2VJ1A

A structural view of the inactivation of the sars-coronavirus main proteinase by benzotriazole esters
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
300
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural View of the Inactivation of the Sars Coronavirus Main Proteinase by Benzotriazole Esters.
pubmed doi rcsb
source organism Human sars coronavirus
molecule tags Hydrolase
molecule keywords SARS CORONAVIRUS MAIN PROTEINASE
total genus 82
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.34.-:
pdb deposition date 2007-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2vj1A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vj1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vj1A02
1C5PA 3ZZ3A 1O3JA 1YCPH 2HOBA 4RKJB 4X2WA 1J16A 4K1TA 1OYQA 5AHGH 3GY6A 1LPZB 4O9VA 2ZECA 4YOIA 1O5FH 2QGRA 2W7SA 1DX5M 2QV1A 3RP2A 1GCDA 2J2UA 1GBCA 2ZTZA 1C5NH 4WVPE 4FVDA 1GHAF 3FZDA 4OS2A 1C5SA 2WYJA 2XBWA 3A8AA 3F9HA 1QJ1B 1O5DH 1BJVA 1BA8B 1F2SE 1Z6EA 2XWBI 3A8BA 1A2CH 4INHA 1GDNA 3ZZDA 2XCFA 3BTEE 2GMTC 1S82A 3CS7A 1T8OA 3UR6A 3UFAA 1YYY1 2BY5X 3ZZ6A 1W8BH 1T32A 1G2MA 1H8DH 1RIWB 3M35A 4NZLA 4X2VA 5A8XA 1SI5H 2ZEBA 2ZA5A 3MH6A 4ABEA 4MNVA 2QF3A 1ELTA 5AVDA 1UK2A 1HB0B 3LC5A 6LPRA 2AGEX 1IQLA 1THRH 1GBLA 3UUZA 1D9IA 5ETXA 1CBWC 1UTPA 5JBBS 1O3DA 1FY3A 5EQSA 1JMOH 2DE8A 1ARCA 4BTTB 3QK1A 1YF4A 1TQ0B 1MQ5A 3P92A 1VJAU 1HAXB 3ATMA 1MD7A 4XBDA 4WY3A 3ATIA 1SB1H 1AWFH 3PMAB 1ZLRA 3T25A 4FU8A 3FP8E 1EXFA 3E6PH 1GJ4H 1QHRB 5LPRA 3UQVA 3ZZAA 2BB4A 3BN9A 2Z9IA 1EB1H 2HRVA 1GJ9B 5L2ZH 2VNTA 1ZR0A 2VWOA 1SGPE 1G2LA 1BHXF 1VCPA 1HPGA 1ZGIA 2BDAA 2HLCA 2BOHB 2WV4A 4NWLA 1V2ST 4Y10E 1EPTA 2F9NA 1AI8H 2F9OA 3E1XB 1Y3UA 1BTPA 1Z71A 4GPGA 2GZ7A 5GDSH 2BLWA 2SFAA 2ALVA 2ZU3A 3E0NB 3SU4A 1F5RA 3GY4A 2GZ8A 1ZZZA 1LO6A 4JK5A 3URDA 1C5VA 1V6DA 2B0FA 5EPYA 1SQAA 4CBOA 1YPGH 3ZZCA 3LONA 1O3HA 5LH8A 3NK8A 2GT7A 3K6ZA 1FIZA 1EJNA 1AZ8A 1K1NA 4Y71A 1FIWA 2Z3DA 1XXDA 1BRAA 1EKBB 3RMMH 1F7ZA 4JZDH 3ZZ8A 2KAIA 1FV9A 1KLTA 2XC5A 3EA7A 1MCTA 4ISNA 3IITA 1F92A 1ELEE 3RXMA 1EAIA 2H9EH 1BMMH 1GHYH 1A4WH 3QWCH 4Y11E 2AMDA 1HRTH 2VIVA 4NSVA 1PQ5A 1CHOF 3ZVDA 1A0HB 2NWNA 1JOUB 5GCHF 1SLXB 4KP0A 1BBRE 1FAKH 2A2XH 2FOHA 1L1GA 2FX4A 1OKXA 5LPFA 3L3TA 2BY6X 1WOFA 3M3TA 1TONA 2JH0D 3NPSA 1LVOA 3VXFH 4B1TA 1QL9A 3RXTA 2GDEH 3ZYEA 4NIVA 3Q3XA 3E3TA 2VIPA 1EZSC 1GVLA 5JB9S 4ZKRU 4FUEA 1GG6C 2TRMA 2OC0A 2ZFRH 5EXLA 4RN6A 3DHKH 2ZFQH 1OX1A 3CENA 2SNWA 3ODDA 3SU3A 1XUHA 1UHBA 2RCEA 2F91A 1ZTKA 2BDGA 1H9HE 4X1RU 2A4QA 1OYTH 4AFSA 3E91A 1O2JA 3I29A 2JH5D 2FOMB 2QIQA 2DUCA 1O30A 4ABAA 3FP6E 2Y7XA 3VXEH 3SI4H 1HLTH 4ABJA 3K2UA 3GCHC 1NTPA 4O3UA 4X8VH 3LJOA 3K65B 4M7GA 3P70B 1BRUP 4CBNA 3T28A 1QTFA 5EODA 5DP3A 3GCTF 3A87A 1GI6A 3GCOA 4X6PA 3SJ9A 1CQQA 1ESTA 3RXUA 2LNCA 4Y8YA 2BY9X 1UHBB 5C1UA 3SZNA 1W2KH 1O2RA 4Y7AA 1QL7A 4WJG2 3T27A 1QRXA 3PTNA 1HGTH 3DT0H 2V0BA 4TPYA 4H6SB 1XVOA 3SU2A 5DP7A 2FI5E 2QXIA 3T26A 1TGNA 3NXPA 3ZVCA 1QQUA 2G5NA 3RXOA 3SU0A 1FY5A 1NN6A 4FUJA 3SU6A 2QXJA 2GZ9A 5ABWA 1QNJA 2OXSA 4E06H 4RKOB 1V2KT 1UCYE 3NCLA 5DP9A 3SV6A 1XUFA 1ARBA 4IN1A 1DY8A 4JYVH 5EGMA 1ELCA 3FP7E 4MNWA 1JRTA 2FTLE 3RXSA 3TLOA 3ATLA 1FAXA 1YM0A 4QT8C 1GGDB 1S85A 3U98H 2G4UA 1LDTT 1DY9A 2WYGA 3LJJA 1BCUH 4E7RG 1CGJE 2P94A 2M5TA 1THPB 4MPVA 1HJAC 2XRCA 1FZZA 1F0UA 1YPMH 3MNCA 2GKVE 3RMLH 2I6QA 2TGTA 3OX7U 1XVMA 3Q3YA 1Z8IB 3QO6A 4AN7A 1W13U 1ZTJA 1B5GH 1BOQA 2WPJS 1YLDA 3W95A 1QJ7B 1MZDA 3TVJB 2ZP0H 3M37A 1UTQA 1V2VT 2XYAA 2LIZA 2ZDMA 1XUJA 1P9SA 2J94A 1Z1IA 1GBHA 4X1NU 2XW9A 3GISB 2ZIQH 3MFJA 1PYTC 2HVXA 2Z6BD 1THSH 3ENSB 3GY3A 2ZU5A 3OYPA 1SR5C 1QCPA 2BMGB 2C93B 2AMQA 1XKAC 1GHBF 3V0XA 2FX6A 4Y0YE 3RXRA 2OC7A 1E35B 1E34B 5JBCS 2BD7A 2BXTH 2OQUA 4IBLH 2ZWLH 4NIWA 1PQAA 4NG9H 1UVOA 4DIIH 1TMBH 1SC8U 2FZZA 4K8YA 1AO5A 2J9NA 1Y3WA 4FU7A 2Y81A 1CO7E 1TNHA 2Y7ZA 3GY8A 1C5RA 1P57B 5AFYH 1QFKH 2IJOB 3MHWU 4XSKU 1WQVH 1ZMJA 3GYMA 3KQEA 2BLOA 5GXPA 1SPJA 1FY8E 2UUKB 1IQJA 3E16B 3RLYH 3SGBE 2ZHEH 4GHTA 2J34A 3RDZA 1AD8H 1P2JA 1SOZA 1O2IA 1K1PA 1OS8A 3SQEE 1C5OH 3A8CA 4X6MA 1G9IE 3RXIA 2SNVA 1C5UA 4KKDA 3LPRA 1K1OA 3DFLA 3QZRA 4UFEH 3D23A 1VGCC 2BX3A 3KNXA 1SBWA 3HGNA 1WAYB 2ZKSA 1KXFA 1OWEA 4XBBA 1T7CA 5DJ7A 3RM0H 3TGJE 2BXUH 2NU0E 4NFFA 2D8WA 5FCKA 5J4SA 3SUEA 5B6OA 1JXPA 2ZGJA 4NIYA 2WUBA 2ZDVH 1F0RA 2BY8X 5EW2H 1IHTH 2ZHFH 1IQMA 3OY6U 2ZI2H 1TMTH 1FJSA 2ANMH 4UEHH 1M9UA 4INLA 1J15A 1T4UH 1ZGVA 3VPKA 4GSOA 1HAYB 1MKXH 3ATWA 1YBWA 1UVTH 4AYVB 3I78A 4ZROA 2ILNA 2W5EA 1B7XB 1K21H 4GAWA 6ESTA 3U1JB 2F9PA 5DG6A 4K2YA 1DWBH 3M5NA 1V2MT 4NA8A 1VCQA 2A45B 4GHQA 1Z8GA 4CR9A 1N8OC 1UTOA 2AYWA 2J4IA 3QLPH 4IMZA 1TX7A 2ZPRA 1ESAA 5F03A 4Z6AH 1SMFE 1IQKA 4AGKA 1O3BA 1EQ9A 1VITH 4U30A 5JBTA 2GMTB 1HAVB 3F68H 2ZTYA 1HAGE 1JIMA 1OWJA 2XC0A 1C2DA 5FHTA 3DD2H 2ANKH 1KIGH 2PHBA 1GJAB 2B8OH 1Z6JH 3GDSA 3SU5A 5HMAA 1SHHB 2XC4A 2RA3A 1C5ZB 3O8BA 5F8ZA 1LHCH 1BTUA 1EPTB 3PLBA 1W0ZU 2PKSC 2P59A 3AW0A 2EA3A 3M61U 2Q1JA 1UTMA 2Z9JA 1W0YH 2ZDLA 1QQ4A 3RXLA 4O03A 1EPTC 3TIUA 1SGRE 1HXFH 3PB1E 3U1IB 4BOHA 3MNBA 3ZZ9A 2GTBA 2ZDNA 1TRMA 