2VJ1A

A structural view of the inactivation of the sars-coronavirus main proteinase by benzotriazole esters
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
300
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SARS CORONAVIRUS MAIN PROTEINASE
publication title A Structural View of the Inactivation of the Sars Coronavirus Main Proteinase by Benzotriazole Esters.
pubmed doi rcsb
source organism Human sars coronavirus
total genus 82
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.34.-:
pdb deposition date 2007-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2vj1A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vj1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vj1A02
2TGPZ 4RKOB 4WMEA 1NS3A 4OS1A 1QL7A 1NFXA 2I6SA 2J95A 3ZZ8A 1ZSKA 1ZMNA 2ZFFH 4NZLA 1SPJA 1DUAA 2BQWB 1G2LA 4DVAU 4R8TB 2QXHA 3UREA 4D76A 1EAXA 1BBRE 4X8TH 3HGNA 3RU4E 1AB9B 1QRZA 3TNSA 1S6HA 1HJAC 3KF2A 4H4FA 2WYJA 4BANB 2ZU2A 1ELEE 4TYDA 2PUXB 1XXDA 1B0EA 4IW4E 1DY9A 1C2FA 2GV7A 1ZSJA 1EPTC 3P8FA 3BIUH 1BHXB 2R9PA 2D8WA 4Y6DA 2VU8E 4ZHMU 1GJAB 1QB6A 1QBOA 2Z6BD 3SJ9A 3ATLA 2FO9A 2GV6A 1K22H 1TGTA 3MH5A 1SI5H 5CMXH 3PB1E 1S0RA 4NCYA 4O97A 3TGKE 1HLTH 1TA6A 3RUOA 2ZU5A 4A7IB 3O8BA 3RXKA 1BTYA 1P9SA 1LKBA 3MNSA 1DY8A 5BRRE 1GBAA 2G81E 1O2HA 2ZFQH 4X6NA 3A82A 7KMEH 3S7HB 2DE9A 1A3BH 1O5EH 1C1QA 3UOUA 1ESTA 1K1OA 5L6NH 4CR5A 1W13U 2FOCA 2D1JA 4VGCB 3VB3A 1ELCA 1HAIH 4JYVH 1OX1A 1C2JA 4Y76A 2P59A 4TY6A 1GVLA 2A4QA 3CS0A 3EAJA 2P3TB 2OCVB 2BXTH 4AX9H 1GMDF 2XBXA 4Y71A 5C1UA 3VB5A 5EQRA 1BZXE 3SHCH 2XBVA 3UUZA 5DKMA 1SGFA 4I32A 1AO5A 1VITF 1GG6C 2P8OB 4X1NU 1L1NA 3K65B 3SU0A 1N6YA 1NN6A 4H6TA 3SU2A 3P6ZB 1OWJA 3T25A 3TJUA 1GBBA 8GCHG 1TBRH 2BTCE 1IQLA 1LVYA 1NC6A 1EQ9A 8KME2 3M3TA 1HAPH 2BDYA 3HKIB 2ZP0H 4Z6AH 1GHAF 4ZXYH 1KDQA 2FEQH 4NWKA 3TJVA 1OWDA 5GCHF 3ATIA 1NFWA 5FBIA 2C3SA 4MVNA 1RTKA 1AVGH 1H9LB 2P95A 4HFPB 1NFUA 2PW8H 2ZFRH 5DP3A 4AYYB 1DWEH 4Y10E 1E38B 2BHGA 1TPSA 1AE5A 1QA7A 5FBEA 1OKXA 3SOSA 2Z3DA 1HAZB 1W14U 1L1JA 3VEQB 3GDVA 1L2EA 1D9IA 1O3AA 4Y11E 1DLKB 1O3HA 4IS5A 1KXFA 1LHFH 1XM1A 2GMTC 1TQ7B 4Q80A 3W95A 3LJOA 1A0JA 1JBUH 1XUIA 1J8AA 1P2KA 3EA9A 1NROH 2FS8A 1WOFA 3AVZA 2OQUA 3A81A 3TLOA 2B8OH 1NU9A 1CT4E 1JMOH 3SGBE 1GDUA 2AIQA 5HM2A 1TE0A 4ZROA 2F9OA 1ESBA 4DY7B 2ZPRA 1HAVB 4FUCA 2PUQH 2BDIA 1HNEE 1FIZA 1MTUA 4B76A 4AFUA 2AS9A 3AAUA 5T6GA 3UQOA 1TX6A 4DW2U 3PROA 4YO9A 1T8LA 3K6ZA 1CBWB 1TNHA 1BOQA 1AHTH 1YCPK 1C5LH 1LVMA 1LKAA 2SGDE 1LQDB 4I7YH 2CV3A 1SGYE 3I29A 1GJBB 3SUDA 1O2NA 3ODFA 2ZGCA 1C2EA 2W7SA 1GI2A 2O8LA 2PFEA 4AGKA 5DP4A 3NKKA 2A2XH 4IGDA 3SUEA 1EZQA 1ZLRA 1SHYA 5DP7A 3A7WA 2A7CA 3PMBB 1C5QA 1ID5H 3RXLA 4FU8A 1IHTH 2ZNKH 2OC0A 4I8GA 1INCA 3VB7A 1G3BA 3B23B 1C5TA 1DLEA 1G37A 3SU1A 1GI1A 5CHAB 1O2TA 1P06A 4RN6A 2GCHF 5JBCS 1KXDA 3S9BA 2FIRH 3RXCA 5DP8A 1O5DH 4CRBA 4GLYA 1EB1H 4VGCC 1GJDB 1V2WT 1P12E 1RIWC 4CH8B 2GZ9A 1A2CH 3EA7A 3RLYH 1TMBH 3ZVFA 2IPHA 1O3CA 3R0FA 1T7CA 1PPBH 1P11E 2Z94A 2HLCA 3D49H 4ISIH 2QV1A 1JIMA 2GCTB 4DT7B 1GMDG 5ETXA 1TMUH 2ZGXH 4JZDH 1VITG 3BEIB 1YF4A 1PPHE 4NA9H 3LC3A 1ACBE 3BTEE 3FANA 1GBJA 1RS0A 4MNYA 4XE4A 1ZPZA 1BRUP 3PWBA 4IMZA 1TPPA 1ZTJA 1JXPA 3TH4H 1O0DH 3KQCA 2P3UB 1K1PA 4INLA 3RP2A 1HXEH 1GHAG 1V2ST 3ELAH 1O3KA 2C8WB 5GCHG 1Z8RA 2Y80A 3VFEA 1A1RA 5ESTE 1GJ4H 2Q1JA 3GISB 3V3MA 4OS6A 2FOBA 2AH4X 1GBKA 1S84A 1YCPH 4HTCH 5C5NA 2ZFTA 1IQKA 1O2YA 2R3UA 3MU4A 4X6OA 1MTVA 2ZHQH 3ESTA 1FY8E 2XC4A 3UNSA 1H4WA 1AKSB 1E35B 1UMAH 5A0CA 1G30B 2QIQA 1FNIA 1YPHC 2FDAA 1UK4A 2FXRA 1GL1A 1ZSLA 2ZIQH 5EW1H 1ETRH 3GCNA 1GBTA 1Y3WA 4FVBA 3QDZB 5JYIA 1EX3A 2BQ7B 4B73A 3D65E 1L0ZA 3PO1B 1O3MA 5AFZH 4D9RA 1CBWC 3QTVH 2PGBB 2ZPQA 1MZAA 4D7GA 1Y3UA 3RXEA 4ABJA 3RXVA 4CRGA 1OP8A 2A31A 2ODQA 1B5GH 1O2RA 4B71A 2OBOA 1GJ6A 5EGMA 1O3NA 3FP6E 1D3TB 5L2ZH 1O2LA 1Y5BT 1C5ZB 5EU8A 3V0XA 1C2GA 2FOEA 5K7RA 1EUFA 4X1PU 1ELGA 3LJJA 4CR9A 1T8NA 3I77A 4Z0KA 4MPXA 2C4FH 1SR5C 2B0FA 3L6PA 1EJNA 2EEKA 1ZPCA 4ABHA 1YLCA 1N6XA 3GDSA 5AVDA 4RSPA 1OOKB 1W12U 3P17H 4Y8ZA 3U1JB 3BTHE 3GY8A 4CRCA 1D6WA 1AGJA 5FPTA 1F5RA 1C2KA 1DWBH 2G5VA 4K60A 4O03A 1Z8IB 1V6DA 2ZHDA 2GCHG 3BG8A 3RC4A 1J14A 2UUYA 3PMHB 1CT2E 7ESTE 4OS5A 2YNBA 2FTMA 1GJ5H 5A8YA 4Q7ZA 4Y0YE 1AY6H 2GGVB 2OTVA 2QAAA 2FPZA 1SB1H 4XBDA 1DUEA 2FOGA 2BOKA 2GCTC 3SV9A 1NU7B 2SNWA 1ZPBA 4I8HA 1J15A 3LIWA 2BLQA 2ZDNA 1C9PA 2AGGX 1MTNB 2ZEBA 1THPB 1GI9B 4YTAA 1TYNA 2GTBA 4NSYA 1WSSH 4AOQA 3AW1A 1TAWA 3GYLB 4UFGH 2ZDKA 1C2MA 2WPHS 3CENA 1NRRH 2W3KA 3V12A 5DK1A 3A8DA 1FAKH 3B8JA 3NWUA 3W94A 3MH6A 1MKXK 1QL9A 1EB2A 2QYIA 1NT1A 1LPGB 2Z7FE 4LZ4B 4XOJA 5LPEA 1UCYK 3Q77A 1V2JT 1BRBE 2H5DA 5F6MA 1VR1H 4F49A 1GCDA 3LH1A 4WMFA 4ZHLU 2ZDMA 4NIYA 1DVAH 1SGEE 1C2IA 1EATA 3HATH 3QX5H 2J34A 1VCWA 1FPHH 4FXGH 2RA0A 1DXPA 1RTLA 4IBLH 1CT0E 1GBDA 3QUMP 2ZGJA 5H4IB 1TBQH 3E8LA 4K8YA 2ZZUH 5DPAA 1K21H 5CE1A 4ZKSU 1C4V2 4JYUH 1RD3B 1F0RA 3PLKA 1S6FA 3OX7U 1A5GH 5C20A 2ZC9H 2ZTYA 5J4QA 2BLOA 1W10U 4NZQA 2NU0E 1QRXA 2CGAA 1BRCE 2WPMS 3ZZ6A 3A7VA 4FUBA 1F0TA 1TALA 1O5FH 1A5HA 1KY9A 2GP9B 1ZHPA 2HOBA 3MH4A 8GCHF 3RXBA 