1Q31A

Crystal structure of the tobacco etch virus protease c151a mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
227
Chain Sequence
LFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEMNELVYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tobacco etch virus protease shows the protein C terminus bound within the active site.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein, hydrolase
molecule keywords Nuclear inclusion protein A
total genus 52
structure length 227
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A02
4JZIA 2GMTC 2ANKH 4GSOA 1TIOA 3BTQE 4Y10E 1YP9A 1XXFA 1S0RA 1WTGH 1CA8B 2FIRH 5GWZA 1C2MA 1TRNA 1QB6A 3UFAA 2Y80A 1TRYA 1MZDA 4TWWA 3RMNH 2TGDA 1FZZA 3ESTA 4JYVH 1GCTB 1QBOA 3D65E 3QWCH 4FXGH 1D4PB 5J4SA 2FOFA 1V6DA 5JPMH 1BITA 1ANEA 3UQVA 3I29A 1C1UH 3FZZA 1L1JA 2VVCA 5DPAA 2UWOA 1TA6A 1MTNC 2ILNA 2ALVA 2VINA 3SV6A 3ZVFA 1BRAA 2CF9H 1TBRH 1DXWA 1GBBA 3U98H 1QL9A 1GI7B 2GV6A 1EQ9A 1BMAA 1GBKA 1ID5H 1MTUA 2JKHA 2CV3A 2BY9X 3A7ZA 4R0IA 2BYAX 3E0NB 3GCHC 1UCYK 1JIMA 4K5ZA 4CR5A 1O39A 2F9PA 3SGAE 5I46H 1O3HA 2QV1A 2ZFSA 3EQ0H 3ZVAA 4AFUA 2VIDA 2OCVB 1QFKH 1C1OA 5FPSA 3UNRA 3SV8A 1HAYB 2ZCKP 3RXVA 3GCOA 4FUBA 4ZROA 5F8TA 4IMZA 3F68H 3BTTE 4ZKRU 3SUGA 3S9BA 1BHXB 4OS7A 1UTLM 3LGTA 1RXPA 1TNLA 3U8RH 2FI4E 3M5NA 1Z8JB 3GYMA 1QGFA 3GYLB 3RXIA 2EA3A 3TLOA 3GY7A 1P10A 1BTPA 1EAWA 1NM6A 1BTHH 4X2VA 1TMBH 1QA0A 1KTTB 4RSPA 2LPRA 2D8WA 3BTWE 3Q00A 3M7QA 3S7KB 3OU0A 4X1RU 1PPZA 2G8TA 1O3OA 1NFXA 2ZA5A 4FUDA 5FCKA 1TGCA 1FDPA 4AFSA 4WH8A 1KIGH 1P2IA 4LZ4B 1GJ7B 1O2XA 3CENA 3P8FA 1TGNA 5EOKA 3NWUA 2ZFPH 3A8AA 4WH6A 5AVDA 2ZU3A 4XOJA 1KDQB 2A4QA 1V2JT 5FHTA 3K2UA 2DE8A 4D8NA 1HLTH 3U9AH 2XBXA 3E8LA 6LPRA 2Y81A 1Y59T 3BTGE 1C5WB 2ZFTA 3SNAA 3TJVA 2BY7X 4X1QU 5JBAS 2H9EH 3GISB 3CP7A 