2EC9H 4DG4A 4TYDA 2FM2A 1GMCF 3EAJA 4DY7B 2STAE 3RU4E 2EI6A 1S6FA 1NC6A 5A0BA 1KTSB 4DURA 1HXEH 2W3KA 4HI3A 3PO1C 2GV6A 4OS1A 1ZPZA 3RXJA 2I6SA 3ZVGA 2P8OB 3T2NA 3UNRA 1TNGA 2WPHS 1EJAA 1O3LA 2BVSH 1RS0A 1NRPH 2ANYA 1V2JT 1L2EA 2R0LA 4TY6A 4X8SH 1O32A 1AN1E 2FOCA 2F3CE 3RC4A 1C1OA 3TU7H 5L30H 1C1VH 1BRBE 1AU8A 4UD9H 2BDBA 5FPSA 3TPIZ 3VGCC 3R3GB 1F5KU 5HXFA 3TK5A 1P04A 1B0EA 3MH4A 1CSOE 1JBUH 3BTQE 3D62A 1QA0A 1GI8B 3RXPA 2Z3CA 4ZXYH 5SGAE 4FU9A 4MG3A 5GCHG 3SN8A 2Z9KA 1TABE 2J95A 2FMJA 4CH2B 1QRZA 5GJ4B 4I8KA 5L6NH 2UUJB 4J1YA 5AF9H 1DT2A 1AB9C 3BG8A 4KGAA 4AB8A 4SGBE 3SNCA 1ORFA 4B76A 2VINA 4ABGA 2PSXA 5PTPA 1SG8B 1P06A 4JZFH 5JB8S 1DPOA 8LPRA 2UUFB 4Y6DA 3BF6H 2C90B 2ZHWH 2OLGA 1GBKA 1TNIA 1ZRKA 2FI4E 2ODPA 4HZHA 1WU1A 1E0FD 1GPZA 1SLUB 1Y5BT 2BDIA 1WCZA 3KL6A 1JWTA 5T6FA 3BV9B 4WXIA 3RXAA 2BYAX 1YCPM 2R3YA 3A7WA 3P17H 1HDTH 1GBFA 2BDYA 3PMBB 3H5CB 3NKKA 3UNQA 4UFGH 1GG6B 1XKBC 3ZVBA 2G55A 1NO9H 1FDPA 5A09A 5EG4A 4I8LA 2QF0A 1FMGA 3KQDA 3PWBA 4MDSA 3BIUH 1XXFA 2BLVA 2JH6D 1HNEE 3BIVH 5C1XA 5DPAA 5CMXH 4UFDH 2Q6DA 2SGAA 5FXLA 2QAAA 1GJ6A 2PV9B 3TJOA 4CRAA 2FEQH 2ZG0H 1DVAH 1GMDF 1C9TA 4K69A 1PPZA 1W14U 1ZPCA 8ESTE 2CF9H 1D6WA 1Q2WA 1ELDE 1TA6A 5HM2A 1GI0A 3KIDU 1GBBA 1AFQB 3HGPA 1PPEE 1FUJA 1Y3XA 3LT3A 1SQTA 3GCHB 1DE7H 3RMNH 2F83A 3LH1A 4U01A 3T62A 3IG6B 1BTZA 4XE4A 2PLXA 2ODQA 2FDAA 4X6NA 1BT7A 3SNDA 1O3MA 4ZHLU 1EB2A 1AKSA 2ZPSA 3SV7A 1FONA 1ELFA 1QRWA 3BTTE 3RXFA 1QB1A 1KYNA 1NFYA 2G5VA 1EJMA 1TYNA 1RJXB 1UVPA 1LPGB 1FY1A 2ZU2A 1SGFA 3RXVA 1QL8A 1QB6A 5DKMA 3A88A 2C8XB 5I25A 2RG3A 2F9UA 1CVWH 2J92A 1A3EH 3KN2A 2BDCA 3A89A 3NZIA 3RXQA 1O3CA 1O3AA 3HKIB 2VVVA 5E0GA 1H9IE 4LK4A 1VCWA 2BLQA 1G3EA 1O2VA 1AZZA 1DFPA 1YPHC 1TBQH 2DE9A 1UJ1A 4YZUA 1J9CH 1GBDA 2GP9B 4E7NA 2GCTC 1ZHPA 3Q00A 1CU1A 2G51A 4AFUA 2PGBB 4MNYA 2P3FH 5C5OA 4ZUHA 1AVGH 4CREA 2BQ6B 1GHZA 3A81A 4KTCA 2NU3E 3TJUA 1MBMA 1WV7H 3HPTB 2D2DA 1P8VC 1UTJA 2ZF0H 1SGIB 2A4OA 3R0FA 2XBVA 2FOGA 1T8MA 1QB9A 4BNRA 2C8YB 2BD4A 4WF8A 4CH8B 1D3PB 2PGQB 4CRCA 4XFQA 1GI5A 2Y82A 1QGFA 2H5CA 2CHAB 1PYTD 4K3JA 3UPEA 1A46H 2HNTF 3U8TH 5AFZH 5FX6A 3MMGA 1O35A 3SJIA 1WSSH 1FPHH 2V3OH 2AIPA 1A3BH 3GY7A 2FS8A 1N1LA 2EI7A 3GDUA 1VGCB 5DP5A 1O3FA 1TWXB 1V2NT 1TB6H 5FBEA 1UMAH 1DDJA 3MO6A 3HK3B 4WMEA 1QBVH 1UK4A 3KQBA 4DGJA 1MAXA 3QDZB 1RTKA 5LPEA 2VJ1A 1T8NA 5T6DA 4DW2U 1DSUA 5EW1H 5HM9A 1DWCH 2FLRH 1EAWA 4D9QA 1O2NA 4WH6A 1LTOA 3B8JA 1IQNA 1ZMNA 1PPGE 2Z9LA 1OP0A 1GHBG 5EQRA 2KAIB 2SGEE 3SHCH 4Y7BA 4R0IA 1TIOA 1P11E 1VR1H 2G4TA 4X1QU 2A7HA 2VIDA 1O3KA 2NU4E 2SGQE 1AY6H 1LQDB 1NROH 3BEUA 5E0JA 1O2PA 3A8DA 1TALA 3B9FH 2QN5T 2GD4B 4JYUH 1C4V2 4FUGA 4D76A 1HJ8A 4TY7A 5E8EH 2R0KA 1C4Y2 1GJ7B 1QBOA 1VJ9U 5DGJA 3TJVA 1RTLA 3F1SB 5DP8A 2W3IA 1LCYA 3PV4A 9ESTA 1TNLA 4AORA 2A1DB 1O2ZA 2R2MB 3HKJB 2P3TB 3GCNA 4ESTE 3PM3A 3ZV8A 2FO9A 3VGCB 3SV8A 4IC5A 4I8JA 1G3CA 3SJOA 1O2TA 1EUFA 2O8WA 4JK6A 1ELAA 1LVYA 1KXEA 1D6RA 1MTWA 3E90B 3TJNA 1OXGA 2J38A 2VH6A 1CBWB 2PUQH 5F8XA 1O2LA 1BTXA 2VH0A 4PROA 4FUBA 2THFB 3PMHB 1GVKB 1SFQB 1UTNA 3LGUA 1FQ3A 2JKHA 4DVAU 2Y5HA 1SSXA 2ODYB 1KLJH 3V3MA 1L0ZA 4A7IB 2FTMA 5GPIB 1YPKH 3SUFA 1ETTH 4JCNA 4KTSA 4Y0ZE 4DIHH 4F4OC 2D1JA 3AVZA 1GBAA 3STJA 1A61H 1TX8A 2AIQA 2G00A 5FCRA 1HBTH 2BX4A 1D3TB 3FAOA 2ZFTA 2V35A 2A4RA 2BD9A 4FUIA 3ZVAA 4H42U 3ITIA 1DSTA 3P8FA 1C5LH 1NESE 7GCHG 5C67A 2FPZA 4X1SU 1BBRH 2RDLA 3RXEA 3RU4T 3SU1A 4FUDA 2WPMS 1JIRA 4GVUA 5HYOA 1L1NA 1AVWA 2ESTE 1GJ8B 1BMNH 1G30B 3UREA 1NZQH 4NA7A 1ZOMA 3RXKA 4HGCA 1CT4E 2QYIA 1DOJA 2PW8H 3OSYA 1AUJA 2FS9A 2A7CA 3EE0B 4ABBA 4LZ1H 4ZAEA 2HNTC 4IGDA 1ANCA 3BG4B 3BTKE 4ISIH 5EQQA 1SHYA 6CHAC 1Y5AT 1P3CA 1KDQA 3BTHE 3S9BA 3TH4H 2TBSA 3LC3A 2JETC 2H5DA 3A83A 4MQAA 1MTNC 1KDQB 1AHTH 5T3HA 1P0SH 4BAHB 3OTJE 2LPRA 1CGHA 1UO6A 4DJZB 3W94A 1NRNH 3MH7A 1MU8B 2XWAA 1P01A 2QCYA 1GI4A 3MO9A 1TQ7B 3SV9A 4R8TB 2CGAA 1EP5A 4IC6A 2ZHQH 4WH8A 2ZGCA 2A5KA 1KLIH 2B9LA 3K9XB 1AE8H 1YCPK 1TBRH 1OOKB 1ZSJA 1BTWA 3TH2H 1PPBH 1FLEE 1OWKA 3BEFB 1GJCB 4WXVA 1LQEA 1C1WH 2AS9A 2AEIH 4J2YB 1SOTA 1NM6A 1ZSKA 1DANH 2EI8A 1O2WA 1D3DB 1S6HA 1QURH 1S0RA 1O2KA 1XX9A 3GOVB 4HFPB 2VVUA 1JRSA 3RXGA 2CF8H 4K1EA 3EA9A 3T29A 1O5AB 3KGPA 1HAOH 5T6GA 1GMDG 1O5CB 1S83A 4ABIA 2P8OC 2Y5GA 1ZPBA 3PLKA 1D4PB 4BAKB 1O5EH 2PWXA 2C8ZB 3SGAE 4OGXA 4ZH8A 1N6XA 3A84A 5FBIA 1SL3A 1TOMH 4VGCC 5TJXA 5C20A 2H6MA 1K1LA 3A82A 8GCHF 1C2MA 5DO4H 2ZGXH 2QA9E 1GHVH 4FUFA 4B75A 1O31A 1W7XH 3M5MA 1TX6A 2FESH 3VB3A 5DP6A 3MWIU 4NIXA 1ESBA 3S9AA 7LPRA 8GCHG 2YOLA 3ATKA 1AQ7A 3LDXH 1KSNA 2HGTH 1GI1A 4GLYA 1NFWA 1EASA 1QJ6B 2BVRH 1V2PT 3QUMP 2Z94A 1QA7A 3VB6A 3SJ8A 2R3UA 2CHAC 1DLEA 2GCHF 2ZU4A 3V13A 1GDQA 3QN7A 2FOAA 1GCTC 4D7FA 1C2LA 3LKWA 4HTCH 1YPJH 4X2XA 1RFNA 1EP6A 2ULLA 2FP7B 4X6OA 2A31A 1MMJN 1VITF 2H1UA 3RMOH 1YPLH 5JYIA 1AE5A 4MTBA 4YOGA 4Y8XA 1K9OE 1V2TT 5DK1A 2TGPZ 3BTFE 1XMNB 1LHFH 4ABFA 1FPCH 1CT2E 4FVBA 4Q7YA 4DT7B 2Z9GA 1C5WB 1TE0A 3FANA 1Y59T 1ETSH 1U6QA 2UUYA 5BRRE 3ZV9A 2FYQA 3FFGA 4XOJA 1TFXA 2ZFSA 4AB9A 2FYRA 1ELGA 4CR5A 3RU4D 3S9CA 1O39A 1AVXA 5FPTA 5TCCA 4D9RA 2BM2A 2Y6TA 1ABJH 1GVZA 