3UWJH 1GBIA 1J17T 1UHBA 3LH3A 5K0HA 3SNBA 3GYMA 2LIZA 2FLRH 4FUFA 1AFEH 3RMMH 2HPQH 1C5MD 1GVZA 3QN7A 2ZU4A 2PR3A 3PYHA 3UWIA 1SGCA 3P70B 5DO4H 3E0PB 3MU5A 1PQ8A 1TMTH 1TNJA 2EC9H 1JIRA 1NZQH 2R2WU 1Y5UT 3MO6A 4WXIA 2ZHFH 1T8MA 2ANYA 4Y0ZE 3PLPA 1THSH 2R0LA 4K2YA 5E0JA 1EP6A 1UTNA 1ZZZA 1SLUB 2FESH 3EDXB 1CHOG 1O2KA 3NCLA 1HB0B 5E8EH 1ANBA 2ODYB 5FPSA 3TH2H 1ABIH 1BTXA 4KTSA 2I6QA 2JKHA 1N8OB 1MKXH 1O2UA 1CE5A 2OC8A 1LVBA 1A0LA 1F0UA 2C8YB 2FODA 1UCYH 4U01A 4NFEA 5GDSH 1PJPA 8ESTE 5JDUB 2SGPE 2WPIS 2Y82A 3UOPA 2A4RA 4ABEA 1O2VA 1EASA 4ISLA 1GI4A 5EQQA 1CHGA 4LK4A 4JZFH 4AN7A 2Z9KA 3ITIA 5FX5A 2R2MB 6ESTA 3GCTF 4FVDA 5T6FA 2XWAA 3Q3XA 2XCFA 1EZSC 1CGIE 2XTTB 3EGKH 2WPLS 5A8XA 3QZRA 4WMDA 1SGDE 3V7TA 4NIWA 3IWMA 4PROA 3ZVDA 4FUDA 4JK5A 1O2GH 4E05H 1Q31A 1XUKA 2Q6GA 1KXEA 2H1UA 4AFSA 1ZTLA 1GJ9B 2BY7X 4ABAA 1IHSH 2OD3B 4ZMAH 3RXIA 4I8JA 1GI5A 1E36B 3RXAA 1MCVA 3GY7A 1LHEH 1P3EA 3ZZ9A 1F2SE 3BTGE 3BEFB 2SGQE 2Z9JA 2BX4A 3M7UA 5LPRA 1QURH 2GZ8A 1C5YB 3OSYA 1P2IA 3DT0H 2GT7A 1NRPH 2ZGBH 3SUFA 3ODDA 1J9CH 1QBNA 1QNJA 1C1NA 2K7XA 1GBMA 1L4DA 4B1TA 3UFAA 1P02A 1ELFA 2DE8A 4JZEH 3RXMA 1AN1E 2PKSB 1YCPM 1GGDB 3P92A 1ABJH 2XCNA 1O3BA 3M5LA 1ELAA 2TGAA 2ZQ2A 5JBBS 5PTPA 5EQSA 1YBWA 4Y7BA 1PPZA 2GDDA 3BN9A 1P03A 4DOQA 3NK8A 5LPFA 3T5FH 3LGWA 3ZZ7A 4THNH 4FUEA 1YGCH 1K1MA 2Q6FA 2BD4A 1EJMA 3DD2H 1TGCA 1C1WH 1BQYA 1LO6A 2ZQ1A 2XYAA 3H7TA 1H9IE 4GSOA 1QA0A 5G4BA 1C5XB 4MLFB 3CS7A 1P3CA 1QQ4A 1SSXA 2W26A 1OP2A 1HAVA 1NPMA 2ZDVH 4ASHA 2OP9A 2F9UA 1O5CB 3IG6B 4D7FA 2VJ1A 1WUNH 1O3IA 1C5NH 1HFDA 1ZYOA 2V35A 2HALA 3DFJA 1GHBF 1NY22 4BAMB 4CRDA 1CQQA 1UO6A 2JH6D 2A32A 2PV9B 3RXFA 1FAXA 1H1BA 5C3NA 1O2PA 2VGCB 2VIOA 3WY8A 2HVXA 1O32A 3KEEA 1C1MA 1ZRKA 2WUBA 2BZ6H 1AI8H 2W7UA 2ZHWH 2RA3A 3JZ1B 2D2DA 1P04A 4MPUA 3RU4T 1UVOA 1UVPA 2UWLA 3GY2A 2IOTA 3RDZA 3OU0A 1C5UA 2PHBA 3OY6U 2D26C 1AU8A 6CHAB 4A6LA 1PPEE 5A0AE 5A2MH 1QHRB 2ODPA 2Y81A 5C67A 3SUGA 3ZVGA 4OS7A 2VH6A 4KP0A 1WTGH 1HV7A 3P8NA 2WPJS 1Q2WA 1A46H 2PKAB 1C5OH 1EZXC 2Y7XA 3TGIE 2CHAB 3RLWH 1EJAA 1UTQA 2O8MA 1BRAA 2Z9LA 2SNVA 3M37A 1TNIA 1GHZA 5JPMH 3GCTG 4MPVA 1RJXB 4TPYA 2FWWA 1ELDE 1TFXA 2ZCKP 2ZI2H 1YC0A 1IQFA 4WH6A 2BXUH 3M3VA 2TIOA 1GBFA 2NU4E 1UVUH 1UTLM 1AB9C 1FIWA 1OYTH 2O8WA 4Q2KA 3EA8A 4JZIA 3RXHA 1IAUA 2G4UA 2K1QA 1V2LT 2F9VA 2GKVE 4ABFA 3SW2B 1C5VA 3NZIA 3EBNA 1GJ8B 1O2JA 2XBYA 3SV2H 4MG3A 5T3HA 2FI3E 3VB4A 2OC7A 1W7XH 3BTWE 2G4TA 2H9EH 1TWXB 2QA9E 2AMQA 3DUXH 3HKJB 1THRH 3SI4H 1K1IA 4DG4A 1BBRH 1MH0A 2C93B 1Z8GA 1KYNA 3QGJA 3URDA 3Q3YA 5C2ZA 4GUXA 3JZ2B 5E2PA 2GDEH 1HXFH 2C8ZB 1XXFA 3E91A 1SGFG 5FAHA 1EP5A 1SLXB 2ZU1A 3A89A 3NUMA 1IQMA 4FU7A 1G3EA 3MTYA 4NWLA 1A0HB 1HGTH 2NU1E 5E2OA 3GY5A 1IOEA 1GGDC 4X6MA 1Y8TA 1O37A 1S85A 2J94A 4OS2A 3SO3A 1O2SA 4ZKRU 2AGIX 1TX8A 1EAIA 2KAIB 4I8KA 1MD8A 1GBHA 4MNXA 3MU0A 4NIVA 4ZAEA 4JZ1A 1AQ7A 2Y6TA 3FVFB 1Z6EA 3TITA 1FZZA 2W5EA 3AAVA 1TRYA 2QC2A 1KXAA 2UWPA 4R0IA 4B75A 1O2OA 1GJCB 1JWTA 1DANH 2QY0B 1C1UH 3TVJB 2QXJA 1ZOMA 3G01A 3A85A 2VIDA 1WYKA 3QWCH 1L1GA 4J1YA 5JB8S 2P8OC 4KTUA 1QTFA 2B7DH 2WINI 1K1LA 3QO6A 3LGUA 3PWCA 1QRWA 1PQ5A 2JETB 3A83A 1MCTA 3S7KB 1HIAA 1S81A 1LPZB 4INHA 4JMYA 2FZZA 4AFZA 2G51A 2UUFB 3AASA 1SGQE 2BY5X 2CF8H 5EXMA 3KN2A 3SN8A 1O2ZA 3OYPA 4HZHA 1YPHE 2V0BA 1BTWA 2H9TH 1TOCB 2SGEE 1GHBG 4GHQA 3MU1A 3OTJE 2A5AA 1T8OA 2A7HA 5JB9S 2BY8X 4H42U 1EAUA 4X2YA 1U6QA 4SGBE 1VGCB 4SGAE 4X8UH 1HPGA 2P16A 1ZHRA 2Y7ZA 1HJ9A 1Z1IA 1FN6A 2P3FH 1TNGA 3F9HA 4BTTB 2ZECA 1P0SH 1AIXH 3KIDU 2F91A 4NA7A 4BAQB 2RG3A 1BIOA 3KQEA 1AUTC 2CHAC 3QGNB 1ANDA 2ZCLP 4NA8A 2Z3EA 1JRTA 4WWYA 1M9UA 4B2BA 5FX6A 2FOAA 3ZVCA 4Y79A 1OSSA 3SHAH 1AWHB 1XKBC 1W3CA 1YYY1 1CSOE 5TCAA 3KL6A 3E3TA 1BCUH 4U32A 4WY3A 1NM6A 2C90B 2ZHEH 1O3DA 5E0GA 1AZZA 4MNWA 4AB8A 3QZQA 4YT6H 2CF9H 1O5AB 2FM2A 2VNTA 4K3JA 1SOZA 1XUJA 2ZU3A 1FY4A 3UNQA 2FYQA 2PTNA 1SFIA 1O30A 3TU7H 3MWIU 1DDJA 1BTPA 1HDTH 1TQ0B 3H5CB 2VVUA 3FAOA 1IQGA 4GPGA 1IQJA 1FN8A 7GCHF 1P01A 4BAOB 1WAYB 4ISNA 2ZDAH 1Z7KA 3EQ0H 1CA8B 2V3HH 1BMAA 3QTOH 3RXOA 1YPGH 3ZVEA 1KLIH 3ATWA 1O39A 3LGVA 3RXDA 1TX7A 1D6RA 1DSTA 3F9EA 2CXVA 1P05A 3O8DA 5CHAC 2STBE 1ESAA 4ZKOU 2VIQA 2WV5A 1BA8B 1O3GA 1MKWH 3UTUH 3GDUA 1B0FA 1CHOF 4TPIZ 2BX3A 1AE8H 4E7NA 1YM0A 1TIOA 4OGYA 2XNIA 2PLXA 1GHYH 1WQVH 2A45B 1PPFE 2GD4B 1RFNA 1FLEE 1QJ6B 2BDGA 3HK6B 2CMYA 4XBBA 4O9VA 1YPLH 4QT8C 4UDWH 1BMNH 2V6NA 3T28A 3ZV8A 4BAKB 2OBQA 2VIVA 4FUJA 5F03A 1BJVA 1C5RA 1UCYE 3BTME 5FHTA 1ANCA 3A88A 3F9GA 1HAOH 5FXLA 3A7YA 4ISHH 1A3EH 1T32A 3RXTA 1ZGIA 1O3PB 3SNCA 2O8TA 1WBGB 3BSQA 3BG4B 2ILNA 1QJ1B 1WV7H 1TONA 2FS9A 1EZUC 2O9QA 3U8RH 4B74A 4M7GA 4BTIB 2A5IA 2A1DB 1K2I1 2BYAX 3SV8A 1IQEA 3U8OH 2F3CE 1GHWH 1ZR0A 1BITA 2VINA 3LOXA 3N7OA 5GWZA 2M5TA 1MTWA 1SHHB 3ZYEA 1DPOA 1Y59T 2ZTXA 1C1VH 1GMHF 5C5OA 2RCEA 2DUCA 1KTTB 5I25A 3SNAA 1VGCC 1TABE 1FONA 1C2HA 1HUTH 1YPMH 5LH8A 3A8BA 1IQHA 1SGRE 2FP7B 1V2OT 1TPOA 3TJOA 1DWCH 1A7SA 1GI7B 1TOMH 3RM0H 2IN2A 1PQ7A 1E34B 2R0KA 1SMFE 2AEIH 1TGNA 3GY6A 3RXQA 2BM2A 1TNKA 1W8BH 1XUHA 3E1XB 1O33A 1YPJH 1EPTB 1F7ZA 1VJAU 2IJOB 3I78A 3STJA 1AVXA 2UUJB 