2FOHA 3SNCA 1ZZZA 3T5FH 2J34A 1F0UA 2A7CA 1T8LA 2FMJA 1K1OA 2OQ5A 4R8TB 3P92A 1SQTA 1ARCA 2C8YB 5GCHG 3SQEE 1A3BH 3KQEA 3EAJA 1J16A 2BZ6H 1G3BA 2BQWB 6ESTA 1YPJH 4MNWA 1MKXK 2C8XB 3Q77A 2GTBA 1NESE 1H1BA 3S9CA 3L6PA 1O30A 4ZHAA 1GBJA 3E16B 3SNDA 1AKSB 4CH8B 1EAUA 2ZECA 3SV2H 5GJ4B 3QLPH 3ZYDA 2RA3A 4NWKA 2GCTB 5C67A 3QZRA 4X6MA 1KDQA 1MUEB 2R3UA 1O2YA 1A5HA 1TNHA 1BRBE 2H9HA 1Z1JA 2BVRH 2P94A 4WJG2 4ABJA 1HAGE 5K7RA 3MU0A 2XW9A 3P6ZB 2FOGA 2CF8H 2A4GA 3A8CA 1P2KA 6CHAB 4Q80A 2GVFA 1OSSA 4NG9H 1HAHH 1YYY1 3LKWA 4I31A 4Y8XA 3RXFA 2GDEH 4ESTE 1FAKH 1MKWH 4THNH 4A1TA 1YC0A 5LPEA 2ANWA 1L4ZA 1PQAA 5C5NA 4ZKOU 1TB6H 2ALPA 3H7TA 1DDJA 1C1TA 3M5OA 5EW2H 4UONA 2FYQA 2XC0A 2PUQH 4I8LA 2FX6A 2HOBA 1O3AA 4O97A 1L0ZA 1O3KA 4GLYA 1ZGIA 2ZGJA 3SHCH 3PLPA 4WXVA 1L1GA 1K1PA 1XVOA 2SGDE 1EZUC 3SJOA 1YBWA 1ZHPA 4IBLH 4X6NA 1G30B 1TX8A 1ZMLA 2ZDKA 2AEIH 2FI5E 3A81A 3QK1A 2BDAA 4U2WA 3GY2A 5E2PA 3M7UA 2CHAC 2A1DB 1GBLA 2BY6X 4B76A 1V2MT 4I8KA 3T2NA 5F03A 4B73A 1U6QA 5IDKA 1CVWH 1INCA 3Q3KA 3AASA 1UTNA 3BTHE 3ZVBA 1O3FA 1O37A 1FQ3A 3LONA 3PM3A 2ASUB 2CHAB 1P04A 1T31A 1YPGH 1FY3A 8KME2 1GJ9B 3QO6A 1GBCA 4NIXA 1O34A 2IN2A 2WPMS 4ISHH 1WBGB 1LO6A 1LVYA 2PTCE 3S9AA 2BLQA 2HPPH 1FY8E 1RRKA 1UTKA 2UWPA 1G2LA 1O2LA 1BRCE 2ZFFH 3RXUA 2OUAA 4ISIH 1CU1A 2B0FA 2A45B 2BLOA 5DP7A 3R3GB 2VB0A 2WPHS 1Y3VA 1W14U 1H9IE 3RXOA 2BVXH 1A46H 1O2NA 1V2NT 2F3CE 1GHWH 3QDZB 5EPYA 4I8JA 2AERH 1LPKB 4Y76A 1LKBA 1KLJH 4E06H 5EODA 3S0NA 1BRUP 2NU3E 2ZQ2A 3HKJB 5EXNA 3A82A 1GHAG 1O5AB 5DK1A 1K2I1 1ZHMA 1YPMH 2G52A 1TMTH 2JH5D 1JRSA 4K60A 1H9HE 1OP8A 1TQ7B 3BTFE 3K6ZA 1DVAH 2WPIS 4UFGH 1EXFA 4X8VH 2BD2A 1G9IE 3VB5A 2BOKA 1E0FD 4Y0YE 1K21H 3M3SA 1TWXB 4ZHMU 1BBRE 4K8BA 3K9XB 1XUIA 1SSXA 1O35A 5FX6A 1PPGE 2FESH 1ZJKA 4WXIA 1AWFH 1Y3UA 3BN9A 2WV5A 4FU9A 