4Q63A

Crystal structure of legionella uncharacterized protein lpg0364
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
b'YFRLKNHGEINASLDNNSIEIVEISSNGAVVVKQKTDIPKEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Lpg0364
molecule tags Unknown function
source organism Legionella pneumophila subsp. pneumophila
publication title Crystal Structure of Legionella Uncharacterized Protein Lpg0364
rcsb
total genus 23
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.430 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4q63A00
4Q63A
chains in the Genus database with same CATH superfamily
1G37A 2WPDD 3PTNA 2AYWA 2PW8H 4YTAA 1ELCA 3GYLB 4FVBA 1CVWH 2KR7A 4A1VA 1PQ7A 3K6YA 8KME2 1A61H 4AFQA 5G4BA 1SGIB 5EQSA 4BAMB 2K8IA 4LZ4B 3A8CA 4U01A 1VGCC 3P8NA 1GI0A 2QXJA 4XD7D 1H9LB 2QCYA 3SUFA 1TIOA 2FS8A 3UUZA 2JH6D 3FVFB 3LOXA 2AGGX 1GMHG 5DK1A 2G00A 2WYJA 4E7NA 2M2AA 2V7QD 2O8LA 1RTFB 2G5VA 2NU0E 4Q80A 1K1OA 5HM9A 1BUIA 1C2LA 1C1OA 1HBTH 3EE7A 3SU5A 1DSUA 2OINA 2SGEE 3RXSA 1CQQA 4FVDA 1JMOH 1N6XA 2STBE 3P8FA 6CHAC 2A4GA 5AF9H 2BD3A 1JOUB 1OYTH 1OS8A 1P9SA 4Y8XA 1KXBA 3ZV9A 3T25A 1O30A 1O2YA 2HWLB 1KMHB 1PYTD 3UOUA 1DE7H 2XCFA 1Y5AT 3P95A 2GVFA 2VGCC 4OS4A 1L2EA 3RC5A 3OX7U 3UREA 5GWZA 1C5LH 3RXHA 1K1JA 3MNXA 1BJVA 3NUMA 5FX5A 2Z6BD 1S6HA 3OY6U 3E0PB 2VIOA 1OP0A 1T8LA 2JH0D 3NWUA 3UB0A 3LH3A 1D3QB 1K1IA 1UJ1A 3MTYA 4LXBH 5AVDA 2WV9A 4XFQA 3LU9B 1ETRH 3RXCA 4DCDA 2AERH 1MTNC 1AZ8A 2WPHS 1FPCH 1QZ8A 1ZHPA 3P17H 1CHOF 1TGNA 1GDUA 3PYHA 2VIWA 1L1NA 3MH5A 1GGDB 4ACAA 1AUTC 4DIIH 5JYIA 3RXBA 2YMSC 4NWLA 2P8OC 2R2MB 2VU8E 3F9EA 4RKJB 5DSFA 8LPRA 3BTKE 3TJVA 4BAQB 4Y7AA 1EAUA 1UTJA 4K69A 2WUBA 2C4FH 1F0RA 3PV2A 3AW0A 2D8WA 3WWFA 2BVXH 2PSYA 1OYQA 1UTKA 1DS2E 2ZDVH 2BDCA 3BEIB 4WMEA 1P2IA 1BJUA 3GY5A 3SOSA 4MNVA 2ZHDA 1FMGA 2ZTZA 3EDXB 2Q6FA 1HUTH 2A2QH 1PQ5A 3SI3H 2THFB 4ABHA 2FOCA 1ZPCA 1TB6H 2BDAA 2W3IA 2CHAB 4GLYA 1B7XB 1TFXA 3SV2H 3ZZ9A 1Y5BT 2QN5T 2VIPA 3F2FA 2FOEA 2ZFTA 5CHAC 3JZ1B 4AB9A 3BTME 1QY6A 1O3LA 3PMAB 1P2MA 2AIPA 1B0FA 2JETC 1Z1JA 4FXGH 5FPTA 2AGIX 3L33A 1O32A 1EPTB 2C8YB 1C1MA 4JZEH 2ZNKH 1GDNA 1YC0A 3A8DA 2NWNA 3ZZ3A 4BXWA 1GBHA 4O03A 1DUAA 1FXYA 3VB6A 3B8JA 4JZ1A 5FXLA 4X6OA 2OQUA 5A0BA 1BMLA 1QIXB 3QN7A 4WY3A 3HK6B 2BX3A 1QQ4A 3RU4D 1C5YB 1SMFE 2BOHB 1O2VA 4UFFH 3PTBA 3QO6A 2BHGA 2BY9X 3V3MA 2VWOA 2ALVA 2R0LA 4Y76A 2CXVA 4X6MA 4TWWA 1UTMA 2WHXA 4YLQH 1CHOG 1GVLA 3SNDA 3LKWA 3RC4A 2AH4X 4YLUA 4SGBE 3Q77A 2Y80A 3PRBA 3SYJA 3ODFA 1BTXA 4JK5A 1FX0B 3CS0A 5EPYA 1EJAA 1Z6EA 1GJAB 4DG4A 1VJ9U 4JMYA 5C5OA 4OGXA 4AB8A 1HCGA 4XSKU 2GCHG 1O2RA 1PPFE 4O97A 1FPHH 1O3KA 2JH5D 2FMJA 3HPTB 2V3OH 1BTHH 1BTUA 3M3VA 3QX5H 2AIQA 1J14A 3TGJE 1GI9B 5T6DA 2P95A 1MD8A 5LGOA 2D2DA 1DITH 1GHXH 1H8ED 3SGAE 3JZ2B 4ABJA 1SGQE 1A4WH 3KYGA 4BANB 3M35A 1CU1A 1HAHH 1FJSA 1O0DH 3LC3A 4A7IB 1S85A 2YOLA 4CHAB 1QR3E 2BY8X 1YYY1 1OXGA 1DFPA 1GG6B 4R0IA 1SGYE 3PROA 4K1TA 4Y10E 1AVGH 1A5HA 3UWIA 2LNCA 1TMBH 1HRTH 1CBWB 2V35A 4YZUA 1KXFA 7KMEH 2JIZD 1J15A 3SJ8A 2BZAA 5EW1H 1MTVA 2YNBA 3PB1E 1O2IA 1VCQA 1MD7A 3SUDA 3KGPA 4DGJA 1E36B 1F0UA 2VIVA 2J5UA 1ABJH 1SOZA 5C1XA 2WPLS 1GMDF 3BEFB 4U2WA 4AG2A 1GHWH 3UY9A 4AX9H 1HNEE 2BLOA 2EY4C 1S6FA 2BLVA 4ZKSU 1O3CA 1SOTA 3M7TA 5LPRA 5BRRE 4Y8ZA 1FAXA 4B6FA 4RI0A 3HKJB 4FUJA 1Q31A 1GBTA 1X7AC 1H1BA 3LGVA 3A80A 2BQ7B 1HAVB 2OP9A 1AI8H 3T62A 2WPJS 4UFDH 2QY0B 4TYDA 3DSGA 3U8RH 4MPXA 1E34B 5EXMA 1D4PB 2Q6DA 3M37A 1W8BH 1O31A 2ZFRH 1ANDA 2FOBA 5IYTA 2FWWA 3TNSA 4AOQA 1P0SH 1Z8JB 4X1PU 2ZGBH 2L6OA 3HK3B 1EUFA 1YPJH 3BG4B 1C5TA 2J95A 2ANMH 5FPSA 1P57B 3E6PH 1WTGH 4NFFA 2ZHWH 2HNTF 1XUFA 2XWBI 4O3UA 1TWXB 1HJAB 3OEED 3HGNA 1C5QA 1TGBA 2PSXA 1QL9A 1V2PT 1ELBA 2CF8H 1BIOA 2O8TA 3QGJA 4CRCA 1GJ7B 1S0QA 1EX3A 1C5VA 1SLWB 4UFEH 5J4SA 1IQFA 4Q7YA 3RMNH 1ELVA 4NZLA 2QF5A 2BMGB 2P8OB 1GI3A 2IJOB 1EASA 1P12E 2GT8A 4AFSA 2KCPA 3ZZ6A 8ESTE 1YPHC 1JRSA 6ESTA 4CRGA 3VFEA 1U6QA 1DLEA 1PPZA 3PLBA 3A87A 2D26C 3MU5A 2XNDD 1OHHD 3RLYH 3MH4A 2C3SA 2CGAA 1IQKA 2HLCA 3A86A 2ZTXA 1V2QT 1MTWA 2QIQA 2XCNA 1C2FA 1AB9B 1K21H 2GTBA 3KL6A 4WF8A 4ABFA 2OC1A 4MNXA 4MTBA 2P16A 1O35A 1RD3B 3D62A 3UWJH 1BRUP 1NZQH 2IOTA 1LKBA 4THNH 2F91A 2KFWA 3V12A 2BY7X 3GDSA 2GMTB 3KYFA 3STIA 1SGEE 2TBSA 1PPEE 2UUYA 1VKYA 3SV7A 1ARCA 4XBBA 3VXFH 3IITA 3KCGH 4K8YA 3OTJE 2WPMS 5FPYA 2G8TA 1EFRD 5E2OA 1RTLA 3RLWH 2ASUB 2Z3DA 1TBQH 4FUIA 4LZ1H 2ZCLP 1C5XB 1ZSJA 4X8VH 1V2LT 2KAIB 2FZZA 1LVBA 4ZAEA 1JWTA 3WWBA 1GHBG 1FUJA 3LGTA 2KX4A 2QF0A 1CGIE 3EA9A 1G2LA 1Y5UT 2FIRH 2J34A 4A1TA 2ZFFH 1JXPA 1P2OA 3MNBA 2HVYB 1CT4E 2C8XB 7GCHF 2BY5X 4X1NU 1NTPA 3CNRA 1LVMA 1PJPA 2XTTB 3SI4H 2H9TH 3SU1A 1SQAA 2R9PA 1MKWH 2A0QB 2HRVA 1O38A 1MTUA 1MQ5A 3DSPA 2YMSB 4KTUA 4ACBA 2UWOA 3OAAD 4INKA 1SHYA 4K60A 4D9QA 1O36A 4NCYA 1J9CH 1ZHMA 4O9VA 4CREA 1XKBC 4U30A 5I25A 2RA3A 1BTPA 4XBCA 4IN1A 1O3AA 1TNJA 2G5NA 3ZVGA 4YT7H 2STAE 1P10A 3MOCA 1Z6JH 1PPGE 4OS7A 5HKKD 5EQQA 2TIOA 1QCPA 1EAXA 3QZRA 4YO9A 5DP7A 5TJXA 1DWCH 2XNIA 1S84A 5EG4A 4KTCA 1O2HA 1AHTH 4IGDA 1XUGA 4A5TS 2J2UA 3F1SB 1FNIA 4GSOA 1ZRBA 4X0WU 3IWMA 3AAVA 3EAJA 5A8ZA 3MMGA 2FOGA 2NU4E 3KN2A 3SZEA 3KIDU 2Y5FA 2XC0A 4H4FA 3EGKH 1BZXE 3SU3A 3EYDA 1J17T 2AFQB 1V2NT 1YPEH 4ASHA 1VCPA 4AZ2B 3FP7E 1IQLA 2WSSD 3A88A 3F2GA 3I78A 4OS6A 1UO6A 2WZQA 5DO4H 1WAYB 2QGRA 4K3JA 3O8BA 1UW7A 3GCNA 3ODDA 3E8LA 1ZMLA 1IHTH 2C8ZB 1LTOA 5GCHG 2TGPZ 2ANKH 1TGSZ 1A46H 2R3UA 5A09A 4FUGA 3U9AH 2EI6A 1HV7A 3N7OA 5JBBS 4P02A 3LPRA 4RT1A 2CF9H 3CP7A 2AGEX 5FX6A 1H4WA 1SVPA 4B2CA 3U28C 2GGVB 4DOQA 1BTYA 3A7TA 1KTTB 3AAUA 4X1QU 3ZZ5A 5JBTA 5LPEA 1V2ST 1V2OT 2OBQA 1GVZA 5AHGH 1DPOA 2JJ2D 1GI6A 3L3TA 2FDAA 4CR5A 5HGGA 3SNCA 4XBDA 1TNGA 3QTOH 3RP2A 4GCHF 1F2SE 1VITG 2A5KA 5T1VA 1E1RD 1QL7A 4Q63A 2G4TA 4RSPA 3MHWU 2ZGXH 5C3NA 1EZXC 1V2JT 2PKSC 1S6LA 