1O2IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA02
4ABJA 3MYWA 1L1NA 4Y8XA 1O5AB 1NRPH 4OS1A 3NKKA 3SQHE 1SGQE 1O3DA 4NA7A 2FTLE 5DP6A 3RMMH 1E38B 1GJ5H 4FXGH 1K1MA 3LH3A 2ZDLA 4SGBE 3SORA 4JYVH 4ABGA 2ZIQH 3BTWE 1W2KH 2ZCKP 1ID5H 1RXPA 4GCHG 1ANDA 3F9FA 3QN7A 5EW1H 4ABDA 9ESTA 3NPSA 4O03A 1GHXH 2QXJA 1H8IH 3EA7A 2XWAA 1HV7A 1W8BH 1ZR0A 3KN2A 5E8EH 1TOMH 1PQ8A 1ZJKA 3VB7A 4Y8ZA 3BIUH 1TQ7B 1RTLA 1LO6A 1C1SA 1GHAG 2VIQA 2XBYA 4AGKA 1GGDC 3MTYA 1HFDA 1E35B 1GBBA 3SU0A 3RC6A 3UIRA 8KME2 2FYQA 3MMGA 1Y3UA 1UVOA 4AG1A 1T8NA 3BG8A 2UUKB 1OWHA 5A0BA 1LTOA 1NRQH 2HWLB 1N8OC 4UFEH 1SGTA 5IDKA 5FXLA 1HJAC 2F91A 1DE7H 1S0QA 3MO9A 1WYKA 1IQIA 1GMHG 1NRSH 4NZLA 1FPHH 5FBIA 3GCHC 5PTPA 5IYTA 1S83A 1P2JA 2P8OC 2VGCC 5LGOA 4TWWA 1G36A 3B8JA 1EAXA 2BLWA 5A8ZA 3STJA 2QY0B 1BRCE 1UHBB 2ZTXA 2VWMA 1DWCH 1AVGH 1T8OA 1ELCA 3UR6A 1K1JA 5E2PA 1MZDA 1TRNA 3RXMA 4CHAB 1YYY1 2V3OH 2HNTF 1MTVA 1FPCH 3SU4A 2FOBA 2D26C 1O5CB 1S6HA 1HAOH 2W7UA 3ZYDA 4I8JA 2BTCE 2FEQH 1XM1A 4IBLH 2GVFA 1EZXC 1HLTH 3A7XA 1FAXA 4O3UA 3BTEE 4IGDA 1JMOH 1P9SA 1AE8H 2AFQB 2THFB 1GBFA 2A5AA 1Q2WA 6GCHG 2CXVA 1XUFA 2BB4A 4MTBA 1ZSKA 1NU9A 3FP8E 4JZEH 4NFEA 1C1VH 1LCYA 3AASA 2XCNA 1O3GA 2NWNA 2K1QA 3M5NA 6LPRA 1GI7B 1V2LT 1BTZA 2DE9A 2FOEA 3SV9A 4X1NU 1GBHA 1QNJA 4OGXA 1GMHF 4ASHA 1PYTD 1DWEH 2F9VA 5A2MH 4X8VH 4IW4E 2QV1A 3A8DA 1VGCC 5DP9A 4CRCA 1A46H 3I78A 1JOUB 5FCRA 4BNRA 1VZQH 2OC7A 1QL8A 2VU8E 3D23A 1GCTB 1OPHB 1FY3A 4K8YA 1A0LA 1NFWA 3ZZ6A 1SGFG 1YP9A 2FXRA 4CH2B 4ZHMU 2IJOB 2HPQH 4NWLA 3U1IB 3SI3H 1DLEA 5T6FA 4E7NA 1FN8A 4ZKOU 4PROA 4O9VA 2J95A 4AORA 4K5ZA 1GMCF 1LQEA 1O3FA 2W7SA 2Z9JA 2P3UB 5FAHA 4DURA 1AGJA 1GWAA 2CMYA 4ZHAA 1CSOE 2QGRA 3E91A 1UK2A 2FZZA 4I8HA 4X1SU 6GCHF 1QB1A 3RXBA 1TA6A 3S9BA 2WINI 1LHEH 1ZTLA 2BD2A 1P04A 1YBWA 2A7CA 1GBKA 1C5OH 4MLFB 1O2ZA 3V0XA 3F9EA 2BVRH 3M7UA 2O8WA 4ABEA 1GHWH 4Y7BA 2M5TA 1MTNC 1VCWA 1EXFA 1GJCB 5L6NH 1G3EA 1SVPA 1EATA 2PTCE 1NESE 2H5CA 3GOVB 1Y8TA 1UTNA 1MTUA 2XC0A 3GYMA 4JZ1A 4NIWA 1KIGH 2VJ1A 1YPGH 1FJSA 1OYQA 1G32B 3SV7A 1O5BB 1W0YH 3M5OA 5C5OA 1EP5A 1J8AA 2W26A 1DS2E 2IOTA 2GMTC 4WF8A 2B0FA 3QWCH 1RIWC 1SOTA 3A7TA 3T27A 1LVYA 1HGTH 4E06H 3UQVA 1AB9C 4U32A 2RG3A 3V7TA 1EPTA 2AMDA 1G2LA 2BXUH 1TMUH 2TRMA 1ABIH 2CF9H 4WH6A 2ASUB 1BJUA 1ZHMA 1HJAB 4FUJA 1O3EA 3UPEA 2HVXA 1MKXK 3GY3A 4KTSA 2VGCB 3BN9A 3PMHB 1IQHA 1MAXA 4X6MA 1P12E 2B9LA 2WV4A 1UVTH 3HK3B 5EQQA 4UFGH 3G01A 1FONA 1BTWA 1NRRH 1CO7E 1YGCH 4ZH8A 5FPYA 2VB0A 5CE1A 4GUXA 1GHZA 4BAMB 3EYDA 1THSH 1YPHC 4DGJA 1NFYA 5GDSH 1EAUA 2Z9GA 1O3IA 1ELEE 1F5RA 3CP7A 1WTGH 1V2UT 1NC6A 1GJ8B 1ANBA 5F6MA 1PPCE 4GHQA 5FPSA 2J4IA 2I6SA 1O34A 4FUHA 1PPZA 3HPTB 4SGAE 2BDIA 3C1KA 4AX9H 4MNXA 4I31A 4AYVB 3SOSA 3RLWH 1QBVH 1XUIA 3LC5A 1SGNE 4ZMAH 2Z9IA 1ESBA 3ATKA 3W95A 4GAWA 1XXFA 3PMAB 4LXBH 1GCDA 3TJVA 3I29A 3E0PB 1O33A 3GY6A 2OBOA 1RTFB 1Z6JH 1NM6A 5T6GA 4BTUB 1G9IE 1O5DH 4OS4A 2R0LA 2ZFQH 1QTFA 4UEHH 1A0HB 2A2XH 2BXTH 1H9LB 1GI9B 1O3HA 1O3NA 1F0SA 1V2KT 1PJPA 2W3KA 1O5EH 2Q6DA 4Q80A 1WBGB 4NWKA 4A1TA 2QA9E 1SGPE 1RTKA 2FOFA 2OC8A 2J94A 1CA8B 1S6FA 3T29A 1D4PB 3IWMA 2BY6X 2PTNA 1KXFA 5JDUB 1C5RA 1SQTA 3MHWU 4XE4A 3RXVA 2ANWA 1V2PT 1C5LH 1C5VA 1TIOA 1V3XA 4GHTA 1V2QT 5JPMH 5E0HA 3S0NA 2ZQ1A 1GVLA 2D8WA 1ZPBA 4UD9H 4B1TA 2A0QB 1TRYA 3A7WA 5E2OA 5GCHG 3MU4A 1QL7A 1CBWC 1KLIH 2BDCA 4WJG2 1UVPA 4CBNA 4ZHLU 2FS9A 1PQ7A 4X2YA 4B75A 1ANEA 1EX3A 1NN6A 1O2MA 1C5TA 1GHBG 2XNIA 1OYTH 1Y59T 2QN5T 2XXLA 4IS5A 1YLDA 1QR3E 3UUZA 1P8VC 1UTOA 2P16A 2AGIX 1O3CA 2V3HH 4X8TH 3SO3A 3V12A 1O2GH 2VH0A 1M9UA 1U6QA 1GI0A 2QXGA 1ZSJA 5A0AE 4NIXA 2ZKSA 2FOGA 1DLKB 3BF6H 3RXQA 5JB9S 4ABAA 5HM9A 1HAGE 1DXPA 1QL9A 2O8UA 5TCAA 1SFQB 2O8MA 3RUOA 1P0SH 3SJOA 1W13U 1MTSA 2NU1E 2RA0A 2BX4A 2A4QA 3E3TA 3D65E 1FY5A 2B5TB 3KEEA 1P11E 4CRDA 1MCVA 3LONA 4D7FA 3EA8A 1PPHE 2R3YA 1UO6A 1O30A 2BD9A 2VIPA 3PM3A 4YO9A 2GMTB 2FI5E 1OSSA 1QQ4A 2R0KA 2SGAA 4DCDA 3RXCA 1A61H 1W12U 2PKSB 2ZHDA 2ZTYA 1H9IE 1SGRE 3W94A 3TNSA 3TJOA 2A4GA 1VJ9U 1ZJDA 5GCHF 2ZEBA 1O3PB 3R0FA 2ZDNA 2G00A 3QX5H 3U8RH 3RMOH 1TB6H 1K1IA 2PGQB 3TGIE 4HTCH 4XDEA 5HM2A 1ARBA 1SL3A 3O8BA 2YNAA 4H4FA 1QHRB 4ABBA 1KXCA 3ZZDA 2F9UA 1YCPH 1T4VH 2F9NA 1GVZA 2FOAA 3P70B 4YLUA 1C1OA 1WSSH 1IQFA 1P02A 3OX7U 2OQUA 1VITF 4JK5A 3ITIA 2UWOA 3MH6A 1BJVA 3U98H 4CHAC 8LPRA 3NCLA 2RA3A 3MWIU 4X0WU 3ESTA 1BMNH 1A2CH 2BX3A 4A5TS 1GJ6A 3QTVH 4AN7A 1IQJA 3A88A 3M3VA 4CRBA 1TAWA 2PV9B 4XOJA 1JIRA 4Y0YE 1TBZH 4DG4A 2G55A 2FP7B 1IQNA 3ZZ8A 1AN1E 1FUJA 2ZU2A 3GDSA 2EI6A 1E34B 2Z9KA 3MH5A 2H2ZA 2I6QA 3GDVA 3R3GB 3MNCA 1WQSA 4Y76A 3RU4T 1QA7A 3P8OA 1LPKB 7ESTE 3GY2A 5EXLA 3KHVA 3SJKA 1GDQA 1GDNA 2WPIS 4Z0KA 1J15A 1CT0E 1HJ8A 3LGTA 5LH8A 2CV3A 1A5GH 2J38A 1FIWA 4D76A 1GCTC 2W5EA 1EAWA 4K8BA 1QCPA 1MAYA 3OU0A 1V2JT 3RXLA 1C2LA 1SGIB 3VEQB 1MCTA 5EG4A 1CBWB 3E8LA 2FWWA 1J17T 1P57B 3UREA 1TQ0B 3MNXA 1BOQA 3A7VA 4CBOA 2HALA 1W11U 1O2IA 1SPJA 1FV9A 1A3EH 2D2DA 1BTUA 4DY7B 3BTDE 1GI3A 2ZU1A 1N6XA 2OQ5A 1BRBE 9LPRA 2QAAA 2QC2A 1GJ4H 1D3DB 3F9HA 