4Q63A

Crystal structure of legionella uncharacterized protein lpg0364
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
YFRLKNHGEINASLDNNSIEIVEISSNGAVVVKQKTDIPKEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Legionella Uncharacterized Protein Lpg0364
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Unknown function
molecule keywords Uncharacterized protein Lpg0364
total genus 23
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.430 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4q63A00
4Q63A
chains in the Genus database with same CATH superfamily
2HPPH 1JBUH 2VVUA 3GY3A 3BTFE 3QWCH 5GNDA 3VB5A 2OC8A 3E6PH 1HUTH 1Z1JA 1W0YH 1MTNB 3F9FA 1SGCA 4JK6A 2FI4E 2WPJS 2ZZUH 4TT3D 3DD2H 4Y0ZE 1MTSA 2GX4A 3DUXH 3GY4A 3QLPH 4FU7A 5I46H 1YKTA 1BRUP 3M61U 4NZQA 1O3IA 1EJMA 4OS7A 1K28D 2G00A 1THPB 3SN8A 3A89A 4WY3A 3A88A 2PP6A 1C5RA 1O2PA 2AFQB 1GBHA 1EAUA 1GCTB 1IQFA 3M3VA 3LGIA 1GBAA 5AFYH 3SUEA 2QC2A 1HLTH 2QXHA 3RMMH 4FUBA 1SGRE 3EAJA 2J95A 1C5SA 3UNQA 3RXOA 2A5IA 2LELA 2Y82A 1QJ6B 4Y8XA 4Y8YA 5FX5A 2J9NA 1YLCA 4CHAB 1G2MA 4O97A 1DWDH 1N6XA 1XM1A 2IJD1 2W6ID 3K6YA 5B6OA 2ZFRH 3F2GA 1EZXC 1MKWK 1QBNA 3RXAA 2SGPE 3U8RH 1TBRH 1LPGB 1SL3A 2VIPA 2XWBI 1P9UA 5T6FA 3PV2A 4YOGA 1DPOA 3MMGA 1V2VT 1V2QT 2A4GA 3U28C 3KGPA 5HM2A 3RLYH 2V3HH 5DPAA 5KECA 1GVLA 2A31A 1C2KA 2ZA5A 2KAIA 3P8GA 1MU8B 1ELVA 3LJJA 3A82A 1W7XH 2F9UA 2GT8A 1D6WA 5DK1A 1W2KH 2FOBA 1MBMA 1TNKA 2ZDLA 1P0SH 5KEDA 3RM0H 2HALA 4I8HA 1J16A 3MQKC 1O3GA 3Q76A 2V3MA 2Y80A 4QT8C 1XUFA 2AGEX 3BEUA 3SQEE 4MNYA 2GT7A 2VWOA 5J4SA 1C1TA 3GDUA 3RXKA 2SGFE 3S9BA 2GVFA 3KF2A 3RXVA 2XCNA 5DP6A 1FY4A 1O5DH 4Y8ZA 2J2UA 2WSSD 3LPRA 1O2IA 5DN6D 2WUBA 1VCPA 3MU1A 1YPKH 1TGNA 1FPCH 4YTAA 1PPHE 2CN0H 2W6JD 4RSPA 7ESTE 3Q00A 1YPHE 4LXBH 4UDWH 2BD5A 5B6LA 2XC0A 4FUJA 3STJA 3P8NA 1T7CA 1MTVA 4B75A 1VITF 2J34A 1C2DA 2FOGA 2NU4E 3RLWH 3RXQA 1SPJA 1TONA 3JZ2B 4KTCA 1CE5A 2UWLA 1O3OA 3MU0A 1B0EA 2ZGCA 4Y71A 2BD9A 1Y8TA 2SGQE 1SLVB 2BD4A 2XCFA 1KLTA 5A2MH 1W3CA 4O3UA 2UUFB 4B2AA 1ID5H 2FS8A 3U9AH 2QF3A 3FANA 1O2TA 1TGBA 3HPTB 3KNXA 2FXRA 1QB9A 2BX4A 5JB8S 3LONA 2KFWA 3A7TA 1OSSA 3LGWA 1GBMA 5E8EH 1Y5BT 3MU5A 1OP8A 4TWWA 5CHBA 2ZECA 3A80A 5FBEA 1GCTC 2HWLB 1C4U2 1IQGA 1G3EA 2PWXA 1GI5A 2SGEE 3B23B 3GCOA 1OOKB 2LPRA 3A87A 4MPWA 2QCYA 1XUKA 8ESTE 4D9QA 1O35A 3TJUA 1OYQA 2XC4A 3A8DA 2OP9A 1ESBA 3PO1C 3A83A 1C1MA 2VU8E 4NFFA 2OINA 1GG6C 4B6EA 2QXGA 2IJOB 4XD7D 3SI3H 1T4VH 1V2UT 2BXUH 9ESTA 4B2CA 1ZTJA 3QN7A 3VGCB 5J4QA 4AG2A 2DE9A 2KZ4A 3FZDA 2FP7B 1TGTA 5C17A 1C2FA 5CHAC 3BG4B 1FZZA 2ZHQH 3SW2B 1NU7B 1AWFH 2VWLA 4A1TA 3P92A 1HYLA 5F03A 4TY7A 2GZ8A 3ZVEA 3F0PA 4TPIZ 2BLQA 1CT0E 1QA7A 3LKWA 5EIYA 2G5VA 2GDEH 2GDDA 2Z9JA 4KKDA 1YPEH 2J97A 4FXGH 3UQOA 3FP6E 2TPIZ 3TJNA 1BBRH 1C5WB 1F5RA 2A4OA 1C5NH 2BLVA 2NWNA 4E06H 1K1JA 2AHME 1FONA 1G37A 1T8MA 2ANKH 4NCYA 1DSUA 2I6QA 3K6ZA 2HOBA 2OC7A 3R0FA 1GDUA 1P2KA 1SLUB 1KTSB 4ABAA 1UCYH 3BTDE 1HB0B 1NN6A 1GJDB 1MQ6A 4ZKRU 3OX7U 3P70B 4LZ1H 5JBCS 4U2WA 1BMFD 2WPLS 3BTTE 3SU5A 3GDVA 4YXWD 2JH6D 3MO3A 3NPSA 1COWD 1W14U 2TGTA 1C1UH 1C1VH 4WVPE 4FVBA 2J5UA 2OQ5A 4A7IB 1QGFA 4XSKU 1QFKH 2QF0A 3P8OA 1Z7KA 1C1SA 1MABB 3MHWU 3ZZ3A 1GBKA 3UAIC 3MYWA 2OK5A 1ELFA 1GGDC 1W0ZU 3PLPA 4U01A 2JKHA 2ALVA 2EI6A 5ESBA 1ZPBA 5C5OA 1QR3E 2GV7A 2OTVA 4KTSA 2HRVA 1SVPA 1WAYB 3SUGA 1ZPCA 3STIA 2VIWA 4B71A 2Z3EA 5EW1H 1VCWA 3WWBA 4BNRA 3NUMA 1ZMLA 2ZWLH 4ZKSU 1T8LA 3SJKA 4IW4E 1BJUA 3LGVA 1ZSJA 1QRWA 2FO9A 3MH4A 1O31A 2XC5A 1DS2E 1SSXA 4WH8A 3M7UA 1ORFA 1L2EA 1IHSH 4CH2B 2G81E 1GMHG 1SGFG 1TYNA 1LHCH 2P3FH 1FPHH 1K1OA 4Z0KA 2WYJA 1HIAB 1EOJA 3AAUA 3UOPA 2CGAA 1AIXH 2ZFTA 3PV4A 1H4WA 1F0RA 1P05A 2G8TA 3AVZA 1GL0E 3RXBA 2O9QA 1A0LA 1IQJA 1HAHH 3O8BA 3ZZ7A 1WU1A 1JMOH 3O8RA 1S6LA 1ZTKA 1P3CA 1F0UA 3SZEA 4ZKOU 4MPVA 2PUQH 4ABIA 1KDQA 3MH6A 5EODA 1C2EA 1T32A 1FI8A 3B8JA 2VVVA 1H9LB 3KQ5A 1C5PA 4MNWA 3UOUA 1SKYE 3K9XB 5E0HA 1GJ8B 2CJIA 3H7OA 1EZQA 5BPEA 1HRTH 1KDQB 3ELAH 4BAKB 2ZEBA 4GSOA 2ZDNA 2BVRH 3GYLB 3MWIU 1BMAA 1C5QA 7GCHF 1HAZB 1DVAH 2G4UA 1U6QA 4FUHA 1YBWA 4MDSA 2BD8A 1GL1A 3KQBA 3P6ZB 1ZGVA 3M5NA 1O2HA 3TU7H 3SU1A 1O30A 1C9PA 3SU6A 1K9OE 1Y59T 1C2LA 4U32A 3ZZ4A 2SNWA 1JRTA 1ELEE 2ZDMA 1TA6A 3GY5A 1UMAH 1C2MA 3GCHB 2PGBB 2HNTC 3LC5A 3RMLH 3UY9A 1EPTB 4DURA 5AVDA 2CHAB 1B7XB 1MMJN 1G9IE 2I6SA 2UUJB 3F2FA 5EJ1A 3TK9A 2FTLE 2P59A 4YM9A 1ABJH 1DLKB 3AW0A 2Z7FE 1AFQC 5DO4H 3TVJB 2A2XH 1MBQA 2TGDA 5TCAA 4RT0A 1RGQA 3ZZ5A 4GCHG 2PHBA 3OYPA 4MPXA 1G30B 4BANB 2QIQA 5EG4A 1K1LA 4CREA 2IPHA 1EUFA 2A0QB 1TMUH 6CHAC 3GOVB 1HAOH 1CBWB 2PGQB 1O3FA 2Z6BD 3UIRA 4IBLH 1EAWA 1FY3A 1AB9C 1Z8GA 1MD8A 1QHRB 3SGBE 5GJ4B 2EI7A 2J4IA 1DDJA 3A7ZA 3NCLA 3RXLA 6ESTA 1TIOA 1AGJA 3PLBA 1WTHD 1P02A 2BQ6B 1XVOA 4GUXA 1XXDA 5C67A 1PQ7A 1FQ3A 3BEIB 4K60A 3FKSD 1HAXB 6LPRA 3TK6A 1TBQH 4B76A 2CXVA 1A3EH 3Q3XA 2ZGXH 4AG1A 3GYMA 1O2OA 2V35A 2QAAA 2BYAX 5EU8A 1GI3A 1ARBA 3SJ9A 1F5LA 2P94A 1W13U 5DG6A 2J98A 1TRMA 4LOYH 3BTKE 1DWCH 2VVCA 1GI0A 3TNSA 3OEHD 1QL7A 2WINI 2D1JA 1YLDA 2PKAA 2VJ1A 1E37B 3SO3A 5AHGH 3WWFA 4PROA 5EXNA 1IQHA 2QF4A 2AYWA 4GHTA 4X6PA 1C1WH 1BQYA 3AW1A 1O38A 1OWEA 4ZROA 3N99A 3VB4A 4HFPB 3FVFB 2ZNKH 4E05H 1SR5C 3BTQE 1O33A 1G2LA 1QZ8A 2CK3D 3RXJA 3A8BA 1LKAA 4Q2KA 1G36A 4HI3A 2B7DH 5T3HA 4BAMB 2Z3CA 3KQCA 4KTUA 2DE8A 4D76A 1GBJA 3LDXH 1OP2A 3VG8A 1GBBA 1D3QB 1SOZA 4BTUB 4RKOB 2K1QA 1ZHPA 2L6OA 2R2MB 2ILNA 1TA2A 2FODA 1O2VA 1GHVH 2ZPQA 3E1XB 1C1QA 4WXIA 4AN7A 2P3UB 5C1UA 4MLFB 4DIIH 4WF8A 3TH3H 3M3TA 3SORA 1Z6JH 4MPUA 5ETXA 2VINA 4AFQA 5LH8A 2H9TH 3D62A 3C27B 1O2GH 4MTBA 3ZVGA 2ZU1A 1W12U 1BB0B 1NTPA 2QA9E 4INKA 1OXGA 4XE4A 2R3YA 3FFGA 1A2CH 1V2LT 1VITH 4CBNA 1LPKB 1RTFB 2VWNA 2ZFSA 3MI4A 2F9PA 1Z8IB 3F3BA 1DE7H 4GHQA 3V13A 1NFWA 5GPIB 3ZV8A 1SGNE 4K3JA 2XTTB 1CHGA 