1O2IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2iA02
1CHGA 4YESB 7KMEH 4GHTA 3MI4A 3UY9A 3ATLA 1OYQA 1HAIH 3A80A 1ELEE 2D26C 1MBMA 1NRSH 2ZKSA 1C1MA 1TNGA 1IQKA 1S83A 1IQEA 1AB9B 1EAWA 1ETSH 2F9UA 2DE9A 3BSQA 1V3XA 2ODYB 1KXDA 2XWBI 1LHGH 1NN6A 1O39A 1AWFH 3ZZ7A 3LGIA 4K60A 3RXOA 2THFB 4ABAA 2BHGA 2FIRH 3KL6A 1LVBA 1QBNA 2FOBA 2G55A 2BDAA 3PROA 2ZFSA 1TE0A 1A5GH 1VJ9U 5C3NA 2Y81A 1K1IA 1TAWA 1XUGA 1VGCC 2TGPZ 3SJ8A 1C5PA 5EG4A 1O2NA 1HAVA 2VWLA 1DM4B 4HI3A 3OX7U 1GI1A 1SLVB 2Z7FE 2O8WA 3EE0B 4MVNA 3E0NB 2P3TB 2OC8A 1G32B 1SVPA 3GCHC 1HFDA 2ZEBA 4K8BA 2FODA 1K9OE 1SGCA 5A8XA 2GCHG 1KLTA 2PKAB 1MD7A 2HPPH 7GCHF 1TX8A 4X0WU 4CRBA 1E37B 1O36A 2FYRA 2D1JA 3QGJA 2J34A 1ELDE 1QCPA 1ELAA 3ZYEA 2P8OB 1DWEH 1GMHF 1OOKB 4RN6A 3LC5A 1F2SE 1U6QA 5LGOA 2R9PA 3LH1A 2AFQB 1EXFA 4CRAA 1SLUB 1V2JT 1S0QA 2BQ6B 2ZFRH 2WPHS 1MKXK 1GCTC 1GJDB 1P9SA 4H6TA 3NXPA 1ACBE 1KDQB 1AMHA 4X1PU 4WWYA 4F4OC 4TWWA 3M7QA 1WUNH 4ZHMU 2PUQH 3O8DA 1VITG 1P8VC 1J9CH 3O8RA 4ABHA 1GMCG 2FP7B 4FU7A 3VXFH 2ODQA 1IHTH 2ZA5A 3LONA 2ZO3H 4KELA 2G4UA 1G37A 4Q7YA 1D6RA 3TGIE 4XBCA 1HRTH 5L2ZH 1MU6B 4BOHA 4I7YH 1GMDF 3QN7A 3F68H 4CREA 1S82A 1F0SA 1XVOA 1MAYA 3TJVA 1MCTA 1MKWK 1O2VA 4DCDA 4X2XA 1ZTJA 1CA0B 1TRYA 3MU8A 1F5KU 2R0KA 5DJ7A 3QO6A 3UWIA 1UTMA 1FIZA 4FUFA 2DUCA 1FV9A 1TX6A 2ZHQH 3WY8A 4J2YB 2AGIX 4I8KA 2H5DA 1NRRH 2FMJA 1PPHE 1A3BH 1HBTH 2BTCE 1TNLA 2J92A 4K1TA 3VEQB 2CN0H 1N8OC 2ZTYA 3BTQE 4UEHH 5CMXH 2BM2A 3E6PH 1LDTT 1TNKA 3EYDA 4GSOA 1IQHA 2G81E 2GCTC 1S84A 2O8LA 1ZMLA 1ANEA 4WJG2 2G52A 1DANH 1K1PA 1E36B 1S6FA 6CHAC 1Z8JB 4AFZA 4INLA 2FOMB 4CRFA 2ALPA 1GMCF 2P3FH 4B76A 1UVUH 2XCFA 5B6OA 1DLEA 2STBE 1UVSH 2C8ZB 1PYTD 4ZKRU 2KAIB 3SUFA 4AG1A 1EB2A 1HJ9A 3IWMA 4MLFB 4FUCA 2LNCA 5A8YA 2ZGJA 3E90B 3SO3A 1SGTA 3BTFE 3SU5A 1A1RA 4AYYB 1FI8A 1NY22 5EPYA 3SNAA 4MNXA 1TRNA 4O9VA 4OS1A 4D9RA 2O8MA 4TY7A 1CT4E 1FXYA 4UFGH 3FP8E 3D49H 3SV7A 1AKSA 3H7OA 1TNHA 2ZPSA 5E2PA 4MTBA 4JYTA 1C1SA 4ZROA 4HTCH 2O8UA 1AFQB 3GCNA 1MTVA 6LPRA 4K1EA 1HUTH 3S0NA 5HM9A 2CV3A 3PMBB 3RXTA 3FVFB 3ZVCA 1J17T 1ZHMA 1RIWC 4Y79A 4BAKB 1JBUH 4I8JA 3NWUA 4ZH8A 3AW1A 1GHZA 4D7FA 1J15A 2BVXH 1W0ZU 2PTNA 1YLCA 2ZHWH 3RXDA 2GT7A 1GHAF 1UTPA 4Y71A 5LH8A 4B1TA 5EXMA 2ZDKA 1ETRH 2FX6A 1G30B 3TNSA 3MH4A 3MU5A 3GY3A 4FUDA 1AN1E 2G51A 2ZU1A 3ZZ3A 1NS3A 1XUKA 4Z6AH 1QIXB 2F9NA 1O3NA 1FLEE 3AASA 1HXEH 1MUEB 3EA8A 1SGYE 2GTBA 3F9HA 3E16B 5C2ZA 2ZG0H 1BTXA 1WQSA 2ULLA 3LOXA 3A8BA 4IN1A 1LPZB 1LVMA 1ZGVA 9ESTA 2IOTA 2QIQA 1OSSA 1C2DA 3A8DA 1G3DA 3VB3A 2JETC 2HLCA 3BIVH 1DICA 2FLRH 1WOFA 1G36A 1L4DA 2WV4A 1BA8B 1HDTH 3RM0H 2HWLB 1O2QA 1GI0A 1GHXH 2OD3B 5ESBA 4JZEH 5T6GA 4YZUA 1MQ5A 1TGBA 3CP7A 3F9EA 4JZDH 5EODA 3G01A 3PYHA 1EX3A 1CE5A 4A6LA 3M5LA 1MTNB 4K3JA 1E38B 1WCZA 2VB0A 3BIUH 1SB1H 3T28A 1IQMA 2A5KA 2XC5A 1O31A 1WYKA 1PQ7A 1THRH 1O3DA 1S81A 3AAVA 1AZZA 3T29A 1KTSB 5DP5A 1BUIA 8KME2 1IQJA 2VINA 1AGJA 3MO9A 2BX4A 5ESTE 1OKXA 3BTHE 1F0RA 1DUAA 1MKXH 4TPIZ 1W8BH 1O2PA 3SJ9A 3BEUA 2G4TA 1SBWA 1NFYA 1CT0E 2SGPE 3SI4H 3RXUA 1QTFA 3U98H 3UQVA 3GY7A 2ZCLP 3STJA 4MPWA 1Y5BT 3OY6U 4O03A 2GV6A 3RM2H 5PTPA 1BT7A 2QF0A 8ESTE 2GV7A 1DPOA 2VH0A 1FUJA 3GY5A 1O30A 2HRVA 2TPIZ 3QUMP 4DIIH 5DKMA 1P01A 3RUOA 3A81A 1GHBG 5LPRA 1LKBA 2VGCB 1Z8GA 1HLTH 1TOMH 4YOIA 1GI3A 3UFAA 1ID5H 2XBWA 1RTFB 3UR9A 1TYNA 1GBAA 4LOYH 3TK6A 2VGCC 2FPZA 2EI7A 3GCTF 3E3TA 4NWLA 1JXPA 2ZFQH 3ZZDA 1Z71A 5EW1H 4WH6A 4KP0A 4Y11E 4AG2A 1KTTB 1T8LA 1YC0A 1P02A 3SUDA 1MZDA 2BY5X 1EASA 2ZIQH 1OYTH 1KXEA 1A5HA 1NO9H 5IDKA 4YM9A 4ZXYH 1DY9A 5DP9A 1XMNB 3SJKA 4WVPE 1D9IA 4NSYA 1MTWA 1UCYE 4OS2A 2HNTE 4FU8A 1AZ8A 3FP7E 4ASHA 2CF8H 1QL9A 3LU9B 5F6MA 2Q6GA 3S9CA 2R3UA 1RXPA 4O3TA 1BMLA 2VIPA 2W3KA 3QWCH 3D62A 2UWLA 4AB9A 1C2GA 4MNYA 1ABJH 3GY4A 1TPAE 3FZDA 3PMAB 3H5CB 1QRWA 1SMFE 2ZTZA 1KSNA 3K65B 3F1SB 1BDAA 1BHXF 3RC5A 2J95A 1W3CA 3PO1C 1N6XA 3SU6A 3I78A 1O2TA 1P12E 1WTHD 1C4Y2 3NPSA 5GWZA 1PQ8A 1N8OB 3ZVBA 5C1XA 2PHBA 3M35A 1WU1A 2FESH 9LPRA 4OS4A 3U8RH 1P03A 2GDEH 2BOKA 1ESAA 2ZPQA 3EGKH 2W5EA 3AAUA 3M7UA 3P8FA 4GVUA 1O2KA 3TH2H 4RKOB 1C1OA 4ABBA 1O5GH 3U1JB 5F8TA 5GPIB 1TX7A 2WYGA 1BZXE 3U9AH 4TWYA 3SUEA 1XM1A 1P04A 2ZDVH 1EAIA 2SNVA 4BXWA 3ATKA 1DUEA 5E0JA 5JPMH 1AE5A 5E2OA 1A4WH 4X6NA 3SI3H 2QN5T 1FY1A 3SJOA 2A4OA 3GY6A 1K1MA 1ZHPA 3BTDE 3KQCA 2WPJS 3SBKA 4AFSA 2A4GA 2A5AA 3SNBA 4Y7BA 1DOJA 4Y6DA 2UUJB 1Z1IA 1HAOH 1KXBA 5L30H 1Z6JH 1EOLA 1SGNE 1HJ8A 1XUHA 3M3SA 3T5FH 1T8MA 1UTQA 2XW9A 1EPTA 2BX3A 2V6NA 3DUXH 1YLDA 1O5BB 3L3TA 2CHAB 2KAIA 1YPGH 5A0CA 3KCGH 3UREA 1GBIA 1TWXB 1VCQA 5DP8A 1GVLA 4DT7B 4FU9A 4R0IA 2BDIA 5FHTA 3NUMA 1H8DH 2C3SA 4ISHH 5EGMA 2AS9A 3TJNA 1OP0A 3BG4C 2A7CA 1ZHRA 1ZJKA 3V12A 4IC5A 2IPHA 1RIWB 3RXAA 1RGQA 4MG3A 3DFLA 4XDEA 1Y3YA 1C5SA 5DG6A 1CA0C 3A8AA 1PFXC 3MHWU 3PTBA 2ZDNA 2BD5A 2G00A 3RXLA 4BTUB 1TQ7B 1GPZA 2C8WB 1ZR0A 1NRNH 1ARBA 2C8YB 1F0TA 3M37A 1UK2A 4B71A 1IHSH 2PW8H 3TK5A 3ODFA 1FNIA 4U01A 1GCDA 3W94A 4K5ZA 1LCYA 1LHEH 3PWBA 1WQVH 3CS0A 1SQAA 1P2IA 4I8GA 3UR6A 1YYY1 