4YM9A 1OP0A 3KQDA 2GKVE 2HPQH 2P8OC 1HBTH 1MH0A 5C2ZA 1O2MA 1C1QA 3RLYH 3KEEA 2ZHDA 4ZMAH 1UO6A 1BMNH 1FXYA 2FOCA 1AU8A 1EB2A 4BOHA 1OYQA 3RP2A 4DOQA 1D9IA 2ZCHP 2P16A 3PLKA 4U32A 1Y8TA 2ZTYA 4INLA 2GZ7A 3MHWU 1OWIA 2W3KA 3RDZA 3OYPA 4X1PU 1XUHA 6GCHF 3URCA 5ETXA 3PTBA 2YNBA 1MD8A 1B5GH 5PTPA 1TPSA 7KMEH 1BBRK 2GCTC 2G5NA 1MU8B 2SGFE 3WY8A 1Y3XA 2PTNA 3VB6A 2ANYA 1C2EA 3MU4A 1AWHB 4I8HA 4X2XA 1G32B 1O38A 1EJMA 1S84A 3HK6B 3RU4E 3P95A 1UTPA 1AKSA 3M5MA 4UD9H 3UNQA 4YLQH 1LDTT 1UVUH 5GDSH 2Y82A 3TH4H 5GXPA 1P9UA 1EX3A 1DICA 2VVVA 4Y7AA 1WOFA 2GV7A 2I6SA 1XX9A 1C2DA 2WUCA 3ZZ4A 3Q76A 1O3DA 4UFEH 1KTSB 2Z9JA 3MH7A 2J2UA 4Q2KA 3PLBA 5T6DA 5CHAB 3RMMH 1GVKB 1IOEA 2H5CA 3HGNA 3QN7A 2VWLA 4NFFA 3VFEA 2A5KA 1YGCH 1FUJA 3UQOA 5K0HA 1C1NA 2V0BA 2RG3A 2Z3EA 1V2VT 1ARBA 5T6FA 3V13A 4X8TH 5E2OA 3VEQB 2UUKB 3ATMA 1Z8RA 4XFQA 3LIWA 1GBFA 2ZDLA 1QB9A 1S0QA 4IN2A 1FNIA 3LDXH 3VXFH 2VU8E 2CJIA 1SR5C 3RMLH 1AY6H 1HJAB 3E6PH 2LNCA 2G00A 4YLUA 2BD7A 1SHYA 5DO4H 4FUIA 2QCYA 2BDIA 3RXGA 3PB1E 2G5VA 4KTSA 4FUEA 3GCHB 4WMFA 1K1IA 1C5YB 3ZYEA 1VGCB 3O8RA 4IC5A 4AG2A 4YOJA 2SNWA 1EOLA 1F2SE 3F1SB 1CHOG 4GCHG 4JYUH 5JYIA 3LOXA 1TPPA 3SGQE 4NA8A 1BMMH 2PWXA 1MBQA 2BZAA 5E0HA 3TIUA 3BG8A 4BTUB 4KGAA 1Z71A 1C2FA 3UTUH 3QZQA 4I33A 1MTNB 1P2JA 4MG3A 2TRMA 2R2WU 1UVPA 1O2VA 1PPFE 4XBBA 1K22H 1YM0A 2ZU2A 1O2HA 3M36A 4KTUA 1O5BB 1KXFA 1GI3A 3GY3A 1O2ZA 4A6LA 4BAOB 2C3SA 3NUMA 1O2GH 2AGGX 1GBIA 2VGCC 1O2UA 2BM2A 5FBEA 1W0ZU 2TGPZ 1AIXH 1DLEA 2A5IA 1VGCC 1ABJH 3FP8E 3SHAH 1A4WH 2HGTH 1OWHA 2GD4B 1UCYE 5EQQA 3QTOH 3KNXA 1NFWA 2EI6A 1C5PA 2GT8A 1DT2A 1W11U 4CRDA 1XUKA 2G51A 3LGWA 2OQUA 3MFJA 1FN8A 1QCPA 5A09A 3LPRA 1DY9A 2CMYA 1P01A 3T26A 1C9PA 1XUJA 1UHBB 3MNSA 4AFQA 4I7YH 3RXJA 4A5TS 1RIWC 3M5LA 5HM9A 1BQYA 1GMDF 2FOEA 5F6MA 2ULLA 