4Q63A

Crystal structure of legionella uncharacterized protein lpg0364
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
YFRLKNHGEINASLDNNSIEIVEISSNGAVVVKQKTDIPKEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein Lpg0364
publication title Crystal Structure of Legionella Uncharacterized Protein Lpg0364
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 23
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.430 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4q63A00
4Q63A
chains in the Genus database with same CATH superfamily
4MQAA 2WV5A 1K28D 2GCTC 1O3GA 4YOIA 1LQEA 1AFQC 1KMHB 2XNIA 4FU9A 2GMTC 1G37A 3BG4B 4FUFA 3ZVAA 5BRRE 2BVSH 4RT0A 1SGNE 4Y10E 2PFEA 2SGPE 5ABWA 1XVOA 2IJOB 2F83A 4ISHH 5AF9H 2GDDA 5F03A 2G4TA 1MTSA 1O2MA 3DHKH 1DVAH 1T32A 2ZHDA 4MNXA 2BXUH 3PRDA 4BXSA 2WYGA 1GL1A 1WDIA 1CU1A 3MU0A 3MO6A 4YT7H 1QURH 1ANBA 1QZ8A 1HIAB 2GCTB 2AEIH 2QAAA 1Z8RA 1BDAA 1QJ6B 2JH0D 1AFQB 1WSSH 2RDLA 4OS4A 3BEFB 3ZVGA 1ESBA 1K1OA 1CA0C 2XBXA 4OS2A 3A80A 2ALVA 2THFB 1M9UA 2GMTB 3KQ5A 3AVZA 3M3TA 3U69H 4K69A 2A4OA 1GVZA 2VWMA 2O8TA 2A4QA 4RT1A 4BNRA 1GJ5H 2VINA 3FO8D 4ZUHA 1C1TA 5FX6A 3CP7A 1G3DA 3K6ZA 1NS3A 3TGKE 4AFQA 1ELDE 1MTVA 2VIVA 4K3JA 2FXRA 1GBFA 1YF4A 2ZFQH 3LH1A 3VXEH 3EGKH 2F9VA 1SGPE 2YOLA 3A89A 4B6EA 4RN6A 1O2PA 2ZU5A 2BY5X 4MNVA 2C4FH 5EPYA 1W7GH 1WV7H 2OTVA 4X2XA 5DP5A 3O8BA 3FP6E 5EW2H 2Z3DA 1HAPH 4K5ZA 1GHYH 1CA0B 1O36A 2RCEA 5IDKA 3RMNH 2GGVB 1IQNA 4K8YA 2F91A 3RDZA 1TX7A 2V3HH 1O3HA 4MPWA 4ZKOU 1DITH 1H8ED 1LHGH 2ZF0H 2ZHFH 1UK3A 1LVBA 1E34B 1GCDA 4CBOA 3DD2H 3STJA 1NRPH 4UDWH 2OC8A 2FOBA 1RIWC 4OS1A 4P00A 1MH0A 1C5NH 2Q1JA 2ZFRH 2TBSA 1CT4E 1SOTA 4B71A 2KAIB 5DN6D 4Z0KA 1FY3A 2ZTXA 1QGFA 5A8ZA 1MABB 3P92A 2L6OA 1UK2A 2FOEA 1MTNC 1HPGA 1GJDB 1K21H 1YPLH 4ZHLU 1C2KA 8ESTE 1BBRE 1TA6A 1V2LT 4NWLA 2BX4A 2JETB 1KDQA 3UFAA 5EXLA 2J9NA 1XKBC 1C2IA 4LK4A 2BOKA 2VVVA 1RIWB 3RXSA 3F68H 2KFWA 1Z7KA 2CF8H 2AGEX 3ZZ6A 1XUFA 1Y5UT 3DCLA 2STAE 4U30A 1SQOA 1EZSC 1QRZA 1WTGH 1HB0B 4XBCA 3D62A 3MYWA 1RTLA 2J92A 3GY4A 4DY7B 1MTNB 2TGPZ 4KGAA 4YESB 5L2YH 5DP8A 4H4FA 3M3VA 1PPZA 1W14U 2ALPA 4AORA 4KTSA 2AMDA 2ZPRA 1AN1E 1GBBA 2ZGHA 3E91A 1H9IE 1HAZB 4NIWA 4UE7H 2LELA 4DT7B 3M7TA 4AYVB 1LVOA 2UUJB 2BQ7B 1O5GH 4CRAA 3DSOA 1CGHA 5GPIB 1PYTC 5GJ4B 5DJ7A 1AB9C 3MH4A 1GMCF 3UR9A 4ZKRU 5KEDA 2G5NA 3VGCC 1LPZB 3F3BA 3LPRA 7GCHF 4AFUA 1P03A 2ZDAH 1NRQH 3MNXA 4AZ2B 4ZCNA 1NU9A 4DIIH 2OC1A 2A5IA 2BHGA 1BRAA 5HYOA 2ZEBA 8KME2 1UTLM 3F6UH 4JK5A 5EQRA 5E0HA 1HAXB 1LKBA 3GCTG 2GP9B 2Q6DA 1GJ9B 2OCVB 3E6PH 1KXCA 2GV7A 1BRCE 2PSXA 2XC5A 3PM3A 3M7UA 2BD4A 2XTTB 1KIGH 3SQEE 2BD7A 1AB9B 1BMMH 1IOEA 1F2SE 2HNTE 3FZDA 3NPSA 3ZZ9A 3VGCB 3W95A 3A88A 1EP6A 1HLTH 1F0UA 1AKSB 2ZC9H 1V2PT 3ZV8A 2QYIA 1HDTH 1E37B 4RKJB 3Q00A 3LDXH 1BT7A 1ZSJA 2PKAB 2LPRA 4B2BA 3SN8A 1K2I1 3GCHC 3RXUA 1MAYA 4U01A 3SORA 1AVXA 2BLQA 1P04A 1FJSA 1SLWB 1UTNA 3PWBA 1SGEE 3T2NA 3QTVH 3PWCA 1BBRH 1UW7A 3P8NA 2Z6BD 5L2ZH 2QXGA 1Z1IA 1ETTH 3JZ1B 4NIYA 3TH4H 3HKIB 1ELCA 2VIPA 1C5YB 2SFAA 4AOQA 3MWIU 3R0FA 3EDXB 3CENA 2PHBA 1VITG 5FXLA 1NC6A 1P05A 5EJ1A 3ZZ5A 2W6JD 3ZVEA 4ASUD 2YMSD 1XX9A 3MMGA 1CA8B 4YT6H 1BHXF 2W3IA 5H4IB 4IW4E 3LGYA 2Y7ZA 1Y3WA 2C93B 1O2WA 5DK1A 2WPIS 3GCHB 2ZTZA 1GHWH 2TGDA 3KF2A 1OS8A 1PQAA 2VIQA 5CHAC 4MPXA 1MZDA 4DOQA 1CGJE 1QCPA 3RXCA 1OWHA 1C2EA 1MQ6A 4MPUA 2Z94A 5T6GA 4TSFD 3MTYA 1GBLA 4GVUA 2FDAA 3P8GA 5GIBA 3SV7A 3T27A 4A1VA 3M5OA 1QL7A 1AE8H 2ESTE 5JBBS 2CK3D 1UCYK 1ZLRA 1YPHC 4CRFA 3ZZBA 1LTOA 5FL7D 1BJVA 4XFQA 2IPQX 1U6QA 1DE7H 3VB6A 2A5KA 3T26A 1D6RA 3GY8A 1W0ZU 1O2QA 2O8UA 4CBNA 3BTGE 4Y8ZA 1A2CH 3F0OA 1BHXB 2BDIA 2J98A 3SNBA 1BCUH 6GCHG 2R2WU 4A6LA 1O2XA 4Y11E 1TNJA 2ZKSA 2P95A 1J8AA 5CHAB 2H9HA 1IHSH 3T29A 1C4V2 5A0CA 5K0HA 3SU3A 5GCHG 3LKWA 1CSOE 1SGQE 2KR7A 1S6FA 2P8OC 1YCPH 1UO6A 3SYJA 2LP6A 1KY9A 3DSPA 1BOQA 1MU6B 1V2JT 1GJ6A 2BYAX 1KXBA 1WUNH 1O39A 1QJ1B 3JZ2B 1JIRA 1TQ7B 1TFXA 3CS7A 1FXYA 2XCFA 1HCGA 2J4IA 4YZUA 1BITA 4XD7D 1EQ9A 1JRTA 2BDCA 7KMEH 1BRBE 1T8MA 1IQGA 1O30A 2G52A 4I31A 1MTUA 2KM0A 4A5TS 2BY6X 3B23B 3ZZ8A 1G36A 1UK4A 1DSUA 4Y6DA 2GT8A 2P8OB 1E79D 1EJMA 1GL0E 4UFFH 1OHHD 1AWFH 3SGQE 1W0JD 1RS0A 1TB6H 1VJAU 1NY22 2QGRA 1A1RA 2VIOA 3SI4H 1SGCA 1NTPA 4H42U 1GI4A 3SJ9A 3ZVDA 4AB9A 1K1NA 5I25A 1BTYA 1BRUP 1C5TA 4ABBA 5C67A 3RXJA 2D1JA 3E0PB 3GY2A 1N1LA 2ZI2H 1GBKA 2GZ9A 3VFEA 2UWLA 3LC3A 2R0KA 2BLWA 4IC5A 2A7JA 2ZA5A 2KCPA 1HAVA 1AI8H 1SPJA 4R0IA 3URCA 1N8OC 3MFJA 1XKAC 4WXVA 3IWMA 1P3EA 1LQDB 3IG6B 1A3BH 4KELA 2G00A 2M5TA 1GCTC 4FUHA 4X2YA 2FZZA 3EE0B 2SGQE 1OP0A 1V2RT 6ESTA 1MU8B 2NU2E 1CGIE 3M37A 1Z8IB 5E2PA 1ZSKA 1O3NA 1QB1A 1TMTH 4RKOB 4FVBA 4IN2A 1BBRK 5EQQA 1A5IA 3OTJE 4JMYA 8GCHF 2QCYA 1TX6A 3TK9A 3RC6A 3BTEE 1TNLA 1KXFA 1O2SA 2HVXA 3UTUH 1FZZA 2KCAA 4KP0A 2ZFTA 2VWLA 3PMBB 2HWLB 5T6FA 4YOGA 4ABHA 2Z9GA 4D76A 1MBQA 4AN7A 1N8OB 1Y8TA 2PTCE 1G9IE 2GD4B 4AC9A 2ZHWH 2Y80A 4X1RU 1GCTB 2UUFB 4JZEH 1GI9B 1C9TA 4RSPA 2NWNA 1SG8B 1DUEA 2VB0A 3EYDA 3DUXH 1GJBB 2W3KA 4Q2KA 5E0JA 4ABIA 3RU4E 1DWBH 3SI3H 4NZLA 1V3XA 1OYQA 2WUBA 1K22H 3RU4D 4ACAA 2BD9A 1B7XB 1K0HA 1C5PA 2FOMB 1MCVA 2O8LA 1G2LA 1CHOF 1SGDE 3KQBA 1YPGH 2PLXA 4OS6A 1DWCH 4UONA 2FI4E 1ZR0A 1BMAA 3M35A 2GJGA 1C5ZB 3OTPA 1TALA 4AFSA 2G51A 3OE7D 2C8WB 2FX4A 1YKTA 1Y3UA 3SNEA 5HIZA 1TGTA 5TJXA 1TMBH 1S81A 5T6DA 3U9AH 3DT0H 1GVKB 1AUJA 1S85A 2B0FA 2BDGA 4MPVA 1AO5A 4ISOA 1C5WB 2P3TB 3QX5H 4NIVA 4IS5A 3U8OH 2G8TA 1ZRKA 2BDAA 1NROH 1GI2A 3FANA 1LDTT 1GHAF 5CHBA 1GI5A 3QTOH 1C1RA 3A7YA 3QGNB 7ESTE 1UTOA 1TGSZ 4Q7ZA 2W5EA 3NRLA 1CT0E 2OP9A 4TY7A 1F92A 3I77A 4BANB 3KCGH 5EQSA 4AGKA 2FODA 5EJLA 1O2YA 1A7SA 1O3PB 1SC8U 1QRXA 3G01A 3UIRA 1AE5A 1KLIH 1ELAA 1XMNB 3RXVA 5AFZH 3FP8E 3NCLA 1YWUA 5BPEA 2FWWA 5A2MH 2HPQH 3NKKA 2HRVA 1BB0B 2PP6A 1O2JA 