2BDGA 1EP6A 2OTVA 1PPBH 1L0ZA 1YM0A 5I46H 4INHA 2ILNA 1ZSJA 3VB5A 1GJ5H 4AGKA 1GHAG 2A5IA 2HNTC 3MFJA 3VPKA 4CHAB 4X1NU 3MNXA 3GDSA 1KXFA 1BBRK 1T32A 1ELVA 1ELCA 2WUCA 4FVBA 4A1XA 1O3BA 1QQUA 1RRKA 1GI4A 4JYUH 4WMEA 1Y3VA 4RKJB 1GI8B 4FUEA 3MH7A 5DO4H 2RDLA 3KEEA 3D65E 1T4UH 1GL1A 1TBZH 5FPSA 5CHAB 1QNJA 1KY9A 1SG8B 2W7UA 1BJVA 1RJXB 3Q3YA 1TPOA 3Q3XA 1V2PT 1ZTKA 5FXLA 2BY6X 1C5UA 1O2HA 3S7HB 4GUXA 2ZGHA 2RG3A 1A46H 1BITA 3OYPA 3P95A 2H6MA 3SUGA 1TQ0B 4UFFH 1KLIH 1SPJA 3D23A 4B2CA 4LZ4B 1LHFH 1MAXA 3CS7A 1JOUB 3TNTA 1C2FA 1MBQA 1GGDC 4X6MA 3RXKA 1KDQA 3FFGA 5GXPA 1MTUA 2FLBH 1VITH 1UTLM 1BMNH 1AD8H 2NU3E 4OGXA 2PUXB 2PTCE 2M5TA 4WF8A 4YLQH 3SGBE 3TK9A 3DT0H 1CHOG 3BF6H 1GBFA 4U32A 4UE7H 4DOQA 2PSXA 2FXRA 1TGCA 1ZRKA 3S69A 4MPUA 1QRZA 4XFQA 3MTYA 2NU4E 2VIQA 2ANMH 2H1UA 1ZTLA 1W14U 2QY0B 1TBQH 5EXNA 1AKSB 4B2AA 1SFIA 2Y7XA 3RLWH 3SN8A 4AN7A 1YF4A 2Y6TA 5GIBA 4ZXXH 2WYJA 3VB6A 3GYMA 3JZ2B 1QBOA 1NROH 1QGFA 5TCAA 4XOJA 1K1OA 1E34B 2HPQH 2ZNKH 4ZKSU 1FN8A 1GJ4H 4X6PA 1GJAB 1QURH 1C9PA 1V2RT 2BMGB 1MZAA 2SGQE 1V2UT 3M36A 2LPRA 2ZP0H 5C20A 1O2WA 3KN2A 3URCA 4ZKOU 3P6ZB 1C5QA 3A89A 3PWCA 1AFEH 4Q80A 1B7XB 3ZZCA 2RA3A 1W10U 3PO1B 1CT2E 3ATMA 2JETB 4B74A 1AB9C 3A7XA 2FOHA 2SGFE 1W12U 2AMQA 4FVDA 5DP3A 1JWTA 3RXIA 1L1JA 1NC6A 1ORFA 2O9QA 3QGNB 4FUGA 3ZZBA 1P06A 2AGGX 3A85A 1GBJA 3NKKA 1OWEA 3DD2H 3RC4A 1Y8TA 1OP2A 4UFEH 3LGUA 1ARCA 8GCHF 1ZSLA 1XUJA 2CF9H 3RMOH 2JH5D 2VIWA 4YTAA 3LGVA 1ABIH 1NFUA 5C1UA 1ESBA 1W11U 1DX5M 3P17H 1C2IA 5K0HA 1A0LA 5JBCS 1P3CA 1HIAB 1V2VT 1V2ST 1P2OA 1DFPA 4JZIA 4JZ1A 2W26A 1O3EA 3LIWA 4A7IB 4CH8B 2AH4X 4Y0ZE 1EB1H 1PPZA 2Q6FA 3LT3A 2BLQA 5AF9H 4X6OA 3RP2A 4GCHF 4WH8A 4IBLH 1IQNA 2FZZA 3I29A 1C1WH 2J9NA 2NU1E 1V2NT 1CGHA 1C1UH 3QK1A 3PLPA 1BTUA 1TRMA 1AO5A 3ESTA 2Z9JA 2BZ6H 1VCPA 5EQRA 2BOHB 3UUZA 3EQ0H 4E7RG 1AWHB 2ZU4A 1BB0B 1NU9A 1BTPA 2D8WA 2GX4A 1O2ZA 2Z9GA 3ZV9A 3GDUA 1C5YB 4X8SH 4Y8YA 3L33A 2P94A 2Z3CA 5FX5A 3ZZ9A 4CBNA 2SFAA 5JB9S 2VH6A 2RA0A 1HAZB 1ZGIA 2J4IA 1PQAA 1RFNA 7ESTE 3FZZA 2ZWLH 1O5FH 5AHGH 1GHVH 1W0YH 5FPTA 4BNRA 5K7RA 1UVPA 1UTJA 1TNJA 3LGYA 2P3UB 3S9BA 4MPXA 4ABFA 3T27A 5TJXA 4X1SU 1O33A 1V2QT 2ZQ2A 3MNBA 4ZKNU 2ZCHP 1K21H 2QC2A 2TGTA 1UJ1A 2WINI 4B75A 3SHCH 1NPMA 2JH0D 2BQWB 1O3GA 1ANBA 1NTPA 2A7HA 2BLWA 4Q2KA 2WUBA 4JZFH 2VWOA 1DT2A 1KXCA 1N1LA 2SGDE 2V35A 3BV9B 2ZDMA 1ELGA 1O3PB 4U2WA 2PKSC 2BD2A 3SV2H 1EZQA 1C5ZB 3QX5H 4AFUA 3H7TA 1FAXA 1C9TA 2PLXA 1FPHH 5L2YH 1YP9A 3VGCC 1B0FA 3LDXH 2VNTA 4MPVA 3RXQA 4A1TA 3GY8A 5A2MH 3ZZ8A 1F7ZA 2FS9A 2OINA 4O97A 1OS8A 2WPMS 2FOEA 3HGNA 1A5IA 3TITA 3KIDU 4ABEA 1QBVH 1S85A 1K1LA 5ETXA 2Q6DA 1C5LH 1NZQH 2G5NA 1NRQH 1E35B 1XKBC 4BTIB 4KTCA 1A3EH 1HJAB 1E0FD 3ELAH 1TGTA 1LKAA 1GHYH 1O2GH 1V2WT 1W7GH 2TGDA 3KQEA 1SLWB 1T4VH 3AVZA 2GCTB 3SU1A 1JRTA 4HZHA 1THPB 3KQBA 1L1GA 2BB4A 1OPHB 2V3HH 3UQOA 2FYQA 3ZVEA 3RXPA 2NWNA 2XC0A 3MNSA 1HYLA 5E0GA 1SGIB 1UO6A 4X1QU 3UNRA 4OGYA 1A0JA 1PPFE 2ZC9H 3A87A 2F83A 2OCVB 3BTGE 4X8VH 1ELBA 1TGNA 5L6NH 1ZLRA 3GDVA 3ZVGA 4ISNA 3Q77A 3PMJA 2OQUA 1GI7B 1GJ7B 3MYWA 1Z6EA 3HGPA 4YOGA 5DPAA 1H9IE 3MH6A 2VWNA 1DWDH 1ZZZA 2OBOA 1YCPH 3P70B 1YPEH 4NFEA 4INKA 1EPTB 4NA9H 1NU7B 4TYDA 4NGAH 1QR3E 1UK3A 1MH0A 4Q7ZA 5C5OA 3P8OA 3ZVAA 1ZJDA 2CGAA 1GG6B 3M5OA 1DY8A 3GCTG 1L2EA 2GCHF 3SNDA 4A92A 2ANYA 1EPTC 1CSOE 2ZI2H 1GJ8B 1D4PB 2WPKS 1O2SA 1UMAH 1TONA 1LVYA 1O5CB 3LC3A 3OU0A 1O32A 4FXGH 4AZ2B 1FPCH 1EZSC 1GBEA 1TBRH 5JBBS 4YOJA 1BHXB 4GAWA 2JKHA 2F9PA 4B2BA 1GHBF 3M5NA 2Z3DA 2AIPA 5JYIA 2GVFA 3VB4A 1J8AA 3SU2A 1EJAA 3UIRA 3SU4A 1Z7KA 2YNAA 2QXIA 4SGBE 2XNIA 6GCHF 2FDAA 1NESE 1CHOF 4MQAA 2PFEA 4NSVA 4J1YA 1EQ9A 4I31A 4U30A 4E7NA 2AIQA 5HXFA 1O3HA 5HMAA 4Z0KA 2BDCA 2P59A 2SGAA 3MH5A 1GBDA 4B73A 2BDYA 3A7ZA 2VVVA 5ABWA 3PB1E 5SGAE 4JCNA 3GOVB 4TY6A 1TOCB 2A2QH 2R2WU 1UTKA 2BD8A 1NRPH 3UTUH 1LQEA 1SGEE 2IJOB 1Q31A 1O2UA 4WMDA 4AORA 1P2JA 1LHDH 1LQDB 1O2YA 2STAE 4BANB 5T6DA 1YCPM 1GHWH 1GI9B 3AW0A 3QTOH 1Q2WA 1DS2E 2OBQA 1TA2A 1KYNA 2B5TB 4BTTB 1TMTH 1OX1A 4ZMAH 1ZMJA 4Y76A 1QY6A 1HGTH 2BY8X 2P8OC 1TLDA 2C4FH 1FY4A 1P10A 2QYIA 2I6QA 1HXFH 1OWHA 3VB7A 4WXVA 1O5AB 4OS6A 1L4ZA 5DGJA 1EJNA 3SNEA 2SNWA 1DXWA 3Q76A 3TJUA 1SHYA 3ITIA 1BJUA 1D3DB 3NCLA 1QA7A 1QQ4A 1FY3A 3TH4H 1QB9A 2Y80A 4UDWH 3F9GA 1ZRBA 1O37A 3LPRA 3UNQA 5GDSH 1HB0B 1V2MT 3DFJA 1FONA 2A45B 1FN6A 3E91A 2BDBA 5C67A 2GZ7A 1MKWH 4DURA 1LMWB 2HOBA 2ZDLA 4WMFA 1HNEE 3PLBA 5I25A 2ZQ1A 4IW4E 3RU4E 2ZGCA 2A1DB 2BXUH 1B5GH 1A2CH 5A0BA 5DP6A 1AUTC 1SQTA 1K2I1 1KLJH 4BXSA 2EEKA 1GL0E 2PV9B 1EKBB 1SGQE 1PYTC 3MOCA 1A0HB 1P2KA 1T8OA 1XX9A 1QJ1B 1S0RA 3O8BA 4H4FA 1K28D 1LTOA 1G9IE 5DP4A 2AMDA 4YLUA 4X8TH 1AHTH 2BD7A 1DWBH 5GCHG 3HKIB 1OWJA 1WAYB 2UUKB 1OWKA 1IOEA 1C4U2 1O38A 3Q00A 3T26A 1O2RA 2ZHEH 1OWIA 4YO9A 2EI8A 1K22H 1UHBA 3LGTA 5BPEA 3RXBA 3UNSA 3FANA 5JDUB 4X8UH 1ZPZA 3TGKE 1FY8E 1Q3XA 3HKJB 1Z8RA 1UHBB 1DWCH 2AYWA 3A84A 1C1VH 3U69H 4DY7B 2H5CA 1XXDA 1HJAC 3MNCA 1G2MA 1Y3XA 2A4RA 1Y5AT 1H9LB 5J4QA 1YGCH 4NA8A 1SHHB 1DSUA 1UCYK 5TCCA 