1MD7A 2AMQA 1EPTA 2EI7A 3UY9A 1ZOMA 2AGEX 3RXHA 1QL8A 3EA9A 2XRCA 2A4OA 4TY6A 4HGCA 1YCPK 3P8GA 1GJ6A 1GMDG 4JYTA 3C27B 4FUJA 5BRRE 1O3MA 2Q6GA 4CHAC 4IW4E 1SOZA 3BTEE 3DHKH 1AVXA 1FJSA 5JBCS 3KIDU 3ZVDA 1PYTD 1GDUA 3ODFA 2PFEA 3SV7A 4AFZA 1ZPBA 2PHBA 5GCHF 1W13U 4O9VA 1C5TA 1ETSH 4AYVB 3UREA 4CREA 2ZDNA 1NPMA 1SPJA 1ZSKA 4FU7A 4PROA 3SO3A 1CHOF 1LVBA 1YPLH 3ATWA 1S6HA 4ISOA 1OWDA 3M35A 2ZWLH 2RA0A 2XWAA 4CRFA 3RUOA 1RD3B 1HAPH 2THFB 1O2IA 5GIBA 3ATLA 4DIIH 2Z94A 4IGDA 1S83A 2ZHEH 2O8MA 1C1SA 3CS7A 1EP6A 4AG1A 1KXBA 2PSXA 5A2MH 3TJNA 1IQGA 1O2PA 3MO3A 1GI4A 3M7TA 4Y7BA 1ORFA 2OP9A 5F8XA 4MVNA 2IOTA 1WU1A 1LHEH 2GX4A 1DSTA 1ELFA 1DITH 3V7TA 1TMUH 1RFNA 4F49A 1N8OC 2BD8A 1XMNB 4ABHA 4AB9A 2P8OB 1MKXH 2PGBB 2AMDA 1GHBF 3KL6A 4NA7A 1NU7B 4K1TA 5GPIB 1S85A 1ELVA 4F4OC 2P95A 3SU4A 1V2LT 2GGVB 2PKAB 2A31A 2BD5A 4UE7H 2V3HH 1C5UA 3LH3A 2Y5GA 2W26A 5FPTA 3ZZ9A 1P11E 1EATA 4X2YA 1SGTA 1UTQA 1BA8B 1C5QA 1SGRE 1LHCH 1GHBG 4INHA 1EOJA 2WPJS 3KHVA 2JETB 3RXPA 4DJZB 4Q7XA 2J9NA 2HNTE 2KAIA 4AB8A 2WV4A 4OGXA 3MI4A 1AMHA 1Y5BT 3E90B 5JBBS 1ELDE 2A32A 3OY6U 1HIAA 5AF9H 3UIRA 1T32A 1VCQA 4CR9A 2WYGA 1C5NH 1THRH 1JRTA 1HAIH 2OD3B 1N8OB 4Q7YA 4UEHH 1BTZA 3H5CB 1SQAA 2GCHG 5J4QA 1LVMA 3RC5A 4AX9H 2BDBA 1EAIA 2ZP0H 1AUJA 1E37B 3OTJE 3PROA 4MNVA 1LVOA 4FUGA 4U01A 2FS9A 4E7RG 1O5CB 1XKAC 1ZR0A 3LC5A 1FIWA 3UWIA 3SZNA 3SJ9A 1GGDB 1CGJE 1F5RA 1SGIB 4INKA 3RXSA 3SW2B 2DE9A 1XUFA 3F9HA 5A0BA 2F83A 4D9QA 2OC8A 3FP7E 4A1XA 3MNBA 2WYJA 1GHVH 2WUBA 3B9FH 1TBQH 2NU4E 2P3TB 3O8BA 5H4IB 1QRZA 1THSH 3BV9B 1WCZA 3DFJA 3S7HB 2FOBA 2O9QA 1TNKA 1O3LA 5ABWA 2AH4X 2QIQA 2W7SA 1C5OH 1HCGA 4MPVA 1C5VA 1FY5A 1GBTA 2G4UA 1VZQH 1ANDA 3QTVH 2PR3A 1O5EH 2VIQA 1ELBA 3MU5A 1P09A 1HAOH 1A5GH 4D7GA 1AE8H 1V2QT 1SGDE 2C8ZB 2VIWA 8GCHF 1QJ7B 1SGFA 2Y7ZA 