1O2IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA02
1C1OA 4B76A 2UWOA 2C90B 3EGKH 1EZXC 2NU4E 3SNEA 1QB1A 1QRXA 2OQ5A 2VIWA 2FODA 2QXHA 3U69H 2AGGX 1FZZA 3ZZDA 1Z6EA 5FPYA 4ZHMU 5HGGA 1L4ZA 2FTLE 3D65E 3VB5A 5EW1H 1RS0A 2GD4B 5F8TA 4ISLA 4X6PA 1QJ7B 3HPTB 5GJ4B 4Y0YE 3SUDA 5LPEA 1D6WA 2A45B 2TGAA 2QA9E 4Z0KA 1SHYA 1GI1A 1OP8A 1JMOH 1C5WB 3HK6B 1GHBG 4AYYB 4E05H 6ESTA 3RXFA 1TA2A 1UCYH 1WSSH 1C5OH 1MCTA 1DY9A 1TOMH 1KSNA 2ZU2A 2G51A 2XC4A 1UTLM 1LTOA 2WUBA 1J16A 1C5UA 4BANB 2ZWLH 2GP9B 3F9HA 2PSXA 4MLFB 1K21H 2BLQA 4NSVA 2QF0A 1P10A 5DP8A 1KTSB 3OSYA 4X8VH 3ODFA 1AB9C 2D2DA 1J14A 3M3SA 3L3TA 4MNXA 1C2FA 1ELCA 1TNKA 3SNDA 5L6NH 2QN5T 1O39A 2WYGA 4JK6A 2H9TH 1ZPZA 1QQUA 1LCYA 1PQ7A 1KLTA 2Z9LA 1HAXB 2XCFA 3U9AH 4DW2U 3LH1A 2Y81A 2F91A 3SQHE 1YPLH 4AZ2B 1C1TA 1EJAA 2OTVA 2J2UA 2EC9H 2ODQA 5BRRE 7KMEH 4I8KA 1SG8B 2ZGBH 4A1XA 5C1YA 2AGEX 3ZVBA 2ZP0H 5A0BA 1TBRH 3BG4C 1HYLA 1T8OA 1NZQH 5ABWA 2UUJB 2OC7A 1A5IA 1AY6H 2P93A 1DPOA 1SC8U 2WUCA 1YGCH 1NU7B 5GPIB 3KQCA 2CF9H 1OWHA 1TNIA 2XYAA 1RTKA 1C1NA 2KAIA 2A2QH 2V3HH 3RM2H 1MAYA 1A46H 4J1YA 3AAUA 2FOGA 1V2JT 4A5TS 3LGWA 1ZTLA 3TH2H 3BTGE 3PTBA 4IMZA 1F5KU 1OKXA 1GG6C 2Z7FE 1T8NA 1TBZH 1BBRE 3SU1A 1P2MA 2H6MA 3BTQE 3ZZ7A 2P3FH 3BTWE 3Q76A 1HJAB 1WAYB 1MTNC 3RXPA 4YM9A 3KIDU 3RXKA 2VIQA 1MU8B 1QGFA 1SBWA 1AMHA 1KXDA 1GHBF 3MFJA 3QO6A 4FVDA 3QGJA 2VU8E 1L0ZA 4KKDA 2PGQB 1TAWA 3SI4H 1NROH 5K0HA 1FY3A 1NC6A 1TGSZ 1EQ9A 1EZUC 1L4DA 4CBNA 4UFDH 4IC5A 1LKAA 3RXJA 3MH7A 2PW8H 1GVLA 1V6DA 5BPEA 1WQVH 2HOBA 1QJ6B 3RXVA 1L1NA 3TH4H 3HATH 5A8XA 4DGJA 1IOEA 3TJVA 1EPTB 1QCPA 3PMBB 4GPGA 1V2QT 2ZCHP 2QC2A 1FUJA 2SGAA 4AG2A 2G00A 2BZ6H 1OS8A 1LQEA 4JZIA 5DG6A 1O2QA 1T7CA 2ZCKP 3A7WA 1W12U 3RXDA 3AW1A 1HAPH 1D6RA 1YKTA 4ISNA 1V2RT 1YLCA 2ZHQH 1LVBA 1C5YB 5LPRA 1WTHD 1LHFH 1O3HA 2WPLS 1QBOA 1C2LA 3UQVA 1THRH 1UVUH 1QR3E 1V3XA 2VGCB 3I77A 1QL8A 3QUMP 4Y8XA 2BQ6B 3SU0A 1TMTH 4OS5A 1TALA 1OWDA 2XW9A 1GJ9B 3IG6B 4NA9H 2ZDMA 1AQ7A 3A8AA 4U32A 2Z6BD 1F7ZA 1V2PT 2B9LA 1OP2A 2G5VA 5DO4H 5E2OA 2PSYA 1TIOA 5FAHA 1H4WA 2ZGHA 1FDPA 1G9IE 5E0GA 1SGYE 1FLEE 1FN8A 2A5KA 2ANMH 1EATA 4AX9H 4GSOA 1O5GH 3MYWA 4IS5A 2QXJA 3B9FH 2FI4E 4Q7XA 4CR9A 1NTPA 5JBAS 3TH3H 2QAAA 3GDUA 3SO3A 2FLRH 2FIRH 1BTPA 4FU9A 2EI8A 1LDTT 2FOBA 4NIVA 1BTHH 1GBMA 1CA0C 1GHWH 1CGJE 2BDHA 3EA8A 2HWLB 5DP6A 3F9EA 2NU1E 1ESBA 1W10U 4AFUA 3LPRA 3GOVB 2TBSA 5FCRA 2OUAA 2XWBI 3DA9B 2Z9JA 2V0BA 4ZUHA 2O8TA 1HAVB 1B0FA 4D76A 1OPHB 2ZPSA 4X6MA 2OBQA 2WV5A 1SMFE 1MTSA 1UMAH 5B6OA 3NPSA 1BTUA 2P3TB 3FAOA 2ZG0H 1W11U 1DANH 2P59A 1NS3A 4I8LA 1XXDA 1GBFA 1FNIA 1GMDG 4XBBA 1V2OT 4O97A 1AO5A 1O2NA 1VCPA 3SNCA 1OWKA 1AWHB 1S85A 2FX6A 4MVNA 2BD8A 2G52A 4I8JA 4FUDA 2VB0A 3FFGA 3KQDA 4DY7B 1LMWB 5LH8A 2ZQ1A 3ZZCA 4UE7H 2O9QA 4GUXA 2QCYA 1O2TA 1IQNA 1MKWH 4ISIH 2FS8A 4TYDA 3RXUA 3T28A 3EA7A 4I7YH 1GBDA 7GCHG 2GT8A 2OP9A 1BIOA 1EJMA 3UNQA 2P94A 2R0KA 3U1JB 4X6NA 2YOLA 1SGIB 4A1VA 1C2HA 3C27B 3DUXH 5J4QA 3QZQA 1UCYE 2VVUA 1GI6A 2R0LA 2GZ8A 3PV4A 4NZQA 5F8XA 3PLKA 5C3NA 1GI7B 2R3YA 3SJOA 1GDNA 1IQEA 2BZAA 1C4U2 1TB6H 1HUTH 2IN2A 5EQSA 1GGDC 1A4WH 3D62A 1G3BA 1O3LA 2I6SA 4XDEA 2F9VA 1E35B 1KXFA 2RA3A 1YPMH 2BDCA 1B5GH 1E37B 1CSOE 1GWAA 2BDYA 1F0RA 2F9OA 1AZZA 1C1VH 1V2ST 4X2XA 3ZZ6A 2QIQA 1QNJA 2PKAA 1BTXA 3SV8A 2ZFTA 1TGTA 3FP6E 3T29A 5FXLA 4K60A 4DIIH 3CS0A 1MMJN 4BAKB 3QLPH 1QHRB 2OLGA 1CBWC 4X1RU 5F8ZA 3A84A 1QL9A 1ZRBA 1H9HE 1SQOA 4AG1A 1BTZA 2BLWA 2FZZA 1TGCA 1Q2WA 1LHGH 1AVWA 2XXLA 1THPB 3ENSB 1Z8JB 4HGCA 1C5RA 1Y3XA 3RXCA 1O3MA 1FY8E 3A83A 1IQHA 3RC4A 1KXEA 1GJAB 2OC8A 1AN1E 3IWMA 3RXRA 1C5NH 4IN1A 1CU1A 4B2BA 1L1JA 5DP5A 1BTWA 1UHBA 1GMDF 1BBRK 1VITH 3OU0A 4H42U 1W8BH 3PMJA 4Y76A 4XBDA 1O3PB 1O2RA 2EEKA 1ZLRA 4WJG2 4Y79A 1GBLA 1UVSH 4ABDA 1TPPA 1C5VA 3P95A 2VWLA 1NT1A 2ZHWH 3KL6A 3M5MA 4ABEA 3BTFE 2HNTC 2BD9A 2NU2E 1GCTC 4K5ZA 1O2GH 3GYLB 1C2MA 2PKSB 3HKJB 3V7TA 7GCHF 5FX5A 3QWCH 4MNVA 1FY5A 3M35A 6LPRA 5FX6A 2WYJA 3PROA 1DY8A 4AB8A 3AAVA 5E8EH 2VVVA 1L1GA 4KELA 1EAWA 4IBLH 2TGPZ 5EXNA 2OD3B 3CP7A 5H4IB 5C2ZA 1P06A 3MO9A 3TJUA 1AUTC 2BLVA 3RXLA 1TMBH 4MNYA 4DT7B 1UJ1A 3SQEE 1EP5A 1NN6A 3LDXH 4RKJB 1QFKH 5K7RA 2F9PA 4IC6A 3P8NA 1OXGA 3QTVH 3B8JA 3P6ZB 3LC5A 3S9AA 4ABJA 1MAXA 3V13A 1YCPH 1W0ZU 3BN9A 2G5NA 4ZHLU 2ZZUH 2OCVB 1G37A 1IHSH 3MNSA 2CGAA 3TLOA 2FPZA 4HZHA 4XE4A 1UTNA 1ZMJA 4FUIA 3ZZ8A 1ZRKA 2XBVA 3MU5A 4X1QU 6CHAB 5GXPA 1HAYB 3ZYEA 8LPRA 1K2I1 1P8VC 2PWXA 3FP7E 3GY3A 4QT8C 1VJAU 1IQLA 1RRKA 1XUKA 3A89A 1ACBE 4CRFA 2SGQE 3PO1B 1X7AC 1P09A 1AVXA 2BDGA 2H1UA 1FY4A 3A85A 1BJVA 8KME2 3SHAH 2ZFSA 4NA7A 4DG4A 1MTNB 1Z71A 2WPKS 3QTOH 4X1SU 4TPIZ 1OWEA 1CO7E 1TQ7B 1SGFG 2SNWA 3P70B 3UFAA 3TVJB 4U01A 2AERH 3UR6A 1GJCB 1TLDA 4R0IA 4TWWA 1SPJA 2D26C 1RTFB 1H8DH 3ATWA 5C5NA 3TIUA 1C2JA 1DM4B 3GY2A 4YOJA 5HM9A 1SGQE 4DJZB 1S81A 2V35A 1ZOMA 2C8ZB 4VGCB 2STAE 2A32A 3SW2B 1BRAA 1GVKB 4NWLA 3BEUA 3DHKH 2EA3A 3SJKA 1OOKB 3EA9A 1BMMH 4O9VA 3NZIA 1OYQA 1EX3A 1JWTA 3HKIB 1BTYA 3SBKA 2BVSH 2NU3E 1EAXA 1C2GA 4OS7A 3L6PA 