1P09A 2BDAA 4FVDA 3B23B 4O97A 4A92A 2AERH 4IN2A 4B73A 4B2AA 3P8GA 2GCHF 1C5QA 1UTLM 3RXJA 3SW2B 2RDLA 1BTXA 3LGYA 3PTNA 4FUIA 1C5SA 3E16B 4O3TA 2BD5A 1LDTT 2PUQH 3ATMA 5FX5A 2ZPSA 4OS5A 1MH0A 1HUTH 3IG6B 3UR9A 5DP5A 3K6YA 1TNJA 5DG6A 5FBEA 1TE0A 5B6OA 4ZROA 2WYGA 1Z8GA 1H4WA 1PPBH 1QJ1B 1IQLA 4FU8A 3P92A 1MU6B 1TNLA 4X2XA 2FX4A 2Z7FE 3ENSB 1TGTA 2G81E 4XBDA 3T26A 3SZNA 4MQAA 2TIOA 1WQVH 1AFQB 1NFXA 2GCTB 5FCKA 5I25A 4K1EA 2UUYA 1Q3XA 5ESBA 3SHAH 1GJ7B 3C27B 2OC0A 8ESTE 4H6TA 5F8TA 3PMJA 3KGPA 3KQEA 4WWYA 3M5MA 3RXSA 1KLJH 1G3BA 1RD3B 1BMAA 1TX7A 1GBMA 3RXKA 2XBWA 2P94A 2H5DA 3TJUA 4GVUA 1C2DA 2P59A 2ILNA 4JYTA 4X1PU 5FHTA 3LC3A 5GPIB 1XUJA 3ATWA 1VJAU 4ZXXH 3KQBA 2ZGBH 3MFJA 1ETSH 3B9FH 5DP7A 2VIWA 2CHAB 3SHCH 5EW2H 5HXFA 1ZPZA 1Y3WA 3VGCB 3STIA 3AVZA 1GMCG 3DHKH 4K3JA 2JETB 1FDPA 1V2NT 5LPEA 2ZA5A 2XC4A 3JZ2B 2A7HA 4UFDH 3AAVA 4FUDA 3QZQA 2BD7A 4Y0ZE 3RXTA 1CHGA 3ZZ7A 1E0FD 2OUAA 3V13A 1SGFA 3ZZBA 1J16A 2VWLA 2H9TH 2XWBI 1NRNH 4OS7A 1GG6B 2FYRA 3ZVEA 1SC8U 1OWJA 4ISNA 1GPZA 3ZV8A 1TGNA 1SGDE 1EASA 2PR3A 2WPMS 1O3OA 2JH6D 3SV6A 1C1MA 3PV4A 3SUDA 1TLDA 2PHBA 1SQAA 1RS0A 3QLPH 2ZF0H 5EPYA 3BTKE 4AFQA 4NGAH 5C3NA 1O39A 1D6RA 4Y79A 3QZRA 5FPTA 2WV5A 4WH8A 5EOKA 2F9PA 1TNGA 5C20A 4UDWH 1TGBA 3RC5A 1JBUH 1EZUC 2ZDAH 2OCVB 1A3BH 1QBOA 5JBAS 1PQ5A 3T28A 4ISHH 5HMAA 1UTKA 1C5ZB 2Q6GA 2AGEX 3SGQE 4IC5A 2OBQA 1QBNA 1ZZZA 3GY7A 3F1SB 3Q76A 1NT1A 1FY1A 2WPJS 5AVDA 1YCPM 1AKSA 4FUGA 5GIBA 3QO6A 2HPPH 1HXEH 1UCYH 1KYNA 3PB1E 3VXFH 1Y3XA 2OD3B 3SUGA 1AIXH 2ODPA 1GBDA 1BZXE 1ZRKA 2XBVA 1GHYH 2A45B 4HI3A 2QXHA 4Q7YA 1AO5A 2EEKA 1ZHRA 3SN8A 1C1NA 4MPUA 2FOMB 1IQEA 4AYYB 3BEIB 3HKJB 1TPAE 1V2OT 3S7HB 2G5VA 1DUAA 2A32A 3T2NA 4RKOB 1ELFA 1FLEE 3OY5U 4CH8B 2TPIZ 3ELAH 1TBQH 3LGWA 2ZGJA 1DY8A 1JRSA 4NSYA 4DW2U 4LOYH 2DUCA 4TY7A 1E36B 5EQRA 1TONA 1AZ8A 3PLBA 4TWYA 4X8UH 5JB8S 1EZQA 1AVWA 2PUXB 1A1RA 3M36A 1GI8B 1C2EA 1O37A 2ZGCA 1YKTA 2FI4E 1DUEA 3H7OA 3UNQA 3UY9A 1G37A 2PKSC 2QIQA 2Q1JA 1MU8B 1C2GA 1T31A 3TH2H 2FX6A 4Y6DA 3URCA 1P2NA 3P8NA 2AIQA 2OXSA 1O2LA 4HFPB 4BOHA 3A83A 4LK4A 1S81A 4DIHH 4A7IB 1FNIA 2Y5GA 4VGCC 1QRXA 2XC5A 2ZFPH 1SGYE 2ZDVH 1TGSZ 1Z8RA 3UTUH 3HK6B 3QDZB 1TFXA 1C2MA 1N1LA 1V2VT 1DWBH 3Q77A 3QUMP 3ZV9A 7KMEH 1O0DH 3TU7H 4I7YH 1K9OE 1AKSB 4ABFA 3TH4H 1O2JA 4CRFA 5GXPA 1BHXB 4JCNA 4MG3A 3VB6A 5HYOA 2QF3A 1ZTKA 3RMLH 2ZFTA 2BY7X 3BV9B 1EAIA 2FODA 1S85A 4WXVA 2HLCA 3KIDU 1YPEH 3UWIA 5AF9H 1S84A 1O2UA 3DFLA 2IN2A 2Z94A 5C1YA 1W3CA 1Z71A 1O31A 2Y81A 3HGNA 3ZZCA 4D9RA 1HCGA 1THPB 3TLOA 4I33A 1BITA 4X6OA 3K2UA 4YOJA 1HAPH 5EXMA 4CREA 4KKDA 2LNCA 2ULLA 1VR1H 2Q6FA 2FIRH 1TPPA 2EC9H 3M35A 2H1UA 5DK1A 1THRH 4M7GA 1MQ6A 4BAOB 1LHFH 3D49H 4GPGA 1RGQA 3KQCA 5ETXA 1FMGA 3LGUA 2FS8A 1MBMA 4HGCA 1NU7B 2WPHS 2XTTB 1KDQA 4F4OC 3ZZ9A 1XVOA 1SB1H 1S82A 4CR5A 2A2QH 2C90B 2SFAA 1V2TT 1EPTB 1P10A 1EUFA 1C2FA 1Y5AT 2C8WB 4GSOA 1TALA 2FTMA 2SGFE 3BG4B 4NIYA 4BANB 2JKHA 1RRKA 3RM2H 1CVWH 4X6NA 1F5KU 1E37B 2J34A 4BAKB 1EP6A 4XBCA 2BY5X 3M7TA 1CE5A 4BTTB 2ZPRA 1K1PA 5L2YH 1V2ST 5EODA 3SV2H 2F83A 2YOLA 4FUFA 4YT6H 5F8XA 3SUEA 3BEUA 1LKAA 2BOKA 2ZDMA 3GCTG 2PW8H 4I8KA 5DPAA 1NS3A 3TK5A 5J4SA 3DT0H 1HAVA 1Z1JA 2Y6TA 1AE5A 2GT8A 2ZHFH 2R2MB 2Z3EA 3V3MA 1OWKA 1UK4A 2FESH 1HIAA 2ZECA 4RSPA 4AFUA 3LU9B 1D6WA 3RMNH 5SGAE 1C4Y2 1CA0B 1ELGA 2G8TA 1UCYE 2C8XB 1SLVB 4X1QU 3IITA 4BAQB 3OTJE 2FMJA 4KTCA 4IN1A 2ZI2H 3RXUA 3ZZAA 3LJOA 5BPEA 1OS8A 1XUGA 4MNVA 1CU1A 1ZGIA 5TJXA 2SGQE 3RP2A 2BMGB 1LVMA 4THNH 2NU4E 1T4UH 2G4UA 2XCFA 3K65B 1VITG 3PTBA 1K22H 1BCUH 3BIVH 1ZMLA 1TPOA 3A85A 3MH7A 1ZPCA 4IC6A 1GL0E 1P2KA 1O2YA 4DOQA 1P03A 5I46H 1IOEA 1DPOA 2GDEH 2HOBA 1FY4A 4AFZA 2W3IA 1C2JA 1XUKA 3SNDA 2UUJB 5CHAB 1Z6EA 3PMBB 3M5LA 1LVOA 3N7OA 5C1XA 1KDQB 4U01A 1YM0A 2FPZA 3WY8A 1ZYOA 2Z3CA 4WMEA 4Q2KA 4Q7XA 2QXIA 3SBKA 2HNTE 1SOZA 1BTYA 5TCCA 3CENA 1HB0B 1CGIE 3MU8A 2SNVA 3GCTF 1AFQC 2GCTC 4K69A 1O2PA 1P06A 2NU0E 2AIPA 4VGCB 1FN6A 1LMWB 1FI8A 3LPRA 1O35A 3UWJH 1C9PA 3A86A 1V6DA 2GD4B 1QY6A 1ZGVA 4E7RG 3M7QA 4JZDH 5EGMA 1HPGA 1HAZB 3BSQA 3GY8A 3SNCA 3A81A 2ZC9H 1XXDA 3SNAA 4ZKSU 2BY9X 2AMQA 3S69A 4OGYA 2BDBA 1PYTC 2WUCA 2OLGA 3A82A 1HIAB 2BY8X 3LGIA 4ISLA 3A7YA 2P93A 1EQ9A 1AWHB 3SNEA 1QIXB 5GWZA 2EI8A 3TGJE 2Y82A 2CHAC 1P3EA 3SGAE 1DVAH 2ZQ2A 3VB4A 3QGNB 3VGCC 1QB9A 1DDJA 4YM9A 4ISOA 1SBWA 2JETC 1TWXB 3MI4A 3EAJA 2EA3A 1SHYA 1C2HA 4QT8C 3RXHA 3S9CA 2VWOA 5C1UA 1ACBE 1YCPK 4YTAA 1BQYA 1W0ZU 2ZG0H 1O2HA 1DWDH 4BXSA 1HYLA 4J2YB 1LHCH 5JBCS 5DP3A 1GG6C 2ZTZA 1QB6A 2GCHG 3A8CA 1GI5A 3U8TH 1H8DH 1GBEA 1SFIA 2GP9B 4R8TB 3TK9A 2ZGXH 1Q31A 2AEIH 3FP6E 1F5LA 3FAOA 3SI4H 2GGVB 1MKWH 2ANMH 1PPEE 2BVXH 2VIOA 1GI4A 4A6LA 1C1PA 1ELBA 1MMJN 2SGEE 1SG8B 2ALVA 1AZZA 4FU9A 5J4QA 2BOHB 2AH4X 1SQOA 3MNBA 3LJJA 1TOCB 2FOCA 3A84A 3LOXA 4RKJB 1LHDH 2GZ7A 2BLQA 4KP0A 1YC0A 4MPVA 5E0GA 5EPNA 2O9QA 2TGAA 1HJ9A 3M3SA 1XVMA 1O38A 3A8AA 3MO3A 4NA8A 4CRAA 4AZ2B 7LPRA 2J92A 3PO1B 3OSYA 1CHOG 1KY9A 2VH6A 4NZQA 1IHSH 4Z6AH 4FVBA 1UK3A 1BA8B 2SNWA 3K9XB 2XRCA 1GBAA 