1TALA 2JH0D 1TNIA 3BIVH 3GY8A 1O2OA 4FUCA 1NRSH 1O5FH 2Z9IA 2FO9A 6GCHG 3TH2H 1AB9C 2TGAA 4GCHF 4CBNA 1F5KU 3G01A 4H6SB 3SU0A 3TJUA 3BEIB 3MH4A 1FN6A 1CT2E 3BIUH 1L4DA 1F0TA 5DP5A 5LH8A 1CQQA 2IPHA 4A7IB 2BD9A 1RIWB 2FEQH 1EJNA 3NXPA 1ABIH 4JZEH 2BLVA 2O8LA 3M3TA 3NCLA 4TPYA 2ODQA 1C5SA 4NIVA 1AVGH 1VITH 1QIXB 4JZDH 1Y3YA 2Z3CA 2F91A 1J8AA 2NU1E 1QRXA 1TPOA 3EGKH 3LU9B 4DW2U 1H8IH 3RXAA 1CHGA 3NKKA 2BOHB 1LHGH 1AVWA 1XXDA 4JZ1A 4ZHLU 3TK6A 2VGCB 5A8YA 1QBNA 2DUCA 1BJVA 3A86A 4WY3A 2XBYA 1O5DH 4B2CA 5A8ZA 1HRTH 1AZZA 1P02A 7GCHG 5T3HA 5EXMA 1HDTH 2AGIX 2QF3A 1T8MA 5CE1A 2SFAA 2Q6DA 1ZSLA 1QHRB 1C9TA 4NCYA 3MOCA 1VCPA 4X8UH 1C2IA 4ZKNU 3AAUA 2ZFRH 1GBDA 1B0FA 1S5SA 5E8EH 3E3TA 1BTYA 1SC8U 4Y71A 3SGBE 3ZZ7A 5ESTE 1C1RA 2AYWA 2GDDA 1DE7H 4BAMB 1O2KA 3UOPA 1O3PB 1GG6B 1AUTC 1HJ9A 2FZZA 2PGQB 1P2MA 2QGRA 2W3IA 4Y6DA 1OKXA 1S81A 1O2QA 3LGVA 1O36A 1OX1A 3PWCA 2EEKA 2BDYA 1E34B 2QC2A 4A1VA 3RU4D 1BMLA 3VGCB 4NWLA 4OS6A 1NRPH 4HZHA 4A92A 2OC7A 1EAXA 5DGJA 1O3CA 3RXEA 1GI0A 5C20A 1HJAC 4X1NU 1SGYE 1W10U 2A0QB 1O3GA 4KELA 5L6NH 1QJ1B 2ZTXA 1W3CA 5DKMA 5IYTA 4DGJA 2BY5X 3ODDA 4LOYH 1CBWC 3F9FA 4OS5A 1AGJA 1Z1IA 2ZPRA 4X1SU 1MZAA 2OINA 2FWWA 2VVUA 2VIOA 4X6OA 1A0JA 3SU1A 4AGJA 3E1XB 1TONA 4MTBA 4ABGA 1GBMA 1CGIE 2ESTE 1SQOA 1ZMNA 5L30H 3MU1A 1C2KA 1PJPA 3FZDA 1EP5A 1KLIH 5A0AE 1Z6JH 2XWBI 4OGYA 1ELAA 1C5MD 1JIRA 1V2RT 1TA2A 3P8OA 1C5ZB 1RTLA 2GMTB 3MH6A 5HXFA 2ZFQH 1TPAE 3P70B 4YTAA 1O33A 5JB8S 3V12A 4QT8C 4DG4A 3BTDE 1LTOA 1EB1H 5DP6A 3UR9A 3VGCC 1N6XA 3SUDA 1EASA 3RXCA 1C1PA 3IG6B 3IITA 4DURA 3TNTA 1IHTH 3LGYA 1ZMJA 3L33A 1MTSA 4YESB 1AFQB 3NK8A 2FI3E 4NZLA 1GI1A 2PKSC 1EZSC 4JK6A 5B6OA 1SGFG 4BTTB 1AZ8A 2QA9E 1KSNA 5JB9S 3A8DA 2FODA 1T4VH 1FV9A 1GCTC 4UFDH 2ZIQH 3ITIA 1KXAA 5FCRA 2BQ7B 2ANMH 1ELTA 1G2MA 1ETTH 