3ATMA 4NIYA 4JMYA 2KAIB 3SGQE 4Y0YE 1AUJA 1OP0A 4JZDH 2VIVA 3V3MA 3QO6A 5DJ7A 2F43B 3SHCH 1QB6A 1F0SA 1O2RA 1JIMA 1RIWC 2BB4A 3IG6B 3TITA 1TPSA 3N7DA 2RA0A 3FP8E 1GVKB 3TJOA 1YPJH 3DSOA 4ISLA 4B2BA 2R9PA 3V7TA 1H8ED 3U69H 1NFYA 1TPPA 4IN1A 2FWWA 5SGAE 1TMBH 4MQAA 1BTZA 4B73A 4ABEA 2P8OB 1ELDE 1C2IA 1DLEA 1BTPA 3E3TA 2QXJA 2G52A 1DY8A 4GCHF 4GPGA 3ODFA 3O8CA 2J94A 1BJVA 1GJCB 1P01A 3PB1E 3TK5A 4FU9A 4X2XA 3AAVA 1BRBE 2J92A 3H5CB 2ZO3H 3S7HB 5T1VA 2D8WA 1Y3XA 3A8CA 4CRFA 3PWBA 1WV7H 2C90B 3FAOA 5F8ZA 3DSPA 1RTKA 2Y5HA 1BITA 1V2ST 2ZF0H 4ISNA 3QTVH 2C4FH 1HAVA 2ULLA 2ZGJA 5EJLA 1XUGA 4UEHH 1CA8B 3E0PB 2GCTB 4TYDA 2TGPZ 4DW2U 2AIQA 2CV3A 1Z6EA 2F4LA 2F9NA 4X1RU 3DCLA 3FN8A 1IQIA 1S6FA 1F0TA 3NK8A 2VBCA 1TOCB 2HLDD 1LTOA 1SGIB 3ZZBA 4CRDA 3PO1B 1PPGE 4H42U 4Y7BA 3MNBA 3TJVA 4ZKNU 1MTNC 3GY7A 2M5TA 1H8DH 1LVMA 1TQ0B 4D8NA 1UTMA 1CGIE 2A5KA 2BZAA 2O8TA 3T28A 1BMLA 3VEQB 4BOHA 4O9VA 3NZIA 3SI4H 4ABDA 3BIVH 3OFND 1KLJH 1P10A 1E0FD 3QTOH 4YLQH 1ANCA 3BG4C 1WQVH 1SMFE 1ESAA 4OS5A 3PTBA 5LGOA 2BM2A 2BDIA 3KHVA 4A1XA 1SB1H 1YC0A 3PMHB 1L0ZA 3E0NB 3VGCC 3ESTA 3SV9A 1CU1A 2DUCA 2ZI2H 3T26A 3UTUH 1O2YA 2Y7XA 2XYAA 1JRSA 1HCGA 1QQ4A 2PKSB 1QIXB 1LKBA 2ZU5A 3EGKH 3FZZA 2L74A 2ZHEH 1ZPZA 1TABE 3ZVDA 1MZDA 1YCPH 1RJXB 3SGAE 5FXLA 5HXFA 1MQ5A 1FMGA 1ACBE 4IC5A 4UD9H 4LK4A 4D9RA 2O8MA 4NWLA 1V2WT 4ISIH 2H9EH 4ZHLU 3SNCA 1OYTH 3OE7D 4O03A 4CHAC 3F9HA 1N8OC 1UHBA 5HIZA 2KCOA 3GY2A 5DGJA 2ZDAH 4KELA 5FHTA 2WPMS 4X2YA 1ARCA 1J17T 1O3CA 2FS9A 4X1NU 3UNRA 2OQUA 5F8TA 1THRH 1GMDG 1ABIH 1TPOA 4E7RG 4NA7A 3Q3KA 5T6GA 2Z9GA 1P2JA 4FUCA 4ISOA 5JBAS 3PMAB 1FV9A 1A7SA 5EQQA 1WTGH 1EP5A 1GI2A 1TMTH 2WUCA 5C20A 1AU8A 2V0BA 5K7RA 2ZGBH 3RXRA 5LPRA 1UTPA 3F68H 2H2ZA 5C5NA 2FOAA 1RS0A 5GDSH 2VH6A 2W7SA 4XFQA 2O8UA 1O2LA 1E1QD 1VR1H 2GGVB 1VZQH 2SGDE 3SV6A 3ATLA 4Y7AA 1QRZA 3A81A 1VJAU 1SHYA 3BTWE 3PYHA 2AIPA 3BTEE 5G4BA 3D49H 1S0QA 1OWIA 4K5ZA 3K65B 1UCYE 2NU1E 1S5SA 2WYGA 3BTME 3O8DA 3SNAA 1W7GH 2HVXA 2XWAA 4BTTB 2SNVA 3SYJA 1F7ZA 2Y81A 4TPYA 2RDEA 2C8ZB 2FPZA 2IPQX 4JCNA 5ESTE 3SV8A 3HATH 2R3UA 2H6MA 4ZXYH 3RM2H 3PTNA 4Q7ZA 2NU3E 3DT0H 2BDHA 1TB6H 5GXPA 4J2YB 2FM2A 3DFJA 1BRCE 5A8ZA 1D6RA 3SJOA 4NIWA 1IQKA 1HBTH 3GCTF 1GJAB 3U98H 2OLGA 1GHWH 1AWHB 1E36B 3OEED 1UO6A 3H09A 2Q1JA 4FOUC 4RT1A 4CR5A 1LPZB 3BEFB 3VXFH 1V3XA 1AB9B 4FUFA 1FY8E 1TRNA 1QL8A 1S6HA 1ETTH 2V3OH 1TE0A 3LOXA 4X8UH 1K22H 1RFNA 4NFEA 1C1RA 3RXTA 2YOLA 1SGYE 1C5LH 2D2DA 2W26A 5TJXA 1UK3A 1O0DH 3LGUA 2HLCA 3RU4E 4INHA 3LGTA 3ZZDA 3U1IB 5HKKD 1FIWA 4OGYA 2PFEA 3DA9B 1TWXB 1L1JA 1O39A 2W3KA 1ZTLA 2XRCA 3I77A 3GISB 2A2QH 1ANDA 1V6DA 2R0KA 1GGDB 1PQAA 4Z1MD 4I31A 1HIAA 5C1YA 2KCYA 1SGFA 1EB1H 5DP7A 2PLXA 4AGKA 3E8LA 4WH6A 1HJ8A 1YWUA 2AGIX 1TPAE 2BY6X 4AGJA 1DSTA 4IMZA 2TRMA 5F6MA 5FCKA 1AVWA 1X7AC 4ZH8A 1K1IA 4UE7H 1PQ5A 2OUAA 1Q31A 3D23A 4INLA 3SBKA 4I8KA 5DP5A 4A5TS 4M7GA 1NZQH 1BHXF 3B9FH 3A7VA 2BQWB 3RXEA 3NRLA 2FMJA 2JH0D 1ZR0A 2F83A 4ZXXH 1KSNA 3RUOA 1QBVH 1C5MD 4OS1A 1IHTH 4XBCA 3L6PA 1QRXA 2CF9H 1ETRH 1PJPA 4DCDA 1XUJA 1NRNH 1SI5H 3SQHE 4AOQA 4AFSA 1FAXA 1YPHC 1FJSA 1A1RA 3W95A 2A32A 4NGAH 4DIHH 5C1XA 1CA0B 3BTGE 4X1PU 1ZYOA 1WQSA 1ZJDA 3F0OA 5F53A 1BIOA 1C5TA 7GCHG 3T29A 1ELTA 1O2KA 2XNDD 1V2KT 2YNAA 3E16B 1HGTH 3RXFA 3I78A 1GVZA 4U30A 5FPSA 2VNTA 4K8BA 4AFUA 3TH4H 4DVAU 1A0JA 1NBMD 1P06A 3A7XA 4XOJA 1CT4E 1OPHB 5TCCA 1YYY1 1OWHA 3LGYA 1C5VA 5FL7D 1PPZA 2Q6GA 2ZTXA 1TNGA 2ZTZA 4NSYA 1N6YA 4ABBA 1HXEH 2Y6TA 1DWEH 3P8FA 2B0FA 2C8WB 3HKIB 6GCHF 4MG3A 1GI1A 4YZUA 3RMOH 4ABJA 1G3CA 3OAAD 1MH0A 4ASUD 1D4PB 4FVDA 1LO6A 4LZ4B 2H9HA 2OCVB 1V2OT 4ABHA 1QA0A 4DGJA 3L3TA 1EXFA 4YOIA 3PMJA 2HPQH 4F4OC 3BSQA 2OD3B 2ZHWH 1K2I1 1AZ8A 1XKAC 2PKAB 4Q4LA 1XVMA 3G01A 4F49A 5HGGA 1GI9B 3A8AA 1BZXE 2BD7A 4ACBA 4ZHMU 3R3GB 5EJZA 1DANH 3T27A 2ALPA 3M5OA 2JETC 1LVYA 3DHKH 4K2YA 1P2IA 4OGXA 2WV4A 1TNHA 1FNIA 1S85A 1M9UA 1WBGB 2BHGA 1O3BA 1RTLA 2FIRH 2BDYA 1LQDB 5EQSA 2FEQH 1KXDA 4I8GA 3S9AA 3FOAA 1VJ9U 2ZCKP 3EA8A 3T25A 1O34A 3RU4D 1BTWA 3V0XA 1K0HA 2OC1A 1GBFA 1KYNA 1A4WH 4OS4A 1NROH 4DG4A 4X6OA 5AF9H 1NY22 1H1BA 1DXWA 3M37A 3S0NA 1AZZA 1DWBH 2JH5D 1B5GH 5JYIA 1MUEB 1Q2WA 1BBRK 4XDEA 5A0CA 1QBOA 1SQAA 1YLNA 1J14A 4X2VA 2F91A 2D26C 3OTJE 5CHAB 4NZLA 1FUJA 1UJ1A 3SZNA 1XKBC 2J38A 3RXSA 3SV2H 2BZ6H 4AYYB 5C0TA 1V2MT 3GY8A 5C2ZA 4M9FA 5DSFA 5JPMH 3BN9A 4DY7B 4Q7XA 4YT6H 2A45B 1P11E 1AE5A 1SHHB 1EPTC 1TNJA 2Z9IA 2AGGX 1L1NA 1UVTH 1ANEA 1GMCF 4DOQA 2O8WA 1SQTA 4XBDA 2VIOA 3F9GA 1SFQB 3E90B 3ZYDA 1C5XB 3EE0B 2GKVE 2B5TB 2YNBA 4HG6A 1KY9A 2GD4B 2B8OH 4NSVA 1O5EH 4K1SA 5JBTA 3PV5A 2BY5X 2BX3A 1N1LA 2ZQ2A 3NWUA 4K1EA 2P8OC 4R0IA 1BMNH 4AC9A 4UONA 1OWDA 1P2MA 3MH5A 1GMCG 2O8LA 4NA8A 1QB1A 3SU3A 2ZPSA 1NC6A 2UWOA 2AS9A 4WMFA 2XBWA 4WWYA 4SGAE 1O3KA 4NWKA 3EA7A 3RC5A 2G51A 3OTPA 2FX6A 2WV5A 4FUDA 2QXIA 3ZZAA 1LHFH 2V6NA 1TX7A 1HAVB 3QDZB 3M5MA 4I7YH 3RXCA 1GHXH 1T31A 1P9SA 1S83A 1LMWB 2PKSC 1Z71A 2XXLA 4FU8A 2FI3E 3HK6B 1RRKA 3FP7E 2C8XB 1J15A 1BOQA 2ZDVH 3TH2H 5C0UA 4CBOA 1VKYA 1G32B 3KN2A 3QZQA 5JB9S 3T62A 4WMDA 1A61H 3VXEH 1O2UA 1BRAA 1O2SA 2BOKA 2BDGA 4WMEA 4BTIB 4AX9H 1LHEH 1AHTH 2BY7X 3BG8A 3C1KA 4TWYA 2KR7A 5AFZH 1WYKA 1EB2A 2ZTYA 1CA0C 4CH8B 3K2UA 4JYVH 1C5ZB 5FX6A 1V2NT 4B1TA 2FX4A 4MVNA 1GBTA 1AFEH 3EA9A 2JIZD 3A7WA 1XUIA 4ABGA 1F92A 3KIDU 2BXTH 2ZCLP 5FPTA 3UR6A 1HV7A 1C5OH 4JZIA 3RC6A 2EI8A 1W0JD 2W3IA 1PPEE 3QZRA 3TGKE 1MKWH 2BMGB 2FLBH 4ASHA 5IK2D 1GBEA 2ODYB 2Z9LA 1BCUH 1A5IA 1PYTC 2WHXA 5HM9A 3ZVBA 4A6LA 3LJOA 1L4DA 2CMYA 1AKSA 5H4IB 4DJZB 3LH1A 3QX5H 2ODPA 3F1SB 3BF6H 1OX1A 2FOFA 5HIYA 1HJ9A 3A84A 1ESTA 1BDAA 4RKJB 3RC4A 2TGAA 3Q3YA 1UVOA 1NT1A 1V2RT 4JZ1A 1YPGH 3UFAA 1O5AB 1NM6A 2XBVA 3PWCA 2XW9A 5A8YA 1XUHA 4OM9A 4ZAEA 1HJAC 2BLOA 2ZC9H 4P00A 1ANBA 4IGDA 3SNEA 2BTCE 2F9VA 1ELGA 4THNH 