1YPHE 2VIOA 3SHAH 4IN2A 5F8TA 5C1YA 3UOPA 1O0DH 1A1RA 2PFEA 2H9TH 1MZAA 3LOXA 3OY5U 1CA8B 3UWIA 1MKWK 4NSYA 4TPIZ 2AGGX 3GCTG 1PJPA 3A7VA 2C3SA 1INCA 1EZQA 3P8OA 2K1QA 1P2NA 3TGIE 4I8HA 4O97A 1W12U 1WTGH 1O3PB 5K0HA 3V7TA 1RGQA 1BB0B 1K1IA 2R9PA 1GMCG 1PPFE 1W11U 1WUNH 3L33A 7ESTE 2QC2A 1EZUC 1ELBA 3M5OA 1BBRK 3ZVEA 5A0CA 1P05A 1X7AC 4JMYA 2AERH 4WMDA 1MTSA 5A2MH 4A5TS 6GCHG 1KXCA 2V6NA 1B0FA 5K7RA 1ZRBA 1EAUA 3S0NA 3GY5A 2A0QB 1IQFA 3P95A 1BQYA 1SFIA 3MNSA 1O3GA 3IWMA 3M3SA 3CS0A 5ESBA 3UNSA 2ZCKP 2ZU1A 3JZ2B 2H2ZA 1MKWH 1QBNA 2VWMA 1HIAA 4B74A 2A32A 2VB0A 1MBQA 4KELA 5ESTE 1SGDE 1LHDH 4GCHF 1CT0E 4MLFB 1XUGA 3O8CA 3GYLB 4OS7A 1UTLM 1A5GH 1ZJKA 4KTUA 4Q2KA 1V2UT 2GV7A 2CN0H 4Y8ZA 1A5IA 2H9HA 3BTDE 1GL0E 2AGIX 4BANB 1AIXH 3DA9B 4RSPA 1Y5UT 2RA0A 2NU1E 5BPEA 1WTHD 2ZGHA 4OS5A 1GHXH 2FWWA 1HAIH 1EAXA 1MD8A 1C1MA 1C4U2 1NU7B 1ZJDA 1O2SA 1CA0C 2WPLS 3I77A 1G32B 1GDUA 1ZMLA 4BXWA 5H4IB 1FXYA 4MPWA 2GCHG 2ZC9H 4ZKOU 3G01A 2AMPA 3SV2H 2B5TB 1HJ9A 2A7JA 1C2JA 1GI9B 3D65E 1V3XA 2FODA 1WQSA 1HYLA 1WYKA 3EGKH 1G37A 3O8DA 2GGVB 5C5NA 1H9LB 2FI3E 1ZHMA 2IOTA 2ZDKA 3C27B 1DS2E 3TK9A 2PSYA 1HCGA 2OBOA 1FY4A 2HPPH 3RXDA 3M7QA 4BAMB 2Q6FA 1BJUA 1IQIA 1OWHA 2BD2A 2HWLB 1OWIA 1GBIA 1O36A 3A80A 4K5ZA 3BTWE 2P93A 2OD3B 4NA9H 4FUCA 4AG1A 1O38A 3PYHA 3PWCA 1A0LA 2IN2A 2PTCE 3ZVFA 4FXGH 1NPMA 1PFXC 2O9QA 4E05H 2QY0B 4U2WA 1EOJA 3OU0A 5FAHA 7KMEH 1TOCB 4MVNA 4Z0KA 4X8UH 3ZYDA 3QGNB 1AWHB 1DXPA 1O2HA 4CRFA 3QX5H 1K2I1 3LGWA 1SLVB 1WBGB 1C1TA 1NU9A 3U8RH 1Z1JA 2HPQH 4IW4E 1DICA 4I31A 1MTUA 2UWOA 4OS4A 4MPXA 3SNEA 1O2XA 2TPIZ 2XNIA 1P3EA 1AFQC 2BQWB 2TIOA 3KEEA 1P12E 5GIBA 1Z7KA 3EBNA 5A0AE 3VB7A 1LKBA 1S0QA 3MU0A 5LGOA 1HUTH 1T8LA 1ZHRA 1O33A 2P95A 2UWLA 3M7TA 3DUXH 1J17T 4GUXA 4B71A 2Y80A 3GY2A 2OP9A 2C4FH 1GL1A 1ETRH 4H4FA 3MYWA 1ANDA 3WY8A 1ANEA 1P9UA 4A1TA 1GMHF 2CXVA 4FUHA 1O3NA 3Q77A 2VIQA 1DUAA 3V12A 4B2CA 3RC6A 1MTNB 2O8TA 3BTME 3QTOH 5E2PA 1YGCH 3RXHA 1MUEB 1RXPA 1DM4B 4JZ1A 1C5TA 2VWLA 1DUEA 2STBE 2P3UB 1UVSH 1AB9B 1C1UH 3U69H 4I33A 1E37B 4CHAB 1O3OA 5IYTA 1P2MA 2O8UA 1T31A 2VWNA 2OINA 1C2EA 1A7SA 1K28D 1Z8RA 1VZQH 3N7OA 3QZQA 3BSQA 2PR3A 1HJAB 3STIA 2ZDAH 1GMHG 1O2UA 4JZIA 4K1SA 2BVXH 4MPUA 1ACBE 1G3BA 1UCYK 2TGDA 2C8WB 2FXRA 2O8MA 1TGSZ 4YLQH 1RD3B 1UVUH 1UCYH 1FI8A 1P10A 1TPSA 4GCHG 3MI4A 3F9EA 1C5XB 1BMLA 4JYTA 3VB5A 1C5MD 3TH3H 2P16A 3KQCA 3FZZA 2SGFE 3GICB 1MKXK 1LMWB 4D8NA 3SBKA 1SGEE 1SVPA 3K6YA 1TRYA 3RM2H 2CJIA 4Q7XA 1J8AA 2CV3A 2OCVB 5DP4A 3LGVA 1D3QB 3ELAH 4O3TA 4VGCB 5JDUB 1OP2A 2YNBA 1BITA 1E38B 4UDWH 4Y79A 4YM9A 5JPMH 1LPKB 5EXNA 3A85A 1NRQH 3RC5A 5C3NA 4AG2A 4AFZA 3KCGH 4ISOA 1BTYA 4THNH 4BAOB 4ISLA 1NRSH 4CRBA 1YP9A 4TWYA 1ID5H 1EX3A 1P2IA 1F0TA 1YPEH 1H8IH 1RRKA 1NS3A 5CHAB 4ZKNU 3O8RA 1C1QA 1KTTB 1OSSA 3B23B 2VIWA 3E0PB 1XUKA 4OGYA 2F9BH 1C2IA 3Q76A 1TNKA 5L2YH 1V2LT 3C1KA 1GI7B 3M7UA 3P6ZB 2OUAA 3VFEA 2ZGBH 3SJKA 4NWKA 1CGIE 5EPNA 1GJ5H 2ZPQA 1RIWC 4AFQA 1K1MA 3SUGA 5EU8A 1XUIA 3PROA 4UE7H 5A8ZA 2F9VA 3LGTA 3AW1A 4U32A 2K7XA 1ZTLA 1W10U 3S69A 2GDDA 4IMQA 2VGCC 1VITG 1T4VH 1HAPH 5G4BA 3L6PA 3ZZBA 1UTKA 2W7UA 3ZZ4A 4D7GA 1SGNE 3AAUA 1AUTC 1Y3VA 1XM1A 1C2KA 1Y8TA 1BZXE 1EOLA 2BQ7B 3A7TA 1BMAA 1C1SA 2G52A 1GBEA 3UR9A 4X2YA 2EEKA 1DITH 1P2KA 2PUXB 1KXAA 3P8GA 1P09A 3Q3KA 3PMJA 3S7HB 1F5LA 1KXDA 4ZHMU 1Q31A 3F9GA 4IS5A 5HGGA 4ZMAH 4OS6A 1FNIA 1FN6A 3ODFA 2WV5A 1GBJA 2PKAB 2ZCLP 4X8TH 2FLBH 2ZZUH 1L4ZA 3LU9B 1N6YA 1PPHE 1H4WA 1E36B 4SGAE 1TPOA 2BY7X 5F6MA 1GCTB 1IQGA 3SGQE 2NU2E 1NFUA 3NWUA 2OBQA 1FN8A 1MAYA 1PQ7A 3MTYA 3M36A 2SGDE 1Q3XA 2VVCA 3LH3A 1MQ6A 1ZSLA 2IPHA 4XDEA 3ZZ5A 1P03A 1O34A 2G81E 1NRRH 2FOBA 1TRNA 3RUOA 1HFDA 1QR3E 1Z8JB 2WUCA 3S7KB 1OWDA 3DFJA 4A6LA 3SUDA 1SQOA 3VB4A 4I8GA 5GWZA 1GI3A 3UIRA 3UTUH 2OC8A 3BTGE 2BTCE 1O2GH 4NCYA 2AFQB 1HAVA 3GDVA 2FOFA 4B2AA 2ZFFH 1MCVA 1OPHB 4X1PU 4AX9H 3SI3H 1LHGH 2XBXA 3KHVA 2QXHA 4AYYB 4YLUA 1O2YA 1TGCA 4YT7H 1A5HA 1LVMA 1C9PA 2A2QH 5A8YA 1YKTA 4YOJA 3MH5A 3F6UH 4XBCA 2XXLA 1GGDC 4YT6H 4CRGA 1IQHA 1TLDA 3KF2A 1DWDH 2G8TA 4JZEH 2UWPA 1SGCA 4K60A 1GHAG 4UONA 1CHOG 1TMUH 1RTFB 1Y3YA 2B7DH 1P02A 1W3CA 4Q7ZA 5FX5A 1PQ8A 1TGTA 3URCA 1CE5A 4BXSA 2ZCHP 3UOUA 1YLCA 2VGCB 4YESB 5C2ZA 5CHAC 4BAQB 2SGPE 1DWEH 4YTAA 4INKA 2OC1A 3UQOA 1N8OB 1AFEH 1IHSH 4CHAC 1HV7A 1TGBA 3H7OA 4A1XA 3MOCA 2FIRH 3H7TA 1V2WT 3ESTA 1C2FA 1BRCE 4ASHA 5IDKA 1S81A 3VEQB 9LPRA 3AASA 2Z3EA 1KXBA 4ABDA 3QTVH 1C1NA 8KME2 2BOKA 3A7XA 1ABIH 4DOQA 1SGYE 3SNAA 3U8OH 2FOEA 3MU5A 1CHGA 1IAUA 2Z7FE 2GCTB 1V2OT 2BZAA 2CMYA 3EQ0H 1C5YB 2YNAA 1V2RT 3JZ1B 1TPAE 1GBMA 3FVFB 1GI2A 3RLWH 5I46H 2GT8A 1W7GH 5CE1A 1O2MA 2ZNKH 3ZZ7A 1ZYOA 1P2QA 2BD5A 4A1VA 1SLWB 2TGAA 1C2HA 1DXWA 2HNTE 1BDAA 4B2BA 4DCDA 2QXGA 1BTHH 4LXBH 1EZXC 1S84A 2PKAA 1OP8A 4Q80A 4MNXA 1CA0B 5E0HA 3U9AH 4I32A 3SO3A 1K22H 3BEIB 3EDXB 3PO1B 4AOQA 2BD3A 1ELVA 2BZ6H 4H6TA 5EOKA 1LKAA 3SW2B 1O3IA 3QGJA 2OQ5A 4UFFH 3A86A 3HATH 1GWAA 1IOEA 4LZ4B 1TNJA 2JETB 1HAZB 1IQEA 2ZQ2A 3TGKE 5JBAS 4F49A 2WPIS 3LGYA 3D49H 3M3VA 1YC0A 3SQHE 4I7YH 2BD8A 2XBYA 4ZHAA 3PLPA 4NFEA 3MU1A 1GHWH 2W26A 1G36A 1C2GA 1L1JA 