1AU8A 2F9NA 1G36A 4XE4A 1W0YH 2ODYB 3MI4A 5ESBA 1V2RT 4B1TA 4B74A 1XKAC 3UIRA 2PGQB 4YOGA 3QLPH 1K9OE 3LGUA 5T6GA 3FN8A 1Z8RA 1O5FH 3TH4H 3VXEH 1Y3UA 2IPQX 2KAIA 2VVVA 4CR9A 1Z8IB 3BV9B 1UTPA 4YM9A 5IK2D 4X2WA 1IOEA 3BN9A 1KIGH 3RUOA 5KECA 1QA0A 3PMJA 1GBIA 2NU1E 1FY3A 3F9GA 1TGTA 5DKMA 2FOAA 1FN6A 3SNBA 1G3BA 2ILNA 2WINI 1UCYK 1ZPBA 2CK3D 3KF2A 3D65E 3NXPA 2O8WA 1GBAA 1C2KA 2ZECA 9ESTA 3STJA 2OUAA 1CA0B 1WQVH 4HG6A 2GCTC 3A8BA 3SHAH 1W0ZU 3SBKA 1O2UA 1IQIA 3F68H 1DDJA 1VZQH 2W6JD 2JETB 3ATMA 3TK6A 4AGJA 1V2WT 1ELTA 1K1LA 3M3TA 1EP5A 5L6NH 2PFEA 2XYAA 1DWBH 2F9OA 2J4IA 4LK4A 3SV9A 1O2PA 3ATIA 3EA8A 3ZZAA 2F3CE 3UPEA 4ABDA 2G55A 4Y71A 2KM0A 1CA8B 1YPHE 4DY7B 3SV8A 4F48B 3BEUA 2H5DA 2OC7A 3GS9A 1YLCA 1GHZA 1EZQA 4BTTB 1BHXB 2B8OH 5DP8A 4YT6H 4Z0KA 2BLWA 5DP5A 2ZKSA 2BDYA 1UHBA 2IJD1 2KCYA 3ZZ4A 4Y7BA 5FHTA 1O2JA 1ZTJA 4Q7ZA 1O3GA 1BA8B 5A8XA 2GX4A 5FBEA 1JIRA 5EGMA 1RJXB 3BTDE 1GVKB 1C2EA 1KXDA 2VH0A 1Y3YA 1LKAA 1TRNA 1OWEA 2F9UA 3ZIAD 2HGTH 4H42U 3RXQA 1GJ6A 2A4QA 4VGCC 3AW1A 1VCWA 2NU3E 1K1MA 7GCHG 2KZ4A 4BOHA 3RXUA 1EAIA 4SGAE 3SGQE 5A0CA 3TLOA 1UTNA 3K65B 3SJIA 3TJOA 3SJOA 2FTLE 4FUFA 2Z94A 1DWDH 3OSYA 4FOUC 1QJ7B 3RXKA 1B5GH 5GXPA 3GCHB 1GJCB 2G51A 3QUMP 1THPB 1HAPH 4AORA 1H8IH 4ZKOU 1V2TT 2ZDNA 1GMHF 4OS1A 3B9FH 4P00A 1TNIA 1D6RA 2HPQH 1QB1A 1D6WA 1O2GH 2HALA 2BYAX 4RN6A 1DM4B 1C5WB 4X2YA 4ISIH 3UNRA 1SGFA 2BX4A 3URCA 2DE8A 4BNRA 1BHXF 1W3CA 2BY6X 3NK8A 1UVPA 2VVCA 4GPGA 1SGFG 1F5KU 4I8JA 3U8OH 2Z9IA 1QTFA 4TPIZ 1QGFA 1DXWA 2R0KA 1CT0E 1ZJKA 1NBMD 1SR5C 4ABAA 1ZZZA 2SGPE 2Z9LA 1NM6A 3PWBA 1LVYA 2J92A 4MQAA 1AZZA 1IQMA 3RDZA 1UK4A 4U32A 3ZZCA 4GVUA 1AE5A 4I8GA 1QJ1B 4NIYA 2QXGA 1WXRA 1A0HB 5DPAA 4ISHH 2V3MA 1Y59T 3NZIA 4NGAH 1AWHB 4O3TA 1YY3A 1C2IA 2GMTC 2FI3E 1KY9A 2J38A 1TBZH 1NU7B 2P3FH 1OP2A 2BB4A 1TOCB 3VGCC 1C2GA 1C1QA 1P3CA 1GBJA 1INCA 1SQTA 3FAOA 1O2SA 4ISLA 3GY3A 3TIUA 4PROA 5C67A 3GY6A 2ZG0H 4HI3A 1BTWA 2BDIA 1TPPA 1C1SA 2ZU3A 2W26A 1DY9A 3FZZA 4YESB 4Z6AH 3ENSB 2HPPH 2UWPA 1DUEA 2A45B 3RXDA 2C90B 2LP6A 3SU2A 1LPZB 3SNAA 1S5SA 3LJOA 2QF3A 4MVNA 2TRMA 1TPOA 3MU4A 1CT2E 4AYVB 1SL3A 1XUHA 3A85A 5EU8A 1ID5H 5L30H 1QRZA 4XDEA 6GCHG 1HDTH 1GBEA 4ZKRU 4ESTE 1FZZA 4JZIA 3FO8D 3CS7A 4FU8A 3DD2H 1YPLH 1T8MA 3PV4A 1QBNA 1ESBA 1TPSA 2LELA 2XOKD 4NA7A 1ZYOA 4BTUB 3LGIA 2B9LA 1CGHA 5TCCA 1IQJA 1W7XH 1O5BB 1TNHA 8GCHG 1WSSH 3N7EA 4MPVA 4D8NA 2EA3A 1P2JA 2SNVA 5SGAE 4B73A 2P93A 1MCTA 1TRYA 2B0FA 3SUGA 2ZF0H 2PTCE 1C5SA 1OWIA 3RXJA 4FUCA 1AN1E 3UTUH 5DN6D 3VB7A 3PO1C 2ODPA 1TX6A 4MNYA 2YNAA 2RCEA 1O2KA 4X1RU 1RS0A 3UQVA 1OOKB 3F6UH 4A1XA 1KLIH 2ZTYA 1HIAA 1O3JA 4FU9A 3M5OA 3TGIE 4UFGH 1HXFH 5HYOA 5EIYA 4X6NA 1NO9H 2W5EA 3PWCA 1UTLM 1XX9A 1D9IA 1GMCG 2BD2A 3RU4T 1O34A 3FFGA 1WU1A 1ANBA 2SGAA 2P94A 1UTOA 1K1NA 1SLVB 1YCPH 3RXEA 1HAVA 1NU9A 1YPKH 2J97A 2BOKA 1ZMNA 4J2YB 2XW9A 2FP7B 1O33A 5C17A 3OEHD 1TX8A 3KQCA 3EE0B 2XC5A 1GHAG 1BCUH 2FLRH 1NRRH 4ABGA 1NRNH 1C1TA 1MBQA 4IMZA 4FUEA 2GCHF 2WUCA 5CMXH 1MKXH 1GI5A 1NN6A 2H6MA 3UQOA 3PMBB 5JB8S 4WH6A 1SGRE 1A2CH 3DCLA 1YPMH 1RXPA 3Q3YA 2HNTE 1C1RA 4CRBA 2HVXA 1F5LA 1T8NA 2CV3A 5HIZA 1AKSB 2JDID 3HATH 4WVPE 1XUJA 1LHCH 3RXFA 2W3KA 2ZDAH 3K9XB 3ZVFA 1ESAA 1HYLA 4ZHLU 1YBWA 5C0UA 2JKHA 5KEDA 1SQRA 3N7DA 1SGNE 1IQGA 2TGTA 1CA0C 3LGWA 1EB2A 3GY8A 1QJ6B 1ZTKA 2A7CA 1UVOA 1YM0A 1P11E 3RM2H 4NSYA 2FESH 3PV5A 4TWYA 1GHVH 3FP6E 1EXFA 4E7RG 2Z7FE 3H7TA 4B71A 1GBDA 3VB3A 3M7UA 1O2ZA 3QK1A 1G3EA 2Z9KA 1QRXA 3BSQA 4HZHA 4DVAU 4HTCH 1T7CA 3UNSA 6CHAB 2RFKC 1EOJA 1GBCA 4Q2KA 4JCNA 5B6OA 2CJIA 1EAWA 1GCDA 3ELAH 3ZV8A 1W0KD 3U8TH 1AD8H 1LHGH 2QF4A 3A7XA 4OM9A 4K2YA 1Z7KA 3FZDA 1ANCA 4HGCA 3SORA 2F4LA 2VWMA 3NKKA 3MU0A 1TGCA 1NFUA 3KQ5A 1P04A 1S81A 2AMQA 5EJLA 3V7TA 4Q7XA 2ZCKP 2ZDKA 1M9UA 2ZO3H 3PMHB 3PLPA 1HB0B 1SQOA 4TY7A 5B6LA 4I8KA 1ZSLA 5PTPA 3ZYEA 5F8TA 1O3OA 4X8TH 9LPRA 2BXUH 1MZDA 3VPKA 3KHVA 1LVOA 1TYNA 4BAOB 3OE7D 2PGBB 1YCPK 4GUXA 3W94A 1PPHE 2FM2A 1RGQA 1F0SA 1MCVA 1AQ7A 6LPRA 2J98B 1F5RA 2PV9B 4WJG2 5CHAB 1C1NA 3GCHC 2BDHA 2A7JA 5FAHA 1OWJA 1P01A 2I6QA 4JZFH 2L74A 2PP6A 1H8DH 1WCZA 4D9RA 2O8MA 1E1QD 1C4V2 1P2KA 4F4OC 3RXPA 3UNQA 4TT3D 1TBRH 1IQHA 1HAYB 1N1LA 1N8OC 3VB5A 1HAXB 1YF4A 1PQ8A 3Q3KA 2H9EH 1T4VH 3P92A 4X8SH 3ZVBA 3LIWA 4FUDA 1DY8A 3NCLA 1JRTA 3RXRA 2VGCB 4KTSA 1FY5A 3N99A 1VITH 3ATWA 2ZU4A 3H7OA 2PKSB 1QNJA 1BBRH 3R0FA 4D7FA 2K0QA 3D23A 4KP0A 1RTKA 1WOFA 1TA2A 5L2YH 5HXFA 1QL8A 4NZQA 1ELFA 2BTCE 1KDQB 1SG8B 4IBLH 1OPHB 4FUHA 2AEIH 4FETA 1THSH 4Q4LA 1HFDA 4F49A 4IS5A 1E38B 1TNLA 3UOPA 2FLBH 4B75A 1TLDA 1BRAA 5DP3A 2A5IA 1Y8TA 1MTSA 1BBRE 1K2I1 3W1EA 3G01A 4INHA 2J9NA 1DX5M 3ZZDA 1DSTA 1GL1A 1NPMA 3BIUH 1AO5A 1T8OA 3T28A 4ZROA 3AVZA 2PTNA 1C5NH 4ZHMU 2BVSH 3FKSD 4XOJA 3SU0A 4AGKA 3QTVH 1MABB 1JIMA 3ZZ7A 5C5NA 1BOQA 1TQ7B 3MO9A 3QDZB 2C93B 4ABIA 3M5LA 2EEKA 3S7KB 4NG9H 1C5RA 5LPFA 2ZPSA 2Z3CA 1VITF 1E35B 1J16A 3SJKA 4H6SB 1RFNA 1CE5A 3GY4A 3MYWA 3TU7H 3VGCB 3ZVAA 2OK5A 1DT2A 4JYVH 1W7GH 1T31A 3B23B 4YXWD 3GCTF 1GG6C 2QXIA 4QT8C 4I31A 2G52A 1C1WH 4AYYB 4UDWH 2OD3B 4OS2A 3F2HA 1MAXA 2J98A 5DGJA 5GIBA 4R8TB 4UE7H 5KGOA 2ZFQH 2FO9A 5ETXA 2BD7A 2TPIZ 4BAKB 4Y0ZE 3DUXH 2BZ6H 1KLJH 3OYPA 1XMNB 1C4U2 1MZAA 2XBWA 4NWKA 5EW2H 1Z71A 1FAKH 1ETTH 1O2XA 4MG3A 2AMDA 3MU1A 1SGTA 1XVOA 2B7DH 2VJ1A 2OQ5A 2F43B 4YOJA 1AKSA 5AFYH 1BT7A 1A7SA 2FX6A 1UMAH 4VGCB 5F53A 4K1EA 3BTHE 2RA0A 5K0HA 4BXSA 1GJ8B 4WMFA 4X6PA 3LJJA 4A6LA 1WBGB 4YOIA 2XC4A 3OY5U 2FOHA 1D3DB 3TJUA 3GDUA 2CHAC 2A4OA 1AGJA 5A2MH 3P6ZB 4WWYA 4AG1A 3ZYDA 4Y79A 1DICA 2FODA 2Y81A 1ABIH 1LO6A 2PUXB 2F9PA 2GZ9A 1IHSH 5TCAA 2BDBA 1B0EA 2ANWA 1G2MA 1UHBB 1GBKA 5F8XA 1KDQA 1Y3XA 2IN2A 4UD9H 2ZEBA 1G3DA 2ESTE 1UCYE 1O2NA 2OCVB 1W2KH 3A7WA 3LONA 2EC9H 1EB1H 3A7VA 2XXLA 1K1PA 5EOKA 4IC5A 1Y3WA 2VWNA 3UFAA 1O2LA 2P3UB 3AASA 