3URDA 3RXEA 4MPWA 2P3FH 3CS0A 1OWEA 2Z6BD 3SU3A 1C5NH 2F3CE 1GBJA 4JK6A 1D3QB 1DSTA 1G30B 1K1LA 1UVSH 2BLOA 1V2WT 4IMQA 3TK6A 3DFJA 3HATH 1ELAA 1B7XB 2O8LA 1P05A 4Q7ZA 3GYLB 1OWDA 5K7RA 3T5FH 4Y71A 5K0HA 1QRWA 1AY6H 3SUFA 1MTWA 3UQOA 5DKMA 3PLKA 1OKXA 1SR5C 1T8MA 1BRAA 4ZXYH 4WMFA 5F8ZA 5ABWA 4FUCA 2WYJA 1LPGB 2O8TA 1KXDA 2PFEA 3E6PH 2BD3A 1EB1H 3A89A 1LHGH 3RM0H 1VITH 4FU7A 2ZP0H 2GV6A 5C5NA 3BTFE 2BD4A 3LIWA 1O3BA 2R2WU 1UMAH 3RXAA 3RXIA 1F0UA 2BD8A 1JRTA 5A09A 1OX1A 3SNBA 1ELVA 1O3LA 1V2RT 2BZAA 1P2OA 2WPLS 1CHOF 3DUXH 3JZ1B 3LH1A 3TPIZ 1A7SA 1BRUP 3RXDA 4WMDA 4WY3A 1C9TA 4YOIA 3PWCA 3MH4A 3RLYH 4NSVA 3BEFB 3LDXH 4NCYA 2ZO3H 4I8GA 2BVSH 1KTTB 2TGDA 2V6NA 1TNHA 3AW1A 2GZ9A 3Q3KA 1C5YB 1GJDB 1QURH 3FZZA 1SI5H 1O3MA 1AUJA 1YPLH 1TNIA 3TNTA 7GCHG 1O2XA 2P95A 1BB0B 1B5GH 1DITH 3L33A 2STBE 1ZHPA 2BM2A 2V0BA 3DA9B 4INKA 2VNTA 1P01A 3NUMA 1N6YA 4DVAU 1GBIA 1NROH 3ZVDA 6CHAB 3O8CA 1UTMA 4INLA 4XSKU 2G51A 4JMYA 4H6SB 3TH3H 4JYUH 3Q00A 2ESTE 1SSXA 2IPHA 1ESTA 1FY8E 2Y5FA 2R3UA 3L6PA 4GCHF 1QA0A 2ZZUH 5DO4H 1MUEB 1AHTH 4TYDA 3GY5A 1F2SE 2AS9A 1W7GH 3MOCA 1O5FH 2VVCA 2FO9A 2ZWLH 4MPXA 1S5SA 4Y10E 4Y7AA 3RXFA 4UE7H 4AGJA 1T32A 2ZDKA 1ZOMA 4K1SA 1GHAF 3ATIA 1F92A 1GBCA 3SU2A 2D1JA 5L2ZH 3A8BA 3SU6A 4KTUA 1D3PB 4U30A 3P8FA 1V2MT 2PLXA 1CT2E 2PWXA 7GCHF 3KNXA 3GDUA 4AOQA 5F03A 1UTJA 1BTPA 1Z8IB 2Z9LA 4GLYA 3U8OH 1L0ZA 5DJ7A 1BT7A 1EPTC 2ANKH 3QGJA 3UFAA 4LZ1H 5AFZH 1ZRBA 1OP8A 1CGHA 3BG4C 4JZFH 2A5IA 1J9CH 3F9GA 5HGGA 1BBRE 4B71A 3H5CB 5L30H 3EE0B 4NG9H 2ZNKH 5DP4A 3SGBE 1O2SA 1W10U 2FLRH 3EA9A 2Z3DA 3GISB 4YZUA 3CS7A 3H7TA 4DJZB 1OP2A 2QYIA 3ZVCA 2ZCLP 3KCGH 1T7CA 4OS6A 1OP0A 2FM2A 4DIIH 4MNWA 4MVNA 6ESTA 1XX9A 1TRMA 1K1OA 1W14U 4ZUHA 3BTHE 3SJ9A 1MD8A 3UOUA 3S9AA 3TJNA 4FUEA 4RN6A 1CA0C 1PQAA 3MNSA 1ORFA 2EI7A 1HAXB 2GX4A 1SLUB 1WU1A 2G5NA 3QTOH 3KL6A 2AMPA 1AWFH 4IMZA 1DSUA 2A4RA 1QGFA 4B2BA 3T62A 1Y3VA 3TIUA 1DXWA 1Z8JB 1O2RA 1IQMA 1TMBH 1GBLA 4YOGA 3TGKE 3OY6U 1C1QA 1XUHA 2AGGX 4D7GA 2ZPQA 4JZIA 1UJ1A 2BQ6B 4D9QA 1L2EA 1MBQA 1QJ7B 2PSYA 1ELTA 1RFNA 1UCYK 1WUNH 1DICA 5A0CA 1B0FA 3NZIA 1FAKH 2BLVA 2CN0H 1AFEH 1OXGA 1XKAC 4Y11E 1GMDG 1GJBB 5T6DA 2OINA 1YPMH 3BTTE 2HGTH 5EXNA 3U1JB 1TPSA 5CHAC 1KLTA 1D9IA 2VVVA 3HGPA 1IQGA 1HDTH 1MKXH 2WPKS 1JIMA 2FI3E 1GL1A 5EQSA 2OC1A 1ETTH 1F7ZA 1TA2A 1O3JA 4YLQH 3RU4E 3K6ZA 1Y5UT 1YPKH 1K2I1 1BUIA 1TX8A 1GGDB 1KXAA 2J9NA 3RC4A 3SV8A 1X7AC 1B0EA 1FZZA 3AAUA 1O2OA 3LKWA 3S7KB 5ESTE 1KTSB 2PKAA 3BTME 3UOPA 2H6MA 3KQDA 1G3CA 1N8OB 3RXPA 2ZU5A 1YPHE 1O3KA 3NWUA 3MU5A 3EQ0H 3F6UH 1O3AA 3ZZ3A 4X8SH 2C93B 3GCHB 2Y5HA 2P8OB 1FIZA 1C5PA 2A5KA 2BZ6H 4E05H 1DANH 4ZAEA 1C5MD 1LQDB 3ZVFA 1TX6A 5LPRA 2VIVA 3ZVGA 1GVKB 2TGPZ 2PGBB 1SGCA 2ZHQH 3GCNA 1C4V2 3OYPA 4A1XA 1PFXC 1GMDF 2XBXA 4BTIB 1SLWB 3A80A 2FLBH 2ZHEH 4F49A 4Y8YA 3SQEE 2BDYA 5JBBS 1GBTA 3P95A 3FP7E 1O5GH 3VPKA 1C1RA 2OP9A 1K21H 2XYAA 1SGEE 4A1VA 1ESAA 1BHXF 1W7XH 2YNBA 1AUTC 5LPFA 5AFYH 1DY9A 1G2MA 4MDSA 4NIVA 1WCZA 1KXBA 3PWBA 1VCPA 3UNRA 4ISIH 3NXPA 2UWLA 1UVUH 3E0NB 1C5UA 3VXEH 3M61U 3UNSA 1GHVH 1ZMJA 4K1TA 1EJMA 2QF0A 3Q3YA 3ZVAA 2BQ7B 2C3SA 1P3CA 1A4WH 1AVXA 3F68H 4D8NA 3ATLA 3VB5A 1P2QA 1C1UH 1GI6A 1WAYB 1HAIH 3T25A 2RCEA 5DGJA 1VGCB 3GCOA 1EOLA 1EZSC 1GJ9B 1IAUA 1L4DA 1NY22 3I77A 2PKAB 3A87A 1MZAA 4NA9H 1Z7KA 1BIOA 1HXFH 4B2CA 1AD8H 2ODYB 2GDDA 3BTGE 3MU1A 3PO1C 2C8YB 1C4U2 1A5HA 2ZU4A 3M3TA 3AW0A 5H4IB 2QCYA 4LZ4B 1F0TA 2FDAA 1FXYA 2NU3E 1XMNB 2ZFSA 1C2KA 1OOKB 1WV7H 3SU5A 4DT7B 1ZSLA 2DE8A 3TVJB 1TNKA 1TYNA 3M37A 1QRZA 3E90B 1SLXB 1GJAB 1JXPA 1GI2A 1CQQA 1L4ZA 1P9UA 2R9PA 1DOJA 1AMHA 4OS2A 3RDZA 4AB8A 1CT4E 3LGVA 2ZFRH 1ANCA 4YESB 1HRTH 1MQ5A 1LVBA 3FFGA 1H9HE 3NK8A 2ODQA 1Y3YA 1C1WH 1DX5M 8GCHG 1F0RA 4INHA 2GZ8A 2C8ZB 4ABHA 4B76A 1C5XB 2ZCHP 5AHGH 1O2TA 1ZTJA 2H9EH 3FZDA 2KAIA 4ESTE 1K28D 2V35A 4WXIA 1NTPA 1ABJH 1BMMH 3ODFA 1NZQH 1MTNB 1PPGE 1O2QA 1BDAA 3QK1A 1INCA 1BTHH 2J2UA 4R0IA 4UONA 1D3TB 2UWPA 1WTHD 3KF2A 4ZKRU 1HBTH 3HKIB 4X6PA 5DP8A 2ZFFH 4U2WA 3SJIA 3U69H 3ZZ4A 1L1GA 1L1JA 4B74A 2SGPE 1IHTH 5A8YA 3E1XB 3DD2H 1C5WB 1A5IA 1LPZB 1IQKA 3O8DA 3ZYEA 1T8LA 3Q3XA 4UFFH 4K60A 2H9HA 5GJ4B 2G4TA 1AQ7A 1RIWB 4I32A 3A7ZA 2JH0D 4MNYA 1EOJA 4AFSA 1O32A 4ZKNU 1AB9B 1EB2A 3RXOA 2ZGHA 3SU1A 2WUBA 2Y7XA 1KSNA 1S0RA 1GDUA 4X1RU 5E0JA 2VINA 4I8LA 4YT7H 1DFPA 3P17H 1C1TA 2HNTC 2VIDA 4BAHB 4BXWA 1AI8H 1DT2A 1MD7A 1HAVB 4XFQA 3ZVBA 1NFUA 1P2MA 1WOFA 3PROA 5A8XA 1GHBF 1AU8A 1UTQA 8GCHF 1JWTA 1K1NA 5G4BA 4TPIZ 4ABIA 2PSXA 3FVFB 2A1DB 2CGAA 2A4OA 3D62A 1DM4B 1YF4A 6CHAC 3U9AH 4WVPE 2UUFB 1ZMNA 1FQ3A 4KGAA 1QFKH 1EJNA 3RXRA 1PPFE 1YPJH 3VFEA 3PLPA 1SHHB 1BMLA 2BQWB 1QJ6B 2CJIA 2ALPA 5FX6A 3MO6A 2KAIB 3EGKH 3P6ZB 4J1YA 2JH5D 1HAYB 1H1BA 3EDXB 3ZZ5A 1O2NA 1HAHH 2SGDE 4HZHA 3ODDA 5CMXH 1NPMA 1ZLRA 2F9OA 2STAE 1ARCA 1O2VA 4KELA 2P3TB 4AB9A 5JYIA 3GY4A 4NFFA 4CR9A 4TPYA 3TITA 3RU4D 4CRGA 1G3DA 2FOHA 2A7JA 1EJAA 1C2IA 2VVUA 2C4FH 2F9BH 5C2ZA 1J14A 3PYHA 1BBRH 1TABE 2CF8H 1TBRH 2AYWA 5JBTA 1TMTH 1SMFE 1A0JA 5EU8A 1LKBA 2OTVA 2NU2E 1O2KA 2BYAX 1Z1IA 1EKBB 3VB3A 1QQUA 5C67A 1P2IA 1OWIA 5BRRE 1YLCA 1NO9H 4XBBA 3SJ8A 1KXEA 4AG2A 3MU0A 1TGCA 1MKWK 2BDGA 1UTPA 2GT7A 2VWNA 1ETRH 2TGTA 4H42U 1O2WA 1O36A 2GV7A 4FUBA 1GI1A 2ANYA 2ZHWH 4X2WA 2XW9A 5T3HA 2Y7ZA 1XKBC 2A31A 2HRVA 2B8OH 1VCQA 2GKVE 1BBRK 3GICB 4TY6A 2TBSA 4X2VA 3LT3A 3BTQE 3L3TA 1UHBA 1Y5BT 1CGJE 2GTBA 2Y80A 4K2YA 3RXGA 2BHGA 1HNEE 2B7DH 2BDHA 3FANA 2ZU3A 1RJXB 2G52A 2LPRA 1ELDE 3O8RA