1O2OA 3UWJH 1S5SA 3LGIA 1C1PA 3A7YA 3E8LA 4X0WU 5E2OA 3BG4C 2ZHDA 2BHGA 5J4QA 3TNTA 3P8NA 4AGJA 3LIWA 1ANBA 3SNBA 4NZQA 1AMHA 2V3HH 1V2QT 3EYDA 5TCAA 1BUIA 1O5BB 3M5LA 1BHXB 1O3EA 3UY9A 1NFXA 1O2QA 4BTUB 2A5IA 3RXCA 2PTNA 3T5FH 1TAWA 1GJDB 2OTVA 3MU8A 4AZ2B 1KY9A 2GX4A 4Y76A 1MU6B 2AH4X 4TWWA 2Q6GA 1AGJA 2A5AA 2Y5FA 1SGFG 2XTTB 1O5GH 3AAVA 3MNXA 1O37A 4A92A 2D26C 2ZTXA 1HIAB 2O8LA 4K8BA 2A4GA 4WMFA 1K1JA 3TITA 2PKSB 1NY22 4CRDA 1C1RA 4WWYA 1SGQE 3F9FA 2WINI 1QY6A 4ZKSU 1AKSB 2ASUB 2ZQ1A 3RXBA 3CP7A 2R2WU 2ANWA 7GCHF 3SORA 3A7ZA 3HK6B 5EXMA 1C5QA 1MTVA 3NUMA 1UK3A 1G3DA 2ZO3H 1GJBB 2ZFPH 1HAHH 1TPPA 2GVFA 1A0JA 4B73A 3PTBA 1L4DA 4NGAH 1GBTA 2ALPA 1TA2A 1SGTA 4ZXXH 6GCHF 4ISHH 1H1BA 1TBZH 5FPYA 1MH0A 1P2OA 1F0SA 3MU4A 2BDHA 1DLKB 1EATA 6CHAB 1PPCE 1J14A 1LHEH 3TNSA 2WPKS 4BTIB 2HALA 1QIXB 3MO3A 3EA8A 1BIOA 1NT1A 3SOSA 1LVBA 4LOYH 3TK6A 2XCNA 4YO9A 4ABHA 2VU8E
chains in the Genus database with same CATH superfamily
1C5PA 3ZZ3A 1O3JA 1YCPH 2HOBA 4RKJB 4X2WA 1J16A 4K1TA 1OYQA 5AHGH 3GY6A 1LPZB 1SQRA 4O9VA 2ZECA 4YOIA 1O5FH 2QGRA 2W7SA 1DX5M 2QV1A 3RP2A 1GCDA 2J2UA 1GBCA 2ZTZA 1C5NH 4WVPE 4FVDA 1GHAF 3FZDA 4OS2A 1C5SA 2WYJA 2XBWA 3A8AA 3F9HA 1QJ1B 1O5DH 1BJVA 1BA8B 1F2SE 1Z6EA 2XWBI 3A8BA 1A2CH 4INHA 1GDNA 3ZZDA 2XCFA 3BTEE 2GMTC 1S82A 3CS7A 1T8OA 5C0TA 2KCYA 3UR6A 3UFAA 3KYFA 1YYY1 2BY5X 3ZZ6A 1W8BH 1T32A 1G2MA 1H8DH 1RIWB 3M35A 4NZLA 4X2VA 3W1EA 5A8XA 3EE7A 1SI5H 2ZEBA 2ZA5A 3MH6A 4ABEA 4MNVA 2QF3A 1ELTA 5AVDA 4RT0A 1UK2A 1HB0B 3LC5A 6LPRA 2JJ1D 2AGEX 1IQLA 1THRH 1GBLA 3UUZA 1D9IA 5ETXA 1CBWC 1UTPA 5JBBS 1O3DA 1FY3A 5EQSA 1JMOH 2DE8A 1ARCA 4BTTB 3QK1A 1YF4A 1TQ0B 1MQ5A 3P92A 1VJAU 1HAXB 3ATMA 1MD7A 4XBDA 4WY3A 3ATIA 1SB1H 1AWFH 3OFND 3PMAB 1ZLRA 3T25A 4FU8A 3FP8E 1EXFA 3E6PH 1GJ4H 1QHRB 5LPRA 3UQVA 3ZZAA 2BB4A 3BN9A 2Z9IA 1EB1H 2HRVA 1GJ9B 5L2ZH 2VNTA 1ZR0A 2VWOA 1SGPE 1G2LA 1BHXF 1VCPA 1HPGA 1ZGIA 2BDAA 2HLCA 2BOHB 2WV4A 4NWLA 1V2ST 4Y10E 1EPTA 2F9NA 1AI8H 2F9OA 3E1XB 1Y3UA 1BTPA 1Z71A 4GPGA 4AC9A 2GZ7A 5GDSH 2BLWA 2SFAA 2ALVA 2ZU3A 3E0NB 3SU4A 1F5RA 3GY4A 2GZ8A 1ZZZA 1LO6A 4JK5A 2QF4A 3URDA 1C5VA 1V6DA 2B0FA 5EPYA 1SQAA 4CBOA 1YPGH 3ZZCA 3LONA 1O3HA 5LH8A 3NK8A 2GT7A 3K6ZA 1FIZA 1EJNA 1AZ8A 1K1NA 4Y71A 1FIWA 2Z3DA 1XXDA 1BRAA 1EKBB 3RMMH 1F7ZA 4JZDH 3ZZ8A 2KAIA 1FV9A 1KLTA 2XC5A 3EA7A 1MCTA 4ISNA 3IITA 1F92A 1ELEE 1W0JD 3RXMA 1EAIA 2H9EH 1BMMH 1GHYH 1A4WH 3QWCH 4Y11E 2AMDA 1HRTH 2VIVA 4NSVA 1PQ5A 1CHOF 3ZVDA 1A0HB 2NWNA 1JOUB 5GCHF 3PRBA 1SLXB 1W0KD 4KP0A 1BBRE 1FAKH 2A2XH 2FOHA 3FOAA 1L1GA 2FX4A 1OKXA 5LPFA 3L3TA 2BY6X 1WOFA 3M3TA 1TONA 2JH0D 4F48B 3NPSA 1LVOA 3VXFH 4B1TA 1QL9A 3RXTA 1WDIA 2GDEH 3ZYEA 2KZ4A 4NIVA 3Q3XA 3WWBA 3E3TA 2VIPA 1EZSC 1GVLA 5JB9S 4ZKRU 4FUEA 1GG6C 2TRMA 2OC0A 2ZFRH 5EXLA 4RN6A 3DHKH 2ZFQH 1OX1A 3CENA 2SNWA 3ODDA 3SU3A 1XUHA 3N7EA 5EJ1A 1UHBA 2RCEA 2F91A 1ZTKA 2BDGA 1H9HE 4X1RU 2A4QA 1OYTH 4AFSA 3E91A 1O2JA 3I29A 2JH5D 2FOMB 2QIQA 2DUCA 1O30A 4ABAA 3FP6E 2Y7XA 4FOUC 3VXEH 1E1RD 3SI4H 1HLTH 4ABJA 3K2UA 3GCHC 1NTPA 4O3UA 4X8VH 3LJOA 3K65B 4M7GA 3P70B 1BRUP 4CBNA 3T28A 1QTFA 5EODA 5DP3A 3GCTF 3A87A 1GI6A 3GCOA 4X6PA 3SJ9A 1CQQA 1ESTA 3RXUA 2LNCA 4Y8YA 2BY9X 1UHBB 5C1UA 3SZNA 1W2KH 1O2RA 4Y7AA 1QL7A 4WJG2 3T27A 1QRXA 2KCPA 3PTNA 1HGTH 3DT0H 2V0BA 4TPYA 4H6SB 1XVOA 3SU2A 5DP7A 2FI5E 2QXIA 3T26A 1TGNA 1UW7A 3NXPA 3ZVCA 2K0QA 1QQUA 2G5NA 3RXOA 3SU0A 1FY5A 1NN6A 4FUJA 3SU6A 2QXJA 2GZ9A 5ABWA 1QNJA 2OXSA 4E06H 4RKOB 1V2KT 1UCYE 3NCLA 5DP9A 3SV6A 1XUFA 1ARBA 4IN1A 1DY8A 4JYVH 5EGMA 1ELCA 1FX0B 3FP7E 1JRTA 4MNWA 2FTLE 3RXSA 3TLOA 3ATLA 5B6LA 1FAXA 1YM0A 4QT8C 1GGDB 1S85A 3U98H 2G4UA 1LDTT 1DY9A 2WYGA 3LJJA 1BCUH 4E7RG 1CGJE 2P94A 2M5TA 1THPB 4MPVA 3FN8A 1HJAC 2XRCA 1FZZA 1F0UA 1YPMH 3MNCA 2GKVE 3RMLH 2J98A 2I6QA 2TGTA 3OX7U 1XVMA 3Q3YA 1Z8IB 3QO6A 4AN7A 1W13U 1ZTJA 4P00A 1B5GH 1BOQA 2WPJS 1YLDA 3W95A 1QJ7B 1MZDA 3TVJB 2ZP0H 3M37A 1UTQA 2J98B 1V2VT 2XYAA 2LIZA 2ZDMA 1XUJA 1P9SA 2J94A 1Z1IA 1GBHA 4X1NU 2XW9A 3GISB 2ZIQH 3MFJA 1PYTC 2HVXA 2Z6BD 1THSH 3ENSB 3GY3A 2ZU5A 3OYPA 1SR5C 1QCPA 2BMGB 2C93B 2AMQA 1XKAC 1GHBF 3V0XA 2FX6A 4Y0YE 3RXRA 2OC7A 4Q4LA 1E35B 1E34B 5JBCS 2BD7A 2BXTH 2OQUA 4IBLH 2ZWLH 4NIWA 4XRNA 1PQAA 4NG9H 1UVOA 4DIIH 1TMBH 1SC8U 2FZZA 4K8YA 1AO5A 2J9NA 1Y3WA 4FU7A 2Y81A 1CO7E 1TNHA 2Y7ZA 3GY8A 1C5RA 1P57B 5AFYH 1QFKH 2IJOB 3MHWU 4XSKU 1QZ8A 1WQVH 1ZMJA 2KFWA 3GYMA 3KQEA 2BLOA 5GXPA 1SPJA 1FY8E 2UUKB 1IQJA 3E16B 3RLYH 3SGBE 2ZHEH 4GHTA 2J34A 3RDZA 1AD8H 3FKSD 1P2JA 1SOZA 1O2IA 1K1PA 1OS8A 3SQEE 1C5OH 3A8CA 4X6MA 1G9IE 3RXIA 2SNVA 1C5UA 4KKDA 3LPRA 1K1OA 3DFLA 3QZRA 1SKYE 4UFEH 3D23A 1VGCC 2BX3A 3KNXA 1SBWA 2QF5A 3HGNA 1WAYB 4P02A 2ZKSA 1KXFA 1OWEA 4XBBA 1T7CA 5DJ7A 3RM0H 3TGJE 2BXUH 2NU0E 4NFFA 2D8WA 5FCKA 5J4SA 3SUEA 5B6OA 1JXPA 2ZGJA 4NIYA 2WUBA 2ZDVH 1F0RA 2BY8X 5EW2H 1IHTH 2ZHFH 1IQMA 3OY6U 2ZI2H 1TMTH 1FJSA 2ANMH 4UEHH 1M9UA 4INLA 1J15A 1T4UH 1ZGVA 3VPKA 4GSOA 1HAYB 1MKXH 3ATWA 1YBWA 1UVTH 5EJZA 4AYVB 3I78A 4ZROA 2ILNA 2W5EA 1B7XB 1K21H 3CNRA 4GAWA 6ESTA 3U1JB 2F9PA 5DG6A 4K2YA 1DWBH 3M5NA 1V2MT 4NA8A 1VCQA 2A45B 4GHQA 1Z8GA 