1LDTT 1P05A 2A32A 2ZCHP 4KKDA 2SFAA 4OGYA 2M5TA 1OWDA 1UK2A 1JBUH 1WUNH 1EJNA 2SGFE 2WPKS 2SGQE 4ZH8A 2FPZA 5E0GA 5ESTE 5AFZH 1A0JA 2ZHEH 3BTGE 3GISB 2ZI2H 3UAIC 2KCAA 2BD8A 2ZPRA 5E2PA 1A0LA 2GZ7A 1FY4A 2QC2A 1HJ9A 4BTIB 1ZRKA 2PHBA 1LCYA 1FY1A 3GCTG 4MLFB 2AHME 4CRFA 2VWLA 1O3HA 1O3MA 2ZP0H 1TALA 3S9BA 3Q3XA 2BQWB 2G81E 3E3TA 1DXPA 2HOBA 2UUFB 2WYGA 2JJ1D 2ULLA 1O3FA 4JK6A 1QBOA 5F03A 1XVMA 1CSOE 4KELA 1W0JD 1UVTH 1V3XA 4GHTA 3V0XA 3A83A 3SU6A 3T2NA 2LPRA 1HJ8A 2VB0A 5EODA 3RXVA 1GHBF 3BG4C 3O8CA 2ZHQH 3RXOA 1O5EH 3VEQB 1CBWC 2GP9B 1K22H 1ZTLA 4H6TA 5E0HA 1GMDG 1HLTH 5C0TA 1DVAH 1GL0E 2A2XH 2OLGA 2ZGCA 1BBRK 3E16B 1NFXA 2Q1JA 3NRLA 3O8RA 1WTHD 2ZFPH 1G3CA 3RXIA 3DT0H 2H2ZA 1SGCA 1WV7H 2FOMB 5DP6A 1V2KT 1BMMH 1THRH 4B6EA 4XRNA 1AIXH 3AK5A 1IQEA 4B2BA 2PR3A 1V2MT 2A4RA 2H5CA 3K6ZA 1C9PA 1COWD 3S7HB 1O5CB 3HKIB 3RMOH 2ANYA 3F9FA 1MQ6A 1FDPA 5J4QA 4BAHB 4K8BA 3RMLH 4NFEA 4CRAA 5HIYA 2QE7D 3A84A 1KTSB 3ATLA 2ZU5A 1WYKA 1BB0B 1EQ9A 1G30B 1Q2WA 4AC9A 2A7HA 3S69A 2GT7A 5EJ1A 1E79D 3W95A 2HNTC 1MMJN 5HM2A 2VINA 4CH8B 1LQDB 3KQDA 3RU4E 4I32A 1GCTB 3A82A 3BTQE 1O37A 1C1UH 3KQEA 3SQHE 2FEQH 3GOVB 1SB1H 1NFWA 1P9UA 1GI1A 1KSNA 1O3EA 1BRCE 2W6ID 3A89A 4CBOA 1C5MD 2Z3EA 2BM2A 2VIQA 1OX1A 2GV6A 3MH6A 2CMYA 1QB6A 3M3SA 3RXLA 3M61U 3SV6A 1TMUH 5L2ZH 1GJ4H 4AFUA 3ZVCA 1TX7A 2J94A 5F8ZA 2A5AA 1NY22 1KXCA 1YGCH 3ZVDA 4ABEA 3MH7A 1BRBE 1S0RA 1G32B 1ZGIA 1ZJDA 2B5TB 4GHQA 3MNSA 2V6NA 1SSXA 1TQ0B 1N8OB 2GDEH 1DWEH 1L1GA 3RXTA 1MKXK 4IW4E 2UUJB 2OXSA 1HAIH 1SC8U 1GHAF 2YMSD 1P06A 1HAGE 2ZGJA 3T27A 3S9AA 1EZSC 3L6PA 2PWXA 1UCYH 1C2HA 1L4ZA 2ZQ1A 5EXLA 5JB9S 4GCHG 3DA9B 1TABE 3TVJB 1HIAB 2ODQA 1LMWB 1HGTH 1LHEH 5K7RA 1WDIA 4Z1MD 2GCTB 5ABWA 3S9CA 1LPKB 5A0AE 3FOAA 5EJZA 3RXMA 2GV7A 2SNWA 1ETSH 4JYTA 4KGAA 4JYUH 1DANH 1W11U 1P03A 2WV4A 1P8VC 2ZIQH 1NRPH 2A1DB 5FCKA 5F6MA 1V6DA 1XUIA 5C2ZA 2BVRH 4B2AA 1UK3A 1ELDE 3MWIU 5BPEA 3TK5A 1T4UH 1TAWA 2BXTH 1BMNH 2FI5E 1D3PB 1HXEH 2RDEA 2Y7ZA 3V13A 1ANEA 1RIWC 1PYTC 2F9VA 3TNTA 4FU7A 1MU8B 3SHCH 3BTFE 1ELAA 1EPTA 3K2UA 1TMTH 2BLQA 4NIXA 3MO6A 1C5UA 4IC6A 1W13U 3BIVH 5FBIA 4UONA 4ZXYH 2EI8A 2Q6GA 1GJ5H 1LHFH 3SW2B 2D1JA 4RKOB 4ZKNU 1C5PA 3BTEE 2DE9A 4WMDA 6GCHF 2FI4E 2SGDE 2VH6A 3GY7A 1AY6H 1O3NA 4X8UH 3SGBE 4E05H 1MH0A 1O2QA 1GBMA 5FL7D 2F83A 4I33A 5JBAS 1O2TA 1HAOH 1O39A 1QHRB 1ZGVA 2H1UA 2V3HH 3QGNB 1W10U 2BD5A 1YP9A 3RM0H 4RT0A 3SQEE 2UUKB 4MPUA 4X2VA 1AFEH 1EKBB 1XM1A 3QWCH 2OBOA 5FCRA 2Y5HA 4M7GA 3P8GA 3GY2A 1AFQC 2QAAA 1FI8A 3WW7A 4MNWA 1GMCF 1VGCB 1MKWK 1P09A 5GDSH 1GWAA 1EJMA 2FYRA 4IMQA 1CO7E 1O5GH 5HMAA 3DSOA 4ZUHA 3SUEA 2WPIS 1ZLRA 3HGPA 1FY8E 1Z8GA 3M7QA 1XUKA 2XRCA 2QYIA 1QURH 2ZC9H 4ASUD 4CRDA 1EATA 2K1QA 2W7UA 3BG8A 3E91A 1BDAA 1GI4A 1FONA 3MU8A 2I6SA 5GNDA 1MUEB 4WXVA 2PUQH 1BMFD 4NIVA 4B76A 3LT3A 4TSFD 2Z9GA 3RMMH 4CBNA 3E1XB 3TITA 3OTPA 4M9FA 1DLKB 1W14U 1Q3XA 1ZOMA 1O5AB 2ZDLA 1GHYH 2GD4B 1C1PA 1ZR0A 4I8LA 1NRQH 1GBLA 3GICB 8GCHF 1SFQB 3EQ0H 1SGPE 3GYMA 1FN8A 2HLDD 1A3BH 2VVUA 4AFZA 3P8OA 3TH3H 1FIWA 1MTNB 3VB4A 1NROH 3FP8E 1H9IE 4NIWA 5EXNA 2G4UA 2FX4A 5LH8A 3MNCA 2KCOA 1RRKA 1O5DH 1FIZA 4A92A 1S82A 1HPGA 1YKTA 1O3IA 4K5ZA 1ZHRA 1C2JA 1NESE 3TPIZ 1WQSA 2Y6TA 2OC0A 2ZWLH 3MFJA 2V0BA 5E0JA 2BD9A 1SLXB 5IDKA 3E0NB 5JDUB 1MBMA 5GCHF 4X2XA 2H9HA 3A8AA 3U1IB 3WY8A 2BDGA 4NA9H 1EZUC 3U98H 5DJ7A 1YLDA 3Q76A 4ZCNA 1NS3A 2NU2E 4ABBA 5CE1A 3F9HA 4AN7A 4ISNA 1PFXC 2EQNA 1BITA 2TGDA 1QRWA 3P70B 3U69H 2FS9A 1AMHA 2Y82A 2OC8A 3PRDA 5T6FA 1VR1H 2FYQA 1GJ9B 1NBME 1ORFA 1A1RA 1P2QA 3CENA 1C1VH 3M36A 1D3TB 1O3BA 4F55A 5C20A 2EI7A 2TGAA 2PKAB 1IQNA 1H9HE 4I8HA 3GCOA 3EA7A 3LDXH 2R3YA 2ZGHA 4DT4A 1C2MA 2FOFA 2GDDA 2Y5GA 2ZPQA 3RXAA 2C8WB 4WXIA 1A5IA 5EQRA 1TOMH 5T3HA 2QV1A 1QB9A 1C4Y2 3A7ZA 3F0OA 1PQAA 1FV9A 1PPBH 1C9TA 1TA6A 3TK9A 1SFIA 5GPIB 3I77A 1O2MA 3H5CB 4OS5A 4ZHAA 1QFKH 1O2OA 4WH8A 1TONA 1C5OH 2P3TB 1T32A 3ATKA 1QQUA 3BTTE 1V2VT 2ALPA 5C1YA 3UR6A 2Z9JA 2R2WU 3TH2H 5DP4A 1EPTC 1EOLA 3F0PA 1ELEE 1ARBA 3KEEA 3KQBA 1C2DA 3KNXA 4NA8A 1ESTA 1KLTA 1SHHB 5E8EH 1GCTC 1L1JA 2ZA5A 1KYNA 5I46H 1SPJA 3A7YA 3S0NA 1Y3VA 2FTMA 3Q00A 5JPMH 1O3PB 3T5FH 7ESTE 1ACBE 2Y7XA 5H4IB 3SJ9A 1GGDC 3T29A 2RG3A 3U1JB 3RC6A 2XWAA 1Z1IA 3M5NA 2XBXA 5CDFE 2FXRA 4K1SA 1OWKA 3A81A 2GZ8A 3LGYA 7LPRA 1GBBA 2GKVE 1NC6A 1UTQA 1A5GH 1K28D 5DG6A 3E90B 2ZFSA 1C5ZB 2IPHA 3RXGA 4DJZB 1SLUB 3O8DA 4DURA 1UVSH 3M5MA 3MQKC 1YCPM 1A3EH 3SN8A 1QA7A 1ZMJA 2QXHA 4MPWA 1AUJA 1MU6B 1XXFA 2ZU1A 1IAUA 1SGDE 2UWLA 1GJDB 3I29A 1OKXA 1GDQA 3D49H 1AFQB 3C1KA 1GI7B 2P59A 1F7ZA 1P3EA 3SU4A 1SKYE 3DFJA 5EPNA 1W12U 3ITIA 4I7YH 1MAYA 1QBVH 4GAWA 3ZZ8A 1TNKA 1XXDA 4DIHH 2XBVA 4D7GA 5JBCS 4DT7B 1NFYA 1GI2A 1EP6A 3UR9A 4JZDH 2VIDA 1FQ3A 1AVXA 1NRSH 1OWHA 2ZHFH 2BD4A 4X1SU 1AB9C 1K0HA 4NSVA 2VBCA 2ZZUH 1GJBB 3LC5A 1J8AA 4ISOA 4D76A 2O8UA 4Y0YE 2PKAA 1E37B 1AVWA 4DW2U 2AMPA 1F0TA 1NT1A 2ZU2A 2O9QA 3PO1B 3R3GB 3URDA 5GJ4B 1G9IE 3IG6B 1O3DA 4LOYH 1LPGB 3GDVA 4CHAC 4ZXXH 4INLA 1YWUA 1KXAA 1ELGA 3SZNA 3DFLA 3PLKA 2CN0H 4ZMAH 1GPZA 1ZSKA 3FANA 1VJAU 3OFND 3SO3A 1OP8A 2RDLA 4HFPB 1DOJA 4Y11E 1AWFH 1F92A 5C1UA 3TJNA 1LHDH 5C94A 4UEHH 4Y6DA 3C27B 1CGJE 1SI5H 3VG8A 1LQEA 3OU0A 2ZQ2A 2GJGA 3SNEA 1OSSA 1TPAE 2BQ6B 1YPGH 1FLEE 4Y8YA 3F3BA 3PM3A 1O2WA 4IN2A 3H09A 3NPSA 1H8HD 3ZVEA 1YLNA 5DP9A 1AE8H 2OTVA 2XBYA 1BTZA 1P02A 3T26A 3DHKH 1HAZB 4TPYA 2QA9E 2A31A 4MDSA 1L0ZA 3TGKE 2WV5A 2PLXA 1RIWB 4TY6A 2AS9A 2F9BH 1TRMA 1S83A 2VNTA 4CH2B 3QZQA 1BQYA 1CHGA 1UVUH 1HJAC 1PPCE 5CHBA 3LH1A 1TE0A 3ESTA 2DUCA 4J1YA 2W7SA 4E06H 3BTWE 3BF6H 4I86A 1ZPZA 1N6YA 1P2NA 2ZDMA 3MO3A 1V2UT 1E0FD 1KXEA 1L4DA 3ZZBA 4FUBA 5A8YA 1GBFA 1SBWA 1GI8B 1BMAA
chains in the Genus database with same CATH topology