chains in the Genus database with same CATH superfamily
4ABJA 3MYWA 1L1NA 4Y8XA 1O5AB 1E1RD 1NRPH 4OS1A 3NKKA 3SQHE 1SGQE 1O3DA 4NA7A 2FTLE 5DP6A 3RMMH 1H8ED 1E38B 1GJ5H 4FXGH 1K1MA 3LH3A 2ZDLA 4SGBE 3SORA 4JYVH 4ABGA 1SKYE 2ZIQH 3BTWE 1W2KH 2ZCKP 1ID5H 1RXPA 4GCHG 1ANDA 3F9FA 3QN7A 5EW1H 4ABDA 9ESTA 3NPSA 4O03A 1GHXH 2QXJA 1H8IH 3EA7A 2L74A 2XWAA 1HV7A 1W8BH 1ZR0A 3KN2A 5E8EH 1TOMH 1PQ8A 1ZJKA 3VB7A 4Y8ZA 3BIUH 1TQ7B 1RTLA 1LO6A 1C1SA 1GHAG 2VIQA 2XBYA 4AGKA 1GGDC 3MTYA 1HFDA 1E35B 1GBBA 3DSGA 2V7QD 3SU0A 3RC6A 3UIRA 8KME2 2FYQA 3F3BA 5C0TA 3MMGA 1Y3UA 2JJ2D 1UVOA 4AG1A 1T8NA 3BG8A 2UUKB 1OWHA 5A0BA 1LTOA 1NRQH 2HWLB 1N8OC 4UFEH 1SGTA 5IDKA 5FXLA 1HJAC 2F91A 1DE7H 1S0QA 3MO9A 1WYKA 1IQIA 1GMHG 1NRSH 4NZLA 1FPHH 5FBIA 3GCHC 5PTPA 5IYTA 1S83A 1P2JA 2P8OC 2VGCC 5LGOA 4TWWA 1G36A 3B8JA 1EAXA 2BLWA 5A8ZA 2EQNA 3STJA 2QY0B 1BRCE 1UHBB 2ZTXA 3WWBA 2VWMA 1DWCH 1AVGH 1T8OA 1ELCA 3UR6A 1K1JA 5E2PA 1MZDA 1TRNA 3RXMA 4CHAB 1YYY1 2V3OH 2HNTF 1MTVA 1FPCH 3SU4A 2FOBA 2D26C 1O5CB 1S6HA 1HAOH 4P02A 2W7UA 3ZYDA 4I8JA 2BTCE 2FEQH 4F48B 1XM1A 4IBLH 2GVFA 1EZXC 1HLTH 3A7XA 1FAXA 4O3UA 3BTEE 4IGDA 1JMOH 1P9SA 1AE8H 2AFQB 2THFB 1GBFA 2A5AA 1Q2WA 6GCHG 2HLDD 2CXVA 1XUFA 2BB4A 4MTBA 1ZSKA 1NU9A 3FP8E 4JZEH 4NFEA 1C1VH 1LCYA 3AASA 2XCNA 1O3GA 2NWNA 2K1QA 3M5NA 6LPRA 1GI7B 1V2LT 1BTZA 2DE9A 2FOEA 3SV9A 4X1NU 1GBHA 1QNJA 4OGXA 1GMHF 4ASHA 1PYTD 1DWEH 2F9VA 5A2MH 4X8VH 4IW4E 2QV1A 4FOUC 3A8DA 1VGCC 5DP9A 4CRCA 1A46H 3I78A 1JOUB 5FCRA 4BNRA 1VZQH 2OC7A 3OE7D 1QL8A 2VU8E 3D23A 1GCTB 2W6ID 1OPHB 1FY3A 4K8YA 1A0LA 1NFWA 3ZZ6A 1SGFG 1YP9A 2FXRA 4CH2B 4ZHMU 2IJOB 2HPQH 4NWLA 3U1IB 3SI3H 1DLEA 5T6FA 4E7NA 1FN8A 4ZKOU 4PROA 4O9VA 2J95A 4AORA 4TSFD 4K5ZA 1GMCF 1LQEA 1O3FA 1S6LA 2W7SA 2Z9JA 2P3UB 5FAHA 4DURA 1AGJA 1GWAA 2CMYA 4ZHAA 1CSOE 2QGRA 3E91A 1UK2A 3CNRA 2FZZA 4I8HA 4X1SU 6GCHF 1QB1A 2F43B 3RXBA 1TA6A 3S9BA 2WINI 1LHEH 1ZTLA 2BD2A 1P04A 3FOAA 1YBWA 2A7CA 1GBKA 1C5OH 4MLFB 1O2ZA 3V0XA 3F9EA 2BVRH 3M7UA 2O8WA 4ABEA 1GHWH 4Y7BA 3N7EA 1MTNC 1VCWA 1EXFA 2M5TA 1GJCB 5L6NH 1G3EA 1SVPA 1EATA 2PTCE 1NESE 2H5CA 3GOVB 1Y8TA 1UTNA 1MTUA 2XC0A 3GYMA 4JZ1A 4NIWA 1KIGH 2VJ1A 1YPGH 1FJSA 1OYQA 1G32B 3F0OA 3SV7A 1O5BB 1W0YH 3M5OA 5C5OA 1EP5A 1J8AA 2W26A 1DS2E 2IOTA 2GMTC 4WF8A 2B0FA 3QWCH 1RIWC 1SOTA 3A7TA 3T27A 1LVYA 1HGTH 4E06H 3UQVA 1AB9C 4U32A 2RG3A 3V7TA 1EPTA 2AMDA 1G2LA 2BXUH 1TMUH 2TRMA 1ABIH 2CF9H 4WH6A 2ASUB 1BJUA 1ZHMA 1HJAB 4FUJA 1O3EA 2J97A 3UPEA 2HVXA 1MKXK 3GY3A 4KTSA 2VGCB 3BN9A 3PMHB 4TT3D 1IQHA 1MAXA 4X6MA 1P12E 2B9LA 2WV4A 1UVTH 3HK3B 5EQQA 4UFGH 3G01A 1FONA 1BTWA 1NRRH 1CO7E 1YGCH 4ZH8A 5FPYA 2VB0A 5CE1A 4GUXA 1GHZA 4BAMB 3EYDA 1THSH 1YPHC 4DGJA 1NFYA 5GDSH 1EAUA 2Z9GA 1O3IA 1ELEE 1F5RA 5HKKD 3CP7A 1WTGH 1V2UT 2AHME 4B6EA 1NC6A 1GJ8B 1ANBA 5F6MA 1PPCE 4GHQA 3OFND 5FPSA 2J4IA 2I6SA 1O34A 4FUHA 1PPZA 3HPTB 4SGAE 2BDIA 3C1KA 4AX9H 4MNXA 4I31A 4AYVB 3SOSA 3RLWH 1QBVH 1XUIA 3LC5A 1SGNE 4ZMAH 2Z9IA 1ESBA 3ATKA 3W95A 4GAWA 1XXFA 3PMAB 4LXBH 1GCDA 3TJVA 3I29A 3E0PB 1O33A 3GY6A 1RTFB 2OBOA 1Z6JH 1NM6A 5T6GA 4BTUB 1G9IE 1O5DH 4OS4A 2R0LA 2ZFQH 1QTFA 4UEHH 1A0HB 2A2XH 2BXTH 1H9LB 1GI9B 1O3HA 1O3NA 1F0SA 1V2KT 1PJPA 2W3KA 1O5EH 2Q6DA 4Q80A 1WBGB 4NWKA 4A1TA 2QA9E 1SGPE 1RTKA 2FOFA 2OC8A 2J94A 1CA8B 1S6FA 3T29A 1D4PB 3IWMA 2BY6X 2PTNA 1KXFA 5JDUB 1C5RA 1SQTA 3MHWU 4XE4A 3RXVA 4YXWD 2ANWA 1V2PT 2M2AA 1C5LH 1C5VA 1TIOA 1V3XA 4GHTA 1V2QT 4P00A 5JPMH 2IPQX 5E0HA 3S0NA 2ZQ1A 1GVLA 2D8WA 1ZPBA 4UD9H 4B1TA 2A0QB 1TRYA 3A7WA 5E2OA 5GCHG 1YY3A 3MU4A 1QL7A 1CBWC 1KLIH 2BDCA 4WJG2 1UVPA 4CBNA 4ZHLU 2FS9A 1PQ7A 2EY4C 4X2YA 4B75A 1ANEA 3OTPA 1EX3A 1NN6A 1O2MA 1C5TA 1GHBG 2XNIA 5KGOA 1OYTH 1Y59T 2QN5T 2XXLA 4IS5A 1YLDA 1QR3E 3UUZA 1P8VC 1UTOA 2P16A 2AGIX 1O3CA 2V3HH 2V3MA 4X8TH 3SO3A 3V12A 1O2GH 3W1EA 2VH0A 1M9UA 1U6QA 1GI0A 2QXGA 1ZSJA 5A0AE 4NIXA 3KYFA 2ZKSA 2FOGA 1DLKB 3BF6H 3RXQA 5JB9S 4ABAA 5HM9A 1HAGE 1DXPA 1QL9A 2O8UA 5TCAA 1SFQB 2O8MA 5DSFA 3RUOA 1P0SH 3SJOA 1W13U 1MTSA 2NU1E 2RA0A 2BX4A 2A4QA 5F53A 3E3TA 3D65E 1FY5A 2B5TB 3KEEA 1P11E 4CRDA 1MCVA 3LONA 4D7FA 3EA8A 1PPHE 2R3YA 1UO6A 1O30A 2BD9A 2VIPA 3PM3A 4YO9A 2GMTB 2FI5E 1OSSA 1QQ4A 2R0KA 2SGAA 4DCDA 3RXCA 1A61H 1W12U 2PKSB 2ZHDA 2ZTYA 1H9IE 1SGRE 3W94A 2XNDD 3TNSA 3TJOA 2A4GA 1VJ9U 1ZJDA 5GCHF 3F2HA 2ZEBA 1O3PB 3R0FA 2ZDNA 2G00A 3QX5H 3U8RH 3RMOH 1TB6H 4M9FA 1K1IA 3DCLA 2PGQB 3TGIE 4HTCH 4XDEA 5HM2A 3FN8A 1ARBA 1SL3A 3O8BA 2YNAA 4H4FA 5EJZA 1K0HA 1QHRB 4ABBA 1W0KD 1KXCA 3ZZDA 2F9UA 1YCPH 1T4VH 2F9NA 1GVZA 5C0UA 3UAIC 2FOAA 3P70B 4YLUA 1C1OA 1WSSH 