1HAVB 1GPZA 4ZXYH 2ZQ1A 3Q3XA 3SQHE 1UK2A 3LGUA 1A0HB 3ZZBA 3D23A 1QBVH 1V2KT 2BVSH 2GP9B 1G36A 1CGHA 1YPHC 1TBZH 3GCTG 1FY1A 3FVFB 1A61H 1GMHG 3SUFA 2EI8A 1HAZB 2PV9B 4OS4A 4B1TA 2Y5FA 2FTMA 3EA7A 1IQLA 1GBAA 1SLVB 1EKBB 1BZXE 2BHGA 1NZQH 1QR3E 3BTME 1PYTC 2J92A 2CGAA 4ASHA 4GUXA 1FMGA 3ZVEA 4ABIA 5DG6A 1F5LA 3ELAH 1YPEH 4H4FA 3RM2H 1SGNE 1TRMA 3LH1A 5EGMA 1OP2A 2TBSA 3A80A 2XC5A 1GGDC 4GVUA 5C1YA 3W95A 4D76A 3MO9A 3FP6E 2G55A 5L2YH 1PQ5A 1P3EA 5CHAC 5EQSA 3U8OH 1E36B 1IQJA 2PLXA 1LHFH 3A87A 1SB1H 4AORA 2EC9H 1HXFH 1BUIA 1TGTA 1G3CA 5EU8A 3AVZA 1SL3A 1Z8GA 1T7CA 4Z6AH 4NFEA 4J2YB 1KXCA 1J17T 2H1UA 3OSYA 3TH3H 1FPCH 2ZDAH 1QQ4A 1HIAB 1W8BH 3VXEH 1TGSZ 3UNSA 1O31A 3AW1A 1P3CA 3TGIE 1GBEA 5FX5A 1RS0A 3QGNB 1W12U 5E0GA 1DX5M 3EA8A 2B7DH 1P03A 2FOMB 4FVDA 2ZHWH 2O8TA 1ZGVA 2NU0E 1GI9B 3D62A 3T25A 4ABBA 4HFPB 4SGBE 2BXUH 1DLKB 2ZF0H 1Q2WA 1GL1A 3W94A 3MH5A 1JWTA 1UMAH 2UUYA 2W7UA 5A0CA 4DY7B 3GICB 2BDHA 3H7OA 2BY8X 4X8SH 3PWBA 2ZI2H 3CS0A 1HNEE 2HVXA 2YNAA 4FVBA 5EQRA 4MPXA 5AHGH 4XBDA 4DIHH 3SJIA 1OYTH 3F6UH 3A7TA 2SGAA 1GJ4H 1ESBA 3K65B 1MCTA 2AMPA 2TPIZ 1HJ8A 1PPHE 2Q6FA 1O2JA 1K28D 1XVMA 3HPTB 4GHQA 4LK4A 5I25A 1ELGA 7ESTE 1FPHH 1N1LA 1ZPZA 2RCEA 2PW8H 3MO6A 8ESTE 3DUXH 5JDUB 2VNTA 2HNTF 2A7HA 1E35B 2F9NA 1MQ6A 1IQNA 2ZO3H 1V2TT 7LPRA 5TCCA 1VCWA 5FPYA 1J15A 3GCNA 2J38A 2ZDMA 4BAQB 2A4RA 3RXDA 1PPBH 2V3OH 4K1EA 1RTFB 1ZSJA 1GHAF 1T8NA 1ZTKA 1GDNA 3FANA 1ANCA 1BB0B 2D2DA 3PMBB 4YOIA 4AN7A 4H42U 2WINI 2R2MB 3R0FA 1OS8A 3LJJA 3VB3A 1ETRH 4DVAU 1P0SH 1SGQE 1IQEA 1V2WT 1SHHB 2FDAA 3PV4A 4Y11E 4TYDA 1FIZA 1WV7H 2TGTA 2BD4A 1W7GH 5EG4A 1P8VC 4RKJB 1ELCA 1GHYH 1UK4A 1AHTH 1NC6A 1CT0E 2ZU5A 1YCPH 1NTPA 2TIOA 2R0LA 3GY5A 2SGQE 1SLXB 1EZQA 3S69A 1Z6EA 1IAUA 3T62A 3ZV9A 5FAHA 2Y5HA 3GDSA 3EDXB 2FYRA 2QY0B 3SNBA 