4Q63A

Crystal structure of legionella uncharacterized protein lpg0364
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
YFRLKNHGEINASLDNNSIEIVEISSNGAVVVKQKTDIPKEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Legionella Uncharacterized Protein Lpg0364
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Unknown function
molecule keywords Uncharacterized protein Lpg0364
total genus 23
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.430 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4q63A00
4Q63A
chains in the Genus database with same CATH superfamily
4RKJB 2ANWA 1IQNA 3TIUA 3MU5A 2C90B 2FOAA 1HJ9A 4ABFA 2STBE 2W7UA 1OYQA 4AYYB 1YKTA 3FZZA 3KQBA 1TA2A 3F68H 3URCA 2PKSB 2J94A 5EQQA 4VGCC 4MPWA 3UIRA 3H7OA 2F9UA 1AHTH 2TRMA 1EP5A 2AMQA 3P95A 4BTTB 4NA7A 4BOHA 1SGYE 4AX9H 1TNKA 2C4FH 1GI2A 4ISIH 3TJOA 1DVAH 1C1RA 3DHKH 3OFND 2ZCKP 2UWPA 2XBXA 3AW0A 2CHAC 1PPFE 3A7TA 2P94A 3V12A 4Y8ZA 2DE8A 1SVPA 1TNIA 1UMAH 4D7GA 1UVSH 1F5RA 1NC6A 1V2LT 3KEEA 4E06H 1JXPA 4MG3A 2XWAA 4X2WA 5F03A 2BLOA 3U8TH 3VGCB 3HK6B 1ZPBA 4WMEA 3QDZB 2LELA 3MU4A 1O2TA 4X8UH 1FUJA 2GZ7A 2ZWLH 4A1TA 1YBWA 1GJCB 1V2MT 1O5CB 1QA0A 1P12E 1BUIA 4QT8C 2PLXA 5GCHG 1AMHA 1DFPA 2K0QA 1O3MA 1ZPCA 3MH6A 3SU1A 1KY9A 3ZIAD 1CT2E 1O3PB 1WDIA 2CN0H 2OK5A 1IQFA 1FY3A 2IPQX 3KN2A 3SI4H 2ZC9H 4JCNA 5FPSA 1AI8H 1A0JA 2OC0A 1NFWA 1QJ6B 1PPBH 3DSOA 5FX6A 3D65E 3TJVA 3ATWA 1E35B 5A8YA 3NUMA 4X0WU 2AFQB 3MNSA 1A5GH 1QFKH 4Y8XA 1ZMJA 1AO5A 1C5VA 2A7CA 3PV5A 3EYDA 3TNTA 2Q6DA 3PWBA 3M37A 1G37A 3P8OA 5ABWA 4JZIA 3PTBA 4I7YH 1K28D 3QGJA 5EGMA 2ZGHA 1D3PB 2AGIX 1LHGH 1TMBH 3K6ZA 2TGAA 1AKSA 1VITF 5F6MA 1Y3VA 2IPHA 3RMOH 4K60A 1CT4E 3RXSA 1GJAB 5KECA 9ESTA 1Z1JA 4OS1A 1FAXA 1SL3A 2BD5A 2XOKD 2V7QD 1RXPA 5F53A 1Z6EA 3ZVBA 3SNAA 3MTYA 2P16A 3UREA 3MOCA 2VGCC 1C9TA 4ZUHA 3GDSA 2VIVA 1VGCB 2ZFQH 1O3AA 1NO9H 1S85A 4U2WA 2G8TA 3L33A 2A5IA 4O9VA 1LPKB 1V2QT 5DO4H 3BSQA 5EPNA 2AGGX 2YOLA 4KELA 3RUOA 3PRDA 2OXSA 3UAIC 1LPGB 3MO3A 1K9OE 2IOTA 1O38A 3SZEA 3DT0H 1FPHH 1OWHA 2ZHQH 4I33A 1QHRB 1W11U 4K1EA 4U30A 5CHAC 5A2MH 1ELFA 4A92A 1C5PA 1OWJA 2QE7D 1FY8E 1GL0E 1ELGA 1O3NA 3T26A 5LPRA 2HNTE 2FZZA 1ANBA 1W13U 3RXJA 3V13A 3LGVA 1T32A 2FIRH 5C1XA 3TU7H 4KTCA 4B1TA 5C5OA 2STAE 4ZROA 1TNHA 2ZEBA 3HATH 3PO1C 1TNJA 3GCTG 1SLXB 1DWCH 1UK4A 1YWUA 4ZHMU 1YLDA 4IN2A 3V0XA 4IN1A 3I29A 1EQ9A 1NS3A 3PYHA 3PV4A 1C1MA 2JIZD 1AB9C 6GCHG 4CRBA 1V2UT 4FUCA 4KP0A 5K0HA 5CMXH 3M61U 1DITH 2F9BH 1QZ8A 1V2WT 1V2KT 3RC4A 3KQDA 1QRZA 1IQGA 1BMMH 1DX5M 4YT7H 1MKXH 1GBLA 5JBAS 1JMOH 8KME2 3OSYA 5IYTA 3ZZ9A 4GSOA 3SJIA 5L2ZH 5JBBS 2BLQA 1JRTA 1TFXA 2A45B 4BAKB 2AH4X 1RIWC 1IAUA 2WPHS 3U28C 3O8RA 3M3VA 3M5OA 4B6FA 3RC5A 2PP6A 1ZRBA 4ACBA 2XW9A 3F0OA 3TPIZ 4B2BA 3UOPA 3MYWA 4HI3A 4JYUH 4GLYA 4AGKA 1V6DA 3EE0B 2VNTA 1EJNA 1IHTH 2F83A 2BDYA 2P8OC 2WYGA 4ZAEA 1GBDA 1K0HA 3UTUH 3W95A 1MD8A 3MHWU 1UTKA 2F9VA 2L74A 4I8JA 1E34B 3RXHA 1O36A 1RJXB 2OLGA 1HIAA 5FPYA 4JMYA 3KNXA 4UFGH 1O32A 1Y3XA 1DICA 5LPEA 2H2ZA 3GCTF 1GBAA 1TGBA 2Z3EA 2ZFFH 4ASUD 1J16A 4NSYA 5E2OA 1W14U 1O34A 2VIPA 4F49A 1F0RA 5A09A 1LHEH 1ELVA 2Y5GA 2PSYA 1LTOA 1AIXH 2CJIA 1RS0A 1Y3WA 1C5ZB 3N7OA 4OS4A 3VFEA 1EAWA 1Z8IB 4INKA 6CHAC 1EZQA 3PLPA 1W7GH 4XDEA 2GP9B 2PHBA 2VGCB 1T8LA 3ZZDA 1C2JA 1G30B 1VGCC 1O2YA 1M9UA 1O2OA 1WOFA 1Z71A 2ZF0H 2OTVA 1F0SA 2Y7XA 3MH7A 5A0AE 3F2HA 2ANKH 1DT2A 1E1QD 1HXEH 2PGBB 1FY1A 4X1NU 2ANYA 3EE7A 1O2ZA 3B9FH 4CRGA 1XUJA 2VJ1A 2YMSC 4AYVB 2XCNA 1EFRD 5HMAA 1O2IA 1O2JA 3GDVA 1JRSA 5EU8A 2VBCA 1AFEH 1QRXA 4AZ2B 4TY7A 4LZ4B 1YYY1 4DJZB 1TWXB 1SG8B 1ZTJA 3BTHE 2ZPSA 3GY8A 1C2HA 1GBCA 1LHDH 2CXVA 1KIGH 1CQQA 1NY22 2RDEA 2BDGA 3MMGA 4ZXXH 1O2UA 2ZFSA 4AFZA 1QB6A 2KR7A 2FOCA 4YOIA 1ZSKA 5C94A 4TWWA 4DVAU 1S6HA 7LPRA 4K8YA 2H9EH 4DIIH 1AZ8A 2QGRA 1D3DB 3ZVCA 2ASUB 1GJ5H 1YCPK 4YOJA 3R0FA 2ZHWH 1AB9B 4Q63A 2ZTZA 1O5EH 2BDCA 1OYTH 3Q77A 1HGTH 2ZU2A 3PM3A 2FX4A 2ZFRH 4WXIA 2O8MA 1NN6A 1GI8B 4Q2KA 3FAOA 1P3EA 3SORA 1QJ1B 2NU0E 2ZQ2A 1F0TA 5EJ1A 1EKBB 1BMFD 1V2RT 2ESTE 1XKAC 1B0FA 3SGBE 1EUFA 2A0QB 1TIOA 1PQ8A 1VKYA 2SGEE 1GVLA 3LH3A 3GY2A 2QV1A 1GBTA 1YPEH 7GCHF 2ZI2H 2FOGA 4VGCB 2XRCA 4E05H 1FONA 1P3CA 5DGJA 1ZHPA 2BDHA 1C2DA 2J34A 1KXAA 3RM0H 1SQRA 2TIOA 1O2XA 1ZJDA 1UK2A 4MPXA 2BX4A 1KXCA 2EEKA 3TK6A 2J2UA 1Y5BT 2Y82A 4GAWA 1L1JA 1PJPA 2VWLA 1G32B 4WMDA 1XUFA 4UFFH 1L0ZA 3ENSB 1IOEA 2J98A 1RIWB 2B9LA 1KLTA 3U1IB 2A4QA 1PQ5A 1V2NT 3BTKE 2KCYA 1WAYB 4XD7D 1ETTH 1QNJA 2BB4A 1ZTLA 1IQJA 4R0IA 1BJVA 2D8WA 3A7WA 1CGHA 3TITA 3QX5H 4YZUA 1ACBE 1NRSH 1ANDA 2XBVA 2A32A 2BDIA 1Z1IA 4WF8A 4ABEA 3F2FA 1ELCA 1BTHH 4UFDH 2GVFA 2K1QA 2WHXA 2THFB 4F55A 1THRH 1NM6A 4MNXA 3ZZ5A 4I8KA 3P70B 3FANA 2PTNA 4NFEA 2W26A 1ELAA 3S7HB 1HAPH 1P57B 4ABAA 4XSKU 1T4VH 5F8ZA 4H6TA 2VIWA 5B6OA 1GMHF 3A7YA 1IQMA 4R8TB 2J97A 1P0SH 1QGFA 2GDDA 2XTTB 5E0JA 4THNH 2B7DH 2TGTA 2GV7A 2P3UB 1H9LB 1W0YH 2Y7ZA 1GGDC 2BY5X 1UVOA 2G4TA 2A31A 2XXLA 3RMLH 3A7VA 1FX0B 1CHOG 1V2PT 2GX4A 3WW7A 1C5OH 2OQUA 4DIHH 2GGVB 4ESTE 1GMCG 4M7GA 4YESB 4CRCA 4NG9H 3UFAA 5EXMA 3ZVEA 3F9GA 2ZP0H 1S5SA 1MTNC 1CT0E 1SB1H 3Q3KA 4XBBA 3SUGA 2GD4B 4ABDA 1W12U 4FXGH 1C1VH 1MZDA 1B7XB 1CA0B 1YP9A 1ZSLA 2YMSB 4X6OA 1ZSJA 1L4DA 1H4WA 3VB6A 2OD3B 1TGSZ 2WUCA 1AN1E 1C2FA 2XC5A 2R2MB 3TK9A 1NU9A 1AVXA 1BBRE 1FMGA 1OPHB 1G3CA 3OEED 5EW2H 5FHTA 1GBIA 3NZIA 1QY6A 3SV9A 2IJD1 1NZQH 1W10U 2QF3A 3WWBA 2JKHA 4TYDA 1VJ9U 1AE8H 2V35A 2ODQA 2P95A 1TQ0B 3ZZ7A 2RA3A 2ZG0H 1LO6A 3O8DA 1O2PA 2CK3D 2A5AA 7KMEH 3SU4A 1UTNA 4AORA 1O3IA 1GJBB 2C8ZB 2UUJB 1ELTA 5TCAA 1A5IA 3ATIA 4H42U 2O9QA 4WH8A 1H9HE 1QR3E 1KXDA 2GJGA 4B2CA 1WQSA 1V3XA 3P8FA 5SGAE 2TGPZ 3SU2A 3LC3A 2Z94A 1EPTB 1MTSA 2KCPA 5GWZA 1GVKB 2ZTXA 1YPLH 4CHAB 1ETSH 1O30A 2LPRA 4F4OC 1CHGA 1EATA 3UPEA 3BN9A 1C5MD 4B2AA 1MKXK 1YM0A 3A7XA 