2GV6A 4X6NA 2KCAA 5EQRA 1S0RA 2P16A 3QUMP 2A1DB 1FY5A 2RG3A 1BTXA 1SGQE 1T8NA 3IWMA 5EPYA 3KYFA 3MTYA 4P02A 3WY8A 1AO5A 1WOFA 2OXSA 3N7EA 1J8AA 1UVSH 1ZGIA 4NIXA 4WJG2 5HMAA 5BRRE 1FIZA 3CS7A 2VGCC 3UB0A 1MZAA 8GCHF 1F5KU 3ZVCA 1TBZH 1SLWB 1EPTA 1TFXA 2JJ2D 4YT7H 2QN5T 1DY9A 4BAQB 2ANYA 1YGCH 2GCHG 2C3SA 4B6FA 1KXAA 3GDSA 1YPLH 1YCPM 5KGOA 1H8IH 2AH4X 2BDBA 3M5LA 3M7QA 1BTUA 2H5CA 3N7OA 4ISHH 2F9BH 5E2PA 1QNJA 1K1NA 1O5CB 4NIVA 1BUIA 2Z3DA 5I25A 4JZFH 1HXFH 1PYTD 1HJAB 2IN2A 4YO9A 2PSYA 2ZGHA 3UR9A 4DT7B 1EFRD 4BXSA 1CVWH 1GDQA 1GMHF 2NU0E 1MAYA 1AI8H 2ZU3A 3MU4A 1GMDF 4CRGA 1ETSH 1VGCB 1EX3A 3TNTA 1DOJA 1TALA 4AB9A 1AN1E 1UTNA 5CDFE 2B9LA 4Y76A 1E35B 3DSGA 2FESH 5A8XA 2UUYA 2VWMA 1AQ7A 4R8TB 9LPRA 1TOMH 1H9IE 1TLDA 2A7JA 4I8JA 4XBBA 1C1PA 4OS6A 4XRNA 5DP4A 4SGBE 1LDTT 1SC8U 1TAWA 1V2TT 3MH7A 4J1YA 5A0AE 1O5BB 1SQOA 1FY1A 1GBDA 2V7QD 2STBE 1AD8H 2BD3A 1GJ6A 1V2JT 2R2WU 1O3LA 2QF5A 1W10U 5FCRA 2BD2A 3DFLA 1J9CH 2ANMH 1HAIH 1P12E 1Y3WA 1NO9H 1E79D 2A5AA 3MU8A 1MCVA 2GJGA 1O3NA 4JZEH 1YY3A 1WSSH 2G4TA 4IN2A 4X1SU 4BAHB 1W11U 2QYIA 4H6SB 1D3PB 3HGNA 1VGCC 1EP6A 1DM4B 3ODDA 2VIQA 1C5YB 4H4FA 1JOUB 3GCTG 4GAWA 4CRBA 1KIGH 2GP9B 1SLXB 2GTBA 1PQ8A 1WDIA 1THSH 2FOHA 5E0JA 4GLYA 1W0KD 4ZUHA 3QK1A 1T8OA 3V12A 1PPBH 1O32A 3OSYA 1D3DB 2PTCE 1RXPA 1EJNA 1EZUC 1BA8B 1GPZA 1FAKH 1HAYB 2ZU2A 1TX8A 4FUIA 4Y6DA 1YM0A 4ZMAH 1GBLA 2ODQA 5IDKA 2VB0A 3MNCA 2QE7D 2G55A 1UVUH 1C2GA 5GCHG 2FOCA 8GCHG 1KXCA 1KXFA 3IITA 3TPIZ 3U8TH 1A46H 1Y3YA 1DX5M 3ZYEA 2BQ7B 1DUEA 3RXMA 5LPFA 2ZFPH 2OBOA 1PPFE 4CRAA 4JYTA 1EASA 1FLEE 1S82A 3F6UH 1G3BA 3ZZ9A 3PM3A 5IYTA 4FETA 1O3MA 3URDA 3UPEA 1C4V2 1ZSKA 3U1JB 2GCTC 2AERH 3I29A 2JETB 4FUEA 2ZU4A 2ZIQH 2EC9H 1NRQH 4K8YA 1CT2E 1O37A 2BY9X 2CHAC 1K1MA 1P2OA 2FTMA 2OBQA 1MAXA 2YMSD 3LU9B 2AEIH 4UFGH 1IQNA 1CSOE 1UW7A 4RI0A 1O3EA 1TGCA 3M36A 2Y5GA 2EA3A 2WPHS 3MNSA 1HFDA 4X6MA 4ACAA 1GJ5H 3QGJA 1GHBF 1GHAG 5JBBS 2LNCA 1EQ9A 2XNIA 4Q80A 2YMSC 2GCHF 4HZHA 2THFB 3GCHC 5L2ZH 2FOMB 1ELBA 1OWKA 2SFAA 4X0WU 1FN8A 3RXPA 1GI4A 2UWPA 2A7HA 2Y5FA 1SGPE 1O36A 1O2QA 1ZMNA 1AVXA 2ZFFH 1NU9A 1MKXH 1QJ7B 1GHBG 2K0QA 1QY6A 4GVUA 1RIWB 1SOTA 1PFXC 3F9EA 2EQNA 4I33A 4YESB 1UK2A 4DT4A 1UK4A 1QJ1B 1O3AA 1Y5UT 2WV9A 1TRYA 3AK5A 6CHAB 1GHYH 1FN6A 3KCGH 3GY6A 5CE1A 1C1OA 4Y11E 3SUDA 1WXRA 2ZQ1A 3U8OH 2ANWA 1K1PA 5DKMA 1D9IA 4ZCNA 3S69A 4HTCH 5L2YH 3NXPA 3UNSA 5C3NA 3VFEA 4JK5A 1CHOG 5GWZA 1E38B 1UTKA 3ZZCA 1PPCE 3RU4T 1BT7A 4AYVB 2Y7ZA 1O5FH 1NBME 1BBRE 3A7YA 2P95A 4WXVA 1KXBA 3TIUA 1EKBB 3ZV9A 1XX9A 3SNDA 1EOLA 1UCYK 3HKJB 3UWJH 4ESTE 2LP6A 1GI8B 3SJ8A 8KME2 4E7NA 1KXEA 3M7TA 2ASUB 4I32A 4UFFH 2R0LA 1OKXA 3RXUA 4UFDH 2PV9B 2FDAA 1HNEE 1TQ7B 2FZZA 1D3TB 1INCA 4K69A 3M3SA 1A0HB 2PSXA 2PW8H 4A92A 4CRCA 4IS5A 2VGCB 1DFPA 2PUXB 1MD7A 1ELCA 3SU2A 2W7UA 2VIDA 3EYDA 1EZSC 1KLIH 5A0BA 2ZHFH 2F3CE 1TX6A 2BLWA 2ZFQH 1SBWA 1O2WA 2AMQA 2BDCA 3W1EA 3ZVAA 1LCYA 3EDXB 2JJ1D 3OU0A 3LIWA 2H1UA 3KL6A 4H6TA 1AKSB 2P3TB 5JDUB 3MNXA 5T6DA 3SHAH 2RFKC 3D65E 3URCA 3PRBA 1Z8JB 2OC0A 3KYGA 5PTPA 1C9TA 1GI7B 4MNXA 1L1GA 1P2QA 1EATA 4NA9H 1SG8B 4Q7YA 1FX0B 3BIUH 2XBYA 1BMMH 1SGEE 1DT2A 2XOKD 2STAE 4ZHAA 2FOEA 1O2MA 2EEKA 3RXHA 2TIOA 1GHAF 1ZMJA 8LPRA 3EE7A 4CR9A 2WPIS 2UUKB 1T4UH 3T5FH 1XMNB 4D7GA 3MO6A 4A1VA 1SQRA 2EY4C 1JXPA 2FLRH 3BV9B 1OHHD 3CP7A 1MKXK 3ZZ6A 4MNVA 3S7KB 1A3BH 2WPKS 2WZQA 1SGDE 1F2SE 2Z94A 1VCQA 2K8IA 1ZRKA 3W94A 3TGIE 1G3DA 4OS2A 2WPDD 1VITG 3ATKA 1IQEA 1NESE 2HGTH 1Y5AT 5DP9A 4X8TH 1IQMA 3VB3A 2JDID 3SNBA 3HGPA 1P2NA 3FO8D 5C94A 2FYRA 1C2JA 2CF8H 2AMDA 1L4ZA 5F8XA 4B74A 2ZP0H 5L6NH 1BTYA 1CO7E 1H9HE 1Q3XA 1C5UA 2G5NA 3NKKA 4RN6A 4TY6A 1GG6B 5K0HA 1NRRH 2HNTF 2J98B 3PROA 1HAGE 1OS8A 1QL9A 1O2NA 1C1NA 1O2ZA 1IOEA 1YCPK 1QQUA 1ZLRA 2H5DA 1Z1IA 1FDPA 3ATWA 4JYUH 3ATIA 1NRSH 2M2AA 3Q77A 3E91A 3SV7A 3OY5U 1A5GH 4KP0A 3A86A 4VGCC 2HVYB 1TNIA 2P93A 5E2OA 1O5GH 4TSFD 5FPYA 1GJ7B 1ZRBA 1MTWA 2GMTB 1O3PB 3MO9A 4YLUA 4YOJA 5EXMA 1O2JA 1QCPA 3T2NA 1IAUA 1P3EA 2NU2E 3SU4A 4UFEH 1EJAA 3LT3A 2GZ9A 2RCEA 5FBIA 1AMHA 3OY6U 4AB8A 1DXPA 3PLKA 2FYQA 4Q63A 3L33A 1A5HA 4BXWA 2BDAA 3A85A 1Z8RA 1Y3VA 2W5EA 3RMNH 1O3HA 2Z9KA 1QTFA 1E1RD 2ZKSA 7KMEH 1C4Y2 4X8SH 3S9CA 2AMPA 4X2WA 3RXGA 1GCDA 3TLOA 1WCZA 3QGNB 3VB7A 3UQVA 1QURH 1UVPA 1AUTC 2ZG0H 3ENSB 4Y79A 3SUFA 1LVOA 3VPKA 1BHXB 3GICB 1P8VC 2FI5E 3SJIA 3LH3A 1DUAA 5EGMA 3P17H 1CHOF 1MU6B 4Y10E 1RD3B 3SU0A 1ZSLA 4X8VH 5FAHA 2QY0B 1CBWC 1O2XA 5ABWA 1SGTA 1ZHMA 1UTOA 4FUGA 2HNTE 2Q6DA 5DP8A 3F2HA 5E0GA 1DITH 4NG9H 1JWTA 2BVSH 2C93B 1TNLA 1ZJKA 5A09A 1AE8H 1GBIA 3MOCA 2XBXA 2A4QA 4O3TA 1OWJA 1P57B 3PRDA 1GI6A 2BOHB 3AASA 1B0FA 3KQDA 4AORA 1P03A 1UTQA 3VB6A 1ELAA 1NS3A 5EW2H 2KX4A 3M35A 2YMSB 2QV1A 1GJBB 4AFZA 1GBCA 2ZCHP 1YF4A 1CGHA 1AY6H 1W8BH 1K21H 1GHZA 5GCHF 1SFIA 3KQEA 3KEEA 2C8YB 4AZ2B 1IQLA 1YPMH 4K1TA 3SOSA 1C2HA 3BTHE 3MFJA 1E34B 1JIRA 1AVGH 1XXFA 1AFQB 1NFUA 3JZ1B 5HYOA 3WW7A 1EAXA 5CMXH 1GDNA 1HDTH 1NPMA 1LHGH 2PR3A 2VH0A 2PTNA 4IMQA 3P95A 3TGJE 1UHBB 1KMHB 1DICA 4IC6A 1LQEA 1GWAA 1LHDH 1NRPH 3GS9A 3RP2A 3RDZA 4F48B 2BVXH 4BAOB 1HPGA 2RA3A 5EOKA 2KM0A 4I8LA 4F55A 5GIBA 4Z6AH 1KTTB 3H7TA 2ZHDA 1H8HD 4ABFA 5L30H 3RXDA 5EPNA 5LPEA 2GZ7A 1WUNH 4D7FA 2KCPA 1O3DA 2ZDKA 1P04A 2F9OA 4X1QU 3ITIA 3CNRA 3ZIAD 5EXLA 1S81A 1Y3UA 2GMTC 2RDLA 2SGAA 1YP9A 1ZZZA 1LVBA 1GJ9B 1N8OB 3ZZ8A 3UWIA 2ZPRA 4VGCB 2ESTE 3PMBB 3ZVFA 2A7CA 2BY8X 1GJ4H 1BTHH 1CGJE 1V2PT 3CS0A 5DP3A 7LPRA 1ZOMA 1ZHRA 4I86A 3UREA 3CENA 3LC3A 1P09A 3RXIA 2Q6FA 3HK3B 4HGCA 1UTLM 2QGRA 1EAIA 1S84A 1MTUA 1MCTA 4KGAA 1UTJA 3GCNA 2TBSA 2IOTA 1O3JA 2A4RA 3UUZA 1FXYA 1CQQA 1HAPH 6GCHG 3EQ0H 1NFXA 1TGSZ
chains in the Genus database with same CATH topology