2YMSB 3DCLA 4CR9A 2OK5A 1N8OC 1UTOA 2AYWA 2J4IA 3QLPH 4IMZA 1TX7A 2ZPRA 1ESAA 5F03A 1K0HA 4Z6AH 1SMFE 1IQKA 4AGKA 1O3BA 1EQ9A 1VITH 4U30A 5JBTA 2JIZD 2GMTB 1HAVB 3F68H 2ZTYA 1HAGE 1JIMA 1OWJA 2XC0A 1C2DA 5FHTA 3DD2H 2ANKH 1KIGH 2PHBA 1GJAB 2B8OH 1Z6JH 2KX4A 3GDSA 3SU5A 5HMAA 1SHHB 2XC4A 2RA3A 1C5ZB 3O8BA 5F8ZA 1LHCH 1BTUA 1EPTB 3PLBA 1W0ZU 2PKSC 2P59A 3AW0A 2EA3A 3M61U 2Q1JA 1UTMA 2Z9JA 1W0YH 2ZDLA 1QQ4A 3RXLA 1H8HD 4O03A 1EPTC 3TIUA 1SGRE 1HXFH 3PB1E 3U1IB 4BOHA 3AK5A 3MNBA 3ZZ9A 2GTBA 1VKYA 2ZDNA 1TRMA 2EC9H 4DG4A 4TYDA 5C0UA 2FM2A 1GMCF 3EAJA 4DY7B 2STAE 4RT1A 3RU4E 2EI6A 1S6FA 1NC6A 2CK3D 5A0BA 1KTSB 4DURA 2KCAA 1HXEH 2W3KA 4HI3A 3PO1C 2GV6A 4OS1A 1ZPZA 3RXJA 2I6SA 2WSSD 3ZVGA 2P8OB 3T2NA 3UNRA 1TNGA 2WPHS 1EJAA 1O3LA 2BVSH 1RS0A 1NRPH 2ANYA 1V2JT 1L2EA 2R0LA 4TY6A 4X8SH 1O32A 1AN1E 2FOCA 2F3CE 3RC4A 1C1OA 3TU7H 5L30H 1C1VH 1BRBE 1AU8A 4UD9H 2BDBA 5FPSA 3TPIZ 3VGCC 3R3GB 3PV5A 1F5KU 5HXFA 3TK5A 1P04A 1B0EA 3MH4A 1CSOE 1JBUH 3BTQE 5FL7D 3D62A 1QA0A 1GI8B 3RXPA 2Z3CA 4ZXYH 5SGAE 4FU9A 4MG3A 5GCHG 3OE7D 3SN8A 2Z9KA 1TABE 2J95A 2PP6A 1EFRD 2FMJA 4CH2B 1QRZA 5GJ4B 4I8KA 5L6NH 2UUJB 4J1YA 5AF9H 1DT2A 1AB9C 3BG8A 4KGAA 4AB8A 4SGBE 3SNCA 1ORFA 4B76A 2VINA 4ABGA 2PSXA 5PTPA 1SG8B 1P06A 4JZFH 5JB8S 1DPOA 8LPRA 2UUFB 4Y6DA 3BF6H 2C90B 2ZHWH 2OLGA 1GBKA 1TNIA 1ZRKA 2FI4E 2ODPA 4HZHA 1WU1A 1E0FD 1GPZA 1SLUB 1Y5BT 2BDIA 1WCZA 3KL6A 1JWTA 5T6FA 3BV9B 4WXIA 3RXAA 2BYAX 1YCPM 2R3YA 2AHME 3A7WA 1HDTH 3P17H 1GBFA 2BDYA 3PMBB 3H5CB 3NKKA 3UNQA 4UFGH 1GG6B 1XKBC 3ZVBA 2G55A 1NO9H 1FDPA 5A09A 5EG4A 4I8LA 2QF0A 1FMGA 3KQDA 3PWBA 1H8ED 4MDSA 4XD7D 3BIUH 1XXFA 2BLVA 2F43B 2JH6D 1HNEE 3BIVH 5C1XA 5DPAA 5CMXH 4UFDH 2Q6DA 2SGAA 5FXLA 2QAAA 3N7DA 1GJ6A 2PV9B 3TJOA 4CRAA 2FEQH 2ZG0H 1DVAH 1GMDF 4OM9A 1C9TA 4K69A 1PPZA 1YWUA 1W14U 1ZPCA 8ESTE 2CF9H 1D6WA 1Q2WA 5DSFA 3GS9A 1ELDE 1TA6A 5HM2A 1GI0A 3KIDU 1GBBA 1AFQB 3HGPA 1PPEE 1FUJA 1Y3XA 3LT3A 1SQTA 3GCHB 1DE7H 3RMNH 2F83A 3LH1A 4U01A 3T62A 3IG6B 1BTZA 4XE4A 2PLXA 2ODQA 2FDAA 4X6NA 1BT7A 3SNDA 1O3MA 4ZHLU 2VBCA 1EB2A 1AKSA 2ZPSA 3SV7A 1FONA 1ELFA 1QRWA 3BTTE 3RXFA 1QB1A 1KYNA 1NFYA 2G5VA 1EJMA 3NRLA 1TYNA 1RJXB 1UVPA 1LPGB 3UAIC 1FY1A 2ZU2A 1SGFA 3RXVA 1QL8A 1QB6A 5DKMA 3A88A 2C8XB 5I25A 2RG3A 2F9UA 1CVWH 2J92A 1A3EH 2J5UA 3KN2A 2BDCA 3A89A 3NZIA 3RXQA 1O3CA 1O3AA 3HKIB 2VVVA 5E0GA 1H9IE 4LK4A 1VCWA 2BLQA 1G3EA 1O2VA 1AZZA 1DFPA 1YPHC 1TBQH 2DE9A 1UJ1A 4YZUA 1J9CH 1GBDA 2GP9B 4E7NA 2GCTC 1ZHPA 3Q00A 1CU1A 2G51A 4AFUA 2PGBB 4MNYA 2P3FH 5C5OA 4ZUHA 1AVGH 4CREA 2BQ6B 4B6FA 1GHZA 3A81A 4KTCA 2NU3E 3TJUA 1MBMA 1WV7H 3HPTB 2D2DA 1P8VC 1UTJA 2ZF0H 1SGIB 2A4OA 2EY4C 3R0FA 2XBVA 2FOGA 1T8MA 1QB9A 4BNRA 2C8YB 2BD4A 4WF8A 4CH8B 1D3PB 2PGQB 2WHXA 4CRCA 4XFQA 1GI5A 2Y82A 1QGFA 2H5CA 2CHAB 1PYTD 4K3JA 3UPEA 3WW7A 1A46H 2HNTF 3U8TH 5AFZH 5FX6A 3MMGA 1O35A 3SJIA 1WSSH 1FPHH 2V3OH 2AIPA 1A3BH 3GY7A 2FS8A 1N1LA 2EI7A 3GDUA 1VGCB 4Z1MD 5KEDA 5DP5A 1O3FA 1TWXB 1V2NT 1TB6H 5FBEA 1UMAH 3OAAD 1DDJA 3MO6A 3HK3B 4WMEA 1QBVH 1UK4A 3KQBA 4DGJA 1MAXA 3QDZB 1RTKA 5LPEA 2VJ1A 1T8NA 5T6DA 4DW2U 1DSUA 5EW1H 5HM9A 1DWCH 2FLRH 1EAWA 4D9QA 1O2NA 4WH6A 1LTOA 3B8JA 1IQNA 1ZMNA 1PPGE 2Z9LA 1OP0A 1GHBG 3F0OA 5EQRA 2KAIB 2SGEE 3SHCH 4Y7BA 4R0IA 1TIOA 1P11E 1VR1H 2G4TA 4X1QU 2A7HA 2HLDD 2VIDA 1O3KA 2NU4E 4F55A 2SGQE 1AY6H 1LQDB 1NROH 3BEUA 5E0JA 1O2PA 3A8DA 1TALA 3B9FH 2JDID 2GD4B 2QN5T 1C4V2 4JYUH 4FUGA 4D76A 2V3MA 1HJ8A 4TY7A 3U28C 5E8EH 2R0KA 1C4Y2 1GJ7B 1QBOA 1VJ9U 5DGJA 3TJVA 1RTLA 3F1SB 5DP8A 2W3IA 1LCYA 3PV4A 9ESTA 1TNLA 4AORA 2A1DB 1O2ZA 2R2MB 3HKJB 2P3TB 3GCNA 4ESTE 3PM3A 3ZV8A 2FO9A 3VGCB 3SV8A 4IC5A 4I8JA 1G3CA 3SJOA 1O2TA 1EUFA 2O8WA 4JK6A 1ELAA 1LVYA 1KXEA 1D6RA 1MTWA 3E90B 3TJNA 1OXGA 5T1VA 2J38A 2VH6A 1CBWB 2PUQH 5F8XA 2YMSD 1O2LA 3OEED 3MQKC 1BTXA 2VH0A 4PROA 4FUBA 2THFB 3PMHB 1GVKB 1SFQB 1UTNA 3LGUA 1FQ3A 2JKHA 4DVAU 2Y5HA 1SSXA 2ODYB 1KLJH 3V3MA 1L0ZA 4A7IB 2FTMA 5GPIB 1YPKH 3SUFA 1ETTH 4JCNA 4KTSA 4Y0ZE 4DIHH 4F4OC 2D1JA 3AVZA 1GBAA 3STJA 1A61H 1TX8A 2AIQA 2G00A 5FCRA 1HBTH 2BX4A 1D3TB 2GJGA 3FAOA 2ZFTA 2V35A 2A4RA 2BD9A 4FUIA 3ZVAA 4H42U 2WV9A 3ITIA 1DSTA 3P8FA 1C5LH 1NESE 7GCHG 5C67A 2FPZA 4X1SU 1BBRH 2RDLA 3RXEA 3RU4T 3SU1A 4FUDA 2WPMS 2KCOA 2QE7D 1JIRA 4GVUA 3KQ5A 5HYOA 1L1NA 1AVWA 2ESTE 3UB0A 1GJ8B 1BMNH 1G30B 3UREA 1NZQH 4NA7A 1ZOMA 3RXKA 4HGCA 1CT4E 2QYIA 1DOJA 2PW8H 3OSYA 1AUJA 2FS9A 5KGOA 2A7CA 3EE0B 4ABBA 4LZ1H 4ZAEA 2HNTC 4IGDA 1ANCA 3BG4B 3BTKE 4ISIH 5EQQA 1SHYA 6CHAC 1Y5AT 1P3CA 1KDQA 3BTHE 3S9BA 3TH4H 2TBSA 3LC3A 2JETC 2H5DA 3A83A 4MQAA 1MTNC 1KDQB 1AHTH 5T3HA 1P0SH 4BAHB 3OTJE 2LPRA 1CGHA 1UO6A 4DJZB 5C94A 3W94A 1NRNH 3MH7A 1MU8B 2XWAA 1P01A 2QCYA 1GI4A 1YLNA 1TQ7B 3MO9A 3SV9A 4R8TB 3H09A 2CGAA 1EP5A 4IC6A 2ZHQH 4WH8A 2ZGCA 2A5KA 1KLIH 2B9LA 3K9XB 1AE8H 1YCPK 1TBRH 1OOKB 1ZSJA 1BTWA 3TH2H 1PPBH 1FLEE 2KR7A 1OWKA 3BEFB 1GJCB 4WXVA 1LQEA 1C1WH 2AS9A 2AEIH 5DN6D 4J2YB 1SOTA 1NM6A 1ZSKA 1DANH 2EI8A 1O2WA 1D3DB 1S6HA 1QURH 1S0RA 1O2KA 1XX9A 3GOVB 4HFPB 2VVUA 1JRSA 3VG8A 3RXGA 2CF8H 4K1EA 3EA9A 3T29A 1O5AB 3KGPA 1HAOH 5T6GA 1GMDG 1O5CB 1S83A 