1DUAA 1THSH 2J2UA 2SNWA 3N99A 1HNEE 1BTHH 1O33A 1TPAE 3UB0A 5C94A 4MLFB 4IGDA 1J14A 3P8FA 1ANCA 1Z6JH 4XDEA 3UNSA 1TNKA 1P2QA 1GI8B 2ZGJA 4LOYH 1BTPA 2DE9A 3N7DA 4E05H 1J15A 1OP2A 4WF8A 2F43B 1EPTC 1MBMA 3KQDA 3OEED 4FUGA 1GBTA 1TAWA 5TCAA 2CJIA 1TBQH 1GI6A 1LHFH 3SU4A 3SV8A 4K8BA 5JBAS 1VR1H 1BTZA 4MDSA 3SV9A 2UUYA 4X0WU 1QRWA 1TNGA 1EOLA 2AFQB 1C2DA 4DIHH 1T7CA 2VVUA 1GBHA 3QWCH 1G3EA 2ZU1A 3N7OA 1IQHA 2WYJA 2XOKD 3UPEA 1GVLA 3RXMA 1HUTH 3SUFA 1NU7B 1NT1A 3LH3A 3ZZCA 1Q31A 1ETSH 3M5MA 4JCNA 3A8AA 5JB8S 1EPTB 3SU0A 1RRKA 1RTKA 1F5LA 2BDHA 1GJCB 3GDVA 4X1PU 1DICA 3ZYDA 3BTME 1GHZA 1W0YH 4FVDA 4DURA 2CXVA 2FOGA 2ZCLP 4LZ1H 3Q76A 1EKBB 2QXIA 4H6SB 4JZIA 4BAMB 4XOJA 1ZGVA 1W12U 1TWXB 1PYTD 4A7IB 3V13A 2ZP0H 1UTKA 1UTPA 5F8XA 3SOSA 5FHTA 4F4OC 4D9QA 3FFGA 2SNVA 3UOPA 3FP7E 1FY1A 1OOKB 4I86A 4BOHA 2CHAC 1QBVH 4WH8A 4ISNA 1X7AC 2ODQA 4D7FA 2BXTH 1GMHF 5HIYA 2FP7B 3DA9B 3EA9A 1XXDA 5HXFA 1V2QT 4R8TB 1F5RA 2P3UB 2PTNA 3WW7A 2ZDMA 3A7ZA 5T3HA 4XSKU 3TLOA 1O32A 3OX7U 1H8HD 2WINI 4WWYA 5DP6A 1AFEH 3AAVA 1GPZA 1V2TT 3SU1A 1IAUA 2F9BH 1PPFE 4Z1MD 4I8HA 2R9PA 3S9AA 1W7XH 4CH2B 2ZECA 3SU6A 2RFKC 2ZQ1A 4CR5A 1AIXH 3LU9B 4X1QU 1O5FH 1TRYA 2CHAB 2OLGA 2Y5FA 3FN8A 3LGIA 4X8VH 3GY6A 3BIVH 1IQMA 2BD5A 1FLEE 4I32A 4FXGH 3BTWE 3RXPA 1EZUC 1FUJA 4ASHA 2KCOA 3TJVA 2K1QA 5A8XA 1UVPA 3SJIA 3Q3YA 7LPRA 4Y0YE 1D9IA 1A0HB 3KQEA 2QV1A 4Q80A 1UCYH 3KNXA 4CRBA 1YBWA 2QXJA 2GTBA 3S9CA 1EZQA 6LPRA 2UWPA 3U8TH 4HTCH 3MHWU 2C8ZB 2FEQH 2FS8A 3ZYEA 5DPAA 1D3TB 1GDUA 3A8CA 4INLA 3RM0H 3P6ZB 3D65E 1GMDF 2GZ8A 1O2NA 5CDFE 4U32A 1FIZA 1FIWA 2JKHA 3F0PA 3LGTA 4D9RA 2AMQA 1L4ZA 1YY3A 1C1NA 4F49A 5JB9S 2W26A 4YO9A 1S6HA 1YPHE 3RXKA 2ANWA 1O5EH 4Y71A 3BF6H 2WUCA 4WMFA 2B9LA 2AERH 5JDUB 1VITH 1SVPA 2PGBB 1YLCA 3ZVBA 3FAOA 3GYLB 2FYQA 1GBJA 1DLEA 2XW9A 3RU4T 2ZPQA 4FUCA 1DOJA 2BZ6H 3DSGA 1ZYOA 3GS9A 1CVWH 2C8XB 4GHQA 1XXFA 3O8RA 4I8KA 2QF3A 3VEQB 3PV4A 3U1IB 2F9PA 1AQ7A 3D23A 4DVAU 1YCPM 1S6LA 3PMHB 4UFDH 3U98H 3RXHA 3N7EA 3RLWH 2FPZA 1GJ4H 5IYTA 1ORFA 4FUEA 2NU4E 4TPIZ 3ESTA 2BZAA 1H1BA 1IQIA 3TNTA 4A1XA 4NSVA 5E0GA 2AGGX 1KTSB 4CREA 4K1SA 1XUIA 5HGGA 1E1QD 1E1RD 4X2WA 3BTDE 2XC0A 5FPYA 1L1NA 1P12E 3KYGA 4WXIA 1LCYA 3P70B 3TGJE 2C90B 1BZXE 1A46H 3MU8A 3RXQA 1C1OA 4OS7A 5FCRA 3TJNA 3TK6A 3W1EA 4ESTE 4ABAA 1SMFE 1C5SA 1LVMA 1P2KA 1SGIB 4DW2U 1P57B 3T25A 2ODPA 3LT3A 1C1SA 2D2DA 3SJKA 4CRGA 2XC4A 1ACBE 2QY0B 1QQ4A 3PMJA 3GYMA 4YLQH 3SGBE 1MD8A 2SGAA 1P3CA 3M5LA 4NIXA 3LGVA 1QA0A 1UTQA 1C2JA 1ELTA 1P09A 3H5CB 4NWKA 3NK8A 2F9OA 2PW8H 3GDUA 1DSTA 2TRMA 3VXFH 3NZIA 1O2ZA 4RI0A 5EOKA 1T8LA 4WVPE 2HOBA 4O03A 2P16A 5HKKD 1IQKA 2CMYA 1DPOA 2FX6A 3BIUH 3S69A 1GDQA 2ASUB 1NFWA 2Y6TA 5C2ZA 1TOCB 1H9LB 1D4PB 3OY6U 2DUCA 4BTTB 3RM2H 2FOHA 2PKSC 1KXEA 1KDQB 3UQVA 4THNH 2OD3B 4OGXA 1FY4A 4NFFA 3PLPA 4A92A 1AGJA 1P11E 3MOCA 3E8LA 1C5UA 2Z3CA 3TH3H 2ZDKA 5CE1A 1LKAA 3M36A 1GMCG 3MO9A 1LMWB 3PTBA 2G81E 3SJ8A 1MKWK 2O9QA 5I46H 4QT8C 1MMJN 7GCHG 1SGRE 1QL9A 1CHGA 3PO1C 2P93A 2EI8A 2EI6A 4X8UH 1NM6A 2HGTH 2BY8X 2R0LA 1QFKH 3AK5A 1OP8A 2ZWLH 1SQAA 1C4Y2 1P2MA 5B6OA 1MCTA 2PKSB 1PQ8A 2SGEE 3OSYA 1NZQH 2KCYA 3MNSA 1ZOMA 3LJOA 1C5MD 2Z9KA 5DKMA 1KLTA 1PPHE 2SGFE 4YXWD 1GHXH 4YTAA 1SOZA 4GCHF 1HJ8A 1B5GH 3KN2A 1O3LA 3PO1B 5C1UA 1DX5M 1SFQB 1ZJDA 1E38B 2OBQA 1S0RA 1SGTA 1C1VH 3V0XA 3SV6A 1C5LH 2FLBH 3T5FH 2IN2A 4TY6A 4IC6A 3RXLA 2WZQA 1JRSA 1NRSH 3HGNA 4WY3A 4DG4A 3ODDA 5JBTA 2V3MA 2FM2A 1UVOA 3F2HA 4Y8YA 1E36B 2OQ5A 4AGJA 2ANMH 3EAJA 2ANKH 1ABJH 1P8VC 3TPIZ 3SGAE 1Y3VA 1DWDH 3F9FA 2EQNA 4Y7BA 5LGOA 2RG3A 1TLDA 4BTUB 3STIA 3GY5A 1MZAA 2QE7D 1INCA 3BV9B 3OYPA 1OXGA 3V3MA 4ABGA 3ELAH 2Z9IA 3MH7A 2ZHEH 1MKXK 4E7RG 1VKYA 2B5TB 3SNDA 2FTLE 2WHXA 1ANDA 3O8CA 4FETA 2HNTF 3D49H 4P02A 2BM2A 1P2JA 3A81A 1C5OH 2ZG0H 4K1EA 1J16A 5EG4A 2XXLA 2Y81A 1MUEB 1GDNA 1WYKA 1XUJA 3FVFB 4MVNA 5AFYH 5DG6A 1FONA 2JJ2D 5AHGH 4I8GA 4CR9A 1P10A 1WTHD 3AASA 1L2EA 3ZIAD 1AZZA 4WMDA 1QIXB 2GZ7A 4I8JA 1TIOA 2J5UA 3ATIA 3SW2B 1SQRA 2ZQ2A 3TU7H 3MU4A 3BTFE 3RXEA 3BTHE 1HBTH 2PV9B 3C1KA 1EZXC 4GUXA 4JZDH 3SJOA 3AW1A 2A2XH 2P94A 4KTCA 4TT3D 1DWEH 1SLUB 4M9FA 3MH6A 2VVCA 1A0JA 1DS2E 2GX4A 2ULLA 1S83A 2K8IA 4A1TA 1A61H 4Z6AH 1GI0A 1UHBA 2J38A 1C2FA 2BDYA 3QDZB 1HRTH 4TWYA 5FBIA 2FO9A 3K2UA 1P9SA 1ELGA 4AFZA 1S84A 4DT4A 1FMGA 1ZJKA 3E0NB 1W13U 1VJ9U 4HI3A 2FOCA 1C5RA 3RMOH 1WXRA 2BDBA 1NRNH 1TABE 1Z8GA 4LZ4B 4HZHA 1GHBF 4IMQA 2DE8A 3A82A 1EASA 1P2IA 3ENSB 2OK5A 4X8TH 1QB9A 1JIMA 3C27B 1O2GH 4VGCC 1UVUH 1NO9H 3SU5A 2Z3EA 2ZU2A 1FDPA 3PB1E 2UWOA 4ISLA 4YM9A 2D26C 3BTKE 3M5NA 1E35B 1FY5A 1O3OA 4F55A 2JDID 1YPMH 3B8JA 3PLBA 1EAIA 1HIAA 2HLDD 3K65B 1G2MA 1AY6H 2GCHG 2UUKB 1A3EH 1H4WA 4SGBE 1ZTLA 4ZHAA 1TNHA 1W10U 1GJ7B 1BMFD 4O97A 4B75A 1TMUH 1FN6A 2FMJA 3F9HA 4GHTA 1GI3A 3B9FH 3RXAA 4NCYA 4VGCB 4ABFA 1QJ7B 3CNRA 1QBNA 4B6FA 3LIWA 3VPKA 2G5VA 1YM0A 1ZHMA 2WPJS 2V7QD 4ABDA 4GLYA 1HAYB 3KYFA 5IK2D 3RUOA 2XBVA 1AHTH 2J97A 3ZVCA 2PR3A 3BEIB 3GOVB 1SHHB 2O8MA 2OUAA 4YOJA 1NFYA 1WQSA 2H2ZA 2AIQA 1V2MT 2L74A 2BVXH 1CO7E 8GCHG 2BOHB 1GBDA 2V3OH 4KKDA 2J94A 3EA7A 1Y5BT 3UAIC 2A45B 2VIDA 5J4QA 1AUTC 1HXEH 1YYY1 5AVDA 1J9CH 2QIQA 3UNRA 2A7HA 2EC9H 3EE7A 1V2ST 1FPCH 3Q77A 5C5OA 1G3CA 1PFXC 1C2MA 1SB1H 1TBRH 1O3EA 2A7CA 1BJUA 1O0DH 1HAVB 1WU1A 1EAWA 1JBUH 3MNCA 4BXWA 2OC0A 2W7SA 3PROA 2VIWA 2KAIA 3SUEA 2WPMS 1ZTJA 2BB4A 1PJPA 3BTTE 3W94A 1EJAA 1RD3B 4BAOB 1Q2WA 1QB6A 4Y0ZE 4E06H 1SLXB 1E0FD 2VWOA 4GSOA 1UVTH 4B2AA 1YPKH 3A83A 4ZKSU 1BIOA 1JMOH 3A7WA 2B8OH 1LVYA 3P95A 3O8DA 1T8NA 4PROA 2WSSD 4INKA 2OINA 2QN5T 3VB4A 1T31A 1CHOG 1ZPZA 1NN6A 2G55A 4JYVH 3TK5A 1HJAC 3A7TA 1ABIH 3BTQE 3UOUA 1NBMD 1OX1A 1YLDA 2KX4A 2R3UA 2VWNA 4ZROA 2AIPA 2H5CA 1LPKB 1ID5H 4MNWA 4X1NU 1OPHB 4Y79A 1KXAA 2QC2A 2IPHA 1GBCA 1TX8A 3L3TA 2TGAA 3RXOA 1K1IA 1V2KT 