3OEED 3SV9A 1CU1A 3H09A 4B74A 1NS3A 1BT7A 2W6JD 5GNDA 2AHME 3RC6A 2OC8A 5FPSA 2F43B 4K8BA 1W0JD 2OBOA 5B6LA 1NBMD 1NBME 1SKYE 3LOXA 2OC7A 2YMSB 3P8NA 5C0TA 2QV1A 5IK2D 3N7DA 4B75A 4M9FA 5DSFA 4FETA 3OEHD 4KTCA 5CDFE 3DSOA 4TT3D 2YOLA 1H8ED 5FL7D 3U1JB 1BMFD 4I32A 3SU5A 2WHXA 4YXWD 2O8MA 3KEEA 4NWLA 3WWFA 2M2AA 3SV7A 1COWD 5H4IB 4R8TB 3U1IB 3OE7D 4B73A 2QF4A 5FPTA 5HKKD 4A92A 4TSFD 5FPYA 2XCFA 3E90B 2KCOA 1DY8A 1W3CA 3O8CA 3SU2A 2J5UA 2OBQA 3EYDA 3RC4A 3SU4A 3M5NA 2YMSD 3WW7A 2V7QD 3N99A 3KNXA 3P8OA 3PV5A 3SU1A 1MABB 3OAAD 4RI0A 3SU6A 3SUEA 4ASUD 1N1LA 4I31A 2OK5A 1DXPA 4Z1MD 2QF5A 2KCYA 3LONA 2KFWA 4Q63A 1KMHB 4U01A 3W1EA 2CK3D 2LELA 5T1VA 2JJ1D 5CHBA 5ESBA 4WH6A 4OM9A 3GS9A 1E79D 5EQQA 3DSPA 3SUGA 2F9VA 2IJD1 1E1RD 2W6ID 2XNIA 2KM0A 5DN6D 3F2FA 3F2GA 2KCAA 2P59A 2YMSC 4B71A 5EQRA 4F55A 4Q4LA 2FOMB 3VG8A 3WWBA 3PV2A 1H8HD 3PRBA 4NWKA 4TYDA 5EPNA 3RC5A 2OC0A 1RGQA 3OTPA 5EPYA 2KCPA 2K1QA 2A4GA 2L6OA 3SUFA 3OYPA 1E1QD 2F4LA 2GGVB 3SV6A 3M5OA 3N7EA 3M5MA 3DCLA 3NRLA 3ZIAD 1FX0B 3FN8A 2K0QA 4WH8A 3UB0A 4WF8A 2OINA 2XOKD 2VBCA 2F9UA 4B6EA 4I33A 1RTLA 2HLDD 5C0UA 4DT4A 3L6PA 3KN2A 3O8DA 2IJOB 4XD7D 5ETXA 5EQSA 3SU0A 2JJ2D 1W0KD 1DY9A 2WV9A 3SYJA 2KZ4A 3AK5A 2FP7B 3FOAA 5C17A 3SV8A 4A1VA 1JXPA 2KR7A 5GJ4B 1A1RA 3F2HA 3SUDA 1OHHD 4A1TA 4B6FA 1WXRA 3M5LA 3F0PA 2OC1A 2WZQA 3F0OA 3O8BA 2K8IA 3F3BA 3LKWA 3FO8D 5F53A 4ZCNA 5GPIB 2WPDD 2GVFA 3OFND 3KF2A 2FM2A 5IDKA 2A4RA 3O8RA 2QE7D 2XCNA 3FKSD 1DXWA 2JIZD 1S6LA 2JDID 2A4QA 2WSSD 4JMYA 4B76A 4A1XA 2XNDD 3SZEA 3PRDA 3SU3A 1EFRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q63 A; 
#chains in the Genus database with same CATH topology
 2HPP H;  1JBU H;  2VVU A;  3GY3 A;  3BTF E;  3QWC H;  5GND A;  3VB5 A;  2OC8 A;  3E6P H;  1HUT H;  1Z1J A;  1W0Y H;  1MTN B;  3F9F A;  1SGC A;  4JK6 A;  2FI4 E;  2WPJ S;  2ZZU H;  4TT3 D;  3DD2 H;  4Y0Z E;  1MTS A;  2GX4 A;  3DUX H;  3GY4 A;  3QLP H;  4FU7 A;  5I46 H;  1YKT A;  1BRU P;  3M61 U;  4NZQ A;  1O3I A;  1EJM A;  4OS7 A;  1K28 D;  2G00 A;  1THP B;  3SN8 A;  3A89 A;  4WY3 A;  3A88 A;  2PP6 A;  1C5R A;  1O2P A;  2AFQ B;  1GBH A;  1EAU A;  1GCT B;  1IQF A;  3M3V A;  3LGI A;  1GBA A;  5AFY H;  3SUE A;  2QC2 A;  1HLT H;  2QXH A;  3RMM H;  4FUB A;  1SGR E;  3EAJ A;  2J95 A;  1C5S A;  3UNQ A;  3RXO A;  2A5I A;  2LEL A;  2Y82 A;  1QJ6 B;  4Y8X A;  4Y8Y A;  5FX5 A;  2J9N A;  1YLC A;  4CHA B;  1G2M A;  4O97 A;  1DWD H;  1N6X A;  1XM1 A;  2IJD 1;  2W6I D;  3K6Y A;  5B6O A;  2ZFR H;  3F2G A;  1EZX C;  1MKW K;  1QBN A;  3RXA A;  2SGP E;  3U8R H;  1TBR H;  1LPG B;  1SL3 A;  2VIP A;  2XWB I;  1P9U A;  5T6F A;  3PV2 A;  4YOG A;  1DPO A;  3MMG A;  1V2V T;  1V2Q T;  2A4G A;  3U28 C;  3KGP A;  5HM2 A;  3RLY H;  2V3H H;  5DPA A;  5KEC A;  1GVL A;  2A31 A;  1C2K A;  2ZA5 A;  2KAI A;  3P8G A;  1MU8 B;  1ELV A;  3LJJ A;  3A82 A;  1W7X H;  2F9U A;  2GT8 A;  1D6W A;  5DK1 A;  1W2K H;  2FOB A;  1MBM A;  1TNK A;  2ZDL A;  1P0S H;  5KED A;  3RM0 H;  2HAL A;  4I8H A;  1J16 A;  3MQK C;  1O3G A;  3Q76 A;  2V3M A;  2Y80 A;  4QT8 C;  1XUF A;  2AGE X;  3BEU A;  3SQE E;  4MNY A;  2GT7 A;  2VWO A;  5J4S A;  1C1T A;  3GDU A;  3RXK A;  2SGF E;  3S9B A;  2GVF A;  3KF2 A;  3RXV A;  2XCN A;  5DP6 A;  1FY4 A;  1O5D H;  4Y8Z A;  2J2U A;  2WSS D;  3LPR A;  1O2I A;  5DN6 D;  2WUB A;  1VCP A;  3MU1 A;  1YPK H;  1TGN A;  1FPC H;  4YTA A;  1PPH E;  2CN0 H;  2W6J D;  4RSP A;  7EST E;  3Q00 A;  1YPH E;  4LXB H;  4UDW H;  2BD5 A;  5B6L A;  2XC0 A;  4FUJ A;  3STJ A;  3P8N A;  1T7C A;  1MTV A;  4B75 A;  1VIT F;  2J34 A;  1C2D A;  2FOG A;  2NU4 E;  3RLW H;  3RXQ A;  1SPJ A;  1TON A;  3JZ2 B;  4KTC A;  1CE5 A;  2UWL A;  1O3O A;  3MU0 A;  1B0E A;  2ZGC A;  4Y71 A;  2BD9 A;  1Y8T A;  2SGQ E;  1SLV B;  2BD4 A;  2XCF A;  1KLT A;  5A2M H;  1W3C A;  4O3U A;  2UUF B;  4B2A A;  1ID5 H;  2FS8 A;  3U9A H;  2QF3 A;  3FAN A;  1O2T A;  1TGB A;  3HPT B;  3KNX A;  2FXR A;  1QB9 A;  2BX4 A;  5JB8 S;  3LON A;  2KFW A;  3A7T A;  1OSS A;  3LGW A;  1GBM A;  5E8E H;  1Y5B T;  3MU5 A;  1OP8 A;  4TWW A;  5CHB A;  2ZEC A;  3A80 A;  5FBE A;  1GCT C;  2HWL B;  1C4U 2;  1IQG A;  1G3E A;  2PWX A;  1GI5 A;  2SGE E;  3B23 B;  3GCO A;  1OOK B;  2LPR A;  3A87 A;  4MPW A;  2QCY A;  1XUK A;  8EST E;  4D9Q A;  1O35 A;  3TJU A;  1OYQ A;  2XC4 A;  3A8D A;  2OP9 A;  1ESB A;  3PO1 C;  3A83 A;  1C1M A;  2VU8 E;  4NFF A;  2OIN A;  1GG6 C;  4B6E A;  2QXG A;  2IJO B;  4XD7 D;  3SI3 H;  1T4V H;  1V2U T;  2BXU H;  9EST A;  4B2C A;  1ZTJ A;  3QN7 A;  3VGC B;  5J4Q A;  4AG2 A;  2DE9 A;  2KZ4 A;  3FZD A;  2FP7 B;  1TGT A;  5C17 A;  1C2F A;  5CHA C;  3BG4 B;  1FZZ A;  2ZHQ H;  3SW2 B;  1NU7 B;  1AWF H;  2VWL A;  4A1T A;  3P92 A;  1HYL A;  5F03 A;  4TY7 A;  2GZ8 A;  3ZVE A;  3F0P A;  4TPI Z;  2BLQ A;  1CT0 E;  1QA7 A;  3LKW A;  5EIY A;  2G5V A;  2GDE H;  2GDD A;  2Z9J A;  4KKD A;  1YPE H;  2J97 A;  4FXG H;  3UQO A;  3FP6 E;  2TPI Z;  3TJN A;  1BBR H;  1C5W B;  1F5R A;  2A4O A;  1C5N H;  2BLV A;  2NWN A;  4E06 H;  1K1J A;  2AHM E;  1FON A;  1G37 A;  1T8M A;  2ANK H;  4NCY A;  1DSU A;  2I6Q A;  3K6Z A;  2HOB A;  2OC7 A;  3R0F A;  1GDU A;  1P2K A;  1SLU B;  1KTS B;  4ABA A;  1UCY H;  3BTD E;  1HB0 B;  1NN6 A;  1GJD B;  1MQ6 A;  4ZKR U;  3OX7 U;  3P70 B;  4LZ1 H;  5JBC S;  4U2W A;  1BMF D;  2WPL S;  3BTT E;  3SU5 A;  3GDV A;  4YXW D;  2JH6 D;  3MO3 A;  3NPS A;  1COW D;  1W14 U;  2TGT A;  1C1U H;  1C1V H;  4WVP E;  4FVB A;  2J5U A;  2OQ5 A;  4A7I B;  1QGF A;  4XSK U;  1QFK H;  2QF0 A;  3P8O A;  1Z7K A;  1C1S A;  1MAB B;  3MHW U;  3ZZ3 A;  1GBK A;  3UAI C;  3MYW A;  2OK5 A;  1ELF A;  1GGD C;  1W0Z U;  3PLP A;  4U01 A;  2JKH A;  2ALV A;  2EI6 A;  5ESB A;  1ZPB A;  5C5O A;  1QR3 E;  2GV7 A;  2OTV A;  4KTS A;  2HRV A;  1SVP A;  1WAY B;  3SUG A;  1ZPC A;  3STI A;  2VIW A;  4B71 A;  2Z3E A;  5EW1 H;  1VCW A;  3WWB A;  4BNR A;  