1Z1IA 3VGCC 3A7TA 4LXBH 4MPVA 1YPGH 3RXOA 2C8WB 2Y6TA 4MPXA 1S84A 1YYY1 1ELEE 3H5CB 1P02A 1Y3WA 4I31A 1ZGVA 1V2NT 3U8RH 4GCHG 1TE0A 2A4RA 3P17H 2F9UA 5GDSH 4YESB 1P3CA 4JYTA 1DICA 2A5IA 1MQ6A 1O2IA 2UUKB 1BJUA 5FHTA 1YM0A 4M7GA 4YLUA 2GDEH 1UTKA 2BY5X 3TJNA 3SV9A 3PWBA 3ODDA 7ESTE 1O2XA 2XNIA 2A0QB 1O3GA 1C2IA 1C2EA 5G4BA 2FMJA 2GV6A 4NG9H 1K1LA 3R0FA 1S5SA 4B1TA 2Y5GA 1K1OA 1UCYK 1N8OB 5ETXA 1DWEH 3U98H 1HPGA 3W94A 3SI3H 1PPBH 1GHZA 3ATKA 4JCNA 3A82A 1P2JA 3MTYA 1RIWC 3BIVH 1XUIA 3DFJA 4INLA 1C9TA 1PYTD 1SGCA 1EB2A 4H6TA 1QURH 1K1JA 3NWUA 4MDSA 2ANKH 4WMEA 1FI8A 4K69A 4DURA 1DLKB 1FAKH 1DT2A 1FN6A 3TGIE 4B74A 2QV1A 3GCTG 2HLCA 4ABFA 3RM0H 1YP9A 1MUEB 4DVAU 1W0YH 1YPKH 1RFNA 1KDQA 4YT6H 2HPPH 3FZDA 4K1EA 1NFXA 1TOCB 1AE8H 2O8WA 5DK1A 4H6SB 5FCKA 3VEQB 1AKSA 2D8WA 2GGVB 3T25A 2VJ1A 3QN7A 1S6FA 2KAIB 1AU8A 4NIWA 2AIQA 3ZVDA 2FOFA 1P01A 2ZGXH 3E0PB 1ARBA 2ZU4A 1LHCH 1A0JA 2J95A 1DOJA 4LK4A 1ESAA 4ZKNU 3R3GB 4CREA 2GZ7A 3NCLA 5DP7A 1AZ8A 5CHAC 1LKBA 2O8UA 1BMLA 1GJDB 1AWFH 3Q00A 1MH0A 1GJBB 3PLPA 1BRCE 4GCHF 1ZZZA 3RXEA 2C3SA 1BA8B 1DFPA 1CVWH 1KXBA 3VXEH 3A7XA 2GCTB 3M5OA 5EGMA 1SSXA 1LVOA 1P12E 2PGBB 1PPHE 1QRZA 1CGHA 2FX4A 1O2PA 2W7SA 1TMUH 1TX7A 2P8OC 4LZ1H 1TNGA 3QZRA 1WQSA 1HV7A 1J9CH 2ODYB 3UNRA 1MKXH 1SGFA 3JZ1B 2J9NA 4OS2A 3E8LA 3GY7A 1PPCE 1OX1A 2WINI 3U8OH 4DIHH 4A92A 1TGBA 9ESTA 3KGPA 5FPTA 3EQ0H 1EASA 1M9UA 1F5LA 2ZDLA 2ZGCA 4X2WA 4K3JA 1TABE 1GMCG 2FP7B 1AI8H 1IQIA 2F3CE 4IGDA 1OSSA 2GCHG 4CRBA 2GX4A 1LHEH 3NUMA 4FUBA 4NWKA 1GBAA 1Y3UA 1NFYA 3GCHC 3K6ZA 4UFGH 4TPYA 2ZC9H 2VIDA 2IOTA 2A1DB 3ATIA 3FZZA 1MQ5A 1O5AB 4Q7ZA 1RTLA 3M37A 1TRYA 1NO9H 2HNTF 3Q77A 4KTUA 4X1PU 1QL7A 3SV7A 1O3BA 3T26A 1AUJA 3GISB 2WPIS 2A4QA 2J4IA 4ABHA 4LZ4B 3GCTF 4I8GA 3IITA 4Y10E 4ZHAA 2ALVA 3ZYDA 2ZHDA 4ZH8A 2TGTA 2BLOA 4JZEH 4CHAB 5DP4A 1BHXF 3M36A 2FLBH 4KP0A 4Y11E 3LJOA 2FESH 1H1BA 1HLTH 1SLWB 3TGKE 4Y8ZA 3SJIA 1IAUA 4SGBE 4F4OC 2G81E 1SGDE 2XWAA 1Y3VA 3A7ZA 2DUCA 2XRCA 4J2YB 4WVPE 1O5FH 2PUQH 5DP3A 5AF9H 1MBMA 1UTMA 2JETB 2GV7A 1G32B 1W13U 2GMTB 1E38B 3KQEA 5L2YH 1GVZA 3A81A 1H8IH 5GCHG 1W7GH 4UDWH 1HJ9A 2ZNKH 4OS1A 4BTIB 4CRGA 1IQMA 1MU6B 1A7SA 1P2KA 3DT0H 1UTQA 1GBKA 1AFQC 3LC3A 4YOGA 2O8LA 4FUHA 1SLUB 2O8MA 1O2UA 1BDAA 4B73A 4UEHH 2Y82A 5T6FA 1SR5C 3LGUA 4MTBA 3M5NA 2VVCA 1SLVB 2WPJS 4AFQA 3MH5A 4ZKOU 1EZSC 3F68H 2BY8X 1C5LH 3F6UH 4WWYA 3RXIA 3SNBA 3ZZ3A 3I29A 1O31A 3S7KB 3A86A 3LIWA 2BQWB 5C5OA 1VITG 2ZDNA 2FS9A 1GMCF 1O5CB 1O32A 3S9CA 2Q6FA 1MTUA 2ZFPH 4I32A 3SU5A 2W3IA 1YLDA 2GCHF 2HRVA 1J17T 3BF6H 3N7OA 1ZSKA 5EPYA 1O5EH 2OC0A 1C1SA 2QXGA 4JZFH 4UFFH 1LHDH 3VPKA 2JH6D 3Q3XA 4HFPB 4IN2A 3O8BA 3TITA 3LOXA 4NIXA 3KHVA 3UTUH 2ZQ2A 3S0NA 4INKA 1O33A 1Y5AT 3HGNA 3WY8A 2QYIA 1KLJH 2VH6A 4X1NU 2UUYA 1O38A 2CV3A 4NFEA 5DJ7A 3M7UA 1THSH 1EKBB 2OXSA 4XBCA 3RLWH 4PROA 1OWJA 1XUFA 4BOHA 1O30A 2AMPA 1MKWK 3P8FA 2UWLA 1D3QB 2ZDAH 3A7YA 4ZKSU 2BY6X 2TRMA 4X8SH 1DUAA 1F0TA 2ZU5A 2CHAC 3KQBA 4K2YA 1VGCC 1WYKA 1XVOA 4AFSA 1TPOA 3TK6A 2ZF0H 1TRMA 2RCEA 5TCCA 3MI4A 1C1MA 4AGJA 3I78A 5GCHF 3P92A 1HJ8A 5EXLA 4OGYA 2BD2A 1FPCH 1HDTH 1DWBH 3F9FA 2PKAB 3UY9A 1HCGA 2UWPA 7LPRA 1ABJH 2VIPA 1G2LA 4OS6A 3W95A 1HJAC 2AIPA 3LKWA 4BAQB 1TPSA 1T4UH 4K1TA 2A4GA 3M7TA 4O3TA 3ZZ4A 1FPHH 1ANCA 1HB0B 1PYTC 2G4TA 1BCUH 2C8YB 5LPFA 1EJNA 1DUEA 2FI5E 2ZO3H 1JIRA 1GDQA 2ANWA 1BQYA 1UTJA 1IQJA 3ZZAA 2ZDVH 3MU8A 1VITF 2Q6GA 3BV9B 3NKKA 1MD8A 1EPTC 1UHBB 3RDZA 3VB4A 4NGAH 1D4PB 3ATLA 4WY3A 1ETSH 3RU4T 1BRUP 2FOEA 3TNSA 4ABAA 1CHOG 1JRSA 3E91A 2RDLA 4FUCA 1O2YA 3ZZ5A 2DE8A 4JYVH 3URCA 4ISOA 1INCA 1PQAA 5AFYH 3T2NA 1KXAA 1QY6A 1DLEA 1TQ0B 4AORA 1Z6JH 2PTNA 1BUIA 1O2LA 4X2YA 1NPMA 2Q6DA 3S9BA 1C2KA 1VR1H 3UUZA 4E06H 1FAXA 3EE0B 3ITIA 1PFXC 1CT0E 3LGVA 4SGAE 1F5RA 5AHGH 2QXIA 2SGEE 1P04A 4ABGA 2YNAA 1BMNH 3GY8A 2PLXA 1BRBE 3TJOA 1A0HB 2GKVE 2VGCC 3SHCH 1ZJKA 1K28D 2J34A 4UD9H 1ID5H 1RIWB 1AB9B 5CE1A 3ELAH 1GDUA 3E6PH 4WH6A 2D1JA 4FVBA 4DCDA 2ZTXA 3ZVGA 4ZMAH 4XOJA 1WU1A 2B7DH 1DSTA 1KYNA 5EG4A 1LVYA 2VIOA 1NRRH 4Y7AA 1UTOA 2FDAA 4RN6A 1EP6A 4IW4E 1N1LA 2BHGA 2J38A 5JB8S 1NFUA 4A1TA 1D3PB 1ELFA 1GI3A 3STJA 2AYWA 4YOIA 1ANDA 1K1PA 2VWOA 4E7RG 2BTCE 2CF8H 3UQOA 4Q80A 3SU4A 2I6QA 3GYMA 5C1UA 1O2MA 3BG4B 2OQUA 1GJ6A 1ZJDA 1P2QA 3LH3A 2R2WU 4GAWA 2HPQH 2XBWA 2P3UB 2NU0E 2ZCLP 1NRNH 1WCZA 2CMYA 1SB1H 5HYOA 3F9GA 1O3IA 1JXPA 1DSUA 3RP2A 1YBWA 4AFZA 3GICB 1YCPK 1A3EH 2A7HA 3UNSA 2NWNA 4CRCA 1SGTA 4Q2KA 3OY6U 5EODA 3A8DA 3A80A 3FP8E 5C20A 2DE9A 1GBCA 2OBOA 1QIXB 3RU4D 1T32A 5PTPA 3H7TA 1ZR0A 2JKHA 3M61U 5HMAA 1XVMA 1A2CH 2C93B 4Z6AH 5I25A 5F6MA 1O3CA 1Y5UT 1EZQA 2ULLA 1VJ9U 1HFDA 3RXAA 1NESE 1GG6B 5A0CA 3E90B 4A7IB 1ELGA 1O2SA 2P8OB 5JBCS 5C1XA 1CHOF 4UFEH 1JOUB 1OP0A 1P9SA 2JH5D 1PPFE 1N6YA 3RMOH 1G3DA 3KN2A 4KGAA 2W3KA 1EB1H 1O2OA 3UOPA 1MZDA 1UK4A 1OWIA 3P8GA 1O2ZA 4NSYA 1AHTH 3ZV8A 3BIUH 2ZI2H 3KEEA 1O3JA 1DS2E 1YC0A 2GT7A 3PTNA 3SN8A 5EU8A 5JPMH 1UK2A 2H5CA 3LJJA 1KIGH 1ELDE 1G36A 2BB4A 1O3KA 2H9HA 3QK1A 3RXTA 3JZ2B 1FY1A 1V2TT 3LGYA 