1IQFA 1P02A 3OX7U 2OQUA 1NBMD 4F55A 1VITF 4JK5A 3ITIA 2UWOA 3MH6A 1BJVA 3U98H 4CHAC 8LPRA 3NCLA 2RA3A 3MWIU 3OEED 4X0WU 4RT0A 3ESTA 1BMNH 1A2CH 2BX3A 4A5TS 4HG6A 2KCOA 1GJ6A 3QTVH 1KMHB 4AN7A 1IQJA 3A88A 3M3VA 4CRBA 1TAWA 2PV9B 4XOJA 1JIRA 4Y0YE 1TBZH 4ZCNA 4DG4A 2G55A 2FP7B 1IQNA 3ZZ8A 1AN1E 1FUJA 2ZU2A 3GDSA 2EI6A 3SZEA 1E34B 2Z9KA 3MH5A 2H2ZA 2I6QA 3GDVA 3R3GB 3MNCA 1WQSA 4Y76A 3RU4T 1QA7A 3P8OA 1LPKB 7ESTE 2IJD1 3GY2A 5EXLA 3KHVA 3SJKA 1GDQA 1GDNA 2WPIS 4Z0KA 1J15A 1CT0E 1HJ8A 3LGTA 5LH8A 2CV3A 1A5GH 2J38A 1FIWA 4D76A 1GCTC 2W5EA 3DSOA 1EAWA 4K8BA 1QCPA 4B6FA 1MAYA 3OU0A 1V2JT 3RXLA 1C2LA 1SGIB 3VEQB 1MCTA 2VBCA 5EG4A 5DN6D 1CBWB 3E8LA 2FWWA 1J17T 1P57B 5HIZA 3UREA 1TQ0B 3MNXA 1BOQA 3A7VA 4CBOA 2HALA 1W11U 1O2IA 1SPJA 1FV9A 1A3EH 2D2DA 1BTUA 4DY7B 3BTDE 1GI3A 2ZU1A 1N6XA 2OQ5A 4RI0A 1BRBE 9LPRA 5B6LA 2QAAA 2QC2A 1GJ4H 1D3DB 3F9HA 1P09A 2BDAA 4FVDA 3B23B 4O97A 4A92A 2AERH 4IN2A 4B73A 4B2AA 3P8GA 2GCHF 1C5QA 1UTLM 3RXJA 3SW2B 2RDLA 1BTXA 3LGYA 3PTNA 4FUIA 3UB0A 1C5SA 3E16B 4O3TA 2BD5A 1LDTT 2PUQH 3ATMA 5FX5A 2ZPSA 4OS5A 1MH0A 1HUTH 3IG6B 2KCYA 3F0PA 3UR9A 4ASUD 5DP5A 3K6YA 1TNJA 5DG6A 5FBEA 1TE0A 5B6OA 4ZROA 2WYGA 1Z8GA 3WW7A 1H4WA 1PPBH 1QJ1B 1IQLA 4FU8A 3P92A 1MU6B 1TNLA 4X2XA 2FX4A 2Z7FE 3ENSB 1TGTA 2G81E 3NRLA 4XBDA 3T26A 3SZNA 4MQAA 2TIOA 1WQVH 1AFQB 1NFXA 2GCTB 4OM9A 5FCKA 5I25A 4K1EA 2UUYA 1Q3XA 5ESBA 2KX4A 3SHAH 1GJ7B 3C27B 2OC0A 8ESTE 4H6TA 5F8TA 3PMJA 3KGPA 3KQEA 4WWYA 3M5MA 3RXSA 1KLJH 1G3BA 5CHBA 1RD3B 1BMAA 1TX7A 1GBMA 3RXKA 2XBWA 2P94A 2H5DA 3TJUA 4GVUA 1C2DA 2P59A 2ILNA 4JYTA 4X1PU 5FHTA 3LC3A 5GPIB 1XUJA 3ATWA 1VJAU 4ZXXH 3KQBA 2ZGBH 3MFJA 1ETSH 2K0QA 3B9FH 5DP7A 2VIWA 2CHAB 3SHCH 5EW2H 5HXFA 1ZPZA 1Y3WA 3VGCB 3STIA 3AVZA 1GMCG 3DHKH 4K3JA 2JETB 1FDPA 1V2NT 5LPEA 2ZA5A 2XC4A 3JZ2B 2A7HA 4UFDH 3AAVA 4FUDA 3QZQA 2BD7A 4Y0ZE 3RXTA 1CHGA 3ZZ7A 1E0FD 2OUAA 3V13A 1SGFA 3ZZBA 1J16A 2VWLA 2H9TH 2XWBI 1NRNH 4OS7A 1GG6B 2FYRA 3ZVEA 1SC8U 1OWJA 4I86A 4RT1A 4ISNA 1GPZA 3ZV8A 1TGNA 1SGDE 1EASA 1H8HD 2PR3A 2WPMS 1O3OA 2JH6D 3SV6A 1C1MA 3PV4A 3SUDA 1TLDA 2PHBA 1SQAA 5KECA 1RS0A 3QLPH 2ZF0H 5EPYA 3BTKE 4AFQA 4NGAH 5C3NA 1O39A 3VG8A 1D6RA 4Y79A 3QZRA 5FPTA 2WV5A 4WH8A 3AK5A 5EOKA 2F9PA 1TNGA 5C20A 4UDWH 1TGBA 3RC5A 1JBUH 1EZUC 2ZDAH 1A3BH 2OCVB 1QBOA 5JBAS 2W6JD 1PQ5A 3T28A 4ISHH 5HMAA 1UTKA 1C5ZB 2Q6GA 2AGEX 3SGQE 4IC5A 2OBQA 1QBNA 1ZZZA 3GY7A 3F1SB 3Q76A 1NT1A 1FY1A 2WPJS 5AVDA 1YCPM 1AKSA 4FUGA 5GIBA 3QO6A 2KM0A 2HPPH 1HXEH 1UCYH 1KYNA 3PB1E 3VXFH 1Y3XA 2OD3B 3SUGA 1AIXH 2ODPA 1GBDA 1BZXE 1ZRKA 2XBVA 1GHYH 2A45B 4HI3A 2QXHA 4Q7YA 1AO5A 2EEKA 1ZHRA 1NBME 3SN8A 1C1NA 4MPUA 2FOMB 1IQEA 4AYYB 3BEIB 3HKJB 1TPAE 5C94A 1V2OT 3S7HB 2G5VA 1DUAA 2A32A 3T2NA 4RKOB 1ELFA 1FLEE 3OY5U 4CH8B 2TPIZ 3ELAH 1TBQH 3LGWA 2ZGJA 1DY8A 1JRSA 4NSYA 4DW2U 4LOYH 2DUCA 4TY7A 1E36B 5EQRA 1TONA 1AZ8A 3PLBA 4TWYA 4X8UH 5JB8S 1EZQA 1AVWA 2PUXB 1A1RA 3M36A 1GI8B 1C2EA 1O37A 2ZGCA 1YKTA 2FI4E 1DUEA 3H7OA 3UNQA 3UY9A 1G37A 2PKSC 2QIQA 2Q1JA 1MU8B 1C2GA 1T31A 3TH2H 2FX6A 4Y6DA 3N99A 3URCA 1P2NA 3P8NA 2AIQA 2OXSA 3OEHD 1O2LA 4HFPB 4BOHA 3A83A 4LK4A 2KCAA 1S81A 4DIHH 4A7IB 1FNIA 2Y5GA 4VGCC 1QRXA 2XC5A 2ZFPH 1SGYE 2ZDVH 1TGSZ 1Z8RA 3UTUH 3HK6B 3QDZB 2J98A 1TFXA 1C2MA 1N1LA 1V2VT 1DWBH 3Q77A 3QUMP 3ZV9A 7KMEH 1O0DH 3OAAD 3TU7H 4I7YH 1K9OE 1AKSB 4ABFA 3TH4H 1O2JA 4CRFA 5HIYA 5GXPA 1BHXB 4JCNA 4MG3A 3VB6A 5HYOA 2QF3A 1ZTKA 3RMLH 2ZFTA 2BY7X 3BV9B 1EAIA 2FODA 1S85A 4WXVA 2HLCA 3KIDU 1YPEH 3UWIA 5AF9H 1S84A 1O2UA 3DFLA 2IN2A 2Z94A 5C1YA 1W3CA 1Z71A 1O31A 2Y81A 3HGNA 3ZZCA 4D9RA 2QE7D 1HCGA 1THPB 3TLOA 4I33A 1BITA 4X6OA 3K2UA 4YOJA 1HAPH 5EXMA 4CREA 4KKDA 2LNCA 2ULLA 1VR1H 2Q6FA 2FIRH 1TPPA 2EC9H 3M35A 2H1UA 5DK1A 1THRH 4M7GA 1MQ6A 4BAOB 1LHFH 3D49H 4GPGA 1RGQA 3KQCA 5ETXA 1FMGA 3LGUA 2FS8A 1MBMA 3SYJA 4HGCA 5C17A 1NU7B 2WPHS 2XTTB 1KDQA 4F4OC 3ZZ9A 1XVOA 1SB1H 1S82A 4CR5A 2A2QH 2C90B 2SFAA 1V2TT 1EPTB 1P10A 1EUFA 1C2FA 1Y5AT 2C8WB 4GSOA 1TALA 2FTMA 2SGFE 3BG4B 4NIYA 4BANB 2JKHA 1RRKA 3RM2H 1CVWH 2JJ1D 4X6NA 2KCPA 1F5KU 1E37B 2J34A 4BAKB 1EP6A 4XBCA 2BY5X 3M7TA 1CE5A 4BTTB 2ZPRA 1K1PA 5L2YH 1V2ST 5EODA 3SV2H 2F83A 2J98B 2YOLA 4FUFA 4YT6H 1OHHD 5F8XA 3SUEA 3BEUA 1LKAA 2BOKA 2ZDMA 3GCTG 2PW8H 4I8KA 5DPAA 1NS3A 3TK5A 5J4SA 3DT0H 1HAVA 1Z1JA 2Y6TA 1AE5A 2GT8A 2ZHFH 2PP6A 2R2MB 2Z3EA 3V3MA 1OWKA 4XD7D 1UK4A 2FESH 1HIAA 2ZECA 4RSPA 4AFUA 3LU9B 1D6WA 3RMNH 5SGAE 1C4Y2 1CA0B 1ELGA 2G8TA 1UCYE 2C8XB 1SLVB 4X1QU 3IITA 4BAQB 3OTJE 2FMJA 4KTCA 4IN1A 2ZI2H 3RXUA 3ZZAA 2JIZD 3LJOA 5BPEA 1OS8A 1XUGA 4MNVA 1CU1A 1ZGIA 5TJXA 2SGQE 3RP2A 2BMGB 1LVMA 4THNH 2NU4E 1T4UH 2G4UA 2XCFA 3K65B 1VITG 3WWFA 3PTBA 1K22H 1BCUH 3BIVH 1ZMLA 1TPOA 3A85A 3MH7A 1ZPCA 4IC6A 1GL0E 1P2KA 1O2YA 4DOQA 1P03A 5I46H 1IOEA 5GNDA 1DPOA 2GDEH 2HOBA 1FY4A 4AFZA 2W3IA 1C2JA 1XUKA 3SNDA 1BMFD 2UUJB 5CHAB 1Z6EA 3PMBB 3M5LA 1LVOA 3N7OA 5C1XA 1KDQB 4U01A 1YM0A 2FPZA 3WY8A 1ZYOA 2Z3CA 4WMEA 4Q2KA 4Q7XA 2QXIA 3SBKA 2HNTE 1SOZA 1E79D 1WDIA 1BTYA 5TCCA 3CENA 1HB0B 1CGIE 