2OBQA 3E0NB 1SGFG 1FLEE 1AU8A 1CBWC 1HBTH 3EE0B 3L6PA 3RMMH 1W14U 3GISB 3P95A 3RXDA 1FIZA 1RS0A 2BXTH 2Z9IA 5EQQA 5HMAA 2ZGJA 2J2UA 3UOPA 3VEQB 3SNBA 1ZHMA 4A92A 1C2HA 5AF9H 7GCHG 1UHBB 2H9TH 1O3PB 4X8UH 5K0HA 2A45B 1QA7A 4CHAB 5AFYH 5T6GA 1XKBC 1BTYA 1BRAA 2AMPA 1FIWA 1EZQA 5FXLA 2G4TA 1O2QA 1HAVA 1N6XA 2SGFE 2BXUH 1ABIH 2PV9B 2CV3A 1P8VC 2W5EA 2ZP0H 4NIWA 1V2LT 1LPKB 1UCYH 3ATKA 1LMWB 1OYTH 4HZHA 2BOKA 1ZYOA 3MH7A 3SI4H 1N1LA 3RXHA 1FMGA 1EZUC 4TWWA 5A0CA 4AN7A 1P04A 2ZTXA 3RXQA 3DT0H 1C5MD 5T3HA 3ATMA 3PYHA 4WH8A 2GX4A 1HAZB 1V2PT 3PMJA 1UTJA 2P59A 1KDQB 1W10U 2BTCE 2VH0A 5TCCA 3RXVA 1O3JA 3A85A 2BD8A 1Z6JH 2ZGHA 1CA0B 2FPZA 1BBRK 3U1JB 1VZQH 4Y11E 1L2EA 4X8VH 1O5CB 2IOTA 1EZSC 1LHEH 2F9PA 4XOJA 1W7GH 2TGPZ 2BMGB 3T29A 3D65E 2OINA 2FWWA 3A7TA 1T7CA 1A5GH 1WSSH 1NN6A 1IOEA 2I6SA 1C2IA 3KNXA 2VVUA 2ZZUH 1TBRH 2JH0D 3LGVA 1PPZA 4JCNA 1NT1A 3QO6A 5C2ZA 2CGAA 3HKJB 3C1KA 1AHTH 1LHFH 2AFQB 4HI3A 1KXAA 2H6MA 3Q76A 1TNGA 1GMDG 3ZZBA 4NZLA 4INHA 2HGTH 3LU9B 4FUBA 5EQSA 2OC1A 3LGUA 2BX4A 4DY7B 1V2NT 1S5SA 1TGTA 1LKBA 1WTHD 1CBWB 4IGDA 1F0TA 2GKVE 3M3TA 3P92A 2F9OA 3BG8A 2ZWLH 1EUFA 2J95A 4OS6A 1K9OE 1O39A 6GCHG 1BRCE 3ZVAA 1GBTA 2ZA5A 1P2OA 1SGYE 1VCPA 4FUJA 3AW1A 3SV9A 4X6MA 2F9NA 5J4QA 1AWFH 2BB4A 2G5NA 5L2ZH 1ETRH 1W2KH 2AH4X 1ZRKA 3BTEE 4DIHH 3VB6A 3A83A 1C1RA 1HYLA 2DUCA 1PFXC 4CBNA 4K1TA 2AIQA 1RXPA 5F03A 4OS5A 5PTPA 2UWOA 2BOHB 3ATIA 1HXEH 5JBTA 4I8KA 1YF4A 3F6UH 3F9HA 1BMAA 2H9EH 4JZ1A 3NUMA 1GI5A 2QV1A 3QX5H 5GCHG 4BXWA 3ZZ8A 2FXRA 1ANCA 2GCHG 1GDUA 2AEIH 3M5OA 2WPIS 3MI4A 2FTMA 2ZU2A 4GHQA 1GJ8B 4XFQA 2Q6GA 1XUGA 3SV7A 3GCHC 4CREA 1BTXA 4F4OC 2ZU3A 5H4IB 4DVAU 3EYDA 5C5OA 2CMYA 1DS2E 3HK6B 3E8LA 1T8OA 2Y5GA 2FTLE 4O97A 1C1NA 1WQSA 4WXIA 1T8MA 1MZAA 1V2ST 1TGSZ 1EXFA 3D23A 2BY6X 5E2OA 3RXLA 5FCKA 2BD9A 1W12U 1NESE 4MTBA 4KTCA 2WPLS 4ESTE 1C2LA 1ZTJA 1UTQA 2VJ1A 3BEUA 2Z7FE 1QQ4A 3LJOA 4A7IB 2G8TA 2QAAA 3T25A 4LXBH 2BQWB 4THNH 1AFQB 1YPEH 1NTPA 2HPQH 2BZ6H 2KAIB 2A4OA 2TRMA 3K6YA 4NSVA 2ULLA 5EPNA 3GCNA 