3U1IB 4IC5A 3PO1C 4D9QA 3BF6H 2OLGA 2A4OA 5FCKA 1VCQA 4WVPE 4X1SU 1FDPA 1TB6H 1MQ6A 4UEHH 2XC0A 2TGDA 1XUGA 3Q3KA 1ZMJA 1KLTA 2VVVA 3MO3A 1FY3A 1GI0A 4FUGA 2ULLA 4UE7H 3A86A 4A5TS 1O3EA 1S0QA 3M3SA 3A87A 3FFGA 1BHXF 1V2MT 1G32B 2A0QB 1SG8B 2AGEX 5DG6A 1G3DA 1C1PA 1DXWA 3MOCA 1LCYA 1VITH 1H8DH 1QBVH 3TH3H 1D3QB 1UVSH 1K1NA 1RGQA 1OWKA 1TRNA 4GCHF 1EKBB 5JBAS 1ORFA 3RU4D 3S69A 3NXPA 3VXEH 7GCHG 5IDKA 2ZGHA 4K69A 2RDLA 6LPRA 1TBZH 1EOLA 2H9HA 2BDAA 4CBOA 4K1EA 4IMQA 3F68H 1GG6B 3ATMA 5C1YA 2QXGA 2ALPA 1V2TT 2F9NA 2QGRA 1P2NA 3Q76A 5I46H 2BDBA 1HBTH 5L2YH 1SQOA 3T26A 5B6OA 2G52A 3LPRA 3R3GB 3SJKA 3LONA 1DOJA 1SGIB 3IITA 1NESE 3PTNA 1O3LA 3MNCA 1TNLA 3RXJA 5F8ZA 1YPKH 2HRVA 1O2XA 1O3JA 1GDQA 3KHVA 5EODA 3UY9A 2AMDA 3Q00A 1MTNC 1FXYA 4X2XA 1F5LA 1F5KU 1GHVH 1MBMA 1HAXB 2BVRH 1D4PB 3SV7A 1MAYA 4KTCA 3O8CA 4MDSA 1MU8B 1KIGH 4J2YB 3S0NA 1DFPA 2GMTB 1QJ7B 4I31A 3ATKA 3BV9B 4BXSA 4K1SA 3RC5A 4X8SH 1SGPE 3A8AA 1QR3E 1OWEA 2ANWA 2HNTE 2WYGA 1T4VH 1LVOA 2FTLE 1ZTKA 1HRTH 1UHBB 4BTUB 2F83A 3SU3A 2OUAA 2B5TB 3C1KA 1LQEA 4INKA 4WH8A 1GMHG 1BT7A 3T2NA 1KXBA 4Y8XA 1EAWA 1TGBA 1SBWA 3LT3A 1HAGE 3BTFE 1V3XA 1DT2A 4ISOA 5EG4A 3M35A 4AFQA 2ESTE 4UONA 4YOJA 3UR9A 1GL0E 2R3YA 4YOGA 1CGHA 2HNTC 3BIVH 1WCZA 1LHDH 2OQ5A 3FZDA 1Z6JH 4I8LA 3SU5A 1MQ5A 4X0WU 1MAXA 2ZTZA 3LGIA 2SGAA 3H7OA 1WU1A 3TGJE 1DSUA 1O3FA 1G9IE 3NPSA 1UTOA 4NG9H 1YP9A 1LHCH 1NRQH 1O34A 4X6PA 4O3UA 3E16B 4KGAA 1O35A 1ZMLA 1SQAA 4JK6A 3F9FA 3S9AA 1QB9A 4OGXA 5EOKA 1IQIA 2UUKB 1BBRK 1RRKA 1QGFA 2F9BH 1PYTD 4AG2A 2PKAA 2Y5GA 1FQ3A 1SC8U 1O3OA 2VB0A 1F92A 3O8RA 3HPTB 1P09A 2GT8A 5SGAE 3SJ8A 1P2OA 1RIWB 2BVSH 1CU1A 2ASUB 4GCHG 2O8UA 1A61H 2ZF0H 1LTOA 3URCA 3L33A 3TNTA 1UK2A 4WXVA 4YZUA 2EA3A 3UNRA 2EI7A 1F0SA 2STAE 5T6DA 1O5GH 5F8TA 1O2WA 5TCCA 1A4WH 1FUJA 2CN0H 3MI4A 5E0HA 5TJXA 1G36A 2A2QH 1PFXC 1GBEA 2AMPA 1D3DB 3GCOA 4MNVA 1GBCA 1C5SA 3SQEE 1UK3A 4HGCA 5EPNA 2Q6DA 1Q3XA 1Z1JA 1N1LA 1T31A 4Q7XA 4D8NA 1K1JA 2BMGB 3VB6A 4AORA 5GXPA 1N8OC 4X1QU 2WV4A 3TK9A 2OC1A 3FP7E 2G8TA 2G00A 1P8VC 2FI4E 3U8TH 2C8XB 4TY7A 5HXFA 1GWAA 1XUFA 3PMAB 1SGTA 3ZZDA 1YKTA 3UR6A 4CRFA 2GX4A 3F1SB 2FLBH 5ABWA 4A92A 1BJUA 1QIXB 4GVUA 1MMJN 1T4UH 2A5KA 2FOHA 2EI6A 4I33A 2Z3CA 2BDCA 2EI8A 1C1TA 9ESTA 4HI3A 3ZZ3A 1V2QT 2BLVA 1SFQB 4ABGA 2KAIA 3LKWA 2BQ6B 2Z9IA 1SQTA 1J16A 2BB4A 1MZDA 1Z8JB 2FMJA 1SVPA 2UWOA 3ENSB 2QF0A 3RXSA 1V2PT 4TWWA 4FU9A 1TA2A 1Y3XA 4WJG2 3L3TA 3RXUA 1ZHMA 2OXSA 4CH2B 2TPIZ 1VJ9U 5DJ7A 2ZO3H 4LXBH 1KDQB 3SU6A 3T27A 3KGPA 1GMCF 2P93A 5FPYA 1GI6A 1C2DA 3T62A 5DP6A 2QXIA 3PTBA 4JCNA 1O36A 3MU8A 2BD2A 1QL8A 1SLVB 5L30H 3UIRA 1AZ8A 1ELTA 1PYTC 2AFQB 2PKSC 3LGYA 3LU9B 1AMHA 5AFYH 1PQAA 1W2KH 2BOHB 2NWNA 1GJ7B 3TJNA 2XWBI 2TBSA 3EYDA 2ZWLH 4UFEH 3E90B 4O3TA 1AUJA 3BTQE 3M7TA 2PWXA 3ZVBA 4BOHA 2AIPA 2VIWA 2VWLA 4Y7AA 1GI8B 4A1TA 3SI3H 2G55A 4U30A 1AKSA 2NU2E 3B9FH 3SV6A 3TIUA 1QQUA 3SGQE 2Y5FA 1G3CA 1C5PA 3GCHB 1ZGVA 4AG1A 3A7TA 2V3OH 3RMLH 3TPIZ 3K2UA 2PSYA 1C1SA 3RXPA 4UFFH 3LC5A 1GCTB 1TPAE 3GOVB 2WUCA 5A09A 3MH7A 3FP8E 3ZZ5A 1KTSB 1XKAC 1K9OE 2XBWA 1O38A 2BD5A 1UTPA 3A7XA 2FX4A 3RM2H 2HWLB 1LHGH 3ZYDA 1AVWA 3VGCB 1BTUA 3ZZAA 4YOIA 1OXGA 4A1XA 1MKWK 4X8VH 5GIBA 1L4ZA 3A7ZA 1VZQH 2BD7A 3SBKA 2SGFE 4A1VA 1FMGA 5A8ZA 2VWNA 2HGTH 1C5WB 5LGOA 1O5BB 1IQNA 9LPRA 2VGCC 1NFYA 1SGNE 1P57B 3BEUA 1MUEB 2H6MA 2ALVA 4IN1A 1AFQB 5AHGH 1FPCH 1QCPA 4YLUA 3AW0A 6CHAC 2ANKH 1TLDA 2BZAA 2ZPSA 3SGAE 5EPYA 2GVFA 1FJSA 1K28D 3RXGA 3GICB 2AYWA 2XRCA 1QB1A 2Z9GA 3S9CA 3FZZA 2FYRA 4IN2A 4ZKNU 3M61U 1C2LA 5C1XA 8LPRA 1H9HE 6GCHF 3CP7A 4H6SB 4NIXA 1NTPA 4AYVB 4YM9A 4K1TA 4ABBA 3UPEA 1CVWH 1BTHH 1JOUB 1OWHA 3ZZBA 1OS8A 1GI3A 1FI8A 4ABIA 3D62A 4ZH8A 2PTCE 4MQAA 2ZKSA 3PLBA 3SNDA 2ZA5A 3T29A 2BLWA 3A8CA 2GZ7A 1V2VT 5IYTA 4FUIA 3U9AH 3MYWA 4K5ZA 3UQVA 4CREA 1HIAB 1DE7H 3ZV9A 1UTKA 2G5NA 3OY5U 4ZHAA 4BAHB 1DITH 1SOTA 2Y5HA 4KELA 3TK5A 2J38A 4K8BA 1OYQA 4LZ1H 2NU3E 2JH0D 1S82A 1NRSH 1O2IA 4LOYH 2BY6X 1P2QA 2HNTF 1FY5A 2WPKS 5EW2H 5AF9H 4X2VA 1GMCG 2QN5T 3SZNA 3E6PH 5HM9A 2F9PA 4XDEA 5EXNA 3SNEA 3KQBA 1NO9H 2ANMH 4E06H 1TRMA 4CHAB 3BTDE 1MD7A 2ZCHP 5DGJA 1GBLA 3STIA 2JH5D 1JRSA 1ANEA 4X1RU 3SJOA 3GY4A 3PMJA 1DM4B 2FOFA 2ZDLA 4BXWA 1W7GH 1Z71A 1CGJE 4YESB 5DP5A 1D3PB 1HAYB 3MO9A 4DGJA 2ZFPH 5A0BA 4AGJA 4FUHA 1EXFA 1DICA 1ETTH 3M5MA 2A4GA 4OS4A 2PGQB 1MU6B 1ARCA 1LPKB 3A80A 1BMLA 2J92A 3GCHC 3GY3A 5F8XA 4AZ2B 5DP9A 1CA0B 5GPIB 1ELVA 3MHWU 4MTBA 1GCTC 1DX5M 2SFAA 3LDXH 2TRMA 1HYLA 3SJIA 1AWFH 1ZJKA 5JBTA 2XXLA 2THFB 3TK6A 1EPTA 2JETC 1MTSA 1ELBA 3P8GA 3KQDA 4JYTA 2ZG0H 5HMAA 1FV9A 2QCYA 1G2MA 1V2NT 3VGCC 7LPRA 3QLPH 4YLQH 3V13A 2H2ZA 4DCDA 2FI5E 1SLWB 1RXPA 3K6YA 4GHTA 5HYOA 5BPEA 1FY1A 1Y3YA 3DA9B 1OWIA 4NGAH 3BTKE 3LGTA 1DS2E 1PPCE 5EXLA 3BTTE 3QK1A 1AFQC 4TWYA 1HJ8A 1KLJH 1UVTH 4YT7H 4IC6A 1XMNB 3RMOH 2VH0A 1H8IH 1QFKH 1TGSZ 4GAWA 4ESTE 1A5IA 4ZXXH 1BB0B 1BUIA 2FOMB 1HJAB 1P2MA 4BNRA 2FX6A 1ETSH 4XBCA 1ARBA 4DIHH 1O31A 1UTJA 4DIIH 4UD9H 3D23A 1GPZA 3SU4A 4CBNA 2ZFSA 3MNBA 2VIPA 2BVXH 4X2WA 1C9TA 1E37B 1V2UT 3KCGH 1HCGA 3MMGA 2BD9A 2VVCA 3PV4A 4Y8YA 2YOLA 3HGPA 