2J94A 1ZMNA 2ASUB 1E36B 1CGIE 1PPEE 2XBYA 3BTKE 3GY4A 1XKAC 1XM1A 1D3TB 4NZLA 1SQTA 5GIBA 4JZ1A 4THNH 1Y5BT 3S7HB 4BAOB 2BD4A 4TY7A 4RSPA 5E0HA 4O03A 1T8LA 1GJ7B 1IQKA 1NM6A 5DGJA 4HTCH 5AVDA 1ARCA 2ZPRA 4D7GA 5JBTA 4Y71A 4H4FA 3CENA 1A3BH 3RXMA 1XX9A 3E0NB 1LVMA 1P3EA 4BNRA 4YZUA 1P57B 4FUFA 1GBIA 2VIVA 1TBQH 1W3CA 1S6HA 4AGKA 3LU9B 2Y5HA 2Y7ZA 1QQ4A 2F9BH 2PR3A 4K1SA 3S69A 1O2JA 1VCQA 1TNJA 1S0RA 4FXGH 1C5MD 2SGFE 1UTPA 2AEIH 3HK3B 1TPAE 1UO6A 2B8OH 3KNXA 1C4V2 1DWDH 2A7JA 2EI7A 3F1SB 4YT7H 1FJSA 1AFQB 3CS7A 2ESTE 4MPUA 5EOKA 4CH2B 1XUGA 1V2MT 2W5EA 1C5SA 1HXFH 1YPHC 2FO9A 5A8YA 4DOQA 1WTGH 1SOTA 3K2UA 1ZSLA 1QBVH 1O37A 1QBNA 5EPNA 1GCDA 1W7XH 4YTAA 1UK3A 2A4OA 1TNHA 4I8HA 3MNBA 2ZGJA 2EI6A 1SQAA 1V2LT 2QGRA 4NCYA 1KDQB 1CA0B 1MD7A 5SGAE 1LPZB 1O3AA 2BMGB 4FUJA 1NRPH 3VXFH 1ZHRA 4OS4A 1AKSB 1GJ8B 1O2HA 2XTTB 2STBE 1A5GH 2PKSC 2FOHA 4ZROA 3ZV9A 4INHA 3G01A 3TK5A 2A2XH 1TFXA 2BY7X 2PV9B 1ZYOA 1EXFA 5GWZA 1WOFA 2QY0B 5DPAA 1IQGA 1Z8GA 1GL0E 2Q1JA 1AD8H 1PJPA 3K65B 4K8BA 1FIZA 2TPIZ 3UIRA 1DWCH 5F03A 4A6LA 2R2MB 4JMYA 1ETTH 1K1NA 1HAHH 1TRNA 3H7OA 8ESTE 4JZDH 5EQQA 2J92A 1PQ8A 3MNXA 1P03A 2YNBA 1C1WH 1BITA 4X2VA 1ETRH 1GPZA 1S82A 1GL1A 2P16A 2ZFRH 4LOYH 3MMGA 2ZHFH 3M3VA 3VB3A 1TA6A 2ZPQA 1GI2A 2BVRH 2PUXB 3PMAB 4GHQA 4D9RA 1QA0A 1UVTH 3RMNH 5EXMA 1GHVH 1K22H 2TGDA 1YPHE 5FBIA 4RKOB 4OGXA 4WMFA 3SUGA 1GI4A 1GJ5H 1XUJA 2GVFA 2Z3DA 2ZA5A 2AS9A 1VZQH 1WBGB 2CHAB 1DXPA 4MG3A 1VGCB 3K6YA 1HRTH 5IYTA 1XKBC 6CHAC 2FEQH 4MNWA 1FMGA 1MBQA 2BD7A 5LGOA 1P11E 1BB0B 3T5FH 1LQDB 3BTDE 1MKXK 1GHXH 3D23A 3E3TA 6GCHG 3ZZ9A 1EAIA 2FOCA 2ZTZA 1ZSJA 3RC6A 1ORFA 5A09A 1K1IA 3PO1C 1GGDB 1MTWA 3BTME 3M7QA 1CT4E 4D8NA 2ZU1A 5ESBA 1GBBA 4WXVA 1HIAB 1W2KH 1TWXB 1DITH 1GI8B 1MTVA 1AFEH 3PMHB 3SU2A 5JDUB 2M5TA 1GBHA 1NFWA 4F49A 4JK5A 1TX8A 1FONA 1K1MA 1IQFA 2CXVA 4ASHA 1HAGE 2HALA 1HIAA 2B0FA 3TU7H 1C5QA 1D3DB 1FXYA 2G8TA 3LONA 4AN7A 3TNTA 1OYTH 1CBWB 2XBXA 3B23B 3BTHE 1MCVA 2BM2A 1KLIH 1K9OE 2V6NA 4VGCC 2JH0D 3LGTA 1GI5A 2R3UA 2BYAX 1DVAH 1T31A 4U2WA 3UREA 1XMNB 2Z94A 3UPEA 3T27A 2ALPA 2GTBA 1E0FD 3MU0A 1ZTKA 1G30B 3NXPA 1KY9A 3V0XA 4KTCA 2A31A 4IMQA 2F83A 1EPTA 3URDA 4FUGA 2G55A 3EDXB 1V2VT 2RG3A 3SGQE 1O3NA 2FXRA 3VFEA 1QB6A 5IDKA 2C8XB 5HM2A 3U1IB 4FU8A 1PQ5A 1O5BB 3STIA 3V3MA 1AIXH 3GY5A 1Q3XA 2BX3A 1SGNE 1KXCA 1GCTB 1RD3B 1DDJA 4I33A 3QX5H 1NU9A 5E2PA 1RXPA 2Y5FA 1CQQA 1ZTJA 1DX5M 4XSKU 3T62A 4ESTE 1CHGA 2VNTA 1ZPBA 4X8TH 1TX6A 3SU6A 3VB7A 1SVPA 1EUFA 1JRTA 1H9LB 3RXBA 2Z3CA 5EW2H 1BHXB 1N8OC 3TPIZ 1FIWA 3BTEE 1EAUA 1S0QA 3SU3A 4ABBA 3E16B 3L33A 4B75A 2ZIQH 1L2EA 1QRWA 6GCHF 1P0SH 2HGTH 1GJ4H 1YCPM 5L2ZH 1P05A 1O35A 3QGNB 1HNEE 4NFFA 1ZPCA 3A7VA 3A8BA 4NA8A 3RUOA 2SFAA 1ELTA 3MHWU 1EOLA 2SGDE 4Y8YA 1SGEE 1T4VH 2BQ7B 2ZFQH 1O34A 3ESTA 1GBEA 4CRDA 3SGAE 4B71A 2ZHEH 2FWWA 3ZVCA 4E7NA 2BDBA 1GHAG 2SGPE 4HI3A 4BTTB 4UONA 1HBTH 2CJIA 1GI0A 4D9QA 1SI5H 1C5TA 3A88A 3GCOA 1CE5A 3M5LA 4WXIA 2BXUH 3RLYH 1ELBA 1SFQB 2ZEBA 3SORA 2H2ZA 1O2KA 2ZFFH 4ZAEA 1QB9A 1SOZA 1J15A 5JBBS 1U6QA 4MPWA 1O2WA 4YLQH 5E0JA 1N6XA 1ZMLA 1EOJA 3RXQA 2G4UA 2VWNA 3RU4E 5AFZH 1HAVA 1XXFA 3ATMA 3PYHA 4Y0ZE 3NK8A 1TNLA 2BD5A 3SNAA 2QF3A 3PWCA 1QA7A 2LNCA 3FANA 2Z3EA 5HXFA 1HAIH 3ZZBA 1C1RA 2RA0A 3MU4A 4JYUH 5JYIA 3C1KA 1Z7KA 2FOMB 3Q3KA 5L30H 2B5TB 2FTMA 5TCAA 1ELAA 1Z8RA 2ZTYA 2WV4A 3EYDA 1RJXB 2GCTC 5DP9A 1RGQA 1HGTH 3PB1E 1KTTB 1ABIH 4TWYA 3O8RA 2Y80A 4MQAA 3M3TA 5FBEA 3SJ8A 3O8DA 5CMXH 2ILNA 1DE7H 1IHTH 3V12A 1W14U 3MO3A 3ZVAA 3K9XB 4GHTA 4WH8A 1BMAA 1O3DA 3GCNA 4GVUA 4Y7BA 4WMDA 2BDAA 4Y6DA 3ZVEA 2LPRA 1GHYH 2BY9X 1A0LA 1C4Y2 4BAHB 3VGCB 1O36A 5A8ZA 1C1UH 2WPHS 3MOCA 4FUEA 2FYQA 4XFQA 3GDSA 1SGPE 2BD3A 3P8OA 2AMQA 1LPKB 3AW0A 4ABIA 1B7XB 4AB9A 1ZGIA 1SHHB 3RMMH 1C1QA 1Q31A 1TYNA 2FYRA 2BVXH 1JIMA 4KTSA 3QDZB 5J4SA 2ODPA 1P2NA 2F9NA 2IPHA 4CBOA 2XCNA 1GHAF 4R8TB 3BTTE 4O3UA 2Z9IA 2BOKA 3UWIA 1HAOH 1WUNH 3LGIA 1Y59T 1P2IA 2FI3E 4CHAC 3A8CA 3RXHA 1V2WT 2ZECA 1NY22 3LT3A 5I46H 2IJOB 1O0DH 1BBRH 4X8UH 3GDVA 5EQRA 1J8AA 1SFIA 1ANEA 1H9IE 1SGRE 1C2DA 3Q3YA 4ISHH 2JETC 2P95A 1YPJH 1HXEH 2GMTC 4BTUB 1TONA 5T6GA 1LO6A 3BEIB 2TIOA 1G3EA 1C5PA 1GMHG 1G3CA 1YPEH 5FPSA 3SZNA 3OYPA 5A0AE 2HVXA 3MH4A 1O3FA 5DKMA 2PFEA 2W7UA 3MO6A 1ELVA 3GY6A 2PHBA 2BXTH 2GDDA 1C5XB 4WF8A 1A1RA 2Z9KA 3KF2A 1AVGH 2Z9GA 3DD2H 1A61H 2VH0A 1FQ3A 4Q7YA 2AH4X 1PPGE 3BEFB 1CT2E 3E1XB 1C9PA 1C1PA 4CRAA 1S83A 8GCHG 3AASA 1SL3A 1V2KT 1FV9A 2BDIA 3PM3A 1UVPA 2PTCE 2Y7XA 1BZXE 3U8TH 3SV2H 4BAMB 3EAJA 5T6DA 3A87A 4B2AA 2SNVA 1E34B 3FVFB 1F0UA 1C5ZB 4BXWA 2A5AA 3UOUA 1G2MA 1F0SA 4D7FA 2R9PA 5CHAB 2XC5A 1A5HA 3KCGH 2GZ9A 3MNCA 3RMLH 3SOSA 3TGJE 3PLBA 1SLXB 2V3OH 2FM2A 3O8CA 4TY6A 2WPMS 2OINA 4U30A 2BOHB 1O5DH 4X6OA 3DFLA 4GLYA 3AVZA 5A2MH 5JB9S 3RXSA 2VWMA 4CH8B 1PPZA 1ANBA 4ZKRU 5TJXA 3OTJE 2A7CA 2ZKSA 4AOQA 3TK9A 3UR9A 3MWIU 3OY5U 2BX4A 4NIYA 3SJ9A 2UUFB 1WV7H 2HNTE 4CR5A 1GBJA 1LPGB 1O2VA 3RC5A 1MZAA 3BG8A 1O3OA 5C67A 1NRSH 4FU7A 2H5DA 2ZU3A 1Y3YA 2VINA 3UWJH 1P2OA 2AFQB 1JBUH 3ZVFA 5ESTE 3SUFA 3RXGA 3SGBE 4BXSA 4B2CA 3GCHB 3HGPA 2FOAA 1D9IA 2W26A 1AGJA 1P9UA 1XUHA 2C4FH 2K1QA 3OX7U 1GI9B 2AGIX 5T3HA 3BSQA 1NRQH 1UVOA 1GMHF 1TGNA 2H9EH 2ANYA 1ZHPA 1ESTA 2XC0A 3SV6A 1BT7A 4K8YA 1BOQA 1AE5A 4ZXYH 4AYVB 3MH6A 1F2SE 1Z1JA 1ZHMA 2CN0H 1B0EA 3D49H 1Z8IB 1V2UT 2OC1A 9LPRA 1HAZB 1Y8TA 4ZXXH 1VCWA 1CA8B 1T8MA 2THFB 3SUEA 3VB6A 1DXWA 2AMDA 8GCHF 1GBTA 4YO9A 1F92A 3MU1A 1YF4A 1O3EA 1QTFA 2ZDKA 4X0WU 1QJ1B