3NUM A;  1ZML A;  2ZWL H;  4ZKS U;  1T8L A;  3SJK A;  4IW4 E;  1BJU A;  3LGV A;  1ZSJ A;  1QRW A;  2FO9 A;  3MH4 A;  1O31 A;  2XC5 A;  1DS2 E;  1SSX A;  4WH8 A;  3M7U A;  1ORF A;  1L2E A;  1IHS H;  4CH2 B;  2G81 E;  1GMH G;  1SGF G;  1TYN A;  1LHC H;  2P3F H;  1FPH H;  1K1O A;  4Z0K A;  2WYJ A;  1HIA B;  1EOJ A;  3AAU A;  3UOP A;  2CGA A;  1AIX H;  2ZFT A;  3PV4 A;  1H4W A;  1F0R A;  1P05 A;  2G8T A;  3AVZ A;  1GL0 E;  3RXB A;  2O9Q A;  1A0L A;  1IQJ A;  1HAH H;  3O8B A;  3ZZ7 A;  1WU1 A;  1JMO H;  3O8R A;  1S6L A;  1ZTK A;  1P3C A;  1F0U A;  3SZE A;  4ZKO U;  4MPV A;  2PUQ H;  4ABI A;  1KDQ A;  3MH6 A;  5EOD A;  1C2E A;  1T32 A;  1FI8 A;  3B8J A;  2VVV A;  1H9L B;  3KQ5 A;  1C5P A;  4MNW A;  3UOU A;  1SKY E;  3K9X B;  5E0H A;  1GJ8 B;  2CJI A;  3H7O A;  1EZQ A;  5BPE A;  1HRT H;  1KDQ B;  3ELA H;  4BAK B;  2ZEB A;  4GSO A;  2ZDN A;  2BVR H;  3GYL B;  3MWI U;  1BMA A;  1C5Q A;  7GCH F;  1HAZ B;  1DVA H;  2G4U A;  1U6Q A;  4FUH A;  1YBW A;  4MDS A;  2BD8 A;  1GL1 A;  3KQB A;  3P6Z B;  1ZGV A;  3M5N A;  1O2H A;  3TU7 H;  3SU1 A;  1O30 A;  1C9P A;  3SU6 A;  1K9O E;  1Y59 T;  1C2L A;  4U32 A;  3ZZ4 A;  2SNW A;  1JRT A;  1ELE E;  2ZDM A;  1TA6 A;  3GY5 A;  1UMA H;  1C2M A;  3GCH B;  2PGB B;  2HNT C;  3LC5 A;  3RML H;  3UY9 A;  1EPT B;  4DUR A;  5AVD A;  2CHA B;  1B7X B;  1MMJ N;  1G9I E;  2I6S A;  2UUJ B;  3F2F A;  5EJ1 A;  3TK9 A;  2FTL E;  2P59 A;  4YM9 A;  1ABJ H;  1DLK B;  3AW0 A;  2Z7F E;  1AFQ C;  5DO4 H;  3TVJ B;  2A2X H;  1MBQ A;  2TGD A;  5TCA A;  4RT0 A;  1RGQ A;  3ZZ5 A;  4GCH G;  2PHB A;  3OYP A;  4MPX A;  1G30 B;  4BAN B;  2QIQ A;  5EG4 A;  1K1L A;  4CRE A;  2IPH A;  1EUF A;  2A0Q B;  1TMU H;  6CHA C;  3GOV B;  1HAO H;  1CBW B;  2PGQ B;  1O3F A;  2Z6B D;  3UIR A;  4IBL H;  1EAW A;  1FY3 A;  1AB9 C;  1Z8G A;  1MD8 A;  1QHR B;  3SGB E;  5GJ4 B;  2EI7 A;  2J4I A;  1DDJ A;  3A7Z A;  3NCL A;  3RXL A;  6EST A;  1TIO A;  1AGJ A;  3PLB A;  1WTH D;  1P02 A;  2BQ6 B;  1XVO A;  4GUX A;  1XXD A;  5C67 A;  1PQ7 A;  1FQ3 A;  3BEI B;  4K60 A;  3FKS D;  1HAX B;  6LPR A;  3TK6 A;  1TBQ H;  4B76 A;  2CXV A;  1A3E H;  3Q3X A;  2ZGX H;  4AG1 A;  3GYM A;  1O2O A;  2V35 A;  2QAA A;  2BYA X;  5EU8 A;  1GI3 A;  1ARB A;  3SJ9 A;  1F5L A;  2P94 A;  1W13 U;  5DG6 A;  2J98 A;  1TRM A;  4LOY H;  3BTK E;  1DWC H;  2VVC A;  1GI0 A;  3TNS A;  3OEH D;  1QL7 A;  2WIN I;  2D1J A;  1YLD A;  2PKA A;  2VJ1 A;  1E37 B;  3SO3 A;  5AHG H;  3WWF A;  4PRO A;  5EXN A;  1IQH A;  2QF4 A;  2AYW A;  4GHT A;  4X6P A;  1C1W H;  1BQY A;  3AW1 A;  1O38 A;  1OWE A;  4ZRO A;  3N99 A;  3VB4 A;  4HFP B;  3FVF B;  2ZNK H;  4E05 H;  1SR5 C;  3BTQ E;  1O33 A;  1G2L A;  1QZ8 A;  2CK3 D;  3RXJ A;  3A8B A;  1LKA A;  4Q2K A;  1G36 A;  4HI3 A;  2B7D H;  5T3H A;  4BAM B;  2Z3C A;  3KQC A;  4KTU A;  2DE8 A;  4D76 A;  1GBJ A;  3LDX H;  1OP2 A;  3VG8 A;  1GBB A;  1D3Q B;  1SOZ A;  4BTU B;  4RKO B;  2K1Q A;  1ZHP A;  2L6O A;  2R2M B;  2ILN A;  1TA2 A;  2FOD A;  1O2V A;  1GHV H;  2ZPQ A;  3E1X B;  1C1Q A;  4WXI A;  4AN7 A;  2P3U B;  5C1U A;  4MLF B;  4DII H;  4WF8 A;  3TH3 H;  3M3T A;  3SOR A;  1Z6J H;  4MPU A;  5ETX A;  2VIN A;  4AFQ A;  5LH8 A;  2H9T H;  3D62 A;  3C27 B;  1O2G H;  4MTB A;  3ZVG A;  2ZU1 A;  1W12 U;  1BB0 B;  1NTP A;  2QA9 E;  4INK A;  1OXG A;  4XE4 A;  2R3Y A;  3FFG A;  1A2C H;  1V2L T;  1VIT H;  4CBN A;  1LPK B;  1RTF B;  2VWN A;  2ZFS A;  3MI4 A;  2F9P A;  1Z8I B;  3F3B A;  1DE7 H;  4GHQ A;  3V13 A;  1NFW A;  5GPI B;  3ZV8 A;  1SGN E;  4K3J A;  2XTT B;  1CHG A;  3ATM A;  4NIY A;  4JMY A;  2KAI B;  3SGQ E;  4Y0Y E;  1AUJ A;  1OP0 A;  4JZD H;  2VIV A;  3V3M A;  3QO6 A;  5DJ7 A;  2F43 B;  3SHC H;  1QB6 A;  1F0S A;  1O2R A;  1JIM A;  1RIW C;  2BB4 A;  3IG6 B;  3TIT A;  1TPS A;  3N7D A;  2RA0 A;  3FP8 E;  1GVK B;  3TJO A;  1YPJ H;  3DSO A;  4ISL A;  4B2B A;  2R9P A;  3V7T A;  1H8E D;  3U69 H;  1NFY A;  1TPP A;  4IN1 A;  2FWW A;  5SGA E;  1TMB H;  4MQA A;  1BTZ A;  4B73 A;  4ABE A;  2P8O B;  1ELD E;  1C2I A;  1DLE A;  1BTP A;  3E3T A;  2QXJ A;  2G52 A;  1DY8 A;  4GCH F;  4GPG A;  3ODF A;  3O8C A;  2J94 A;  1BJV A;  1GJC B;  1P01 A;  3PB1 E;  3TK5 A;  4FU9 A;  4X2X A;  3AAV A;  1BRB E;  2J92 A;  3H5C B;  2ZO3 H;  3S7H B;  5T1V A;  2D8W A;  1Y3X A;  3A8C A;  4CRF A;  3PWB A;  1WV7 H;  2C90 B;  3FAO A;  5F8Z A;  3DSP A;  1RTK A;  2Y5H A;  1BIT A;  1V2S T;  2ZF0 H;  4ISN A;  3QTV H;  2C4F H;  1HAV A;  2ULL A;  2ZGJ A;  5EJL A;  1XUG A;  4UEH H;  1CA8 B;  3E0P B;  2GCT B;  4TYD A;  2TGP Z;  4DW2 U;  2AIQ A;  2CV3 A;  1Z6E A;  2F4L A;  2F9N A;  4X1R U;  3DCL A;  3FN8 A;  1IQI A;  1S6F A;  1F0T A;  3NK8 A;  2VBC A;  1TOC B;  2HLD D;  1LTO A;  1SGI B;  3ZZB A;  4CRD A;  3PO1 B;  1PPG E;  4H42 U;  4Y7B A;  3MNB A;  3TJV A;  4ZKN U;  1MTN C;  3GY7 A;  2M5T A;  1H8D H;  1LVM A;  1TQ0 B;  4D8N A;  1UTM A;  1CGI E;  2A5K A;  2BZA A;  2O8T A;  3T28 A;  1BML A;  3VEQ B;  4BOH A;  4O9V A;  3NZI A;  3SI4 H;  4ABD A;  3BIV H;  3OFN D;  1KLJ H;  1P10 A;  1E0F D;  3QTO H;  4YLQ H;  1ANC A;  3BG4 C;  1WQV H;  1SMF E;  1ESA A;  4OS5 A;  3PTB A;  5LGO A;  2BM2 A;  2BDI A;  3KHV A;  4A1X A;  1SB1 H;  1YC0 A;  3PMH B;  1L0Z A;  3E0N B;  3VGC C;  3EST A;  3SV9 A;  1CU1 A;  2DUC A;  2ZI2 H;  3T26 A;  3UTU H;  1O2Y A;  2Y7X A;  2XYA A;  1JRS A;  1HCG A;  1QQ4 A;  2PKS B;  1QIX B;  1LKB A;  2ZU5 A;  3EGK H;  3FZZ A;  2L74 A;  2ZHE H;  1ZPZ A;  1TAB E;  3ZVD A;  1MZD A;  1YCP H;  1RJX B;  3SGA E;  5FXL A;  5HXF A;  1MQ5 A;  1FMG A;  1ACB E;  4IC5 A;  4UD9 H;  4LK4 A;  4D9R A;  2O8M A;  4NWL A;  1V2W T;  4ISI H;  2H9E H;  4ZHL U;  3SNC A;  1OYT H;  3OE7 D;  4O03 A;  4CHA C;  3F9H A;  1N8O C;  1UHB A;  5HIZ A;  2KCO A;  3GY2 A;  5DGJ A;  2ZDA H;  4KEL A;  5FHT A;  2WPM S;  