1GCTB 1P9UA 5EU8A 1GI5A 4JYVH 1WSSH 1Y59T 1F92A 5E0HA 1FJSA 3EAJA 4ZHLU 1ANDA 3SV6A 3SV9A 2WPLS 3NK8A 4X2WA 2B9LA 2H2ZA 3TJOA 2PWXA 3A86A 1S5SA 1EZXC 3A83A 3P92A 1J14A 3T62A 4FUIA 4Y10E 1D3PB 2A32A 4AYVB 1BTYA 1GJCB 2XBYA 4ISOA 4IS5A 1AI8H 1XKAC 3RXJA 3SZNA 1YPMH 1C1TA 2GDDA 2ZFPH 1HV7A 3C1KA 4TPYA 1ELTA 2Z6BD 2ZHDA 4OS7A 4AB8A 1RTLA 4FUBA 3ZZ6A 3E0PB 2ALVA 1NM6A 1Y3WA 3PV4A 4H6SB 2BXTH 1V2LT 4LK4A 1D3QB 2VVCA 1DSTA 3ENSB 4DJZB 5LPEA 3B23B 1QJ6B 4XSKU 5FBEA 3SOSA 1GJ6A 5GCHF 2GKVE 4I32A 1W13U 1C4V2 3SGQE 1GDQA 1O2XA 1GBHA 2BVSH 2CMYA 1PQ5A 2ZECA 3ATWA 1CQQA 5LPFA 1EZUC 3A7WA 1H8IH 4UD9H 3TGJE 2F3CE 2XC4A 1AY6H 1HCGA 3RU4T 3TIUA 4NWKA 4ZUHA 2J94A 1QA0A 4Y8XA 1P2NA 1SLXB 1C1PA 2VWMA 2P93A 1UCYH 3RXSA 4KTUA 3KF2A 2GMTC 3K6YA 2OLGA 1TB6H 4DVAU 5EPNA 7GCHG 4H42U 2O8TA 2GD4B 1ZSKA 3V7TA 1PPGE 4THNH 1O3KA 2C93B 2FTLE 1EAXA 3GISB 2ZZUH 4Q7XA 1BOQA 1HAXB 2A4QA 5GJ4B 3R3GB 3ZZAA 3EA7A 4ISIH 2H9HA 5F8ZA 4X2VA 2Y7ZA 1JIRA 3KNXA 1H1BA 2TRMA 3VXEH 2GMTB 2ZFFH 3RDZA 1AE8H 4VGCC 1O3AA 3LJJA 4YT6H 1FQ3A 4DW2U 1INCA 2Z9IA 2IN2A 1JMOH 8LPRA 1ZYOA 1RS0A 4FUJA 5HYOA 3FAOA 1V2TT 3A7VA 4NIYA 3ATIA 2VVUA 1HAVB 8GCHG 2XWAA 4MNWA 1Z1JA 1VZQH 2BZAA 1BMAA 1F5LA 4D8NA 3BG8A 3ZYDA 1O3CA 1UTOA 2BY9X 2OC7A 4AFQA 1MQ6A 1BBRE 4A5TS 1C2LA 1QB6A 1O3IA 3VGCB 3SGAE 3SQHE 2QA9E 2AMPA 4QT8C 3SJIA 3RXFA 2AERH 1DDJA 1CBWB 2FI4E 1C2HA 3RXEA 1L1NA 5T6FA 4XBBA 2I6SA 3RXGA 5A8ZA 1QHRB 3A7YA 2TIOA 3P8NA 4XBDA 3M3VA 1A61H 3B9FH 5JBAS 2GZ9A 1UTNA 5BRRE 1FY5A 3P8GA 6ESTA 2QCYA 1VITF 3BTEE 5J4SA 4NG9H 1LO6A 4GPGA 1SOZA 2Z9LA 4CBOA 1HIAA 1B0EA 3MMGA 1VJAU 5E8EH 2AGEX 3K2UA 1DLKB 2XRCA 1GGDB 2BY7X 1P57B 2BQ7B 2Q1JA 1V6DA 2SGEE 4LXBH 1CBWC 3IG6B 1BRCE 4GCHG 1AVWA 1BTZA 4BAMB 1MU8B 2FTMA 1G3EA 2ZU2A 2ZDAH 1GBKA 2BD4A 2EC9H 3GICB 5DK1A 3SHAH 2TGAA 2BD9A 2J2UA 3UOUA 2XBVA 3GCOA 4K1SA 3UPEA 1X7AC 3NZIA 1T31A 1AFQC 3BG4B 1ZOMA 1C5NH 1WBGB 2F9VA 3PMHB 2BVRH 3S7KB 1SSXA 1P2MA 2A7JA 2V3OH 2A0QB 2ZU5A 1P11E 2W7SA 3RC6A 1C5OH 2Y82A 1CVWH 3SW2B 4CRCA 2PKAA 1C2MA 1O0DH 4E06H 3GYLB 2VIDA 1VGCB 2QAAA 3U1IB 3UOPA 3VFEA 3U8OH 1O2JA 1O3FA 2FOAA 1MTNC 3M3TA 1C5MD 1O34A 1FAKH 1SGPE 1LPGB 1TPPA 3GCHB 1GVKB 1W2KH 2FS8A 3IITA 2ZTXA 2R0LA 3HK6B 1XUFA 3Q3KA 2A2XH 1OP8A 1GJBB 3FP6E 5AFYH 2R2MB 2K1QA 3PLKA 4BAOB 4CR5A 3SV8A 3MO3A 5FPYA 4Y7AA 4NIXA 1GI2A 1IAUA 4AOQA 1FDPA 1TA6A 1FZZA 3JZ1B 1NFWA 1GBTA 3RXRA 2OP9A 1SGFG 3QTVH 3A8CA 3EA9A 1QRXA 1IQIA 4KGAA 4UONA 3MU0A 4CH2B 3I77A 2FI5E 5F03A 1GBLA 3PTNA 3RXMA 1GDUA 1TMUH 2H9EH 2HVXA 3K6ZA 1P05A 1AU8A 5FCRA 2D2DA 1DXPA 1SQOA 2FI3E 3TVJB 2DE8A 3R0FA 4IMQA 1BRUP 4NA7A 1C5XB 2YNBA 2C8XB 1C5WB 1UVOA 2PR3A 3ZVDA 3MU4A 1LVOA 2ANWA 4CRDA 4KKDA 1HAHH 3HK3B 3B8JA 1O2LA 5AVDA 1BTWA 4AGJA 2EA3A 1SOTA 3PM3A 3SORA 1EOJA 4X2YA 3KGPA 2XTTB 4A1VA 1UVTH 1A7SA 2FOFA 2OQ5A 3HPTB 2QXGA 5F8XA 4MDSA 1CA8B 1G3BA 1V2KT 1IQGA 3RXVA 4JK5A 2BLOA 2NU2E 4NFFA 3RLYH 3LH3A 1BRBE 3V3MA 1AVGH 1TNIA 3TPIZ 5C5NA 2VIVA 1VCWA 3RXCA 4ESTE 1GBMA 4SGAE 4AX9H 1RD3B 3OSYA 3SU0A 3KHVA 2GZ8A 2QXJA 1C5TA 3M61U 4BAQB 2UWPA 2G8TA 2OC0A 2ZGBH 4D76A 2QV1A 4M7GA 1QJ7B 4F49A 4IMZA 1C2EA 1THSH 1HAPH 1SI5H 1H9HE 3BEIB 1SL3A 1C1QA 2C90B 4HFPB 2GGVB 1O3JA 1Y3UA 3ZV8A 2WV5A 5T3HA 3M7TA 1MD8A 2NU0E 1PPCE 5HM2A 4I8LA 1RTKA 1SGFA 2TBSA 2ANKH 4NCYA 3LGWA 1G2LA 2BD3A 3TH3H 1J16A 2VU8E 1O5EH 2PGBB 1NT1A 5AFZH 1TIOA 1ETTH 1T8NA 2FX4A 1GWAA 1LHCH 1H4WA 4Y0YE 3CENA 1G3CA 5FX6A 1YPHE 2EI6A 1GVZA 1YPJH 4NZQA 3BTTE 3LKWA 5FAHA 3SQEE 4ABGA 4YT7H 1QL8A 3QDZB 5EOKA 1K1JA 3OTJE 1CU1A 4CHAC 2XYAA 1ANCA 1ZPBA 1C1RA 3URDA 3SU3A 2QGRA 1IQFA 1WV7H 1YKTA 1P2QA 1XXFA 3RMNH 4NIWA 2V0BA 4JK6A 3TLOA 5C1YA 1CGJE 2BYAX 4DG4A 2B8OH 1BRAA 1VR1H 1YPLH 2W3IA 5FBIA 2UUFB 2Z9KA 4I8HA 5EQSA 1KXAA 1MTSA 2PSYA 1YBWA 1P0SH 1DE7H 1ZPCA 1EJMA 4GHQA 6CHAB 2FOGA 3N7OA 5EQQA 3KQDA 4OS5A 4D9QA 1BTHH 1KIGH 4XE4A 2HALA 3U8TH 1BIOA 3HATH 2Y5GA 2ZHFH 1DITH 4RSPA 1EATA 1MCVA 2Z3EA 1PJPA 2GT8A 1QFKH 1W7XH 5CE1A 2GP9B 1GMDG 4MNVA 3RMMH 1O3MA 1N6YA 2FWWA 4O3UA 2XCNA 4K2YA 1HPGA 1C5RA 1SC8U 3L6PA 3E1XB 1ELFA 2J38A 2BLVA 1HAYB 4IGDA 5FCKA 1TFXA 3DA9B 2Y5FA 1IQLA 4DGJA 4I33A 3RMLH 3EDXB 2UUYA 1C2KA 1CGIE 4Y8ZA 1SGRE 1FMGA 2ZU3A 5IYTA 1O5DH 2UWOA 4NIVA 1DVAH 1P09A 2VJ1A 1LPKB 3A82A 4ABIA 1EUFA 4BAHB 5A0AE 7LPRA 2YOLA 1D6WA 4DIHH 4D7GA 3QZRA 4WXIA 1QL7A 1TPSA 3T2NA 1GBCA 1JRSA 2P16A 1GBBA 3C27B 6GCHG 3BEFB 5DP7A 1AVXA 1T7CA 1F5RA 4IN2A 2CJIA 2ZF0H 4K69A 2FO9A 1GMHG 2CHAC 1Z8IB 5G4BA 3S9AA 1P3EA 3F9FA 4CR9A 1AUJA 5JB8S 1TMBH 1O35A 4HGCA 1EAUA 4R8TB 1SR5C 1WTGH 3GY2A 3M5MA 3MO6A 1OWDA 3OY5U 2ZFTA 1S6HA 2QXHA 1NFXA 4ZHAA 3ZVFA 3F6UH 2JH6D 1AQ7A 2ASUB 1XVMA 3QZQA 2ZCKP 3A88A 2CXVA 3RXHA 3LJOA 5EXLA 1O3OA 3V13A 2OC1A 1Y5UT 2R3YA 1GI6A 3DHKH 2A31A 2F9OA 3SNCA 1K1NA 4LZ1H 2WPIS 4UFDH 5CHAC 4VGCB 1C5VA 2RCEA 4E05H 1BMMH 1O2OA 4CRGA 5HGGA 2PKSB 3UWJH 4ABJA 2OUAA 2B7DH 2OXSA 3MWIU 3BTWE 1F0UA 2HNTF 2BDHA 2F9BH 1CO7E 3TU7H 3STIA 4ABDA 4WY3A 2XBXA 1YPHC 3T25A 1OXGA 1BCUH 1C1NA 1FIWA 4PROA 5JBTA 1C2JA 2HGTH 1AIXH 4GLYA 1JIMA 1EP5A 4KTSA 2FOCA 1SGDE 1XUIA 3QLPH 1ESTA 2ZPRA 4X1RU 1D3TB 2XXLA 2ZGXH 4NZLA 1TGSZ 1TABE 1HAGE 3E8LA 3BTME 3V0XA 2ESTE 3BN9A 1GDNA 3ODDA 1M9UA 4IC6A 1MMJN 3BTKE 2P95A 1TALA 2Z94A 3ZZ5A 1SFQB 1YCPK 2H9TH 3MU1A 3O8CA 1QB1A 4JMYA 2Y5HA 2ODPA 2PGQB 2QF3A 2FM2A 1BBRH 5H4IB 5A09A 2F91A 1GJ9B 2VIOA 1BQYA 3W95A 1O2IA 1O3LA 1PPEE 3A7TA 4K8YA 3ZZ4A 2FEQH 1O2MA 4ZAEA 5EW2H 4FUHA 1ZMNA 3K9XB 2AEIH 3RU4D 1YPKH 1GG6C 1V2OT 2G5VA 1UK4A 2B0FA 4ISLA