chains in the Genus database with same CATH superfamily
1C1OA 4B76A 2UWOA 2C90B 3EGKH 1EZXC 3N7DA 2NU4E 3SNEA 3DSPA 1QB1A 1QRXA 2OQ5A 2VIWA 2FODA 2QXHA 3U69H 2AGGX 1FZZA 3ZZDA 1Z6EA 5FPYA 4ZHMU 5HGGA 1L4ZA 2FTLE 3D65E 3VB5A 5EW1H 1RS0A 2GD4B 3PRDA 5F8TA 4ISLA 4I86A 4P02A 4X6PA 1QJ7B 3HPTB 5GJ4B 4Y0YE 3SUDA 5LPEA 1D6WA 2A45B 2TGAA 2QA9E 4Z0KA 1SHYA 1GI1A 1OP8A 1JMOH 1C5WB 3HK6B 1GHBG 4AYYB 4E05H 6ESTA 3RXFA 1TA2A 1UCYH 1WSSH 1C5OH 1MCTA 1DY9A 1TOMH 1KSNA 2ZU2A 2G51A 2XC4A 1UTLM 1LTOA 2WUBA 1J16A 5FL7D 1C5UA 4BANB 2ZWLH 2GP9B 3F9HA 2PSXA 4MLFB 1K21H 2CK3D 2BLQA 4NSVA 2QF0A 1P10A 5DP8A 1KTSB 3OSYA 4X8VH 3ODFA 1AB9C 2D2DA 1J14A 3M3SA 3L3TA 4MNXA 1C2FA 1ELCA 1TNKA 3SNDA 5L6NH 2QN5T 1O39A 2WYGA 4JK6A 2H9TH 1ZPZA 1QQUA 1LCYA 1PQ7A 1KLTA 2Z9LA 1HAXB 2XCFA 3U9AH 4DW2U 3LH1A 2Y81A 2F91A 3SQHE 1YPLH 4AZ2B 1C1TA 1EJAA 2J2UA 2OTVA 2EC9H 2ODQA 5BRRE 7KMEH 4I8KA 1SG8B 2ZGBH 4A1XA 5C1YA 2AGEX 3ZVBA 2ZP0H 5A0BA 1TBRH 3BG4C 1HYLA 1T8OA 1NZQH 2J98B 5ABWA 2UUJB 2OC7A 1A5IA 1AY6H 2P93A 1DPOA 1SC8U 2WUCA 1YGCH 1NU7B 5GPIB 3KQCA 2CF9H 1OWHA 1TNIA 2XYAA 1RTKA 1C1NA 2KAIA 2A2QH 2V3HH 3RM2H 1MAYA 3FO8D 1A46H 4J1YA 3AAUA 2FOGA 1V2JT 4A5TS 3LGWA 1ZTLA 3TH2H 3BTGE 3PTBA 4IMZA 1F5KU 1OKXA 1GG6C 2Z7FE 1T8NA 1TBZH 2WSSD 3UAIC 1BBRE 3SU1A 1P2MA 3PV5A 2H6MA 3BTQE 3ZZ7A 2P3FH 3BTWE 3Q76A 1HJAB 1WAYB 1MTNC 3RXPA 4YM9A 3SYJA 3KIDU 3RXKA 2VIQA 1MU8B 1QGFA 1SBWA 1AMHA 1KXDA 1GHBF 3MFJA 3QO6A 4FVDA 3QGJA 2VU8E 1L0ZA 3FOAA 4KKDA 2PGQB 1TAWA 3SI4H 1NROH 5K0HA 1FY3A 1NC6A 1TGSZ 1EQ9A 1EZUC 1L4DA 4CBNA 4UFDH 4IC5A 1LKAA 3RXJA 3MH7A 2PW8H 1GVLA 1V6DA 5BPEA 1WQVH 2HOBA 1QJ6B 3RXVA 1L1NA 3TH4H 3HATH 5A8XA 4DGJA 1IOEA 3TJVA 1EPTB 1QCPA 1SKYE 3PMBB 4GPGA 1V2QT 2ZCHP 2QC2A 1FUJA 2SGAA 1VKYA 4AG2A 2G00A 2BZ6H 1OS8A 1LQEA 4FETA 4JZIA 5DG6A 1O2QA 1T7CA 2ZCKP 3A7WA 1W12U 3RXDA 5IK2D 3AW1A 1HAPH 1D6RA 1YKTA 4ISNA 1V2RT 1YLCA 2ZHQH 1LVBA 1C5YB 3KQ5A 5LPRA 1WTHD 1LHFH 1O3HA 2WPLS 1QBOA 1C2LA 3UQVA 1THRH 1UVUH 1QR3E 1V3XA 2VGCB 3I77A 1QL8A 3QUMP 4Y8XA 2BQ6B 3SU0A 1TMTH 4OS5A 1TALA 2EQNA 1OWDA 2XW9A 1GJ9B 3IG6B 4NA9H 2ZDMA 1AQ7A 3A8AA 4U32A 2Z6BD 1F7ZA 1V2PT 2B9LA 2W6JD 1OP2A 2G5VA 5DO4H 5E2OA 2PSYA 1TIOA 5FAHA 1H4WA 2ZGHA 1FDPA 1G9IE 5E0GA 1SGYE 1FLEE 1FN8A 2A5KA 2ANMH 1EATA 4AX9H 4GSOA 1O5GH 3F2GA 3MYWA 4IS5A 2QXJA 3B9FH 2FI4E 4Q7XA 4CR9A 1NTPA 5JBAS 3TH3H 2QAAA 2V7QD 3GDUA 2FLRH 3SO3A 2FIRH 1BTPA 4FU9A 2EI8A 1WDIA 1LDTT 2FOBA 4NIVA 1BTHH 1GBMA 1CA0C 1GHWH 1CGJE 2BDHA 3EA8A 5CHBA 2HWLB 5DP6A 3F9EA 2NU1E 1ESBA 2WHXA 1W10U 4AFUA 3LPRA 3GOVB 1MABB 2TBSA 5FCRA 2OUAA 2XWBI 3DA9B 2Z9JA 2V0BA 4ZUHA 2O8TA 1HAVB 1B0FA 4D76A 1OPHB 2ZPSA 4X6MA 2OBQA 2WV5A 1SMFE 1MTSA 1UMAH 5B6OA 3NPSA 1BTUA 2P3TB 3OFND 2QF4A 3FAOA 2ZG0H 1W11U 1DANH 2P59A 1NS3A 4I8LA 1XXDA 1GBFA 1FNIA 1GMDG 4XBBA 1V2OT 5C94A 4O97A 2KCYA 4ACBA 1AO5A 1O2NA 1VCPA 3SNCA 1OWKA 1AWHB 1S85A 2FX6A 4MVNA 2BD8A 2G52A 4I8JA 4FUDA 2VB0A 3FFGA 3KQDA 4DY7B 1LMWB 5LH8A 2ZQ1A 3ZZCA 4UE7H 2O9QA 1EFRD 4GUXA 2QCYA 1O2TA 1IQNA 1MKWH 4ISIH 2FS8A 4TYDA 3RXUA 1FX0B 3EA7A 3T28A 4I7YH 1GBDA 7GCHG 2GT8A 2OP9A 1BIOA 1EJMA 3UNQA 2P94A 2R0KA 3U1JB 4X6NA 2YOLA 1SGIB 4A1VA 1C2HA 3C27B 5C0TA 3DUXH 5J4QA 3QZQA 1UCYE 2VVUA 1GI6A 2R0LA 2GZ8A 3PV4A 4NZQA 5F8XA 3PLKA 5C3NA 1GI7B 2R3YA 3SJOA 1GDNA 1IQEA 2BZAA 1NBMD 1C4U2 1TB6H 1HUTH 2IN2A 5EQSA 1GGDC 1A4WH 3D62A 1G3BA 1O3LA 2I6SA 4XDEA 2F9VA 1E35B 1KXFA 2RA3A 1YPMH 2BDCA 1YLNA 1B5GH 1E37B 1CSOE 1GWAA 2BDYA 1F0RA 2F9OA 1AZZA 1C1VH 1V2ST 4X2XA 3ZZ6A 2QIQA 1QNJA 2PKAA 1BTXA 3SV8A 2ZFTA 1TGTA 3FP6E 3T29A 5FXLA 4K60A 2K8IA 4DIIH 3CS0A 1MMJN 4BAKB 3QLPH 2IJD1 1QHRB 1W0KD 1CBWC 2OLGA 4X1RU 5F8ZA 3A84A 1QL9A 1ZRBA 1H9HE 1SQOA 2F43B 4AG1A 1BTZA 2BLWA 2FZZA 3WWBA 1TGCA 1Q2WA 1LHGH 1AVWA 2KX4A 2XXLA 1THPB 3ENSB 2WV9A 1Z8JB 4HGCA 1C5RA 1Y3XA 3RXCA 1O3MA 1H8ED 1FY8E 3A83A 1IQHA 3RC4A 3U28C 1KXEA 1GJAB 2OC8A 1AN1E 3IWMA 3RXRA 1C5NH 4IN1A 1CU1A 4B2BA 1L1JA 5DP5A 1BTWA 1UHBA 1GMDF 1BBRK 1VITH 3OU0A 4H42U 5DSFA 2OK5A 1W8BH 3PMJA 4Y76A 4XBDA 1O3PB 1O2RA 2EEKA 1ZLRA 4RT1A 4WJG2 4Y79A 1GBLA 1UVSH 4ABDA 1TPPA 4TSFD 1C5VA 3P95A 5HIZA 2VWLA 1NT1A 2ZHWH 3KL6A 3M5MA 4ABEA 3BTFE 2HNTC 2BD9A 1GCTC 2NU2E 4K5ZA 4Z1MD 1O2GH 3GYLB 1C2MA 2PKSB 3HKJB 1BMFD 3V7TA 7GCHF 3OTPA 5FX5A 3QWCH 4MNVA 1FY5A 3M35A 6LPRA 5FX6A 2WYJA 3PROA 1DY8A 4AB8A 3AAVA 5E8EH 2VVVA 4B6FA 1L1GA 4KELA 1EAWA 4F48B 4IBLH 2KM0A 2TGPZ 1YY3A 5EXNA 2OD3B 3CP7A 5H4IB 3UB0A 5C2ZA 1P06A 3MO9A 3TJUA 1AUTC 2BLVA 3RXLA 1TMBH 2QF5A 4MNYA 4DT7B 1UJ1A 3SQEE 1EP5A 1NN6A 3LDXH 4RKJB 1QFKH 5K7RA 2F9PA 4IC6A 3P8NA 1OXGA 