4X2Y A;  1ARC A;  1J17 T;  1O3C A;  2FS9 A;  4X1N U;  3UNR A;  2OQU A;  5F8T A;  1THR H;  1GMD G;  1ABI H;  1TPO A;  4E7R G;  4NA7 A;  3Q3K A;  5T6G A;  2Z9G A;  1P2J A;  4FUC A;  4ISO A;  5JBA S;  3PMA B;  1FV9 A;  1A7S A;  5EQQ A;  1WTG H;  1EP5 A;  1GI2 A;  1TMT H;  2WUC A;  5C20 A;  1AU8 A;  2V0B A;  5K7R A;  2ZGB H;  3RXR A;  5LPR A;  1UTP A;  3F68 H;  2H2Z A;  5C5N A;  2FOA A;  1RS0 A;  5GDS H;  2VH6 A;  2W7S A;  4XFQ A;  2O8U A;  1O2L A;  1E1Q D;  1VR1 H;  2GGV B;  1VZQ H;  2SGD E;  3SV6 A;  3ATL A;  4Y7A A;  1QRZ A;  3A81 A;  1VJA U;  1SHY A;  3BTW E;  3PYH A;  2AIP A;  3BTE E;  5G4B A;  3D49 H;  1S0Q A;  1OWI A;  4K5Z A;  3K65 B;  1UCY E;  2NU1 E;  1S5S A;  2WYG A;  3BTM E;  3O8D A;  3SNA A;  1W7G H;  2HVX A;  2XWA A;  4BTT B;  2SNV A;  3SYJ A;  1F7Z A;  2Y81 A;  4TPY A;  2RDE A;  2C8Z B;  2FPZ A;  2IPQ X;  4JCN A;  5EST E;  3SV8 A;  3HAT H;  2R3U A;  2H6M A;  4ZXY H;  3RM2 H;  3PTN A;  4Q7Z A;  2NU3 E;  3DT0 H;  2BDH A;  1TB6 H;  5GXP A;  4J2Y B;  2FM2 A;  3DFJ A;  1BRC E;  5A8Z A;  1D6R A;  3SJO A;  4NIW A;  1IQK A;  1HBT H;  3GCT F;  1GJA B;  3U98 H;  2OLG A;  1GHW H;  1AWH B;  1E36 B;  3OEE D;  1UO6 A;  3H09 A;  2Q1J A;  4FOU C;  4RT1 A;  4CR5 A;  1LPZ B;  3BEF B;  3VXF H;  1V3X A;  1AB9 B;  4FUF A;  1FY8 E;  1TRN A;  1QL8 A;  1S6H A;  1ETT H;  2V3O H;  1TE0 A;  3LOX A;  4X8U H;  1K22 H;  1RFN A;  4NFE A;  1C1R A;  3RXT A;  2YOL A;  1SGY E;  1C5L H;  2D2D A;  2W26 A;  5TJX A;  1UK3 A;  1O0D H;  3LGU A;  2HLC A;  3RU4 E;  4INH A;  3LGT A;  3ZZD A;  3U1I B;  5HKK D;  1FIW A;  4OGY A;  2PFE A;  3DA9 B;  1TWX B;  1L1J A;  1O39 A;  2W3K A;  1ZTL A;  2XRC A;  3I77 A;  3GIS B;  2A2Q H;  1AND A;  1V6D A;  2R0K A;  1GGD B;  1PQA A;  4Z1M D;  4I31 A;  1HIA A;  5C1Y A;  2KCY A;  1SGF A;  1EB1 H;  5DP7 A;  2PLX A;  4AGK A;  3E8L A;  4WH6 A;  1HJ8 A;  1YWU A;  2AGI X;  1TPA E;  2BY6 X;  4AGJ A;  1DST A;  4IMZ A;  2TRM A;  5F6M A;  5FCK A;  1AVW A;  1X7A C;  4ZH8 A;  1K1I A;  4UE7 H;  1PQ5 A;  2OUA A;  1Q31 A;  3D23 A;  4INL A;  3SBK A;  4I8K A;  5DP5 A;  4A5T S;  4M7G A;  1NZQ H;  1BHX F;  3B9F H;  3A7V A;  2BQW B;  3RXE A;  3NRL A;  2FMJ A;  2JH0 D;  1ZR0 A;  2F83 A;  4ZXX H;  1KSN A;  3RUO A;  1QBV H;  1C5M D;  4OS1 A;  1IHT H;  4XBC A;  3L6P A;  1QRX A;  2CF9 H;  1ETR H;  1PJP A;  4DCD A;  1XUJ A;  1NRN H;  1SI5 H;  3SQH E;  4AOQ A;  4AFS A;  1FAX A;  1YPH C;  1FJS A;  1A1R A;  3W95 A;  2A32 A;  4NGA H;  4DIH H;  5C1X A;  1CA0 B;  3BTG E;  4X1P U;  1ZYO A;  1WQS A;  1ZJD A;  3F0O A;  5F53 A;  1BIO A;  1C5T A;  7GCH G;  3T29 A;  1ELT A;  1O2K A;  2XND D;  1V2K T;  2YNA A;  3E16 B;  1HGT H;  3RXF A;  3I78 A;  1GVZ A;  4U30 A;  5FPS A;  2VNT A;  4K8B A;  4AFU A;  3TH4 H;  4DVA U;  1A0J A;  1NBM D;  1P06 A;  3A7X A;  4XOJ A;  1CT4 E;  1OPH B;  5TCC A;  1YYY 1;  1OWH A;  3LGY A;  1C5V A;  5FL7 D;  1PPZ A;  2Q6G A;  2ZTX A;  1TNG A;  2ZTZ A;  4NSY A;  1N6Y A;  4ABB A;  1HXE H;  2Y6T A;  1DWE H;  3P8F A;  2B0F A;  2C8W B;  3HKI B;  6GCH F;  4MG3 A;  1GI1 A;  4YZU A;  3RMO H;  4ABJ A;  1G3C A;  3OAA D;  1MH0 A;  4ASU D;  1D4P B;  4FVD A;  1LO6 A;  4LZ4 B;  2H9H A;  2OCV B;  1V2O T;  4ABH A;  1QA0 A;  4DGJ A;  3L3T A;  1EXF A;  4YOI A;  3PMJ A;  2HPQ H;  4F4O C;  3BSQ A;  2OD3 B;  2ZHW H;  1K2I 1;  1AZ8 A;  1XKA C;  2PKA B;  4Q4L A;  1XVM A;  3G01 A;  4F49 A;  5HGG A;  1GI9 B;  3A8A A;  1BZX E;  2BD7 A;  4ACB A;  4ZHM U;  3R3G B;  5EJZ A;  1DAN H;  3T27 A;  2ALP A;  3M5O A;  2JET C;  1LVY A;  3DHK H;  4K2Y A;  1P2I A;  4OGX A;  2WV4 A;  1TNH A;  1FNI A;  1S85 A;  1M9U A;  1WBG B;  2BHG A;  1O3B A;  1RTL A;  2FIR H;  2BDY A;  1LQD B;  5EQS A;  2FEQ H;  1KXD A;  4I8G A;  3S9A A;  3FOA A;  1VJ9 U;  2ZCK P;  3EA8 A;  3T25 A;  1O34 A;  3RU4 D;  1BTW A;  3V0X A;  1K0H A;  2OC1 A;  1GBF A;  1KYN A;  1A4W H;  4OS4 A;  1NRO H;  4DG4 A;  4X6O A;  5AF9 H;  1NY2 2;  1H1B A;  1DXW A;  3M37 A;  3S0N A;  1AZZ A;  1DWB H;  2JH5 D;  1B5G H;  5JYI A;  1MUE B;  1Q2W A;  1BBR K;  4XDE A;  5A0C A;  1QBO A;  1SQA A;  1YLN A;  1J14 A;  4X2V A;  2F91 A;  2D26 C;  3OTJ E;  5CHA B;  4NZL A;  1FUJ A;  1UJ1 A;  3SZN A;  1XKB C;  2J38 A;  3RXS A;  3SV2 H;  2BZ6 H;  4AYY B;  5C0T A;  1V2M T;  3GY8 A;  5C2Z A;  4M9F A;  5DSF A;  5JPM H;  3BN9 A;  4DY7 B;  4Q7X A;  4YT6 H;  2A45 B;  1P11 E;  1AE5 A;  1SHH B;  1EPT C;  1TNJ A;  2Z9I A;  2AGG X;  1L1N A;  1UVT H;  1ANE A;  1GMC F;  4DOQ A;  2O8W A;  1SQT A;  4XBD A;  2VIO A;  3F9G A;  1SFQ B;  3E90 B;  3ZYD A;  1C5X B;  3EE0 B;  2GKV E;  2B5T B;  2YNB A;  4HG6 A;  1KY9 A;  2GD4 B;  2B8O H;  4NSV A;  1O5E H;  4K1S A;  5JBT A;  3PV5 A;  2BY5 X;  2BX3 A;  1N1L A;  2ZQ2 A;  3NWU A;  4K1E A;  2P8O C;  4R0I A;  1BMN H;  4AC9 A;  4UON A;  1OWD A;  1P2M A;  3MH5 A;  1GMC G;  2O8L A;  4NA8 A;  1QB1 A;  3SU3 A;  2ZPS A;  1NC6 A;  2UWO A;  2AS9 A;  4WMF A;  2XBW A;  4WWY A;  4SGA E;  1O3K A;  4NWK A;  3EA7 A;  3RC5 A;  2G51 A;  3OTP A;  2FX6 A;  2WV5 A;  4FUD A;  2QXI A;  3ZZA A;  1LHF H;  2V6N A;  1TX7 A;  1HAV B;  3QDZ B;  3M5M A;  4I7Y H;  3RXC A;  1GHX H;  1T31 A;  1P9S A;  1S83 A;  1LMW B;  2PKS C;  1Z71 A;  2XXL A;  4FU8 A;  2FI3 E;  3HK6 B;  1RRK A;  3FP7 E;  2C8X B;  1J15 A;  1BOQ A;  2ZDV H;  3TH2 H;  5C0U A;  4CBO A;  1VKY A;  1G32 B;  3KN2 A;  3QZQ A;  5JB9 S;  3T62 A;  4WMD A;  1A61 H;  3VXE H;  1O2U A;  1BRA A;  1O2S A;  2BOK A;  2BDG A;  4WME A;  4BTI B;  4AX9 H;  1LHE H;  1AHT H;  2BY7 X;  3BG8 A;  3C1K A;  4TWY A;  2KR7 A;  5AFZ H;  1WYK A;  1EB2 A;  2ZTY A;  1CA0 C;  4CH8 B;  3K2U A;  4JYV H;  1C5Z B;  5FX6 A;  1V2N T;  4B1T A;  2FX4 A;  4MVN A;  1GBT A;  1AFE H;  3EA9 A;  2JIZ D;  3A7W A;  1XUI A;  4ABG A;  1F92 A;  3KID U;  2BXT H;  2ZCL P;  5FPT A;  3UR6 A;  1HV7 A;  1C5O H;  4JZI