4K1TA 4IMZA 2BD3A 5C0UA 1SL3A 1D3DB 3S0NA 5F8TA 2ZZUH 3GY7A 1J17T 1HYLA 3BG8A 3QLPH 1BTXA 1GHAG 2PUQH 1Y59T 2BQWB 1JWTA 1EATA 5GXPA 1KSNA 3H09A 3M61U 1ZRBA 1HJAB 1D3PB 5LH8A 3ATMA 2ANYA 2A31A 5A09A 4NGAH 1IQEA 1RTFB 2AS9A 1LPGB 1O2LA 3ZZAA 1SSXA 1FAKH 1QBOA 1FV9A 4JZFH 1UVSH 3EA8A 1KXDA 2C3SA 2Z9LA 1TPPA 2RDEA 2Y5GA 1TGBA 1W11U 1QA7A 3TITA 1HAHH 5CMXH 1ZTKA 1Z71A 2STBE 2J34A 1WQVH 1THRH 2NU0E 1P9UA 1B0FA 4UFEH 4CHAC 1YP9A 4UFGH 1T4UH 4NA7A 1O31A 3H7OA 5EW1H 2EI7A 1Y5AT 1DT2A 3PYHA 3UNQA 1SGFG 1WCZA 4IBLH 1O2OA 3V12A 4DJZB 5FAHA 1ANEA 3AW0A 2J95A 4AYYB 2H1UA 3H7TA 1TA2A 1EUFA 1A0LA 4WH6A 4WMEA 2Q6FA 1SQTA 2HVYB 3L6PA 3S9BA 4FU8A 5ESTE 2F9NA 2OQUA 1EAUA 4ZH8A 2FOAA 1C1MA 1O3MA 4FU7A 4XBDA 1V2UT 2ILNA 2JETC 3PRBA 1O3JA 1AKSA 5C3NA 2GVFA 3E90B 1L1GA 1P0SH 1OWEA 2R2MB 3NWUA 1CBWC 4TPYA 1MAXA 1GG6C 1RGQA 1MKWH 1RFNA 1SI5H 4CHAB 2WV4A 4B76A 1L4DA 3ZZDA 3F2FA 1EB2A 1FPHH 2PKAA 4DGJA 1OYTH 2XYAA 4GPGA 1C4U2 1EX3A 3U28C 1P2NA 1UJ1A 1F0SA 1QQUA 4BAQB 2F3CE 3OU0A 3PV2A 1O3CA 3FKSD 3GCTF 1OWKA 4ZHMU 1C1WH 4XE4A 1QL8A 4B74A 4CRCA 1A4WH 1BQYA 1ESAA 1TQ0B 2ZHQH 4HFPB 2P59A 3RC4A 1DY8A 1EFRD 2GT7A 3E16B 2I6SA 4J2YB 1F0RA 4KTUA 4LXBH 1OWJA 1RXPA 2ZFFH 1G32B 2ZCKP 2QA9E 3ZZ4A 5E2OA 1CBWB 1H8IH 4OM9A 4NSYA 4NA9H 1GG6B 2BMGB 2XRCA 4AX9H 1WBGB 2VNTA 5DGJA 3S7HB 1C5XB 3RXRA 2XWBI 4X2VA 5GNDA 1O3KA 1D6WA 1HJ9A 4HGCA 3QK1A 5EXMA 2WV9A 3PV5A 2PSYA 1PPCE 2Z9JA 1GBAA 1GMHG 3U1JB 1TE0A 2TPIZ 3SZNA 2KZ4A 5DP3A 1ZZZA 4TYDA 1T8OA 4ISIH 3HGPA 1VCPA 1O2KA 4FUIA 3UY9A 1ELVA 1NRRH 2OC7A 1TPSA 3U8RH 5GWZA 1K1PA 3I29A 3A87A 1HAOH 1EAXA 4BAKB 3TVJB 1YC0A 5C1XA 5FPTA 2PGQB 3SZEA 1GI1A 1EB1H 5PTPA 1XM1A 1HGTH 1C9PA 1VITF 2BY7X 1WOFA 3A8DA 4JYUH 3KEEA 1UTMA 2BD2A 1SBWA 3F1SB 3HPTB 5DSFA 2R3YA 4X6OA 2H9TH 1AD8H 1MKXH 3LJJA 3A85A 3RXGA 1L1JA 2OXSA 1C2LA 1UMAH 3Q3XA 3R3GB 2JIZD 3SV2H 5HMAA 2G4UA 1OWIA 1CE5A 4NG9H 1ZSLA 4ABJA 1FI8A 2ZU3A 4ZAEA 3SBKA 1TNIA 1S0QA 2BLOA 5C20A 2WPHS 2WPDD 5A0AE 3QZQA 5HM9A 3FOAA 5C0TA 1O5DH 1ETRH 1AWHB 1LHCH 2D8WA 3VB5A 1HV7A 4CH8B 3A84A 2HPPH 3HATH 4D8NA 2LNCA 3K6YA 3OY5U 5FCKA 2AHME 4ACBA 5L6NH 1O2RA 1BTWA 3LOXA 2H6MA 6GCHF 5JBCS 2BLVA 1MQ5A 2TIOA 1DY9A 1GMDG 4ZKNU 3UUZA 1SGYE 1O34A 5GCHF 1RJXB 1EP5A 3DFLA 2ZCHP 2TGTA 1O5AB 2ZDLA 1O37A 4FUDA 5G4BA 3HKJB 2IJD1 3PLKA 2ZGXH 1FX0B 4ZXXH 2QF5A 6CHAC 3SO3A 2YNBA 2CV3A 2BTCE 2A4RA 1TRNA 1O5BB 4HG6A 2FESH 1ZHPA 4Q63A 2FI5E 1XVMA 5E8EH 1B0EA 3UWIA 1O3AA 1ELFA 5T1VA 1ELEE 2A1DB 1K1LA 3FZZA 5C1YA 1EJNA 4F48B 3VB3A 2RA0A 5A8YA 3GICB 4X6MA 8LPRA 1KYNA 4U2WA 3SUGA 3SQHE 3K9XB 1FN8A 1W2KH 3RXFA 1IHTH 1DXPA 5EJZA 1H9HE 1T4VH 5J4SA 1O2UA 1LHDH 1YPJH 4NA8A 6CHAB 1CT2E 4SGAE 4YLUA 1Z6EA 4JZ1A 5KGOA 1C5VA 4GAWA 1L0ZA 3HK3B 4ZMAH 1PPBH 1O3BA 2WPKS 1Y3XA 1XUHA 4K60A 2HALA 3VG8A 4UD9H 1N6YA 4X1SU 4XRNA 4ZXYH 2HLCA 3MO3A 1Z1JA 3NUMA 1GJ8B 2BD8A 1O2HA 1PQ7A 1BMNH 2VGCC 3WWFA 4JK6A 3AAUA 2AYWA 1BA8B 1PPEE 2CGAA 3ATKA 4MNYA 4XBBA 1VZQH 3E1XB 5EXNA 3BEUA 4I33A 4UEHH 1O38A 2FTMA 1COWD 2Y7XA 5FPSA 5L30H 1F7ZA 1SKYE 3E3TA 4B2CA 1TYNA 5DP9A 4H6TA 4TWWA 4O3UA 3NXPA 3LC5A 4Q7XA 1QY6A 4Y8XA 1P01A 2VU8E 1BMLA 2YNAA 1TONA 5ETXA 1K1MA 1NPMA 5LPRA 2FIRH 3ITIA 2EY4C 4OS5A 2AH4X 4B73A 3GCOA 2VH0A 1BTUA 1ZMJA 4X8SH 3TIUA 5EU8A 2O8WA 1SHYA 2VBCA 3OEHD 4E7NA 1OWDA 2VGCB 1AVGH 4FUJA 4AG2A 1K9OE 1C1PA 1ESTA 1TPOA 2IOTA 2K0QA 2XBWA 3CS0A 3Q3KA 1F5KU 3QO6A 4Y7AA 1MTWA 1SFIA 2ZNKH 1O35A 3RLYH 1JOUB 1GJAB 2ZFSA 3BN9A 3BSQA 4IN1A 4WJG2 5DP4A 3RMLH 2HNTC 1HFDA 2JJ1D 5GDSH 2BY9X 2H5DA 3RP2A 2VJ1A 1G3BA 1MD7A 1N6XA 1K1JA 1QTFA 2V35A 1DDJA 1ZPBA 3SU2A 5FBEA 2BX3A 3M7QA 1VCWA 1V6DA 1LHEH 2FOFA 3HK6B 3RXIA 1VGCC 2H9EH 5SGAE 2GKVE 4O3TA 5HM2A 1NFUA 3IITA 3MU1A 2CN0H 1SR5C 4D7GA 4BAHB 1DFPA 1PQ5A 1XUKA 2GV6A 1OKXA 9LPRA 2GCHF 3ZVFA 3A7VA 1C5QA 1F0TA 1FAXA 3ATLA 3ODFA 1YPEH 1YLNA 1O2TA 3WWBA 2ZDVH 1O2IA 1AZ8A 1GBMA 4GCHG 2SGDE 1ZGIA 5F53A 3V7TA 3L33A 1AVWA 3SHCH 3KHVA 4FUBA 4X6NA 3TGIE 2ZU4A 1KLJH 3A8BA 2YMSC 2ZIQH 2NU3E 2Y5HA 1A5GH 1HAGE 1V2WT 4Y76A 1FY8E 1V2OT 1QNJA 3MI4A 2OBOA 1O3IA 3ATWA 1AU8A 3RXBA 3TJOA 2Y82A 5K7RA 4CRDA 2ZGCA 3S7KB 1VGCB 3A7XA 1VCQA 3OFND 3TH2H 1P2OA 1S5SA 2QXHA 2A4GA 3WY8A 3ZZ3A 2PUXB 5ESBA 1HXFH 2F4LA 3F9GA 3F9EA 4FOUC 2A2QH 5DP7A 2ZTYA 2F9UA 2AGIX 3ZZ7A 1WAYB 4ABEA 2B7DH 3SHAH 2J98B 1C1QA 1S82A 1YGCH 5F8ZA 1C2GA 2A0QB 1CQQA 2YMSB 4DCDA 1ARCA 2WPLS 3GISB 3GDSA 1V2VT 2QF0A 3P17H 2VH6A 5EGMA 5B6LA 5C5NA 2NU1E 1XUGA 1O2VA 1W0KD 4BTIB 3PTNA 5EODA 5KECA 1P06A 1SGFA 1EPTA 4Q7YA 3TNSA 3SUDA 3QZRA 1W3CA 3F2GA 3T28A 2AMPA 1G30B 4K2YA 4O9VA 2W6ID 5LPEA 2Z7FE 4AG1A 1O3FA 1O5CB 1DXWA 1OSSA 2ZGBH 2I6QA 2FI3E 3MU5A 3RMMH 1DM4B 1D3QB 2XCNA 2ZPSA 3TJUA 1GGDC 1SLVB 1NESE 1UTJA 2FLRH 1GBEA 2CF9H 2XNDD 3M3SA 1C2HA 1A5HA 1QR3E 4NZQA 1ZHRA 3A86A 2XBYA 3OAAD 1H8DH 2ODYB 1TGNA 3RXTA 2ZDNA 5DO4H 1YCPK 3T62A 3DFJA 1KTTB 5TCCA 3RXDA 9ESTA 5JYIA 5JPMH 1GBIA 1P02A 3LGUA 1PPGE 3MNBA 3EQ0H 3RC5A 5LPFA 1Q3XA 1AMHA 1TGCA 3KQCA 1JXPA 2BQ6B 1GI7B 2V0BA 1O3DA 1THPB 3LONA 4JYTA 4OGYA 5F6MA 3MQKC 5FX5A 1QHRB 5EPNA 3UQOA 1IQFA 2BVRH 1TBZH 2FYRA 3P8OA 1GWAA 1TRMA 3KIDU 1GGDB 1FNIA 1ZMNA 3SNCA 1IQJA 3PMAB 1C1UH 1LO6A 3VB7A 2M2AA 3I78A 1ELBA 4NFEA 1IQLA 5A0BA 1GHVH 1ZPCA 3ZV9A 4AB8A 2P3FH 3QGJA 1GHBG 3UREA 1W8BH 3GCNA 2JH5D 2A32A 5C17A 4MTBA 1V2NT 1BUIA 2ZFPH 3BG4C 1Z8JB 3MH5A 3LGWA 2QF4A 3UR6A 2V6NA 1HAIH 3SNAA 1DANH 2A5AA 2EEKA 3QUMP 2EA3A 1TOMH 1ZMLA 2Q6GA 4B1TA 3KGPA 2FS9A 2W7UA 1EOJA 4X6PA 4Q4LA 2C8YB 1DLKB 1NBME 2GDEH 2ZO3H 4I7YH 2PWXA 1EXFA 2RA3A 3QN7A 1Y3YA 1ARBA 2XWAA 4INHA 4MG3A 2JH6D 3UWJH 4M7GA 3KL6A 1UCYE 1UHBB 5EIYA 4I8LA 1NFXA 4J1YA 3GY3A 1FQ3A 3URDA
chains in the Genus database with same CATH topology