3E0PB 1C5SA 1IQLA 1C2DA 2VGCC 3SJOA 2Y7XA 4Q7XA 2JH5D 7GCHF 3SU1A 2BD7A 3BTHE 1F5LA 2F9UA 1QCPA 1AE5A 1ELBA 3KF2A 2ZNKH 1JMOH 3LDXH 1Y3YA 1BA8B 2FMJA 1K1LA 1QHRB 1GHVH 2TPIZ 4ZMAH 4AORA 2W7UA 1QTFA 2R9PA 1FY1A 1A0JA 1MH0A 4RN6A 1EJAA 1CE5A 1P06A 1TNIA 3KQDA 1YPHC 1OP2A 1HAGE 2UUJB 1P3CA 1GBMA 1NO9H 3Q3XA 4Y0ZE 1X7AC 3A81A 2C90B 2PTCE 4CRDA 5DP9A 1KXCA 3GDUA 2QY0B 3QN7A 2OC7A 2PUXB 3VPKA 2SGQE 1K28D 1EOJA 2FOCA 4CRAA 1DE7H 4AG2A 1SGIB 3ITIA 2Y7ZA 1SG8B 1D9IA 1UTMA 2Y82A 1SGCA 2GV6A 2AYWA 3BF6H 1ZZZA 1OWKA 1LQDB 3H7TA 3PLKA 5A8XA 1HDTH 1Z8JB 1ANDA 4NA9H 5C20A 2FP7B 3ZZCA 1BOQA 1G3DA 3QTOH 4Y8YA 3QZQA 1EJMA 1Q3XA 3GY6A 3U1IB 4TPYA 3P70B 3V7TA 3GDVA 4AYVB 3NPSA 1MTNC 2A2QH 3GCHB 2ZIQH 1TE0A 1GJ4H 1C2KA 4SGBE 2RCEA 3E3TA 3M36A 1V2JT 4UFEH 3LH1A 9LPRA 2PHBA 5GIBA 4ZKNU 1DPOA 1IQKA 4WMEA 4BTTB 3MU5A 4YLUA 4ABIA 1GMDF 1H9HE 1QA0A 1DWEH 1ZGIA 1E37B 4ZXXH 3RXPA 1IQIA 1GWAA 1UCYE 4B2AA 1TONA 3MWIU 1W7XH 4YOGA 3DHKH 3O8CA 2ZDAH 1OSSA 4CR9A 5EXMA 1GBEA 3FP7E 4X1SU 2GMTB 1AZ8A 3MHWU 2GV7A 5GWZA 4K1EA 2WUBA 3ZVEA 4XDEA 3SUDA 2VGCB 3LT3A 3S0NA 6GCHF 2ODYB 3RXRA 5B6OA 1O2OA 2ZU5A 4YTAA 3EA8A 2F9BH 2QXGA 5EPYA 3SJ8A 5HM2A 4I8HA 2P93A 4XE4A 4FUFA 4ZHMU 3ZZAA 3IWMA 1P9SA 4CH8B 3QGNB 4CRFA 1YPGH 2ALPA 1ESBA 1V2TT 1LQEA 1PJPA 3MU0A 4BAMB 2VH6A 4ISIH 3SW2B 1MKWK 1Y5UT 1L1NA 5F8ZA 4NA7A 4B73A 1YBWA 3TJOA 2ZU1A 1L4DA 1S6HA 2ZFPH 4JZDH 1J8AA 3RXMA 3UREA 2VU8E 1TALA 2BD2A 1GCTB 1UVSH 1SGQE 1TMUH 1SSXA 2BHGA 1P9UA 1DLKB 2FOEA 1RTLA 2GCHF 1LO6A 1TIOA 1QL7A 8LPRA 2Q6FA 5EGMA 1B5GH 2PKAA 1GL1A 4VGCB 1P2KA 5C1UA 1PPCE 1LDTT 4UFDH 2FLRH 3FAOA 1HUTH 3PMAB 3V3MA 4IBLH 4YOIA 4MQAA 1OP0A 1MKXH 4FUGA 5A0BA 2VB0A 3RXSA 1YLCA 4K69A 1DXWA 1P2JA 1NS3A 2BDIA 1AVGH 4K2YA 2A1DB 1P2MA 5AVDA 3PO1C 1KIGH 5DPAA 3TJVA 2HVXA 4ABBA 1DSUA 1A46H 4WY3A 1ESAA 5A2MH 2IPHA 3F9GA 3BTME 4NCYA 3MH5A 1EPTC 2G55A 4X1PU 4YOJA 1O34A 1MTUA 2ILNA 1O2NA 2K1QA 5DKMA 1Z6EA 5LPFA 5DK1A 1G3BA 1A1RA 3E90B 3FANA 2OBOA 4JZIA 3ZZ3A 2EC9H 5F8TA 3NWUA 4X2XA 2GCTC 2BVXH 1GBFA 3LC3A 