3DA9B 1DSUA 2FYRA 5DSFA 4ASHA 2IJOB 4OS6A 1BBRK 2B5TB 4RT1A 1O3HA 1D3TB 1E0FD 2D26C 1YLNA 5IK2D 2PKAB 2XBWA 2F9NA 3ATLA 4FOUC 4AFUA 3L3TA 2OC7A 1U6QA 2HLDD 4Y7AA 3VB3A 4FVBA 2EC9H 1FNIA 2BX3A 2SGQE 3UQOA 1Z6JH 4HFPB 4IMZA 2EI6A 4A1VA 3CP7A 1ABJH 1X7AC 1XXDA 1P04A 2XNIA 3E1XB 1GHVH 1E38B 2FI5E 1SKYE 5FBEA 3SW2B 1MCVA 1CA8B 5ETXA 4OS7A 1FZZA 1P2IA 2CF9H 4D9RA 3A87A 1QIXB 2Q6GA 2TBSA 2QYIA 2KFWA 3T2NA 2BY7X 1TQ7B 3KYGA 1HAHH 4B76A 3CNRA 4BANB 5GJ4B 1UTPA 3EA9A 2DE9A 3GDUA 1DM4B 4BNRA 5EQRA 1QQUA 1SOTA 1W3CA 2JH5D 2BY9X 2KAIB 1ZYOA 2BZ6H 1ZZZA 1C4Y2 1TMUH 2IN2A 3U8OH 1MTNB 4HGCA 2OC8A 4FUBA 1HV7A 1GHAF 4FUEA 3SN8A 4FUHA 3RXDA 3SV8A 3OX7U 7ESTE 1KMHB 1HAVB 1TE0A 1AFQB 1PPZA 5LH8A 3PWCA 3WWFA 4CRAA 1SGCA 2PUQH 4UDWH 1GVZA 1O3KA 3SZNA 2Z3DA 1QTFA 1O3CA 4O97A 4AFQA 3SV7A 2VVVA 3ODDA 3E6PH 5TCCA 2Z9JA 5HM2A 1ZOMA 2GCHG 2Y5HA 1C5NH 2FYQA 1O5DH 2FM2A 4YLQH 3DSPA 1C1UH 1MAXA 4MPUA 3SYJA 4NZQA 1BT7A 1MABB 5C1UA 3P92A 1YF4A 1PQAA 1GMHG 1C2MA 5FL7D 3BTWE 6ESTA 3FP8E 4GCHG 2SNVA 1LHFH 1N6XA 1HAXB 4Y8YA 3WY8A 3RLYH 2KM0A 1OS8A 3SBKA 5GXPA 3JZ2B 1EX3A 3GICB 5FCKA 8GCHG 3RU4D 1QL9A 2ZECA 1GDNA 1A0LA 1YPHE 2J9NA 1P05A 4IGDA 5GCHF 3NRLA 2WYJA 5JBCS 1OKXA 4Y11E 4X8TH 1CBWB 1HFDA 1W2KH 4WH6A 2CF8H 2VIDA 4TT3D 5E0GA 3KQ5A 4CBOA 1SGFA 2FOHA 1HDTH 5FBIA 3A7ZA 5A8ZA 1C1QA 5T1VA 4IW4E 3M7UA 4I8HA 2BHGA 4MDSA 3G01A 3GY3A 4JYTA 1O3JA 1OP2A 1J17T 2HGTH 1H8IH 3RXQA 3SUEA 4FUIA 1TMTH 4Y0ZE 1NFUA 4A7IB 1SFIA 1NRPH 2H9TH 2CHAB 1SBWA 3A8DA 4FUJA 4Z6AH 4NZLA 1O2LA 2G55A 3MO6A 2QXGA 1MCTA 1FY4A 4INHA 3TGIE 1K1NA 2WPMS 3GCHC 2VIQA 2BMGB 1K1IA 1DUAA 2WPLS 2JJ1D 3VGCC 1P10A 1OSSA 3Q3XA 3SQEE 1Y3YA 1GI0A 1WUNH 3M5LA 2WSSD 4YO9A 3QWCH 4XE4A 1MU6B 3SO3A 2ZNKH 4BAOB 4FU9A 1SC8U 1AQ7A 1QRWA 3ZVAA 3HGNA 3LGYA 3QTVH 3LONA 1O2MA 2OBOA 2ZKSA 2W6ID 3LU9B 2VWNA 4ZH8A 2ZIQH 4YT6H 4DURA 8GCHF 2ZGJA 1SLUB 3N7EA 2NWNA 1UJ1A 3STJA 3FO8D 3RXEA 1C5UA 2R3YA 3LGWA 1TB6H 1VITG 2WZQA 5JDUB 4INLA 5DP4A 1S6FA 1XUKA 2J95A 5DP7A 3ZZ4A 1P2QA 1K22H 2BDAA 3SV6A 1TRMA 1O3EA 3RU4T 1K1JA 1UCYH 1OX1A 3S9BA 2RFKC 3BG4C 1GI5A 1LDTT 1SGEE 3NWUA 1EAUA 5C1YA 3ZYDA 4B75A 3B8JA 2ZDVH 2FWWA 2AYWA 4IBLH 3H09A 1GG6C 1DLKB 3ZV8A 2A4GA 1C5QA 1UTOA 3CENA 3K2UA 3K6YA 3GYMA 2R2WU 3GY4A 3HK3B 3VEQB 3DCLA 3RC6A 2QF0A 2GZ9A 2NU3E 1LMWB 3MNXA 1ESBA 1F92A 2BY6X 1HIAB 1KYNA 2WINI 3IITA 2SFAA 3UUZA 1P01A 4CH8B 4KTSA 2XC4A 2FPZA 1GBBA 2RDLA 2BZAA 1P09A 3D23A 4Z0KA 3RXOA 1TOCB 3LT3A 2PSXA 3QK1A 3F9HA 5H4IB 1O3DA 4O3TA 3BEUA 4YM9A 5DK1A 5G4BA 1ORFA 4O3UA 4OGYA 1O0DH 1O35A 2ZCHP 1AWFH 5IDKA 1HAIH 3KF2A 5C5NA 3F0PA 4D8NA 4GUXA 1WU1A 3P17H 2GT7A 3ATMA 1F7ZA 3EAJA 4GHTA 4J2YB 1BMLA 2A2QH 1PQ7A 1S0RA 3PMJA 1J9CH 2V0BA 3M7TA 1PPHE 3TGKE 8ESTE 1KTSB 3E0NB 1BHXB 1A2CH 1LVYA 1YPHC 4A5TS 1TPSA 1TX8A 5AVDA 2BY8X 3A8BA 1O5GH 3RMNH 1GJ8B 2ZGBH 3QUMP 3ZVGA 2HPPH 4K1TA 1P02A 1AUTC 1A7SA 2OBQA 2FLRH 3T25A 1XVMA 4GPGA 4BAQB 4NIYA 1TYNA 1OP0A 4DY7B 5EW1H 4BTUB 2QY0B 3QO6A 3NK8A 2M2AA 1GMDG 3BG8A 1ESAA 1GJ9B 1DY8A 2A2XH 2G5NA 3GCHB 4GCHF 4Q80A 4MVNA 1NRRH 2WPKS 2L6OA 1GBMA 1TNLA 2J98B 4U01A 5EJLA 4TSFD 4BAMB 1AU8A 1UHBB 2GCTB 3SJOA 3DSGA 3SU3A 1UVUH 4JK6A 5F8TA 2QXJA 3A84A 1ARBA 1H8HD 1PPEE 2SGPE 5I46H 1NU7B 1SPJA 3MU0A 2Z9IA 2C8XB 2QA9E 3RXCA 1GI7B 2P59A 1Q31A 3SHAH 1OXGA 1GJDB 3UB0A 1O3GA 2J4IA 1C2IA 1WTGH 1C4V2 1SR5C 1NFYA 4Q4LA 3F3BA 4H6SB 4ZKRU 2ZCLP 4RI0A 1ZMNA 1KXBA 1HAVA 4ABHA 5J4SA 4JZ1A 1GHAG 1TLDA 2V3OH 4KGAA 4DOQA 1G36A 1BMNH 1EXFA 3SNEA 1P2MA 1NROH 2QF4A 1K1PA 1ZLRA 3U69H 4Q7ZA 1JWTA 3LJJA 4ABIA 2I6QA 1TPOA 2AEIH 5GIBA 2FOBA 3MFJA 1FY5A 3OYPA 3KCGH 1XKBC 2ZDLA 1ZTKA 1CO7E 1SGTA 2QC2A 5KEDA 3PMBB 5C2ZA 1AE5A 1P2NA 3LOXA 4XRNA 3BF6H 1BOQA 1OHHD 3MI4A 3AVZA 3T28A 1DE7H 1SLWB 3BV9B 1C1SA 5AF9H 2GT8A 1E1RD 1A1RA 1TX7A 3QGNB 3FN8A 3AK5A 1J15A 3RXRA 3N7DA 1GG6B 1P2OA 2R0LA 2KCOA 1EZXC 1SMFE 1AD8H 1AFQC 1AVGH 1G3BA 1WXRA 1VCWA 4X1PU 2Y5FA 2ZU1A 3P8GA 1FV9A 3UR6A 1S84A 3ZZCA 2BLWA 2EA3A 2O8LA 2WPJS 3GCNA 2ZFPH 2P3TB 3U9AH 1XUIA 1T7CA 4K2YA 4WVPE 5C0UA 1EB1H 3E90B 2H6MA 5A8XA 3ZVFA 4CH2B 1V2ST 3I77A 1H8ED 1CBWC 1YCPM 1DWEH 1O5BB 1MBMA 1FIWA 3QZRA 3STIA 1WYKA 3KQEA 1GBKA 4KTUA 1MKWH 3AASA 4DT7B 2OP9A 1EZUC 1EPTA 1MTUA 1P11E 2SNWA 1IQHA 1MAYA 4MNYA 4J1YA 1O2NA 1PPGE 2BDBA 3RXPA 5C67A 3QZQA 1G3DA 1AUJA 2GZ8A 2YMSD 2Z9GA 4ISHH 1K21H 1FIZA 2YNBA 4H4FA 4BAHB 3EDXB 2ZU4A 1IQLA 1LCYA 1SI5H 3GISB 3A8AA 2LNCA 1O3OA 3I78A 4NIVA 4DGJA 3W94A 1MU8B 1EZSC 1W8BH 2V6NA 3MNBA 4UD9H 5T3HA 1H9IE 2UWLA 4D76A 1QB9A 4HG6A 5AHGH 4ZCNA 2W6JD 3E8LA 1O31A 4K1SA 3RXTA 1YGCH 1C4U2 1F5KU 2P8OB 7GCHG 3BEIB 3UQVA 2SGAA 1QL8A 1NESE 1TBZH 1PYTD 2Z6BD 4WXVA 1KLJH 3S9CA 5L2YH 4AB9A 1BBRH 2F3CE 1O2VA 1O3LA 5DJ7A 1SSXA 5CHAB 1OWDA 2XYAA 3TJUA 4MLFB 2PW8H 1CHOF 3TH4H 5EXLA 2F9OA 3RMMH 1FXYA 1NRQH 2PKSC 2HVYB 1T4UH 3VB5A 1GI9B 4I86A 1O2KA 2G51A 4ZKOU 2FX6A 2PGQB 1WBGB 3SV2H 3RXBA 1MQ6A 2ILNA 1DLEA 3BTQE 1UTMA 2JH0D 1LQEA 2F91A 1GJ4H 2BOHB 5CHBA 2NU2E 3BTDE 1GJ6A 1W0KD 3OY5U 1BRUP 1Q3XA 2BD4A 3EA7A 4JYVH 1QBNA 2CGAA 1TAWA 3QLPH 1DWBH 1DY9A 1NBME 1T8OA 1TPAE 4DT4A 2BVSH 2ZU5A 3BG4B 3A8CA 1GHYH 1AZZA 1T8NA 5AFZH 2JJ2D 5HM9A 1GHBG 1XVOA 1BZXE 4OM9A 1Y5UT 1O33A 2QAAA 1K1LA 2R9PA 1GMCF 1EASA 3AAVA 1S0QA 2WV5A 3CS0A 5GPIB 3PLBA 1KDQA 3MH5A 1C1PA 3UY9A 4BXWA 1GBHA 3SGAE 4XBCA 2FOMB 2HLCA 1JIMA 2FTMA 1THPB 3LGUA 3U98H 2G5VA 1BA8B 1YPJH 2J5UA 4X2XA 3F1SB 1TBRH 1TX6A 4WJG2 1HUTH 1ANCA 1DANH 2ZHEH 1HNEE 3OTJE 4FETA 5TJXA 5HIYA 1O2WA 3KQCA 2HPQH 2ODPA 3PMHB 3SUDA 4CR5A 1SLVB 3RXLA 3KIDU 1GCTC 3VPKA 1C1NA 1GI6A 1QCPA 1E36B 4A6LA 2F4LA 1WV7H 1LVBA 1RTFB 1YPGH 3ZV9A 2ODYB 5T6DA 1Y8TA 3H7TA 4HZHA 3TGJE 6LPRA 4ISLA 1HBTH 1GBJA 3BEFB 3T5FH 1Y3UA 4YTAA 2VU8E 1DS2E 5DP3A 5BRRE 1DWDH 4CR9A 1A61H 2GV6A 1W0ZU 3L6PA 3URDA 4A1XA 1TALA 1IQIA 2SGDE 1V2OT 3DFLA 3SUFA 2KAIA 3BIUH 