1GJ5H 2ZDVH 1P2OA 2P59A 1AO5A 3RXKA 2SNVA 1KXDA 1BT7A 4M7GA 4I32A 4WF8A 1YPHE 1BBRH 1DS2E 3SI3H 3MNCA 1UHBA 1IQFA 1UVOA 1PPEE 2FLRH 5SGAE 1NRNH 4MQAA 1HPGA 2WPKS 1IQMA 5DP9A 2XTTB 1IQIA 1GJCB 1Y3WA 3A7YA 1QL7A 3PMHB 1YF4A 3M61U 1GMCF 2OTVA 1VJ9U 4KKDA 1V2OT 1JBUH 4ABFA 1EUFA 4TWYA 4IN1A 1A1RA 3B8JA 1MCVA 2JETC 3SJKA 1BCUH 1C1WH 2STAE 5HYOA 1D3DB 1A0LA 4YZUA 1X7AC 4ZAEA 3QUMP 3T27A 2XC4A 1HGTH 1WQVH 2ZGCA 1XM1A 1O3EA 1P9SA 3TGKE 3GCTF 2SGPE 1O0DH 1HV7A 3BTKE 1FAXA 2HRVA 4NGAH 2OLGA 3N7OA 1C4U2 4ISNA 5HGGA 1UVTH 4FU8A 2VH0A 3F9GA 4NIWA 2FS8A 1TAWA 2CXVA 2P3UB 2J95A 1ZHRA 2YOLA 4ZUHA 3GOVB 3L3TA 4NZQA 1SFIA 1C4V2 4D9RA 1SMFE 1DFPA 2B9LA 3SOSA 1ESAA 4E7NA 2HLCA 1NROH 4RN6A 3SORA 1C5XB 1P57B 2H9TH 2V6NA 1V3XA 3UUZA 1SG8B 1UTOA 3DA9B 4E05H 1THPB 2GCHF 3HATH 2G4TA 2ZGHA 3SI4H 1BIOA 3ENSB 3E91A 1O3NA 1O32A 3EYDA 1ZLRA 1ZRBA 1PFXC 4BAKB 4GHTA 1UCYH 1C4Y2 4HI3A 2BB4A 1GHZA 2UWLA 9LPRA 3RXQA 1ZRKA 2VJ1A 2AFQB 1MMJN 4K2YA 3P17H 4K8YA 1GWAA 4MPWA 1FLEE 1BDAA 4SGAE 3V0XA 3KQCA 4CRGA 3GDVA 3SU2A 4B74A 1J14A 1HYLA 4CH2B 3MU8A 4CRAA 4ZXXH 4CRCA 4JZFH 4GPGA 3LC3A 3ZZ5A 3NPSA 3KQBA 2I6QA 1AN1E 3MMGA 2FM2A 3F9EA 2P3FH 5G4BA 3M37A 1IQHA 1MTVA 1TYNA 1W0YH 1C2LA 4X0WU 1LHDH 4X6PA 4YT6H 2BQ6B 1T4UH 5FBIA 1HUTH 1NFUA 4O03A 4BXWA 2OXSA 1E38B 1W2KH 3O8CA 3A8BA 1Z7KA 1HXEH 1WSSH 2ZU4A 1CSOE 1P12E 1GHXH 2ZPSA 4ABEA 4TY7A 1AQ7A 2A5AA 1CBWB 1GJ8B 3TU7H 1O3JA 1ESTA 1A5IA 1DY8A 1H8DH 1ACBE 2PUXB 1TQ0B 1AE5A 1GVLA 1SLWB 1OWJA 3ATKA 2FPZA 1BHXF 3TGJE 3MNXA 1Y5UT 2Z7FE 2H5DA 1OOKB 5HMAA 3SV9A 1OWKA 2W5EA 1K1LA 1KXEA 3D49H 2C4FH 3PMJA 2BXTH 1L2EA 2UUFB 3B23B 3BEFB 4YO9A 1C2HA 5L2ZH 2VH6A 4KP0A 1C5LH 1MTWA 3KCGH 1GG6C 1NRRH 1TNJA 2O8UA 3SU3A 2F9VA 2VIVA 4WMEA 2AIPA 1ZYOA 1LQEA 3SNEA 4ABDA 3VB4A 1K1NA 4DT7B 1LCYA 3JZ2B 5TCAA 1GCDA 1P06A 