4WH6A 3OEED 3SU1A 2WPDD 3PV2A 2F9UA 4I31A 3ZIAD 4A1VA 1H8ED 2KR7A 5T1VA 1W0JD 3F2HA 2A4QA 3DCLA 3WWFA 1E1RD 3DSPA 4Q63A 4R8TB 2YMSB 5EQSA 2K8IA 2KZ4A 3OAAD 3P8NA 4U01A 3SU6A 4XD7D 5ETXA 2OBOA 3SUFA 1CU1A 2OC8A 3PRDA 3LOXA 2QF5A 3OYPA 1S6LA 3O8CA 2JDID 4NWKA 1NBME 1A1RA 2YOLA 2YMSD 2IJOB 4F55A 2M2AA 2V7QD 3FO8D 2O8MA 1E1QD 2KCPA 2VBCA 3L6PA 5ESBA 3WW7A 5C0TA 5HKKD 4TT3D 5EQQA 4B74A 5C0UA 2F43B 2LELA 3NRLA 1N1LA 3F2FA 3SU5A 3O8RA 2XOKD 3FN8A 2XNIA 1BT7A 2OINA 3N7DA 4KTCA 2XNDD 3DSOA 5F53A 4DT4A 4YXWD 3SUEA 2FOMB 5FPTA 1OHHD 5GJ4B 5EQRA 5IK2D 2QV1A 1DY8A 4B6EA 2JIZD 2A4GA 3N7EA 4Z1MD 3AK5A 3N99A 3FOAA 3F0OA 2A4RA 4ASUD 4B73A 2XCNA 2K1QA 1COWD 3SUDA 1W3CA 2K0QA 5GPIB 3KN2A 3SZEA 4WF8A 3OFND 3PV5A 5GNDA 2OC1A 2J5UA 2CK3D 3KF2A 4WH8A 1BMFD 1KMHB 4B76A 4TSFD 3SUGA 3SU3A 3EYDA 2XCFA 3OTPA 4K8BA 2GVFA 2WSSD 4M9FA 4B71A 1DXWA 3F2GA 1NBMD 3RC5A 4FETA 3F0PA 4Q4LA 2WZQA 3KEEA 2QE7D 2W6JD 5DN6D 2KFWA 3KNXA 3VG8A 4B6FA 3O8BA 3LONA 4B75A 4RI0A 2HLDD 3F3BA 3SV7A 4A1XA 1W0KD 2QF4A 3M5OA 3H09A 1WXRA 4OM9A 3SV9A 3P8OA 2F9VA 5H4IB 1H8HD 1E79D 5FPYA 3W1EA 3RC6A 3U1JB 3M5NA 1EFRD 5CDFE 1RTLA 2F4LA 3UB0A 4TYDA 2WHXA 4I32A 3LKWA 3RC4A 2KCOA 2KM0A 2WV9A 4A92A 3E90B 3PRBA 3SV8A 3SYJA 3FKSD 3GS9A 1FX0B 2OC7A 3SU0A 3WWBA 3O8DA 2KCAA 5EPYA 2GGVB 3M5MA 1MABB 2W6ID 4JMYA 2FP7B 5B6LA 2L6OA 5C17A 2KCYA 2IJD1 3OEHD 5CHBA 2OBQA 3M5LA 5EPNA 2OC0A 4A1TA 2AHME 2JJ2D 3OE7D 1JXPA 5IDKA 2YMSC 4NWLA 3SV6A 1DY9A 5DSFA 5FPSA 2P59A 3U1IB 2OK5A 2FM2A 5FL7D 1RGQA 3SU4A 1SKYE 4I33A 3SU2A 1DXPA 4ZCNA 1NS3A 2JJ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q63 A; 
#chains in the Genus database with same CATH topology
 1G37 A;  2WPD D;  3PTN A;  2AYW A;  2PW8 H;  4YTA A;  1ELC A;  3GYL B;  4FVB A;  1CVW H;  2KR7 A;  4A1V A;  1PQ7 A;  3K6Y A;  8KME 2;  1A61 H;  4AFQ A;  5G4B A;  1SGI B;  5EQS A;  4BAM B;  2K8I A;  4LZ4 B;  3A8C A;  4U01 A;  1VGC C;  3P8N A;  1GI0 A;  2QXJ A;  4XD7 D;  1H9L B;  2QCY A;  3SUF A;  1TIO A;  2FS8 A;  3UUZ A;  2JH6 D;  3FVF B;  3LOX A;  2AGG X;  1GMH G;  5DK1 A;  2G00 A;  2WYJ A;  4E7N A;  2M2A A;  2V7Q D;  2O8L A;  1RTF B;  2G5V A;  2NU0 E;  4Q80 A;  1K1O A;  5HM9 A;  1BUI A;  1C2L A;  1C1O A;  1HBT H;  3EE7 A;  3SU5 A;  1DSU A;  2OIN A;  2SGE E;  3RXS A;  1CQQ A;  4FVD A;  1JMO H;  1N6X A;  2STB E;  3P8F A;  6CHA C;  2A4G A;  5AF9 H;  2BD3 A;  1JOU B;  1OYT H;  1OS8 A;  1P9S A;  4Y8X A;  1KXB A;  3ZV9 A;  3T25 A;  1O30 A;  1O2Y A;  2HWL B;  1KMH B;  1PYT D;  3UOU A;  1DE7 H;  2XCF A;  1Y5A T;  3P95 A;  2GVF A;  2VGC C;  4OS4 A;  1L2E A;  3RC5 A;  3OX7 U;  3URE A;  5GWZ A;  1C5L H;  3RXH A;  1K1J A;  3MNX A;  1BJV A;  3NUM A;  5FX5 A;  2Z6B D;  1S6H A;  3OY6 U;  3E0P B;  2VIO A;  1OP0 A;  1T8L A;  2JH0 D;  3NWU A;  3UB0 A;  3LH3 A;  1D3Q B;  1K1I A;  1UJ1 A;  3MTY A;  4LXB H;  5AVD A;  2WV9 A;  4XFQ A;  3LU9 B;  1ETR H;  3RXC A;  4DCD A;  2AER H;  1MTN C;  1AZ8 A;  2WPH S;  1FPC H;  1QZ8 A;  1ZHP A;  3P17 H;  1CHO F;  1TGN A;  1GDU A;  3PYH A;  2VIW A;  1L1N A;  3MH5 A;  1GGD B;  4ACA A;  1AUT C;  4DII H;  5JYI A;  3RXB A;  2YMS C;  4NWL A;  2P8O C;  2R2M B;  2VU8 E;  3F9E A;  4RKJ B;  5DSF A;  8LPR A;  3BTK E;  3TJV A;  4BAQ B;  4Y7A A;  1EAU A;  1UTJ A;  4K69 A;  2WUB A;  2C4F H;  1F0R A;  3PV2 A;  3AW0 A;  2D8W A;  3WWF A;  2BVX H;  2PSY A;  1OYQ A;  1UTK A;  1DS2 E;  2ZDV H;  2BDC A;  3BEI B;  4WME A;  1P2I A;  1BJU A;  3GY5 A;  3SOS A;  4MNV A;  2ZHD A;  1FMG A;  2ZTZ A;  3EDX B;  2Q6F A;  1HUT H;  2A2Q H;  1PQ5 A;  3SI3 H;  2THF B;  4ABH A;  2FOC A;  1ZPC A;  1TB6 H;  2BDA A;  2W3I A;  2CHA B;  4GLY A;  1B7X B;  1TFX A;  3SV2 H;  3ZZ9 A;  1Y5B T;  2QN5 T;  2VIP A;  3F2F A;  2FOE A;  2ZFT A;  5CHA C;  3JZ1 B;  4AB9 A;  3BTM E;  1QY6 A;  1O3L A;  3PMA B;  1P2M A;  2AIP A;  1B0F A;  2JET C;  1Z1J A;  4FXG H;  5FPT A;  2AGI X;  3L33 A;  1O32 A;  1EPT B;  2C8Y B;  1C1M A;  4JZE H;  2ZNK H;  1GDN A;  1YC0 A;  3A8D A;  2NWN A;  3ZZ3 A;  4BXW A;  1GBH A;  4O03 A;  1DUA A;  1FXY A;  3VB6 A;  3B8J A;  4JZ1 A;  5FXL A;  4X6O A;  2OQU A;  5A0B A;  1BML A;  1QIX B;  3QN7 A;  4WY3 A;  3HK6 B;  2BX3 A;  1QQ4 A;  3RU4 D;  1C5Y B;  1SMF E;  2BOH B;  1O2V A;  4UFF H;  3PTB A;  3QO6 A;  2BHG A;  2BY9 X;  3V3M A;  2VWO A;  2ALV A;  2R0L A;  4Y76 A;  2CXV A;  4X6M A;  4TWW A;  1UTM A;  2WHX A;  4YLQ H;  1CHO G;  1GVL A;  3SND A;  3LKW A;  3RC4 A;  2AH4 X;  4YLU A;  4SGB E;  3Q77 A;  2Y80 A;  3PRB A;  3SYJ A;  3ODF A;  1BTX A;  4JK5 A;  1FX0 B;  3CS0 A;  5EPY A;  1EJA A;  1Z6E A;  1GJA B;  4DG4 A;  1VJ9 U;  4JMY A;  5C5O A;  4OGX A;  4AB8 A;  1HCG A;  4XSK U;  2GCH G;  1O2R A;  1PPF E;  4O97 A;  1FPH H;  1O3K A;  2JH5 D;  2FMJ A;  3HPT B;  2V3O H;  1BTH H;  1BTU A;  3M3V A;  3QX5 H;  2AIQ A;  1J14 A;  3TGJ E;  1GI9 B;  5T6D A;  2P95 A;  1MD8 A;  5LGO A;  2D2D A;  1DIT H;  1GHX H;  1H8E D;  3SGA E;  3JZ2 B;  4ABJ A;  1SGQ E;  1A4W H;  3KYG A;  4BAN B;  3M35 A;  1CU1 A;  1HAH H;  1FJS A;  1O0D H;  3LC3 A;  4A7I B;  1S85 A;  2YOL A;  4CHA B;  1QR3 E;  2BY8 X;  1YYY 1;  1OXG A;  1DFP A;  1GG6 B;  4R0I A;  1SGY E;  3PRO A;  4K1T A;  4Y10 E;  1AVG H;  1A5H A;  3UWI A;  2LNC A;  1TMB H;  1HRT H;  1CBW B;  2V35 A;  4YZU A;  1KXF A;  7KME H;  2JIZ D;  1J15 A;  3SJ8 A;  2BZA A;  5EW1 H;  1MTV A;  2YNB A;  3PB1 E;  1O2I A;  1VCQ A;  1MD7 A;  3SUD A;  3KGP A;  4DGJ A;  1E36 B;  1F0U A;  2VIV A;  2J5U A;  1ABJ H;  1SOZ A;  5C1X A;  2WPL S;  1GMD F;  3BEF B;  4U2W A;  4AG2 A;  1GHW H;  3UY9 A;  4AX9 H;  1HNE E;  2BLO A;  2EY4 C;  1S6F A;  2BLV A;  4ZKS U;  1O3C A;  1SOT A;  3M7T A;  5LPR A;  5BRR E;  4Y8Z A;  1FAX A;  4B6F A;  4RI0 A;  3HKJ B;  4FUJ A;  1Q31 A;  1GBT A;  1X7A C;  1H1B A;  3LGV A;  3A80 A;  2BQ7 B;  1HAV B;  2OP9 A;  1AI8 H;  3T62 A;  2WPJ S;  4UFD H;  2QY0 B;  4TYD A;  3DSG A;  3U8R H;  4MPX A;  1E34 B;  5EXM