3QTVH 3B8JA 2KCOA 3P6ZB 3LC5A 3S9AA 4ABJA 1MAXA 3V13A 1YCPH 1W0ZU 3BN9A 3OEHD 2G5NA 4ZHLU 2ZZUH 2OCVB 1G37A 1IHSH 3MNSA 2CGAA 3TLOA 2FPZA 4HZHA 2V3MA 4XE4A 1UTNA 1ZMJA 2L74A 4FUIA 1ZRKA 2XBVA 3MU5A 4X1QU 3ZZ8A 6CHAB 5GXPA 1HAYB 3ZYEA 8LPRA 1K2I1 1P8VC 2PWXA 4ASUD 3FP7E 3GY3A 4QT8C 1VJAU 1IQLA 1RRKA 1XUKA 3A89A 1ACBE 4CRFA 2SGQE 3PO1B 1X7AC 1P09A 1AVXA 2BDGA 2H1UA 1FY4A 3A85A 1BJVA 8KME2 3SHAH 2ZFSA 4NA7A 1WXRA 4DG4A 1MTNB 1Z71A 2WPKS 3QTOH 4X1SU 4TPIZ 1OWEA 1CO7E 1TQ7B 1SGFG 2SNWA 3P70B 3UFAA 3TVJB 4U01A 2AERH 3UR6A 1GJCB 1TLDA 4R0IA 4TWWA 1SPJA 2D26C 1RTFB 1H8DH 3ATWA 5C5NA 3TIUA 1C2JA 1DM4B 3GY2A 4YOJA 5HM9A 1SGQE 4DJZB 3GS9A 1S81A 2V35A 1ZOMA 2C8ZB 4VGCB 2STAE 2A32A 3SW2B 1BRAA 1GVKB 4NWLA 3BEUA 3DHKH 2EA3A 5HKKD 3SJKA 1OOKB 3EA9A 1BMMH 4O9VA 3NZIA 1OYQA 1EX3A 1KMHB 1JWTA 3HKIB 1BTYA 3SBKA 2BVSH 2NU3E 1EAXA 1C2GA 4OS7A 3L6PA 1Z1IA 3VGCC 3A7TA 4LXBH 4MPVA 1YPGH 3RXOA 2C8WB 2Y6TA 4MPXA 1S84A 1YYY1 5B6LA 1ELEE 3H5CB 1P02A 1Y3WA 4I31A 1ZGVA 1V2NT 3U8RH 4GCHG 1TE0A 2A4RA 3P17H 2F9UA 4RI0A 5GDSH 3EE7A 4YESB 1P3CA 4JYTA 1DICA 4Q4LA 2A5IA 2KCAA 1MQ6A 1O2IA 2UUKB 1BJUA 4FOUC 5FHTA 1YM0A 4M7GA 4YLUA 2GDEH 1UTKA 2BY5X 3TJNA 3SV9A 3PWBA 3ZIAD 3ODDA 7ESTE 1O2XA 2XNIA 2A0QB 1O3GA 1H8HD 4B6EA 1C2IA 1C2EA 3DSOA 5G4BA 2FMJA 2GV6A 4NG9H 1K1LA 3R0FA 1S5SA 4B1TA 4XRNA 2JJ2D 1K1OA 2Y5GA 1UCYK 1N8OB 5ETXA 1DWEH 3U98H 1HPGA 3W94A 3SI3H 1PPBH 1GHZA 3ATKA 4JCNA 3A82A 1P2JA 3MTYA 1RIWC 3BIVH 1XUIA 3DFJA 4INLA 4XD7D 1C9TA 1PYTD 1SGCA 1EB2A 2F4LA 4H6TA 1QURH 1K1JA 3NWUA 4MDSA 2ANKH 4WMEA 1FI8A 4K69A 4DURA 1DLKB 1FAKH 1DT2A 1FN6A 3TGIE 4B74A 2QV1A 3GCTG 2HLCA 4ABFA 3RM0H 1YP9A 1MUEB 4DVAU 1W0YH 1YPKH 1RFNA 1KDQA 4YT6H 2HPPH 3FZDA 4K1EA 1NFXA 1TOCB 1AE8H 2O8WA 5DK1A 4H6SB 3OEED 5FCKA 3VEQB 1AKSA 2D8WA 2GGVB 3T25A 2VJ1A 3QN7A 1S6FA 2KAIB 1AU8A 4NIWA 2AIQA 3ZVDA 2FOFA 1P01A 2ZGXH 3E0PB 1ARBA 2ZU4A 1LHCH 1A0JA 2J95A 1DOJA 4LK4A 1ESAA 2YMSB 4ZKNU 3R3GB 4CREA 2GZ7A 3NCLA 5DP7A 1AZ8A 5CHAC 1LKBA 2O8UA 1BMLA 1GJDB 1AWFH 3Q00A 1MH0A 1GJBB 3PLPA 1BRCE 4GCHF 1ZZZA 3RXEA 2C3SA 1BA8B 1DFPA 1CVWH 1KXBA 3VXEH 3A7XA 2GCTB 3M5OA 5EGMA 1SSXA 1LVOA 1P12E 2PGBB 2FX4A 1PPHE 1CGHA 1QRZA 1O2PA 2W7SA 1TMUH 1TX7A 1YWUA 2P8OC 4LZ1H 1TNGA 3QZRA 1WQSA 1HV7A 1J9CH 2ODYB 3UNRA 1MKXH 1SGFA 3JZ1B 2J9NA 2JJ1D 4OS2A 3E8LA 3GY7A 1PPCE 1OX1A 2WINI 3U8OH 4DIHH 4A92A 1TGBA 9ESTA 3KGPA 5FPTA 3EQ0H 1EASA 1M9UA 1F5LA 1NBME 2ZDLA 2ZGCA 4X2WA 4K3JA 3MQKC 1TABE 1GMCG 2FP7B 1AI8H 1IQIA 2F3CE 4IGDA 1OSSA 2GCHG 4CRBA 2GX4A 1LHEH 3NUMA 4FUBA 4NWKA 1GBAA 1Y3UA 1NFYA 3GCHC 3KYGA 1S6LA 3K6ZA 4UFGH 4TPYA 2ZC9H 2VIDA 2IOTA 2A1DB 3ATIA 3FZZA 1MQ5A 1O5AB 4Q7ZA 1RTLA 3M37A 1TRYA 1NO9H 2HNTF 3Q77A 4KTUA 4X1PU 1QL7A 3SV7A 1O3BA 3T26A 1AUJA 3GISB 2WPIS 2A4QA 2J4IA 4ABHA 4LZ4B 3GCTF 4I8GA 3IITA 4Y10E 4ZHAA 2ALVA 3ZYDA 2ZHDA 4ZH8A 2TGTA 2BLOA 4JZEH 4CHAB 5DP4A 1SQRA 1BHXF 3M36A 2FLBH 4KP0A 4Y11E 3LJOA 2FESH 1H1BA 1HLTH 1SLWB 3TGKE 4Y8ZA 3SJIA 1IAUA 4SGBE 4F4OC 2G81E 1SGDE 2XWAA 1Y3VA 3A7ZA 2DUCA 2XRCA 4J2YB 4WVPE 1O5FH 2PUQH 5DP3A 5AF9H 1MBMA 1UTMA 2JETB 4F55A 2GV7A 3KYFA 1G32B 5EJ1A 1W13U 2GMTB 1E38B 3KQEA 5L2YH 1GVZA 3A81A 1H8IH 4Q63A 5GCHG 1W7GH 4UDWH 1HJ9A 2ZNKH 4OS1A 4BTIB 4CRGA 1IQMA 1MU6B 1A7SA 1P2KA 3DT0H 1UTQA 1GBKA 1AFQC 3LC3A 5F53A 4YOGA 2O8LA 4FUHA 1SLUB 2O8MA 1O2UA 1BDAA 4B73A 4RT0A 4UEHH 2Y82A 5T6FA 1SR5C 3LGUA 4MTBA 3M5NA 2VVCA 1SLVB 2WPJS 4AFQA 2AHME 3MH5A 4ZKOU 1EZSC 3F68H 2BY8X 1C5LH 3F6UH 4WWYA 3RXIA 3SNBA 3ZZ3A 3I29A 1O31A 3S7KB 3A86A 3LIWA 2BQWB 5C5OA 1VITG 2ZDNA 2FS9A 1GMCF 1O5CB 1O32A 3S9CA 2Q6FA 1MTUA 2ZFPH 4I32A 3SU5A 2W3IA 1YLDA 2GCHF 2HRVA 1J17T 3BF6H 3N7OA 1ZSKA 5EPYA 1O5EH 2OC0A 1C1SA 2QXGA 2HVYB 4JZFH 4UFFH 1LHDH 3VPKA 2JH6D 3Q3XA 4HFPB 4IN2A 3O8BA 3TITA 3LOXA 4NIXA 3KHVA 3UTUH 2ZQ2A 3S0NA 4INKA 1O33A 1Y5AT 3HGNA 3WY8A 2QYIA 1KLJH 2VH6A 4X1NU 2UUYA 1O38A 2CV3A 4NFEA 5DJ7A 3M7UA 3H09A 1THSH 1EKBB 5C0UA 2OXSA 3N99A 4XBCA 3RLWH 4PROA 1OWJA 4M9FA 1XUFA 4BOHA 2XNDD 5GNDA 1O30A 2AMPA 1MKWK 3P8FA 2UWLA 1D3QB 2ZDAH 3A7YA 4ZKSU 2BY6X 2TRMA 4X8SH 1DUAA 1F0TA 2ZU5A 2CHAC 3KQBA 4K2YA 1VGCC 1WYKA 1XVOA 4AFSA 1TPOA 3TK6A 2ZF0H 1TRMA 2RCEA 5TCCA 3MI4A 1C1MA 3OAAD 4AGJA 3I78A 2RFKC 5GCHF 2M2AA 4DT4A 3P92A 1HJ8A 5EXLA 4OGYA 2BD2A 1FPCH 1HDTH 1DWBH 3F9FA 2PKAB 3UY9A 1HCGA 2UWPA 7LPRA 1ABJH 2VIPA 1G2LA 4OS6A 3W95A 1HJAC 2AIPA 3LKWA 4BAQB 1TPSA 1T4UH 4K1TA 2A4GA 3M7TA 4O3TA 3ZZ4A 1FPHH 3WWFA 1ANCA 1HB0B 1PYTC 2G4TA 2JIZD 1BCUH 2C8YB 5LPFA 1EJNA 1DUEA 2FI5E 2ZO3H 1JIRA 1GDQA 2ANWA 1BQYA 1UTJA 1IQJA 3ZZAA 3F2FA 2ZDVH 3MU8A 1VITF 1E1RD 3BV9B 2Q6GA 3NKKA 1MD8A 1EPTC 1UHBB 3RDZA 3VB4A 4NGAH 1D4PB 3ATLA 4WY3A 1ETSH 3RU4T 1BRUP 2FOEA 3TNSA 4ABAA 1CHOG 1JRSA 3E91A 2RDLA 4FUCA 1O2YA 1COWD 3ZZ5A 2DE8A 4JYVH 3URCA 4ISOA 1INCA 2GJGA 1PQAA 5AFYH 3T2NA 1KXAA 1QY6A 1DLEA 1TQ0B 4AORA 3PRBA 1Z6JH 2PTNA 1BUIA 1O2LA 4X2YA 1NPMA 2Q6DA 3S9BA 1C2KA 1VR1H 4OM9A 3UUZA 4E06H 1FAXA 3EE0B 3ITIA 1PFXC 1CT0E 3F3BA 3LGVA 4SGAE 1F5RA 5AHGH 2QXIA 2SGEE 3F2HA 1P04A 4ABGA 2YNAA 1BMNH 