3MU8A 2SNVA 4XRNA 3GCTF 1AFQC 2GCTC 4K69A 1O2PA 1P06A 2NU0E 2AIPA 4VGCB 1FN6A 1LMWB 1FI8A 3LPRA 1O35A 3UWJH 1C9PA 3A86A 1V6DA 2GD4B 1QY6A 1ZGVA 4E7RG 3M7QA 4JZDH 5EGMA 2LP6A 1HPGA 1HAZB 3BSQA 3GY8A 3SNCA 3A81A 2ZC9H 1XXDA 3SNAA 4ZKSU 2BY9X 2AMQA 3S69A 4OGYA 2BDBA 1PYTC 2WUCA 2OLGA 3A82A 1HIAB 2BY8X 3LGIA 4ISLA 2JDID 3A7YA 2P93A 1EQ9A 1AWHB 3SNEA 1QIXB 5GWZA 2EI8A 3TGJE 2Y82A 2CHAC 1P3EA 3SGAE 1DVAH 2ZQ2A 3VB4A 3QGNB 3VGCC 1QB9A 1DDJA 4YM9A 2QF4A 4ISOA 1SBWA 2JETC 1TWXB 3MI4A 3EAJA 2EA3A 2RDEA 1SHYA 1C2HA 4QT8C 3RXHA 3S9CA 2VWOA 5C1UA 1ACBE 1YCPK 4YTAA 1BQYA 1W0ZU 2ZG0H 1O2HA 1DWDH 4BXSA 1HYLA 4J2YB 1LHCH 5JBCS 5DP3A 1GG6C 2ZTZA 1QB6A 2GCHG 3A8CA 1GI5A 3U8TH 1H8DH 1GBEA 1SFIA 2GP9B 4R8TB 3TK9A 2ZGXH 1Q31A 2AEIH 3FP6E 1F5LA 3FAOA 3SI4H 2GGVB 2YMSB 1MKWH 1QZ8A 2ANMH 1PPEE 1WXRA 2BVXH 2VIOA 1GI4A 4A6LA 1C1PA 1ELBA 1MMJN 2SGEE 1SG8B 2ALVA 1AZZA 4FU9A 5J4QA 2BOHB 2AH4X 1SQOA 3MNBA 3LJJA 1TOCB 2FOCA 3A84A 3LOXA 4RKJB 1LHDH 3EE7A 2GZ7A 2BLQA 4KP0A 2J5UA 1YC0A 4MPVA 5E0GA 5EPNA 2O9QA 2TGAA 1HJ9A 3M3SA 1XVMA 1O38A 3A8AA 3MO3A 4NA8A 4CRAA 4AZ2B 7LPRA 2J92A 3PO1B 3OSYA 1CHOG 1KY9A 2VH6A 4NZQA 1IHSH 4Z6AH 4FVBA 1UK3A 1BA8B 2SNWA 3K9XB 2XRCA 1GBAA 3URDA 3RXEA 4MPWA 2P3FH 3CS0A 1OWEA 2Z6BD 3SU3A 1C5NH 2F3CE 1GBJA 4JK6A 1D3QB 1DSTA 1G30B 1K1LA 1UVSH 2BLOA 1V2WT 2YMSD 4IMQA 3TK6A 3DFJA 3HATH 1ELAA 1B7XB 2O8LA 1P05A 4Q7ZA 3GYLB 1OWDA 5K7RA 3T5FH 4Y71A 5K0HA 1QRWA 1AY6H 3SUFA 1MTWA 3UQOA 2WSSD 5DKMA 3PLKA 1OKXA 1SR5C 1T8MA 1BRAA 4ZXYH 4WMFA 5F8ZA 5ABWA 4FUCA 2WYJA 1LPGB 2O8TA 1KXDA 2PFEA 3E6PH 2BD3A 1EB1H 3A89A 1LHGH 3RM0H 1VITH 4FU7A 2ZP0H 2GV6A 5C5NA 3BTFE 2BD4A 3LIWA 1O3BA 2R2WU 1UMAH 3RXAA 3RXIA 1F0UA 2BD8A 1JRTA 5A09A 1OX1A 3SNBA 1ELVA 1O3LA 1V2RT 2BZAA 1P2OA 2WPLS 1CHOF 3DUXH 3JZ1B 3LH1A 3TPIZ 1A7SA 1BRUP 3RXDA 4WMDA 4WY3A 1C9TA 2QF5A 2K8IA 4YOIA 3PWCA 5EJ1A 3MH4A 3RLYH 4NSVA 3BEFB 3LDXH 4NCYA 2ZO3H 4I8GA 3PV5A 2BVSH 1KTTB 2TGDA 2V6NA 1TNHA 3AW1A 2GZ9A 3Q3KA 1C5YB 1GJDB 1QURH 3FZZA 2WV9A 1SI5H 1O3MA 1AUJA 1YPLH 1TNIA 3TNTA 7GCHG 1O2XA 2P95A 3N7DA 1BB0B 1B5GH 1DITH 3L33A 2RFKC 2STBE 3H09A 1ZHPA 2BM2A 4Q4LA 4ACAA 2V0BA 3F2FA 3DA9B 4INKA 2VNTA 1P01A 3NUMA 1N6YA 4DVAU 1GBIA 1NROH 3ZVDA 6CHAB 3O8CA 1UTMA 4INLA 4XSKU 2G51A 4JMYA 4H6SB 3TH3H 4JYUH 3Q00A 2ESTE 1SSXA 2IPHA 1ESTA 1FY8E 2Y5FA 2R3UA 3L6PA 4GCHF 1QA0A 2ZZUH 5DO4H 1MUEB 3FKSD 1AHTH 4TYDA 3GY5A 1F2SE 2AS9A 1W7GH 3MOCA 1O5FH 2VVCA 5EIYA 4FETA 2FO9A 2ZWLH 4MPXA 1S5SA 4Y10E 4Y7AA 3RXFA 3MQKC 4UE7H 4AGJA 1T32A 2ZDKA 4DT4A 1ZOMA 4K1SA 1GHAF 3ATIA 1F92A 1GBCA 3SU2A 2D1JA 5L2ZH 3A8BA 3SU6A 4KTUA 1D3PB 4U30A 3P8FA 1V2MT 2PLXA 1CT2E 2PWXA 7GCHF 3KNXA 3GDUA 4AOQA 5F03A 1UTJA 1BTPA 1Z8IB 2Z9LA 4GLYA 3U8OH 1L0ZA 5DJ7A 1BT7A 1EPTC 2ANKH 3QGJA 3UFAA 4LZ1H 5AFZH 1ZRBA 1OP8A 1CGHA 3BG4C 4JZFH 2A5IA 1J9CH 3F9GA 5HGGA 1BBRE 2GJGA 4B71A 1FX0B 3H5CB 5L30H 3EE0B 4NG9H 2ZNKH 5DP4A 3SGBE 1O2SA 1W10U 2FLRH 3EA9A 2Z3DA 3GISB 4YZUA 3CS7A 3H7TA 4DJZB 1OP2A 2QYIA 3ZVCA 2WPDD 2ZCLP 1UW7A 3KCGH 1T7CA 4OS6A 2KR7A 1OP0A 2FM2A 4DIIH 4MNWA 4MVNA 6ESTA 1XX9A 1TRMA 1K1OA 1W14U 4ZUHA 3BTHE 3SJ9A 1MD8A 3UOUA 3S9AA 3TJNA 4FUEA 4RN6A 1CA0C 1PQAA 3MNSA 1ORFA 2EI7A 1HAXB 2GX4A 1SLUB 1WU1A 2G5NA 3QTOH 3KL6A 2AMPA 1AWFH 4IMZA 1DSUA 2A4RA 1QGFA 3ZIAD 4B2BA 3T62A 1Y3VA 3TIUA 1DXWA 1Z8JB 1O2RA 1IQMA 1TMBH 1GBLA 4YOGA 3TGKE 3OY6U 1C1QA 1XUHA 2AGGX 4D7GA 2ZPQA 4JZIA 1UJ1A 1MABB 2BQ6B 4D9QA 1L2EA 1MBQA 1QJ7B 2PSYA 1ELTA 1RFNA 1UCYK 1WUNH 1DICA 5A0CA 1B0FA 3NZIA 1FAKH 2BLVA 2CN0H 1AFEH 1OXGA 1XKAC 4Y11E 1GMDG 1GJBB 5T6DA 2OINA 1COWD 1YPMH 3BTTE 2HGTH 5EXNA 3U1JB 1TPSA 5CHAC 1KLTA 1D9IA 2VVVA 3PV2A 3HGPA 1IQGA 1HDTH 1MKXH 2WPKS 1JIMA 2FI3E 1GL1A 5EQSA 2OC1A 1ETTH 1F7ZA 1TA2A 1O3JA 4YLQH 3RU4E 3K6ZA 2L6OA 1Y5UT 1YPKH 1K2I1 1BUIA 1TX8A 1EFRD 1GGDB 1KXAA 2J9NA 3RC4A 3SV8A 1X7AC 1B0EA 4ACBA 1FZZA 3AAUA 1O2OA 3LKWA 3S7KB 5ESTE 1KTSB 2PKAA 3BTME 3UOPA 2H6MA 3KQDA 1G3CA 1N8OB 3RXPA 2ZU5A 1YPHE 1O3KA 5CDFE 3NWUA 3MU5A 3EQ0H 3F6UH 1O3AA 1YLNA 4X8SH 2C93B 3GCHB 3ZZ3A 2Y5HA 2P8OB 1FIZA 1C5PA 2A5KA 2BZ6H 4E05H 1DANH 4ZAEA 2KFWA 1C5MD 1LQDB 5T1VA 3ZVFA 1TX6A 5LPRA 2VIVA 3ZVGA 1GVKB 2TGPZ 2PGBB 1SGCA 2ZHQH 3GCNA 4AC9A 1C4V2 3OYPA 4A1XA 1PFXC 1GMDF 2XBXA 4BTIB 1SLWB 3A80A 2FLBH 2ZHEH 5FL7D 4F49A 4Y8YA 3SQEE 2BDYA 5JBBS 1GBTA 3P95A 3FP7E 1O5GH 3VPKA 1C1RA 2OP9A 1K21H 2XYAA 1SGEE 4A1VA 1ESAA 1BHXF 1W7XH 2YNBA 1AUTC 5LPFA 5AFYH 1DY9A 1G2MA 4MDSA 4NIVA 1WCZA 3KYGA 1KXBA 3PWBA 1VCPA 3UNRA 4ISIH 3NXPA 2UWLA 1UVUH 3E0NB 1C5UA 3VXEH 3M61U 3UNSA 1GHVH 1ZMJA 4K1TA 1EJMA 2QF0A 3Q3YA 3ZVAA 2YMSC 2BQ7B 2C3SA 1P3CA 1A4WH 1AVXA 3F68H 4D8NA 3ATLA 3VB5A 1P2QA 1C1UH 1GI6A 3DSPA 1WAYB 1HAIH 3T25A 2RCEA 5DGJA 1VGCB 3GCOA 1EOLA 1EZSC 1GJ9B 1IAUA 1L4DA 1NY22 3I77A 2PKAB 3A87A 1MZAA 4NA9H 1Z7KA 4Z1MD 1BIOA 1HXFH 4B2CA 1AD8H 2ODYB 2GDDA 3BTGE 3MU1A 3PO1C 2C8YB 1C4U2 1A5HA 2ZU4A 3M3TA 3AW0A 5H4IB 2QCYA 4LZ4B 1F0TA 2FDAA 1FXYA 2NU3E 1XMNB 2ZFSA 1C2KA 1OOKB 1WV7H 3SU5A 4DT7B 1ZSLA 5KEDA 2DE8A 3TVJB 1TNKA 1TYNA 3M37A 1QRZA 3E90B 