chains in the Genus database with same CATH superfamily
1CHGA 4YESB 7KMEH 1E1QD 4GHTA 3MI4A 3UY9A 3ATLA 1OYQA 1EFRD 1MABB 1HAIH 3A80A 1ELEE 2D26C 3FOAA 1MBMA 1NRSH 2ZKSA 1C1MA 1TNGA 1IQKA 1H8HD 1S83A 1IQEA 1AB9B 1EAWA 1ETSH 2F9UA 2DE9A 3BSQA 1V3XA 2ODYB 1KXDA 2XWBI 1LHGH 1NN6A 1O39A 1AWFH 3ZZ7A 3LGIA 4K60A 1K0HA 3RXOA 2THFB 4ABAA 2BHGA 2FIRH 3KL6A 1LVBA 1QBNA 2FOBA 2G55A 2BDAA 3PROA 2ZFSA 1TE0A 1A5GH 1VJ9U 1BMFD 5C3NA 2Y81A 1K1IA 1TAWA 1XUGA 1VGCC 2TGPZ 3SJ8A 1C5PA 5EG4A 1O2NA 1HAVA 2VWLA 1DM4B 4HI3A 3OX7U 1FX0B 1GI1A 1SLVB 4TT3D 2Z7FE 2O8WA 3EE0B 4MVNA 3E0NB 2P3TB 2OC8A 1G32B 1SVPA 3GCHC 1HFDA 2ZEBA 4K8BA 2FODA 1K9OE 1SGCA 5A8XA 2GCHG 1KLTA 2PKAB 1MD7A 2HPPH 7GCHF 1TX8A 4X0WU 4CRBA 1E37B 1O36A 2FYRA 2D1JA 3QGJA 2J34A 1ELDE 1QCPA 1ELAA 3ZYEA 2P8OB 1DWEH 1GMHF 1OOKB 4RN6A 3LC5A 1F2SE 1U6QA 5LGOA 2R9PA 3LH1A 2AFQB 3DCLA 3F0OA 1EXFA 4CRAA 1SLUB 1V2JT 1S0QA 2BQ6B 2ZFRH 2WPHS 1MKXK 1GCTC 1GJDB 1P9SA 4H6TA 3NXPA 1ACBE 1KDQB 1AMHA 4X1PU 4WWYA 4F4OC 4TWWA 3M7QA 1WUNH 4ZHMU 2PUQH 3O8DA 1VITG 1P8VC 1J9CH 3O8RA 4ABHA 1GMCG 2FP7B 4FU7A 3VXFH 2ODQA 1IHTH 2ZA5A 1COWD 3LONA 2ZO3H 4KELA 2G4UA 1G37A 4Q7YA 1D6RA 3TGIE 4XBCA 1HRTH 4RT1A 5L2ZH 1MU6B 4BOHA 4I7YH 1GMDF 3QN7A 3F68H 4CREA 1S82A 1F0SA 1XVOA 1MAYA 3TJVA 1MCTA 1MKWK 1O2VA 4DCDA 4X2XA 1ZTJA 1CA0B 1TRYA 3MU8A 1F5KU 2R0KA 5DJ7A 3QO6A 3N99A 3UWIA 1UTMA 1FIZA 4FUFA 2DUCA 3FN8A 1FV9A 1TX6A 4I86A 2ZHQH 3WY8A 4J2YB 2AGIX 4I8KA 2H5DA 1NRRH 2FMJA 1PPHE 1A3BH 1HBTH 2BTCE 1TNLA 2J92A 4K1TA 3VEQB 2CN0H 1N8OC 2ZTYA 3BTQE 4UEHH 3F2GA 5CMXH 2BM2A 3E6PH 1LDTT 1TNKA 3EYDA 4GSOA 1IQHA 2G81E 2GCTC 3CNRA 1S84A 2O8LA 1ZMLA 1ANEA 4WJG2 2G52A 1DANH 1K1PA 1E36B 1S6FA 6CHAC 1Z8JB 3WW7A 4AFZA 4INLA 2FOMB 4CRFA 2EQNA 2ALPA 1GMCF 2P3FH 4B76A 1UVUH 2XCFA 5B6OA 1DLEA 2STBE 1UVSH 2C8ZB 1PYTD 4ZKRU 2KAIB 3SUFA 4AG1A 4TSFD 2AHME 1EB2A 1HJ9A 3IWMA 4MLFB 4FUCA 2LNCA 5A8YA 2ZGJA 3E90B 3SO3A 1SGTA 3BTFE 3KQ5A 1W0KD 3SU5A 1A1RA 4AYYB 1FI8A 1NY22 5EPYA 3SNAA 4MNXA 1TRNA 2W6ID 4O9VA 4OS1A 4D9RA 2O8MA 4TY7A 1CT4E 1FXYA 4UFGH 3FP8E 3D49H 3SV7A 1AKSA 3H7OA 1TNHA 2ZPSA 5E2PA 4MTBA 2WPDD 4JYTA 1C1SA 4ZROA 4HTCH 2O8UA 1AFQB 3GCNA 1MTVA 6LPRA 4OM9A 4K1EA 1HUTH 3S0NA 5HM9A 2CV3A 3PMBB 3RXTA 3FVFB 3ZVCA 1J17T 1ZHMA 1RIWC 4Y79A 4BAKB 1JBUH 4I8JA 3NWUA 4ZH8A 3AW1A 1GHZA 4AC9A 4D7FA 1J15A 2BVXH 1W0ZU 2PTNA 1YLCA 2ZHWH 3RXDA 2GT7A 3F3BA 1GHAF 1UTPA 4Y71A 5LH8A 2PP6A 4B1TA 5EXMA 2ZDKA 1ETRH 2FX6A 1G30B 3TNSA 3MH4A 3MU5A 3GY3A 4FUDA 2YMSD 1AN1E 2G51A 2ZU1A 3ZZ3A 1NS3A 1XUKA 4Z6AH 1QIXB 2F9NA 1O3NA 1FLEE 3F2FA 1S6LA 1HXEH 3AASA 1MUEB 3EA8A 1SGYE 2GTBA 3F9HA 3E16B 4P00A 5C2ZA 2ZG0H 1BTXA 1WQSA 2ULLA 3LOXA 3A8BA 4IN1A 1LPZB 1LVMA 1ZGVA 9ESTA 2IOTA 2QIQA 3OFND 1OSSA 1C2DA 3A8DA 1G3DA 3VB3A 2JETC 2HLCA 3BIVH 1DICA 2FLRH 1WOFA 1G36A 1L4DA 2WV4A 1BA8B 1HDTH 3RM0H 2HWLB 1O2QA 1GI0A 1GHXH 2OD3B 5ESBA 2EY4C 4JZEH 5T6GA 4YZUA 1MQ5A 1TGBA 3CP7A 3F9EA 4JZDH 5EODA 3AK5A 3G01A 3PRDA 3PYHA 1EX3A 1CE5A 4A6LA 3M5LA 1MTNB 4K3JA 1E38B 1WCZA 2VB0A 3BIUH 1SB1H 3T28A 1IQMA 2A5KA 2XC5A 1O31A 1WYKA 1PQ7A 1THRH 1O3DA 1S81A 3AAVA 1AZZA 3T29A 1KTSB 5DP5A 1BUIA 8KME2 1IQJA 2VINA 1AGJA 3MO9A 2BX4A 5ESTE 1OKXA 3BTHE 1F0RA 1DUAA 1MKXH 4TPIZ 1W8BH 1O2PA 3SJ9A 3BEUA 2G4TA 1SBWA 1NFYA 1CT0E 2SGPE 3SI4H 3RXUA 1QTFA 3U98H 3UQVA 3GY7A 2ZCLP 3STJA 4MPWA 1Y5BT 4B6FA 3OY6U 4O03A 2GV6A 3RM2H 5PTPA 1BT7A 2QF0A 8ESTE 2GV7A 1DPOA 2VH0A 1FUJA 3GY5A 1O30A 2HRVA 2TPIZ 3QUMP 4DIIH 5DKMA 1P01A 3RUOA 3A81A 1GHBG 5LPRA 1LKBA 2VGCB 1Z8GA 1HLTH 1TOMH 4YOIA 1GI3A 3UFAA 1ID5H 2XBWA 1RTFB 3UR9A 5HKKD 1TYNA 1GBAA 4HG6A 4LOYH 3TK6A 2KCAA 2VGCC 2FPZA 2EI7A 3GCTF 5C0TA 3E3TA 4NWLA 1JXPA 2ZFQH 3ZZDA 1Z71A 5EW1H 4WH6A 4KP0A 4Y11E 4AG2A 1KTTB 1T8LA 1YC0A 1P02A 3SUDA 1MZDA 2BY5X 1EASA 2ZIQH 1OYTH 1KXEA 2M2AA 1A5HA 1NO9H 5IDKA 4YM9A 4ZXYH 1DY9A 5DP9A 1XMNB 3SJKA 4WVPE 1D9IA 4NSYA 1MTWA 1UCYE 2LELA 4OS2A 2HNTE 4FU8A 1AZ8A 3FP7E 4ASHA 2CF8H 1QL9A 3LU9B 5F6MA 2Q6GA 3S9CA 2R3UA 1RXPA 4O3TA 1BMLA 2VIPA 2W3KA 2KZ4A 3QWCH 3D62A 2UWLA 4AB9A 1C2GA 4MNYA 1ABJH 3GY4A 1TPAE 3FZDA 3PMAB 3H5CB 1QRWA 1SMFE 2ZTZA 1KSNA 3K65B 3F1SB 1BDAA 1BHXF 3RC5A 2J95A 1W3CA 3PO1C 1N6XA 3SU6A 3I78A 1O2TA 1P12E 1WTHD 1C4Y2 3NPSA 5GWZA 1PQ8A 1N8OB 3ZVBA 5C1XA 2PHBA 3M35A 1WU1A 2FESH 9LPRA 4OS4A 3U8RH 1P03A 1QZ8A 2BOKA 2GDEH 1ESAA 2ZPQA 3EGKH 2W5EA 3AAUA 3M7UA 3P8FA 4GVUA 1O2KA 3TH2H 4RKOB 3N7DA 1C1OA 3OEED 4ABBA 1O5GH 3U1JB 5F8TA 5GPIB 1TX7A 2WYGA 1BZXE 3U9AH 4TWYA 3DSGA 1XM1A 3SUEA 1P04A 2ZDVH 1EAIA 2SNVA 4BXWA 3ATKA 1DUEA 2L6OA 5E0JA 5JPMH 1AE5A 5E2OA 1A4WH 4X6NA 