4ABIA 2P8OC 2Y5GA 1ZPBA 3PLKA 1D4PB 4BAKB 1O5EH 2PWXA 2C8ZB 3SGAE 4OGXA 4ZH8A 1N6XA 3A84A 5FBIA 1SL3A 1TOMH 4VGCC 5TJXA 5C20A 2H6MA 1K1LA 2RDEA 3A82A 8GCHF 1C2MA 5DO4H 4FETA 2ZGXH 2IPQX 2QA9E 1GHVH 4FUFA 4B75A 1O31A 1W7XH 3M5MA 1TX6A 2FESH 3VB3A 5DP6A 3MWIU 4NIXA 1ESBA 2L6OA 3S9AA 7LPRA 8GCHG 2JJ2D 2YOLA 3ATKA 1AQ7A 3LDXH 1KSNA 2HGTH 1GI1A 4GLYA 1NFWA 1EASA 1QJ6B 2BVRH 1V2PT 3QUMP 2Z94A 1QA7A 3VB6A 3SJ8A 2R3UA 2CHAC 1DLEA 2GCHF 2ZU4A 3V13A 1GDQA 3QN7A 2FOAA 1GCTC 4D7FA 1C2LA 3LKWA 4HTCH 1YPJH 4X2XA 1RFNA 1EP6A 2ULLA 2FP7B 4X6OA 2A31A 1MMJN 1VITF 2H1UA 3RMOH 1YPLH 5JYIA 1AE5A 4MTBA 4YOGA 4Y8XA 1K9OE 1V2TT 5DK1A 2TGPZ 3BTFE 1XMNB 1LHFH 4ABFA 1FPCH 1CT2E 4FVBA 4Q7YA 4DT7B 2Z9GA 1C5WB 1TE0A 5CHBA 3FANA 1Y59T 1ETSH 2WPDD 1U6QA 2UUYA 5BRRE 3OEHD 2FYQA 3FFGA 3ZV9A 4XOJA 1TFXA 2ZFSA 4AB9A 2FYRA 1ELGA 4CR5A 3RU4D 3S9CA 1O39A 1AVXA 5FPTA 5TCCA 4D9RA 2BM2A 2Y6TA 1ABJH 1GVZA 1YPHE 2VIOA 3SHAH 4IN2A 5F8TA 5C1YA 3UOPA 1O0DH 1A1RA 2PFEA 2H9TH 1MZAA 3LOXA 3OY5U 1CA8B 3UWIA 1MKWK 4M9FA 4NSYA 4TPIZ 2AGGX 3GCTG 1PJPA 3A7VA 2C3SA 1INCA 1EZQA 3P8OA 2K1QA 1P2NA 5CDFE 3TGIE 4I8HA 4O97A 1W12U 3DSPA 1WTGH 1O3PB 5K0HA 3V7TA 1RGQA 1BB0B 1K1IA 2L74A 2R9PA 2M2AA 2KM0A 1GMCG 1PPFE 1W11U 1WUNH 3L33A 2IJD1 7ESTE 2QC2A 1EZUC 1ELBA 3M5OA 1BBRK 3ZVEA 5A0CA 1P05A 1X7AC 4JMYA 2AERH 4WMDA 1MTSA 5A2MH 4A5TS 6GCHG 1KXCA 2V6NA 1B0FA 5K7RA 1ZRBA 1EAUA 3S0NA 4ZCNA 3GY5A 2A0QB 1IQFA 3P95A 1BQYA 1SFIA 3MNSA 1O3GA 3IWMA 3M3SA 3CS0A 5ESBA 3UNSA 2ZCKP 2ZU1A 3JZ2B 2H2ZA 1MKWH 1QBNA 2VWMA 1HIAA 4B74A 1OHHD 2A32A 2VB0A 1MBQA 4KELA 5ESTE 1SGDE 1LHDH 4GCHF 1CT0E 4MLFB 1XUGA 3O8CA 3GYLB 4OS7A 1UTLM 1A5GH 1ZJKA 4KTUA 4Q2KA 1V2UT 2GV7A 2CN0H 4Y8ZA 1A5IA 2H9HA 3BTDE 1GL0E 2AGIX 4BANB 1AIXH 3DA9B 4RSPA 1Y5UT 2RA0A 2NU1E 5BPEA 1WTHD 2ZGHA 4OS5A 1GHXH 2FWWA 1HAIH 1EAXA 1MD8A 1C1MA 1C4U2 1NU7B 1ZJDA 1O2SA 1CA0C 2WPLS 3I77A 1G32B 1GDUA 1ZMLA 4BXWA 5H4IB 1FXYA 4MPWA 2GCHG 2ZC9H 4ZKOU 3G01A 2AMPA 3SV2H 2B5TB 1HJ9A 2A7JA 1C2JA 1GI9B 3D65E 5EJLA 1V3XA 2FODA 1WQSA 1HYLA 1WYKA 3EGKH 1G37A 3F2FA 3O8DA 2GGVB 5C5NA 1H9LB 2XOKD 2FI3E 1ZHMA 2IOTA 2ZDKA 3C27B 1DS2E 3TK9A 2PSYA 1HCGA 2OBOA 1FY4A 2HPPH 3RXDA 3M7QA 2HVYB 4BAMB 2Q6FA 1BJUA 1IQIA 1OWHA 2BD2A 1BMFD 1OWIA 2HWLB 1GBIA 1O36A 3A80A 4K5ZA 3BTWE 2P93A 2OD3B 4NA9H 4FUCA 4AG1A 1O38A 3PYHA 3PWCA 1A0LA 2RFKC 2IN2A 2PTCE 3ZVFA 4FXGH 1NPMA 1PFXC 2O9QA 3ZIAD 3WWFA 2W6ID 4E05H 2K8IA 2QY0B 4U2WA 1EOJA 3OU0A 5FAHA 7KMEH 3N99A 1TOCB 4MVNA 4Z0KA 4X8UH 3ZYDA 3QGNB 5F53A 1AWHB 1DXPA 1O2HA 4CRFA 3QX5H 1K2I1 3LGWA 1SLVB 1WBGB 1C1TA 1NU9A 3U8RH 1Z1JA 2HPQH 4IW4E 1DICA 4I31A 1MTUA 2UWOA 4OS4A 4MPXA 3SNEA 1O2XA 2TPIZ 3PRDA 2XNIA 1P3EA 1AFQC 2BQWB 2TIOA 3KEEA 1P12E 5GIBA 3SYJA 1Z7KA 3EBNA 5A0AE 3VB7A 1LKBA 1S0QA 3MU0A 5LGOA 1HUTH 1T8LA 1ZHRA 1O33A 2P95A 2UWLA 3M7TA 3DUXH 1J17T 1NBMD 5C17A 4B6EA 4GUXA 4B71A 2Y80A 3GY2A 2OP9A 2C4FH 1GL1A 1ETRH 4H4FA 3MYWA 1ANDA 3WY8A 1ANEA 1P9UA 4A1TA 1GMHF 2CXVA 4FUHA 1O3NA 3Q77A 2VIQA 1DUAA 3V12A 4B2CA 3RC6A 1MTNB 2O8TA 3BTME 3QTOH 5E2PA 1YGCH 3RXHA 1MUEB 1RXPA 1DM4B 4JZ1A 1C5TA 2VWLA 1DUEA 2STBE 5HIZA 2P3UB 1UVSH 1AB9B 1C1UH 3U69H 4I33A 1E37B 4CHAB 1O3OA 5IYTA 1P2MA 2O8UA 1T31A 2VWNA 2OINA 1C2EA 1A7SA 1K28D 1Z8RA 1VZQH 3N7OA 3QZQA 3BSQA 2PR3A 1HJAB 2EQNA 3STIA 2ZDAH 1GMHG 1O2UA 4JZIA 4K1SA 2BVXH 4MPUA 1S6LA 1ACBE 1G3BA 1UCYK 2TGDA 2V7QD 2C8WB 2FXRA 2O8MA 1TGSZ 4YLQH 1RD3B 1UVUH 1UCYH 1FI8A 1P10A 1TPSA 4GCHG 3MI4A 3F9EA 1C5XB 1BMLA 4JYTA 3VB5A 1C5MD 3TH3H 2P16A 3KQCA 3FZZA 2SGFE 3GICB 1MKXK 1LMWB 4D8NA 3SBKA 1SGEE 1SVPA 3K6YA 1TRYA 3RM2H 2CJIA 4Q7XA 1J8AA 2CV3A 2OCVB 5DP4A 3LGVA 1D3QB 3ELAH 4O3TA 4VGCB 5JDUB 1OP2A 2YNBA 1BITA 1E38B 4UDWH 4Y79A 4YM9A 5JPMH 1LPKB 5EXNA 3A85A 1NRQH 3RC5A 5C3NA 4AG2A 4AFZA 3KCGH 4ISOA 1BTYA 4THNH 4BAOB 4ISLA 1NRSH 4CRBA 1YP9A 4TWYA 1ID5H 1EX3A 1P2IA 2W6JD 4HG6A 1F0TA 3F2GA 1YPEH 1H8IH 1KMHB 1RRKA 1NS3A 5CHAB 4ZKNU 3O8RA 1C1QA 1KTTB 1OSSA 3B23B 2VIWA 3E0PB 1XUKA 4OGYA 2F9BH 1C2IA 3Q76A 1TNKA 5L2YH 1V2LT 3C1KA 1GI7B 3M7UA 3P6ZB 2OUAA 3VFEA 2ZGBH 3SJKA 4NWKA 1CGIE 1MABB 2YMSC 3DSOA 5EPNA 5HKKD 1GJ5H 2XNDD 2ZPQA 1RIWC 4TSFD 4AFQA 1K1MA 3SUGA 5EU8A 1XUIA 3PROA 4UE7H 5A8ZA 2F9VA 3LGTA 3AW1A 4U32A 2F4LA 2K7XA 2LELA 1ZTLA 4DT4A 1W10U 3S69A 2GDDA 4IMQA 2VGCC 1VITG 1T4VH 1HAPH 5G4BA 3L6PA 3ZZBA 1UTKA 2W7UA 4ACBA 3ZZ4A 4D7GA 1SGNE 3AAUA 1AUTC 1Y3VA 1XM1A 1C2KA 1Y8TA 1BZXE 1EOLA 2BQ7B 3A7TA 1BMAA 1C1SA 4RI0A 2G52A 1GBEA 3UR9A 4X2YA 2EEKA 1DITH 1P2KA 2PUXB 1KXAA 3P8GA 1P09A 3Q3KA 3PMJA 3S7HB 1F5LA 1KXDA 4ZHMU 1Q31A 5EIYA 3F9GA 4IS5A 5HGGA 2LP6A 4ZMAH 4OS6A 1FNIA 1FN6A 4I86A 3ODFA 2WV5A 1GBJA 2PKAB 2ZCLP 4X8TH 2FLBH 2ZZUH 1L4ZA 3LU9B 1N6YA 1PPHE 4ASUD 1H4WA 1E36B 4SGAE 1TPOA 2BY7X 5F6MA 1GCTB 1IQGA 3SGQE 1COWD 1NFUA 2NU2E 3NWUA 2OBQA 4TT3D 1FN8A 1MAYA 1PQ7A 3MTYA 3M36A 2SGDE 1Q3XA 2VVCA 3LH3A 1MQ6A 1ZSLA 2IPHA 4XDEA 3ZZ5A 1P03A 1O34A 2G81E 1NRRH 2FOBA 1TRNA 3RUOA 2WZQA 1HFDA 1QR3E 1Z8JB 2WUCA 4YXWD 3S7KB 1OWDA 3DFJA 4A6LA 3SUDA 1SQOA 3VB4A 4I8GA 5GWZA 1GI3A 3UIRA 3UTUH 2OC8A 3BTGE 2BTCE 1O2GH 4NCYA 2AFQB 1HAVA 3GDVA 3SZEA 2FOFA 4B2AA 2ZFFH 