A;  3RC6 A;  2EI8 A;  1W0J D;  2W3I A;  1PPE E;  3QZR A;  3TGK E;  1MKW H;  2BMG B;  2FLB H;  4ASH A;  5IK2 D;  1GBE A;  2ODY B;  2Z9L A;  1BCU H;  1A5I A;  1PYT C;  2WHX A;  5HM9 A;  3ZVB A;  4A6L A;  3LJO A;  1L4D A;  2CMY A;  1AKS A;  5H4I B;  4DJZ B;  3LH1 A;  3QX5 H;  2ODP A;  3F1S B;  3BF6 H;  1OX1 A;  2FOF A;  5HIY A;  1HJ9 A;  3A84 A;  1EST A;  1BDA A;  4RKJ B;  3RC4 A;  2TGA A;  3Q3Y A;  1UVO A;  1NT1 A;  1V2R T;  4JZ1 A;  1YPG H;  3UFA A;  1O5A B;  1NM6 A;  2XBV A;  3PWC A;  2XW9 A;  5A8Y A;  1XUH A;  4OM9 A;  4ZAE A;  1HJA C;  2BLO A;  2ZC9 H;  4P00 A;  1ANB A;  4IGD A;  3SNE A;  2BTC E;  2F9V A;  1ELG A;  4THN H;  2GV6 A;  4X6N A;  2KCA A;  5EQR A;  1S0R A;  2P16 A;  3QUM P;  2A1D B;  1FY5 A;  2RG3 A;  1BTX A;  1SGQ E;  1T8N A;  3IWM A;  5EPY A;  3KYF A;  3MTY A;  4P02 A;  3WY8 A;  1AO5 A;  1WOF A;  2OXS A;  3N7E A;  1J8A A;  1UVS H;  1ZGI A;  4NIX A;  4WJG 2;  5HMA A;  5BRR E;  1FIZ A;  3CS7 A;  2VGC C;  3UB0 A;  1MZA A;  8GCH F;  1F5K U;  3ZVC A;  1TBZ H;  1SLW B;  1EPT A;  1TFX A;  2JJ2 D;  4YT7 H;  2QN5 T;  1DY9 A;  4BAQ B;  2ANY A;  1YGC H;  2GCH G;  2C3S A;  4B6F A;  1KXA A;  3GDS A;  1YPL H;  1YCP M;  5KGO A;  1H8I H;  2AH4 X;  2BDB A;  3M5L A;  3M7Q A;  1BTU A;  2H5C A;  3N7O A;  4ISH H;  2F9B H;  5E2P A;  1QNJ A;  1K1N A;  1O5C B;  4NIV A;  1BUI A;  2Z3D A;  5I25 A;  4JZF H;  1HXF H;  1PYT D;  1HJA B;  2IN2 A;  4YO9 A;  2PSY A;  2ZGH A;  3UR9 A;  4DT7 B;  1EFR D;  4BXS A;  1CVW H;  1GDQ A;  1GMH F;  2NU0 E;  1MAY A;  1AI8 H;  2ZU3 A;  3MU4 A;  1GMD F;  4CRG A;  1ETS H;  1VGC B;  1EX3 A;  3TNT A;  1DOJ A;  1TAL A;  4AB9 A;  1AN1 E;  1UTN A;  5CDF E;  2B9L A;  4Y76 A;  1E35 B;  3DSG A;  2FES H;  5A8X A;  2UUY A;  2VWM A;  1AQ7 A;  4R8T B;  9LPR A;  1TOM H;  1H9I E;  1TLD A;  2A7J A;  4I8J A;  4XBB A;  1C1P A;  4OS6 A;  4XRN A;  5DP4 A;  4SGB E;  1LDT T;  1SC8 U;  1TAW A;  1V2T T;  3MH7 A;  4J1Y A;  5A0A E;  1O5B B;  1SQO A;  1FY1 A;  1GBD A;  2V7Q D;  2STB E;  1AD8 H;  2BD3 A;  1GJ6 A;  1V2J T;  2R2W U;  1O3L A;  2QF5 A;  1W10 U;  5FCR A;  2BD2 A;  3DFL A;  1J9C H;  2ANM H;  1HAI H;  1P12 E;  1Y3W A;  1NO9 H;  1E79 D;  2A5A A;  3MU8 A;  1MCV A;  2GJG A;  1O3N A;  4JZE H;  1YY3 A;  1WSS H;  2G4T A;  4IN2 A;  4X1S U;  4BAH B;  1W11 U;  2QYI A;  4H6S B;  1D3P B;  3HGN A;  1VGC C;  1EP6 A;  1DM4 B;  3ODD A;  2VIQ A;  1C5Y B;  4H4F A;  1JOU B;  3GCT G;  4GAW A;  4CRB A;  1KIG H;  2GP9 B;  1SLX B;  2GTB A;  1PQ8 A;  1WDI A;  1THS H;  2FOH A;  5E0J A;  4GLY A;  1W0K D;  4ZUH A;  3QK1 A;  1T8O A;  3V12 A;  1PPB H;  1O32 A;  3OSY A;  1D3D B;  2PTC E;  1RXP A;  1EJN A;  1EZU C;  1BA8 B;  1GPZ A;  1FAK H;  1HAY B;  2ZU2 A;  1TX8 A;  4FUI A;  4Y6D A;  1YM0 A;  4ZMA H;  1GBL A;  2ODQ A;  5IDK A;  2VB0 A;  3MNC A;  2QE7 D;  2G55 A;  1UVU H;  1C2G A;  5GCH G;  2FOC A;  8GCH G;  1KXC A;  1KXF A;  3IIT A;  3TPI Z;  3U8T H;  1A46 H;  1Y3Y A;  1DX5 M;  3ZYE A;  2BQ7 B;  1DUE A;  3RXM A;  5LPF A;  2ZFP H;  2OBO A;  1PPF E;  4CRA A;  4JYT A;  1EAS A;  1FLE E;  1S82 A;  3F6U H;  1G3B A;  3ZZ9 A;  3PM3 A;  5IYT A;  4FET A;  1O3M A;  3URD A;  3UPE A;  1C4V 2;  1ZSK A;  3U1J B;  2GCT C;  2AER H;  3I29 A;  2JET B;  4FUE A;  2ZU4 A;  2ZIQ H;  2EC9 H;  1NRQ H;  4K8Y A;  1CT2 E;  1O37 A;  2BY9 X;  2CHA C;  1K1M A;  1P2O A;  2FTM A;  2OBQ A;  1MAX A;  2YMS D;  3LU9 B;  2AEI H;  4UFG H;  1IQN A;  1CSO E;  1UW7 A;  4RI0 A;  1O3E A;  1TGC A;  3M36 A;  2Y5G A;  2EA3 A;  2WPH S;  3MNS A;  1HFD A;  4X6M A;  4ACA A;  1GJ5 H;  3QGJ A;  1GHB F;  1GHA G;  5JBB S;  2LNC A;  1EQ9 A;  2XNI A;  4Q80 A;  2YMS C;  2GCH F;  4HZH A;  2THF B;  3GCH C;  5L2Z H;  2FOM B;  1ELB A;  1OWK A;  2SFA A;  4X0W U;  1FN8 A;  3RXP A;  1GI4 A;  2UWP A;  2A7H A;  2Y5F A;  1SGP E;  1O36 A;  1O2Q A;  1ZMN A;  1AVX A;  2ZFF H;  1NU9 A;  1MKX H;  1QJ7 B;  1GHB G;  2K0Q A;  1QY6 A;  4GVU A;  1RIW B;  1SOT A;  1PFX C;  3F9E A;  2EQN A;  4I33 A;  4YES B;  1UK2 A;  4DT4 A;  1UK4 A;  1QJ1 B;  1O3A A;  1Y5U T;  2WV9 A;  1TRY A;  3AK5 A;  6CHA B;  1GHY H;  1FN6 A;  3KCG H;  3GY6 A;  5CE1 A;  1C1O A;  4Y11 E;  3SUD A;  1WXR A;  2ZQ1 A;  3U8O H;  2ANW A;  1K1P A;  5DKM A;  1D9I A;  4ZCN A;  3S69 A;  4HTC H;  5L2Y H;  3NXP A;  3UNS A;  5C3N A;  3VFE A;  4JK5 A;  1CHO G;  5GWZ A;  1E38 B;  1UTK A;  3ZZC A;  1PPC E;  3RU4 T;  1BT7 A;  4AYV B;  2Y7Z A;  1O5F H;  1NBM E;  1BBR E;  3A7Y A;  2P95 A;  4WXV A;  1KXB A;  3TIU A;  1EKB B;  3ZV9 A;  1XX9 A;  3SND A;  1EOL A;  1UCY K;  3HKJ B;  3UWJ H;  4EST E;  2LP6 A;  1GI8 B;  3SJ8 A;  8KME 2;  4E7N A;  1KXE A;  3M7T A;  2ASU B;  4I32 A;  4UFF H;  2R0L A;  1OKX A;  3RXU A;  4UFD H;  2PV9 B;  2FDA A;  1HNE E;  1TQ7 B;  2FZZ A;  1D3T B;  1INC A;  4K69 A;  3M3S A;  1A0H B;  2PSX A;  2PW8 H;  4A92 A;  4CRC A;  4IS5 A;  2VGC B;  1DFP A;  2PUX B;  1MD7 A;  1ELC A;  3SU2 A;  2W7U A;  2VID A;  3EYD A;  1EZS C;  1KLI H;  5A0B A;  2ZHF H;  2F3C E;  1TX6 A;  2BLW A;  2ZFQ H;  1SBW A;  1O2W A;  2AMQ A;  2BDC A;  3W1E A;  3ZVA A;  1LCY A;  3EDX B;  2JJ1 D;  3OU0 A;  3LIW A;  2H1U A;  3KL6 A;  4H6T A;  1AKS B;  2P3T B;  5JDU B;  3MNX A;  5T6D A;  3SHA H;  2RFK C;  3D65 E;  3URC A;  3PRB A;  1Z8J B;  2OC0 A;  3KYG A;  5PTP A;  1C9T A;  1GI7 B;  4MNX A;  1L1G A;  1P2Q A;  1EAT A;  4NA9 H;  1SG8 B;  4Q7Y A;  1FX0 B;  3BIU H;  2XBY A;  1BMM H;  1SGE E;  1DT2 A;  2XOK D;  2STA E;  4ZHA A;  2FOE A;  1O2M A;  2EEK A;  3RXH A;  2TIO A;  1GHA F;  1ZMJ A;  8LPR A;  3EE7 A;  4CR9 A;  2WPI S;  2UUK B;  1T4U H;  3T5F H;  1XMN B;  4D7G A;  3MO6 A;  4A1V A;  1SQR A;  2EY4 C;  1JXP A;  2FLR H;  3BV9 B;  1OHH D;  3CP7 A;  1MKX K;  3ZZ6 A;  4MNV A;  3S7K B;  1A3B H;  2WPK S;  2WZQ A;  1SGD E;  1F2S E;  2Z94 A;  1VCQ A;  2K8I A;  1ZRK A;  3W94 