3SI3H 2QN5T 1FY1A 3SJOA 1WDIA 2A4OA 3GY6A 1K1MA 1ZHPA 2W6JD 3BTDE 3KQCA 2WPJS 3SBKA 4AFSA 2A4GA 3SYJA 2A5AA 3SNBA 4Y7BA 1DOJA 4Y6DA 2UUJB 1Z1IA 1HAOH 1KXBA 5L30H 1Z6JH 1EOLA 5B6LA 1SGNE 1HJ8A 1XUHA 3M3SA 3T5FH 1T8MA 1UTQA 2XW9A 1EPTA 2BX3A 2V6NA 3DUXH 1YLDA 1O5BB 3L3TA 2CHAB 2KAIA 1YPGH 5A0CA 3KCGH 3UREA 3SZEA 1GBIA 3KYGA 1TWXB 1VCQA 5DP8A 1GVLA 4DT7B 4FU9A 4R0IA 2BDIA 5FHTA 3NUMA 1H8DH 2C3SA 4ISHH 5EGMA 2AS9A 3OTPA 3TJNA 1OP0A 3BG4C 2A7CA 1ZHRA 1ZJKA 3V12A 4IC5A 2IPHA 1RIWB 3RXAA 1RGQA 4MG3A 4RT0A 3DFLA 4XDEA 1Y3YA 1C5SA 5DG6A 1CA0C 3A8AA 1PFXC 2WHXA 3MHWU 3PTBA 2ZDNA 2BD5A 2G00A 3RXLA 4BTUB 1TQ7B 1GPZA 2C8WB 2V3MA 1ZR0A 1NRNH 1ARBA 2C8YB 1F0TA 3M37A 1UK2A 4B71A 2QF4A 1IHSH 2PW8H 3TK5A 3ODFA 1FNIA 4U01A 1GCDA 1YY3A 3W94A 4K5ZA 1LCYA 1LHEH 3PWBA 1WQVH 2KCYA 3CS0A 1SQAA 1P2IA 4I8GA 3UR6A 1YYY1 2BDGA 1EP6A 1SQRA 2JIZD 2OTVA 1PPBH 1L0ZA 1YM0A 1NBME 5I46H 4INHA 2ILNA 1ZSJA 3VB5A 1GJ5H 4AGKA 1GHAG 5CHBA 5GNDA 1WXRA 2A5IA 2HNTC 3MFJA 3VPKA 4CHAB 4X1NU 3MNXA 3GDSA 1KXFA 1BBRK 1T32A 1ELVA 1ELCA 2J97A 2WUCA 4FVBA 5C0UA 2KM0A 4A1XA 1O3BA 1E1RD 1QQUA 1RRKA 1GI4A 4JYUH 4WMEA 5EJLA 1Y3VA 4RKJB 1GI8B 2K8IA 4FUEA 3MH7A 5DO4H 2RDLA 3KEEA 3D65E 1T4UH 1GL1A 1TBZH 5FPSA 5CHAB 1QNJA 5CDFE 1KY9A 1SG8B 2W7UA 1BJVA 1RJXB 3Q3YA 1TPOA 3Q3XA 1V2PT 1ZTKA 5FXLA 2BY6X 1C5UA 1O2HA 3S7HB 2GJGA 4GUXA 2ZGHA 2RG3A 1A46H 1BITA 3OYPA 3P95A 2H6MA 3SUGA 1TQ0B 4UFFH 1KLIH 1SPJA 3D23A 4B2CA 4LZ4B 1LHFH 1MAXA 3CS7A 1JOUB 3TNTA 1C2FA 1MBQA 1GGDC 4X6MA 3RXKA 1KDQA 3FFGA 5GXPA 1MTUA 2FLBH 1VITH 1UTLM 1BMNH 1AD8H 2NU3E 4OGXA 2PUXB 2PTCE 2M5TA 4WF8A 4YLQH 3SGBE 3TK9A 3DT0H 1CHOG 3BF6H 1GBFA 4U32A 4UE7H 3ZIAD 4DOQA 2PSXA 2FXRA 1TGCA 1ZRKA 3S69A 4MPUA 1QRZA 4XFQA 3MTYA 2NU4E 2VIQA 2ANMH 2H1UA 1ZTLA 1W14U 2QY0B 1TBQH 5EXNA 1AKSB 4B2AA 1SFIA 2Y7XA 3RLWH 3SN8A 4AN7A 1YF4A 2Y6TA 5GIBA 4ZXXH 2WYJA 3VB6A 3GYMA 3JZ2B 1QBOA 1NROH 1QGFA 5TCAA 4ZCNA 4XOJA 1K1OA 1E34B 2HPQH 2QF5A 2ZNKH 4ZKSU 1FN8A 1GJ4H 4X6PA 1GJAB 1QURH 1C9PA 1V2RT 2BMGB 1MZAA 2SGQE 1V2UT 3M36A 2LPRA 2ZP0H 5C20A 1O2WA 5HIYA 3KN2A 3URCA 4ZKOU 3P6ZB 1C5QA 3A89A 3PWCA 1AFEH 4Q80A 1B7XB 3ZZCA 2RA3A 1W10U 3PO1B 1CT2E 3ATMA 2JETB 4B74A 1AB9C 3A7XA 2J98B 2FOHA 2SGFE 1W12U 2AMQA 4FVDA 5DP3A 1JWTA 3RXIA 1L1JA 1NC6A 1ORFA 2O9QA 3QGNB 4FUGA 4YXWD 3ZZBA 1P06A 2AGGX 3A85A 1GBJA 3NKKA 1OWEA 3DD2H 3RC4A 1KMHB 1Y8TA 1OP2A 4UFEH 3LGUA 1ARCA 8GCHF 1ZSLA 1XUJA 4Q4LA 2CF9H 3NRLA 3RMOH 2JH5D 2VIWA 4YTAA 3LGVA 1ABIH 1NFUA 5C1UA 1ESBA 1W11U 1DX5M 3P17H 1C2IA 5K0HA 1A0LA 5JBCS 1P3CA 1HIAB 1V2VT 4FETA 1V2ST 1P2OA 1DFPA 4JZIA 4JZ1A 2W26A 1O3EA 3LIWA 2YMSC 4A7IB 4CH8B 2AH4X 4Y0ZE 1EB1H 1PPZA 2Q6FA 3LT3A 2BLQA 5AF9H 4X6OA 3RP2A 4GCHF 4WH8A 4IBLH 1IQNA 2FZZA 3I29A 2WSSD 1C1WH 2J9NA 2RDEA 2NU1E 1V2NT 1CGHA 1C1UH 3QK1A 5DSFA 3PLPA 1BTUA 1TRMA 3PRBA 1AO5A 3ESTA 2Z9JA 2BZ6H 1VCPA 5EQRA 2BOHB 3F2HA 3UUZA 2L74A 3EQ0H 4E7RG 1AWHB 2ZU4A 1BB0B 1NU9A 1BTPA 2D8WA 2GX4A 1O2ZA 2Z9GA 3ZV9A 3GDUA 1C5YB 4X8SH 4Y8YA 3L33A 5HIZA 2P94A 2Z3CA 5FX5A 3ZZ9A 4CBNA 2SFAA 2KCOA 2VH6A 2RA0A 1HAZB 1ZGIA 5JB9S 2J4IA 1PQAA 1VKYA 2KCPA 1RFNA 7ESTE 3FZZA 2ZWLH 1O5FH 5AHGH 1GHVH 1W0YH 2KX4A 5FPTA 4BNRA 5K7RA 1UVPA 1UTJA 1TNJA 3LGYA 2P3UB 3S9BA 4MPXA 4ABFA 3T27A 5TJXA 4X1SU 1O33A 1V2QT 2ZQ2A 3MNBA 4ZKNU 2ZCHP 1K21H 2QC2A 2TGTA 1UJ1A 2JDID 2WINI 4B75A 3SHCH 1NPMA 2JH0D 2BQWB 1O3GA 1ANBA 1NTPA 2A7HA 2BLWA 4Q2KA 2KFWA 2WUBA 4JZFH 2KR7A 2VWOA 1DT2A 1KXCA 1N1LA 2SGDE 2V35A 3BV9B 1W0JD 2ZDMA 1ELGA 1O3PB 4U2WA 2PKSC 2BD2A 3SV2H 1EZQA 1C5ZB 3QX5H 4AFUA 3H7TA 1FAXA 1C9TA 2PLXA 1NBMD 1FPHH 5L2YH 1YP9A 3VGCC 1B0FA 3LDXH 2VNTA 4Z1MD 4MPVA 3RXQA 4A1TA 3GY8A 5A2MH 3ZZ8A 1F7ZA 2FS9A 2OINA 4O97A 1OS8A 2RFKC 2WPMS 2FOEA 3HGNA 1A5IA 3TITA 3KIDU 4ABEA 5DN6D 1QBVH 1S85A 1K1LA 5ETXA 2Q6DA 1C5LH 1NZQH 2G5NA 1NRQH 1E35B 1XKBC 4BTIB 4KTCA 1A3EH 4RI0A 1HJAB 1E0FD 3ELAH 1TGTA 1LKAA 1GHYH 1O2GH 1V2WT 3EE7A 1W7GH 2TGDA 3KQEA 1SLWB 1T4VH 3AVZA 2GCTB 3SU1A 1JRTA 4HZHA 1THPB 3KQBA 1L1GA 2BB4A 1OPHB 2V3HH 3UQOA 2FYQA 3ZVEA 3RXPA 2NWNA 2XC0A 3MNSA 1HYLA 5E0GA 1SGIB 1UO6A 4X1QU 3UNRA 4OGYA 1A0JA 1PPFE 2ZC9H 3A87A 2F83A 2OCVB 3BTGE 4X8VH 1ELBA 1TGNA 5L6NH 1ZLRA 3GDVA 3ZVGA 4ISNA 3Q77A 3PMJA 2OQUA 1GI7B 1GJ7B 3MYWA 1Z6EA 3HGPA 4YOGA 5DPAA 1H9IE 3MH6A 2VWNA 5C94A 3UAIC 1DWDH 1ZZZA 2OBOA 1YCPH 3P70B 1YPEH 4NFEA 4DT4A 4INKA 1EPTB 4NA9H 1NU7B 4TYDA 4NGAH 1QR3E 1UK3A 1MH0A 4Q7ZA 5C5OA 3P8OA 3ZVAA 1ZJDA 2CGAA 1GG6B 2WZQA 1DY8A 3M5OA 3GCTG 1L2EA 2GCHF 3SNDA 4A92A 2ANYA 1EPTC 1CSOE 2ZI2H 1GJ8B 1D4PB 2WPKS 1O2SA 1UMAH 1TONA 1LVYA 1O5CB 3LC3A 3OU0A 1O32A 2LP6A 4FXGH 4AZ2B 1FPCH 1EZSC 1GBEA 1TBRH 5JBBS 4YOJA 1BHXB 4GAWA 2JKHA 2F9PA 4B2BA 1GHBF 3M5NA 2Z3DA 2AIPA 5JYIA 2GVFA 3VB4A 1J8AA 3SU2A 1EJAA 3UIRA 3SU4A 1Z7KA 2YNAA 2QXIA 4SGBE 2XNIA 6GCHF 2FDAA 1NESE 1CHOF 4MQAA 2PFEA 4NSVA 3DSOA 1EQ9A 2K0QA 4I31A 4J1YA 4U30A 4E7NA 2AIQA 5HXFA 1O3HA 2IJD1 5HMAA 4Z0KA 2BDCA 2P59A 2SGAA 2WV9A 3MH5A 1GBDA 4B73A 2BDYA 3A7ZA 2VVVA 5ABWA 3PB1E 5SGAE 4JCNA 3GOVB 4TY6A 1TOCB 2A2QH 2R2WU 1UTKA 