1SLXB 1GJAB 1JXPA 1GI2A 1CQQA 1L4ZA 1P9UA 2R9PA 1DOJA 1AMHA 4OS2A 3RDZA 4AB8A 1CT4E 3U28C 3LGVA 2ZFRH 1ANCA 4YESB 1HRTH 1MQ5A 1LVBA 3FFGA 1H9HE 3NK8A 2ODQA 2CK3D 1Y3YA 1C1WH 1DX5M 8GCHG 1F0RA 4INHA 2GZ8A 2C8ZB 4ABHA 3KQ5A 4B76A 1W0JD 1C5XB 2ZCHP 5AHGH 1O2TA 1ZTJA 2H9EH 3FZDA 2KAIA 4ESTE 1K28D 2V35A 4WXIA 1NTPA 1ABJH 1BMMH 3ODFA 1NZQH 1MTNB 1PPGE 2HVYB 1O2QA 1BDAA 3QK1A 1INCA 1BTHH 2J2UA 4R0IA 4UONA 1D3TB 2UWPA 1WTHD 3KF2A 4ZKRU 1HBTH 3HKIB 4X6PA 3PRDA 2ZFFH 4U2WA 5DP8A 3SJIA 3U69H 3ZZ4A 1L1GA 1L1JA 4B74A 2SGPE 1IHTH 5A8YA 3E1XB 3DD2H 1C5WB 1A5IA 1LPZB 1IQKA 3O8DA 3ZYEA 1T8LA 3Q3XA 4UFFH 4K60A 2H9HA 5GJ4B 2G4TA 1AQ7A 1YWUA 1RIWB 4I32A 3A7ZA 2JH0D 4MNYA 1EOJA 4AFSA 1O32A 4ZKNU 1AB9B 1EB2A 4Q63A 2ZGHA 3RXOA 3SU1A 2WHXA 2WUBA 2Y7XA 1KSNA 1S0RA 1GDUA 4X1RU 5E0JA 2VINA 4I8LA 4YT7H 1DFPA 1E1QD 3P17H 1C1TA 2HNTC 2VIDA 4BAHB 4BXWA 1AI8H 1DT2A 1MD7A 1HAVB 4XFQA 3ZVBA 1NFUA 1P2MA 1WOFA 3PROA 5A8XA 1GHBF 1AU8A 1UTQA 8GCHF 1JWTA 1K1NA 5EJLA 5G4BA 4TPIZ 2LELA 2PSXA 3FVFB 4ABIA 2A1DB 2CGAA 2A4OA 3D62A 1DM4B 1YF4A 2F4LA 3PRBA 3F2GA 6CHAC 1SQRA 4WVPE 3U9AH 2UUFB 3GS9A 2OK5A 1ZMNA 1FQ3A 4KGAA 1QFKH 1EJNA 3RXRA 1PPFE 1YPJH 3VFEA 2KZ4A 3PLPA 1SHHB 1BMLA 2BQWB 3FO8D 1QJ6B 2CJIA 2ALPA 5FX6A 3MO6A 2KAIB 3EGKH 3P6ZB 4J1YA 2JH5D 1HAYB 1H1BA 3EDXB 3ZZ5A 1O2NA 1HAHH 2SGDE 4HZHA 3ODDA 5CMXH 1NPMA 1ZLRA 2F9OA 2STAE 1ARCA 1O2VA 4KELA 2P3TB 4AB9A 5JYIA 3GY4A 4NFFA 4CR9A 4TPYA 3TITA 3RU4D 4CRGA 1G3DA 2FOHA 2A7JA 1EJAA 1C2IA 2VVUA 2C4FH 2F9BH 5C2ZA 1J14A 3PYHA 1BBRH 1TABE 2CF8H 1TBRH 2AYWA 5JBTA 1TMTH 1SMFE 1A0JA 5EU8A 1LKBA 2OTVA 2NU2E 1O2KA 2BYAX 1Z1IA 1EKBB 3VB3A 1QQUA 5C67A 1P2IA 1OWIA 5BRRE 1YLCA 1VKYA 1NO9H 4XBBA 3SJ8A 1KXEA 4AG2A 3MU0A 1TGCA 1MKWK 2BDGA 2WZQA 1UTPA 2GT7A 2VWNA 1ETRH 2TGTA 4H42U 1O2WA 1O36A 2GV7A 4FUBA 1GI1A 2ANYA 2ZHWH 4X2WA 2XW9A 5T3HA 2Y7ZA 1XKBC 2A31A 2HRVA 2B8OH 5IK2D 1VCQA 2GKVE 1BBRK 3GICB 4TY6A 2TBSA 4X2VA 2XOKD 3LT3A 3BTQE 3L3TA 1UHBA 1Y5BT 1CGJE 2GTBA 2Y80A 4K2YA 3RXGA 2BHGA 1HNEE 2B7DH 2BDHA 3FANA 2ZU3A 1RJXB 2G52A 2LPRA 1ELDE 3O8RA
chains in the Genus database with same CATH topology
4ABJA 3MYWA 1L1NA 4Y8XA 1O5AB 1NRPH 4OS1A 3NKKA 3SQHE 1SGQE 1O3DA 4NA7A 2FTLE 5DP6A 3RMMH 1E38B 1GJ5H 4FXGH 1K1MA 3LH3A 2ZDLA 4SGBE 3SORA 4JYVH 4ABGA 2ZIQH 3BTWE 1W2KH 2ZCKP 1ID5H 1RXPA 4GCHG 1ANDA 3F9FA 3QN7A 5EW1H 4ABDA 9ESTA 3NPSA 4O03A 1GHXH 2QXJA 1H8IH 3EA7A 2XWAA 1HV7A 1W8BH 1ZR0A 3KN2A 5E8EH 1TOMH 1PQ8A 1ZJKA 3VB7A 4Y8ZA 3BIUH 1TQ7B 1RTLA 1LO6A 1C1SA 1GHAG 2VIQA 2XBYA 4AGKA 1GGDC 3MTYA 1HFDA 1E35B 1GBBA 3SU0A 3RC6A 3UIRA 8KME2 2FYQA 3MMGA 1Y3UA 1UVOA 4AG1A 1T8NA 3BG8A 2UUKB 1OWHA 5A0BA 1LTOA 1NRQH 2HWLB 1N8OC 4UFEH 1SGTA 5IDKA 5FXLA 1HJAC 2F91A 1DE7H 1S0QA 3MO9A 1WYKA 1IQIA 1GMHG 1NRSH 4NZLA 1FPHH 5FBIA 3GCHC 5PTPA 5IYTA 1S83A 1P2JA 2P8OC 2VGCC 5LGOA 4TWWA 1G36A 3B8JA 1EAXA 2BLWA 5A8ZA 3STJA 2QY0B 1BRCE 1UHBB 2ZTXA 2VWMA 1DWCH 1AVGH 1T8OA 1ELCA 3UR6A 1K1JA 5E2PA 1MZDA 1TRNA 3RXMA 4CHAB 1YYY1 2V3OH 2HNTF 1MTVA 1FPCH 3SU4A 2FOBA 2D26C 1O5CB 1S6HA 1HAOH 2W7UA 3ZYDA 4I8JA 2BTCE 2FEQH 1XM1A 4IBLH 2GVFA 1EZXC 1HLTH 3A7XA 1FAXA 4O3UA 3BTEE 4IGDA 1JMOH 1P9SA 1AE8H 2AFQB 2THFB 1GBFA 2A5AA 1Q2WA 6GCHG 2CXVA 1XUFA 2BB4A 4MTBA 1ZSKA 1NU9A 3FP8E 4JZEH 4NFEA 1C1VH 1LCYA 3AASA 2XCNA 1O3GA 2NWNA 2K1QA 3M5NA 6LPRA 1GI7B 1V2LT 1BTZA 2DE9A 2FOEA 3SV9A 4X1NU 1GBHA 1QNJA 4OGXA 1GMHF 4ASHA 1PYTD 1DWEH 2F9VA 5A2MH 4X8VH 4IW4E 2QV1A 3A8DA 1VGCC 5DP9A 4CRCA 1A46H 3I78A 1JOUB 5FCRA 4BNRA 1VZQH 2OC7A 1QL8A 2VU8E 3D23A 1GCTB 1OPHB 1FY3A 4K8YA 1A0LA 1NFWA 3ZZ6A 1SGFG 1YP9A 2FXRA 4CH2B 4ZHMU 2IJOB 2HPQH 4NWLA 3U1IB 3SI3H 1DLEA 5T6FA 4E7NA 1FN8A 4ZKOU 4PROA 4O9VA 2J95A 4AORA 4K5ZA 1GMCF 1LQEA 1O3FA 2W7SA 2Z9JA 2P3UB 5FAHA 4DURA 1AGJA 1GWAA 2CMYA 4ZHAA 1CSOE 2QGRA 3E91A 1UK2A 2FZZA 4I8HA 4X1SU 6GCHF 1QB1A 3RXBA 1TA6A 3S9BA 2WINI 1LHEH 1ZTLA 2BD2A 1P04A 1YBWA 2A7CA 1GBKA 1C5OH 4MLFB 1O2ZA 3V0XA 3F9EA 2BVRH 3M7UA 2O8WA 4ABEA 1GHWH 4Y7BA 2M5TA 1MTNC 1VCWA 1EXFA 1GJCB 5L6NH 1G3EA 1SVPA 1EATA 2PTCE 1NESE 2H5CA 3GOVB 1Y8TA 1UTNA 1MTUA 2XC0A 3GYMA 4JZ1A 4NIWA 1KIGH 2VJ1A 1YPGH 1FJSA 1OYQA 1G32B 3SV7A 1O5BB 1W0YH 3M5OA 5C5OA 1EP5A 1J8AA 2W26A 1DS2E 2IOTA 2GMTC 4WF8A 2B0FA 3QWCH 1RIWC 1SOTA 3A7TA 3T27A 1LVYA 1HGTH 4E06H 3UQVA 1AB9C 4U32A 2RG3A 3V7TA 1EPTA 2AMDA 1G2LA 2BXUH 1TMUH 2TRMA 1ABIH 2CF9H 4WH6A 2ASUB 1BJUA 1ZHMA 1HJAB 4FUJA 1O3EA 3UPEA 2HVXA 1MKXK 3GY3A 4KTSA 2VGCB 3BN9A 3PMHB 1IQHA 1MAXA 4X6MA 1P12E 2B9LA 2WV4A 1UVTH 3HK3B 5EQQA 4UFGH 3G01A 1FONA 1BTWA 1NRRH 1CO7E 1YGCH 4ZH8A 5FPYA 2VB0A 5CE1A 4GUXA 1GHZA 4BAMB 3EYDA 1THSH 1YPHC 4DGJA 1NFYA 5GDSH 1EAUA 2Z9GA 1O3IA 1ELEE 1F5RA 3CP7A 1WTGH 1V2UT 1NC6A 1GJ8B 1ANBA 5F6MA 1PPCE 4GHQA 5FPSA 2J4IA 2I6SA 1O34A 4FUHA 1PPZA 3HPTB 4SGAE 2BDIA 3C1KA 4AX9H 4MNXA 4I31A 4AYVB 3SOSA 3RLWH 1QBVH 1XUIA 3LC5A 1SGNE 4ZMAH 2Z9IA 1ESBA 3ATKA 3W95A 4GAWA 1XXFA 3PMAB 4LXBH 1GCDA 3TJVA 3I29A 3E0PB 1O33A 3GY6A 2OBOA 1RTFB 1Z6JH 1NM6A 5T6GA 4BTUB 1G9IE 1O5DH 4OS4A 2R0LA 2ZFQH 1QTFA 4UEHH 1A0HB 