1MCVA 1OPHB 4X1PU 4AX9H 3SI3H 5GNDA 1LHGH 2XBXA 3KHVA 2QXHA 4AYYB 4YLUA 1O2YA 1TGCA 4YT7H 1A5HA 1LVMA 1C9PA 2A2QH 5A8YA 1YKTA 4YOJA 3MH5A 3F6UH 4XBCA 2XXLA 1GGDC 4YT6H 4CRGA 3F3BA 1IQHA 1TLDA 3KF2A 1DWDH 2G8TA 4JZEH 2UWPA 1SGCA 4K60A 1GHAG 4UONA 1CHOG 1TMUH 1RTFB 1Y3YA 2B7DH 1P02A 1W3CA 4Q7ZA 5FX5A 1PQ8A 1TGTA 3URCA 1CE5A 4BXSA 2ZCHP 3UOUA 1YLCA 2VGCB 4YESB 5C2ZA 5CHAC 4BAQB 2SGPE 1DWEH 4YTAA 4INKA 2OC1A 3UQOA 1N8OB 1AFEH 1IHSH 4CHAC 1HV7A 1TGBA 3H7OA 4A1XA 3MOCA 2FIRH 3DSGA 3H7TA 1V2WT 3ESTA 1C2FA 1BRCE 4ASHA 5IDKA 1S81A 3VEQB 9LPRA 3AASA 2Z3EA 1KXBA 4ABDA 3QTVH 1C1NA 8KME2 2BOKA 3A7XA 1ABIH 4DOQA 5KECA 1SGYE 3SNAA 3U8OH 2FOEA 1E1QD 1CHGA 1IAUA 3MU5A 2Z7FE 2GCTB 1V2OT 2BZAA 2CMYA 3EQ0H 1C5YB 2YNAA 1V2RT 3JZ1B 1TPAE 1GBMA 3FVFB 1GI2A 3RLWH 5I46H 2GT8A 1W7GH 3PV2A 5CE1A 1O2MA 2ZNKH 3ZZ7A 1ZYOA 1P2QA 2BD5A 4A1VA 1SLWB 4ACAA 2TGAA 1C2HA 1DXWA 2HNTE 1BDAA 4B2BA 4DCDA 2QXGA 1BTHH 4LXBH 1EZXC 1S84A 4Q63A 2PKAA 1OP8A 4Q80A 4MNXA 1CA0B 5E0HA 3U9AH 4I32A 3SO3A 1K22H 3BEIB 3EDXB 3PO1B 4AOQA 2BD3A 1ELVA 2BZ6H 4H6TA 5EOKA 1LKAA 3SW2B 1O3IA 3QGJA 2OQ5A 4UFFH 3A86A 3HATH 1GWAA 1IOEA 4LZ4B 1TNJA 2JETB 1HAZB 1IQEA 2ZQ2A 3TGKE 5JBAS 4F49A 2WPIS 3LGYA 3D49H 3M3VA 1YC0A 3SQHE 4I7YH 2BD8A 2XBYA 4ZHAA 3PLPA 4NFEA 3MU1A 1GHWH 2W26A 1G36A 1C2GA 1L1JA 1O2OA 1WXRA 3UWJH 1S5SA 3LGIA 1C1PA 3A7YA 3E8LA 4X0WU 5E2OA 3BG4C 2ZHDA 2BHGA 5J4QA 3TNTA 3P8NA 1YY3A 4AGJA 3LIWA 1ANBA 3SNBA 4NZQA 1AMHA 2V3HH 1V2QT 3EYDA 5TCAA 1BUIA 1O5BB 3M5LA 1BHXB 1O3EA 3UY9A 1NFXA 3OTPA 1O2QA 4BTUB 2A5IA 3RXCA 2PTNA 3T5FH 1TAWA 1GJDB 2OTVA 3MU8A 4AZ2B 1KY9A 2GX4A 4Y76A 1MU6B 2AH4X 4TWWA 2Q6GA 1AGJA 2A5AA 1E79D 2Y5FA 1SGFG 2XTTB 3F0PA 1O5GH 3AAVA 3MNXA 1O37A 4A92A 2D26C 2ZTXA 1NBME 1HIAB 2O8LA 4K8BA 2A4GA 4WMFA 1K1JA 3TITA 1NY22 2PKSB 4CRDA 1C1RA 4WWYA 1SGQE 3F9FA 2WINI 1QY6A 4ZKSU 1AKSB 2ASUB 2ZQ1A 3RXBA 3CP7A 2R2WU 2ANWA 7GCHF 3SORA 3A7ZA 3HK6B 5EXMA 1C5QA 1MTVA 3NUMA 5HIYA 1UK3A 1G3DA 2ZO3H 1GJBB 2ZFPH 1HAHH 1TPPA 2GVFA 1A0JA 4B73A 3PTBA 1L4DA 4NGAH 1GBTA 2ALPA 1TA2A 1SGTA 3F2HA 3KYGA 4ISHH 4ZXXH 6GCHF 1H1BA 1TBZH 5FPYA 1MH0A 1P2OA 1F0SA 3MU4A 2BDHA 1DLKB 1EATA 2J97A 6CHAB 1PPCE 1J14A 1LHEH 3TNSA 2WPKS 4BTIB 5IK2D 2HALA 1QIXB 3MO3A 3EA8A 1BIOA 3FO8D 1NT1A 3SOSA 1LVBA 4LOYH 3TK6A 2XCNA 4YO9A 4ABHA 2VU8E
chains in the Genus database with same CATH topology
1C5PA 3ZZ3A 1O3JA 1YCPH 2HOBA 4RKJB 4X2WA 1J16A 4K1TA 1OYQA 5AHGH 3GY6A 1LPZB 4O9VA 2ZECA 4YOIA 1O5FH 2QGRA 2W7SA 1DX5M 2QV1A 3RP2A 1GCDA 2J2UA 1GBCA 2ZTZA 1C5NH 4WVPE 4FVDA 1GHAF 3FZDA 4OS2A 1C5SA 2WYJA 2XBWA 3A8AA 3F9HA 1QJ1B 1O5DH 1BJVA 1BA8B 1F2SE 1Z6EA 2XWBI 3A8BA 1A2CH 4INHA 1GDNA 3ZZDA 2XCFA 3BTEE 2GMTC 1S82A 3CS7A 1T8OA 3UR6A 3UFAA 1YYY1 2BY5X 3ZZ6A 1W8BH 1T32A 1G2MA 1H8DH 1RIWB 3M35A 4NZLA 4X2VA 5A8XA 1SI5H 2ZEBA 2ZA5A 3MH6A 4ABEA 4MNVA 2QF3A 1ELTA 5AVDA 1UK2A 1HB0B 3LC5A 6LPRA 2AGEX 1IQLA 1THRH 1GBLA 3UUZA 1D9IA 5ETXA 1CBWC 1UTPA 5JBBS 1O3DA 1FY3A 5EQSA 1JMOH 2DE8A 1ARCA 4BTTB 3QK1A 1YF4A 1TQ0B 1MQ5A 3P92A 1VJAU 1HAXB 3ATMA 1MD7A 4XBDA 4WY3A 3ATIA 1SB1H 1AWFH 3PMAB 1ZLRA 3T25A 4FU8A 3FP8E 1EXFA 3E6PH 1GJ4H 1QHRB 5LPRA 3UQVA 3ZZAA 2BB4A 3BN9A 2Z9IA 1EB1H 2HRVA 1GJ9B 5L2ZH 2VNTA 1ZR0A 2VWOA 1SGPE 1G2LA 1BHXF 1VCPA 1HPGA 1ZGIA 2BDAA 2HLCA 2BOHB 2WV4A 4NWLA 1V2ST 4Y10E 1EPTA 2F9NA 1AI8H 2F9OA 3E1XB 1Y3UA 1BTPA 1Z71A 4GPGA 2GZ7A 5GDSH 2BLWA 2SFAA 2ALVA 2ZU3A 3E0NB 3SU4A 1F5RA 3GY4A 2GZ8A 1ZZZA 1LO6A 4JK5A 3URDA 1C5VA 1V6DA 2B0FA 5EPYA 1SQAA 4CBOA 1YPGH 3ZZCA 3LONA 1O3HA 5LH8A 3NK8A 2GT7A 3K6ZA 1FIZA 1EJNA 1AZ8A 1K1NA 4Y71A 1FIWA 2Z3DA 1XXDA 1BRAA 1EKBB 3RMMH 1F7ZA 4JZDH 3ZZ8A 2KAIA 1FV9A 1KLTA 2XC5A 3EA7A 1MCTA 4ISNA 3IITA 1F92A 1ELEE 3RXMA 1EAIA 2H9EH 1BMMH 1GHYH 1A4WH 3QWCH 4Y11E 2AMDA 1HRTH 2VIVA 4NSVA 1PQ5A 1CHOF 3ZVDA 1A0HB 2NWNA 1JOUB 5GCHF 1SLXB 4KP0A 1BBRE 1FAKH 2A2XH 2FOHA 1L1GA 2FX4A 1OKXA 5LPFA 3L3TA 2BY6X 1WOFA 3M3TA 1TONA 2JH0D 3NPSA 1LVOA 3VXFH 4B1TA 1QL9A 3RXTA 2GDEH 3ZYEA 4NIVA 3Q3XA 3E3TA 2VIPA 1EZSC 1GVLA 5JB9S 4ZKRU 4FUEA 1GG6C 2TRMA 2OC0A 2ZFRH 5EXLA 4RN6A 3DHKH 2ZFQH 1OX1A 3CENA 2SNWA 3ODDA 3SU3A 1XUHA 1UHBA 2RCEA 2F91A 1ZTKA 2BDGA 1H9HE 4X1RU 2A4QA 1OYTH 4AFSA 3E91A 1O2JA 3I29A 2JH5D 2FOMB 2QIQA 2DUCA 1O30A 4ABAA 3FP6E 2Y7XA 3VXEH 3SI4H 1HLTH 4ABJA 3K2UA 3GCHC 1NTPA 4O3UA 4X8VH 3LJOA 3K65B 4M7GA 3P70B 1BRUP 4CBNA 3T28A 1QTFA 5EODA 5DP3A 3GCTF 3A87A 1GI6A 3GCOA 4X6PA 3SJ9A 1CQQA 1ESTA 3RXUA 2LNCA 4Y8YA 2BY9X 1UHBB 5C1UA 3SZNA 1W2KH 1O2RA 4Y7AA 1QL7A 4WJG2 3T27A 1QRXA 3PTNA 1HGTH 3DT0H 2V0BA 4TPYA 4H6SB 1XVOA 3SU2A 5DP7A 2FI5E 2QXIA 3T26A 1TGNA 3NXPA 3ZVCA 1QQUA 2G5NA 3RXOA 3SU0A 1FY5A 1NN6A 4FUJA 3SU6A 2QXJA 2GZ9A 5ABWA 1QNJA 2OXSA 4E06H 4RKOB 1V2KT 1UCYE 3NCLA 5DP9A 3SV6A 1XUFA 1ARBA 4IN1A 1DY8A 4JYVH 5EGMA 1ELCA 3FP7E 4MNWA 1JRTA 2FTLE 3RXSA 3TLOA 3ATLA 1FAXA 1YM0A 4QT8C 1GGDB 1S85A 3U98H 2G4UA 1LDTT 1DY9A 2WYGA 3LJJA 1BCUH 4E7RG 1CGJE 2P94A 2M5TA 1THPB 4MPVA 1HJAC 2XRCA 1FZZA 1F0UA 1YPMH 3MNCA 2GKVE 3RMLH 2I6QA 2TGTA 3OX7U 1XVMA 3Q3YA 1Z8IB 3QO6A 4AN7A 1W13U 1ZTJA 1B5GH 1BOQA 2WPJS 1YLDA 3W95A 1QJ7B 1MZDA 3TVJB 2ZP0H 3M37A 