2BD8A 1NRPH 3PV2A 3UTUH 1LQEA 1SGEE 2IJOB 1Q31A 1O2UA 4WMDA 4AORA 1P2JA 1LHDH 1LQDB 3U28C 1O2YA 2STAE 4BANB 5T6DA 1YCPM 1GHWH 1GI9B 3AW0A 3QTOH 1Q2WA 1DS2E 2OBQA 1TA2A 1KYNA 3FO8D 2B5TB 4BTTB 1TMTH 1OX1A 4ZMAH 1ZMJA 4Y76A 1QY6A 1HGTH 2BY8X 2P8OC 1TLDA 2C4FH 1FY4A 1P10A 2QYIA 2I6QA 1HXFH 1OWHA 3VB7A 4WXVA 4ASUD 1O5AB 4OS6A 1L4ZA 5DGJA 1EJNA 3SNEA 2SNWA 1DXWA 3Q76A 2YMSB 3TJUA 1SHYA 3ITIA 1BJUA 1D3DB 3NCLA 3WWFA 1QA7A 1QQ4A 1FY3A 3H09A 3TH4H 1QB9A 2Y80A 4UDWH 3F9GA 1ZRBA 1O37A 3LPRA 3UNQA 5GDSH 1HB0B 1V2MT 3DFJA 1FONA 5KGOA 2A45B 1FN6A 2XNDD 3E91A 2BDBA 1OHHD 5C67A 2GZ7A 1MKWH 4DURA 2HVYB 1LMWB 2HOBA 2ZDLA 4WMFA 1HNEE 3PLBA 5I25A 2ZQ1A 4IW4E 3RU4E 2ZGCA 2A1DB 2BXUH 1B5GH 1A2CH 5A0BA 5DP6A 1AUTC 1SQTA 1K2I1 1KLJH 4BXSA 2EEKA 1GL0E 2PV9B 1EKBB 1SGQE 1PYTC 3MOCA 1A0HB 1P2KA 1T8OA 1XX9A 1QJ1B 1S0RA 3O8BA 4H4FA 1K28D 1LTOA 1G9IE 5DP4A 2AMDA 4YLUA 4X8TH 1AHTH 2BD7A 1DWBH 5GCHG 3HKIB 1OWJA 1WAYB 2UUKB 1OWKA 1IOEA 1C4U2 1O38A 3Q00A 3T26A 1O2RA 2ZHEH 5KECA 1OWIA 4YO9A 2EI8A 1K22H 1UHBA 3LGTA 5BPEA 3RXBA 3UNSA 3FANA 5JDUB 4X8UH 1ZPZA 3TGKE 1FY8E 1Q3XA 3HKJB 1Z8RA 1UHBB 1DWCH 2AYWA 3A84A 1C1VH 3U69H 4DY7B 2H5CA 1XXDA 1HJAC 3MNCA 1G2MA 1Y3XA 2A4RA 1Y5AT 1H9LB 5J4QA 1YGCH 4NA8A 1SHHB 1DSUA 1UCYK 5TCCA 1GCTB 1P9UA 2IPQX 5EU8A 1GI5A 4JYVH 1WSSH 1Y59T 1F92A 5E0HA 1FJSA 3EAJA 4ZHLU 1ANDA 2J5UA 3SV6A 5F53A 3SV9A 2WPLS 3NK8A 4X2WA 2B9LA 2H2ZA 2V7QD 4FOUC 3TJOA 2PWXA 3A86A 1S5SA 1EZXC 3A83A 3P92A 1J14A 3T62A 4FUIA 4Y10E 1D3PB 2A32A 4AYVB 1BTYA 1GJCB 2XBYA 4ISOA 4IS5A 1AI8H 1XKAC 3RXJA 3SZNA 1YPMH 1C1TA 2GDDA 2ZFPH 1HV7A 3C1KA 4TPYA 1ELTA 2Z6BD 2ZHDA 4OS7A 4AB8A 1RTLA 4FUBA 3ZZ6A 2JJ1D 3E0PB 2ALVA 1NM6A 1Y3WA 3PV4A 4H6SB 2BXTH 1V2LT 4LK4A 1D3QB 2VVCA 1DSTA 3ENSB 4DJZB 5LPEA 3B23B 1QJ6B 4XSKU 5FBEA 3SOSA 1GJ6A 5GCHF 2GKVE 4I32A 1W13U 1C4V2 3SGQE 1GDQA 1O2XA 1GBHA 2BVSH 2CMYA 1PQ5A 2ZECA 3ATWA 1CQQA 5LPFA 1EZUC 3A7WA 1H8IH 4UD9H 3TGJE 2F3CE 4XRNA 2XC4A 1AY6H 1HCGA 3RU4T 3TIUA 4NWKA 4ZUHA 2J94A 1QA0A 4Y8XA 1P2NA 1SLXB 1C1PA 2VWMA 2P93A 1UCYH 3RXSA 4KTUA 3KF2A 2GMTC 3K6YA 2OLGA 1TB6H 4DVAU 5EPNA 7GCHG 4H42U 2O8TA 2GD4B 1ZSKA 3V7TA 1PPGE 4THNH 1O3KA 2C93B 3FKSD 2FTLE 1EAXA 3GISB 2ZZUH 4Q7XA 1BOQA 1HAXB 2A4QA 5GJ4B 3R3GB 3ZZAA 3EA7A 4ISIH 2H9HA 5F8ZA 4X2VA 2Y7ZA 1JIRA 3KNXA 1H1BA 2TRMA 3UB0A 2GMTB 2ZFFH 3VXEH 3RDZA 1AE8H 1UW7A 4VGCC 1O3AA 3LJJA 4YT6H 1FQ3A 4DW2U 1INCA 2Z9IA 2IN2A 1JMOH 8LPRA 1ZYOA 1RS0A 4FUJA 4B6EA 5HYOA 3FAOA 1V2TT 3A7VA 4NIYA 3ATIA 2VVUA 1HAVB 8GCHG 2XWAA 4MNWA 3PV5A 1Z1JA 1VZQH 2BZAA 1BMAA 1F5LA 4D8NA 3BG8A 3ZYDA 1O3CA 1UTOA 2BY9X 2OC7A 4AFQA 1MQ6A 1BBRE 4A5TS 1C2LA 1QB6A 1O3IA 3VGCB 3SGAE 2J98A 3SQHE 5EIYA 2QA9E 2AMPA 4QT8C 3SJIA 3RXFA 2AERH 1DDJA 1CBWB 2FI4E 1C2HA 3RXEA 1L1NA 5T6FA 4XBBA 2I6SA 3RXGA 5A8ZA 1QHRB 4M9FA 3A7YA 2TIOA 3P8NA 4XBDA 3M3VA 1A61H 3B9FH 5JBAS 2GZ9A 1UTNA 5BRRE 1FY5A 3P8GA 6ESTA 2QCYA 1VITF 3BTEE 5J4SA 4NG9H 1LO6A 4GPGA 1SOZA 2Z9LA 4CBOA 1HIAA 5T1VA 1B0EA 3MMGA 1VJAU 5E8EH 2AGEX 3K2UA 1DLKB 2XRCA 1GGDB 2BY7X 1P57B 2BQ7B 2Q1JA 1V6DA 2SGEE 4LXBH 1CBWC 3IG6B 3W1EA 1BRCE 4GCHG 1AVWA 1BTZA 4BAMB 1MU8B 2FTMA 1G3EA 2ZU2A 2ZDAH 1GBKA 2BD4A 2EC9H 3GICB 5DK1A 3SHAH 2TGAA 2BD9A 2J2UA 3UOUA 2XBVA 3GCOA 4K1SA 3UPEA 1X7AC 3NZIA 1T31A 1AFQC 3BG4B 1ZOMA 1C5NH 1WBGB 2F9VA 2QE7D 3PMHB 2F43B 2BVRH 3S7KB 1SSXA 1P2MA 2A7JA 2CK3D 2V3OH 2A0QB 2ZU5A 1P11E 2W7SA 3RC6A 1C5OH 2Y82A 1CVWH 3SW2B 4CRCA 2PKAA 1C2MA 1O0DH 4E06H 3GYLB 2VIDA 1VGCB 2QAAA 3U1IB 3UOPA 1YWUA 3VFEA 3U8OH 1O2JA 1O3FA 2FOAA 5FL7D 1MTNC 1YLNA 3M3TA 1C5MD 1O34A 1FAKH 1SGPE 1LPGB 1TPPA 3GCHB 1GVKB 1W2KH 2FS8A 3IITA 2ZTXA 2R0LA 3HK6B 1XUFA 3Q3KA 2A2XH 1OP8A 1GJBB 3FP6E 4ACAA 5AFYH 2R2MB 2K1QA 3PLKA 4BAOB 4CR5A 3SV8A 3MO3A 5FPYA 4Y7AA 4NIXA 1GI2A 1IAUA 4AOQA 1FDPA 1TA6A 1FZZA 3JZ1B 1NFWA 1GBTA 3RXRA 2OP9A 1SGFG 3QTVH 3A8CA 3EA9A 1QRXA 1IQIA 4KGAA 4UONA 3MU0A 4CH2B 3I77A 2FI5E 5F03A 1GBLA 3PTNA 3RXMA 1GDUA 1TMUH 2H9EH 2HVXA 3K6ZA 1P05A 1AU8A 5FCRA 2D2DA 1DXPA 1SQOA 2FI3E 3TVJB 2DE8A 3R0FA 4IMQA 1BRUP 4NA7A 1C5XB 2YNBA 2C8XB 1C5WB 1UVOA 2PR3A 3ZVDA 3MU4A 1LVOA 2ANWA 4CRDA 4P02A 4KKDA 1HAHH 3HK3B 3B8JA 1O2LA 5AVDA 1BTWA 4AGJA 2EA3A 1SOTA 3PM3A 3SORA 1EOJA 4X2YA 3KGPA 2XTTB 4A1VA 1UVTH 1A7SA 2FOFA 2OQ5A 3HPTB 2QXGA 5F8XA 4MDSA 3F0PA 1CA8B 1G3BA 1V2KT 1IQGA 3RXVA 4JK5A 2BLOA 2NU2E 4NFFA 3RLYH 3LH3A 1BRBE 3V3MA 1AVGH 1TNIA 3TPIZ 5C5NA 2VIVA 1VCWA 3RXCA 4ESTE 1GBMA 4SGAE 4AX9H 1RD3B 3OSYA 3SU0A 3KHVA 2GZ8A 2QXJA 1C5TA 3M61U 3MQKC 4BAQB 2UWPA 1H8ED 2G8TA 2OC0A 2ZGBH 4D76A 2QV1A 4M7GA 1QJ7B 4F49A 4IMZA 1C2EA 1THSH 1HAPH 1SI5H 1H9HE 3BEIB 1SL3A 1C1QA 2C90B 4HFPB 2GGVB 4ACBA 1O3JA 1Y3UA 3ZV8A 2WV5A 5T3HA 3M7TA 1MD8A 2NU0E 1PPCE 5HM2A 4I8LA 1RTKA 1SGFA 2TBSA 2ANKH 4NCYA 4XD7D 3LGWA 1G2LA 2BD3A 3TH3H 1J16A 2VU8E 1O5EH 2PGBB 1NT1A 5AFZH 1TIOA 1ETTH 1T8NA 2FX4A 1GWAA 5C17A 1LHCH 1H4WA 4Y0YE 3CENA 1G3CA 5FX6A 1YPHE 2EI6A 1GVZA 1YPJH 4NZQA 3BTTE 3LKWA 5FAHA 3SQEE 4ABGA 2F4LA 1QL8A 2JJ2D 4YT7H 3QDZB 5EOKA 1K1JA 3OTJE 1CU1A 4CHAC 2XYAA 1ANCA 