3GY8A 2PLXA 1BRBE 3TJOA 1A0HB 2GKVE 2VGCC 3SHCH 1ZJKA 1K28D 2J34A 4UD9H 1QZ8A 5EJLA 1ID5H 1RIWB 1AB9B 5CE1A 3ELAH 1GDUA 3E6PH 4WH6A 2D1JA 4FVBA 4DCDA 2ZTXA 3N7EA 3ZVGA 4ZMAH 2J97A 4XOJA 1WU1A 3PV2A 2B7DH 1DSTA 1KYNA 5EG4A 1LVYA 2VIOA 1NRRH 4Y7AA 1UTOA 2FDAA 4RN6A 1EP6A 4IW4E 1N1LA 2BHGA 2J38A 5JB8S 1NFUA 4A1TA 1D3PB 1ELFA 1GI3A 3STJA 2AYWA 4YOIA 1ANDA 1K1PA 2VWOA 4E7RG 2BTCE 2CF8H 3UQOA 4Q80A 3SU4A 2I6QA 3GYMA 5C1UA 1O2MA 3BG4B 2OQUA 1GJ6A 1ZJDA 1P2QA 3LH3A 2R2WU 4GAWA 2HPQH 2XBWA 2P3UB 2NU0E 2ZCLP 1NRNH 1WCZA 2CMYA 1SB1H 5HYOA 3F9GA 1O3IA 1JXPA 1DSUA 3RP2A 1YBWA 4AFZA 3GICB 1YCPK 1A3EH 2A7HA 3UNSA 2NWNA 4CRCA 1SGTA 4Q2KA 3OY6U 5EODA 3A8DA 3A80A 3FP8E 5C20A 2DE9A 1GBCA 2OBOA 1QIXB 3RU4D 1T32A 5PTPA 3H7TA 1ZR0A 2JKHA 3M61U 5HMAA 1XVMA 1A2CH 2C93B 4Z6AH 5I25A 5F6MA 1O3CA 1Y5UT 1EZQA 2ULLA 1VJ9U 1HFDA 3RXAA 1E1QD 1GG6B 1NESE 5A0CA 3E90B 4A7IB 1ELGA 1O2SA 2P8OB 5JBCS 5C1XA 1CHOF 4UFEH 1JOUB 1OP0A 1P9SA 2JH5D 1PPFE 1N6YA 3RMOH 1G3DA 3KN2A 4KGAA 2W3KA 1EB1H 1O2OA 3UOPA 1MZDA 1UK4A 1OWIA 3P8GA 1O2ZA 4NSYA 2PP6A 1AHTH 3ZV8A 3BIUH 2ZI2H 3KEEA 1O3JA 1DS2E 1YC0A 2GT7A 3PTNA 3SN8A 5EU8A 5JPMH 1UK2A 2H5CA 3LJJA 1KIGH 1ELDE 1G36A 2BB4A 1O3KA 2H9HA 3QK1A 3RXTA 3JZ2B 1FY1A 1V2TT 3LGYA 4AC9A 2J94A 1ZMNA 2ASUB 1E36B 1CGIE 1PPEE 2XBYA 3BTKE 3GY4A 1XKAC 1XM1A 1D3TB 1OHHD 4NZLA 1SQTA 5GIBA 4JZ1A 4THNH 1Y5BT 3S7HB 2LP6A 2BD4A 4BAOB 4TY7A 2KR7A 4RSPA 5E0HA 4O03A 1T8LA 1GJ7B 1IQKA 1NM6A 5DGJA 4HTCH 5AVDA 1ARCA 2ZPRA 4D7GA 5JBTA 4Y71A 4H4FA 3CENA 1A3BH 3RXMA 1XX9A 3E0NB 1LVMA 2J5UA 1P3EA 4BNRA 4YZUA 1P57B 4FUFA 1GBIA 2VIVA 1TBQH 1W3CA 1S6HA 4AGKA 3LU9B 2Y5HA 2YMSD 2Y7ZA 1QQ4A 2F9BH 2PR3A 4K1SA 3S69A 1O2JA 1VCQA 1TNJA 1S0RA 4FXGH 1C5MD 2WZQA 2SGFE 1UTPA 2AEIH 3HK3B 1TPAE 1UO6A 2B8OH 3KNXA 1K0HA 1C4V2 1DWDH 2A7JA 2EI7A 3F1SB 4YT7H 1FJSA 2L6OA 1AFQB 3CS7A 2ESTE 4MPUA 5EOKA 4CH2B 1XUGA 1V2MT 2LELA 2W5EA 1C5SA 1HXFH 1YPHC 2FO9A 5A8YA 4DOQA 1WTGH 1SOTA 3K2UA 1ZSLA 1QBVH 1O37A 1QBNA 5EPNA 1GCDA 1W7XH 4YTAA 1UK3A 2A4OA 1TNHA 4I8HA 3MNBA 2ZGJA 2EI6A 1SQAA 1V2LT 4YXWD 2QGRA 2VBCA 4NCYA 1KDQB 1CA0B 1MD7A 5SGAE 1LPZB 1O3AA 2BMGB 4FUJA 1NRPH 3VXFH 1ZHRA 4OS4A 3F0PA 1AKSB 1GJ8B 1O2HA 2XTTB 2STBE 1A5GH 2PKSC 2FOHA 4ZROA 3ZV9A 4INHA 3G01A 3TK5A 2A2XH 1TFXA 2BY7X 2PV9B 1ZYOA 1EXFA 5GWZA 1WOFA 2QY0B 5DPAA 1IQGA 1Z8GA 1GL0E 2Q1JA 1AD8H 1PJPA 3FN8A 3K65B 4K8BA 1FIZA 2TPIZ 4P00A 3UIRA 1DWCH 5F03A 4A6LA 2R2MB 4JMYA 1ETTH 1K1NA 1HAHH 1TRNA 3H7OA 8ESTE 4JZDH 5EQQA 2J92A 1PQ8A 3MNXA 3SZEA 1P03A 2YNBA 1C1WH 1BITA 4X2VA 1ETRH 1GPZA 1S82A 1GL1A 2P16A 2ZFRH 4LOYH 3MMGA 2ZHFH 5EJZA 3M3VA 3VB3A 1TA6A 2ZPQA 1GI2A 2BVRH 2PUXB 3PMAB 4GHQA 4D9RA 1QA0A 1UVTH 3OE7D 3RMNH 5EXMA 1GHVH 1K22H 2TGDA 1YPHE 5FBIA 4RKOB 4OGXA 4WMFA 3SUGA 1GI4A 1GJ5H 1XUJA 2GVFA 2J98A 2Z3DA 2ZA5A 2AS9A 1VZQH 4TT3D 1WBGB 2CHAB 1DXPA 4MG3A 1VGCB 3K6YA 1HRTH 5IYTA 1XKBC 6CHAC 2FEQH 4MNWA 1FMGA 1MBQA 2BD7A 5LGOA 1P11E 1BB0B 3T5FH 1LQDB 3BTDE 1MKXK 1GHXH 3D23A 3E3TA 6GCHG 3ZZ9A 1EAIA 2FOCA 2ZTZA 1ZSJA 3RC6A 1ORFA 5A09A 1K1IA 3PO1C 1GGDB 1MTWA 2HLDD 3BTME 3M7QA 1CT4E 4D8NA 2ZU1A 5ESBA 1GBBA 4WXVA 5HIYA 1HIAB 2K0QA 1W2KH 1TWXB 1DITH 1GI8B 1MTVA 1AFEH 3PMHB 3SU2A 5JDUB 2M5TA 1GBHA 1NFWA 4F49A 4JK5A 1TX8A 1FONA 1K1MA 1IQFA 2CXVA 4ACAA 4ASHA 1HAGE 2HALA 1HIAA 2B0FA 3TU7H 1C5QA 1D3DB 2JDID 1FXYA 2G8TA 3LONA 4AN7A 3TNTA 1OYTH 1CBWB 2XBXA 3B23B 3BTHE 1MCVA 2BM2A 5KGOA 1KLIH 1K9OE 2V6NA 4VGCC 5EIYA 2JH0D 3LGTA 1GI5A 2R3UA 2BYAX 1DVAH 1T31A 4U2WA 3UREA 1XMNB 2Z94A 3UPEA 3T27A 2ALPA 2GTBA 1E0FD 3MU0A 1ZTKA 1G30B 3NXPA 1KY9A 3V0XA 4KTCA 2A31A 4IMQA 2F83A 1EPTA 3URDA 4FUGA 2G55A 3EDXB 1V2VT 2RG3A 3SGQE 1O3NA 2FXRA 3VFEA 1QB6A 5IDKA 2C8XB 2W6ID 5HM2A 3U1IB 1E79D 5KEDA 4FU8A 1PQ5A 1O5BB 3STIA 3V3MA 1AIXH 3GY5A 1Q3XA 2XOKD 3VG8A 2BX3A 1SGNE 1KXCA 1GCTB 1RD3B 1DDJA 4I33A 3QX5H 1NU9A 5E2PA 1RXPA 2Y5FA 1CQQA 1ZTJA 1DX5M 4XSKU 3T62A 4ESTE 1CHGA 2VNTA 1ZPBA 4X8TH 1TX6A 3SU6A 3VB7A 1SVPA 1EUFA 1JRTA 1H9LB 3RXBA 2Z3CA 5EW2H 1BHXB 1N8OC 3TPIZ 1FIWA 3BTEE 1EAUA 1S0QA 3SU3A 4ABBA 3E16B 3L33A 4B75A 2ZIQH 1L2EA 1QRWA 6GCHF 1P0SH 2HGTH 1GJ4H 1YCPM 5L2ZH 1P05A 1O35A 3QGNB 1HNEE 4NFFA 1ZPCA 3A7VA 3A8BA 4NA8A 3RUOA 2SFAA 1ELTA 3MHWU 1EOLA 2SGDE 4Y8YA 1SGEE 1T4VH 2BQ7B 2ZFQH 1O34A 3ESTA 1GBEA 4CRDA 3SGAE 4B71A 2ZHEH 2FWWA 5KECA 3ZVCA 4E7NA 2WPDD 3CNRA 2BDBA 1GHAG 2SGPE 4HI3A 4BTTB 4UONA 1HBTH 2CJIA 1GI0A 4D9QA 1SI5H 1C5TA 3A88A 3GCOA 1CE5A 3M5LA 4WXIA 2BXUH 3RLYH 1ELBA 1SFQB 2ZEBA 4HG6A 3SORA 2H2ZA 1O2KA 2ZFFH 4ZAEA 1QB9A 5CDFE 1SOZA 1J15A 5JBBS 1U6QA 4MPWA 1O2WA 4YLQH 5E0JA 1N6XA 1ZMLA 1EOJA 3RXQA 2G4UA 5C17A 2VWNA 3RU4E 1W0JD 5AFZH 1HAVA 1XXFA 3ATMA 3PYHA 4Y0ZE 3NK8A 1TNLA 2BD5A 3SNAA 2QF3A 3PWCA 1QA7A 2LNCA 3FANA 2YMSC 2Z3EA 5HXFA 1HAIH 3ZZBA 1C1RA 2RA0A 3AK5A 3MU4A 4JYUH 5JYIA 3C1KA 1Z7KA 2FOMB 3Q3KA 5L30H 2B5TB 2FTMA 5TCAA 1ELAA 1Z8RA 2ZTYA 2WV4A 3EYDA 1RJXB 4ZCNA 2GCTC 5DP9A 1RGQA 1HGTH 3PB1E 1KTTB 1ABIH 4TWYA 3O8RA 2Y80A 4MQAA 3M3TA 5FBEA 3SJ8A 3O8DA 5CMXH 2ILNA 1DE7H 1IHTH 3V12A 1W14U 3MO3A 