A;  1D4P B;  2Q6D A;  3M37 A;  1W8B H;  1O31 A;  2ZFR H;  1AND A;  2FOB A;  5IYT A;  2FWW A;  3TNS A;  4AOQ A;  1P0S H;  1Z8J B;  4X1P U;  2ZGB H;  2L6O A;  3HK3 B;  1EUF A;  1YPJ H;  3BG4 B;  1C5T A;  2J95 A;  2ANM H;  5FPS A;  1P57 B;  3E6P H;  1WTG H;  4NFF A;  2ZHW H;  2HNT F;  1XUF A;  2XWB I;  4O3U A;  1TWX B;  1HJA B;  3OEE D;  3HGN A;  1C5Q A;  1TGB A;  2PSX A;  1QL9 A;  1V2P T;  1ELB A;  2CF8 H;  1BIO A;  2O8T A;  3QGJ A;  4CRC A;  1GJ7 B;  1S0Q A;  1EX3 A;  1C5V A;  1SLW B;  4UFE H;  5J4S A;  1IQF A;  4Q7Y A;  3RMN H;  1ELV A;  4NZL A;  2QF5 A;  2BMG B;  2P8O B;  1GI3 A;  2IJO B;  1EAS A;  1P12 E;  2GT8 A;  4AFS A;  2KCP A;  3ZZ6 A;  8EST E;  1YPH C;  1JRS A;  6EST A;  4CRG A;  3VFE A;  1U6Q A;  1DLE A;  1PPZ A;  3PLB A;  3A87 A;  2D26 C;  3MU5 A;  2XND D;  1OHH D;  3RLY H;  3MH4 A;  2C3S A;  2CGA A;  1IQK A;  2HLC A;  3A86 A;  2ZTX A;  1V2Q T;  1MTW A;  2QIQ A;  2XCN A;  1C2F A;  1AB9 B;  1K21 H;  2GTB A;  3KL6 A;  4WF8 A;  4ABF A;  2OC1 A;  4MNX A;  4MTB A;  2P16 A;  1O35 A;  1RD3 B;  3D62 A;  3UWJ H;  1BRU P;  1NZQ H;  2IOT A;  1LKB A;  4THN H;  2F91 A;  2KFW A;  3V12 A;  2BY7 X;  3GDS A;  2GMT B;  3KYF A;  3STI A;  1SGE E;  2TBS A;  1PPE E;  2UUY A;  1VKY A;  3SV7 A;  1ARC A;  4XBB A;  3VXF H;  3IIT A;  3KCG H;  4K8Y A;  3OTJ E;  2WPM S;  5FPY A;  2G8T A;  1EFR D;  5E2O A;  1RTL A;  3RLW H;  2ASU B;  2Z3D A;  1TBQ H;  4FUI A;  4LZ1 H;  2ZCL P;  1C5X B;  1ZSJ A;  4X8V H;  1V2L T;  2KAI B;  2FZZ A;  1LVB A;  4ZAE A;  1JWT A;  3WWB A;  1GHB G;  1FUJ A;  3LGT A;  2KX4 A;  2QF0 A;  1CGI E;  3EA9 A;  1G2L A;  1Y5U T;  2FIR H;  2J34 A;  4A1T A;  2ZFF H;  1JXP A;  1P2O A;  3MNB A;  2HVY B;  1CT4 E;  2C8X B;  7GCH F;  2BY5 X;  4X1N U;  1NTP A;  3CNR A;  1LVM A;  1PJP A;  2XTT B;  3SI4 H;  2H9T H;  3SU1 A;  1SQA A;  2R9P A;  1MKW H;  2A0Q B;  2HRV A;  1O38 A;  1MTU A;  1MQ5 A;  3DSP A;  2YMS B;  4KTU A;  4ACB A;  2UWO A;  3OAA D;  4INK A;  1SHY A;  4K60 A;  4D9Q A;  1O36 A;  4NCY A;  1J9C H;  1ZHM A;  4O9V A;  4CRE A;  1XKB C;  4U30 A;  5I25 A;  2RA3 A;  1BTP A;  4XBC A;  4IN1 A;  1O3A A;  1TNJ A;  2G5N A;  3ZVG A;  4YT7 H;  2STA E;  1P10 A;  3MOC A;  1Z6J H;  1PPG E;  4OS7 A;  5HKK D;  5EQQ A;  2TIO A;  1QCP A;  1EAX A;  3QZR A;  4YO9 A;  5DP7 A;  5TJX A;  1DWC H;  2XNI A;  1S84 A;  5EG4 A;  4KTC A;  1O2H A;  1AHT H;  4IGD A;  1XUG A;  4A5T S;  2J2U A;  3F1S B;  1FNI A;  4GSO A;  1ZRB A;  4X0W U;  3IWM A;  3AAV A;  3EAJ A;  5A8Z A;  3MMG A;  2FOG A;  2NU4 E;  3KN2 A;  3SZE A;  3KID U;  2Y5F A;  2XC0 A;  4H4F A;  3EGK H;  1BZX E;  3SU3 A;  3EYD A;  1J17 T;  2AFQ B;  1V2N T;  1YPE H;  4ASH A;  1VCP A;  4AZ2 B;  3FP7 E;  1IQL A;  2WSS D;  3A88 A;  3F2G A;  3I78 A;  4OS6 A;  1UO6 A;  2WZQ A;  5DO4 H;  1WAY B;  2QGR A;  4K3J A;  3O8B A;  1UW7 A;  3GCN A;  3ODD A;  3E8L A;  1ZML A;  1IHT H;  2C8Z B;  1LTO A;  5GCH G;  2TGP Z;  2ANK H;  1TGS Z;  1A46 H;  2R3U A;  5A09 A;  4FUG A;  3U9A H;  2EI6 A;  1HV7 A;  3N7O A;  5JBB S;  4P02 A;  3LPR A;  4RT1 A;  2CF9 H;  3CP7 A;  2AGE X;  5FX6 A;  1H4W A;  1SVP A;  4B2C A;  3U28 C;  2GGV B;  4DOQ A;  1BTY A;  3A7T A;  1KTT B;  3AAU A;  4X1Q U;  3ZZ5 A;  5JBT A;  5LPE A;  1V2S T;  1V2O T;  2OBQ A;  1GVZ A;  5AHG H;  1DPO A;  2JJ2 D;  1GI6 A;  3L3T A;  2FDA A;  4CR5 A;  5HGG A;  3SNC A;  4XBD A;  1TNG A;  3QTO H;  3RP2 A;  4GCH F;  1F2S E;  1VIT G;  2A5K A;  5T1V A;  1E1R D;  1QL7 A;  4Q63 A;  2G4T A;  4RSP A;  3MHW U;  2ZGX H;  5C3N A;  1EZX C;  1V2J T;  2PKS C;  1S6L A;  1AU8 A;  2F9N A;  1G36 A;  4XE4 A;  1W0Y H;  2ODY B;  3MI4 A;  5ESB A;  1V2R T;  4B1T A;  4B74 A;  1XKA C;  3UIR A;  2PGQ B;  4YOG A;  3QLP H;  1K9O E;  3LGU A;  5T6G A;  3FN8 A;  1Z8R A;  1O5F H;  3TH4 H;  3VXE H;  1Y3U A;  2IPQ X;  2KAI A;  2VVV A;  4CR9 A;  1Z8I B;  3BV9 B;  1UTP A;  4YM9 A;  5IK2 D;  4X2W A;  1IOE A;  3BN9 A;  1KIG H;  3RUO A;  5KEC A;  1QA0 A;  3PMJ A;  1GBI A;  2NU1 E;  1FY3 A;  3F9G A;  1TGT A;  5DKM A;  2FOA A;  1FN6 A;  3SNB A;  1G3B A;  2ILN A;  2WIN I;  1UCY K;  1ZPB A;  2CK3 D;  3KF2 A;  3D65 E;  3NXP A;  2O8W A;  1GBA A;  1C2K A;  2ZEC A;  9EST A;  3STJ A;  2OUA A;  1CA0 B;  1WQV H;  4HG6 A;  2GCT C;  3A8B A;  3SHA H;  1W0Z U;  3SBK A;  1O2U A;  1IQI A;  3F68 H;  1DDJ A;  1VZQ H;  2W6J D;  2JET B;  3ATM A;  3TK6 A;  4AGJ A;  1V2W T;  1ELT A;  1K1L A;  3M3T A;  1EP5 A;  5L6N H;  2PFE A;  2XYA A;  1DWB H;  2F9O A;  2J4I A;  4LK4 A;  3SV9 A;  1O2P A;  3ATI A;  3EA8 A;  3ZZA A;  2F3C E;  3UPE A;  4ABD A;  2G55 A;  4Y71 A;  2KM0 A;  1CA8 B;  1YPH E;  4DY7 B;  3SV8 A;  4F48 B;  3BEU A;  2H5D A;  2OC7 A;  3GS9 A;  1YLC A;  1GHZ A;  1EZQ A;  4BTT B;  1BHX B;  2B8O H;  5DP8 A;  4YT6 H;  4Z0K A;  2BLW A;  5DP5 A;  2ZKS A;  2BDY A;  1UHB A;  2IJD 1;  2KCY A;  3ZZ4 A;  4Y7B A;  5FHT A;  1O2J A;  1ZTJ A;  4Q7Z A;  1O3G A;  1BA8 B;  5A8X A;  2GX4 A;  5FBE A;  1JIR A;  5EGM A;  1RJX B;  3BTD E;  1GVK B;  1C2E A;  1KXD A;  2VH0 A;  1Y3Y A;  1LKA A;  1TRN A;  1OWE A;  2F9U A;  3ZIA D;  2HGT H;  4H42 U;  3RXQ A;  1GJ6 A;  2A4Q A;  4VGC C;  3AW1 A;  1VCW A;  2NU3 E;  1K1M A;  7GCH G;  2KZ4 A;  4BOH A;  3RXU A;  1EAI A;  4SGA E;  3SGQ E;  5A0C A;  3TLO A;  1UTN A;  3K65 B;  3SJI A;  3TJO A;  3SJO A;  2FTL E;  4FUF A;  2Z94 A;  1DWD H;  3OSY A;  4FOU C;  1QJ7 B;  3RXK A;  1B5G H;  5GXP A;  3GCH B;  1GJC B;  2G51 A;  3QUM P;  1THP B;  1HAP H;  4AOR A;  1H8I H;  4ZKO U;  1V2T T;  2ZDN A;  1GMH F;  4OS1 A;  3B9F H;  4P00 A;  1TNI A;  1D6R A;  2HPQ H;  1QB1 A;  1D6W A;  1O2G H;  2HAL A;  2BYA X;  4RN6 A;  1DM4 B;  1C5W B;  4X2Y A;  4ISI H;  3UNR A;  1SGF A;  2BX4 A;  3URC A;  2DE8 A;  4BNR A;  1BHX F;  1W3C A;  2BY6 X;  3NK8 A;  1UVP A;  2VVC A;  4GPG A;  1SGF G;  1F5K U;  4I8J A;  3U8O H;  