1ZPBA 1C1RA 3URDA 3SU3A 2QGRA 1IQFA 1WV7H 1YKTA 1P2QA 1XXFA 3RMNH 4NIWA 2V0BA 4JK6A 3TLOA 5C1YA 1CGJE 2BYAX 4DG4A 2B8OH 1BRAA 1VR1H 1YPLH 2W3IA 5FBIA 2UUFB 2Z9KA 4I8HA 5EQSA 1KXAA 1MTSA 2PSYA 1YBWA 1P0SH 1DE7H 1ZPCA 5EJZA 1EJMA 3N7EA 4GHQA 6CHAB 2FOGA 3N7OA 5EQQA 3KQDA 4OS5A 4D9QA 1BTHH 1KIGH 4XE4A 2HALA 3U8TH 1BIOA 3HATH 2Y5GA 2ZHFH 3WWBA 1DITH 4RSPA 1EATA 1MCVA 2Z3EA 1PJPA 2GT8A 1QFKH 1W7XH 2XOKD 5CE1A 2GP9B 1GMDG 4MNVA 3RMMH 1O3MA 1N6YA 2FWWA 4O3UA 2XCNA 4K2YA 1HPGA 1C5RA 1SC8U 3L6PA 3E1XB 1ELFA 2J38A 2BLVA 1HAYB 4IGDA 5FCKA 1TFXA 3DA9B 2Y5FA 1IQLA 4DGJA 3OE7D 4I33A 3RMLH 3EDXB 2UUYA 1C2KA 1CGIE 4Y8ZA 1SGRE 1FMGA 2ZU3A 5IYTA 1O5DH 2UWOA 4NIVA 1DVAH 1P09A 2VJ1A 1LPKB 3A82A 4ABIA 1EUFA 4BAHB 5A0AE 7LPRA 2YOLA 1D6WA 4DIHH 4D7GA 4F55A 3QZRA 4WXIA 1QL7A 1TPSA 3T2NA 2OK5A 1GBCA 1JRSA 2P16A 1GBBA 3C27B 6GCHG 4Q63A 3BEFB 5IK2D 5DP7A 1AVXA 5KEDA 1T7CA 1F5RA 4IN2A 2CJIA 2ZF0H 4K69A 2FO9A 1GMHG 2CHAC 1Z8IB 5G4BA 3S9AA 1P3EA 3F9FA 4CR9A 1AUJA 1E79D 3GS9A 5JB8S 1TMBH 1O35A 4HGCA 1EAUA 4R8TB 1SR5C 1WTGH 3VG8A 3GY2A 3M5MA 3MO6A 1OWDA 3OY5U 4F48B 2ZFTA 1S6HA 2QXHA 1NFXA 4ZHAA 3ZVFA 3F6UH 2JH6D 1AQ7A 2ASUB 1XVMA 3QZQA 2ZCKP 3A88A 2CXVA 3RXHA 3LJOA 5EXLA 1O3OA 3V13A 2OC1A 1Y5UT 2R3YA 1GI6A 3DHKH 2A31A 2F9OA 3SNCA 1K1NA 4LZ1H 2WPIS 4UFDH 5CHAC 4VGCB 1C5VA 2RCEA 4E05H 1BMMH 1O2OA 4CRGA 5HGGA 2PKSB 3UWJH 4ABJA 2OUAA 2B7DH 2OXSA 3MWIU 3BTWE 1F0UA 2HNTF 2BDHA 2F9BH 1CO7E 3TU7H 3STIA 4ABDA 4WY3A 2XBXA 1YPHC 3T25A 3OAAD 1OXGA 1BCUH 1C1NA 1FIWA 4PROA 5JBTA 1C2JA 2HGTH 1AIXH 3DSPA 3KYFA 1JIMA 4GLYA 1EP5A 1SKYE 4KTSA 2FOCA 1SGDE 1XUIA 3QLPH 1ESTA 2ZPRA 4X1RU 1D3TB 2VBCA 2XXLA 2ZGXH 4NZLA 1TGSZ 1TABE 1HAGE 3E8LA 3BTME 3V0XA 2ESTE 3BN9A 1GDNA 3ODDA 1M9UA 4IC6A 1MMJN 3BTKE 5EJ1A 2P95A 1TALA 2Z94A 3ZZ5A 1SFQB 1YCPK 2H9TH 3MU1A 3O8CA 1QB1A 4JMYA 2Y5HA 2ODPA 2PGQB 2QF3A 2FM2A 1BBRH 3OEHD 5H4IB 5A09A 2F91A 1GJ9B 2VIOA 1BQYA 3W95A 1O2IA 1O3LA 1PPEE 3A7TA 4K8YA 3ZZ4A 2FEQH 1O2MA 4ZAEA 5EW2H 4FUHA 1ZMNA 3K9XB 2AEIH 3RU4D 1YPKH 1GG6C 1V2OT 2G5VA 1UK4A 2B0FA 2HLDD 4ISLA
chains in the Genus database with same CATH topology
1CHGA 4YESB 7KMEH 4GHTA 3MI4A 3UY9A 3ATLA 1OYQA 1HAIH 3A80A 1ELEE 2D26C 1MBMA 1NRSH 2ZKSA 1C1MA 1TNGA 1IQKA 1S83A 1IQEA 1AB9B 1EAWA 1ETSH 2F9UA 2DE9A 3BSQA 1V3XA 2ODYB 1KXDA 2XWBI 1LHGH 1NN6A 1O39A 1AWFH 3ZZ7A 3LGIA 4K60A 3RXOA 2THFB 4ABAA 2BHGA 2FIRH 3KL6A 1LVBA 1QBNA 2FOBA 2G55A 2BDAA 3PROA 2ZFSA 1TE0A 1A5GH 1VJ9U 5C3NA 2Y81A 1K1IA 1TAWA 1XUGA 1VGCC 2TGPZ 3SJ8A 1C5PA 5EG4A 1O2NA 1HAVA 2VWLA 1DM4B 4HI3A 3OX7U 1GI1A 1SLVB 2Z7FE 2O8WA 3EE0B 4MVNA 3E0NB 2P3TB 2OC8A 1G32B 1SVPA 3GCHC 1HFDA 2ZEBA 4K8BA 2FODA 1K9OE 1SGCA 5A8XA 2GCHG 1KLTA 2PKAB 1MD7A 2HPPH 7GCHF 1TX8A 4X0WU 4CRBA 1E37B 1O36A 2FYRA 2D1JA 3QGJA 2J34A 1ELDE 1QCPA 1ELAA 3ZYEA 2P8OB 1DWEH 1GMHF 1OOKB 4RN6A 3LC5A 1F2SE 1U6QA 5LGOA 2R9PA 3LH1A 2AFQB 1EXFA 4CRAA 1SLUB 1V2JT 1S0QA 2BQ6B 2ZFRH 2WPHS 1MKXK 1GCTC 1GJDB 1P9SA 4H6TA 3NXPA 1ACBE 1KDQB 1AMHA 4X1PU 4WWYA 4F4OC 4TWWA 3M7QA 1WUNH 4ZHMU 2PUQH 3O8DA 1VITG 1P8VC 1J9CH 3O8RA 4ABHA 1GMCG 2FP7B 4FU7A 3VXFH 2ODQA 1IHTH 2ZA5A 3LONA 2ZO3H 4KELA 2G4UA 1G37A 4Q7YA 1D6RA 3TGIE 4XBCA 1HRTH 5L2ZH 1MU6B 4BOHA 4I7YH 1GMDF 3QN7A 3F68H 4CREA 1S82A 1F0SA 1XVOA 1MAYA 3TJVA 1MCTA 1MKWK 1O2VA 4DCDA 4X2XA 1ZTJA 1CA0B 1TRYA 3MU8A 1F5KU 2R0KA 5DJ7A 3QO6A 3UWIA 1UTMA 1FIZA 4FUFA 2DUCA 1FV9A 1TX6A 2ZHQH 3WY8A 4J2YB 2AGIX 4I8KA 2H5DA 1NRRH 2FMJA 1PPHE 1A3BH 1HBTH 2BTCE 1TNLA 2J92A 4K1TA 3VEQB 2CN0H 1N8OC 2ZTYA 3BTQE 4UEHH 5CMXH 2BM2A 3E6PH 1LDTT 1TNKA 3EYDA 4GSOA 1IQHA 2G81E 2GCTC 1S84A 2O8LA 1ZMLA 1ANEA 4WJG2 2G52A 1DANH 1K1PA 1E36B 1S6FA 6CHAC 1Z8JB 4AFZA 4INLA 2FOMB 4CRFA 2ALPA 1GMCF 2P3FH 4B76A 1UVUH 2XCFA 5B6OA 1DLEA 2STBE 1UVSH 2C8ZB 1PYTD 4ZKRU 2KAIB 3SUFA 4AG1A 1EB2A 1HJ9A 3IWMA 4MLFB 4FUCA 2LNCA 5A8YA 2ZGJA 3E90B 3SO3A 1SGTA 3BTFE 3SU5A 1A1RA 4AYYB 1FI8A 1NY22 5EPYA 3SNAA 4MNXA 1TRNA 4O9VA 4OS1A 4D9RA 2O8MA 4TY7A 1CT4E 1FXYA 4UFGH 3FP8E 3D49H 3SV7A 1AKSA 3H7OA 1TNHA 2ZPSA 5E2PA 4MTBA 4JYTA 1C1SA 4ZROA 4HTCH 2O8UA 1AFQB 3GCNA 1MTVA 6LPRA 4K1EA 1HUTH 3S0NA 5HM9A 2CV3A 3PMBB 3RXTA 3FVFB 3ZVCA 1J17T 1ZHMA 1RIWC 4Y79A 4BAKB 1JBUH 4I8JA 3NWUA 4ZH8A 3AW1A 1GHZA 4D7FA 1J15A 2BVXH 1W0ZU 2PTNA 1YLCA 2ZHWH 3RXDA 2GT7A 1GHAF 1UTPA 4Y71A 5LH8A 4B1TA 5EXMA 2ZDKA 1ETRH 2FX6A 1G30B 3TNSA 3MH4A 3MU5A 3GY3A 4FUDA 1AN1E 2G51A 2ZU1A 3ZZ3A 1NS3A 1XUKA 4Z6AH 1QIXB 2F9NA 1O3NA 1FLEE 3AASA 1HXEH 1MUEB 3EA8A 1SGYE 2GTBA 3F9HA 3E16B 5C2ZA 2ZG0H 1BTXA 1WQSA 2ULLA 3LOXA 3A8BA 4IN1A 1LPZB 1LVMA 1ZGVA 9ESTA 2IOTA 2QIQA 1OSSA 1C2DA 3A8DA 1G3DA 3VB3A 2JETC 2HLCA 3BIVH 1DICA 2FLRH 1WOFA 1G36A 1L4DA 2WV4A 1BA8B 1HDTH 3RM0H 2HWLB 1O2QA 1GI0A 1GHXH 2OD3B 5ESBA 4JZEH 5T6GA 4YZUA 1MQ5A 1TGBA 3CP7A 3F9EA 4JZDH 5EODA 3G01A 3PYHA 1EX3A 1CE5A 4A6LA 3M5LA 1MTNB 4K3JA 1E38B 1WCZA 2VB0A 3BIUH 1SB1H 3T28A 1IQMA 2A5KA 2XC5A 1O31A 1WYKA 1PQ7A 1THRH 1O3DA 1S81A 3AAVA 1AZZA 3T29A 1KTSB 5DP5A 1BUIA 8KME2 1IQJA 2VINA 1AGJA 3MO9A 2BX4A 5ESTE 1OKXA 3BTHE 