4B6FA 2IJD1 2K0QA 3H09A 3RC6A 1FX0B 2JJ2D 2QF5A 3GS9A 4R8TB 4B71A 2V7QD 5DN6D 3WW7A 5IK2D 2KCAA 3O8RA 1KMHB 2A4RA 2XNIA 3AK5A 1MABB 1H8HD 5GNDA 2L6OA 3SU3A 3SUDA 3LKWA 3U1IB 3ZIAD 2KR7A 4Q63A 1W3CA 3F2GA 3N99A 2WV9A 1S6LA 3PV5A 3UB0A 2O8MA 3SU1A 2J5UA 5T1VA 3SYJA 2JJ1D 3U1JB 3DSPA 2W6ID 3N7EA 4Z1MD 2KZ4A 4NWLA 4TYDA 3SU2A 1DXWA 3SU6A 2IJOB 4A1XA 2KCYA 2OC7A 3N7DA 1E1QD 2XCNA 1E1RD 2XCFA 4WF8A 2F43B 3FN8A 3OEED 1BT7A 3EYDA 4XD7D 5FPYA 4YXWD 4KTCA 4TT3D 3SU4A 3SUGA 3PRDA 4K8BA 4M9FA 3SV8A 5FPTA 3KN2A 4U01A 1DXPA 2KFWA 1CU1A 4I32A 3SZEA 2XNDD 2K8IA 4I31A 4A1TA 2KM0A 3DCLA 3SV9A 2KCOA 3W1EA 3OAAD 2K1QA 2OBQA 3SV6A 3KEEA 2OC0A 3P8NA 1RTLA 2FOMB 4DT4A 5DSFA 3SUEA 3WWBA 2WZQA 2QV1A 1E79D 3VG8A 1OHHD 4WH6A 2A4QA 2XOKD 3KNXA 5F53A 1WXRA 1W0JD 3L6PA 3RC5A 1A1RA 3FO8D 3M5LA 2YMSC 1JXPA 3OTPA 3SUFA 2JIZD 2FM2A 3LONA 3F2HA 2OK5A 3M5MA 4NWKA 2OBOA 1NS3A 2W6JD 3PRBA 5EPNA 3WWFA 2LELA 3OE7D 4ASUD 2GVFA 2YMSD 3E90B 3O8DA 3P8OA 3SU0A 2WSSD 5H4IB 3SU5A 2OINA 4RI0A 2F9VA 1RGQA 2M2AA 2WPDD 2YOLA 3OFND 5HKKD 4B76A 3FOAA 3KF2A 4I33A 4B6EA 5C0TA 1COWD 3DSOA 3F2FA 2A4GA 3M5NA 5GPIB 5FPSA 5CDFE 1NBMD 5GJ4B 1N1LA 1SKYE 5EPYA 3F0PA 4TSFD 2QE7D 4F55A 3OYPA 5C17A 2JDID 3O8BA 5ESBA 2F4LA 2KCPA 3SV7A 2AHME 4A1VA 3PV2A 2QF4A 3M5OA 2CK3D 3FKSD 3LOXA 2F9UA 2HLDD 3F3BA 5CHBA 5ETXA 5IDKA 2GGVB 4B74A 2WHXA 1H8ED 5FL7D 4ZCNA 3O8CA 4FETA 4A92A 1DY9A 2OC1A 4Q4LA 4B73A 2YMSB 1NBME 3NRLA 5C0UA 2P59A 3RC4A 1DY8A 1EFRD 2VBCA 3OEHD 1BMFD 4WH8A 4B75A 5B6LA 5EQSA 5EQRA 2OC8A 3F0OA 4OM9A 1W0KD 2FP7B 5EQQA 4JMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q63 A; 
#chains in the Genus database with same CATH topology
 4MQA A;  2WV5 A;  1K28 D;  2GCT C;  1O3G A;  4YOI A;  1LQE A;  1AFQ C;  1KMH B;  2XNI A;  4FU9 A;  2GMT C;  1G37 A;  3BG4 B;  4FUF A;  3ZVA A;  5BRR E;  2BVS H;  4RT0 A;  1SGN E;  4Y10 E;  2PFE A;  2SGP E;  5ABW A;  1XVO A;  2IJO B;  2F83 A;  4ISH H;  5AF9 H;  2GDD A;  5F03 A;  2G4T A;  1MTS A;  1O2M A;  3DHK H;  1DVA H;  1T32 A;  2ZHD A;  4MNX A;  2BXU H;  3PRD A;  4BXS A;  2WYG A;  1GL1 A;  1WDI A;  1CU1 A;  3MU0 A;  3MO6 A;  4YT7 H;  1QUR H;  1ANB A;  1QZ8 A;  1HIA B;  2GCT B;  2AEI H;  2QAA A;  1Z8R A;  1BDA A;  1QJ6 B;  2JH0 D;  1AFQ B;  1WSS H;  2RDL A;  4OS4 A;  3BEF B;  3ZVG A;  1ESB A;  1K1O A;  1CA0 C;  2XBX A;  4OS2 A;  3A80 A;  2ALV A;  2THF B;  1M9U A;  2GMT B;  3KQ5 A;  3AVZ A;  3M3T A;  3U69 H;  4K69 A;  2A4O A;  1GVZ A;  2VWM A;  2O8T A;  2A4Q A;  4RT1 A;  4BNR A;  1GJ5 H;  2VIN A;  3FO8 D;  4ZUH A;  1C1T A;  5FX6 A;  3CP7 A;  1G3D A;  3K6Z A;  1NS3 A;  3TGK E;  4AFQ A;  1ELD E;  1MTV A;  2VIV A;  4K3J A;  2FXR A;  1GBF A;  1YF4 A;  2ZFQ H;  3LH1 A;  3VXE H;  3EGK H;  2F9V A;  1SGP E;  2YOL A;  3A89 A;  4B6E A;  4RN6 A;  1O2P A;  2ZU5 A;  2BY5 X;  4MNV A;  2C4F H;  5EPY A;  1W7G H;  1WV7 H;  2OTV A;  4X2X A;  5DP5 A;  3O8B A;  3FP6 E;  5EW2 H;  2Z3D A;  1HAP H;  4K5Z A;  1GHY H;  1CA0 B;  1O36 A;  2RCE A;  5IDK A;  3RMN H;  2GGV B;  1IQN A;  4K8Y A;  2F91 A;  3RDZ A;  1TX7 A;  2V3H H;  1O3H A;  4MPW A;  4ZKO U;  1DIT H;  1H8E D;  1LHG H;  2ZF0 H;  2ZHF H;  1UK3 A;  1LVB A;  1E34 B;  1GCD A;  4CBO A;  3DD2 H;  3STJ A;  1NRP H;  4UDW H;  2OC8 A;  2FOB A;  1RIW C;  4OS1 A;  4P00 A;  1MH0 A;  1C5N H;  2Q1J A;  2ZFR H;  2TBS A;  1CT4 E;  1SOT A;  4B71 A;  2KAI B;  5DN6 D;  4Z0K A;  1FY3 A;  2ZTX A;  1QGF A;  5A8Z A;  1MAB B;  3P92 A;  2L6O A;  1UK2 A;  2FOE A;  1MTN C;  1HPG A;  1GJD B;  1K21 H;  1YPL H;  4ZHL U;  1C2K A;  8EST E;  1BBR E;  1TA6 A;  1V2L T;  4NWL A;  2BX4 A;  2JET B;  1KDQ A;  3UFA A;  5EXL A;  2J9N A;  1XKB C;  1C2I A;  4LK4 A;  2BOK A;  2VVV A;  1RIW B;  3RXS A;  3F68 H;  2KFW A;  1Z7K A;  2CF8 H;  2AGE X;  3ZZ6 A;  1XUF A;  1Y5U T;  3DCL A;  2STA E;  4U30 A;  1SQO A;  1EZS C;  1QRZ A;  1WTG H;  1HB0 B;  4XBC A;  3D62 A;  3MYW A;  1RTL A;  2J92 A;  3GY4 A;  4DY7 B;  1MTN B;  2TGP Z;  4KGA A;  4YES B;  5L2Y H;  5DP8 A;  4H4F A;  3M3V A;  1PPZ A;  1W14 U;  2ALP A;  4AOR A;  4KTS A;  2AMD A;  2ZPR A;  1AN1 E;  1GBB A;  2ZGH A;  3E91 A;  1H9I E;  1HAZ B;  4NIW A;  4UE7 H;  2LEL A;  4DT7 B;  3M7T A;  4AYV B;  1LVO A;  2UUJ B;  2BQ7 B;  1O5G H;  4CRA A;  3DSO A;  1CGH A;  5GPI B;  1PYT C;  5GJ4 B;  5DJ7 A;  1AB9 C;  3MH4 A;  1GMC F;  3UR9 A;  4ZKR U;  5KED A;  2G5N A;  3VGC C;  1LPZ B;  3F3B A;  3LPR A;  7GCH F;  4AFU A;  1P03 A;  2ZDA H;  1NRQ H;  3MNX A;  4AZ2 B;  4ZCN A;  1NU9 A;  4DII H;  2OC1 A;  2A5I A;  2BHG A;  1BRA A;  5HYO A;  2ZEB A;  8KME 2;  1UTL M;  3F6U H;  4JK5 A;  5EQR A;  5E0H A;  1HAX B;  1LKB A;  3GCT G;  2GP9 B;  2Q6D A;  1GJ9 B;  2OCV B;  3E6P H;  1KXC A;  2GV7 A;  1BRC E;  2PSX A;  2XC5 A;  3PM3 A;  3M7U A;  2BD4 A;  2XTT B;  1KIG H;  3SQE E;  2BD7 A;  1AB9 B;  1BMM H;  1IOE A;  1F2S E;  2HNT E;  3FZD A;  3NPS A;  3ZZ9 A;  3VGC B;  3W95 A;  3A88 A;  1EP6 A;  1HLT H;  1F0U A;  1AKS B;  2ZC9 H;  1V2P T;  3ZV8 A;  2QYI A;  1HDT H;  1E37 B;  4RKJ B;  3Q00 A;  3LDX H;  1BT7 A;  1ZSJ A;  2PKA B;  2LPR A;  4B2B A;  3SN8 A;  1K2I 1;  3GCH C;  3RXU A;  1MAY A;  4U01 A;  3SOR A;  1AVX A;  2BLQ A;  1P04 A;  1FJS A;  1SLW B;  1UTN A;  3PWB A;  1SGE E;  3T2N A;  3QTV H;  3PWC A;  1BBR H;  1UW7 A;  3P8N A;  2Z6B D;  5L2Z H;  2QXG A;  1Z1I A;  1ETT H;  3JZ1 B;  4NIY A;  3TH4 H;  3HKI B;  1ELC A;  2VIP A;  1C5Y B;  2SFA A;  4AOQ A;  3MWI U;  3R0F A;  3EDX B;  3CEN A;  2PHB A;  1VIT G;  5FXL A;  1NC6 A;  1P05 A;  5EJ1 A;  3ZZ5 A;  2W6J D;  3ZVE A;  4ASU D;  2YMS D;  1XX9 A;  3MMG A;  1CA8 B;  4YT6 H;  1BHX F;  2W3I A;  5H4I B;  4IW4 E;  3LGY A;  2Y7Z A;  1Y3W A;  2C93 B;  1O2W A;  5DK1 A;  2WPI S;  3GCH B;  2ZTZ A;  1GHW H;  2TGD A;  3KF2 A;  1OS8 A;  1PQA A;  2VIQ A;  5CHA C;  4MPX A;  1MZD A;  4DOQ A;  1CGJ E;  1QCP A;  3RXC A;  1OWH A;  1C2E A;  1MQ6 A;  4MPU A;  2Z94 A;  5T6G A;  4TSF D;  3MTY A;  1GBL