1UTQA 1V2VT 2XYAA 2LIZA 2ZDMA 1XUJA 1P9SA 2J94A 1Z1IA 1GBHA 4X1NU 2XW9A 3GISB 2ZIQH 3MFJA 1PYTC 2HVXA 2Z6BD 1THSH 3ENSB 3GY3A 2ZU5A 3OYPA 1SR5C 1QCPA 2BMGB 2C93B 2AMQA 1XKAC 1GHBF 3V0XA 2FX6A 4Y0YE 3RXRA 2OC7A 1E35B 1E34B 5JBCS 2BD7A 2BXTH 2OQUA 4IBLH 2ZWLH 4NIWA 1PQAA 4NG9H 1UVOA 4DIIH 1TMBH 1SC8U 2FZZA 4K8YA 1AO5A 2J9NA 1Y3WA 4FU7A 2Y81A 1CO7E 1TNHA 2Y7ZA 3GY8A 1C5RA 1P57B 5AFYH 1QFKH 2IJOB 3MHWU 4XSKU 1WQVH 1ZMJA 3GYMA 3KQEA 2BLOA 5GXPA 1SPJA 1FY8E 2UUKB 1IQJA 3E16B 3RLYH 3SGBE 2ZHEH 4GHTA 2J34A 3RDZA 1AD8H 1P2JA 1SOZA 1O2IA 1K1PA 1OS8A 3SQEE 1C5OH 3A8CA 4X6MA 1G9IE 3RXIA 2SNVA 1C5UA 4KKDA 3LPRA 1K1OA 3DFLA 3QZRA 4UFEH 3D23A 1VGCC 2BX3A 3KNXA 1SBWA 3HGNA 1WAYB 2ZKSA 1KXFA 1OWEA 4XBBA 1T7CA 5DJ7A 3RM0H 3TGJE 2BXUH 2NU0E 4NFFA 2D8WA 5FCKA 5J4SA 3SUEA 5B6OA 1JXPA 2ZGJA 4NIYA 2WUBA 2ZDVH 1F0RA 2BY8X 5EW2H 1IHTH 2ZHFH 1IQMA 3OY6U 2ZI2H 1TMTH 1FJSA 2ANMH 4UEHH 1M9UA 4INLA 1J15A 1T4UH 1ZGVA 3VPKA 4GSOA 1HAYB 1MKXH 3ATWA 1YBWA 1UVTH 4AYVB 3I78A 4ZROA 2ILNA 2W5EA 1B7XB 1K21H 4GAWA 6ESTA 3U1JB 2F9PA 5DG6A 4K2YA 1DWBH 3M5NA 1V2MT 4NA8A 1VCQA 2A45B 4GHQA 1Z8GA 4CR9A 1N8OC 1UTOA 2AYWA 2J4IA 3QLPH 4IMZA 1TX7A 2ZPRA 1ESAA 5F03A 4Z6AH 1SMFE 1IQKA 4AGKA 1O3BA 1EQ9A 1VITH 4U30A 5JBTA 2GMTB 1HAVB 3F68H 2ZTYA 1HAGE 1JIMA 1OWJA 2XC0A 1C2DA 5FHTA 3DD2H 2ANKH 1KIGH 2PHBA 1GJAB 2B8OH 1Z6JH 3GDSA 3SU5A 5HMAA 1SHHB 2XC4A 2RA3A 1C5ZB 3O8BA 5F8ZA 1LHCH 1BTUA 1EPTB 3PLBA 1W0ZU 2PKSC 2P59A 3AW0A 2EA3A 3M61U 2Q1JA 1UTMA 2Z9JA 1W0YH 2ZDLA 1QQ4A 3RXLA 4O03A 1EPTC 3TIUA 1SGRE 1HXFH 3PB1E 3U1IB 4BOHA 3MNBA 3ZZ9A 2GTBA 2ZDNA 1TRMA 2EC9H 4DG4A 4TYDA 2FM2A 1GMCF 3EAJA 4DY7B 2STAE 3RU4E 2EI6A 1S6FA 1NC6A 5A0BA 1KTSB 4DURA 1HXEH 2W3KA 4HI3A 3PO1C 2GV6A 4OS1A 1ZPZA 3RXJA 2I6SA 3ZVGA 2P8OB 3T2NA 3UNRA 1TNGA 2WPHS 1EJAA 1O3LA 2BVSH 1RS0A 1NRPH 2ANYA 1V2JT 1L2EA 2R0LA 4TY6A 4X8SH 1O32A 1AN1E 2FOCA 2F3CE 3RC4A 1C1OA 3TU7H 5L30H 1C1VH 1BRBE 1AU8A 4UD9H 2BDBA 5FPSA 3TPIZ 3VGCC 3R3GB 1F5KU 5HXFA 3TK5A 1P04A 1B0EA 3MH4A 1CSOE 1JBUH 3BTQE 3D62A 1QA0A 1GI8B 3RXPA 2Z3CA 4ZXYH 5SGAE 4FU9A 4MG3A 5GCHG 3SN8A 2Z9KA 1TABE 2J95A 2FMJA 4CH2B 1QRZA 5GJ4B 4I8KA 5L6NH 2UUJB 4J1YA 5AF9H 1DT2A 1AB9C 3BG8A 4KGAA 4AB8A 4SGBE 3SNCA 1ORFA 4B76A 2VINA 4ABGA 2PSXA 5PTPA 1SG8B 1P06A 4JZFH 5JB8S 1DPOA 8LPRA 2UUFB 4Y6DA 3BF6H 2C90B 2ZHWH 2OLGA 1GBKA 1TNIA 1ZRKA 2FI4E 2ODPA 4HZHA 1WU1A 1E0FD 1GPZA 1SLUB 1Y5BT 2BDIA 1WCZA 3KL6A 1JWTA 5T6FA 3BV9B 4WXIA 3RXAA 2BYAX 1YCPM 2R3YA 3A7WA 3P17H 1HDTH 1GBFA 2BDYA 3PMBB 3H5CB 3NKKA 3UNQA 4UFGH 1GG6B 1XKBC 3ZVBA 2G55A 1NO9H 1FDPA 5A09A 5EG4A 4I8LA 2QF0A 1FMGA 3KQDA 3PWBA 4MDSA 3BIUH 1XXFA 2BLVA 2JH6D 1HNEE 3BIVH 5C1XA 5DPAA 5CMXH 4UFDH 2Q6DA 2SGAA 5FXLA 2QAAA 1GJ6A 2PV9B 3TJOA 4CRAA 2FEQH 2ZG0H 1DVAH 1GMDF 1C9TA 4K69A 1PPZA 1W14U 1ZPCA 8ESTE 2CF9H 1D6WA 1Q2WA 1ELDE 1TA6A 5HM2A 1GI0A 3KIDU 1GBBA 1AFQB 3HGPA 1PPEE 1FUJA 1Y3XA 3LT3A 1SQTA 3GCHB 1DE7H 3RMNH 2F83A 3LH1A 4U01A 3T62A 3IG6B 1BTZA 4XE4A 2PLXA 2ODQA 2FDAA 4X6NA 1BT7A 3SNDA 1O3MA 4ZHLU 1EB2A 1AKSA 2ZPSA 3SV7A 1FONA 1ELFA 1QRWA 3BTTE 3RXFA 1QB1A 1KYNA 1NFYA 2G5VA 1EJMA 1TYNA 1RJXB 1UVPA 1LPGB 1FY1A 2ZU2A 1SGFA 3RXVA 1QL8A 1QB6A 5DKMA 3A88A 2C8XB 5I25A 2RG3A 2F9UA 1CVWH 2J92A 1A3EH 3KN2A 2BDCA 3A89A 3NZIA 3RXQA 1O3CA 1O3AA 3HKIB 2VVVA 5E0GA 1H9IE 4LK4A 1VCWA 2BLQA 1G3EA 1O2VA 1AZZA 1DFPA 1YPHC 1TBQH 2DE9A 1UJ1A 4YZUA 1J9CH 1GBDA 2GP9B 4E7NA 2GCTC 1ZHPA 3Q00A 1CU1A 2G51A 4AFUA 2PGBB 4MNYA 2P3FH 5C5OA 4ZUHA 1AVGH 4CREA 2BQ6B 1GHZA 3A81A 4KTCA 2NU3E 3TJUA 1MBMA 1WV7H 3HPTB 2D2DA 1P8VC 1UTJA 2ZF0H 1SGIB 2A4OA 3R0FA 2XBVA 2FOGA 1T8MA 1QB9A 4BNRA 2C8YB 2BD4A 4WF8A 4CH8B 1D3PB 2PGQB 4CRCA 4XFQA 1GI5A 2Y82A 1QGFA 2H5CA 2CHAB 1PYTD 4K3JA 3UPEA 1A46H 2HNTF 3U8TH 5AFZH 5FX6A 3MMGA 1O35A 3SJIA 1WSSH 1FPHH 2V3OH 2AIPA 1A3BH 3GY7A 2FS8A 1N1LA 2EI7A 3GDUA 1VGCB 5DP5A 1O3FA 1TWXB 1V2NT 1TB6H 5FBEA 1UMAH 1DDJA 3MO6A 3HK3B 4WMEA 1QBVH 1UK4A 3KQBA 4DGJA 1MAXA 3QDZB 1RTKA 5LPEA 2VJ1A 1T8NA 5T6DA 4DW2U 1DSUA 5EW1H 5HM9A 1DWCH 2FLRH 1EAWA 4D9QA 1O2NA 4WH6A 1LTOA 3B8JA 1IQNA 1ZMNA 1PPGE 2Z9LA 1OP0A 1GHBG 5EQRA 2KAIB 2SGEE 3SHCH 4Y7BA 4R0IA 1TIOA 1P11E 1VR1H 2G4TA 4X1QU 2A7HA 2VIDA 1O3KA 2NU4E 2SGQE 1AY6H 1LQDB 1NROH 3BEUA 5E0JA 1O2PA 3A8DA 1TALA 3B9FH 2QN5T 2GD4B 4JYUH 1C4V2 4FUGA 4D76A 1HJ8A 4TY7A 5E8EH 2R0KA 1C4Y2 1GJ7B 1QBOA 1VJ9U 5DGJA 3TJVA 1RTLA 3F1SB 5DP8A 2W3IA 1LCYA 3PV4A 9ESTA 1TNLA 4AORA 2A1DB 1O2ZA 2R2MB 3HKJB 2P3TB 3GCNA 4ESTE 3PM3A 3ZV8A 2FO9A 3VGCB 3SV8A 4IC5A 4I8JA 1G3CA 3SJOA 1O2TA 1EUFA 2O8WA 4JK6A 1ELAA 1LVYA 1KXEA 1D6RA 1MTWA 3E90B 3TJNA 1OXGA 2J38A 2VH6A 1CBWB 2PUQH 5F8XA 1O2LA 1BTXA 2VH0A 4PROA 4FUBA 2THFB 3PMHB 1GVKB 1SFQB 1UTNA 3LGUA 1FQ3A 2JKHA 4DVAU 2Y5HA 1SSXA 2ODYB 1KLJH 3V3MA 1L0ZA 4A7IB 2FTMA 5GPIB 1YPKH 3SUFA 1ETTH 4JCNA 4KTSA 4Y0ZE 4DIHH 4F4OC 2D1JA 3AVZA 1GBAA 3STJA 1A61H 1TX8A 2AIQA 2G00A 5FCRA 1HBTH 2BX4A 1D3TB 3FAOA 2ZFTA 2V35A 2A4RA 2BD9A 4FUIA 3ZVAA 4H42U 3ITIA 1DSTA 3P8FA 1C5LH 1NESE 7GCHG 5C67A 2FPZA 4X1SU 1BBRH 2RDLA 3RXEA 3RU4T 3SU1A 4FUDA 2WPMS 1JIRA 4GVUA 5HYOA 1L1NA 1AVWA 2ESTE 1GJ8B 1BMNH 1G30B 3UREA 1NZQH