1F0RA 1DUAA 1MKXH 4TPIZ 1W8BH 1O2PA 3SJ9A 3BEUA 2G4TA 1SBWA 1NFYA 1CT0E 2SGPE 3SI4H 3RXUA 1QTFA 3U98H 3UQVA 3GY7A 2ZCLP 3STJA 4MPWA 1Y5BT 3OY6U 4O03A 2GV6A 3RM2H 5PTPA 1BT7A 2QF0A 8ESTE 2GV7A 1DPOA 2VH0A 1FUJA 3GY5A 1O30A 2HRVA 2TPIZ 3QUMP 4DIIH 5DKMA 1P01A 3RUOA 3A81A 1GHBG 5LPRA 1LKBA 2VGCB 1Z8GA 1HLTH 1TOMH 4YOIA 1GI3A 3UFAA 1ID5H 2XBWA 1RTFB 3UR9A 1TYNA 1GBAA 4LOYH 3TK6A 2VGCC 2FPZA 2EI7A 3GCTF 3E3TA 4NWLA 1JXPA 2ZFQH 3ZZDA 1Z71A 5EW1H 4WH6A 4KP0A 4Y11E 4AG2A 1KTTB 1T8LA 1YC0A 1P02A 3SUDA 1MZDA 2BY5X 1EASA 2ZIQH 1OYTH 1KXEA 1A5HA 1NO9H 5IDKA 4YM9A 4ZXYH 1DY9A 5DP9A 1XMNB 3SJKA 4WVPE 1D9IA 4NSYA 1MTWA 1UCYE 4OS2A 2HNTE 4FU8A 1AZ8A 3FP7E 4ASHA 2CF8H 1QL9A 3LU9B 5F6MA 2Q6GA 3S9CA 2R3UA 1RXPA 4O3TA 1BMLA 2VIPA 2W3KA 3QWCH 3D62A 2UWLA 4AB9A 1C2GA 4MNYA 1ABJH 3GY4A 1TPAE 3FZDA 3PMAB 3H5CB 1QRWA 1SMFE 2ZTZA 1KSNA 3K65B 3F1SB 1BDAA 1BHXF 3RC5A 2J95A 1W3CA 3PO1C 1N6XA 3SU6A 3I78A 1O2TA 1P12E 1WTHD 1C4Y2 3NPSA 5GWZA 1PQ8A 1N8OB 3ZVBA 5C1XA 2PHBA 3M35A 1WU1A 2FESH 9LPRA 4OS4A 3U8RH 1P03A 2GDEH 2BOKA 1ESAA 2ZPQA 3EGKH 2W5EA 3AAUA 3M7UA 3P8FA 4GVUA 1O2KA 3TH2H 4RKOB 1C1OA 4ABBA 1O5GH 3U1JB 5F8TA 5GPIB 1TX7A 2WYGA 1BZXE 3U9AH 4TWYA 3SUEA 1XM1A 1P04A 2ZDVH 1EAIA 2SNVA 4BXWA 3ATKA 1DUEA 5E0JA 5JPMH 1AE5A 5E2OA 1A4WH 4X6NA 3SI3H 2QN5T 1FY1A 3SJOA 2A4OA 3GY6A 1K1MA 1ZHPA 3BTDE 3KQCA 2WPJS 3SBKA 4AFSA 2A4GA 2A5AA 3SNBA 4Y7BA 1DOJA 4Y6DA 2UUJB 1Z1IA 1HAOH 1KXBA 5L30H 1Z6JH 1EOLA 1SGNE 1HJ8A 1XUHA 3M3SA 3T5FH 1T8MA 1UTQA 2XW9A 1EPTA 2BX3A 2V6NA 3DUXH 1YLDA 1O5BB 3L3TA 2CHAB 2KAIA 1YPGH 5A0CA 3KCGH 3UREA 1GBIA 1TWXB 1VCQA 5DP8A 1GVLA 4DT7B 4FU9A 4R0IA 2BDIA 5FHTA 3NUMA 1H8DH 2C3SA 4ISHH 5EGMA 2AS9A 3TJNA 1OP0A 3BG4C 2A7CA 1ZHRA 1ZJKA 3V12A 4IC5A 2IPHA 1RIWB 3RXAA 1RGQA 4MG3A 3DFLA 4XDEA 1Y3YA 1C5SA 5DG6A 1CA0C 3A8AA 1PFXC 3MHWU 3PTBA 2ZDNA 2BD5A 2G00A 3RXLA 4BTUB 1TQ7B 1GPZA 2C8WB 1ZR0A 1NRNH 1ARBA 2C8YB 1F0TA 3M37A 1UK2A 4B71A 1IHSH 2PW8H 3TK5A 3ODFA 1FNIA 4U01A 1GCDA 3W94A 4K5ZA 1LCYA 1LHEH 3PWBA 1WQVH 3CS0A 1SQAA 1P2IA 4I8GA 3UR6A 1YYY1 2BDGA 1EP6A 2OTVA 1PPBH 1L0ZA 1YM0A 5I46H 4INHA 2ILNA 1ZSJA 3VB5A 1GJ5H 4AGKA 1GHAG 2A5IA 2HNTC 3MFJA 3VPKA 4CHAB 4X1NU 3MNXA 3GDSA 1KXFA 1BBRK 1T32A 1ELVA 1ELCA 2WUCA 4FVBA 4A1XA 1O3BA 1QQUA 1RRKA 1GI4A 4JYUH 4WMEA 1Y3VA 4RKJB 1GI8B 4FUEA 3MH7A 5DO4H 2RDLA 3KEEA 3D65E 1T4UH 1GL1A 1TBZH 5FPSA 5CHAB 1QNJA 1KY9A 1SG8B 2W7UA 1BJVA 1RJXB 3Q3YA 1TPOA 3Q3XA 1V2PT 1ZTKA 5FXLA 2BY6X 1C5UA 1O2HA 3S7HB 4GUXA 2ZGHA 2RG3A 1A46H 1BITA 3OYPA 3P95A 2H6MA 3SUGA 1TQ0B 4UFFH 1KLIH 1SPJA 3D23A 4B2CA 4LZ4B 1LHFH 1MAXA 3CS7A 1JOUB 3TNTA 1C2FA 1MBQA 1GGDC 4X6MA 3RXKA 1KDQA 3FFGA 5GXPA 1MTUA 2FLBH 1VITH 1UTLM 1BMNH 1AD8H 2NU3E 4OGXA 2PUXB 2PTCE 2M5TA 4WF8A 4YLQH 3SGBE 3TK9A 3DT0H 1CHOG 3BF6H 1GBFA 4U32A 4UE7H 4DOQA 2PSXA 2FXRA 1TGCA 1ZRKA 3S69A 4MPUA 1QRZA 4XFQA 3MTYA 2NU4E 2VIQA 2ANMH 2H1UA 1ZTLA 1W14U 2QY0B 1TBQH 5EXNA 1AKSB 4B2AA 1SFIA 2Y7XA 3RLWH 3SN8A 4AN7A 1YF4A 2Y6TA 5GIBA 4ZXXH 2WYJA 3VB6A 3GYMA 3JZ2B 1QBOA 1NROH 1QGFA 5TCAA 4XOJA 1K1OA 1E34B 2HPQH 2ZNKH 4ZKSU 1FN8A 1GJ4H 4X6PA 1GJAB 1QURH 1C9PA 1V2RT 2BMGB 1MZAA 2SGQE 1V2UT 3M36A 2LPRA 2ZP0H 5C20A 1O2WA 3KN2A 3URCA 4ZKOU 3P6ZB 1C5QA 3A89A 3PWCA 1AFEH 4Q80A 1B7XB 3ZZCA 2RA3A 1W10U 3PO1B 1CT2E 3ATMA 2JETB 4B74A 1AB9C 3A7XA 2FOHA 2SGFE 1W12U 2AMQA 4FVDA 5DP3A 1JWTA 3RXIA 1L1JA 1NC6A 1ORFA 2O9QA 3QGNB 4FUGA 3ZZBA 1P06A 2AGGX 3A85A 1GBJA 3NKKA 1OWEA 3DD2H 3RC4A 1Y8TA 1OP2A 4UFEH 3LGUA 1ARCA 8GCHF 1ZSLA 1XUJA 2CF9H 3RMOH 2JH5D 2VIWA 4YTAA 3LGVA 1ABIH 1NFUA 5C1UA 1ESBA 1W11U 1DX5M 3P17H 1C2IA 5K0HA 1A0LA 5JBCS 1P3CA 1HIAB 1V2VT 1V2ST 1P2OA 1DFPA 4JZIA 4JZ1A 2W26A 1O3EA 3LIWA 4A7IB 4CH8B 2AH4X 4Y0ZE 1EB1H 1PPZA 2Q6FA 3LT3A 2BLQA 5AF9H 4X6OA 3RP2A 4GCHF 4WH8A 4IBLH 1IQNA 2FZZA 3I29A 1C1WH 2J9NA 2NU1E 1V2NT 1CGHA 1C1UH 3QK1A 3PLPA 1BTUA 1TRMA 1AO5A 3ESTA 2Z9JA 2BZ6H 1VCPA 5EQRA 2BOHB 3UUZA 3EQ0H 4E7RG 1AWHB 2ZU4A 1BB0B 1NU9A 1BTPA 2D8WA 2GX4A 1O2ZA 2Z9GA 3ZV9A 3GDUA 1C5YB 4X8SH 4Y8YA 3L33A 2P94A 2Z3CA 5FX5A 3ZZ9A 4CBNA 2SFAA 5JB9S 2VH6A 2RA0A 1HAZB 1ZGIA 2J4IA 1PQAA 1RFNA 7ESTE 3FZZA 2ZWLH 1O5FH 5AHGH 1GHVH 1W0YH 5FPTA 4BNRA 5K7RA 1UVPA 1UTJA 1TNJA 3LGYA 2P3UB 3S9BA 4MPXA 4ABFA 3T27A 5TJXA 4X1SU 1O33A 1V2QT 2ZQ2A 3MNBA 4ZKNU 2ZCHP 1K21H 2QC2A 2TGTA 1UJ1A 2WINI 4B75A 3SHCH 1NPMA 2JH0D 2BQWB 1O3GA 1ANBA 1NTPA 2A7HA 2BLWA 4Q2KA 2WUBA 4JZFH 2VWOA 1DT2A 1KXCA 1N1LA 2SGDE 2V35A 3BV9B 2ZDMA 1ELGA 1O3PB 4U2WA 2PKSC 2BD2A 3SV2H 1EZQA 1C5ZB 3QX5H 4AFUA 3H7TA 1FAXA 1C9TA 2PLXA 1FPHH 5L2YH 1YP9A 3VGCC 1B0FA 3LDXH 2VNTA 4MPVA 3RXQA 4A1TA 3GY8A 5A2MH 3ZZ8A 1F7ZA 2FS9A 2OINA 4O97A 1OS8A 2WPMS 2FOEA 3HGNA 1A5IA 3TITA 3KIDU 4ABEA 1QBVH 1S85A 1K1LA 5ETXA 2Q6DA 1C5LH 1NZQH 2G5NA 1NRQH 1E35B 1XKBC 4BTIB 4KTCA 1A3EH 1HJAB 1E0FD 3ELAH 1TGTA 1LKAA 1GHYH 1O2GH 1V2WT 1W7GH 2TGDA 3KQEA 1SLWB 1T4VH 3AVZA 2GCTB 3SU1A 1JRTA 4HZHA 1THPB 3KQBA 1L1GA 2BB4A 1OPHB 2V3HH 3UQOA 2FYQA 3ZVEA 3RXPA 2NWNA 2XC0A 3MNSA 1HYLA 5E0GA 1SGIB 1UO6A 4X1QU 3UNRA 4OGYA 1A0JA 1PPFE