A;  4GVU A;  2FDA A;  3P8G A;  5GIB A;  3SV7 A;  3T27 A;  4A1V A;  3M5O A;  1QL7 A;  1AE8 H;  2EST E;  5JBB S;  2CK3 D;  1UCY K;  1ZLR A;  1YPH C;  4CRF A;  3ZZB A;  1LTO A;  5FL7 D;  1BJV A;  4XFQ A;  2IPQ X;  1U6Q A;  1DE7 H;  3VB6 A;  2A5K A;  3T26 A;  1D6R A;  3GY8 A;  1W0Z U;  1O2Q A;  2O8U A;  4CBN A;  3BTG E;  4Y8Z A;  1A2C H;  3F0O A;  1BHX B;  2BDI A;  2J98 A;  3SNB A;  1BCU H;  6GCH G;  2R2W U;  4A6L A;  1O2X A;  4Y11 E;  1TNJ A;  2ZKS A;  2P95 A;  1J8A A;  5CHA B;  2H9H A;  1IHS H;  3T29 A;  1C4V 2;  5A0C A;  5K0H A;  3SU3 A;  5GCH G;  3LKW A;  1CSO E;  1SGQ E;  2KR7 A;  1S6F A;  2P8O C;  1YCP H;  1UO6 A;  3SYJ A;  2LP6 A;  1KY9 A;  3DSP A;  1BOQ A;  1MU6 B;  1V2J T;  1GJ6 A;  2BYA X;  1KXB A;  1WUN H;  1O39 A;  1QJ1 B;  3JZ2 B;  1JIR A;  1TQ7 B;  1TFX A;  3CS7 A;  1FXY A;  2XCF A;  1HCG A;  2J4I A;  4YZU A;  1BIT A;  4XD7 D;  1EQ9 A;  1JRT A;  2BDC A;  7KME H;  1BRB E;  1T8M A;  1IQG A;  1O30 A;  2G52 A;  4I31 A;  1MTU A;  2KM0 A;  4A5T S;  2BY6 X;  3B23 B;  3ZZ8 A;  1G36 A;  1UK4 A;  1DSU A;  4Y6D A;  2GT8 A;  2P8O B;  1E79 D;  1EJM A;  1GL0 E;  4UFF H;  1OHH D;  1AWF H;  3SGQ E;  1W0J D;  1RS0 A;  1TB6 H;  1VJA U;  1NY2 2;  2QGR A;  1A1R A;  2VIO A;  3SI4 H;  1SGC A;  1NTP A;  4H42 U;  1GI4 A;  3SJ9 A;  3ZVD A;  4AB9 A;  1K1N A;  5I25 A;  1BTY A;  1BRU P;  1C5T A;  4ABB A;  5C67 A;  3RXJ A;  2D1J A;  3E0P B;  3GY2 A;  1N1L A;  2ZI2 H;  1GBK A;  2GZ9 A;  3VFE A;  2UWL A;  3LC3 A;  2R0K A;  2BLW A;  4IC5 A;  2A7J A;  2ZA5 A;  2KCP A;  1HAV A;  1AI8 H;  1SPJ A;  4R0I A;  3URC A;  1N8O C;  3MFJ A;  1XKA C;  4WXV A;  3IWM A;  1P3E A;  1LQD B;  3IG6 B;  1A3B H;  4KEL A;  2G00 A;  2M5T A;  1GCT C;  4FUH A;  4X2Y A;  2FZZ A;  3EE0 B;  2SGQ E;  1OP0 A;  1V2R T;  6EST A;  1MU8 B;  2NU2 E;  1CGI E;  3M37 A;  1Z8I B;  5E2P A;  1ZSK A;  1O3N A;  1QB1 A;  1TMT H;  4RKO B;  4FVB A;  4IN2 A;  1BBR K;  5EQQ A;  1A5I A;  3OTJ E;  4JMY A;  8GCH F;  2QCY A;  1TX6 A;  3TK9 A;  3RC6 A;  3BTE E;  1TNL A;  1KXF A;  1O2S A;  2HVX A;  3UTU H;  1FZZ A;  2KCA A;  4KP0 A;  2ZFT A;  2VWL A;  3PMB B;  2HWL B;  5T6F A;  4YOG A;  4ABH A;  2Z9G A;  4D76 A;  1MBQ A;  4AN7 A;  1N8O B;  1Y8T A;  2PTC E;  1G9I E;  2GD4 B;  4AC9 A;  2ZHW H;  2Y80 A;  4X1R U;  1GCT B;  2UUF B;  4JZE H;  1GI9 B;  1C9T A;  4RSP A;  2NWN A;  1SG8 B;  1DUE A;  2VB0 A;  3EYD A;  3DUX H;  1GJB B;  2W3K A;  4Q2K A;  5E0J A;  4ABI A;  3RU4 E;  1DWB H;  3SI3 H;  4NZL A;  1V3X A;  1OYQ A;  2WUB A;  1K22 H;  3RU4 D;  4ACA A;  2BD9 A;  1B7X B;  1K0H A;  1C5P A;  2FOM B;  1MCV A;  2O8L A;  1G2L A;  1CHO F;  1SGD E;  3KQB A;  1YPG H;  2PLX A;  4OS6 A;  1DWC H;  4UON A;  2FI4 E;  1ZR0 A;  1BMA A;  3M35 A;  2GJG A;  1C5Z B;  3OTP A;  1TAL A;  4AFS A;  2G51 A;  3OE7 D;  2C8W B;  2FX4 A;  1YKT A;  1Y3U A;  3SNE A;  5HIZ A;  1TGT A;  5TJX A;  1TMB H;  1S81 A;  5T6D A;  3U9A H;  3DT0 H;  1GVK B;  1AUJ A;  1S85 A;  2B0F A;  2BDG A;  4MPV A;  1AO5 A;  4ISO A;  1C5W B;  2P3T B;  3QX5 H;  4NIV A;  4IS5 A;  3U8O H;  2G8T A;  1ZRK A;  2BDA A;  1NRO H;  1GI2 A;  3FAN A;  1LDT T;  1GHA F;  5CHB A;  1GI5 A;  3QTO H;  1C1R A;  3A7Y A;  3QGN B;  7EST E;  1UTO A;  1TGS Z;  4Q7Z A;  2W5E A;  3NRL A;  1CT0 E;  2OP9 A;  4TY7 A;  1F92 A;  3I77 A;  4BAN B;  3KCG H;  5EQS A;  4AGK A;  2FOD A;  5EJL A;  1O2Y A;  1A7S A;  1O3P B;  1SC8 U;  1QRX A;  3G01 A;  3UIR A;  1AE5 A;  1KLI H;  1ELA A;  1XMN B;  3RXV A;  5AFZ H;  3FP8 E;  3NCL A;  1YWU A;  5BPE A;  2FWW A;  5A2M H;  2HPQ H;  3NKK A;  2HRV A;  1BB0 B;  2PP6 A;  1O2J A;  1DUA A;  1THS H;  2J2U A;  2SNW A;  3N99 A;  1HNE E;  1BTH H;  1O33 A;  1TPA E;  3UB0 A;  5C94 A;  4MLF B;  4IGD A;  1J14 A;  3P8F A;  1ANC A;  1Z6J H;  4XDE A;  3UNS A;  1TNK A;  1P2Q A;  1GI8 B;  2ZGJ A;  4LOY H;  1BTP A;  2DE9 A;  3N7D A;  4E05 H;  1J15 A;  1OP2 A;  4WF8 A;  2F43 B;  1EPT C;  1MBM A;  3KQD A;  3OEE D;  4FUG A;  1GBT A;  1TAW A;  5TCA A;  2CJI A;  1TBQ H;  1GI6 A;  1LHF H;  3SU4 A;  3SV8 A;  4K8B A;  5JBA S;  1VR1 H;  1BTZ A;  4MDS A;  3SV9 A;  2UUY A;  4X0W U;  1QRW A;  1TNG A;  1EOL A;  2AFQ B;  1C2D A;  4DIH H;  1T7C A;  2VVU A;  1GBH A;  3QWC H;  1G3E A;  2ZU1 A;  3N7O A;  1IQH A;  2WYJ A;  2XOK D;  3UPE A;  1GVL A;  3RXM A;  1HUT H;  3SUF A;  1NU7 B;  1NT1 A;  3LH3 A;  3ZZC A;  1Q31 A;  1ETS H;  3M5M A;  4JCN A;  3A8A A;  5JB8 S;  1EPT B;  3SU0 A;  1RRK A;  1RTK A;  1F5L A;  2BDH A;  1GJC B;  3GDV A;  4X1P U;  1DIC A;  3ZYD A;  3BTM E;  1GHZ A;  1W0Y H;  4FVD A;  4DUR A;  2CXV A;  2FOG A;  2ZCL P;  4LZ1 H;  3Q76 A;  1EKB B;  2QXI A;  4H6S B;  4JZI A;  4BAM B;  4XOJ A;  1ZGV A;  1W12 U;  1TWX B;  1PYT D;  4A7I B;  3V13 A;  2ZP0 H;  1UTK A;  1UTP A;  5F8X A;  3SOS A;  5FHT A;  4F4O C;  4D9Q A;  3FFG A;  2SNV A;  3UOP A;  3FP7 E;  1FY1 A;  1OOK B;  4I86 A;  4BOH A;  2CHA C;  1QBV H;  4WH8 A;  4ISN A;  1X7A C;  2ODQ A;  4D7F A;  2BXT H;  1GMH F;  5HIY A;  2FP7 B;  3DA9 B;  3EA9 A;  1XXD A;  5HXF A;  1V2Q T;  4R8T B;  1F5R A;  2P3U B;  2PTN A;  3WW7 A;  2ZDM A;  3A7Z A;  5T3H A;  4XSK U;  3TLO A;  1O32 A;  3OX7 U;  1H8H D;  2WIN I;  4WWY A;  5DP6 A;  1AFE H;  3AAV A;  1GPZ A;  1V2T T;  3SU1 A;  1IAU A;  2F9B H;  1PPF E;  4Z1M D;  4I8H A;  2R9P A;  3S9A A;  1W7X H;  4CH2 B;  2ZEC A;  3SU6 A;  2RFK C;  2ZQ1 A;  4CR5 A;  1AIX H;  3LU9 B;  4X1Q U;  1O5F H;  1TRY A;  2CHA B;  2OLG A;  2Y5F A;  3FN8 A;  3LGI A;  4X8V H;  3GY6 A;  3BIV H;  1IQM A;  2BD5 A;  1FLE E;  4I32 A;  4FXG H;  3BTW E;  3RXP A;  1EZU C;  1FUJ A;  4ASH A;  2KCO A;  3TJV A;  2K1Q A;  5A8X A;  1UVP A;  3SJI A;  3Q3Y A;  7LPR A;  4Y0Y E;  1D9I A;  1A0H B;  3KQE A;  2QV1 A;  4Q80 A;  1UCY H;  3KNX A;  4CRB A;  1YBW A;  2QXJ A;  2GTB A;  3S9C A;  1EZQ A;  6LPR A;  2UWP A;  3U8T