3GOVB 1DOJA 1YCPH 1QURH 3S9AA 4ZKNU 6CHAB 1P2JA 2GTBA 4Z1MD 2W3IA 2FP7B 2PFEA 4WY3A 1C5LH 1GL1A 1Z7KA 1J14A 3OY6U 1S81A 1EB2A 2ZQ1A 4KKDA 1K2I1 3SNBA 2WUBA 3C27B 1SGRE 4X8SH 1P8VC 2BVXH 1MMJN 4X6PA 1FI8A 3A86A 1GHXH 5EG4A 4DW2U 8LPRA 5F8XA 5EPYA 4K5ZA 1QQ4A 3LJOA 4E7RG 2P93A 2AS9A 3SNCA 1E37B 3FP6E 1ESTA 1B5GH 1GI4A 3M3SA 3LGIA 2ULLA 3ZZAA 5EIYA 3S69A 4I8GA 3SU5A 1GHWH 1TBQH 2F9PA 1W0JD 2BD7A 3E16B 4YXWD 4CHAC 1BRCE 1V2TT 5E2PA 2PKAA 2RCEA 2BLVA 4TPIZ 2GMTB 1GHZA 3SJ8A 1O5FH 1YPMH 4WMFA 1N1LA 1LVOA 1BHXF 2A4OA 1HLTH 1AY6H 3ESTA 3VB4A 4YOGA 1ELDE 1GCDA 4XFQA 3GY6A 4Y71A 1BRBE 2EI7A 2HWLB 3LPRA 4BXSA 2FS9A 2GKVE 3QN7A 4AC9A 4LXBH 2TPIZ 1C5TA 1GDQA 2UUYA 3RXAA 1XM1A 1D4PB 3A89A 3TNSA 1C5XB 1QL7A 2J38A 3UNRA 1TGTA 2JETB 3GYLB 5HXFA 1C2GA 1PFXC 2VWOA 5DG6A 3E91A 1DUEA 3KL6A 1PYTC 3LC5A 4NIXA 1A46H 3OU0A 1FQ3A 1FLEE 1H8DH 3M7QA 1GI1A 1SFQB 4SGBE 2RA0A 4TY6A 3UOUA 2V3HH 2B8OH 2BTCE 2QXHA 3TH2H 1KXFA 2GCTC 3MH4A 1MD7A 3D62A 5L30H 1RTLA 4DCDA 2QXIA 1MTWA 3FKSD 5C17A 3DFJA 1W7XH 1O3FA 3BTTE 3VXEH 2VH6A 3HKIB 1WTHD 1F5LA 1KXEA 2Z9KA 3PV2A 3VXFH 1O2GH 5FPTA 2P3FH 4NA8A 2BM2A 1DXWA 2ALPA 3BTEE 1GCTB 1O2HA 4NWKA 4NCYA 1JOUB 1KSNA 2YNAA 1INCA 2Q6FA 2WV9A 1LVMA 2Q1JA 1C5RA 1QB1A 1Y59T 4Y0YE 4K3JA 2QCYA 4OS2A 4X1RU 1D6WA 2KX4A 2HOBA 1HYLA 1OWEA 1S6LA 3PLKA 1MUEB 1J8AA 2UWOA 3TLOA 6GCHF 5FCRA 1NBMD 2BD2A 1LKAA 5A0BA 3SU6A 1AWHB 1NPMA 2Y80A 2ALVA 1Z8JB 4D7FA 4X6NA 1G2LA 1WSSH 2FDAA 4X2YA 3IWMA 4ACAA 4AOQA 1TOMH 3ZZ8A 4UFEH 2HNTC 4AN7A 3F6UH 1ZGVA 1BITA 2AMDA 3RXVA 1GGDB 2GCHF 1L2EA 4X1SU 1QBVH 1UCYE 3GCOA 2G52A 1Q2WA 3A82A 4B73A 4FUFA 1BQYA 4UONA 1A3EH 1UO6A 1T31A 1XUGA 1FN6A 2H5DA 2A4RA 3Q76A 2FESH 3MU1A 2Z7FE 3OTPA 2Y81A 4HTCH 4X2VA 4O03A 1D3QB 1VCPA 3BIVH 4NA9H 4ABGA 1G9IE 2XNDD 4UE7H 1MH0A 5JYIA 1ZMLA 2NU1E 3SJ9A 3RXMA 1QJ7B 4ZXYH 2CMYA 1SGQE 4IMQA 1HAGE 4ABBA 1C2EA 1UTLM 1C1OA 3NXPA 1HAYB 2HRVA 1GBFA 1L4ZA 1CGIE 1H1BA 1GI3A 4X6MA 5PTPA 3F2GA 3CS7A 4LOYH 3AW1A 2WPDD 3OAAD 1GJ7B 1DSTA 1UW7A 1FJSA 4TWYA 3RXUA 2JH6D 5JB8S 1ABIH 2BD3A 2O8UA 2H5CA 3ODFA 1DPOA 3D49H 2QN5T 1OWKA 2ZPQA 3PROA 2AIPA 3O8CA 2PUXB 2BXUH 2FOFA 2WV4A 3RXFA 2F43B 2FI4E 1MZAA 5A0CA 1BTUA 3R3GB 4K8BA 4MQAA 4FVDA 4Y6DA 1KTTB 1C2KA 1C2LA 1ETRH 2GMTC 2EI8A 1ARCA 1JBUH 1CE5A 1HJAC 3BTFE 4JK5A 1HJ8A 4ZKSU 1DDJA 1HPGA 1A5HA 1Y5AT 4PROA 3UNQA 2BD9A 1GHBF 1HAOH 4AFSA 2R3UA 3F9FA 2HVXA 2Z3CA 2HALA 3FFGA 4FUGA 4CRDA 5DP6A 1C1TA 1ELEE 3MNCA 5C3NA 5DP5A 1UCYK 1C5YB 1V2JT 2XBYA 1HAZB 3MO9A 3PB1E 4YLUA 1BDAA 1ZR0A 2W3KA 3PTNA 2BXTH 3PMAB 4JZEH 2AGEX 1LQDB 2ZHFH 4ZHLU 1NTPA 1Z8GA 1F0UA 1UVTH 2ZFTA 3SNDA 1GPZA 2Y6TA 3M3TA 3GY7A 3FOAA 3NKKA 1AKSB 3PRBA 4AGJA 3M35A 4IC5A 1IQKA 2ZHDA 3RLWH 1SQTA 1RRKA 1G2MA 5HGGA 2ZO3H 2VIOA 5HKKD 1IQEA 5L6NH 2ZDAH 1E79D 3SQHE 3OEHD 4CBNA 2ZGXH 1LPZB 4MNVA 5ESTE 3UWJH 1EJMA 1XMNB 2WPIS 2K8IA 3MQKC 2VVCA 4Q7YA 5DP9A 1A0HB 2J92A 2OUAA 1THSH 3KHVA 1D6RA 3S0NA 2M5TA 4ISOA 4M9FA 4GHQA 1N8OC 5I25A 1RFNA 2ZA5A 1BTYA 1C9PA 1NFXA 2OINA 2VVUA 3V7TA 3U1JB 2R0KA 1K1MA 1S83A 2ZTYA 1XX9A 3NCLA 1QBOA 3T29A 1OP8A 2FTLE 3RXKA 2OQ5A 5LGOA 2RG3A 4MTBA 3VB7A 5HYOA 5K7RA 4IS5A 3TJNA 1N6YA 3OE7D 3A88A 1EP6A 3TK5A 3UWIA 5C20A 1EJAA 2ANMH 1P9SA 4ISNA 1EAXA 1BMAA 2DUCA 3BTGE 2SGFE 2B0FA 1SHYA 1TRYA 5B6LA 2ZZUH 5CE1A 1UVPA 2FI3E 3A80A 3RM2H 2AIQA 1FDPA 1EAIA 3LGTA 3ZZBA 1YY3A 3VG8A 3H5CB 3SU0A 1P03A 1XXFA 3EA8A 1YPKH 1OWIA 1WCZA 1ELBA 3K9XB 3K65B 2ZGCA 1MKWK 1IHSH 1UK3A 2FMJA 3A81A 4P02A 4IC6A 2AHME 5EXNA 2A7JA 1S82A 1TONA 3P8NA 3M5NA 1L1NA 4MPVA 1RGQA 5GNDA 3SI3H 3ZVDA 2TGDA 4NFFA 1UHBA 4JZDH 1Z8RA 5EODA 2BQ7B 2ZU3A 4RSPA 5T6GA 1O37A 5EQSA 5HIZA 3P6ZB 4I32A 3ZZ6A 1A4WH 1BTZA 1CA0C 2EY4C 1UTJA 4Y7BA 3SGQE 1GMDF 1ZJKA 3B23B 1O5AB 5EOKA 1WQVH 2XC0A 1GBEA 1O2RA 2O8WA 4P00A 4AG2A 5E8EH 2FS8A 5KGOA 3T27A 3JZ1B 1YC0A 1HCGA 4GVUA 4WWYA 2FEQH 1C5WB 1SGPE 2C8WB 2VWMA 1G3EA 3TH3H 1C1WH 1ANEA 1NRNH 2BD8A 4RN6A 3A85A 3GY5A 1MTVA 3BTME 4I8LA 2BQ6B 2G81E 1DXPA 2ZDNA 1CSOE 2PV9B 4X1QU 4B74A 3MU8A 1TABE 2VH0A 1C5SA 1F2SE 3T62A 1HJAB 3E3TA 5CDFE 1XUHA 3GS9A 2FODA 4F48B 1HXFH 1OOKB 4OGXA 1ZHRA 1FN8A 3KGPA 4XOJA 5FX5A 1O3BA 3RXIA 3UR9A 1SOZA 3U8RH 2A5KA 3QTOH 4FU8A 1SGIB 5EJZA 1ZHMA 3V3MA 2ZDKA 4D9QA 1BTPA 1P2KA 3LDXH 3HPTB 2NU4E 4FU7A 2W5EA 3F9EA 3PO1B 4CREA 1O2SA 3RXGA 4AG1A 2KCAA 2FLBH 3KYFA 2OC1A 1EPTC 4B71A 1VJAU 5DKMA 3TVJB 1SHHB 4NGAH 1O39A 5J4QA 5JPMH 4Y10E 1TA6A 2PWXA 5DP8A 1EOJA 1JIRA 4LK4A 2W7SA 5DN6D 3FP7E 2AERH 5T6FA 1TPPA 2JETC 4NWLA 1BJUA 4UEHH 1FAKH 3EQ0H 3FZDA 3A83A 1VCQA 3DUXH 2H1UA 3Q00A 4MNWA 4XBDA 2AMPA 1QA7A 3ELAH 3M5MA 1KDQB 2EQNA 4AB8A 2QF5A 2JDID 3UNSA 3RDZA 3C1KA 1P9UA 5FXLA 1B0EA 3ZZ3A 1V2VT 2O8TA 4FUDA 2VINA 2GDEH 2G00A 1LKBA 1SGFG 1CVWH 3SHCH 1SQAA 1TGNA 2FOEA 4NIWA 1KLIH 3SJKA 1RTKA 4ABJA 1A3BH 5AFYH 2PR3A 1AVWA 1LHCH 1VR1H 2QIQA 2C3SA 4ZHAA 3RP2A 1CU1A 1D9IA 2Z9LA 5ESBA 2A7HA 4X8VH 2I6SA 2H9HA 2FXRA 2XCFA 1FPCH 1HB0B 4Y79A 3E0PB 1N8OB 1PPCE 5LPFA 3LH1A 2G4UA 5JB9S 4RT0A 3DD2H 5FAHA 3W1EA 1AGJA 4ZMAH 3FVFB 3HGPA 4TPYA 1ID5H 3O8BA 1COWD 4OS5A 3SOSA 4NSVA 3ZYEA 4I31A 3MWIU 5BPEA 4Y76A 1SGDE 4SGAE 4BTIB 2CV3A 2UUKB 4K69A 3AAUA 1YLCA 2XWBI 2ZPRA 3RU4E 3LKWA 2D2DA 3NPSA 3IG6B 2BOKA 1VITH 4B6EA 5C0TA 2FO9A 2C93B 1TRNA 2BQWB 1SQOA 4E7NA 3LIWA 4CRFA 1BCUH 1L1GA 1ZPZA 3ITIA 3S7KB 1SGNE 5GDSH 2C8YB 5JBTA 1CGJE 1UTQA 2HNTF 2BYAX 2VB0A 9LPRA 1GWAA 5DPAA 2V3MA 1O2QA 1ZGIA 1TNGA 1BIOA 1T8MA 5E0HA 3HKJB 3N99A 3Q3YA 1BB0B 1BTXA 1BTWA 2KZ4A 1K1OA 1RD3B 2A1DB 1MQ5A 2BVRH 4U32A 1ZRKA 1HRTH 2LP6A 4LZ1H 3EGKH 2D1JA 1MBQA 2OCVB 4Q7XA 4DG4A 3ATKA 2PTCE 1EOLA 3M36A 1VZQH 1NT1A 1TGCA 1GDUA 2UUFB 4JZFH 2ZDMA 1P06A 1BRAA 4RKOB
chains in the Genus database with same CATH topology