3ZVAA 3K9XB 4GHTA 4WH8A 1BMAA 1O3DA 3GCNA 4GVUA 4Y7BA 4WMDA 2BDAA 4Y6DA 3ZVEA 2LPRA 1GHYH 2BY9X 1A0LA 1C4Y2 4BAHB 3VGCB 1O36A 5A8ZA 1C1UH 2RDEA 2WPHS 3MOCA 2EY4C 4FUEA 2FYQA 4XFQA 3GDSA 1SGPE 2BD3A 3P8OA 2AMQA 1LPKB 3AW0A 4ABIA 1B7XB 4AB9A 1ZGIA 1SHHB 3RMMH 3FKSD 1C1QA 1Q31A 1TYNA 2FYRA 2BVXH 1JIMA 4KTSA 3QDZB 5J4SA 2ODPA 1P2NA 2F9NA 2IPHA 4CBOA 2XCNA 1GHAF 3DCLA 4R8TB 3BTTE 4O3UA 2Z9IA 2BOKA 3UWIA 1HAOH 1WUNH 3LGIA 1Y59T 1P2IA 2FI3E 4CHAC 3A8CA 3RXHA 1V2WT 2ZECA 1NY22 3LT3A 5I46H 2IJOB 1O0DH 1BBRH 4X8UH 3GDVA 5EQRA 1J8AA 1SFIA 1ANEA 1H9IE 1SGRE 1C2DA 3Q3YA 4ISHH 2JETC 2P95A 1UW7A 1YPJH 1HXEH 2GMTC 4BTUB 1TONA 5T6GA 1LO6A 3BEIB 2TIOA 1G3EA 1C5PA 1GMHG 1G3CA 1YPEH 5FPSA 3SZNA 3OYPA 5A0AE 2HVXA 3MH4A 1O3FA 5DKMA 2PFEA 2W7UA 3MO6A 1ELVA 3GY6A 2PHBA 2BXTH 2GDDA 1C5XB 4WF8A 1A1RA 2Z9KA 3KF2A 1AVGH 2Z9GA 3DD2H 1A61H 2VH0A 1FQ3A 4Q7YA 2AH4X 1PPGE 3BEFB 1CT2E 3E1XB 1C9PA 1C1PA 4CRAA 1S83A 8GCHG 3AASA 1SL3A 3W1EA 1V2KT 5DN6D 1FV9A 2BDIA 3PM3A 1UVPA 2PTCE 2KCPA 2Y7XA 1BZXE 3U8TH 3SV2H 4BAMB 3EAJA 5T6DA 3A87A 4B2AA 2QE7D 2SNVA 1E34B 3FVFB 1F0UA 1C5ZB 4BXWA 2A5AA 2IPQX 3UOUA 1G2MA 1F0SA 4D7FA 2R9PA 5CHAB 2XC5A 1A5HA 3KCGH 2GZ9A 3MNCA 3RMLH 3SOSA 3TGJE 3PLBA 1SLXB 2V3OH 2FM2A 3O8CA 4TY6A 2WPMS 2OINA 4U30A 2BOHB 1O5DH 3F0OA 4X6OA 3DFLA 4GLYA 3AVZA 5A2MH 5JB9S 3RXSA 2VWMA 4CH8B 1PPZA 1ANBA 4ZKRU 5TJXA 3OTJE 2A7CA 2ZKSA 4AOQA 3TK9A 3UR9A 3MWIU 3OY5U 2BX4A 4NIYA 3SJ9A 2UUFB 1WV7H 2HNTE 4CR5A 1GBJA 1LPGB 1O2VA 2KZ4A 3RC5A 1MZAA 3BG8A 1O3OA 5C67A 1NRSH 4FU7A 2H5DA 2ZU3A 1Y3YA 2VINA 3UWJH 1P2OA 2AFQB 1JBUH 3ZVFA 5ESTE 3SUFA 3RXGA 3SGBE 4BXSA 4B2CA 3GCHB 3HGPA 2FOAA 1D9IA 2W26A 1AGJA 1P9UA 1XUHA 2C4FH 3WW7A 2K1QA 3OX7U 1GI9B 2AGIX 5T3HA 3BSQA 1NRQH 1UVOA 1GMHF 1TGNA 2H9EH 2ANYA 1ZHPA 1ESTA 2XC0A 3NRLA 3SV6A 1BT7A 4K8YA 1BOQA 1AE5A 4ZXYH 4AYVB 3MH6A 1F2SE 1Z1JA 1ZHMA 2CN0H 1B0EA 3D49H 3DSGA 1Z8IB 1V2UT 2OC1A 9LPRA 1HAZB 1Y8TA 4ZXXH 1VCWA 1CA8B 1T8MA 2THFB 3SUEA 3VB6A 1DXWA 2AMDA 5T1VA 8GCHF 1GBTA 4YO9A 1F92A 3MU1A 1YF4A 1O3EA 1QTFA 2KFWA 2ZDKA 4X0WU 1QJ1B
chains in the Genus database with same CATH topology
1C1OA 4B76A 2UWOA 2C90B 3EGKH 1EZXC 2NU4E 3SNEA 1QB1A 1QRXA 2OQ5A 2VIWA 2FODA 2QXHA 3U69H 2AGGX 1FZZA 3ZZDA 1Z6EA 5FPYA 4ZHMU 5HGGA 1L4ZA 2FTLE 3D65E 3VB5A 5EW1H 1RS0A 2GD4B 5F8TA 4ISLA 4X6PA 1QJ7B 3HPTB 5GJ4B 4Y0YE 3SUDA 5LPEA 1D6WA 2A45B 2TGAA 2QA9E 4Z0KA 1SHYA 1GI1A 1OP8A 1JMOH 1C5WB 3HK6B 1GHBG 4AYYB 4E05H 6ESTA 3RXFA 1TA2A 1UCYH 1WSSH 1C5OH 1MCTA 1DY9A 1TOMH 1KSNA 2ZU2A 2G51A 2XC4A 1UTLM 1LTOA 2WUBA 1J16A 1C5UA 4BANB 2ZWLH 2GP9B 3F9HA 2PSXA 4MLFB 1K21H 2BLQA 4NSVA 2QF0A 1P10A 5DP8A 1KTSB 3OSYA 4X8VH 3ODFA 1AB9C 2D2DA 1J14A 3M3SA 3L3TA 4MNXA 1C2FA 1ELCA 1TNKA 3SNDA 5L6NH 2QN5T 1O39A 2WYGA 4JK6A 2H9TH 1ZPZA 1QQUA 1LCYA 1PQ7A 1KLTA 2Z9LA 1HAXB 2XCFA 3U9AH 4DW2U 3LH1A 2Y81A 2F91A 3SQHE 1YPLH 4AZ2B 1C1TA 1EJAA 2OTVA 2J2UA 2EC9H 2ODQA 5BRRE 7KMEH 4I8KA 1SG8B 2ZGBH 4A1XA 5C1YA 2AGEX 3ZVBA 2ZP0H 5A0BA 1TBRH 3BG4C 1HYLA 1T8OA 1NZQH 5ABWA 2UUJB 2OC7A 1A5IA 1AY6H 2P93A 1DPOA 1SC8U 2WUCA 1YGCH 1NU7B 5GPIB 3KQCA 2CF9H 1OWHA 1TNIA 2XYAA 1RTKA 1C1NA 2KAIA 2A2QH 2V3HH 3RM2H 1MAYA 1A46H 4J1YA 3AAUA 2FOGA 1V2JT 4A5TS 3LGWA 1ZTLA 3TH2H 3BTGE 3PTBA 4IMZA 1F5KU 1OKXA 1GG6C 2Z7FE 1T8NA 1TBZH 1BBRE 3SU1A 1P2MA 2H6MA 3BTQE 3ZZ7A 2P3FH 3BTWE 3Q76A 1HJAB 1WAYB 1MTNC 3RXPA 4YM9A 3KIDU 3RXKA 2VIQA 1MU8B 1QGFA 1SBWA 1AMHA 1KXDA 1GHBF 3MFJA 3QO6A 4FVDA 3QGJA 2VU8E 1L0ZA 4KKDA 2PGQB 1TAWA 3SI4H 1NROH 5K0HA 1FY3A 1NC6A 1TGSZ 1EQ9A 1EZUC 1L4DA 4CBNA 4UFDH 4IC5A 1LKAA 3RXJA 3MH7A 2PW8H 1GVLA 1V6DA 5BPEA 1WQVH 2HOBA 1QJ6B 3RXVA 1L1NA 3TH4H 3HATH 5A8XA 4DGJA 1IOEA 3TJVA 1EPTB 1QCPA 3PMBB 4GPGA 1V2QT 2ZCHP 2QC2A 1FUJA 2SGAA 4AG2A 2G00A 2BZ6H 1OS8A 1LQEA 4JZIA 5DG6A 1O2QA 1T7CA 2ZCKP 3A7WA 1W12U 3RXDA 3AW1A 1HAPH 1D6RA 1YKTA 4ISNA 1V2RT 1YLCA 2ZHQH 1LVBA 1C5YB 5LPRA 1WTHD 1LHFH 1O3HA 2WPLS 1QBOA 1C2LA 3UQVA 1THRH 1UVUH 1QR3E 1V3XA 2VGCB 3I77A 1QL8A 3QUMP 4Y8XA 2BQ6B 3SU0A 1TMTH 4OS5A 1TALA 1OWDA 2XW9A 1GJ9B 3IG6B 4NA9H 2ZDMA 1AQ7A 3A8AA 4U32A 2Z6BD 1F7ZA 1V2PT 2B9LA 1OP2A 2G5VA 5DO4H 5E2OA 2PSYA 1TIOA 5FAHA 1H4WA 2ZGHA 1FDPA 1G9IE 5E0GA 1SGYE 1FLEE 1FN8A 2A5KA 2ANMH 1EATA 4AX9H 4GSOA 1O5GH 3MYWA 4IS5A 2QXJA 3B9FH 2FI4E 4Q7XA 4CR9A 1NTPA 5JBAS 3TH3H 2QAAA 3GDUA 3SO3A 2FLRH 2FIRH 1BTPA 4FU9A 2EI8A 1LDTT 2FOBA 4NIVA 1BTHH 1GBMA 1CA0C 1GHWH 1CGJE 2BDHA 3EA8A 2HWLB 5DP6A 3F9EA 2NU1E 1ESBA 1W10U 4AFUA 3LPRA 3GOVB 2TBSA 5FCRA 2OUAA 2XWBI 3DA9B 2Z9JA 2V0BA 4ZUHA 2O8TA 1HAVB 1B0FA 4D76A 1OPHB 2ZPSA 4X6MA 2OBQA 2WV5A 1SMFE 1MTSA 1UMAH 5B6OA 3NPSA 1BTUA 2P3TB 3FAOA 2ZG0H 1W11U 1DANH 2P59A 1NS3A 4I8LA 1XXDA 1GBFA 1FNIA 1GMDG 4XBBA 1V2OT 4O97A 1AO5A 1O2NA 1VCPA 3SNCA 1OWKA 1AWHB 1S85A 2FX6A 4MVNA 2BD8A 2G52A 4I8JA 4FUDA 2VB0A 3FFGA 3KQDA 4DY7B 1LMWB 5LH8A 2ZQ1A 3ZZCA 4UE7H 2O9QA 4GUXA 2QCYA 1O2TA 1IQNA 1MKWH 4ISIH 2FS8A 4TYDA 3RXUA 3T28A 3EA7A 4I7YH 1GBDA 7GCHG 2GT8A 2OP9A 1BIOA 1EJMA 3UNQA 2P94A 2R0KA 3U1JB 4X6NA 2YOLA 1SGIB 4A1VA 1C2HA 