H;  4HTC H;  3MHW U;  2C8Z B;  2FEQ H;  2FS8 A;  3ZYE A;  5DPA A;  1D3T B;  1GDU A;  3A8C A;  4INL A;  3RM0 H;  3P6Z B;  3D65 E;  1GMD F;  2GZ8 A;  1O2N A;  5CDF E;  4U32 A;  1FIZ A;  1FIW A;  2JKH A;  3F0P A;  3LGT A;  4D9R A;  2AMQ A;  1L4Z A;  1YY3 A;  1C1N A;  4F49 A;  5JB9 S;  2W26 A;  4YO9 A;  1S6H A;  1YPH E;  3RXK A;  2ANW A;  1O5E H;  4Y71 A;  3BF6 H;  2WUC A;  4WMF A;  2B9L A;  2AER H;  5JDU B;  1VIT H;  1SVP A;  2PGB B;  1YLC A;  3ZVB A;  3FAO A;  3GYL B;  2FYQ A;  1GBJ A;  1DLE A;  2XW9 A;  3RU4 T;  2ZPQ A;  4FUC A;  1DOJ A;  2BZ6 H;  3DSG A;  1ZYO A;  3GS9 A;  1CVW H;  2C8X B;  4GHQ A;  1XXF A;  3O8R A;  4I8K A;  2QF3 A;  3VEQ B;  3PV4 A;  3U1I B;  2F9P A;  1AQ7 A;  3D23 A;  4DVA U;  1YCP M;  1S6L A;  3PMH B;  4UFD H;  3U98 H;  3RXH A;  3N7E A;  3RLW H;  2FPZ A;  1GJ4 H;  5IYT A;  1ORF A;  4FUE A;  2NU4 E;  4TPI Z;  3EST A;  2BZA A;  1H1B A;  1IQI A;  3TNT A;  4A1X A;  4NSV A;  5E0G A;  2AGG X;  1KTS B;  4CRE A;  4K1S A;  1XUI A;  5HGG A;  1E1Q D;  1E1R D;  4X2W A;  3BTD E;  2XC0 A;  5FPY A;  1L1N A;  1P12 E;  3KYG A;  4WXI A;  1LCY A;  3P70 B;  3TGJ E;  2C90 B;  1BZX E;  1A46 H;  3MU8 A;  3RXQ A;  1C1O A;  4OS7 A;  5FCR A;  3TJN A;  3TK6 A;  3W1E A;  4EST E;  4ABA A;  1SMF E;  1C5S A;  1LVM A;  1P2K A;  1SGI B;  4DW2 U;  1P57 B;  3T25 A;  2ODP A;  3LT3 A;  1C1S A;  2D2D A;  3SJK A;  4CRG A;  2XC4 A;  1ACB E;  2QY0 B;  1QQ4 A;  3PMJ A;  3GYM A;  4YLQ H;  3SGB E;  1MD8 A;  2SGA A;  1P3C A;  3M5L A;  4NIX A;  3LGV A;  1QA0 A;  1UTQ A;  1C2J A;  1ELT A;  1P09 A;  3H5C B;  4NWK A;  3NK8 A;  2F9O A;  2PW8 H;  3GDU A;  1DST A;  2TRM A;  3VXF H;  3NZI A;  1O2Z A;  4RI0 A;  5EOK A;  1T8L A;  4WVP E;  2HOB A;  4O03 A;  2P16 A;  5HKK D;  1IQK A;  2CMY A;  1DPO A;  2FX6 A;  3BIU H;  3S69 A;  1GDQ A;  2ASU B;  1NFW A;  2Y6T A;  5C2Z A;  1TOC B;  1H9L B;  1D4P B;  3OY6 U;  2DUC A;  4BTT B;  3RM2 H;  2FOH A;  2PKS C;  1KXE A;  1KDQ B;  3UQV A;  4THN H;  2OD3 B;  4OGX A;  1FY4 A;  4NFF A;  3PLP A;  4A92 A;  1AGJ A;  1P11 E;  3MOC A;  3E8L A;  1C5U A;  2Z3C A;  3TH3 H;  2ZDK A;  5CE1 A;  1LKA A;  3M36 A;  1GMC G;  3MO9 A;  1LMW B;  3PTB A;  2G81 E;  3SJ8 A;  1MKW K;  2O9Q A;  5I46 H;  4QT8 C;  1MMJ N;  7GCH G;  1SGR E;  1QL9 A;  1CHG A;  3PO1 C;  2P93 A;  2EI8 A;  2EI6 A;  4X8U H;  1NM6 A;  2HGT H;  2BY8 X;  2R0L A;  1QFK H;  3AK5 A;  1OP8 A;  2ZWL H;  1SQA A;  1C4Y 2;  1P2M A;  5B6O A;  1MCT A;  2PKS B;  1PQ8 A;  2SGE E;  3OSY A;  1NZQ H;  2KCY A;  3MNS A;  1ZOM A;  3LJO A;  1C5M D;  2Z9K A;  5DKM A;  1KLT A;  1PPH E;  2SGF E;  4YXW D;  1GHX H;  4YTA A;  1SOZ A;  4GCH F;  1HJ8 A;  1B5G H;  3KN2 A;  1O3L A;  3PO1 B;  5C1U A;  1DX5 M;  1SFQ B;  1ZJD A;  1E38 B;  2OBQ A;  1S0R A;  1SGT A;  1C1V H;  3V0X A;  3SV6 A;  1C5L H;  2FLB H;  3T5F H;  2IN2 A;  4TY6 A;  4IC6 A;  3RXL A;  2WZQ A;  1JRS A;  1NRS H;  3HGN A;  4WY3 A;  4DG4 A;  3ODD A;  5JBT A;  2V3M A;  2FM2 A;  1UVO A;  3F2H A;  4Y8Y A;  1E36 B;  2OQ5 A;  4AGJ A;  2ANM H;  3EAJ A;  2ANK H;  1ABJ H;  1P8V C;  3TPI Z;  3SGA E;  1Y3V A;  1DWD H;  3F9F A;  2EQN A;  4Y7B A;  5LGO A;  2RG3 A;  1TLD A;  4BTU B;  3STI A;  3GY5 A;  1MZA A;  2QE7 D;  1INC A;  3BV9 B;  3OYP A;  1OXG A;  3V3M A;  4ABG A;  3ELA H;  2Z9I A;  3MH7 A;  2ZHE H;  1MKX K;  4E7R G;  1VKY A;  2B5T B;  3SND A;  2FTL E;  2WHX A;  1AND A;  3O8C A;  4FET A;  2HNT F;  3D49 H;  4P02 A;  2BM2 A;  1P2J A;  3A81 A;  1C5O H;  2ZG0 H;  4K1E A;  1J16 A;  5EG4 A;  2XXL A;  2Y81 A;  1MUE B;  1GDN A;  1WYK A;  1XUJ A;  3FVF B;  4MVN A;  5AFY H;  5DG6 A;  1FON A;  2JJ2 D;  5AHG H;  4I8G A;  4CR9 A;  1P10 A;  1WTH D;  3AAS A;  1L2E A;  3ZIA D;  1AZZ A;  4WMD A;  1QIX B;  2GZ7 A;  4I8J A;  1TIO A;  2J5U A;  3ATI A;  3SW2 B;  1SQR A;  2ZQ2 A;  3TU7 H;  3MU4 A;  3BTF E;  3RXE A;  3BTH E;  1HBT H;  2PV9 B;  3C1K A;  1EZX C;  4GUX A;  4JZD H;  3SJO A;  3AW1 A;  2A2X H;  2P94 A;  4KTC A;  4TT3 D;  1DWE H;  1SLU B;  4M9F A;  3MH6 A;  2VVC A;  1A0J A;  1DS2 E;  2GX4 A;  2ULL A;  1S83 A;  2K8I A;  4A1T A;  1A61 H;  4Z6A H;  1GI0 A;  1UHB A;  2J38 A;  1C2F A;  2BDY A;  3QDZ B;  1HRT H;  4TWY A;  5FBI A;  2FO9 A;  3K2U A;  1P9S A;  1ELG A;  4AFZ A;  1S84 A;  4DT4 A;  1FMG A;  1ZJK A;  3E0N B;  1W13 U;  1VJ9 U;  4HI3 A;  2FOC A;  1C5R A;  3RMO H;  1WXR A;  2BDB A;  1NRN H;  1TAB E;  1Z8G A;  4LZ4 B;  4HZH A;  1GHB F;  4IMQ A;  2DE8 A;  3A82 A;  1EAS A;  1P2I A;  3ENS B;  2OK5 A;  4X8T H;  1QB9 A;  1JIM A;  3C27 B;  1O2G H;  4VGC C;  1UVU H;  1NO9 H;  3SU5 A;  2Z3E A;  2ZU2 A;  1FDP A;  3PB1 E;  2UWO A;  4ISL A;  4YM9 A;  2D26 C;  3BTK E;  3M5N A;  1E35 B;  1FY5 A;  1O3O A;  4F55 A;  2JDI D;  1YPM H;  3B8J A;  3PLB A;  1EAI A;  1HIA A;  2HLD D;  3K65 B;  1G2M A;  1AY6 H;  2GCH G;  2UUK B;  1A3E H;  1H4W A;  4SGB E;  1ZTL A;  4ZHA A;  1TNH A;  1W10 U;  1GJ7 B;  1BMF D;  4O97 A;  4B75 A;  1TMU H;  1FN6 A;  2FMJ A;  3F9H A;  4GHT A;  1GI3 A;  3B9F H;  3RXA A;  4NCY A;  4VGC B;  4ABF A;  1QJ7 B;  3CNR A;  1QBN A;  4B6F A;  3LIW A;  3VPK A;  2G5V A;  1YM0 A;  1ZHM A;  2WPJ S;  2V7Q D;  4ABD A;  4GLY A;  1HAY B;  3KYF A;  5IK2 D;  3RUO A;  2XBV A;  1AHT H;  2J97 A;  3ZVC A;  2PR3 A;  3BEI B;  3GOV B;  1SHH B;  2O8M A;  2OUA A;  4YOJ A;  1NFY A;  1WQS A;  2H2Z A;  2AIQ A;  1V2M T;  2L74 A;  2BVX H;  1CO7 E;  8GCH G;  2BOH B;  1GBD A;  2V3O H;  4KKD A;  2J94 A;  3EA7 A;  1Y5B T;  3UAI C;  2A45 B;  2VID A;  5J4Q A;  1AUT C;  1HXE H;  1YYY 1;  5AVD A;  1J9C H;  2QIQ A;  3UNR A;  2A7H A;  2EC9 H;  3EE7 A;  1V2S T;  1FPC H;  3Q77 A;  5C5O A;  1G3C A;  1PFX C;  1C2M A;  1SB1 H;  1TBR H;  1O3E A;  2A7C A;  1BJU A;  1O0D H;  1HAV B;  1WU1 A;  1EAW A;  1JBU H;  3MNC A;  4BXW A;  2OC0 A;  2W7S A;  3PRO A;  2VIW A;  2KAI A;  