5EQSA 1NBME 1DY9A 1S6LA 5FL7D 4I32A 2M2AA 1NBMD 2XOKD 2V7QD 4Q63A 5F53A 5EPYA 3SU6A 1DY8A 5DSFA 4DT4A 2IJOB 5EQQA 3SV6A 5IK2D 2KM0A 1FX0B 1CU1A 2JJ2D 2L6OA 2O8MA 5ESBA 5C0UA 2F9UA 3E90B 2F9VA 2OC7A 3WW7A 2HLDD 3SU5A 4OM9A 2XCFA 5FPYA 2GGVB 4JMYA 3KNXA 5EPNA 1H8ED 4U01A 4A1VA 4B73A 1BMFD 2YOLA 1W0JD 4TSFD 2XNIA 3NRLA 4B75A 4YXWD 3OFND 3PRDA 3SU3A 1SKYE 3FOAA 4WH6A 1DXPA 3H09A 5GPIB 3SUGA 3W1EA 5ETXA 3PRBA 4ASUD 1H8HD 3SZEA 2QV1A 4B74A 2A4GA 3O8BA 4TT3D 4I33A 1COWD 2FOMB 2A4RA 2YMSB 5HKKD 4I31A 3DCLA 3RC6A 2QE7D 3OTPA 3KEEA 1N1LA 4A92A 2KFWA 1JXPA 1E79D 5CDFE 2J5UA 3GS9A 3OEHD 5T1VA 2P59A 2XNDD 4B76A 2YMSD 2K8IA 3UB0A 5GJ4B 3LKWA 2LELA 4KTCA 4FETA 4Q4LA 3SUEA 3F3BA 5EQRA 4RI0A 4A1TA 3OEED 4B6EA 5C0TA 1W3CA 3SUDA 4M9FA 3SV9A 2QF4A 2IJD1 3U1IB 2A4QA 2K0QA 2OINA 3F2GA 2F4LA 3F2HA 3U1JB 1NS3A 2WPDD 2KCYA 1E1QD 3OAAD 2KCAA 4XD7D 3SU1A 4ZCNA 5H4IB 2W6JD 2OC8A 3WWBA 3ZIAD 2OC1A 4TYDA 2OK5A 2JIZD 4B71A 2YMSC 2XCNA 3KN2A 1EFRD 5FPSA 3SV8A 1KMHB 2JJ1D 2OC0A 3N99A 3OE7D 3OYPA 2VBCA 5IDKA 3DSOA 3O8DA 3RC4A 2CK3D 3KF2A 5DN6D 3F0PA 2KZ4A 3L6PA 2WSSD 3M5LA 3WWFA 4WF8A 3SU4A 3LOXA 3F2FA 4NWLA 1OHHD 1RTLA 4A1XA 5B6LA 3FKSD 5C17A 3O8CA 2GVFA 3SV7A 3SUFA 2WHXA 2K1QA 3PV5A 4F55A 2F43B 3VG8A 3EYDA 4WH8A 1E1RD 3M5MA 3PV2A 3SU0A 1A1RA 3LONA 3P8OA 2OBOA 2QF5A 2JDID 5FPTA 2FM2A 2W6ID 3FN8A 3DSPA 1DXWA 4Z1MD 3AK5A 3SYJA 3SU2A 4K8BA 2KR7A 2FP7B 3N7EA 4NWKA 5CHBA 2AHME 3N7DA 3O8RA 3FO8D 1W0KD 2WV9A 2KCPA 1MABB 3M5NA 2KCOA 3P8NA 1BT7A 1RGQA 3M5OA 5GNDA 4B6FA 2WZQA 3RC5A 1WXRA 4R8TB 3F0OA 2OBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q63 A; 
#chains in the Genus database with same CATH topology
 4RKJ B;  2ANW A;  1IQN A;  3TIU A;  3MU5 A;  2C90 B;  2FOA A;  1HJ9 A;  4ABF A;  2STB E;  2W7U A;  1OYQ A;  4AYY B;  1YKT A;  3FZZ A;  3KQB A;  1TA2 A;  3F68 H;  3URC A;  2PKS B;  2J94 A;  5EQQ A;  4VGC C;  4MPW A;  3UIR A;  3H7O A;  2F9U A;  1AHT H;  2TRM A;  1EP5 A;  2AMQ A;  3P95 A;  4BTT B;  4NA7 A;  4BOH A;  1SGY E;  4AX9 H;  1TNK A;  2C4F H;  1GI2 A;  4ISI H;  3TJO A;  1DVA H;  1C1R A;  3DHK H;  3OFN D;  2ZCK P;  2UWP A;  2XBX A;  3AW0 A;  2CHA C;  1PPF E;  3A7T A;  2P94 A;  3V12 A;  4Y8Z A;  2DE8 A;  1SVP A;  1TNI A;  1UMA H;  4D7G A;  1UVS H;  1F5R A;  1NC6 A;  1V2L T;  3KEE A;  4E06 H;  1JXP A;  4MG3 A;  2XWA A;  4X2W A;  5F03 A;  2BLO A;  3U8T H;  3VGC B;  3HK6 B;  1ZPB A;  4WME A;  3QDZ B;  2LEL A;  3MU4 A;  1O2T A;  4X8U H;  1FUJ A;  2GZ7 A;  2ZWL H;  4A1T A;  1YBW A;  1GJC B;  1V2M T;  1O5C B;  1QA0 A;  1P12 E;  1BUI A;  4QT8 C;  2PLX A;  5GCH G;  1AMH A;  1DFP A;  2K0Q A;  1O3M A;  1ZPC A;  3MH6 A;  3SU1 A;  1KY9 A;  3ZIA D;  1CT2 E;  1O3P B;  1WDI A;  2CN0 H;  2OK5 A;  1IQF A;  1FY3 A;  2IPQ X;  3KN2 A;  3SI4 H;  2ZC9 H;  4JCN A;  5FPS A;  1AI8 H;  1A0J A;  2OC0 A;  1NFW A;  1QJ6 B;  1PPB H;  3DSO A;  5FX6 A;  3D65 E;  3TJV A;  3ATW A;  1E35 B;  5A8Y A;  3NUM A;  4X0W U;  2AFQ B;  3MNS A;  1A5G H;  1QFK H;  4Y8X A;  1ZMJ A;  1AO5 A;  1C5V A;  2A7C A;  3PV5 A;  3EYD A;  3TNT A;  2Q6D A;  3PWB A;  3M37 A;  1G37 A;  3P8O A;  5ABW A;  4JZI A;  3PTB A;  4I7Y H;  1K28 D;  3QGJ A;  5EGM A;  2ZGH A;  1D3P B;  2AGI X;  1LHG H;  1TMB H;  3K6Z A;  2TGA A;  1AKS A;  1VIT F;  5F6M A;  1Y3V A;  2IPH A;  3RMO H;  4K60 A;  1CT4 E;  3RXS A;  1GJA B;  5KEC A;  9EST A;  1Z1J A;  4OS1 A;  1FAX A;  1SL3 A;  2BD5 A;  2XOK D;  2V7Q D;  1RXP A;  5F53 A;  1Z6E A;  3ZVB A;  3SNA A;  3MTY A;  2P16 A;  3URE A;  3MOC A;  2VGC C;  1C9T A;  4ZUH A;  3GDS A;  2VIV A;  1VGC B;  2ZFQ H;  1O3A A;  1NO9 H;  1S85 A;  4U2W A;  2G8T A;  3L33 A;  2A5I A;  4O9V A;  1LPK B;  1V2Q T;  5DO4 H;  3BSQ A;  5EPN A;  2AGG X;  2YOL A;  4KEL A;  3RUO A;  3PRD A;  2OXS A;  3UAI C;  1LPG B;  3MO3 A;  1K9O E;  2IOT A;  1O38 A;  3SZE A;  3DT0 H;  1FPH H;  1OWH A;  2ZHQ H;  4I33 A;  1QHR B;  1W11 U;  4K1E A;  4U30 A;  5CHA C;  5A2M H;  1ELF A;  4A92 A;  1C5P A;  1OWJ A;  2QE7 D;  1FY8 E;  1GL0 E;  1ELG A;  1O3N A;  3T26 A;  5LPR A;  2HNT E;  2FZZ A;  1ANB A;  1W13 U;  3RXJ A;  3V13 A;  3LGV A;  1T32 A;  2FIR H;  5C1X A;  3TU7 H;  4KTC A;  4B1T A;  5C5O A;  2STA E;  4ZRO A;  1TNH A;  2ZEB A;  3HAT H;  3PO1 C;  1TNJ A;  3GCT G;  1SLX B;  1DWC H;  1UK4 A;  1YWU A;  4ZHM U;  1YLD A;  4IN2 A;  3V0X A;  4IN1 A;  3I29 A;  1EQ9 A;  1NS3 A;  3PYH A;  3PV4 A;  1C1M A;  2JIZ D;  1AB9 C;  6GCH G;  4CRB A;  1V2U T;  4FUC A;  4KP0 A;  5K0H A;  5CMX H;  3M61 U;  1DIT H;  2F9B H;  1QZ8 A;  1V2W T;  1V2K T;  3RC4 A;  3KQD A;  1QRZ A;  1IQG A;  1BMM H;  1DX5 M;  4YT7 H;  1MKX H;  1GBL A;  5JBA S;  1JMO H;  8KME 2;  3OSY A;  5IYT A;  3ZZ9 A;  4GSO A;  3SJI A;  5L2Z H;  5JBB S;  2BLQ A;  1JRT A;  1TFX A;  2A45 B;  4BAK B;  2AH4 X;  1RIW C;  1IAU A;  2WPH S;  3U28 C;  3O8R A;  3M3V A;  3M5O A;  4B6F A;  3RC5 A;  2PP6 A;  1ZRB A;  4ACB A;  2XW9 A;  3F0O A;  3TPI Z;  4B2B A;  3UOP A;  3MYW A;  4HI3 A;  4JYU H;  4GLY A;  4AGK A;  1V6D A;  3EE0 B;  2VNT A;  1EJN A;  1IHT H;  2F83 A;  2BDY A;  2P8O C;  2WYG A;  4ZAE A;  1GBD A;  1K0H A;  3UTU H;  3W95 A;  1MD8 A;  3MHW U;  1UTK A;  2F9V A;  2L74 A;  4I8J A;  1E34 B;  3RXH A;  1O36 A;  1RJX B;  2OLG A;  1HIA A;  5FPY A;  4JMY A;  3KNX A;  4UFG H;  1O32 A;  1Y3X A;  1DIC A;  5LPE A;  2H2Z A;  3GCT F;  1GBA A;  1TGB A;  2Z3E A;  2ZFF H;  4ASU D;  1J16 A;  4NSY A;  5E2O A;  1W14 U;  1O34 A;  2VIP A;  4F49 A;  1F0R A;  5A09 A;  1LHE H;  1ELV A;  2Y5G A;  2PSY A;  1LTO A;  1AIX H;  2CJI A;  1RS0 A;  1Y3W A;  1C5Z B;  3N7O A;  4OS4 A;  3VFE A;  1EAW A;  1Z8I B;  4INK A;  6CHA C;  1EZQ A;  3PLP A;  1W7G H;  4XDE A;  2GP9 B;  2PHB A;  2VGC B;  1T8L A;  3ZZD A;  1C2J A;  1G30 B;  1VGC C;  1O2Y A;  1M9U A;  1O2O A;  1WOF A;  1Z71 A;  2ZF0 H;  2OTV A;  1F0S A;  2Y7X A;  3MH7 A;  5A0A E;  3F2H A;  2ANK H;  1DT2 A;  1E1Q D;  1HXE H;  2PGB B;  1FY1 A;  