1LPGB 1QJ7B 1TWXB 1O2UA 1KXEA 1VJAU 2IN2A 5E8EH 2STAE 1JBUH 3M7QA 5IYTA 2OLGA 1GG6B 4X6NA 1SPJA 4R0IA 5I25A 2SGAA 1S82A 1GHAG 4DGJA 1GI4A 2Y80A 2FOMB 1SLWB 2A7JA 3LJJA 4IMZA 1Y3WA 3CP7A 4Y7BA 3BTQE 2OCVB 5SGAE 3SO3A 5JBCS 3SJKA 5TCAA 3DUXH 3GY2A 2PW8H 4BXSA 1EAUA 5FBIA 3A8DA 2C3SA 1TNJA 1ELVA 2ZECA 1GI2A 1SBWA 1UO6A 3BG4C 4DJZB 3A7WA 4A5TS 4NGAH 1AUJA 1GMHG 1FAKH 2CXVA 2QC2A 1ETTH 1RIWC 3O8BA 1GMCF 1W13U 4TYDA 1H9IE 1T4VH 3VGCC 1Z7KA 1S6FA 2V3HH 1K1JA 1Y8TA 2A7CA 1O35A 2FX6A 1ACBE 1TYNA 3SNAA 2A32A 2ANMH 4NG9H 4RKOB 1MBQA 3F9EA 3GCTG 4LZ1H 4NZQA 2ZHDA 3KQEA 4A1VA 1TNKA 1ZR0A 3GYLB 1TGNA 5DP4A 1B0EA 2ZC9H 4ASHA 1GI0A 2ALVA 2HNTE 2PLXA 2QA9E 2CHAC 1IQNA 2TGDA 3A89A 2OUAA 4DT7B 3Q00A 1L0ZA 1SGEE 3RXBA 1G36A 3JZ1B 3S9AA 2QGRA 5T6DA 1RD3B 4YT6H 2RA0A 3SUGA 1EOLA 1HB0B 4AG1A 2FOGA 1OYQA 3CS0A 3QK1A 2V35A 4NWLA 1JOUB 2DE8A 2GTBA 3ZZ5A 1YCPM 1BB0B 5EXLA 1D3QB 1NU9A 2HRVA 1QL8A 4MNYA 1MU8B 5EW2H 1C2EA 4U2WA 1GGDC 1THSH 2Z3EA 2O9QA 1A3EH 4IW4E 7KMEH 2ZDKA 3OU0A 1O3HA 2H2ZA 2ZHFH 3LGWA 4BAHB 2G4UA 1VGCC 1A4WH 1GDNA 3T27A 1C1UH 3SNCA 2FM2A 1ZMNA 1K22H 4BAQB 1GBCA 1NFXA 1FY8E 4ZXYH 1ELCA 5L30H 3AAUA 3UQOA 3ZVGA 3SUFA 3BTWE 3RXAA 3RP2A 3U8TH 1BTUA 1TX7A 2B8OH 2PTNA 4UFGH 2VIQA 2A31A 2BDHA 1RTKA 2NU4E 1GI3A 1WUNH 1O37A 3QLPH 2O8WA 5EU8A 1G37A 1FN8A 2TIOA 2AGIX 3HGNA 2DE9A 4I8JA 1DOJA 8ESTE 4WMFA 1YPHE 3A7VA 9ESTA 4Y71A 2QF3A 3EGKH 2VIVA 2JH6D 4YM9A 3RXEA 4Q2KA 1HFDA 2AIPA 2WPMS 1ZJKA 2C8WB 1PPBH 1RIWB 4CH2B 1O2TA 3T5FH 1DT2A 1O2YA 2QN5T 3AW0A 1SHHB 1TGBA 5L2YH 1H9LB 4B71A 1GJ7B 1PQ5A 3UWJH 2NU2E 5J4SA 3RXJA 1A0LA 1V6DA 4I7YH 4TPIZ 2F3CE 1MTWA 3MNCA 5EXNA 3SU3A 3UUZA 1ZSLA 2QXJA 2ESTE 1CU1A 1LHCH 1OS8A 4WH6A 4B1TA 2THFB 4K1SA 1AVXA 2NU3E 4AGKA 3BV9B 3ZZ6A 4AZ2B 5AFZH 1AQ7A 1ZSJA 2SGEE 2RA3A 1D3TB 2XC0A 3E16B 3RMOH 1TA2A 2HNTF 1PQAA 3EA9A 4X6PA 3F9FA 3UNSA 1FONA 2Y81A 1SQTA 2XW9A 4HTCH 2ZO3H 1BT7A 4D9RA 5HYOA 3STIA 1IQMA 1V2QT 4JK5A 5EW1H 2A5AA 2P94A 2PKAB 2FEQH 3O8DA 1DANH 1TRMA 3V13A 4INLA 5HM9A 2B0FA 1QBNA 1P05A 1GBJA