4Q7YA 1P9UA 1QY6A 6GCHG 1DWDH 2P94A 1EOJA 4NFFA 1RTFB 2B9LA 1C4Y2 2LPRA 2VWMA 3P8OA 3RMNH 1E0FD 3PM3A 1S83A 3M7QA 1C1RA 4DURA 1Y3VA 1V2KT 3M5NA 1OPHB 5GJ4B 4F4OC 1KSNA 4B2AA 1GHXH 1C4U2 5J4SA 1MBQA 2J9NA 3VXFH 1X7AC 1KXCA 2BD3A 4WF8A 3SORA 2HPPH 1XVOA 2TGTA 4XSKU 1AD8H 3MNXA 4DJZB 1Y5AT 1XX9A 1PPGE 1GVKB 3ZZCA 4B2CA 4U2WA 3DFLA 1WTHD 2H5CA 4AB9A 4CRAA 2BDHA 1V2RT 4CHAC 5FCRA 1WQSA 1LDTT 1BMMH 1OP0A 1C1OA 1W0YH 2LNCA 2XC5A 1VCPA 3C27B 3F6UH 4UFDH 3ZVAA 3P95A 3RC6A 1BTZA 3EE0B 5ESBA 1W0ZU 4ZUHA 1O2MA 1YPEH 3K9XB 4ABDA 1W11U 1HAHH 1S5SA 4XFQA 3MFJA 1GDNA 3U69H 4KKDA 1UTMA 1P2JA 3HK3B 3SQHE 1ZJDA 1XVMA 1CA0C 2AERH 3A84A 3E0NB 3ZZ4A 3DHKH 2W3IA 3RXRA 2PSXA 1YLDA 2OINA 3U98H 2YNAA 2J4IA 3M5OA 2J2UA 1LMWB 1O2QA 2VWOA 2XW9A 1BDAA 3KNXA 1B7XB 1ZRBA 4NSVA 1P10A 3BG4C 2A7JA 1SL3A 2BY9X 3VPKA 4MPWA 1CO7E 5HGGA 1UJ1A 2CJIA 4RKJB 1NRNH 3M36A 4E7RG 2BD8A 2QF3A
chains in the Genus database with same CATH superfamily
2TGPZ 4RKOB 4WMEA 1NS3A 4OS1A 1QL7A 1NFXA 2I6SA 2J95A 3ZZ8A 1ZSKA 1ZMNA 5EJ1A 2KCYA 2ZFFH 4NZLA 1SPJA 1DUAA 2BQWB 1G2LA 4DVAU 4R8TB 2QXHA 3UREA 4D76A 1EAXA 1BBRE 4X8TH 3HGNA 3RU4E 1AB9B 1QRZA 3TNSA 1S6HA 1HJAC 3KF2A 4H4FA 2WYJA 4BANB 2KCPA 2ZU2A 1ELEE 4TYDA 2PUXB 1XXDA 1B0EA 4IW4E 1DY9A 1C2FA 2GV7A 1ZSJA 1EPTC 3P8FA 3BIUH 1BHXB 2R9PA 2D8WA 4Y6DA 2VU8E 4ZHMU 5C17A 1GJAB 1QB6A 1QBOA 2Z6BD 3SJ9A 3ATLA 2FO9A 2GV6A 1K22H 1TGTA 3MH5A 1SI5H 5CMXH 3PB1E 1S0RA 2F43B 4NCYA 4O97A 3TGKE 1HLTH 1TA6A 3RUOA 2J5UA 2ZU5A 4A7IB 4XRNA 3O8BA 3RXKA 1BTYA 1P9SA 1LKBA 2HLDD 3MNSA 1DY8A 5BRRE 1GBAA 2G81E 1O2HA 2ZFQH 4X6NA 3A82A 7KMEH 3S7HB 2DE9A 2AHME 1A3BH 1O5EH 1C1QA 3UOUA 1ESTA 1K1OA 5L6NH 4CR5A 1W13U 2FOCA 2D1JA 4VGCB 3VB3A 4AC9A 5F53A 1ELCA 1HAIH 1S6LA 4JYVH 1OX1A 1C2JA 4Y76A 2P59A 4TY6A 1GVLA 2A4QA 3CS0A 3EAJA 2P3TB 5T1VA 2OCVB 4P02A 2BXTH 4AX9H 1GMDF 2XBXA 4Y71A 4ACAA 5C1UA 3VB5A 5EQRA 1BZXE 3SHCH 2XBVA 3UUZA 5DKMA 1SGFA 4I32A 1AO5A 1VITF 1GG6C 2P8OB 4X1NU 1L1NA 3K65B 3SU0A 1N6YA 1NN6A 4H6TA 3SU2A 3P6ZB 1OWJA 3T25A 3TJUA 1GBBA 8GCHG 1TBRH 2BTCE 1IQLA 1LVYA 1NC6A 1EQ9A 8KME2 3M3TA 1HAPH 2BDYA 3HKIB 1SQRA 2ZP0H 4Z6AH 1GHAF 4ZXYH 1KDQA 2FEQH 4NWKA 3TJVA 1OWDA 5GCHF 3ATIA 1NFWA 5FBIA 2C3SA 4MVNA 1RTKA 1AVGH 1H9LB 2P95A 4HFPB 1NFUA 2PW8H 2ZFRH 5DP3A 4AYYB 1DWEH 4Y10E 1E38B 2BHGA 1TPSA 1AE5A 1QA7A 5FBEA 1OKXA 3SOSA 2Z3DA 1HAZB 1W14U 1L1JA 3VEQB 3FKSD 4Z1MD 3GDVA 1L2EA 2V7QD 1D9IA 1O3AA 4Y11E 1DLKB 2IPQX 1O3HA 4IS5A 4ZCNA 1KXFA 1LHFH 1XM1A 2GMTC 1TQ7B 4Q80A 3W95A 3LJOA 1A0JA 1JBUH 1XUIA 1J8AA 1P2KA 3EA9A 1NROH 2FS8A 1WOFA 3AVZA 2OQUA 3A81A 3TLOA 2B8OH 1NU9A 1CT4E 1JMOH 3WWFA 3SGBE 1GDUA 2AIQA 5HM2A 1TE0A 4ZROA 2F9OA 1ESBA 4DY7B 2ZPRA 1HAVB 4FUCA 2PUQH 2BDIA 1HNEE 1FIZA 1MTUA 4B76A 3PV5A 4AFUA 2AS9A 3AAUA 5T6GA 3UQOA 1TX6A 3WWBA 4ASUD 3PROA 4YO9A 4DW2U 1T8LA 3K6ZA 1CBWB 1TNHA 4YXWD 1BOQA 1AHTH 1YCPK 1C5LH 1LVMA 1LKAA 2SGDE 1LQDB 4I7YH 2CV3A 1SGYE 3I29A 1GJBB 3SUDA 1O2NA 3ODFA 2ZGCA 1C2EA 2W7SA 1GI2A 2O8LA 2PFEA 4AGKA 5DP4A 3NKKA 2A2XH 4IGDA 3SUEA 1EZQA 1ZLRA 1SHYA 5DP7A 3A7WA 2A7CA 3PMBB 1C5QA 1ID5H 3RXLA 4FU8A 1IHTH 2ZNKH 2OC0A 4I8GA 1INCA 3VB7A 1G3BA 3B23B 1C5TA 1DLEA 1G37A 3SU1A 1GI1A 5CHAB 1O2TA 1P06A 4RN6A 2GCHF 5JBCS 1KXDA 3S9BA 2FIRH 3RXCA 5DP8A 1O5DH 4CRBA 2K8IA 4GLYA 1EB1H 4VGCC 1GJDB 1V2WT 1P12E 1RIWC 4CH8B 2GZ9A 1A2CH 3EA7A 3RLYH 1TMBH 3ZVFA 2IPHA 1O3CA 2L74A 1T7CA 3R0FA 1PPBH 1P11E 2Z94A 2HLCA 3D49H 4ISIH 2QV1A 1JIMA 2GCTB 4DT7B 1GMDG 5ETXA 1TMUH 2ZGXH 4JZDH 1VITG 4DT4A 3BEIB 1YF4A 1PPHE 4NA9H 3LC3A 1ACBE 3BTEE 3FANA 1GBJA 1RS0A 4MNYA 4XE4A 1ZPZA 1BRUP 3PWBA 4IMZA 1TPPA 1ZTJA 1JXPA 3TH4H 1O0DH 3KQCA 2P3UB 1K1PA 4INLA 3RP2A 1HXEH 1GHAG 1V2ST 3ELAH 1O3KA 2C8WB 5GCHG 4ACBA 1Z8RA 2Y80A 3VFEA 1A1RA 5ESTE 1GJ4H 2Q1JA 3GISB 3V3MA 4OS6A 2FOBA 2AH4X 1NBMD 1GBKA 1S84A 1YCPH 4HTCH 5C5NA 2ZFTA 1IQKA 1O2YA 2R3UA 3MU4A 4X6OA 1MTVA 2ZHQH 3ESTA 3DSGA 1FY8E 2XC4A 5CHBA 3UNSA 1H4WA 1AKSB 1E35B 1E1RD 1UMAH 5A0CA 1G30B 2QIQA 1FNIA 1YPHC 2FDAA 1UK4A 2FXRA 1GL1A 1ZSLA 5HIZA 2ZIQH 5EW1H 1ETRH 3GCNA 1GBTA 1Y3WA 4FVBA 3QDZB 5JYIA 1EX3A 2BQ7B 4B73A 3D65E 1L0ZA 2K0QA 3PV2A 3PO1B 1O3MA 5AFZH 4D9RA 2JIZD 1CBWC 3QTVH 2PGBB 2ZPQA 1MZAA 4D7GA 1Y3UA 3RXEA 4ABJA 3RXVA 4CRGA 1OP8A 2A31A 2ODQA 1B5GH 1O2RA 4B71A 2OBOA 1GJ6A 5EGMA 1O3NA 3FP6E 1D3TB 5L2ZH 1O2LA 1Y5BT 1C5ZB 5EU8A 3V0XA 1C2GA 3FN8A 2FOEA 5K7RA 1EUFA 4X1PU 1ELGA 3LJJA 4CR9A 1T8NA 3I77A 4HG6A 5GNDA 4Z0KA 4MPXA 2C4FH 1SR5C 2B0FA 3L6PA 1EJNA 4RT0A 2EEKA 1ZPCA 4ABHA 1YLCA 1N6XA 2J97A 3GDSA 5AVDA 4RSPA 1OOKB 1W12U 3P17H 4Y8ZA 3U1JB 3BTHE 3GY8A 4CRCA 1D6WA 1AGJA 3OEHD 5FPTA 1F5RA 1C2KA 1DWBH 2G5VA 4K60A 1MABB 4O03A 1Z8IB 1V6DA 2ZHDA 2GCHG 1NBME 3BG8A 3RC4A 1J14A 2UUYA 3PMHB 1CT2E 7ESTE 4OS5A 3F2HA 2YNBA 2FTMA 1GJ5H 5A8YA 4Q7ZA 4Y0YE 1AY6H 2GGVB 2OTVA 2QAAA 2FPZA 1SB1H 3FOAA 4XBDA 1DUEA 2FOGA 2BOKA 2GCTC 3SV9A 1NU7B 2SNWA 1ZPBA 4I8HA 1J15A 3LIWA 2BLQA 2ZDNA 1C9PA 2AGGX 1MTNB 4RT1A 2RFKC 2ZEBA 1E79D 1THPB 1GI9B 4YTAA 1TYNA 2GTBA 2LELA 4NSYA 1WSSH 4AOQA 3AW1A 1TAWA 3GYLB 4UFGH 2ZDKA 1C2MA 2WPHS 3CENA 1NRRH 2W3KA 5C0TA 3V12A 5DK1A 3A8DA 1FAKH 3B8JA 