A;  3TGI E;  1G3D A;  4OS2 A;  2WPD D;  1VIT G;  3ATK A;  1IQE A;  1NES E;  2HGT H;  1Y5A T;  5DP9 A;  4X8T H;  1IQM A;  3VB3 A;  2JDI D;  3SNB A;  3HGP A;  1P2N A;  3FO8 D;  5C94 A;  2FYR A;  1C2J A;  2CF8 H;  2AMD A;  1L4Z A;  5F8X A;  4B74 A;  2ZP0 H;  5L6N H;  1BTY A;  1CO7 E;  1H9H E;  1Q3X A;  1C5U A;  2G5N A;  3NKK A;  4RN6 A;  4TY6 A;  1GG6 B;  5K0H A;  1NRR H;  2HNT F;  2J98 B;  3PRO A;  1HAG E;  1OS8 A;  1QL9 A;  1O2N A;  1C1N A;  1O2Z A;  1IOE A;  1YCP K;  1QQU A;  1ZLR A;  2H5D A;  1Z1I A;  1FDP A;  3ATW A;  4JYU H;  3ATI A;  1NRS H;  2M2A A;  3Q77 A;  3E91 A;  3SV7 A;  3OY5 U;  1A5G H;  4KP0 A;  3A86 A;  4VGC C;  2HVY B;  1TNI A;  2P93 A;  5E2O A;  1O5G H;  4TSF D;  5FPY A;  1GJ7 B;  1ZRB A;  1MTW A;  2GMT B;  1O3P B;  3MO9 A;  4YLU A;  4YOJ A;  5EXM A;  1O2J A;  1QCP A;  3T2N A;  1IAU A;  1P3E A;  2NU2 E;  3SU4 A;  4UFE H;  1EJA A;  3LT3 A;  2GZ9 A;  2RCE A;  5FBI A;  1AMH A;  3OY6 U;  4AB8 A;  1DXP A;  3PLK A;  2FYQ A;  4Q63 A;  3L33 A;  1A5H A;  4BXW A;  2BDA A;  3A85 A;  1Z8R A;  1Y3V A;  2W5E A;  3RMN H;  1O3H A;  2Z9K A;  1QTF A;  1E1R D;  2ZKS A;  7KME H;  1C4Y 2;  4X8S H;  3S9C A;  2AMP A;  4X2W A;  3RXG A;  1GCD A;  3TLO A;  1WCZ A;  3QGN B;  3VB7 A;  3UQV A;  1QUR H;  1UVP A;  1AUT C;  2ZG0 H;  3ENS B;  4Y79 A;  3SUF A;  1LVO A;  3VPK A;  1BHX B;  3GIC B;  1P8V C;  2FI5 E;  3SJI A;  3LH3 A;  1DUA A;  5EGM A;  3P17 H;  1CHO F;  1MU6 B;  4Y10 E;  1RD3 B;  3SU0 A;  1ZSL A;  4X8V H;  5FAH A;  2QY0 B;  1CBW C;  1O2X A;  5ABW A;  1SGT A;  1ZHM A;  1UTO A;  4FUG A;  2HNT E;  2Q6D A;  5DP8 A;  3F2H A;  5E0G A;  1DIT H;  4NG9 H;  1JWT A;  2BVS H;  2C93 B;  1TNL A;  1ZJK A;  5A09 A;  1AE8 H;  1GBI A;  3MOC A;  2XBX A;  2A4Q A;  4O3T A;  1OWJ A;  1P57 B;  3PRD A;  1GI6 A;  2BOH B;  3AAS A;  1B0F A;  3KQD A;  4AOR A;  1P03 A;  1UTQ A;  3VB6 A;  1ELA A;  1NS3 A;  5EW2 H;  2KX4 A;  3M35 A;  2YMS B;  2QV1 A;  1GJB B;  4AFZ A;  1GBC A;  2ZCH P;  1YF4 A;  1CGH A;  1AY6 H;  1W8B H;  1K21 H;  1GHZ A;  5GCH F;  1SFI A;  3KQE A;  3KEE A;  2C8Y B;  4AZ2 B;  1IQL A;  1YPM H;  4K1T A;  3SOS A;  1C2H A;  3BTH E;  3MFJ A;  1E34 B;  1JIR A;  1AVG H;  1XXF A;  1AFQ B;  1NFU A;  3JZ1 B;  5HYO A;  3WW7 A;  1EAX A;  5CMX H;  1GDN A;  1HDT H;  1NPM A;  1LHG H;  2PR3 A;  2VH0 A;  2PTN A;  4IMQ A;  3P95 A;  3TGJ E;  1UHB B;  1KMH B;  1DIC A;  4IC6 A;  1LQE A;  1GWA A;  1LHD H;  1NRP H;  3GS9 A;  3RP2 A;  3RDZ A;  4F48 B;  2BVX H;  4BAO B;  1HPG A;  2RA3 A;  5EOK A;  2KM0 A;  4I8L A;  4F55 A;  5GIB A;  4Z6A H;  1KTT B;  3H7T A;  2ZHD A;  1H8H D;  4ABF A;  5L30 H;  3RXD A;  5EPN A;  5LPE A;  2GZ7 A;  1WUN H;  4D7F A;  2KCP A;  1O3D A;  2ZDK A;  1P04 A;  2F9O A;  4X1Q U;  3ITI A;  3CNR A;  3ZIA D;  5EXL A;  1S81 A;  1Y3U A;  2GMT C;  2RDL A;  2SGA A;  1YP9 A;  1ZZZ A;  1LVB A;  1GJ9 B;  1N8O B;  3ZZ8 A;  3UWI A;  2ZPR A;  4VGC B;  2EST E;  3PMB B;  3ZVF A;  2A7C A;  2BY8 X;  1GJ4 H;  1BTH H;  1CGJ E;  1V2P T;  3CS0 A;  5DP3 A;  7LPR A;  1ZOM A;  1ZHR A;  4I86 A;  3URE A;  3CEN A;  3LC3 A;  1P09 A;  3RXI A;  2Q6F A;  3HK3 B;  4HGC A;  1UTL M;  2QGR A;  1EAI A;  1S84 A;  1MTU A;  1MCT A;  4KGA A;  1UTJ A;  3GCN A;  2TBS A;  2IOT A;  1O3J A;  2A4R A;  3UUZ A;  1FXY A;  1CQQ A;  1HAP H;  6GCH G;  3EQ0 H;  1NFX A;  1TGS Z; 
#chains in the Genus database with same CATH homology
 3OEE D;  3SV9 A;  1CU1 A;  3H09 A;  4B74 A;  1NS3 A;  1BT7 A;  2W6J D;  5GND A;  2AHM E;  3RC6 A;  2OC8 A;  5FPS A;  2F43 B;  4K8B A;  1W0J D;  2OBO A;  5B6L A;  1NBM D;  1NBM E;  1SKY E;  3LOX A;  2OC7 A;  2YMS B;  3P8N A;  5C0T A;  2QV1 A;  5IK2 D;  3N7D A;  4B75 A;  4M9F A;  5DSF A;  4FET A;  3OEH D;  4KTC A;  5CDF E;  3DSO A;  4TT3 D;  2YOL A;  1H8E D;  5FL7 D;  3U1J B;  1BMF D;  4I32 A;  3SU5 A;  2WHX A;  4YXW D;  2O8M A;  3KEE A;  4NWL A;  3WWF A;  2M2A A;  3SV7 A;  1COW D;  5H4I B;  4R8T B;  3U1I B;  3OE7 D;  4B73 A;  2QF4 A;  5FPT A;  5HKK D;  4A92 A;  4TSF D;  5FPY A;  2XCF A;  3E90 B;  2KCO A;  1DY8 A;  1W3C A;  3O8C A;  3SU2 A;  2J5U A;  2OBQ A;  3EYD A;  3RC4 A;  3SU4 A;  3M5N A;  2YMS D;  3WW7 A;  2V7Q D;  3N99 A;  3KNX A;  3P8O A;  3PV5 A;  3SU1 A;  1MAB B;  3OAA D;  4RI0 A;  3SU6 A;  3SUE A;  4ASU D;  1N1L A;  4I31 A;  2OK5 A;  1DXP A;  4Z1M D;  2QF5 A;  2KCY A;  3LON A;  2KFW A;  4Q63 A;  1KMH B;  4U01 A;  3W1E A;  2CK3 D;  2LEL A;  5T1V A;  2JJ1 D;  5CHB A;  5ESB A;  4WH6 A;  4OM9 A;  3GS9 A;  1E79 D;  5EQQ A;  3DSP A;  3SUG A;  2F9V A;  2IJD 1;  1E1R D;  2W6I D;  2XNI A;  2KM0 A;  5DN6 D;  3F2F A;  3F2G A;  2KCA A;  2P59 A;  2YMS C;  4B71 A;  5EQR A;  4F55 A;  4Q4L A;  2FOM B;  3VG8 A;  3WWB A;  3PV2 A;  1H8H D;  3PRB A;  4NWK A;  4TYD A;  5EPN A;  3RC5 A;  2OC0 A;  1RGQ A;  3OTP A;  5EPY A;  2KCP A;  2K1Q A;  2A4G A;  2L6O A;  3SUF A;  3OYP A;  1E1Q D;  2F4L A;  2GGV B;  3SV6 A;  3M5O A;  3N7E A;  3M5M A;  3DCL A;  3NRL A;  3ZIA D;  1FX0 B;  3FN8 A;  2K0Q A;  4WH8 A;  3UB0 A;  4WF8 A;  2OIN A;  2XOK D;  2VBC A;  2F9U A;  4B6E A;  4I33 A;  1RTL A;  2HLD D;  5C0U A;  4DT4 A;  3L6P A;  3KN2 A;  3O8D A;  2IJO B;  4XD7 D;  5ETX A;  5EQS A;  3SU0 A;  2JJ2 D;  1W0K D;  1DY9 A;  2WV9 A;  3SYJ A;  2KZ4 A;  3AK5 A;  2FP7 B;  3FOA A;  5C17 A;  3SV8 A;  4A1V A;  1JXP A;  2KR7 A;  5GJ4 B;  1A1R A;  3F2H A;  3SUD A;  1OHH D;  4A1T A;  4B6F A;  1WXR A;  3M5L A;  3F0P A;  2OC1 A;  2WZQ A;  3F0O A;  3O8B A;  2K8I A;  3F3B A;  3LKW A;  3FO8 D;  5F53 A;  4ZCN A;  5GPI B;  2WPD D;  2GVF A;  3OFN D;  3KF2 A;  2FM2 A;  5IDK A;  2A4R A;  3O8R A;  2QE7 D;  2XCN A;  3FKS D;  1DXW A;  2JIZ D;  1S6L A;  2JDI D;  2A4Q A;  2WSS D;  4JMY A;  4B76 A;  4A1X A;  2XND D;  3SZE A;  3PRD A;  3SU3 A;  1EFR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...