4X1N U;  2ANY A;  3EE7 A;  1O2Z A;  3B9F H;  4CRG A;  1XUJ A;  2VJ1 A;  2YMS C;  4AYV B;  2XCN A;  1EFR D;  5HMA A;  1O2I A;  1O2J A;  3GDV A;  1JRS A;  5EU8 A;  2VBC A;  1AFE H;  1QRX A;  4AZ2 B;  4TY7 A;  4LZ4 B;  1YYY 1;  4DJZ B;  1TWX B;  1SG8 B;  1ZTJ A;  3BTH E;  2ZPS A;  3GY8 A;  1C2H A;  1GBC A;  1LHD H;  2CXV A;  1KIG H;  1CQQ A;  1NY2 2;  2RDE A;  2BDG A;  3MMG A;  4ZXX H;  1O2U A;  2ZFS A;  4AFZ A;  1QB6 A;  2KR7 A;  2FOC A;  4YOI A;  1ZSK A;  5C94 A;  4TWW A;  4DVA U;  1S6H A;  7LPR A;  4K8Y A;  2H9E H;  4DII H;  1AZ8 A;  2QGR A;  1D3D B;  3ZVC A;  2ASU B;  1GJ5 H;  1YCP K;  4YOJ A;  3R0F A;  2ZHW H;  1AB9 B;  4Q63 A;  2ZTZ A;  1O5E H;  2BDC A;  1OYT H;  3Q77 A;  1HGT H;  2ZU2 A;  3PM3 A;  2FX4 A;  2ZFR H;  4WXI A;  2O8M A;  1NN6 A;  1GI8 B;  4Q2K A;  3FAO A;  1P3E A;  3SOR A;  1QJ1 B;  2NU0 E;  2ZQ2 A;  1F0T A;  5EJ1 A;  1EKB B;  1BMF D;  1V2R T;  2EST E;  1XKA C;  1B0F A;  3SGB E;  1EUF A;  2A0Q B;  1TIO A;  1PQ8 A;  1VKY A;  2SGE E;  1GVL A;  3LH3 A;  3GY2 A;  2QV1 A;  1GBT A;  1YPE H;  7GCH F;  2ZI2 H;  2FOG A;  4VGC B;  2XRC A;  4E05 H;  1FON A;  1P3C A;  5DGJ A;  1ZHP A;  2BDH A;  1C2D A;  2J34 A;  1KXA A;  3RM0 H;  1SQR A;  2TIO A;  1O2X A;  1ZJD A;  1UK2 A;  4MPX A;  2BX4 A;  1KXC A;  2EEK A;  3TK6 A;  2J2U A;  1Y5B T;  2Y82 A;  4GAW A;  1L1J A;  1PJP A;  2VWL A;  1G32 B;  4WMD A;  1XUF A;  4UFF H;  1L0Z A;  3ENS B;  1IOE A;  2J98 A;  1RIW B;  2B9L A;  1KLT A;  3U1I B;  2A4Q A;  1PQ5 A;  1V2N T;  3BTK E;  2KCY A;  1WAY B;  4XD7 D;  1ETT H;  1QNJ A;  2BB4 A;  1ZTL A;  1IQJ A;  4R0I A;  1BJV A;  2D8W A;  3A7W A;  1CGH A;  3TIT A;  3QX5 H;  4YZU A;  1ACB E;  1NRS H;  1AND A;  2XBV A;  2A32 A;  2BDI A;  1Z1I A;  4WF8 A;  4ABE A;  3F2F A;  1ELC A;  1BTH H;  4UFD H;  2GVF A;  2K1Q A;  2WHX A;  2THF B;  4F55 A;  1THR H;  1NM6 A;  4MNX A;  3ZZ5 A;  4I8K A;  3P70 B;  3FAN A;  2PTN A;  4NFE A;  2W26 A;  1ELA A;  3S7H B;  1HAP H;  1P57 B;  4ABA A;  4XSK U;  1T4V H;  5F8Z A;  4H6T A;  2VIW A;  5B6O A;  1GMH F;  3A7Y A;  1IQM A;  4R8T B;  2J97 A;  1P0S H;  1QGF A;  2GDD A;  2XTT B;  5E0J A;  4THN H;  2B7D H;  2TGT A;  2GV7 A;  2P3U B;  1H9L B;  1W0Y H;  2Y7Z A;  1GGD C;  2BY5 X;  1UVO A;  2G4T A;  2A31 A;  2XXL A;  3RML H;  3A7V A;  1FX0 B;  1CHO G;  1V2P T;  2GX4 A;  3WW7 A;  1C5O H;  2OQU A;  4DIH H;  2GGV B;  4EST E;  1GMC G;  4M7G A;  4YES B;  4CRC A;  4NG9 H;  3UFA A;  5EXM A;  3ZVE A;  3F9G A;  2ZP0 H;  1S5S A;  1MTN C;  1CT0 E;  1SB1 H;  3Q3K A;  4XBB A;  3SUG A;  2GD4 B;  4ABD A;  1W12 U;  4FXG H;  1C1V H;  1MZD A;  1B7X B;  1CA0 B;  1YP9 A;  1ZSL A;  2YMS B;  4X6O A;  1ZSJ A;  1L4D A;  1H4W A;  3VB6 A;  2OD3 B;  1TGS Z;  2WUC A;  1AN1 E;  1C2F A;  2XC5 A;  2R2M B;  3TK9 A;  1NU9 A;  1AVX A;  1BBR E;  1FMG A;  1OPH B;  1G3C A;  3OEE D;  5EW2 H;  5FHT A;  1GBI A;  3NZI A;  1QY6 A;  3SV9 A;  2IJD 1;  1NZQ H;  1W10 U;  2QF3 A;  3WWB A;  2JKH A;  4TYD A;  1VJ9 U;  1AE8 H;  2V35 A;  2ODQ A;  2P95 A;  1TQ0 B;  3ZZ7 A;  2RA3 A;  2ZG0 H;  1LO6 A;  3O8D A;  1O2P A;  2CK3 D;  2A5A A;  7KME H;  3SU4 A;  1UTN A;  4AOR A;  1O3I A;  1GJB B;  2C8Z B;  2UUJ B;  1ELT A;  5TCA A;  1A5I A;  3ATI A;  4H42 U;  2O9Q A;  4WH8 A;  1H9H E;  1QR3 E;  1KXD A;  2GJG A;  4B2C A;  1WQS A;  1V3X A;  3P8F A;  5SGA E;  2TGP Z;  3SU2 A;  3LC3 A;  2Z94 A;  1EPT B;  1MTS A;  2KCP A;  5GWZ A;  1GVK B;  2ZTX A;  1YPL H;  4CHA B;  1ETS H;  1O30 A;  2LPR A;  4F4O C;  1CHG A;  1EAT A;  3UPE A;  3BN9 A;  1C5M D;  4B2A A;  1MKX K;  1YM0 A;  3A7X A;  3DA9 B;  1DSU A;  2FYR A;  5DSF A;  4ASH A;  2IJO B;  4OS6 A;  1BBR K;  2B5T B;  4RT1 A;  1O3H A;  1D3T B;  1E0F D;  2D26 C;  1YLN A;  5IK2 D;  2PKA B;  2XBW A;  2F9N A;  3ATL A;  4FOU C;  4AFU A;  3L3T A;  2OC7 A;  1U6Q A;  2HLD D;  4Y7A A;  3VB3 A;  4FVB A;  2EC9 H;  1FNI A;  2BX3 A;  2SGQ E;  3UQO A;  1Z6J H;  4HFP B;  4IMZ A;  2EI6 A;  4A1V A;  3CP7 A;  1ABJ H;  1X7A C;  1XXD A;  1P04 A;  2XNI A;  3E1X B;  1GHV H;  1E38 B;  2FI5 E;  1SKY E;  5FBE A;  3SW2 B;  1MCV A;  1CA8 B;  5ETX A;  4OS7 A;  1FZZ A;  1P2I A;  2CF9 H;  4D9R A;  3A87 A;  1QIX B;  2Q6G A;  2TBS A;  2QYI A;  2KFW A;  3T2N A;  2BY7 X;  1TQ7 B;  3KYG A;  1HAH H;  4B76 A;  3CNR A;  4BAN B;  5GJ4 B;  1UTP A;  3EA9 A;  2DE9 A;  3GDU A;  1DM4 B;  4BNR A;  5EQR A;  1QQU A;  1SOT A;  1W3C A;  2JH5 D;  2BY9 X;  2KAI B;  1ZYO A;  2BZ6 H;  1ZZZ A;  1C4Y 2;  1TMU H;  2IN2 A;  3U8O H;  1MTN B;  4HGC A;  2OC8 A;  4FUB A;  1HV7 A;  1GHA F;  4FUE A;  3SN8 A;  4FUH A;  3RXD A;  3SV8 A;  3OX7 U;  7EST E;  1KMH B;  1HAV B;  1TE0 A;  1AFQ B;  1PPZ A;  5LH8 A;  3PWC A;  3WWF A;  4CRA A;  1SGC A;  2PUQ H;  4UDW H;  1GVZ A;  1O3K A;  3SZN A;  2Z3D A;  1QTF A;  1O3C A;  4O97 A;  4AFQ A;  3SV7 A;  2VVV A;  3ODD A;  3E6P H;  5TCC A;  2Z9J A;  5HM2 A;  1ZOM A;  2GCH G;  2Y5H A;  1C5N H;  2FYQ A;  1O5D H;  2FM2 A;  4YLQ H;  3DSP A;  1C1U H;  1MAX A;  4MPU A;  3SYJ A;  4NZQ A;  1BT7 A;  1MAB B;  5C1U A;  3P92 A;  1YF4 A;  1PQA A;  1GMH G;  1C2M A;  5FL7 D;  3BTW E;  6EST A;  3FP8 E;  4GCH G;  2SNV A;  1LHF H;  1N6X A;  1HAX B;  4Y8Y A;  3WY8 A;  3RLY H;  2KM0 A;  1OS8 A;  3SBK A;  5GXP A;  3JZ2 B;  1EX3 A;  3GIC B;  5FCK A;  8GCH G;  3RU4 D;  1QL9 A;  2ZEC A;  1GDN A;  1A0L A;  1YPH E;  2J9N A;  1P05 A;  4IGD A;  5GCH F;  3NRL A;  2WYJ A;  5JBC S;  1OKX A;  4Y11 E;  4X8T H;  1CBW B;  1HFD A;  1W2K H;  4WH6 A;  2CF8 H;  2VID A;  4TT3 D;  5E0G A;  3KQ5 A;  4CBO A;  1SGF A;  2FOH A;  1HDT H;  5FBI A;  3A7Z A;  5A8Z A;  1C1Q A;  5T1V A;  4IW4 E;  3M7U A;  4I8H A;  2BHG A;  4MDS A;  3G01 A;  3GY3 A;  4JYT A;  1O3J A;  1OP2 A;  1J17 T;  2HGT H;  1H8I H;  3RXQ A;  3SUE A;  4FUI A;  1TMT H;  4Y0Z E;  1NFU A;  4A7I B;  1SFI A;  1NRP H;  2H9T H;  