2Z9I A;  1QTF A;  4TPI Z;  1QGF A;  1DXW A;  2R0K A;  1CT0 E;  1ZJK A;  1NBM D;  1SR5 C;  4ABA A;  1ZZZ A;  2SGP E;  2Z9L A;  1NM6 A;  3PWB A;  1LVY A;  2J92 A;  4MQA A;  1AZZ A;  1IQM A;  3RDZ A;  1UK4 A;  4U32 A;  3ZZC A;  4GVU A;  1AE5 A;  4I8G A;  1QJ1 B;  4NIY A;  2QXG A;  1WXR A;  1A0H B;  5DPA A;  4ISH H;  2V3M A;  1Y59 T;  3NZI A;  4NGA H;  1AWH B;  4O3T A;  1YY3 A;  1C2I A;  2GMT C;  2FI3 E;  1KY9 A;  2J38 A;  1TBZ H;  1NU7 B;  2P3F H;  1OP2 A;  2BB4 A;  1TOC B;  3VGC C;  1C2G A;  1C1Q A;  1P3C A;  1GBJ A;  1INC A;  1SQT A;  3FAO A;  1O2S A;  4ISL A;  3GY3 A;  3TIU A;  4PRO A;  5C67 A;  3GY6 A;  2ZG0 H;  4HI3 A;  1BTW A;  2BDI A;  1TPP A;  1C1S A;  2ZU3 A;  2W26 A;  1DY9 A;  3FZZ A;  4YES B;  4Z6A H;  3ENS B;  2HPP H;  2UWP A;  1DUE A;  2A45 B;  3RXD A;  2C90 B;  2LP6 A;  3SU2 A;  1LPZ B;  3SNA A;  1S5S A;  3LJO A;  2QF3 A;  4MVN A;  2TRM A;  1TPO A;  3MU4 A;  1CT2 E;  4AYV B;  1SL3 A;  1XUH A;  3A85 A;  5EU8 A;  1ID5 H;  5L30 H;  1QRZ A;  4XDE A;  6GCH G;  1HDT H;  1GBE A;  4ZKR U;  4EST E;  1FZZ A;  4JZI A;  3FO8 D;  3CS7 A;  4FU8 A;  3DD2 H;  1YPL H;  1T8M A;  3PV4 A;  1QBN A;  1ESB A;  1TPS A;  2LEL A;  2XOK D;  4NA7 A;  1ZYO A;  4BTU B;  3LGI A;  2B9L A;  1CGH A;  5TCC A;  1IQJ A;  1W7X H;  1O5B B;  1TNH A;  8GCH G;  1WSS H;  3N7E A;  4MPV A;  4D8N A;  2EA3 A;  1P2J A;  2SNV A;  5SGA E;  4B73 A;  2P93 A;  1MCT A;  1TRY A;  2B0F A;  3SUG A;  2ZF0 H;  2PTC E;  1C5S A;  1OWI A;  3RXJ A;  4FUC A;  1AN1 E;  3UTU H;  5DN6 D;  3VB7 A;  3PO1 C;  2ODP A;  1TX6 A;  4MNY A;  2YNA A;  2RCE A;  1O2K A;  4X1R U;  1RS0 A;  3UQV A;  1OOK B;  3F6U H;  4A1X A;  1KLI H;  2ZTY A;  1HIA A;  1O3J A;  4FU9 A;  3M5O A;  3TGI E;  4UFG H;  1HXF H;  5HYO A;  5EIY A;  4X6N A;  1NO9 H;  2W5E A;  3PWC A;  1UTL M;  1XX9 A;  1D9I A;  1GMC G;  2BD2 A;  3RU4 T;  1O34 A;  3FFG A;  1WU1 A;  1ANB A;  2SGA A;  2P94 A;  1UTO A;  1K1N A;  1SLV B;  1YCP H;  3RXE A;  1HAV A;  1NU9 A;  1YPK H;  2J97 A;  2BOK A;  1ZMN A;  4J2Y B;  2XW9 A;  2FP7 B;  1O33 A;  5C17 A;  3OEH D;  1TX8 A;  3KQC A;  3EE0 B;  2XC5 A;  1GHA G;  1BCU H;  2FLR H;  1NRR H;  4ABG A;  1NRN H;  1C1T A;  1MBQ A;  4IMZ A;  4FUE A;  2GCH F;  2WUC A;  5CMX H;  1MKX H;  1GI5 A;  1NN6 A;  2H6M A;  3UQO A;  3PMB B;  5JB8 S;  4WH6 A;  1SGR E;  1A2C H;  3DCL A;  1YPM H;  1RXP A;  3Q3Y A;  2HNT E;  1C1R A;  4CRB A;  2HVX A;  1F5L A;  1T8N A;  2CV3 A;  5HIZ A;  1AKS B;  2JDI D;  3HAT H;  4WVP E;  1XUJ A;  1LHC H;  3RXF A;  2W3K A;  2ZDA H;  3K9X B;  3ZVF A;  1ESA A;  1HYL A;  4ZHL U;  1YBW A;  5C0U A;  2JKH A;  5KED A;  1SQR A;  3N7D A;  1SGN E;  1IQG A;  2TGT A;  1CA0 C;  3LGW A;  1EB2 A;  3GY8 A;  1QJ6 B;  1ZTK A;  2A7C A;  1UVO A;  1YM0 A;  1P11 E;  3RM2 H;  4NSY A;  2FES H;  3PV5 A;  4TWY A;  1GHV H;  3FP6 E;  1EXF A;  4E7R G;  2Z7F E;  3H7T A;  4B71 A;  1GBD A;  3VB3 A;  3M7U A;  1O2Z A;  3QK1 A;  1G3E A;  2Z9K A;  1QRX A;  3BSQ A;  4HZH A;  4DVA U;  4HTC H;  1T7C A;  3UNS A;  6CHA B;  2RFK C;  1EOJ A;  1GBC A;  4Q2K A;  4JCN A;  5B6O A;  2CJI A;  1EAW A;  1GCD A;  3ELA H;  3ZV8 A;  1W0K D;  3U8T H;  1AD8 H;  1LHG H;  2QF4 A;  3A7X A;  4OM9 A;  4K2Y A;  1Z7K A;  3FZD A;  1ANC A;  4HGC A;  3SOR A;  2F4L A;  2VWM A;  3NKK A;  3MU0 A;  1TGC A;  1NFU A;  3KQ5 A;  1P04 A;  1S81 A;  2AMQ A;  5EJL A;  3V7T A;  4Q7X A;  2ZCK P;  2ZDK A;  1M9U A;  2ZO3 H;  3PMH B;  3PLP A;  1HB0 B;  1SQO A;  4TY7 A;  5B6L A;  4I8K A;  1ZSL A;  5PTP A;  3ZYE A;  5F8T A;  1O3O A;  4X8T H;  9LPR A;  2BXU H;  1MZD A;  3VPK A;  3KHV A;  1LVO A;  1TYN A;  4BAO B;  3OE7 D;  2PGB B;  1YCP K;  4GUX A;  3W94 A;  1PPH E;  2FM2 A;  1RGQ A;  1F0S A;  1MCV A;  1AQ7 A;  6LPR A;  2J98 B;  1F5R A;  2PV9 B;  4WJG 2;  5CHA B;  1C1N A;  3GCH C;  2BDH A;  2A7J A;  5FAH A;  1OWJ A;  1P01 A;  2I6Q A;  4JZF H;  2L74 A;  2PP6 A;  1H8D H;  1WCZ A;  4D9R A;  2O8M A;  1E1Q D;  1C4V 2;  1P2K A;  4F4O C;  3RXP A;  3UNQ A;  4TT3 D;  1TBR H;  1IQH A;  1HAY B;  1N1L A;  1N8O C;  3VB5 A;  1HAX B;  1YF4 A;  1PQ8 A;  3Q3K A;  2H9E H;  1T4V H;  3P92 A;  4X8S H;  3ZVB A;  3LIW A;  4FUD A;  1DY8 A;  3NCL A;  1JRT A;  3RXR A;  2VGC B;  4KTS A;  1FY5 A;  3N99 A;  1VIT H;  3ATW A;  2ZU4 A;  3H7O A;  2PKS B;  1QNJ A;  1BBR H;  3R0F A;  4D7F A;  2K0Q A;  3D23 A;  4KP0 A;  1RTK A;  1WOF A;  1TA2 A;  5L2Y H;  5HXF A;  1QL8 A;  4NZQ A;  1ELF A;  2BTC E;  1KDQ B;  1SG8 B;  4IBL H;  1OPH B;  4FUH A;  2AEI H;  4FET A;  1THS H;  4Q4L A;  1HFD A;  4F49 A;  4IS5 A;  1E38 B;  1TNL A;  3UOP A;  2FLB H;  4B75 A;  1TLD A;  1BRA A;  5DP3 A;  2A5I A;  1Y8T A;  1MTS A;  1BBR E;  1K2I 1;  3W1E A;  3G01 A;  4INH A;  2J9N A;  1DX5 M;  3ZZD A;  1DST A;  1GL1 A;  1NPM A;  3BIU H;  1AO5 A;  1T8O A;  3T28 A;  4ZRO A;  3AVZ A;  2PTN A;  1C5N H;  4ZHM U;  2BVS H;  3FKS D;  4XOJ A;  3SU0 A;  4AGK A;  3QTV H;  1MAB B;  1JIM A;  3ZZ7 A;  5C5N A;  1BOQ A;  1TQ7 B;  3MO9 A;  3QDZ B;  2C93 B;  4ABI A;  3M5L A;  2EEK A;  3S7K B;  4NG9 H;  1C5R A;  5LPF A;  2ZPS A;  2Z3C A;  1VIT F;  1E35 B;  1J16 A;  3SJK A;  4H6S B;  1RFN A;  1CE5 A;  3GY4 A;  3MYW A;  3TU7 H;  3VGC B;  3ZVA A;  2OK5 A;  1DT2 A;  4JYV H;  1W7G H;  1T31 A;  3B23 B;  4YXW D;  3GCT F;  1GG6 C;  2QXI A;  4QT8 C;  4I31 A;  2G52 A;  1C1W H;  4AYY B;  4UDW H;  2OD3 B;  4OS2 A;  3F2H A;  1MAX A;  2J98 A;  5DGJ A;  5GIB A;  4R8T B;  4UE7 H;  5KGO A;  2ZFQ H;  2FO9 A;  5ETX A;  2BD7 A;  2TPI Z;  4BAK B;  4Y0Z E;  3DUX H;  2BZ6 H;  1KLJ H;  3OYP A;  1XMN B;  1C4U 2;  1MZA A;  2XBW A;  4NWK A;  5EW2 H;  1Z71 A;  1FAK H;  1ETT H;  1O2X A;  4MG3 A;  2AMD A;  3MU1 A;  1SGT A;  1XVO A;  2B7D H;  2VJ1 A;  2OQ5 A;  2F43 B;  4YOJ A;  1AKS A;  5AFY H;  1BT7 A;  1A7S A;  2FX6 A;  1UMA H;  4VGC B;  5F53 A;  4K1E A;  3BTH