3NWUA 3W94A 3MH6A 1MKXK 1QL9A 1EB2A 2QYIA 1NT1A 1LPGB 2Z7FE 4LZ4B 4XOJA 5LPEA 1UCYK 3KYFA 2GJGA 3Q77A 1V2JT 1BRBE 2H5DA 5F6MA 1VR1H 4F49A 1GCDA 3LH1A 4WMFA 4ZHLU 2ZDMA 4NIYA 1DVAH 1SGEE 1COWD 1C2IA 1EATA 3HATH 3QX5H 2J34A 1VCWA 1FPHH 4FXGH 2RA0A 1DXPA 1RTLA 2W6JD 4IBLH 1CT0E 1GBDA 3QUMP 2ZGJA 5H4IB 1TBQH 3E8LA 4K8YA 2ZZUH 5DSFA 5DPAA 5C94A 1K21H 2XOKD 5CE1A 4ZKSU 1C4V2 4JYUH 1RD3B 2KM0A 1F0RA 3PLKA 1S6FA 3OX7U 1A5GH 5C20A 2ZC9H 2ZTYA 5J4QA 2BLOA 1W10U 4NZQA 2NU0E 1QRXA 2CGAA 1BRCE 2WPMS 3ZZ6A 3A7VA 4FUBA 2WZQA 1F0TA 1TALA 1O5FH 1A5HA 1KY9A 2GP9B 1YY3A 2HOBA 1ZHPA 3MH4A 5CDFE 8GCHF 3RXBA 3UWJH 1GBIA 1J17T 1UHBA 3LH3A 5K0HA 3SNBA 3GYMA 2LIZA 2FLRH 4FUFA 1AFEH 3RMMH 2HPQH 3UAIC 1C5MD 1GVZA 3QN7A 2ZU4A 2PR3A 3PYHA 3UWIA 1SGCA 3P70B 5DO4H 3E0PB 3MU5A 1PQ8A 1TMTH 1TNJA 2EC9H 1JIRA 1NZQH 2R2WU 1Y5UT 3MO6A 4WXIA 2ZHFH 1T8MA 2ANYA 4Y0ZE 3PLPA 1THSH 2R0LA 4K2YA 5E0JA 1EP6A 1UTNA 1ZZZA 1SLUB 2FESH 2WV9A 3EDXB 1CHOG 1O2KA 3NCLA 1HB0B 5E8EH 1ANBA 2ODYB 2YMSB 5FPSA 3TH2H 1ABIH 1BTXA 4KTSA 2I6QA 2JKHA 1N8OB 1MKXH 1O2UA 1CE5A 2OC8A 1LVBA 1A0LA 1F0UA 2C8YB 2FODA 1UCYH 4U01A 4NFEA 5GDSH 1PJPA 8ESTE 5JDUB 2SGPE 2WPIS 2Y82A 3UOPA 2A4RA 4ABEA 1O2VA 1EASA 4ISLA 1GI4A 5EQQA 1CHGA 4LK4A 4JZFH 4AN7A 2Z9KA 3ITIA 5FX5A 2R2MB 6ESTA 3GCTF 4FVDA 5T6FA 2XWAA 3Q3XA 2YMSD 2XCFA 1EZSC 1CGIE 2XTTB 3EGKH 2WPLS 5A8XA 3QZRA 4WMDA 1SGDE 3V7TA 4NIWA 3IWMA 1FX0B 4PROA 3ZVDA 4FUDA 4JK5A 1O2GH 5KGOA 4E05H 1UW7A 1Q31A 1XUKA 3OEED 2Q6GA 1KXEA 2L6OA 2H1UA 4AFSA 1ZTLA 5B6LA 1GJ9B 4F48B 2BY7X 4ABAA 1IHSH 3OFND 2OD3B 4ZMAH 3RXIA 4I8JA 1GI5A 1E36B 2EY4C 3RXAA 1MCVA 3GY7A 1LHEH 1P3EA 3ZZ9A 1F2SE 3BTGE 3BEFB 2SGQE 2Z9JA 2BX4A 3M7UA 5LPRA 3UB0A 1QURH 2GZ8A 1C5YB 3OSYA 1P2IA 3DT0H 2GT7A 1NRPH 2ZGBH 3SUFA 3ODDA 1J9CH 1QBNA 1QNJA 1C1NA 2K7XA 1GBMA 1L4DA 4B1TA 3UFAA 1P02A 1ELFA 2DE8A 4JZEH 3RXMA 1AN1E 2PKSB 1YCPM 5KECA 1GGDB 3P92A 1ABJH 2XCNA 1O3BA 3M5LA 1ELAA 2JJ1D 2TGAA 2ZQ2A 5JBBS 5PTPA 5EQSA 1YBWA 2KR7A 4Y7BA 1PPZA 2GDDA 3BN9A 3CNRA 1P03A 4DOQA 3NK8A 5LPFA 3T5FH 3LGWA 3ZZ7A 1K0HA 4THNH 1W0KD 4FUEA 1YGCH 1K1MA 2Q6FA 2BD4A 1EJMA 3U28C 1TGCA 3DD2H 1C1WH 1BQYA 1LO6A 2ZQ1A 2XYAA 3H7TA 3ZIAD 1H9IE 4GSOA 1QA0A 5G4BA 1C5XB 4MLFB 3CS7A 1P3CA 1QQ4A 1SSXA 2W26A 1OP2A 1HAVA 1NPMA 2ZDVH 4ASHA 2OP9A 2F9UA 1O5CB 3IG6B 4D7FA 2VJ1A 1WUNH 1O3IA 1C5NH 1HFDA 1ZYOA 2V35A 2HALA 3DFJA 3NRLA 1GHBF 1NY22 2W6ID 4BAMB 4CRDA 1CQQA 1UO6A 2JH6D 2A32A 2PV9B 3RXFA 1FAXA 1H1BA 5C3NA 1O2PA 2VGCB 2VIOA 3WY8A 2HVXA 1O32A 3KEEA 1C1MA 1ZRKA 2WUBA 2BZ6H 1AI8H 2W7UA 2ZHWH 2RA3A 2YMSC 3JZ1B 1KMHB 2D2DA 1P04A 4MPUA 3RU4T 1UVOA 1UVPA 2UWLA 3GY2A 3F0OA 2IOTA 3RDZA 3OU0A 1C5UA 2PHBA 3OY6U 2D26C 1AU8A 6CHAB 4A6LA 1PPEE 5A0AE 1WXRA 5A2MH 1QHRB 2ODPA 2Y81A 5C67A 3SUGA 3ZVGA 4OS7A 2VH6A 4KP0A 1WTGH 1HV7A 3P8NA 2WPJS 1Q2WA 1A46H 2PKAB 1C5OH 1EZXC 2Y7XA 3TGIE 2CHAB 1OHHD 3RLWH 1EJAA 1UTQA 2O8MA 1BRAA 2Z9LA 2SNVA 3M37A 1TNIA 1GHZA 5JPMH 3GCTG 4MPVA 1RJXB 4TPYA 2FWWA 1ELDE 1TFXA 2ZCKP 2ZI2H 1YC0A 1IQFA 4WH6A 2BXUH 3M3VA 2WPDD 2TIOA 1GBFA 3AK5A 2NU4E 1UVUH 1UTLM 1AB9C 1FIWA 1OYTH 2O8WA 4Q2KA 3EA8A 4JZIA 3RXHA 1IAUA 2G4UA 2K1QA 1V2LT 2F9VA 2GKVE 4ABFA 3SW2B 1C5VA 3NZIA 3EBNA 1GJ8B 1O2JA 2XBYA 3SV2H 4MG3A 5T3HA 2FI3E 3VB4A 2OC7A 1W7XH 3BTWE 2G4TA 2H9EH 1TWXB 2QA9E 2AMQA 3DUXH 3HKJB 1THRH 3SI4H 1K1IA 4B6EA 4DG4A 1BBRH 1MH0A 2C93B 1Z8GA 1KYNA 3QGJA 3URDA 3H09A 3Q3YA 5C2ZA 4GUXA 3JZ2B 5E2PA 2GDEH 1HXFH 2C8ZB 1XXFA 3E91A 1SGFG 5FAHA 1EP5A 1SLXB 2ZU1A 3A89A 3N99A 2QF5A 3NUMA 1IQMA 4FU7A 1G3EA 3MTYA 4NWLA 1A0HB 1HGTH 2NU1E 5E2OA 3GY5A 1IOEA 1GGDC 4X6MA 1Y8TA 1O37A 1S85A 2J94A 4OS2A 3SO3A 1O2SA 4ZKRU 2AGIX 3DSOA 1TX8A 1EAIA 2KAIB 4I8KA 1MD8A 1GBHA 4MNXA 3MU0A 4NIVA 4ZAEA 4JZ1A 1AQ7A 2Y6TA 3FVFB 1Z6EA 3TITA 1FZZA 2W5EA 3AAVA 1TRYA 2QC2A 1KXAA 2UWPA 4R0IA 4B75A 1O2OA 1GJCB 1JWTA 1DANH 2QY0B 1C1UH 3TVJB 2QXJA 1ZOMA 3G01A 3A85A 2VIDA 1WYKA 3QWCH 5EJZA 1L1GA 4J1YA 5JB8S 2P8OC 4KTUA 1H8ED 1QTFA 2B7DH 2WINI 1K1LA 3QO6A 3LGUA 3PWCA 1QRWA 1PQ5A 2JETB 3A83A 1MCTA 3S7KB 1HIAA 1S81A 1LPZB 4INHA 4JMYA 2FZZA 4AFZA 2G51A 2UUFB 3AASA 1SGQE 2BY5X 2CF8H 5EXMA 3KN2A 3SN8A 1O2ZA 3OYPA 4HZHA 4P00A 1YPHE 2V0BA 1BTWA 4TT3D 2H9TH 1TOCB 2SGEE 1GHBG 4GHQA 3MU1A 3F2FA 3OTJE 2XNDD 2A5AA 1T8OA 2A7HA 5JB9S 5EJLA 2BY8X 4H42U 1EAUA 4X2YA 1U6QA 4SGBE 1VGCB 4SGAE 4X8UH 1HPGA 3PRBA 2P16A 1ZHRA 2Y7ZA 1HJ9A 1Z1IA 1FN6A 2P3FH 1TNGA 2IJD1 3F9HA 4BTTB 2ZECA 1P0SH 1AIXH 3KIDU 2F91A 4NA7A 4BAQB 2RG3A 1BIOA 3KQEA 1AUTC 2CHAC 3QGNB 1ANDA 2ZCLP 4NA8A 2Z3EA 1JRTA 4WWYA 1M9UA 4B2BA 5FX6A 2FOAA 3ZVCA 4Y79A 1OSSA 3SHAH 1AWHB 1XKBC 1W3CA 1YYY1 1CSOE 5TCAA 3KL6A 3E3TA 1BCUH 4U32A 4WY3A 1NM6A 2C90B 2ZHEH 1O3DA 5E0GA 1AZZA 4MNWA 4AB8A 3QZQA 3KYGA 4YT6H 2CF9H 1O5AB 2FM2A 2VNTA 4K3JA 1SOZA 1XUJA 2ZU3A 1FY4A 3UNQA 2FYQA 2PTNA 1SFIA 1O30A 3TU7H 3MWIU 1DDJA 1BTPA 1HDTH 1TQ0B 3H5CB 2VVUA 3FAOA 1IQGA 4GPGA 1IQJA 1FN8A 7GCHF 1P01A 4BAOB 1WAYB 4ISNA 2ZDAH 1Z7KA 3EQ0H 1CA8B 2V3HH 1BMAA 3QTOH 3RXOA 1YPGH 3ZVEA 1KLIH 3ATWA 1O39A 3LGVA 3RXDA 1TX7A 1D6RA 1DSTA 3F9EA 2CXVA 1P05A 3O8DA 5CHAC 2STBE 1ESAA 4ZKOU 2VIQA 2WV5A 1BA8B 1O3GA 