2CHA B;  1SBW A;  3A8D A;  4FUJ A;  4Z6A H;  4NZL A;  1O2L A;  2G55 A;  3MO6 A;  2QXG A;  1MCT A;  1FY4 A;  4INH A;  3TGI E;  1K1N A;  2WPM S;  3GCH C;  2VIQ A;  2BMG B;  1K1I A;  1DUA A;  2WPL S;  2JJ1 D;  3VGC C;  1P10 A;  1OSS A;  3Q3X A;  3SQE E;  1Y3Y A;  1GI0 A;  1WUN H;  3M5L A;  2WSS D;  4YO9 A;  3QWC H;  4XE4 A;  1MU6 B;  3SO3 A;  2ZNK H;  4BAO B;  4FU9 A;  1SC8 U;  1AQ7 A;  1QRW A;  3ZVA A;  3HGN A;  3LGY A;  3QTV H;  3LON A;  1O2M A;  2OBO A;  2ZKS A;  2W6I D;  3LU9 B;  2VWN A;  4ZH8 A;  2ZIQ H;  4YT6 H;  4DUR A;  8GCH F;  2ZGJ A;  1SLU B;  3N7E A;  2NWN A;  1UJ1 A;  3STJ A;  3FO8 D;  3RXE A;  1C5U A;  2R3Y A;  3LGW A;  1TB6 H;  1VIT G;  2WZQ A;  5JDU B;  4INL A;  5DP4 A;  1S6F A;  1XUK A;  2J95 A;  5DP7 A;  3ZZ4 A;  1P2Q A;  1K22 H;  2BDA A;  3SV6 A;  1TRM A;  1O3E A;  3RU4 T;  1K1J A;  1UCY H;  1OX1 A;  3S9B A;  2RFK C;  3BG4 C;  1GI5 A;  1LDT T;  1SGE E;  3NWU A;  1EAU A;  5C1Y A;  3ZYD A;  4B75 A;  3B8J A;  2ZDV H;  2FWW A;  2AYW A;  4IBL H;  3H09 A;  1GG6 C;  1DLK B;  3ZV8 A;  2A4G A;  1C5Q A;  1UTO A;  3CEN A;  3K2U A;  3K6Y A;  3GYM A;  2R2W U;  3GY4 A;  3HK3 B;  3VEQ B;  3DCL A;  3RC6 A;  2QF0 A;  2GZ9 A;  2NU3 E;  1LMW B;  3MNX A;  1ESB A;  1F92 A;  2BY6 X;  1HIA B;  1KYN A;  2WIN I;  3IIT A;  2SFA A;  3UUZ A;  1P01 A;  4CH8 B;  4KTS A;  2XC4 A;  2FPZ A;  1GBB A;  2RDL A;  2BZA A;  1P09 A;  3D23 A;  4Z0K A;  3RXO A;  1TOC B;  3LT3 A;  2PSX A;  3QK1 A;  3F9H A;  5H4I B;  1O3D A;  4O3T A;  3BEU A;  4YM9 A;  5DK1 A;  5G4B A;  1ORF A;  4O3U A;  4OGY A;  1O0D H;  1O35 A;  2ZCH P;  1AWF H;  5IDK A;  1HAI H;  3KF2 A;  5C5N A;  3F0P A;  4D8N A;  4GUX A;  1WU1 A;  3P17 H;  2GT7 A;  3ATM A;  1F7Z A;  3EAJ A;  4GHT A;  4J2Y B;  1BML A;  2A2Q H;  1PQ7 A;  1S0R A;  3PMJ A;  1J9C H;  2V0B A;  3M7T A;  1PPH E;  3TGK E;  8EST E;  1KTS B;  3E0N B;  1BHX B;  1A2C H;  1LVY A;  1YPH C;  4A5T S;  1TPS A;  1TX8 A;  5AVD A;  2BY8 X;  3A8B A;  1O5G H;  3RMN H;  1GJ8 B;  2ZGB H;  3QUM P;  3ZVG A;  2HPP H;  4K1T A;  1P02 A;  1AUT C;  1A7S A;  2OBQ A;  2FLR H;  3T25 A;  1XVM A;  4GPG A;  4BAQ B;  4NIY A;  1TYN A;  1OP0 A;  4DY7 B;  5EW1 H;  4BTU B;  2QY0 B;  3QO6 A;  3NK8 A;  2M2A A;  1GMD G;  3BG8 A;  1ESA A;  1GJ9 B;  1DY8 A;  2A2X H;  2G5N A;  3GCH B;  4GCH F;  4Q80 A;  4MVN A;  1NRR H;  2WPK S;  2L6O A;  1GBM A;  1TNL A;  2J98 B;  4U01 A;  5EJL A;  4TSF D;  4BAM B;  1AU8 A;  1UHB B;  2GCT B;  3SJO A;  3DSG A;  3SU3 A;  1UVU H;  4JK6 A;  5F8T A;  2QXJ A;  3A84 A;  1ARB A;  1H8H D;  1PPE E;  2SGP E;  5I46 H;  1NU7 B;  1SPJ A;  3MU0 A;  2Z9I A;  2C8X B;  2QA9 E;  3RXC A;  1GI7 B;  2P59 A;  1Q31 A;  3SHA H;  1OXG A;  1GJD B;  3UB0 A;  1O3G A;  2J4I A;  1C2I A;  1WTG H;  1C4V 2;  1SR5 C;  1NFY A;  4Q4L A;  3F3B A;  4H6S B;  4ZKR U;  2ZCL P;  4RI0 A;  1ZMN A;  1KXB A;  1HAV A;  4ABH A;  5J4S A;  4JZ1 A;  1GHA G;  1TLD A;  2V3O H;  4KGA A;  4DOQ A;  1G36 A;  1BMN H;  1EXF A;  3SNE A;  1P2M A;  1NRO H;  2QF4 A;  1K1P A;  1ZLR A;  3U69 H;  4Q7Z A;  1JWT A;  3LJJ A;  4ABI A;  2I6Q A;  1TPO A;  2AEI H;  5GIB A;  2FOB A;  3MFJ A;  1FY5 A;  3OYP A;  3KCG H;  1XKB C;  2ZDL A;  1ZTK A;  1CO7 E;  1SGT A;  2QC2 A;  5KED A;  3PMB B;  5C2Z A;  1AE5 A;  1P2N A;  3LOX A;  4XRN A;  3BF6 H;  1BOQ A;  1OHH D;  3MI4 A;  3AVZ A;  3T28 A;  1DE7 H;  1SLW B;  3BV9 B;  1C1S A;  5AF9 H;  2GT8 A;  1E1R D;  1A1R A;  1TX7 A;  3QGN B;  3FN8 A;  3AK5 A;  1J15 A;  3RXR A;  3N7D A;  1GG6 B;  1P2O A;  2R0L A;  2KCO A;  1EZX C;  1SMF E;  1AD8 H;  1AFQ C;  1AVG H;  1G3B A;  1WXR A;  1VCW A;  4X1P U;  2Y5F A;  2ZU1 A;  3P8G A;  1FV9 A;  3UR6 A;  1S84 A;  3ZZC A;  2BLW A;  2EA3 A;  2O8L A;  2WPJ S;  3GCN A;  2ZFP H;  2P3T B;  3U9A H;  1XUI A;  1T7C A;  4K2Y A;  4WVP E;  5C0U A;  1EB1 H;  3E90 B;  2H6M A;  5A8X A;  3ZVF A;  4CH2 B;  1V2S T;  3I77 A;  1H8E D;  1CBW C;  1YCP M;  1DWE H;  1O5B B;  1MBM A;  1FIW A;  3QZR A;  3STI A;  1WYK A;  3KQE A;  1GBK A;  4KTU A;  1MKW H;  3AAS A;  4DT7 B;  2OP9 A;  1EZU C;  1EPT A;  1MTU A;  1P11 E;  2SNW A;  1IQH A;  1MAY A;  4MNY A;  4J1Y A;  1O2N A;  1PPG E;  2BDB A;  3RXP A;  5C67 A;  3QZQ A;  1G3D A;  1AUJ A;  2GZ8 A;  2YMS D;  2Z9G A;  4ISH H;  1K21 H;  1FIZ A;  2YNB A;  4H4F A;  4BAH B;  3EDX B;  2ZU4 A;  1IQL A;  1LCY A;  1SI5 H;  3GIS B;  3A8A A;  2LNC A;  1O3O A;  3I78 A;  4NIV A;  4DGJ A;  3W94 A;  1MU8 B;  1EZS C;  1W8B H;  2V6N A;  3MNB A;  4UD9 H;  5T3H A;  1H9I E;  2UWL A;  4D76 A;  1QB9 A;  4HG6 A;  5AHG H;  4ZCN A;  2W6J D;  3E8L A;  1O31 A;  4K1S A;  3RXT A;  1YGC H;  1C4U 2;  1F5K U;  2P8O B;  7GCH G;  3BEI B;  3UQV A;  2SGA A;  1QL8 A;  1NES E;  1TBZ H;  1PYT D;  2Z6B D;  4WXV A;  1KLJ H;  3S9C A;  5L2Y H;  4AB9 A;  1BBR H;  2F3C E;  1O2V A;  1O3L A;  5DJ7 A;  1SSX A;  5CHA B;  1OWD A;  2XYA A;  3TJU A;  4MLF B;  2PW8 H;  1CHO F;  3TH4 H;  5EXL A;  2F9O A;  3RMM H;  1FXY A;  1NRQ H;  2PKS C;  2HVY B;  1T4U H;  3VB5 A;  1GI9 B;  4I86 A;  1O2K A;  2G51 A;  4ZKO U;  2FX6 A;  2PGQ B;  1WBG B;  3SV2 H;  3RXB A;  1MQ6 A;  2ILN A;  1DLE A;  3BTQ E;  1UTM A;  2JH0 D;  1LQE A;  2F91 A;  1GJ4 H;  2BOH B;  5CHB A;  2NU2 E;  3BTD E;  1GJ6 A;  1W0K D;  3OY5 U;  1BRU P;  1Q3X A;  2BD4 A;  3EA7 A;  4JYV H;  1QBN A;  2CGA A;  1TAW A;  3QLP H;  1DWB H;  1DY9 A;  1NBM E;  1T8O A;  1TPA E;  4DT4 A;  2BVS H;  2ZU5 A;  3BG4 B;  3A8C A;  1GHY H;  1AZZ A;  1T8N A;  5AFZ H;  2JJ2 D;  5HM9 A;  1GHB G;  1XVO A;  1BZX E;  4OM9 A;  1Y5U T;  1O33 A;  2QAA A;  1K1L A;  2R9P A;  1GMC F;  1EAS A;  3AAV A;  1S0Q A;  2WV5 A;  3CS0 A;  5GPI B;  3PLB A;  1KDQ A;  3MH5 A;  1C1P A;  3UY9 A;  4BXW A;  1GBH A;  3SGA E;  4XBC A;  2FOM B;  2HLC A;  1JIM A;  2FTM A;  1THP B;  3LGU A;  3U98 H;  2G5V A;  1BA8 B;  1YPJ H;  2J5U A;  4X2X