E;  2RA0 A;  5K0H A;  4BXS A;  1GJ8 B;  4WMF A;  4X6P A;  3LJJ A;  4A6L A;  1WBG B;  4YOI A;  2XC4 A;  3OY5 U;  2FOH A;  1D3D B;  3TJU A;  3GDU A;  2CHA C;  2A4O A;  1AGJ A;  5A2M H;  3P6Z B;  4WWY A;  4AG1 A;  3ZYD A;  4Y79 A;  1DIC A;  2FOD A;  2Y81 A;  1ABI H;  1LO6 A;  2PUX B;  2F9P A;  2GZ9 A;  1IHS H;  5TCA A;  2BDB A;  1B0E A;  2ANW A;  1G2M A;  1UHB B;  1GBK A;  5F8X A;  1KDQ A;  1Y3X A;  2IN2 A;  4UD9 H;  2ZEB A;  1G3D A;  2EST E;  1UCY E;  1O2N A;  2OCV B;  1W2K H;  3A7W A;  3LON A;  2EC9 H;  1EB1 H;  3A7V A;  2XXL A;  1K1P A;  5EOK A;  4IC5 A;  1Y3W A;  2VWN A;  3UFA A;  1O2L A;  2P3U B;  3AAS A;  1LDT T;  1P05 A;  2A32 A;  2ZCH P;  4KKD A;  2SFA A;  4OGY A;  2M5T A;  1OWD A;  1UK2 A;  1JBU H;  1WUN H;  1EJN A;  2SGF E;  2WPK S;  2SGQ E;  4ZH8 A;  2FPZ A;  5E0G A;  5EST E;  5AFZ H;  1A0J A;  2ZHE H;  3BTG E;  3GIS B;  2ZI2 H;  3UAI C;  2KCA A;  2BD8 A;  2ZPR A;  5E2P A;  1A0L A;  2GZ7 A;  1FY4 A;  2QC2 A;  1HJ9 A;  4BTI B;  1ZRK A;  2PHB A;  1LCY A;  1FY1 A;  3GCT G;  4MLF B;  2AHM E;  4CRF A;  2VWL A;  1O3H A;  1O3M A;  2ZP0 H;  1TAL A;  3S9B A;  3Q3X A;  2BQW B;  2G81 E;  3E3T A;  1DXP A;  2HOB A;  2UUF B;  2WYG A;  2JJ1 D;  2ULL A;  1O3F A;  4JK6 A;  1QBO A;  5F03 A;  1XVM A;  1CSO E;  4KEL A;  1W0J D;  1UVT H;  1V3X A;  4GHT A;  3V0X A;  3A83 A;  3SU6 A;  3T2N A;  2LPR A;  1HJ8 A;  2VB0 A;  5EOD A;  3RXV A;  1GHB F;  3BG4 C;  3O8C A;  2ZHQ H;  3RXO A;  1O5E H;  3VEQ B;  1CBW C;  2GP9 B;  1K22 H;  1ZTL A;  4H6T A;  5E0H A;  1GMD G;  1HLT H;  5C0T A;  1DVA H;  1GL0 E;  2A2X H;  2OLG A;  2ZGC A;  1BBR K;  3E16 B;  1NFX A;  2Q1J A;  3NRL A;  3O8R A;  1WTH D;  2ZFP H;  1G3C A;  3RXI A;  3DT0 H;  2H2Z A;  1SGC A;  1WV7 H;  2FOM B;  5DP6 A;  1V2K T;  1BMM H;  1THR H;  4B6E A;  4XRN A;  1AIX H;  3AK5 A;  1IQE A;  4B2B A;  2PR3 A;  1V2M T;  2A4R A;  2H5C A;  3K6Z A;  1C9P A;  1COW D;  3S7H B;  1O5C B;  3HKI B;  3RMO H;  2ANY A;  3F9F A;  1MQ6 A;  1FDP A;  5J4Q A;  4BAH B;  4K8B A;  3RML H;  4NFE A;  4CRA A;  5HIY A;  2QE7 D;  3A84 A;  1KTS B;  3ATL A;  2ZU5 A;  1WYK A;  1BB0 B;  1EQ9 A;  1G30 B;  1Q2W A;  4AC9 A;  2A7H A;  3S69 A;  2GT7 A;  5EJ1 A;  1E79 D;  3W95 A;  2HNT C;  1MMJ N;  5HM2 A;  2VIN A;  4CH8 B;  1LQD B;  3KQD A;  3RU4 E;  4I32 A;  1GCT B;  3A82 A;  3BTQ E;  1O37 A;  1C1U H;  3KQE A;  3SQH E;  2FEQ H;  3GOV B;  1SB1 H;  1NFW A;  1P9U A;  1GI1 A;  1KSN A;  1O3E A;  1BRC E;  2W6I D;  3A89 A;  4CBO A;  1C5M D;  2Z3E A;  2BM2 A;  2VIQ A;  1OX1 A;  2GV6 A;  3MH6 A;  2CMY A;  1QB6 A;  3M3S A;  3RXL A;  3M61 U;  3SV6 A;  1TMU H;  5L2Z H;  1GJ4 H;  4AFU A;  3ZVC A;  1TX7 A;  2J94 A;  5F8Z A;  2A5A A;  1NY2 2;  1KXC A;  1YGC H;  3ZVD A;  4ABE A;  3MH7 A;  1BRB E;  1S0R A;  1G32 B;  1ZGI A;  1ZJD A;  2B5T B;  4GHQ A;  3MNS A;  2V6N A;  1SSX A;  1TQ0 B;  1N8O B;  2GDE H;  1DWE H;  1L1G A;  3RXT A;  1MKX K;  4IW4 E;  2UUJ B;  2OXS A;  1HAI H;  1SC8 U;  1GHA F;  2YMS D;  1P06 A;  1HAG E;  2ZGJ A;  3T27 A;  3S9A A;  1EZS C;  3L6P A;  2PWX A;  1UCY H;  1C2H A;  1L4Z A;  2ZQ1 A;  5EXL A;  5JB9 S;  4GCH G;  3DA9 B;  1TAB E;  3TVJ B;  1HIA B;  2ODQ A;  1LMW B;  1HGT H;  1LHE H;  5K7R A;  1WDI A;  4Z1M D;  2GCT B;  5ABW A;  3S9C A;  1LPK B;  5A0A E;  3FOA A;  5EJZ A;  3RXM A;  2GV7 A;  2SNW A;  1ETS H;  4JYT A;  4KGA A;  4JYU H;  1DAN H;  1W11 U;  1P03 A;  2WV4 A;  1P8V C;  2ZIQ H;  1NRP H;  2A1D B;  5FCK A;  5F6M A;  1V6D A;  1XUI A;  5C2Z A;  2BVR H;  4B2A A;  1UK3 A;  1ELD E;  3MWI U;  5BPE A;  3TK5 A;  1T4U H;  1TAW A;  2BXT H;  1BMN H;  2FI5 E;  1D3P B;  1HXE H;  2RDE A;  2Y7Z A;  3V13 A;  1ANE A;  1RIW C;  1PYT C;  2F9V A;  3TNT A;  4FU7 A;  1MU8 B;  3SHC H;  3BTF E;  1ELA A;  1EPT A;  3K2U A;  1TMT H;  2BLQ A;  4NIX A;  3MO6 A;  1C5U A;  4IC6 A;  1W13 U;  3BIV H;  5FBI A;  4UON A;  4ZXY H;  2EI8 A;  2Q6G A;  1GJ5 H;  1LHF H;  3SW2 B;  2D1J A;  4RKO B;  4ZKN U;  1C5P A;  3BTE E;  2DE9 A;  4WMD A;  6GCH F;  2FI4 E;  2SGD E;  2VH6 A;  3GY7 A;  1AY6 H;  1O3N A;  4X8U H;  3SGB E;  4E05 H;  1MH0 A;  1O2Q A;  1GBM A;  5FL7 D;  2F83 A;  4I33 A;  5JBA S;  1O2T A;  1HAO H;  1O39 A;  1QHR B;  1ZGV A;  2H1U A;  2V3H H;  3QGN B;  1W10 U;  2BD5 A;  1YP9 A;  3RM0 H;  4RT0 A;  3SQE E;  2UUK B;  4MPU A;  4X2V A;  1AFE H;  1EKB B;  1XM1 A;  3QWC H;  2OBO A;  5FCR A;  2Y5H A;  4M7G A;  3P8G A;  3GY2 A;  1AFQ C;  2QAA A;  1FI8 A;  3WW7 A;  4MNW A;  1GMC F;  1VGC B;  1MKW K;  1P09 A;  5GDS H;  1GWA A;  1EJM A;  2FYR A;  4IMQ A;  1CO7 E;  1O5G H;  5HMA A;  3DSO A;  4ZUH A;  3SUE A;  2WPI S;  1ZLR A;  3HGP A;  1FY8 E;  1Z8G A;  3M7Q A;  1XUK A;  2XRC A;  2QYI A;  1QUR H;  2ZC9 H;  4ASU D;  4CRD A;  1EAT A;  2K1Q A;  2W7U A;  3BG8 A;  3E91 A;  1BDA A;  1GI4 A;  1FON A;  3MU8 A;  2I6S A;  5GND A;  1MUE B;  4WXV A;  2PUQ H;  1BMF D;  4NIV A;  4B76 A;  3LT3 A;  4TSF D;  2Z9G A;  3RMM H;  4CBN A;  3E1X B;  3TIT A;  3OTP A;  4M9F A;  1DLK B;  1W14 U;  1Q3X A;  1ZOM A;  1O5A B;  2ZDL A;  1GHY H;  2GD4 B;  1C1P A;  1ZR0 A;  4I8L A;  1NRQ H;  1GBL A;  3GIC B;  8GCH F;  1SFQ B;  3EQ0 H;  1SGP E;  3GYM A;  1FN8 A;  2HLD D;  1A3B H;  2VVU A;  4AFZ A;  3P8O A;  3TH3 H;  1FIW A;  1MTN B;  3VB4 A;  1NRO H;  3FP8 E;  1H9I E;  4NIW A;  5EXN A;  2G4U A;  2FX4 A;  5LH8 A;  3MNC A;  2KCO A;  1RRK A;  1O5D H;  1FIZ A;  4A92 A;  1S82 A;  1HPG A;  1YKT A;  1O3I A;  4K5Z A;  1ZHR A;  1C2J A;  1NES E;  3TPI Z;  1WQS A;  2Y6T A;  2OC0 A;  2ZWL H;  3MFJ A;  2V0B A;  5E0J A;  2BD9 A;  1SLX B;  5IDK A;  3E0N B;  5JDU B;  1MBM A;  5GCH F;  4X2X A;  2H9H A;  3A8A A;  3U1I B;  3WY8 A;  2BDG A;  4NA9 H;  1EZU C;  3U98 H;  5DJ7 A;  1YLD A;  3Q76 A;  4ZCN A;  1NS3 A;  2NU2 E;  4ABB A;  5CE1 A;  3F9H A;  4AN7 A;  4ISN A;  1PFX C;  2EQN A;  1BIT A;  