1MKWH 3UTUH 3GDUA 1B0FA 1CHOF 4TPIZ 2BX3A 1AE8H 4E7NA 1YM0A 1TIOA 4OGYA 2XNIA 2PLXA 1GHYH 1WQVH 2A45B 1PPFE 2GD4B 1RFNA 3DCLA 1FLEE 1QJ6B 2BDGA 3HK6B 4TSFD 2CMYA 4XBBA 4O9VA 1YPLH 4QT8C 4UDWH 1BMNH 2V6NA 3T28A 3ZV8A 4BAKB 2OBQA 2VIVA 4FUJA 5F03A 1BJVA 1C5RA 1UCYE 3BTME 5FHTA 1ANCA 3A88A 3F9GA 1HAOH 5FXLA 3A7YA 4ISHH 1A3EH 1T32A 3RXTA 1ZGIA 1O3PB 3W1EA 3SNCA 2O8TA 1WBGB 3BSQA 3BG4B 2ILNA 1QJ1B 1WV7H 1TONA 2FS9A 1EZUC 2O9QA 3U8RH 4B74A 5KEDA 4M7GA 2M2AA 4BTIB 2A5IA 2A1DB 1K2I1 2BYAX 3SV8A 1IQEA 3U8OH 2F3CE 1GHWH 1ZR0A 1BITA 2VINA 3LOXA 3N7OA 5GWZA 2M5TA 1MTWA 1SHHB 3ZYEA 1DPOA 1Y59T 2ZTXA 1C1VH 1GMHF 5C5OA 2PP6A 2RCEA 2DUCA 3SZEA 1KTTB 5I25A 3SNAA 1VGCC 1TABE 1FONA 1C2HA 1HUTH 1YPMH 5LH8A 3A8BA 1IQHA 1SGRE 2FP7B 1V2OT 1TPOA 3TJOA 1DWCH 1A7SA 1GI7B 1TOMH 3RM0H 2IN2A 1PQ7A 1E34B 2R0KA 1SMFE 2AEIH 1TGNA 3GY6A 3RXQA 2BM2A 1TNKA 1W8BH 1XUHA 3E1XB 1O33A 1YPJH 1EPTB 1F7ZA 1VJAU 2IJOB 3I78A 3STJA 1AVXA 2UUJB 3U1IB 4IC5A 3PO1C 4D9QA 3BF6H 2OLGA 2A4OA 5FCKA 1VCQA 4WVPE 4X1SU 5EIYA 1FDPA 1TB6H 1MQ6A 4UEHH 2XC0A 2TGDA 2HVYB 1XUGA 3Q3KA 1ZMJA 1KLTA 2VVVA 3MO3A 1FY3A 1GI0A 4FUGA 2ULLA 3F0PA 3A86A 4UE7H 4A5TS 1O3EA 1S0QA 3M3SA 3A87A 3FFGA 1BHXF 1W0JD 1V2MT 1G32B 2A0QB 1SG8B 2AGEX 5DG6A 1G3DA 1C1PA 1DXWA 3MOCA 1LCYA 1VITH 1H8DH 1QBVH 3TH3H 1D3QB 1UVSH 1K1NA 1RGQA 1OWKA 1TRNA 4GCHF 1EKBB 5JBAS 1ORFA 3RU4D 3S69A 3NXPA 3VXEH 7GCHG 5IDKA 2ZGHA 4K69A 2RDLA 6LPRA 1TBZH 1EOLA 5C0UA 3OTPA 2H9HA 2BDAA 4CBOA 4K1EA 4IMQA 3F68H 1GG6B 3ATMA 5C1YA 2QXGA 2ALPA 1V2TT 2F9NA 2QGRA 1P2NA 3Q76A 2WHXA 5I46H 2BDBA 4I86A 1HBTH 4M9FA 5L2YH 1SQOA 3T26A 5B6OA 2G52A 3LPRA 3R3GB 3SJKA 3LONA 1DOJA 1SGIB 3IITA 1NESE 3PTNA 1O3LA 3MNCA 1TNLA 3RXJA 5F8ZA 1YPKH 2HRVA 1O2XA 1O3JA 1GDQA 3KHVA 5EODA 3UY9A 2AMDA 1QZ8A 2F4LA 3Q00A 1MTNC 1FXYA 4X2XA 1F5LA 1F5KU 3MQKC 1GHVH 1MBMA 1HAXB 2BVRH 1D4PB 3SV7A 1MAYA 4KTCA 3O8CA 4MDSA 1MU8B 1KIGH 4J2YB 3S0NA 1DFPA 1QJ7B 2GMTB 4I31A 3ATKA 3BV9B 4BXSA 4K1SA 3RC5A 4X8SH 1SGPE 5IK2D 3A8AA 1QR3E 1OWEA 2ANWA 2HNTE 2WYGA 1T4VH 1LVOA 2FTLE 2J98B 1ZTKA 1HRTH 1UHBB 4BTUB 2F83A 3SU3A 2OUAA 2B5TB 3C1KA 1LQEA 4INKA 4WH8A 1GMHG 1BT7A 3T2NA 1KXBA 4Y8XA 1EAWA 1TGBA 1SBWA 3LT3A 1HAGE 3BTFE 1V3XA 1DT2A 4ISOA 5EG4A 1SKYE 3M35A 4AFQA 2ESTE 4UONA 4YOJA 3UR9A 1GL0E 2R3YA 4YOGA 1CGHA 2HNTC 3BIVH 1WCZA 1LHDH 4B6FA 2OQ5A 3OE7D 3FZDA 1Z6JH 4I8LA 3SU5A 1MQ5A 4X0WU 1MAXA 2ZTZA 3LGIA 2SGAA 3H7OA 1WU1A 2EQNA 3TGJE 1DSUA 1O3FA 1G9IE 3NPSA 1UTOA 4NG9H 1VKYA 1YP9A 1LHCH 1NRQH 1O34A 4X6PA 4O3UA 3E16B 4KGAA 1O35A 1ZMLA 1SQAA 4JK6A 3F9FA 3S9AA 1QB9A 4OGXA 5EOKA 1IQIA 2UUKB 1BBRK 1RRKA 2LP6A 1QGFA 2F9BH 1PYTD 4AG2A 2PKAA 2Y5GA 1FQ3A 1SC8U 1O3OA 2VB0A 1F92A 2VBCA 3O8RA 3HPTB 1P09A 2GT8A 5SGAE 3SJ8A 1P2OA 1RIWB 2BVSH 1CU1A 2ASUB 4GCHG 2O8UA 1A61H 2ZF0H 2QE7D 1LTOA 3URCA 3L33A 3TNTA 1UK2A 3FO8D 4WXVA 4YZUA 2EA3A 3UNRA 2EI7A 1F0SA 2STAE 5T6DA 1O5GH 1H8HD 5F8TA 1O2WA 5TCCA 1A4WH 3F3BA 1FUJA 2CN0H 3MI4A 5E0HA 5HIYA 5TJXA 1G36A 2A2QH 1PFXC 1GBEA 2AMPA 1D3DB 3GCOA 4MNVA 1GBCA 1C5SA 3SQEE 1UK3A 4HGCA 5EPNA 2Q6DA 1Q3XA 1Z1JA 1N1LA 1T31A 4Q7XA 4D8NA 1K1JA 2BMGB 3VB6A 4AORA 5GXPA 1N8OC 4X1QU 2WV4A 3TK9A 3GS9A 2OC1A 2WSSD 3FP7E 4FETA 2G8TA 2G00A 1P8VC 2FI4E 3U8TH 2C8XB 4TY7A 5HXFA 1GWAA 1XUFA 3PMAB 1SGTA 3ZZDA 1YKTA 3UR6A 4CRFA 2GX4A 3F1SB 2FLBH 5ABWA 4A92A 1BJUA 1QIXB 4GVUA 1MMJN 1T4UH 2A5KA 2FOHA 2EI6A 5DN6D 4I33A 2Z3CA 2BDCA 2EI8A 1C1TA 9ESTA 4HI3A 3ZZ3A 1V2QT 2BLVA 1SFQB 4ABGA 2KAIA 3LKWA 2BQ6B 2Z9IA 1SQTA 1J16A 2BB4A 1MZDA 1Z8JB 2FMJA 1SVPA 2UWOA 3ENSB 2QF0A 3RXSA 1V2PT 4TWWA 4FU9A 1TA2A 1Y3XA 4WJG2 3L3TA 3RXUA 1ZHMA 2OXSA 4CH2B 2TPIZ 1VJ9U 3PRDA 5DJ7A 2ZO3H 4LXBH 1KDQB 3SU6A 3T27A 3KGPA 1GMCF 2P93A 5FPYA 1GI6A 1C2DA 3T62A 5DP6A 2QXIA 3PTBA 4JCNA 1O36A 3MU8A 2BD2A 1QL8A 1SLVB 2JDID 5L30H 3UIRA 1AZ8A 1ELTA 1PYTC 2AFQB 2PKSC 3LGYA 3LU9B 1AMHA 5AFYH 1PQAA 1W2KH 2BOHB 2NWNA 1GJ7B 3TJNA 2XWBI 2TBSA 3EYDA 2ZWLH 4UFEH 3E90B 4O3TA 1AUJA 3BTQE 3M7TA 2PWXA 3EE7A 3ZVBA 4BOHA 2AIPA 2VIWA 2VWLA 4Y7AA 1GI8B 4A1TA 3SI3H 2G55A 4U30A 1AKSA 1WDIA 2NU2E 3B9FH 3TIUA 3SV6A 1QQUA 3SGQE 2Y5FA 1G3CA 1C5PA 1E1QD 1ZGVA 3GCHB 4AG1A 3N7DA 3A7TA 2V3OH 3RMLH 3TPIZ 3K2UA 2PSYA 1C1SA 3RXPA 4UFFH 3LC5A 1GCTB 1TPAE 3GOVB 2WUCA 5A09A 3MH7A 3FP8E 3ZZ5A 1KTSB 1XKAC 1K9OE 2XBWA 1O38A 2BD5A 1UTPA 3A7XA 2FX4A 3RM2H 2HWLB 1LHGH 3ZYDA 1AVWA 3VGCB 1BTUA 3ZZAA 4YOIA 1OXGA 4A1XA 1MKWK 4X8VH 5GIBA 1L4ZA 3A7ZA 1VZQH 2BD7A 3SBKA 2SGFE 4A1VA 1FMGA 1YLNA 5A8ZA 2VWNA 2HGTH 1C5WB 5LGOA 1O5BB 1IQNA 9LPRA 2VGCC 1NFYA 1SGNE 1P57B 3BEUA 1MUEB 2H6MA 2ALVA 4IN1A 1AFQB 2JJ2D 5AHGH 1FPCH 1QCPA 4YLUA 3AW0A 6CHAC 2ANKH 1TLDA 2BZAA 2ZPSA 3SGAE 5EPYA 2GVFA 1FJSA 1K28D 3RXGA 3GICB 4Q4LA 2AYWA 2XRCA 1QB1A 2KFWA 2Z9GA 3S9CA 3FZZA 2FYRA 4IN2A 4ZKNU 3M61U 1C2LA 5C1XA 8LPRA 1H9HE 6GCHF 3CP7A 4H6SB 4NIXA 1NTPA 4AYVB 4YM9A 4K1TA 3WW7A 4ABBA 3UPEA 1CVWH 1BTHH 1JOUB 1OWHA 3ZZBA 1OS8A 1GI3A 1FI8A 4ABIA 3D62A 4ZH8A 1EFRD 2PTCE 4MQAA 2ZKSA 3PLBA 3SNDA 2ZA5A 3T29A 2BLWA 3A8CA 2GZ7A 1V2VT 5IYTA 4FUIA 3U9AH 3MYWA 4K5ZA 3UQVA 4CREA 1HIAB 1DE7H 3ZV9A 1UTKA 2G5NA 3OY5U 4ZHAA 4BAHB 1DITH 