2A2XH 2BXTH 1H9LB 1GI9B 1O3HA 1O3NA 1F0SA 1V2KT 1PJPA 2W3KA 1O5EH 2Q6DA 4Q80A 1WBGB 4NWKA 4A1TA 2QA9E 1SGPE 1RTKA 2FOFA 2OC8A 2J94A 1CA8B 1S6FA 3T29A 1D4PB 3IWMA 2BY6X 2PTNA 1KXFA 5JDUB 1C5RA 1SQTA 3MHWU 4XE4A 3RXVA 2ANWA 1V2PT 1C5LH 1C5VA 1TIOA 1V3XA 4GHTA 1V2QT 5JPMH 5E0HA 3S0NA 2ZQ1A 1GVLA 2D8WA 1ZPBA 4UD9H 4B1TA 2A0QB 1TRYA 3A7WA 5E2OA 5GCHG 3MU4A 1QL7A 1CBWC 1KLIH 2BDCA 4WJG2 1UVPA 4CBNA 4ZHLU 2FS9A 1PQ7A 4X2YA 4B75A 1ANEA 1EX3A 1NN6A 1O2MA 1C5TA 1GHBG 2XNIA 1OYTH 1Y59T 2QN5T 2XXLA 4IS5A 1YLDA 1QR3E 3UUZA 1P8VC 1UTOA 2P16A 2AGIX 1O3CA 2V3HH 4X8TH 3SO3A 3V12A 1O2GH 2VH0A 1M9UA 1U6QA 1GI0A 2QXGA 1ZSJA 5A0AE 4NIXA 2ZKSA 2FOGA 1DLKB 3BF6H 3RXQA 5JB9S 4ABAA 5HM9A 1HAGE 1DXPA 1QL9A 2O8UA 5TCAA 1SFQB 2O8MA 3RUOA 1P0SH 3SJOA 1W13U 1MTSA 2NU1E 2RA0A 2BX4A 2A4QA 3E3TA 3D65E 1FY5A 2B5TB 3KEEA 1P11E 4CRDA 1MCVA 3LONA 4D7FA 3EA8A 1PPHE 2R3YA 1UO6A 1O30A 2BD9A 2VIPA 3PM3A 4YO9A 2GMTB 2FI5E 1OSSA 1QQ4A 2R0KA 2SGAA 4DCDA 3RXCA 1A61H 1W12U 2PKSB 2ZHDA 2ZTYA 1H9IE 1SGRE 3W94A 3TNSA 3TJOA 2A4GA 1VJ9U 1ZJDA 5GCHF 2ZEBA 1O3PB 3R0FA 2ZDNA 2G00A 3QX5H 3U8RH 3RMOH 1TB6H 1K1IA 2PGQB 3TGIE 4HTCH 4XDEA 5HM2A 1ARBA 1SL3A 3O8BA 2YNAA 4H4FA 1QHRB 4ABBA 1KXCA 3ZZDA 2F9UA 1YCPH 1T4VH 2F9NA 1GVZA 2FOAA 3P70B 4YLUA 1C1OA 1WSSH 1IQFA 1P02A 3OX7U 2OQUA 1VITF 4JK5A 3ITIA 2UWOA 3MH6A 1BJVA 3U98H 4CHAC 8LPRA 3NCLA 2RA3A 3MWIU 4X0WU 3ESTA 1BMNH 1A2CH 2BX3A 4A5TS 1GJ6A 3QTVH 4AN7A 1IQJA 3A88A 3M3VA 4CRBA 1TAWA 2PV9B 4XOJA 1JIRA 4Y0YE 1TBZH 4DG4A 2G55A 2FP7B 1IQNA 3ZZ8A 1AN1E 1FUJA 2ZU2A 3GDSA 2EI6A 1E34B 2Z9KA 3MH5A 2H2ZA 2I6QA 3GDVA 3R3GB 3MNCA 1WQSA 4Y76A 3RU4T 1QA7A 3P8OA 1LPKB 7ESTE 3GY2A 5EXLA 3KHVA 3SJKA 1GDQA 1GDNA 2WPIS 4Z0KA 1J15A 1CT0E 1HJ8A 3LGTA 5LH8A 2CV3A 1A5GH 2J38A 1FIWA 4D76A 1GCTC 2W5EA 1EAWA 4K8BA 1QCPA 1MAYA 3OU0A 1V2JT 3RXLA 1C2LA 1SGIB 3VEQB 1MCTA 5EG4A 1CBWB 3E8LA 2FWWA 1J17T 1P57B 3UREA 1TQ0B 3MNXA 1BOQA 3A7VA 4CBOA 2HALA 1W11U 1O2IA 1SPJA 1FV9A 1A3EH 2D2DA 1BTUA 4DY7B 3BTDE 1GI3A 2ZU1A 1N6XA 2OQ5A 1BRBE 9LPRA 2QAAA 2QC2A 1GJ4H 1D3DB 3F9HA 1P09A 2BDAA 4FVDA 3B23B 4O97A 4A92A 2AERH 4IN2A 4B73A 4B2AA 3P8GA 2GCHF 1C5QA 1UTLM 3RXJA 3SW2B 2RDLA 1BTXA 3LGYA 3PTNA 4FUIA 1C5SA 3E16B 4O3TA 2BD5A 1LDTT 2PUQH 3ATMA 5FX5A 2ZPSA 4OS5A 1MH0A 1HUTH 3IG6B 3UR9A 5DP5A 3K6YA 1TNJA 5DG6A 5FBEA 1TE0A 5B6OA 4ZROA 2WYGA 1Z8GA 1H4WA 1PPBH 1QJ1B 1IQLA 4FU8A 3P92A 1MU6B 1TNLA 4X2XA 2FX4A 2Z7FE 3ENSB 1TGTA 2G81E 4XBDA 3T26A 3SZNA 4MQAA 2TIOA 1WQVH 1AFQB 1NFXA 2GCTB 5FCKA 5I25A 4K1EA 2UUYA 1Q3XA 5ESBA 3SHAH 1GJ7B 3C27B 2OC0A 8ESTE 4H6TA 5F8TA 3PMJA 3KGPA 3KQEA 4WWYA 3M5MA 3RXSA 1KLJH 1G3BA 1RD3B 1BMAA 1TX7A 1GBMA 3RXKA 2XBWA 2P94A 2H5DA 3TJUA 4GVUA 1C2DA 2P59A 2ILNA 4JYTA 4X1PU 5FHTA 3LC3A 5GPIB 1XUJA 3ATWA 1VJAU 4ZXXH 3KQBA 2ZGBH 3MFJA 1ETSH 3B9FH 5DP7A 2VIWA 2CHAB 3SHCH 5EW2H 5HXFA 1ZPZA 1Y3WA 3VGCB 3STIA 3AVZA 1GMCG 3DHKH 4K3JA 2JETB 1FDPA 1V2NT 5LPEA 2ZA5A 2XC4A 3JZ2B 2A7HA 4UFDH 3AAVA 4FUDA 3QZQA 2BD7A 4Y0ZE 3RXTA 1CHGA 3ZZ7A 1E0FD 2OUAA 3V13A 1SGFA 3ZZBA 1J16A 2VWLA 2H9TH 2XWBI 1NRNH 4OS7A 1GG6B 2FYRA 3ZVEA 1SC8U 1OWJA 4ISNA 1GPZA 3ZV8A 1TGNA 1SGDE 1EASA 2PR3A 2WPMS 1O3OA 2JH6D 3SV6A 1C1MA 3PV4A 3SUDA 1TLDA 2PHBA 1SQAA 1RS0A 3QLPH 2ZF0H 5EPYA 3BTKE 4AFQA 4NGAH 5C3NA 1O39A 1D6RA 4Y79A 3QZRA 5FPTA 2WV5A 4WH8A 5EOKA 2F9PA 1TNGA 5C20A 4UDWH 1TGBA 3RC5A 1JBUH 1EZUC 2ZDAH 2OCVB 1A3BH 1QBOA 5JBAS 1PQ5A 3T28A 4ISHH 5HMAA 1UTKA 1C5ZB 2Q6GA 2AGEX 3SGQE 4IC5A 2OBQA 1QBNA 1ZZZA 3GY7A 3F1SB 3Q76A 1NT1A 1FY1A 2WPJS 5AVDA 1YCPM 1AKSA 4FUGA 5GIBA 3QO6A 2HPPH 1HXEH 1UCYH 1KYNA 3PB1E 3VXFH 1Y3XA 2OD3B 3SUGA 1AIXH 2ODPA 1GBDA 1BZXE 1ZRKA 2XBVA 1GHYH 2A45B 4HI3A 2QXHA 4Q7YA 1AO5A 2EEKA 1ZHRA 3SN8A 1C1NA 4MPUA 2FOMB 1IQEA 4AYYB 3BEIB 3HKJB 1TPAE 1V2OT 3S7HB 2G5VA 1DUAA 2A32A 3T2NA 4RKOB 1ELFA 1FLEE 3OY5U 4CH8B 2TPIZ 3ELAH 1TBQH 3LGWA 2ZGJA 1DY8A 1JRSA 4NSYA 4DW2U 4LOYH 2DUCA 4TY7A 1E36B 5EQRA 1TONA 1AZ8A 3PLBA 4TWYA 4X8UH 5JB8S 1EZQA 1AVWA 2PUXB 1A1RA 3M36A 1GI8B 1C2EA 1O37A 2ZGCA 1YKTA 2FI4E 1DUEA 3H7OA 3UNQA 3UY9A 1G37A 2PKSC 2QIQA 2Q1JA 1MU8B 1C2GA 1T31A 3TH2H 2FX6A 4Y6DA 3URCA 1P2NA 3P8NA 2AIQA 2OXSA 1O2LA 4HFPB 4BOHA 3A83A 4LK4A 1S81A 4DIHH 4A7IB 1FNIA 2Y5GA 4VGCC 1QRXA 2XC5A 2ZFPH 1SGYE 2ZDVH 1TGSZ 1Z8RA 3UTUH 3HK6B 3QDZB 1TFXA 1C2MA 1N1LA 1V2VT 1DWBH 3Q77A 3QUMP 3ZV9A 7KMEH 1O0DH 3TU7H 4I7YH 1K9OE 1AKSB 4ABFA 3TH4H 1O2JA 4CRFA 5GXPA 1BHXB 4JCNA 4MG3A 3VB6A 5HYOA 2QF3A 1ZTKA 3RMLH 2ZFTA 2BY7X 3BV9B 1EAIA 2FODA 1S85A 4WXVA 2HLCA 3KIDU 1YPEH 3UWIA 5AF9H 1S84A 1O2UA 3DFLA 2IN2A 2Z94A 5C1YA 1W3CA 1Z71A 1O31A 2Y81A 3HGNA 3ZZCA 4D9RA 1HCGA 1THPB 3TLOA 4I33A 1BITA 4X6OA 3K2UA 4YOJA 1HAPH 5EXMA 4CREA 4KKDA 2LNCA 2ULLA 1VR1H 2Q6FA 2FIRH 1TPPA 2EC9H 3M35A 2H1UA 5DK1A 1THRH 4M7GA 1MQ6A 4BAOB 1LHFH 3D49H 4GPGA 1RGQA 3KQCA 5ETXA 1FMGA 3LGUA 2FS8A 1MBMA 4HGCA 1NU7B 2WPHS 2XTTB 1KDQA 4F4OC 3ZZ9A 1XVOA 1SB1H 1S82A 4CR5A 2A2QH 2C90B 2SFAA 1V2TT 1EPTB 1P10A 1EUFA 1C2FA 1Y5AT 2C8WB 4GSOA 1TALA 2FTMA 2SGFE 3BG4B 4NIYA 4BANB 2JKHA 1RRKA 3RM2H