A;  3F1S B;  1TBR H;  1TX6 A;  4WJG 2;  1HUT H;  1ANC A;  1DAN H;  2ZHE H;  1HNE E;  3OTJ E;  4FET A;  5TJX A;  5HIY A;  1O2W A;  3KQC A;  2HPQ H;  2ODP A;  3PMH B;  3SUD A;  4CR5 A;  1SLV B;  3RXL A;  3KID U;  1GCT C;  3VPK A;  1C1N A;  1GI6 A;  1QCP A;  1E36 B;  4A6L A;  2F4L A;  1WV7 H;  1LVB A;  1RTF B;  1YPG H;  3ZV9 A;  2ODY B;  5T6D A;  1Y8T A;  3H7T A;  4HZH A;  3TGJ E;  6LPR A;  4ISL A;  1HBT H;  1GBJ A;  3BEF B;  3T5F H;  1Y3U A;  4YTA A;  2VU8 E;  1DS2 E;  5DP3 A;  5BRR E;  1DWD H;  4CR9 A;  1A61 H;  2GV6 A;  1W0Z U;  3L6P A;  3URD A;  4A1X A;  1TAL A;  1IQI A;  2SGD E;  1V2O T;  3DFL A;  3SUF A;  2KAI A;  3BIU H;  3GOV B;  1DOJ A;  1YCP H;  1QUR H;  3S9A A;  4ZKN U;  6CHA B;  1P2J A;  2GTB A;  4Z1M D;  2W3I A;  2FP7 B;  2PFE A;  4WY3 A;  1C5L H;  1GL1 A;  1Z7K A;  1J14 A;  3OY6 U;  1S81 A;  1EB2 A;  2ZQ1 A;  4KKD A;  1K2I 1;  3SNB A;  2WUB A;  3C27 B;  1SGR E;  4X8S H;  1P8V C;  2BVX H;  1MMJ N;  4X6P A;  1FI8 A;  3A86 A;  1GHX H;  5EG4 A;  4DW2 U;  8LPR A;  5F8X A;  5EPY A;  4K5Z A;  1QQ4 A;  3LJO A;  4E7R G;  2P93 A;  2AS9 A;  3SNC A;  1E37 B;  3FP6 E;  1EST A;  1B5G H;  1GI4 A;  3M3S A;  3LGI A;  2ULL A;  3ZZA A;  5EIY A;  3S69 A;  4I8G A;  3SU5 A;  1GHW H;  1TBQ H;  2F9P A;  1W0J D;  2BD7 A;  3E16 B;  4YXW D;  4CHA C;  1BRC E;  1V2T T;  5E2P A;  2PKA A;  2RCE A;  2BLV A;  4TPI Z;  2GMT B;  1GHZ A;  3SJ8 A;  1O5F H;  1YPM H;  4WMF A;  1N1L A;  1LVO A;  1BHX F;  2A4O A;  1HLT H;  1AY6 H;  3EST A;  3VB4 A;  4YOG A;  1ELD E;  1GCD A;  4XFQ A;  3GY6 A;  4Y71 A;  1BRB E;  2EI7 A;  2HWL B;  3LPR A;  4BXS A;  2FS9 A;  2GKV E;  3QN7 A;  4AC9 A;  4LXB H;  2TPI Z;  1C5T A;  1GDQ A;  2UUY A;  3RXA A;  1XM1 A;  1D4P B;  3A89 A;  3TNS A;  1C5X B;  1QL7 A;  2J38 A;  3UNR A;  1TGT A;  2JET B;  3GYL B;  5HXF A;  1C2G A;  1PFX C;  2VWO A;  5DG6 A;  3E91 A;  1DUE A;  3KL6 A;  1PYT C;  3LC5 A;  4NIX A;  1A46 H;  3OU0 A;  1FQ3 A;  1FLE E;  1H8D H;  3M7Q A;  1GI1 A;  1SFQ B;  4SGB E;  2RA0 A;  4TY6 A;  3UOU A;  2V3H H;  2B8O H;  2BTC E;  2QXH A;  3TH2 H;  1KXF A;  2GCT C;  3MH4 A;  1MD7 A;  3D62 A;  5L30 H;  1RTL A;  4DCD A;  2QXI A;  1MTW A;  3FKS D;  5C17 A;  3DFJ A;  1W7X H;  1O3F A;  3BTT E;  3VXE H;  2VH6 A;  3HKI B;  1WTH D;  1F5L A;  1KXE A;  2Z9K A;  3PV2 A;  3VXF H;  1O2G H;  5FPT A;  2P3F H;  4NA8 A;  2BM2 A;  1DXW A;  2ALP A;  3BTE E;  1GCT B;  1O2H A;  4NWK A;  4NCY A;  1JOU B;  1KSN A;  2YNA A;  1INC A;  2Q6F A;  2WV9 A;  1LVM A;  2Q1J A;  1C5R A;  1QB1 A;  1Y59 T;  4Y0Y E;  4K3J A;  2QCY A;  4OS2 A;  4X1R U;  1D6W A;  2KX4 A;  2HOB A;  1HYL A;  1OWE A;  1S6L A;  3PLK A;  1MUE B;  1J8A A;  2UWO A;  3TLO A;  6GCH F;  5FCR A;  1NBM D;  2BD2 A;  1LKA A;  5A0B A;  3SU6 A;  1AWH B;  1NPM A;  2Y80 A;  2ALV A;  1Z8J B;  4D7F A;  4X6N A;  1G2L A;  1WSS H;  2FDA A;  4X2Y A;  3IWM A;  4ACA A;  4AOQ A;  1TOM H;  3ZZ8 A;  4UFE H;  2HNT C;  4AN7 A;  3F6U H;  1ZGV A;  1BIT A;  2AMD A;  3RXV A;  1GGD B;  2GCH F;  1L2E A;  4X1S U;  1QBV H;  1UCY E;  3GCO A;  2G52 A;  1Q2W A;  3A82 A;  4B73 A;  4FUF A;  1BQY A;  4UON A;  1A3E H;  1UO6 A;  1T31 A;  1XUG A;  1FN6 A;  2H5D A;  2A4R A;  3Q76 A;  2FES H;  3MU1 A;  2Z7F E;  3OTP A;  2Y81 A;  4HTC H;  4X2V A;  4O03 A;  1D3Q B;  1VCP A;  3BIV H;  4NA9 H;  4ABG A;  1G9I E;  2XND D;  4UE7 H;  1MH0 A;  5JYI A;  1ZML A;  2NU1 E;  3SJ9 A;  3RXM A;  1QJ7 B;  4ZXY H;  2CMY A;  1SGQ E;  4IMQ A;  1HAG E;  4ABB A;  1C2E A;  1UTL M;  1C1O A;  3NXP A;  1HAY B;  2HRV A;  1GBF A;  1L4Z A;  1CGI E;  1H1B A;  1GI3 A;  4X6M A;  5PTP A;  3F2G A;  3CS7 A;  4LOY H;  3AW1 A;  2WPD D;  3OAA D;  1GJ7 B;  1DST A;  1UW7 A;  1FJS A;  4TWY A;  3RXU A;  2JH6 D;  5JB8 S;  1ABI H;  2BD3 A;  2O8U A;  2H5C A;  3ODF A;  1DPO A;  3D49 H;  2QN5 T;  1OWK A;  2ZPQ A;  3PRO A;  2AIP A;  3O8C A;  2PUX B;  2BXU H;  2FOF A;  2WV4 A;  3RXF A;  2F43 B;  2FI4 E;  1MZA A;  5A0C A;  1BTU A;  3R3G B;  4K8B A;  4MQA A;  4FVD A;  4Y6D A;  1KTT B;  1C2K A;  1C2L A;  1ETR H;  2GMT C;  2EI8 A;  1ARC A;  1JBU H;  1CE5 A;  1HJA C;  3BTF E;  4JK5 A;  1HJ8 A;  4ZKS U;  1DDJ A;  1HPG A;  1A5H A;  1Y5A T;  4PRO A;  3UNQ A;  2BD9 A;  1GHB F;  1HAO H;  4AFS A;  2R3U A;  3F9F A;  2HVX A;  2Z3C A;  2HAL A;  3FFG A;  4FUG A;  4CRD A;  5DP6 A;  1C1T A;  1ELE E;  3MNC A;  5C3N A;  5DP5 A;  1UCY K;  1C5Y B;  1V2J T;  2XBY A;  1HAZ B;  3MO9 A;  3PB1 E;  4YLU A;  1BDA A;  1ZR0 A;  2W3K A;  3PTN A;  2BXT H;  3PMA B;  4JZE H;  2AGE X;  1LQD B;  2ZHF H;  4ZHL U;  1NTP A;  1Z8G A;  1F0U A;  1UVT H;  2ZFT A;  3SND A;  1GPZ A;  2Y6T A;  3M3T A;  3GY7 A;  3FOA A;  3NKK A;  1AKS B;  3PRB A;  4AGJ A;  3M35 A;  4IC5 A;  1IQK A;  2ZHD A;  3RLW H;  1SQT A;  1RRK A;  1G2M A;  5HGG A;  2ZO3 H;  2VIO A;  5HKK D;  1IQE A;  5L6N H;  2ZDA H;  1E79 D;  3SQH E;  3OEH D;  4CBN A;  2ZGX H;  1LPZ B;  4MNV A;  5EST E;  3UWJ H;  1EJM A;  1XMN B;  2WPI S;  2K8I A;  3MQK C;  2VVC A;  4Q7Y A;  5DP9 A;  1A0H B;  2J92 A;  2OUA A;  1THS H;  3KHV A;  1D6R A;  3S0N A;  2M5T A;  4ISO A;  4M9F A;  4GHQ A;  1N8O C;  5I25 A;  1RFN A;  2ZA5 A;  1BTY A;  1C9P A;  1NFX A;  2OIN A;  2VVU A;  3V7T A;  3U1J B;  2R0K A;  1K1M A;  1S83 A;  2ZTY A;  1XX9 A;  3NCL A;  1QBO A;  3T29 A;  1OP8 A;  2FTL E;  3RXK A;  2OQ5 A;  5LGO A;  2RG3 A;  4MTB A;  3VB7 A;  5HYO A;  5K7R A;  4IS5 A;  3TJN A;  1N6Y A;  3OE7 D;  3A88 A;  1EP6 A;  3TK5 A;  3UWI A;  5C20 A;  1EJA A;  2ANM H;  1P9S A;  4ISN A;  1EAX A;  1BMA A;  2DUC A;  3BTG E;  2SGF E;  2B0F A;  1SHY A;  1TRY A;  5B6L A;  2ZZU H;  5CE1 A;  1UVP A;  2FI3 E;  3A80 A;  3RM2 H;  2AIQ A;  1FDP A;  1EAI A;  3LGT A;  3ZZB A;  1YY3 A;  3VG8 A;  3H5C B;  3SU0 A;  1P03 A;  1XXF A;  3EA8 A;  1YPK H;  1OWI A;  1WCZ A;  1ELB A;  3K9X B;  3K65 