3SUE A;  2WPM S;  1ZTJ A;  2BB4 A;  1PJP A;  3BTT E;  3W94 A;  1EJA A;  1RD3 B;  4BAO B;  1Q2W A;  1QB6 A;  4Y0Z E;  4E06 H;  1SLX B;  1E0F D;  2VWO A;  4GSO A;  1UVT H;  4B2A A;  1YPK H;  3A83 A;  4ZKS U;  1BIO A;  1JMO H;  3A7W A;  2B8O H;  1LVY A;  3P95 A;  3O8D A;  1T8N A;  4PRO A;  2WSS D;  4INK A;  2OIN A;  2QN5 T;  3VB4 A;  1T31 A;  1CHO G;  1ZPZ A;  1NN6 A;  2G55 A;  4JYV H;  3TK5 A;  1HJA C;  3A7T A;  1ABI H;  3BTQ E;  3UOU A;  1NBM D;  1OX1 A;  1YLD A;  2KX4 A;  2R3U A;  2VWN A;  4ZRO A;  2AIP A;  2H5C A;  1LPK B;  1ID5 H;  4MNW A;  4X1N U;  1OPH B;  4Y79 A;  1KXA A;  2QC2 A;  2IPH A;  1GBC A;  1TX8 A;  3L3T A;  2TGA A;  3RXO A;  1K1I A;  1V2K T;  4K1T A;  4IMZ A;  2BD3 A;  5C0U A;  1SL3 A;  1D3D B;  3S0N A;  5F8T A;  2ZZU H;  3GY7 A;  1J17 T;  1HYL A;  3BG8 A;  3QLP H;  1BTX A;  1GHA G;  2PUQ H;  1Y59 T;  2BQW B;  1JWT A;  1EAT A;  5GXP A;  1KSN A;  3H09 A;  3M61 U;  1ZRB A;  1HJA B;  1D3P B;  5LH8 A;  3ATM A;  2ANY A;  2A31 A;  5A09 A;  4NGA H;  1IQE A;  1RTF B;  2AS9 A;  1LPG B;  1O2L A;  3ZZA A;  1SSX A;  1FAK H;  1QBO A;  1FV9 A;  4JZF H;  1UVS H;  3EA8 A;  1KXD A;  2C3S A;  2Z9L A;  1TPP A;  2RDE A;  2Y5G A;  1TGB A;  1W11 U;  1QA7 A;  3TIT A;  1HAH H;  5CMX H;  1ZTK A;  1Z71 A;  2STB E;  2J34 A;  1WQV H;  1THR H;  2NU0 E;  1P9U A;  1B0F A;  4UFE H;  4CHA C;  1YP9 A;  4UFG H;  1T4U H;  4NA7 A;  1O31 A;  3H7O A;  5EW1 H;  2EI7 A;  1Y5A T;  1DT2 A;  3PYH A;  3UNQ A;  1SGF G;  1WCZ A;  4IBL H;  1O2O A;  3V12 A;  4DJZ B;  5FAH A;  1ANE A;  3AW0 A;  2J95 A;  4AYY B;  2H1U A;  3H7T A;  1TA2 A;  1EUF A;  1A0L A;  4WH6 A;  4WME A;  2Q6F A;  1SQT A;  2HVY B;  3L6P A;  3S9B A;  4FU8 A;  5EST E;  2F9N A;  2OQU A;  1EAU A;  4ZH8 A;  2FOA A;  1C1M A;  1O3M A;  4FU7 A;  4XBD A;  1V2U T;  2ILN A;  2JET C;  3PRB A;  1O3J A;  1AKS A;  5C3N A;  2GVF A;  3E90 B;  1L1G A;  1P0S H;  1OWE A;  2R2M B;  3NWU A;  1CBW C;  4TPY A;  1MAX A;  1GG6 C;  1RGQ A;  1MKW H;  1RFN A;  1SI5 H;  4CHA B;  2WV4 A;  4B76 A;  1L4D A;  3ZZD A;  3F2F A;  1EB2 A;  1FPH H;  2PKA A;  4DGJ A;  1OYT H;  2XYA A;  4GPG A;  1C4U 2;  1EX3 A;  3U28 C;  1P2N A;  1UJ1 A;  1F0S A;  1QQU A;  4BAQ B;  2F3C E;  3OU0 A;  3PV2 A;  1O3C A;  3FKS D;  3GCT F;  1OWK A;  4ZHM U;  1C1W H;  4XE4 A;  1QL8 A;  4B74 A;  4CRC A;  1A4W H;  1BQY A;  1ESA A;  1TQ0 B;  2ZHQ H;  4HFP B;  2P59 A;  3RC4 A;  1DY8 A;  1EFR D;  2GT7 A;  3E16 B;  2I6S A;  4J2Y B;  1F0R A;  4KTU A;  4LXB H;  1OWJ A;  1RXP A;  2ZFF H;  1G32 B;  2ZCK P;  2QA9 E;  3ZZ4 A;  5E2O A;  1CBW B;  1H8I H;  4OM9 A;  4NSY A;  4NA9 H;  1GG6 B;  2BMG B;  2XRC A;  4AX9 H;  1WBG B;  2VNT A;  5DGJ A;  3S7H B;  1C5X B;  3RXR A;  2XWB I;  4X2V A;  5GND A;  1O3K A;  1D6W A;  1HJ9 A;  4HGC A;  3QK1 A;  5EXM A;  2WV9 A;  3PV5 A;  2PSY A;  1PPC E;  2Z9J A;  1GBA A;  1GMH G;  3U1J B;  1TE0 A;  2TPI Z;  3SZN A;  2KZ4 A;  5DP3 A;  1ZZZ A;  4TYD A;  1T8O A;  4ISI H;  3HGP A;  1VCP A;  1O2K A;  4FUI A;  3UY9 A;  1ELV A;  1NRR H;  2OC7 A;  1TPS A;  3U8R H;  5GWZ A;  1K1P A;  3I29 A;  3A87 A;  1HAO H;  1EAX A;  4BAK B;  3TVJ B;  1YC0 A;  5C1X A;  5FPT A;  2PGQ B;  3SZE A;  1GI1 A;  1EB1 H;  5PTP A;  1XM1 A;  1HGT H;  1C9P A;  1VIT F;  2BY7 X;  1WOF A;  3A8D A;  4JYU H;  3KEE A;  1UTM A;  2BD2 A;  1SBW A;  3F1S B;  3HPT B;  5DSF A;  2R3Y A;  4X6O A;  2H9T H;  1AD8 H;  1MKX H;  3LJJ A;  3A85 A;  3RXG A;  1L1J A;  2OXS A;  1C2L A;  1UMA H;  3Q3X A;  3R3G B;  2JIZ D;  3SV2 H;  5HMA A;  2G4U A;  1OWI A;  1CE5 A;  4NG9 H;  1ZSL A;  4ABJ A;  1FI8 A;  2ZU3 A;  4ZAE A;  3SBK A;  1TNI A;  1S0Q A;  2BLO A;  5C20 A;  2WPH S;  2WPD D;  5A0A E;  3QZQ A;  5HM9 A;  3FOA A;  5C0T A;  1O5D H;  1ETR H;  1AWH B;  1LHC H;  2D8W A;  3VB5 A;  1HV7 A;  4CH8 B;  3A84 A;  2HPP H;  3HAT H;  4D8N A;  2LNC A;  3K6Y A;  3OY5 U;  5FCK A;  2AHM E;  4ACB A;  5L6N H;  1O2R A;  1BTW A;  3LOX A;  2H6M A;  6GCH F;  5JBC S;  2BLV A;  1MQ5 A;  2TIO A;  1DY9 A;  1GMD G;  4ZKN U;  3UUZ A;  1SGY E;  1O34 A;  5GCH F;  1RJX B;  1EP5 A;  3DFL A;  2ZCH P;  2TGT A;  1O5A B;  2ZDL A;  1O37 A;  4FUD A;  5G4B A;  3HKJ B;  2IJD 1;  3PLK A;  2ZGX H;  1FX0 B;  4ZXX H;  2QF5 A;  6CHA C;  3SO3 A;  2YNB A;  2CV3 A;  2BTC E;  2A4R A;  1TRN A;  1O5B B;  4HG6 A;  2FES H;  1ZHP A;  4Q63 A;  2FI5 E;  1XVM A;  5E8E H;  1B0E A;  3UWI A;  1O3A A;  1ELF A;  5T1V A;  1ELE E;  2A1D B;  1K1L A;  3FZZ A;  5C1Y A;  1EJN A;  4F48 B;  3VB3 A;  2RA0 A;  5A8Y A;  3GIC B;  4X6M A;  8LPR A;  1KYN A;  4U2W A;  3SUG A;  3SQH E;  3K9X B;  1FN8 A;  1W2K H;  3RXF A;  1IHT H;  1DXP A;  5EJZ A;  1H9H E;  1T4V H;  5J4S A;  1O2U A;  1LHD H;  1YPJ H;  4NA8 A;  6CHA B;  1CT2 E;  4SGA E;  4YLU A;  1Z6E A;  4JZ1 A;  5KGO A;  1C5V A;  4GAW A;  1L0Z A;  3HK3 B;  4ZMA H;  1PPB H;  1O3B A;  2WPK S;  1Y3X A;  1XUH A;  4K60 A;  2HAL A;  3VG8 A;  4UD9 H;  1N6Y A;  4X1S U;  4XRN A;  4ZXY H;  2HLC A;  3MO3 A;  1Z1J A;  3NUM A;  1GJ8 B;  2BD8 A;  1O2H A;  1PQ7 A;  1BMN H;  2VGC C;  3WWF A;  4JK6 A;  3AAU A;  2AYW A;  1BA8 B;  1PPE E;  2CGA A;  3ATK A;  4MNY A;  4XBB A;  1VZQ H;  3E1X B;  5EXN A;  3BEU A;  4I33 A;  4UEH H;  1O38 A;  2FTM A;  1COW D;  2Y7X A;  5FPS A;  5L30 H;  1F7Z A;  1SKY E;  3E3T A;  4B2C A;  1TYN A;  5DP9 A;  4H6T A;  4TWW A;  4O3U A;  3NXP A;  3LC5 A;  4Q7X A;  1QY6 A;  4Y8X A;  1P01 A;  2VU8 E;  1BML A;  2YNA A;  1TON A;  5ETX A;  1K1M A;  1NPM A;  5LPR A;  2FIR H;  3ITI A;  2EY4 C;  4OS5 A;  2AH4 X;  4B73 A;  3GCO A;  2VH0 A;  1BTU A;  1ZMJ A;  4X8S H;  3TIU A;  5EU8 A;  2O8W A;  1SHY A;  2VBC A;  3OEH D;  4E7N A;  1OWD A;  2VGC B;  1AVG H;  4FUJ A;  4AG2 A;  1K9O E;  1C1P A;  1EST A;  1TPO A;  2IOT A;  2K0Q A;  2XBW A;  3CS0 A;  3Q3K A;  1F5K U;  3QO6 A;  4Y7A A;  1MTW A;  1SFI A;  