3C27B 3DUXH 5J4QA 3QZQA 1UCYE 2VVUA 1GI6A 2R0LA 2GZ8A 3PV4A 4NZQA 5F8XA 3PLKA 5C3NA 1GI7B 2R3YA 3SJOA 1GDNA 1IQEA 2BZAA 1C4U2 1TB6H 1HUTH 2IN2A 5EQSA 1GGDC 1A4WH 3D62A 1G3BA 1O3LA 2I6SA 4XDEA 2F9VA 1E35B 1KXFA 2RA3A 1YPMH 2BDCA 1B5GH 1E37B 1CSOE 1GWAA 2BDYA 1F0RA 2F9OA 1AZZA 1C1VH 1V2ST 4X2XA 3ZZ6A 2QIQA 1QNJA 2PKAA 1BTXA 3SV8A 2ZFTA 1TGTA 3FP6E 3T29A 5FXLA 4K60A 4DIIH 3CS0A 1MMJN 4BAKB 3QLPH 1QHRB 2OLGA 1CBWC 4X1RU 5F8ZA 3A84A 1QL9A 1ZRBA 1H9HE 1SQOA 4AG1A 1BTZA 2BLWA 2FZZA 1TGCA 1Q2WA 1LHGH 1AVWA 2XXLA 1THPB 3ENSB 1Z8JB 4HGCA 1C5RA 1Y3XA 3RXCA 1O3MA 1FY8E 3A83A 1IQHA 3RC4A 1KXEA 1GJAB 2OC8A 1AN1E 3IWMA 3RXRA 1C5NH 4IN1A 1CU1A 4B2BA 1L1JA 5DP5A 1BTWA 1UHBA 1GMDF 1BBRK 1VITH 3OU0A 4H42U 1W8BH 3PMJA 4Y76A 4XBDA 1O3PB 1O2RA 2EEKA 1ZLRA 4WJG2 4Y79A 1GBLA 1UVSH 4ABDA 1TPPA 1C5VA 3P95A 2VWLA 1NT1A 2ZHWH 3KL6A 3M5MA 4ABEA 3BTFE 2HNTC 2BD9A 2NU2E 1GCTC 4K5ZA 1O2GH 3GYLB 1C2MA 2PKSB 3HKJB 3V7TA 7GCHF 5FX5A 3QWCH 4MNVA 1FY5A 3M35A 6LPRA 5FX6A 2WYJA 3PROA 1DY8A 4AB8A 3AAVA 5E8EH 2VVVA 1L1GA 4KELA 1EAWA 4IBLH 2TGPZ 5EXNA 2OD3B 3CP7A 5H4IB 5C2ZA 1P06A 3MO9A 3TJUA 1AUTC 2BLVA 3RXLA 1TMBH 4MNYA 4DT7B 1UJ1A 3SQEE 1EP5A 1NN6A 3LDXH 4RKJB 1QFKH 5K7RA 2F9PA 4IC6A 3P8NA 1OXGA 3QTVH 3B8JA 3P6ZB 3LC5A 3S9AA 4ABJA 1MAXA 3V13A 1YCPH 1W0ZU 3BN9A 2G5NA 4ZHLU 2ZZUH 2OCVB 1G37A 1IHSH 3MNSA 2CGAA 3TLOA 2FPZA 4HZHA 4XE4A 1UTNA 1ZMJA 4FUIA 3ZZ8A 1ZRKA 2XBVA 3MU5A 4X1QU 6CHAB 5GXPA 1HAYB 3ZYEA 8LPRA 1K2I1 1P8VC 2PWXA 3FP7E 3GY3A 4QT8C 1VJAU 1IQLA 1RRKA 1XUKA 3A89A 1ACBE 4CRFA 2SGQE 3PO1B 1X7AC 1P09A 1AVXA 2BDGA 2H1UA 1FY4A 3A85A 1BJVA 8KME2 3SHAH 2ZFSA 4NA7A 4DG4A 1MTNB 1Z71A 2WPKS 3QTOH 4X1SU 4TPIZ 1OWEA 1CO7E 1TQ7B 1SGFG 2SNWA 3P70B 3UFAA 3TVJB 4U01A 2AERH 3UR6A 1GJCB 1TLDA 4R0IA 4TWWA 1SPJA 2D26C 1RTFB 1H8DH 3ATWA 5C5NA 3TIUA 1C2JA 1DM4B 3GY2A 4YOJA 5HM9A 1SGQE 4DJZB 1S81A 2V35A 1ZOMA 2C8ZB 4VGCB 2STAE 2A32A 3SW2B 1BRAA 1GVKB 4NWLA 3BEUA 3DHKH 2EA3A 3SJKA 1OOKB 3EA9A 1BMMH 4O9VA 3NZIA 1OYQA 1EX3A 1JWTA 3HKIB 1BTYA 3SBKA 2BVSH 2NU3E 1EAXA 1C2GA 4OS7A 3L6PA 1Z1IA 3VGCC 3A7TA 4LXBH 4MPVA 1YPGH 3RXOA 2C8WB 2Y6TA 4MPXA 1S84A 1YYY1 1ELEE 3H5CB 1P02A 1Y3WA 4I31A 1ZGVA 1V2NT 3U8RH 4GCHG 1TE0A 2A4RA 3P17H 2F9UA 5GDSH 4YESB 1P3CA 4JYTA 1DICA 2A5IA 1MQ6A 1O2IA 2UUKB 1BJUA 5FHTA 1YM0A 4M7GA 4YLUA 2GDEH 1UTKA 2BY5X 3TJNA 3SV9A 3PWBA 3ODDA 7ESTE 1O2XA 2XNIA 2A0QB 1O3GA 1C2IA 1C2EA 5G4BA 2FMJA 2GV6A 4NG9H 1K1LA 3R0FA 1S5SA 4B1TA 2Y5GA 1K1OA 1UCYK 1N8OB 5ETXA 1DWEH 3U98H 1HPGA 3W94A 3SI3H 1PPBH 1GHZA 3ATKA 4JCNA 3A82A 1P2JA 3MTYA 1RIWC 3BIVH 1XUIA 3DFJA 4INLA 1C9TA 1PYTD 1SGCA 1EB2A 4H6TA 1QURH 1K1JA 3NWUA 4MDSA 2ANKH 4WMEA 1FI8A 4K69A 4DURA 1DLKB 1FAKH 1DT2A 1FN6A 3TGIE 4B74A 2QV1A 3GCTG 2HLCA 4ABFA 3RM0H 1YP9A 1MUEB 4DVAU 1W0YH 1YPKH 1RFNA 1KDQA 4YT6H 2HPPH 3FZDA 4K1EA 1NFXA 1TOCB 1AE8H 2O8WA 5DK1A 4H6SB 5FCKA 3VEQB 1AKSA 2D8WA 2GGVB 3T25A 2VJ1A 3QN7A 1S6FA 2KAIB 1AU8A 4NIWA 2AIQA 3ZVDA 2FOFA 1P01A 2ZGXH 3E0PB 1ARBA 2ZU4A 1LHCH 1A0JA 2J95A 1DOJA 4LK4A 1ESAA 4ZKNU 3R3GB 4CREA 2GZ7A 3NCLA 5DP7A 1AZ8A 5CHAC 1LKBA 2O8UA 1BMLA 1GJDB 1AWFH 3Q00A 1MH0A 1GJBB 3PLPA 1BRCE 4GCHF 1ZZZA 3RXEA 2C3SA 1BA8B 1DFPA 1CVWH 1KXBA 3VXEH 3A7XA 2GCTB 3M5OA 5EGMA 1SSXA 1LVOA 1P12E 2PGBB 1PPHE 1QRZA 1CGHA 2FX4A 1O2PA 2W7SA 1TMUH 1TX7A 2P8OC 4LZ1H 1TNGA 3QZRA 1WQSA 1HV7A 1J9CH 2ODYB 3UNRA 1MKXH 1SGFA 3JZ1B 2J9NA 4OS2A 3E8LA 3GY7A 1PPCE 1OX1A 2WINI 3U8OH 4DIHH 4A92A 1TGBA 9ESTA 3KGPA 5FPTA 3EQ0H 1EASA 1M9UA 1F5LA 2ZDLA 2ZGCA 4X2WA 4K3JA 1TABE 1GMCG 2FP7B 1AI8H 1IQIA 2F3CE 4IGDA 1OSSA 2GCHG 4CRBA 2GX4A 1LHEH 3NUMA 4FUBA 4NWKA 1GBAA 1Y3UA 1NFYA 3GCHC 3K6ZA 4UFGH 4TPYA 2ZC9H 2VIDA 2IOTA 2A1DB 3ATIA 3FZZA 1MQ5A 1O5AB 4Q7ZA 1RTLA 3M37A 1TRYA 1NO9H 2HNTF 3Q77A 4KTUA 4X1PU 1QL7A 3SV7A 1O3BA 3T26A 1AUJA 3GISB 2WPIS 2A4QA 2J4IA 4ABHA 4LZ4B 3GCTF 4I8GA 3IITA 4Y10E 4ZHAA 2ALVA 3ZYDA 2ZHDA 4ZH8A 2TGTA 2BLOA 4JZEH 4CHAB 5DP4A 1BHXF 3M36A 2FLBH 4KP0A 4Y11E 3LJOA 2FESH 1H1BA 1HLTH 1SLWB 3TGKE 4Y8ZA 3SJIA 1IAUA 4SGBE 4F4OC 2G81E 1SGDE 2XWAA 1Y3VA 3A7ZA 2DUCA 2XRCA 4J2YB 4WVPE 1O5FH 2PUQH 5DP3A 5AF9H 1MBMA 1UTMA 2JETB 2GV7A 1G32B 1W13U 2GMTB 1E38B 3KQEA 5L2YH 1GVZA 3A81A 1H8IH 5GCHG 1W7GH 4UDWH 1HJ9A 2ZNKH 4OS1A 4BTIB 4CRGA 1IQMA 1MU6B 1A7SA 1P2KA 3DT0H 1UTQA 1GBKA 1AFQC 3LC3A 4YOGA 2O8LA 4FUHA 1SLUB 2O8MA 1O2UA 1BDAA 4B73A 4UEHH 2Y82A 5T6FA 1SR5C 3LGUA 4MTBA 3M5NA 2VVCA 1SLVB 2WPJS 4AFQA 3MH5A 4ZKOU 1EZSC 3F68H 2BY8X 1C5LH 3F6UH 4WWYA 3RXIA 3SNBA 3ZZ3A 3I29A 1O31A 3S7KB 3A86A 3LIWA 2BQWB 5C5OA 1VITG 2ZDNA 2FS9A 1GMCF 1O5CB 1O32A 3S9CA 2Q6FA 1MTUA 2ZFPH 4I32A 3SU5A 2W3IA 1YLDA 2GCHF 2HRVA 1J17T 3BF6H 3N7OA 1ZSKA 5EPYA 1O5EH 2OC0A 1C1SA 2QXGA 4JZFH 4UFFH 1LHDH 3VPKA 2JH6D 3Q3XA 4HFPB 4IN2A 3O8BA 3TITA 3LOXA 4NIXA 3KHVA 3UTUH 2ZQ2A 3S0NA 4INKA 1O33A 1Y5AT 3HGNA 3WY8A 2QYIA 1KLJH 2VH6A 4X1NU 2UUYA 1O38A 2CV3A 4NFEA 5DJ7A 3M7UA 1THSH 1EKBB 2OXSA 4XBCA 3RLWH 4PROA 1OWJA 1XUFA 4BOHA 1O30A 2AMPA 1MKWK 3P8FA 2UWLA 1D3QB 2ZDAH 3A7YA 4ZKSU 2BY6X 2TRMA 4X8SH 1DUAA 1F0TA