2TGD A;  1QRW A;  3P70 B;  3U69 H;  2FS9 A;  1AMH A;  2Y82 A;  2OC8 A;  3PRD A;  5T6F A;  1VR1 H;  2FYQ A;  1GJ9 B;  1NBM E;  1ORF A;  1A1R A;  1P2Q A;  3CEN A;  1C1V H;  3M36 A;  1D3T B;  1O3B A;  4F55 A;  5C20 A;  2EI7 A;  2TGA A;  2PKA B;  1IQN A;  1H9H E;  4I8H A;  3GCO A;  3EA7 A;  3LDX H;  2R3Y A;  2ZGH A;  4DT4 A;  1C2M A;  2FOF A;  2GDD A;  2Y5G A;  2ZPQ A;  3RXA A;  2C8W B;  4WXI A;  1A5I A;  5EQR A;  1TOM H;  5T3H A;  2QV1 A;  1QB9 A;  1C4Y 2;  3A7Z A;  3F0O A;  1PQA A;  1FV9 A;  1PPB H;  1C9T A;  1TA6 A;  3TK9 A;  1SFI A;  5GPI B;  3I77 A;  1O2M A;  3H5C B;  4OS5 A;  4ZHA A;  1QFK H;  1O2O A;  4WH8 A;  1TON A;  1C5O H;  2P3T B;  1T32 A;  3ATK A;  1QQU A;  3BTT E;  1V2V T;  2ALP A;  5C1Y A;  3UR6 A;  2Z9J A;  2R2W U;  3TH2 H;  5DP4 A;  1EPT C;  1EOL A;  3F0P A;  1ELE E;  1ARB A;  3KEE A;  3KQB A;  1C2D A;  3KNX A;  4NA8 A;  1EST A;  1KLT A;  1SHH B;  5E8E H;  1GCT C;  1L1J A;  2ZA5 A;  1KYN A;  5I46 H;  1SPJ A;  3A7Y A;  3S0N A;  1Y3V A;  2FTM A;  3Q00 A;  5JPM H;  1O3P B;  3T5F H;  7EST E;  1ACB E;  2Y7X A;  5H4I B;  3SJ9 A;  1GGD C;  3T29 A;  2RG3 A;  3U1J B;  3RC6 A;  2XWA A;  1Z1I A;  3M5N A;  2XBX A;  5CDF E;  2FXR A;  4K1S A;  1OWK A;  3A81 A;  2GZ8 A;  3LGY A;  7LPR A;  1GBB A;  2GKV E;  1NC6 A;  1UTQ A;  1A5G H;  1K28 D;  5DG6 A;  3E90 B;  2ZFS A;  1C5Z B;  2IPH A;  3RXG A;  4DJZ B;  1SLU B;  3O8D A;  4DUR A;  1UVS H;  3M5M A;  3MQK C;  1YCP M;  1A3E H;  3SN8 A;  1QA7 A;  1ZMJ A;  2QXH A;  4MPW A;  1AUJ A;  1MU6 B;  1XXF A;  2ZU1 A;  1IAU A;  1SGD E;  2UWL A;  1GJD B;  3I29 A;  1OKX A;  1GDQ A;  3D49 H;  1AFQ B;  3C1K A;  1GI7 B;  2P59 A;  1F7Z A;  1P3E A;  3SU4 A;  1SKY E;  3DFJ A;  5EPN A;  1W12 U;  3ITI A;  4I7Y H;  1MAY A;  1QBV H;  4GAW A;  3ZZ8 A;  1TNK A;  1XXD A;  4DIH H;  2XBV A;  4D7G A;  5JBC S;  4DT7 B;  1NFY A;  1GI2 A;  1EP6 A;  3UR9 A;  4JZD H;  2VID A;  1FQ3 A;  1AVX A;  1NRS H;  1OWH A;  2ZHF H;  2BD4 A;  4X1S U;  1AB9 C;  1K0H A;  4NSV A;  2VBC A;  2ZZU H;  1GJB B;  3LC5 A;  1J8A A;  4ISO A;  4D76 A;  2O8U A;  4Y0Y E;  2PKA A;  1E37 B;  1AVW A;  4DW2 U;  2AMP A;  1F0T A;  1NT1 A;  2ZU2 A;  2O9Q A;  3PO1 B;  3R3G B;  3URD A;  5GJ4 B;  1G9I E;  3IG6 B;  1O3D A;  4LOY H;  1LPG B;  3GDV A;  4CHA C;  4ZXX H;  4INL A;  1YWU A;  1KXA A;  1ELG A;  3SZN A;  3DFL A;  3PLK A;  2CN0 H;  4ZMA H;  1GPZ A;  1ZSK A;  3FAN A;  1VJA U;  3OFN D;  3SO3 A;  1OP8 A;  2RDL A;  4HFP B;  1DOJ A;  4Y11 E;  1AWF H;  1F92 A;  5C1U A;  3TJN A;  1LHD H;  5C94 A;  4UEH H;  4Y6D A;  3C27 B;  1CGJ E;  1SI5 H;  3VG8 A;  1LQE A;  3OU0 A;  2ZQ2 A;  2GJG A;  3SNE A;  1OSS A;  1TPA E;  2BQ6 B;  1YPG H;  1FLE E;  4Y8Y A;  3F3B A;  3PM3 A;  1O2W A;  4IN2 A;  3H09 A;  3NPS A;  1H8H D;  3ZVE A;  1YLN A;  5DP9 A;  1AE8 H;  2OTV A;  2XBY A;  1BTZ A;  1P02 A;  3T26 A;  3DHK H;  1HAZ B;  4TPY A;  2QA9 E;  2A31 A;  4MDS A;  1L0Z A;  3TGK E;  2WV5 A;  2PLX A;  1RIW B;  4TY6 A;  2AS9 A;  2F9B H;  1TRM A;  1S83 A;  2VNT A;  4CH2 B;  3QZQ A;  1BQY A;  1CHG A;  1UVU H;  1HJA C;  1PPC E;  5CHB A;  3LH1 A;  1TE0 A;  3EST A;  2DUC A;  4J1Y A;  2W7S A;  4E06 H;  3BTW E;  3BF6 H;  4I86 A;  1ZPZ A;  1N6Y A;  1P2N A;  2ZDM A;  3MO3 A;  1V2U T;  1E0F D;  1KXE A;  1L4D A;  3ZZB A;  4FUB A;  5A8Y A;  1GBF A;  1SBW A;  1GI8 B;  1BMA A; 
#chains in the Genus database with same CATH homology
 4WH6 A;  3OEE D;  3SU1 A;  2WPD D;  3PV2 A;  2F9U A;  4I31 A;  3ZIA D;  4A1V A;  1H8E D;  2KR7 A;  5T1V A;  1W0J D;  3F2H A;  2A4Q A;  3DCL A;  3WWF A;  1E1R D;  3DSP A;  4Q63 A;  4R8T B;  2YMS B;  5EQS A;  2K8I A;  2KZ4 A;  3OAA D;  3P8N A;  4U01 A;  3SU6 A;  4XD7 D;  5ETX A;  2OBO A;  3SUF A;  1CU1 A;  2OC8 A;  3PRD A;  3LOX A;  2QF5 A;  3OYP A;  1S6L A;  3O8C A;  2JDI D;  4NWK A;  1NBM E;  1A1R A;  2YOL A;  2YMS D;  2IJO B;  4F55 A;  2M2A A;  2V7Q D;  3FO8 D;  2O8M A;  1E1Q D;  2KCP A;  2VBC A;  3L6P A;  5ESB A;  3WW7 A;  5C0T A;  5HKK D;  4TT3 D;  5EQQ A;  4B74 A;  5C0U A;  2F43 B;  2LEL A;  3NRL A;  1N1L A;  3F2F A;  3SU5 A;  3O8R A;  2XOK D;  3FN8 A;  2XNI A;  1BT7 A;  2OIN A;  3N7D A;  4KTC A;  2XND D;  3DSO A;  5F53 A;  4DT4 A;  4YXW D;  3SUE A;  2FOM B;  5FPT A;  1OHH D;  5GJ4 B;  5EQR A;  5IK2 D;  2QV1 A;  1DY8 A;  4B6E A;  2JIZ D;  2A4G A;  3N7E A;  4Z1M D;  3AK5 A;  3N99 A;  3FOA A;  3F0O A;  2A4R A;  4ASU D;  4B73 A;  2XCN A;  2K1Q A;  1COW D;  3SUD A;  1W3C A;  2K0Q A;  5GPI B;  3KN2 A;  3SZE A;  4WF8 A;  3OFN D;  3PV5 A;  5GND A;  2OC1 A;  2J5U A;  2CK3 D;  3KF2 A;  4WH8 A;  1BMF D;  1KMH B;  4B76 A;  4TSF D;  3SUG A;  3SU3 A;  3EYD A;  2XCF A;  3OTP A;  4K8B A;  2GVF A;  2WSS D;  4M9F A;  4B71 A;  1DXW A;  3F2G A;  1NBM D;  3RC5 A;  4FET A;  3F0P A;  4Q4L A;  2WZQ A;  3KEE A;  2QE7 D;  2W6J D;  5DN6 D;  2KFW A;  3KNX A;  3VG8 A;  4B6F A;  3O8B A;  3LON A;  4B75 A;  4RI0 A;  2HLD D;  3F3B A;  3SV7 A;  4A1X A;  1W0K D;  2QF4 A;  3M5O A;  3H09 A;  1WXR A;  4OM9 A;  3SV9 A;  3P8O A;  2F9V A;  5H4I B;  1H8H D;  1E79 D;  5FPY A;  3W1E A;  3RC6 A;  3U1J B;  3M5N A;  1EFR D;  5CDF E;  1RTL A;  2F4L A;  3UB0 A;  4TYD A;  2WHX A;  4I32 A;  3LKW A;  3RC4 A;  2KCO A;  2KM0 A;  2WV9 A;  4A92 A;  3E90 B;  3PRB A;  3SV8 A;  3SYJ A;  3FKS D;  3GS9 A;  1FX0 B;  2OC7 A;  3SU0 A;  3WWB A;  3O8D A;  2KCA A;  5EPY A;  2GGV B;  3M5M A;  1MAB B;  2W6I D;  4JMY A;  2FP7 B;  5B6L A;  2L6O A;  5C17 A;  2KCY A;  2IJD 1;  3OEH D;  5CHB A;  2OBQ A;  3M5L A;  5EPN A;  2OC0 A;  4A1T A;  2AHM E;  2JJ2 D;  3OE7 D;  1JXP A;  5IDK A;  2YMS C;  4NWL A;  3SV6 A;  1DY9 A;  5DSF A;  5FPS A;  2P59 A;  3U1I B;  2OK5 A;  2FM2 A;  5FL7 D;  1RGQ A;  3SU4 A;  1SKY E;  4I33 A;  3SU2 A;  1DXP A;  4ZCN A;  1NS3 A;  2JJ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...