1SOTA 2Y5HA 4KELA 5HKKD 3TK5A 2J38A 4K8BA 1OYQA 4LZ1H 2NU3E 2JH0D 1S82A 1NRSH 1O2IA 4LOYH 2BY6X 1P2QA 2HNTF 1FY5A 2WPKS 5EW2H 5AF9H 4X2VA 1GMCG 2QN5T 3SZNA 3E6PH 5HM9A 2F9PA 4XDEA 5EXNA 3SNEA 3KQBA 1NO9H 2ANMH 4E06H 1TRMA 4CHAB 2QF4A 3BTDE 1MD7A 2ZCHP 5DGJA 1GBLA 3STIA 2JH5D 1JRSA 1ANEA 4X1RU 3SJOA 3GY4A 3PMJA 1DM4B 2FOFA 2ZDLA 4BXWA 1W7GH 1Z71A 1CGJE 4YESB 5DP5A 1D3PB 1HAYB 3MO9A 4DGJA 2ZFPH 5A0BA 4AGJA 4FUHA 1EXFA 1DICA 1ETTH 3M5MA 2A4GA 4OS4A 2PGQB 1MU6B 1ARCA 1LPKB 3A80A 1BMLA 2J92A 3GCHC 3GY3A 5F8XA 4AZ2B 5DP9A 1CA0B 2KCAA 5GPIB 1ELVA 3MHWU 4MTBA 1GCTC 1DX5M 2SFAA 2V3MA 3LDXH 2TRMA 1HYLA 3SJIA 2RDEA 2OK5A 1AWFH 1ZJKA 5JBTA 2XXLA 2THFB 3TK6A 4FOUC 1EPTA 2JETC 1MTSA 1ELBA 3P8GA 3KQDA 3SYJA 4JYTA 2ZG0H 5HMAA 1FV9A 2QCYA 1G2MA 1V2NT 3VGCC 7LPRA 3QLPH 4YLQH 3V13A 2H2ZA 4DCDA 2FI5E 1SLWB 1RXPA 3K6YA 4GHTA 5HYOA 2KX4A 1FY1A 5BPEA 1Y3YA 3DA9B 4F55A 1OWIA 4NGAH 3BTKE 3LGTA 1DS2E 1PPCE 5EXLA 3BTTE 3QK1A 1AFQC 4TWYA 1HJ8A 1KLJH 1UVTH 4YT7H 4IC6A 1XMNB 3RMOH 2VH0A 1H8IH 1QFKH 1TGSZ 4GAWA 4ESTE 1A5IA 3OAAD 4ZXXH 1BB0B 1BUIA 2FOMB 1HJAB 1P2MA 4BNRA 2FX6A 1ETSH 4XBCA 1ARBA 4DIHH 1O31A 1UTJA 4DIIH 4UD9H 3D23A 1GPZA 3SU4A 4CBNA 2ZFSA 3MNBA 2VIPA 2BVXH 3KQ5A 4X2WA 1C9TA 1E37B 1V2UT 3KCGH 1HCGA 3MMGA 2BD9A 2VVCA 3PV4A 4Y8YA 2YOLA 3HGPA 5FL7D 4Q7YA 1P9UA 3VG8A 1QY6A 6GCHG 1DWDH 2P94A 1EOJA 4NFFA 1RTFB 2B9LA 1C4Y2 2LPRA 1BMFD 2VWMA 3N7EA 3P8OA 3RMNH 1E0FD 3PM3A 1S83A 3M7QA 1C1RA 4DURA 1Y3VA 1V2KT 3M5NA 1OPHB 4XD7D 5GJ4B 2CK3D 4F4OC 3F2GA 1KSNA 4B2AA 1GHXH 1C4U2 5J4SA 1MBQA 2J9NA 3VXFH 1X7AC 1KXCA 2BD3A 4WF8A 3SORA 2HPPH 1XVOA 2TGTA 4XSKU 1AD8H 3MNXA 4DJZB 1Y5AT 1XX9A 1PPGE 1GVKB 3ZZCA 4B2CA 4U2WA 3DFLA 1WTHD 2H5CA 4AB9A 4CRAA 2BDHA 2KZ4A 1V2RT 4CHAC 5FCRA 1WQSA 1LDTT 1BMMH 1OP0A 1C1OA 1W0YH 2LNCA 2XC5A 1VCPA 3C27B 3F6UH 4UFDH 3ZVAA 3P95A 3RC6A 1BTZA 3EE0B 5ESBA 2J98A 1W0ZU 4ZUHA 1O2MA 1YPEH 3K9XB 4ABDA 1W11U 1HAHH 1S5SA 4XFQA 3MFJA 1GDNA 3U69H 4KKDA 4Q63A 1UTMA 1P2JA 3HK3B 3SQHE 1ZJDA 1XVMA 1CA0C 2AERH 3A84A 3E0NB 3ZZ4A 3DHKH 2W3IA 3RXRA 2PSXA 1YLDA 2OINA 3U98H 2YNAA 2KCOA 2J4IA 3M5OA 2J2UA 1LMWB 4OM9A 1O2QA 2VWOA 2XW9A 1BDAA 3KNXA 1B7XB 1ZRBA 4NSVA 1P10A 3BG4C 2A7JA 1SL3A 4RI0A 2BY9X 3VPKA 3DSPA 4MPWA 1CO7E 5HGGA 1UJ1A 2CJIA 4RKJB 1NRNH 3M36A 4E7RG 2BD8A 1YWUA 2QF3A
chains in the Genus database with same CATH topology
2TGPZ 4RKOB 4WMEA 1NS3A 4OS1A 1QL7A 1NFXA 2I6SA 2J95A 3ZZ8A 1ZSKA 1ZMNA 2ZFFH 4NZLA 1SPJA 1DUAA 2BQWB 1G2LA 4DVAU 4R8TB 2QXHA 3UREA 4D76A 1EAXA 1BBRE 4X8TH 3HGNA 3RU4E 1AB9B 1QRZA 3TNSA 1S6HA 1HJAC 3KF2A 4H4FA 2WYJA 4BANB 2ZU2A 1ELEE 4TYDA 2PUXB 1XXDA 1B0EA 4IW4E 1DY9A 1C2FA 2GV7A 1ZSJA 1EPTC 3P8FA 3BIUH 1BHXB 2R9PA 2D8WA 4Y6DA 2VU8E 4ZHMU 1GJAB 1QB6A 1QBOA 2Z6BD 3SJ9A 3ATLA 2FO9A 2GV6A 1K22H 1TGTA 3MH5A 1SI5H 5CMXH 3PB1E 1S0RA 4NCYA 4O97A 3TGKE 1HLTH 1TA6A 3RUOA 2ZU5A 4A7IB 3O8BA 3RXKA 1BTYA 1P9SA 1LKBA 3MNSA 1DY8A 5BRRE 1GBAA 2G81E 1O2HA 2ZFQH 4X6NA 3A82A 7KMEH 3S7HB 2DE9A 1A3BH 1O5EH 1C1QA 3UOUA 1ESTA 1K1OA 5L6NH 4CR5A 1W13U 2FOCA 2D1JA 4VGCB 3VB3A 1ELCA 1HAIH 4JYVH 1OX1A 1C2JA 4Y76A 2P59A 4TY6A 1GVLA 2A4QA 3CS0A 3EAJA 2P3TB 2OCVB 2BXTH 4AX9H 1GMDF 2XBXA 4Y71A 5C1UA 3VB5A 5EQRA 1BZXE 3SHCH 2XBVA 3UUZA 5DKMA 1SGFA 4I32A 1AO5A 1VITF 1GG6C 2P8OB 4X1NU 1L1NA 3K65B 3SU0A 1N6YA 1NN6A 4H6TA 3SU2A 3P6ZB 1OWJA 3T25A 3TJUA 1GBBA 8GCHG 1TBRH 2BTCE 1IQLA 1LVYA 1NC6A 1EQ9A 8KME2 3M3TA 1HAPH 2BDYA 3HKIB 2ZP0H 4Z6AH 1GHAF 4ZXYH 1KDQA 2FEQH 4NWKA 3TJVA 1OWDA 5GCHF 3ATIA 1NFWA 5FBIA 2C3SA 4MVNA 1RTKA 1AVGH 1H9LB 2P95A 4HFPB 1NFUA 2PW8H 2ZFRH 5DP3A 4AYYB 1DWEH 4Y10E 1E38B 2BHGA 1TPSA 1AE5A 1QA7A 5FBEA 1OKXA 3SOSA 2Z3DA 1HAZB 1W14U 1L1JA 3VEQB 3GDVA 1L2EA 1D9IA 1O3AA 4Y11E 1DLKB 1O3HA 4IS5A 1KXFA 1LHFH 1XM1A 2GMTC 1TQ7B 4Q80A 3W95A 3LJOA 1A0JA 1JBUH 1XUIA 1J8AA 1P2KA 3EA9A 1NROH 2FS8A 1WOFA 3AVZA 2OQUA 3A81A 3TLOA 2B8OH 1NU9A 1CT4E 1JMOH 3SGBE 1GDUA 2AIQA 5HM2A 1TE0A 4ZROA 2F9OA 1ESBA 4DY7B 2ZPRA 1HAVB 4FUCA 2PUQH 2BDIA 1HNEE 1FIZA 1MTUA 4B76A 4AFUA 2AS9A 3AAUA 5T6GA 3UQOA 1TX6A 4DW2U 3PROA 4YO9A 1T8LA 3K6ZA 1CBWB 1TNHA 1BOQA 1AHTH 1YCPK 1C5LH 1LVMA 1LKAA 2SGDE 1LQDB 4I7YH 2CV3A 1SGYE 3I29A 1GJBB 3SUDA 1O2NA 3ODFA 2ZGCA 1C2EA 2W7SA 1GI2A 2O8LA 2PFEA 4AGKA 5DP4A 3NKKA 2A2XH 4IGDA 3SUEA 1EZQA 1ZLRA 1SHYA 5DP7A 3A7WA 2A7CA 3PMBB 1C5QA 1ID5H 3RXLA 4FU8A 1IHTH 2ZNKH 2OC0A 4I8GA 1INCA 3VB7A 1G3BA 3B23B 1C5TA 1DLEA 1G37A 3SU1A 1GI1A 5CHAB 1O2TA 1P06A 4RN6A 2GCHF 5JBCS 1KXDA 3S9BA 2FIRH 3RXCA 5DP8A 1O5DH 4CRBA 4GLYA 1EB1H 4VGCC 1GJDB 1V2WT 1P12E 1RIWC 4CH8B 2GZ9A 1A2CH 3EA7A 3RLYH 1TMBH 3ZVFA 2IPHA 1O3CA 3R0FA 1T7CA 1PPBH 1P11E 2Z94A 2HLCA 3D49H 4ISIH 2QV1A 1JIMA 2GCTB 4DT7B 1GMDG 5ETXA 1TMUH 2ZGXH 4JZDH 1VITG 3BEIB 1YF4A 1PPHE 4NA9H 3LC3A 1ACBE 3BTEE 3FANA 1GBJA 1RS0A 4MNYA 4XE4A 1ZPZA 1BRUP 3PWBA 4IMZA 1TPPA 1ZTJA 1JXPA 3TH4H 1O0DH 3KQCA 2P3UB 1K1PA 4INLA 3RP2A 1HXEH 1GHAG 1V2ST 3ELAH 1O3KA 2C8WB 5GCHG 1Z8RA 2Y80A 3VFEA 1A1RA 5ESTE 1GJ4H 2Q1JA 3GISB 3V3MA 4OS6A 2FOBA 2AH4X 1GBKA 1S84A 1YCPH 4HTCH 5C5NA 2ZFTA 1IQKA 1O2YA 2R3UA 3MU4A 4X6OA 1MTVA 2ZHQH 3ESTA 1FY8E 2XC4A 3UNSA 