2ZNK H;  1O35 A;  3RLY H;  1JOU B;  1GJA B;  2ZFS A;  3BN9 A;  3BSQ A;  4IN1 A;  4WJG 2;  5DP4 A;  3RML H;  2HNT C;  1HFD A;  2JJ1 D;  5GDS H;  2BY9 X;  2H5D A;  3RP2 A;  2VJ1 A;  1G3B A;  1MD7 A;  1N6X A;  1K1J A;  1QTF A;  2V35 A;  1DDJ A;  1ZPB A;  3SU2 A;  5FBE A;  2BX3 A;  3M7Q A;  1VCW A;  1V6D A;  1LHE H;  2FOF A;  3HK6 B;  3RXI A;  1VGC C;  2H9E H;  5SGA E;  2GKV E;  4O3T A;  5HM2 A;  1NFU A;  3IIT A;  3MU1 A;  2CN0 H;  1SR5 C;  4D7G A;  4BAH B;  1DFP A;  1PQ5 A;  1XUK A;  2GV6 A;  1OKX A;  9LPR A;  2GCH F;  3ZVF A;  3A7V A;  1C5Q A;  1F0T A;  1FAX A;  3ATL A;  3ODF A;  1YPE H;  1YLN A;  1O2T A;  3WWB A;  2ZDV H;  1O2I A;  1AZ8 A;  1GBM A;  4GCH G;  2SGD E;  1ZGI A;  5F53 A;  3V7T A;  3L33 A;  1AVW A;  3SHC H;  3KHV A;  4FUB A;  4X6N A;  3TGI E;  2ZU4 A;  1KLJ H;  3A8B A;  2YMS C;  2ZIQ H;  2NU3 E;  2Y5H A;  1A5G H;  1HAG E;  1V2W T;  4Y76 A;  1FY8 E;  1V2O T;  1QNJ A;  3MI4 A;  2OBO A;  1O3I A;  3ATW A;  1AU8 A;  3RXB A;  3TJO A;  2Y82 A;  5K7R A;  4CRD A;  2ZGC A;  3S7K B;  1VGC B;  3A7X A;  1VCQ A;  3OFN D;  3TH2 H;  1P2O A;  1S5S A;  2QXH A;  2A4G A;  3WY8 A;  3ZZ3 A;  2PUX B;  5ESB A;  1HXF H;  2F4L A;  3F9G A;  3F9E A;  4FOU C;  2A2Q H;  5DP7 A;  2ZTY A;  2F9U A;  2AGI X;  3ZZ7 A;  1WAY B;  4ABE A;  2B7D H;  3SHA H;  2J98 B;  1C1Q A;  1S82 A;  1YGC H;  5F8Z A;  1C2G A;  2A0Q B;  1CQQ A;  2YMS B;  4DCD A;  1ARC A;  2WPL S;  3GIS B;  3GDS A;  1V2V T;  2QF0 A;  3P17 H;  2VH6 A;  5EGM A;  5B6L A;  5C5N A;  2NU1 E;  1XUG A;  1O2V A;  1W0K D;  4BTI B;  3PTN A;  5EOD A;  5KEC A;  1P06 A;  1SGF A;  1EPT A;  4Q7Y A;  3TNS A;  3SUD A;  3QZR A;  1W3C A;  3F2G A;  3T28 A;  2AMP A;  1G30 B;  4K2Y A;  4O9V A;  2W6I D;  5LPE A;  2Z7F E;  4AG1 A;  1O3F A;  1O5C B;  1DXW A;  1OSS A;  2ZGB H;  2I6Q A;  2FI3 E;  3MU5 A;  3RMM H;  1DM4 B;  1D3Q B;  2XCN A;  2ZPS A;  3TJU A;  1GGD C;  1SLV B;  1NES E;  1UTJ A;  2FLR H;  1GBE A;  2CF9 H;  2XND D;  3M3S A;  1C2H A;  1A5H A;  1QR3 E;  4NZQ A;  1ZHR A;  3A86 A;  2XBY A;  3OAA D;  1H8D H;  2ODY B;  1TGN A;  3RXT A;  2ZDN A;  5DO4 H;  1YCP K;  3T62 A;  3DFJ A;  1KTT B;  5TCC A;  3RXD A;  9EST A;  5JYI A;  5JPM H;  1GBI A;  1P02 A;  3LGU A;  1PPG E;  3MNB A;  3EQ0 H;  3RC5 A;  5LPF A;  1Q3X A;  1AMH A;  1TGC A;  3KQC A;  1JXP A;  2BQ6 B;  1GI7 B;  2V0B A;  1O3D A;  1THP B;  3LON A;  4JYT A;  4OGY A;  5F6M A;  3MQK C;  5FX5 A;  1QHR B;  5EPN A;  3UQO A;  1IQF A;  2BVR H;  1TBZ H;  2FYR A;  3P8O A;  1GWA A;  1TRM A;  3KID U;  1GGD B;  1FNI A;  1ZMN A;  3SNC A;  1IQJ A;  3PMA B;  1C1U H;  1LO6 A;  3VB7 A;  2M2A A;  3I78 A;  1ELB A;  4NFE A;  1IQL A;  5A0B A;  1GHV H;  1ZPC A;  3ZV9 A;  4AB8 A;  2P3F H;  3QGJ A;  1GHB G;  3URE A;  1W8B H;  3GCN A;  2JH5 D;  2A32 A;  5C17 A;  4MTB A;  1V2N T;  1BUI A;  2ZFP H;  3BG4 C;  1Z8J B;  3MH5 A;  3LGW A;  2QF4 A;  3UR6 A;  2V6N A;  1HAI H;  3SNA A;  1DAN H;  2A5A A;  2EEK A;  3QUM P;  2EA3 A;  1TOM H;  1ZML A;  2Q6G A;  4B1T A;  3KGP A;  2FS9 A;  2W7U A;  1EOJ A;  4X6P A;  4Q4L A;  2C8Y B;  1DLK B;  1NBM E;  2GDE H;  2ZO3 H;  4I7Y H;  2PWX A;  1EXF A;  2RA3 A;  3QN7 A;  1Y3Y A;  1ARB A;  2XWA A;  4INH A;  4MG3 A;  2JH6 D;  3UWJ H;  4M7G A;  3KL6 A;  1UCY E;  1UHB B;  5EIY A;  4I8L A;  1NFX A;  4J1Y A;  3GY3 A;  1FQ3 A;  3URD A; 
#chains in the Genus database with same CATH homology
 4B6F A;  2IJD 1;  2K0Q A;  3H09 A;  3RC6 A;  1FX0 B;  2JJ2 D;  2QF5 A;  3GS9 A;  4R8T B;  4B71 A;  2V7Q D;  5DN6 D;  3WW7 A;  5IK2 D;  2KCA A;  3O8R A;  1KMH B;  2A4R A;  2XNI A;  3AK5 A;  1MAB B;  1H8H D;  5GND A;  2L6O A;  3SU3 A;  3SUD A;  3LKW A;  3U1I B;  3ZIA D;  2KR7 A;  4Q63 A;  1W3C A;  3F2G A;  3N99 A;  2WV9 A;  1S6L A;  3PV5 A;  3UB0 A;  2O8M A;  3SU1 A;  2J5U A;  5T1V A;  3SYJ A;  2JJ1 D;  3U1J B;  3DSP A;  2W6I D;  3N7E A;  4Z1M D;  2KZ4 A;  4NWL A;  4TYD A;  3SU2 A;  1DXW A;  3SU6 A;  2IJO B;  4A1X A;  2KCY A;  2OC7 A;  3N7D A;  1E1Q D;  2XCN A;  1E1R D;  2XCF A;  4WF8 A;  2F43 B;  3FN8 A;  3OEE D;  1BT7 A;  3EYD A;  4XD7 D;  5FPY A;  4YXW D;  4KTC A;  4TT3 D;  3SU4 A;  3SUG A;  3PRD A;  4K8B A;  4M9F A;  3SV8 A;  5FPT A;  3KN2 A;  4U01 A;  1DXP A;  2KFW A;  1CU1 A;  4I32 A;  3SZE A;  2XND D;  2K8I A;  4I31 A;  4A1T A;  2KM0 A;  3DCL A;  3SV9 A;  2KCO A;  3W1E A;  3OAA D;  2K1Q A;  2OBQ A;  3SV6 A;  3KEE A;  2OC0 A;  3P8N A;  1RTL A;  2FOM B;  4DT4 A;  5DSF A;  3SUE A;  3WWB A;  2WZQ A;  2QV1 A;  1E79 D;  3VG8 A;  1OHH D;  4WH6 A;  2A4Q A;  2XOK D;  3KNX A;  5F53 A;  1WXR A;  1W0J D;  3L6P A;  3RC5 A;  1A1R A;  3FO8 D;  3M5L A;  2YMS C;  1JXP A;  3OTP A;  3SUF A;  2JIZ D;  2FM2 A;  3LON A;  3F2H A;  2OK5 A;  3M5M A;  4NWK A;  2OBO A;  1NS3 A;  2W6J D;  3PRB A;  5EPN A;  3WWF A;  2LEL A;  3OE7 D;  4ASU D;  2GVF A;  2YMS D;  3E90 B;  3O8D A;  3P8O A;  3SU0 A;  2WSS D;  5H4I B;  3SU5 A;  2OIN A;  4RI0 A;  2F9V A;  1RGQ A;  2M2A A;  2WPD D;  2YOL A;  3OFN D;  5HKK D;  4B76 A;  3FOA A;  3KF2 A;  4I33 A;  4B6E A;  5C0T A;  1COW D;  3DSO A;  3F2F A;  2A4G A;  3M5N A;  5GPI B;  5FPS A;  5CDF E;  1NBM D;  5GJ4 B;  1N1L A;  1SKY E;  5EPY A;  3F0P A;  4TSF D;  2QE7 D;  4F55 A;  3OYP A;  5C17 A;  2JDI D;  3O8B A;  5ESB A;  2F4L A;  2KCP A;  3SV7 A;  2AHM E;  4A1V A;  3PV2 A;  2QF4 A;  3M5O A;  2CK3 D;  3FKS D;  3LOX A;  2F9U A;  2HLD D;  3F3B A;  5CHB A;  5ETX A;  5IDK A;  2GGV B;  4B74 A;  2WHX A;  1H8E D;  5FL7 D;  4ZCN A;  3O8C A;  4FET A;  4A92 A;  1DY9 A;  2OC1 A;  4Q4L A;  4B73 A;  2YMS B;  1NBM E;  3NRL A;  5C0U A;  2P59 A;  3RC4 A;  1DY8 A;  1EFR D;  2VBC A;  3OEH D;  1BMF D;  4WH8 A;  4B75 A;  5B6L A;  5EQS A;  5EQR A;  2OC8 A;  3F0O A;  4OM9 A;  1W0K D;  2FP7 B;  5EQQ A;  4JMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...