B;  2ZGC A;  1MKW K;  1IHS H;  1UK3 A;  2FMJ A;  3A81 A;  4P02 A;  4IC6 A;  2AHM E;  5EXN A;  2A7J A;  1S82 A;  1TON A;  3P8N A;  3M5N A;  1L1N A;  4MPV A;  1RGQ A;  5GND A;  3SI3 H;  3ZVD A;  2TGD A;  4NFF A;  1UHB A;  4JZD H;  1Z8R A;  5EOD A;  2BQ7 B;  2ZU3 A;  4RSP A;  5T6G A;  1O37 A;  5EQS A;  5HIZ A;  3P6Z B;  4I32 A;  3ZZ6 A;  1A4W H;  1BTZ A;  1CA0 C;  2EY4 C;  1UTJ A;  4Y7B A;  3SGQ E;  1GMD F;  1ZJK A;  3B23 B;  1O5A B;  5EOK A;  1WQV H;  2XC0 A;  1GBE A;  1O2R A;  2O8W A;  4P00 A;  4AG2 A;  5E8E H;  2FS8 A;  5KGO A;  3T27 A;  3JZ1 B;  1YC0 A;  1HCG A;  4GVU A;  4WWY A;  2FEQ H;  1C5W B;  1SGP E;  2C8W B;  2VWM A;  1G3E A;  3TH3 H;  1C1W H;  1ANE A;  1NRN H;  2BD8 A;  4RN6 A;  3A85 A;  3GY5 A;  1MTV A;  3BTM E;  4I8L A;  2BQ6 B;  2G81 E;  1DXP A;  2ZDN A;  1CSO E;  2PV9 B;  4X1Q U;  4B74 A;  3MU8 A;  1TAB E;  2VH0 A;  1C5S A;  1F2S E;  3T62 A;  1HJA B;  3E3T A;  5CDF E;  1XUH A;  3GS9 A;  2FOD A;  4F48 B;  1HXF H;  1OOK B;  4OGX A;  1ZHR A;  1FN8 A;  3KGP A;  4XOJ A;  5FX5 A;  1O3B A;  3RXI A;  3UR9 A;  1SOZ A;  3U8R H;  2A5K A;  3QTO H;  4FU8 A;  1SGI B;  5EJZ A;  1ZHM A;  3V3M A;  2ZDK A;  4D9Q A;  1BTP A;  1P2K A;  3LDX H;  3HPT B;  2NU4 E;  4FU7 A;  2W5E A;  3F9E A;  3PO1 B;  4CRE A;  1O2S A;  3RXG A;  4AG1 A;  2KCA A;  2FLB H;  3KYF A;  2OC1 A;  1EPT C;  4B71 A;  1VJA U;  5DKM A;  3TVJ B;  1SHH B;  4NGA H;  1O39 A;  5J4Q A;  5JPM H;  4Y10 E;  1TA6 A;  2PWX A;  5DP8 A;  1EOJ A;  1JIR A;  4LK4 A;  2W7S A;  5DN6 D;  3FP7 E;  2AER H;  5T6F A;  1TPP A;  2JET C;  4NWL A;  1BJU A;  4UEH H;  1FAK H;  3EQ0 H;  3FZD A;  3A83 A;  1VCQ A;  3DUX H;  2H1U A;  3Q00 A;  4MNW A;  4XBD A;  2AMP A;  1QA7 A;  3ELA H;  3M5M A;  1KDQ B;  2EQN A;  4AB8 A;  2QF5 A;  2JDI D;  3UNS A;  3RDZ A;  3C1K A;  1P9U A;  5FXL A;  1B0E A;  3ZZ3 A;  1V2V T;  2O8T A;  4FUD A;  2VIN A;  2GDE H;  2G00 A;  1LKB A;  1SGF G;  1CVW H;  3SHC H;  1SQA A;  1TGN A;  2FOE A;  4NIW A;  1KLI H;  3SJK A;  1RTK A;  4ABJ A;  1A3B H;  5AFY H;  2PR3 A;  1AVW A;  1LHC H;  1VR1 H;  2QIQ A;  2C3S A;  4ZHA A;  3RP2 A;  1CU1 A;  1D9I A;  2Z9L A;  5ESB A;  2A7H A;  4X8V H;  2I6S A;  2H9H A;  2FXR A;  2XCF A;  1FPC H;  1HB0 B;  4Y79 A;  3E0P B;  1N8O B;  1PPC E;  5LPF A;  3LH1 A;  2G4U A;  5JB9 S;  4RT0 A;  3DD2 H;  5FAH A;  3W1E A;  1AGJ A;  4ZMA H;  3FVF B;  3HGP A;  4TPY A;  1ID5 H;  3O8B A;  1COW D;  4OS5 A;  3SOS A;  4NSV A;  3ZYE A;  4I31 A;  3MWI U;  5BPE A;  4Y76 A;  1SGD E;  4SGA E;  4BTI B;  2CV3 A;  2UUK B;  4K69 A;  3AAU A;  1YLC A;  2XWB I;  2ZPR A;  3RU4 E;  3LKW A;  2D2D A;  3NPS A;  3IG6 B;  2BOK A;  1VIT H;  4B6E A;  5C0T A;  2FO9 A;  2C93 B;  1TRN A;  2BQW B;  1SQO A;  4E7N A;  3LIW A;  4CRF A;  1BCU H;  1L1G A;  1ZPZ A;  3ITI A;  3S7K B;  1SGN E;  5GDS H;  2C8Y B;  5JBT A;  1CGJ E;  1UTQ A;  2HNT F;  2BYA X;  2VB0 A;  9LPR A;  1GWA A;  5DPA A;  2V3M A;  1O2Q A;  1ZGI A;  1TNG A;  1BIO A;  1T8M A;  5E0H A;  3HKJ B;  3N99 A;  3Q3Y A;  1BB0 B;  1BTX A;  1BTW A;  2KZ4 A;  1K1O A;  1RD3 B;  2A1D B;  1MQ5 A;  2BVR H;  4U32 A;  1ZRK A;  1HRT H;  2LP6 A;  4LZ1 H;  3EGK H;  2D1J A;  1MBQ A;  2OCV B;  4Q7X A;  4DG4 A;  3ATK A;  2PTC E;  1EOL A;  3M36 A;  1VZQ H;  1NT1 A;  1TGC A;  1GDU A;  2UUF B;  4JZF H;  2ZDM A;  1P06 A;  1BRA A;  4RKO B; 
#chains in the Genus database with same CATH homology
 5EQS A;  1NBM E;  1DY9 A;  1S6L A;  5FL7 D;  4I32 A;  2M2A A;  1NBM D;  2XOK D;  2V7Q D;  4Q63 A;  5F53 A;  5EPY A;  3SU6 A;  1DY8 A;  5DSF A;  4DT4 A;  2IJO B;  5EQQ A;  3SV6 A;  5IK2 D;  2KM0 A;  1FX0 B;  1CU1 A;  2JJ2 D;  2L6O A;  2O8M A;  5ESB A;  5C0U A;  2F9U A;  3E90 B;  2F9V A;  2OC7 A;  3WW7 A;  2HLD D;  3SU5 A;  4OM9 A;  2XCF A;  5FPY A;  2GGV B;  4JMY A;  3KNX A;  5EPN A;  1H8E D;  4U01 A;  4A1V A;  4B73 A;  1BMF D;  2YOL A;  1W0J D;  4TSF D;  2XNI A;  3NRL A;  4B75 A;  4YXW D;  3OFN D;  3PRD A;  3SU3 A;  1SKY E;  3FOA A;  4WH6 A;  1DXP A;  3H09 A;  5GPI B;  3SUG A;  3W1E A;  5ETX A;  3PRB A;  4ASU D;  1H8H D;  3SZE A;  2QV1 A;  4B74 A;  2A4G A;  3O8B A;  4TT3 D;  4I33 A;  1COW D;  2FOM B;  2A4R A;  2YMS B;  5HKK D;  4I31 A;  3DCL A;  3RC6 A;  2QE7 D;  3OTP A;  3KEE A;  1N1L A;  4A92 A;  2KFW A;  1JXP A;  1E79 D;  5CDF E;  2J5U A;  3GS9 A;  3OEH D;  5T1V A;  2P59 A;  2XND D;  4B76 A;  2YMS D;  2K8I A;  3UB0 A;  5GJ4 B;  3LKW A;  2LEL A;  4KTC A;  4FET A;  4Q4L A;  3SUE A;  3F3B A;  5EQR A;  4RI0 A;  4A1T A;  3OEE D;  4B6E A;  5C0T A;  1W3C A;  3SUD A;  4M9F A;  3SV9 A;  2QF4 A;  2IJD 1;  3U1I B;  2A4Q A;  2K0Q A;  2OIN A;  3F2G A;  2F4L A;  3F2H A;  3U1J B;  1NS3 A;  2WPD D;  2KCY A;  1E1Q D;  3OAA D;  2KCA A;  4XD7 D;  3SU1 A;  4ZCN A;  5H4I B;  2W6J D;  2OC8 A;  3WWB A;  3ZIA D;  2OC1 A;  4TYD A;  2OK5 A;  2JIZ D;  4B71 A;  2YMS C;  2XCN A;  3KN2 A;  1EFR D;  5FPS A;  3SV8 A;  1KMH B;  2JJ1 D;  2OC0 A;  3N99 A;  3OE7 D;  3OYP A;  2VBC A;  5IDK A;  3DSO A;  3O8D A;  3RC4 A;  2CK3 D;  3KF2 A;  5DN6 D;  3F0P A;  2KZ4 A;  3L6P A;  2WSS D;  3M5L A;  3WWF A;  4WF8 A;  3SU4 A;  3LOX A;  3F2F A;  4NWL A;  1OHH D;  1RTL A;  4A1X A;  5B6L A;  3FKS D;  5C17 A;  3O8C A;  2GVF A;  3SV7 A;  3SUF A;  2WHX A;  2K1Q A;  3PV5 A;  4F55 A;  2F43 B;  3VG8 A;  3EYD A;  4WH8 A;  1E1R D;  3M5M A;  3PV2 A;  3SU0 A;  1A1R A;  3LON A;  3P8O A;  2OBO A;  2QF5 A;  2JDI D;  5FPT A;  2FM2 A;  2W6I D;  3FN8 A;  3DSP A;  1DXW A;  4Z1M D;  3AK5 A;  3SYJ A;  3SU2 A;  4K8B A;  2KR7 A;  2FP7 B;  3N7E A;  4NWK A;  5CHB A;  2AHM E;  3N7D A;  3O8R A;  3FO8 D;  1W0K D;  2WV9 A;  2KCP A;  1MAB B;  3M5N A;  2KCO A;  3P8N A;  1BT7 A;  1RGQ A;  3M5O A;  5GND A;  4B6F A;  2WZQ A;  3RC5 A;  1WXR A;  4R8T B;  3F0O A;  2OBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...