1H4WA 1AKSB 1E35B 1UMAH 5A0CA 1G30B 2QIQA 1FNIA 1YPHC 2FDAA 1UK4A 2FXRA 1GL1A 1ZSLA 2ZIQH 5EW1H 1ETRH 3GCNA 1GBTA 1Y3WA 4FVBA 3QDZB 5JYIA 1EX3A 2BQ7B 4B73A 3D65E 1L0ZA 3PO1B 1O3MA 5AFZH 4D9RA 1CBWC 3QTVH 2PGBB 2ZPQA 1MZAA 4D7GA 1Y3UA 3RXEA 4ABJA 3RXVA 4CRGA 1OP8A 2A31A 2ODQA 1B5GH 1O2RA 4B71A 2OBOA 1GJ6A 5EGMA 1O3NA 3FP6E 1D3TB 5L2ZH 1O2LA 1Y5BT 1C5ZB 5EU8A 3V0XA 1C2GA 2FOEA 5K7RA 1EUFA 4X1PU 1ELGA 3LJJA 4CR9A 1T8NA 3I77A 4Z0KA 4MPXA 2C4FH 1SR5C 2B0FA 3L6PA 1EJNA 2EEKA 1ZPCA 4ABHA 1YLCA 1N6XA 3GDSA 5AVDA 4RSPA 1OOKB 1W12U 3P17H 4Y8ZA 3U1JB 3BTHE 3GY8A 4CRCA 1D6WA 1AGJA 5FPTA 1F5RA 1C2KA 1DWBH 2G5VA 4K60A 4O03A 1Z8IB 1V6DA 2ZHDA 2GCHG 3BG8A 3RC4A 1J14A 2UUYA 3PMHB 1CT2E 7ESTE 4OS5A 2YNBA 2FTMA 1GJ5H 5A8YA 4Q7ZA 4Y0YE 1AY6H 2GGVB 2OTVA 2QAAA 2FPZA 1SB1H 4XBDA 1DUEA 2FOGA 2BOKA 2GCTC 3SV9A 1NU7B 2SNWA 1ZPBA 4I8HA 1J15A 3LIWA 2BLQA 2ZDNA 1C9PA 2AGGX 1MTNB 2ZEBA 1THPB 1GI9B 4YTAA 1TYNA 2GTBA 4NSYA 1WSSH 4AOQA 3AW1A 1TAWA 3GYLB 4UFGH 2ZDKA 1C2MA 2WPHS 3CENA 1NRRH 2W3KA 3V12A 5DK1A 3A8DA 1FAKH 3B8JA 3NWUA 3W94A 3MH6A 1MKXK 1QL9A 1EB2A 2QYIA 1NT1A 1LPGB 2Z7FE 4LZ4B 4XOJA 5LPEA 1UCYK 3Q77A 1V2JT 1BRBE 2H5DA 5F6MA 1VR1H 4F49A 1GCDA 3LH1A 4WMFA 4ZHLU 2ZDMA 4NIYA 1DVAH 1SGEE 1C2IA 1EATA 3HATH 3QX5H 2J34A 1VCWA 1FPHH 4FXGH 2RA0A 1DXPA 1RTLA 4IBLH 1CT0E 1GBDA 3QUMP 2ZGJA 5H4IB 1TBQH 3E8LA 4K8YA 2ZZUH 5DPAA 1K21H 5CE1A 4ZKSU 1C4V2 4JYUH 1RD3B 1F0RA 3PLKA 1S6FA 3OX7U 1A5GH 5C20A 2ZC9H 2ZTYA 5J4QA 2BLOA 1W10U 4NZQA 2NU0E 1QRXA 2CGAA 1BRCE 2WPMS 3ZZ6A 3A7VA 4FUBA 1F0TA 1TALA 1O5FH 1A5HA 1KY9A 2GP9B 1ZHPA 2HOBA 3MH4A 8GCHF 3RXBA 3UWJH 1GBIA 1J17T 1UHBA 3LH3A 5K0HA 3SNBA 3GYMA 2LIZA 2FLRH 4FUFA 1AFEH 3RMMH 2HPQH 1C5MD 1GVZA 3QN7A 2ZU4A 2PR3A 3PYHA 3UWIA 1SGCA 3P70B 5DO4H 3E0PB 3MU5A 1PQ8A 1TMTH 1TNJA 2EC9H 1JIRA 1NZQH 2R2WU 1Y5UT 3MO6A 4WXIA 2ZHFH 1T8MA 2ANYA 4Y0ZE 3PLPA 1THSH 2R0LA 4K2YA 5E0JA 1EP6A 1UTNA 1ZZZA 1SLUB 2FESH 3EDXB 1CHOG 1O2KA 3NCLA 1HB0B 5E8EH 1ANBA 2ODYB 5FPSA 3TH2H 1ABIH 1BTXA 4KTSA 2I6QA 2JKHA 1N8OB 1MKXH 1O2UA 1CE5A 2OC8A 1LVBA 1A0LA 1F0UA 2C8YB 2FODA 1UCYH 4U01A 4NFEA 5GDSH 1PJPA 8ESTE 5JDUB 2SGPE 2WPIS 2Y82A 3UOPA 2A4RA 4ABEA 1O2VA 1EASA 4ISLA 1GI4A 5EQQA 1CHGA 4LK4A 4JZFH 4AN7A 2Z9KA 3ITIA 5FX5A 2R2MB 6ESTA 3GCTF 4FVDA 5T6FA 2XWAA 3Q3XA 2XCFA 1EZSC 1CGIE 2XTTB 3EGKH 2WPLS 5A8XA 3QZRA 4WMDA 1SGDE 3V7TA 4NIWA 3IWMA 4PROA 3ZVDA 4FUDA 4JK5A 1O2GH 4E05H 1Q31A 1XUKA 2Q6GA 1KXEA 2H1UA 4AFSA 1ZTLA 1GJ9B 2BY7X 4ABAA 1IHSH 2OD3B 4ZMAH 3RXIA 4I8JA 1GI5A 1E36B 3RXAA 1MCVA 3GY7A 1LHEH 1P3EA 3ZZ9A 1F2SE 3BTGE 3BEFB 2SGQE 2Z9JA 2BX4A 3M7UA 5LPRA 1QURH 2GZ8A 1C5YB 3OSYA 1P2IA 3DT0H 2GT7A 1NRPH 2ZGBH 3SUFA 3ODDA 1J9CH 1QBNA 1QNJA 1C1NA 2K7XA 1GBMA 1L4DA 4B1TA 3UFAA 1P02A 1ELFA 2DE8A 4JZEH 3RXMA 1AN1E 2PKSB 1YCPM 1GGDB 3P92A 1ABJH 2XCNA 1O3BA 3M5LA 1ELAA 2TGAA 2ZQ2A 5JBBS 5PTPA 5EQSA 1YBWA 4Y7BA 1PPZA 2GDDA 3BN9A 1P03A 4DOQA 3NK8A 5LPFA 3T5FH 3LGWA 3ZZ7A 4THNH 4FUEA 1YGCH 1K1MA 2Q6FA 2BD4A 1EJMA 3DD2H 1TGCA 1C1WH 1BQYA 1LO6A 2ZQ1A 2XYAA 3H7TA 1H9IE 4GSOA 1QA0A 5G4BA 1C5XB 4MLFB 3CS7A 1P3CA 1QQ4A 1SSXA 2W26A 1OP2A 1HAVA 1NPMA 2ZDVH 4ASHA 2OP9A 2F9UA 1O5CB 3IG6B 4D7FA 2VJ1A 1WUNH 1O3IA 1C5NH 1HFDA 1ZYOA 2V35A 2HALA 3DFJA 1GHBF 1NY22 4BAMB 4CRDA 1CQQA 1UO6A 2JH6D 2A32A 2PV9B 3RXFA 1FAXA 1H1BA 5C3NA 1O2PA 2VGCB 2VIOA 3WY8A 2HVXA 1O32A 3KEEA 1C1MA 1ZRKA 2WUBA 2BZ6H 1AI8H 2W7UA 2ZHWH 2RA3A 3JZ1B 2D2DA 1P04A 4MPUA 3RU4T 1UVOA 1UVPA 2UWLA 3GY2A 2IOTA 3RDZA 3OU0A 1C5UA 2PHBA 3OY6U 2D26C 1AU8A 6CHAB 4A6LA 1PPEE 5A0AE 5A2MH 1QHRB 2ODPA 2Y81A 5C67A 3SUGA 3ZVGA 4OS7A 2VH6A 4KP0A 1WTGH 1HV7A 3P8NA 2WPJS 1Q2WA 1A46H 2PKAB 1C5OH 1EZXC 2Y7XA 3TGIE 2CHAB 3RLWH 1EJAA 1UTQA 2O8MA 1BRAA 2Z9LA 2SNVA 3M37A 1TNIA 1GHZA 5JPMH 3GCTG 4MPVA 1RJXB 4TPYA 2FWWA 1ELDE 1TFXA 2ZCKP 2ZI2H 1YC0A 1IQFA 4WH6A 2BXUH 3M3VA 2TIOA 1GBFA 2NU4E 1UVUH 1UTLM 1AB9C 1FIWA 1OYTH 2O8WA 4Q2KA 3EA8A 4JZIA 3RXHA 1IAUA 2G4UA 2K1QA 1V2LT 2F9VA 2GKVE 4ABFA 3SW2B 1C5VA 3NZIA 3EBNA 1GJ8B 1O2JA 2XBYA 3SV2H 4MG3A 5T3HA 2FI3E 3VB4A 2OC7A 1W7XH 3BTWE 2G4TA 2H9EH 1TWXB 2QA9E 2AMQA 3DUXH 3HKJB 1THRH 3SI4H 1K1IA 4DG4A 1BBRH 1MH0A 2C93B 1Z8GA 1KYNA 3QGJA 3URDA 3Q3YA 5C2ZA 4GUXA 3JZ2B 5E2PA 2GDEH 1HXFH 2C8ZB 1XXFA 3E91A 1SGFG 5FAHA 1EP5A 1SLXB 2ZU1A 3A89A 3NUMA 1IQMA 4FU7A 1G3EA 3MTYA 4NWLA 1A0HB 1HGTH 2NU1E 5E2OA 3GY5A 1IOEA 1GGDC 4X6MA 1Y8TA 1O37A 1S85A 2J94A 4OS2A 3SO3A 1O2SA 4ZKRU 2AGIX 1TX8A 1EAIA 2KAIB 4I8KA 1MD8A 1GBHA 4MNXA 3MU0A 4NIVA 4ZAEA 4JZ1A 1AQ7A 2Y6TA 3FVFB 1Z6EA 3TITA 1FZZA 2W5EA 3AAVA 1TRYA 2QC2A 1KXAA 2UWPA 4R0IA 4B75A 1O2OA 1GJCB 1JWTA 1DANH 2QY0B 1C1UH 3TVJB 2QXJA 1ZOMA 3G01A 3A85A 2VIDA 1WYKA 3QWCH 1L1GA 4J1YA 5JB8S 2P8OC 4KTUA 1QTFA 2B7DH 2WINI 1K1LA 3QO6A 3LGUA 3PWCA 1QRWA 1PQ5A 2JETB 3A83A 1MCTA 3S7KB 1HIAA 1S81A 1LPZB 4INHA 4JMYA 2FZZA 4AFZA 2G51A 2UUFB 3AASA 1SGQE 2BY5X 2CF8H 5EXMA 3KN2A 3SN8A 1O2ZA 3OYPA 4HZHA 1YPHE 2V0BA 1BTWA 2H9TH 1TOCB 2SGEE 1GHBG 4GHQA 3MU1A 3OTJE 2A5AA 1T8OA 2A7HA 5JB9S 2BY8X 4H42U 1EAUA 4X2YA 1U6QA 4SGBE 1VGCB 4SGAE 4X8UH 1HPGA 2P16A 1ZHRA 2Y7ZA 1HJ9A 1Z1IA 1FN6A 2P3FH 1TNGA 3F9HA