3A7XA 2BD3A 2P93A 1A2CH 2ZHQH 4J1YA 5T6GA 1ELEE 2PKSB 1NRQH 4IC6A 4BAHB 1K1MA 2QN5T 3MWIU 2WPLS 1LQDB 2ZPQA 3TITA 3M3VA 4KTCA 4I8GA 2ZU1A 4CRBA 1O2WA 1J9CH 1DXPA 3SUEA 1NN6A 2A2XH 4XBCA 1G37A 3SN8A 1DOJA 2D26C 1BTUA 1VR1H 8GCHG 1D3QB 2FOAA 1MU6B 2UUJB 1RTKA 2FTLE 3RXLA 1BTWA 3FAOA 4MPUA 5LPFA 1HAXB 1CE5A 1TFXA 2Z9KA 1SI5H 3PYHA 2J94A 2FX4A 1JXPA 1P2QA 1GJBB 3GY4A 4HTCH 1BJUA 1PQ8A 1MBMA 2BTCE 1GI5A 1LPZB 3PO1B 2CN0H 3OX7U 1SGPE 3PTNA 1KY9A 1P2NA 3A7WA 2OC1A 1TGBA 1S82A 1PQ7A 2HALA 2ODYB 2FLBH 2STBE 1HAVA 2Z9GA 3ZZAA 3URDA 1F0SA 1H9LB 3ZZ8A 2QF0A 1NY22 1PPCE 1D6WA 3LT3A 1O2RA 3STJA 1ZTLA 2ZZUH 3UPEA 2VWOA 3ZZDA 1OXGA 3RXTA 1A3EH 4JMYA 1GBHA 1KYNA 2ZTZA 1NFYA 4Q7ZA 2R3YA 3Q3YA 1AI8H 2XBVA 2QXHA 1XKBC 4MNXA 5C3NA 4XDEA 2V35A 1NS3A 1TABE 3ZVGA 2PKAA 3A83A 3TVJB 2G81E 3LJOA 1D3TB 1VITF 1MAYA 3RMOH 1EZXC 3BSQA 1ZPCA 3EE0B 1N6YA 2GZ8A 4NSVA 3ZZ6A 5LGOA 1K1JA 1MKWK 4NSYA 3RC6A 5E0JA 2R9PA 1GJAB 3KF2A 1V2UT 1RJXB 2VWMA 2KAIB 1CA0B 1YKTA 1CO7E 5C5OA 1DWDH 4D7FA 1TX7A 1W7XH 4K1SA 3ZZCA 4K3JA 1QA7A 2Y6TA 1SGEE 1EPTB 1OPHB 2BX4A 3K6YA 3QGJA 1NO9H 4AOQA 2XXLA 3I78A 1BTXA 3OY5U 7GCHF 3TPIZ 1F92A 3U8TH 4WWYA 2XNIA 4IMQA 4XE4A 3BG4B 2Z6BD 1TOMH 3RM0H 3HK3B 1YLDA 1ZTJA 3U1IB 1O3IA 2ZGXH 1SFQB 3UOUA 2QXIA 2O8WA 2HNTC 3DT0H 5C1UA 3ATIA 3TK9A 1QURH 5LPRA 3BEUA 4UDWH 1AD8H 2RDLA 2R0KA 3TNSA 1TNGA 3A89A 2C93B 4Y79A 3U69H 3FFGA 1DM4B 3AAVA 2B8OH 3HKIB 2OBQA 1Q31A 2Z9LA 1EPTC 1RGQA 2QYIA 4VGCB 2ZCLP 4WMDA 4BXSA 1UK3A 1GVZA 2QXJA 3A7VA 5DJ7A 1GL0E 1O2TA 2AS9A 4Z0KA 3GY6A 4YT7H 2D1JA 1NU9A 4O3TA 1SOTA 1AB9B 1D3PB 2GZ9A 3STIA 4ZH8A 1QRWA 5AFZH 3T28A 1GDQA 1DUAA 1Q3XA 3T29A 4FUHA 3RU4T 4ISLA 2XCFA 1IQKA 4DCDA 1IHSH 2BX3A 1XUGA 3UWJH 1GI2A 1LMWB 1NT1A 2IJOB 6CHAC 1EJAA 1DWBH 4BNRA 1CT4E 4LZ1H 1QY6A 3SU6A 3A84A 2B5TB 4O3UA 2NWNA 2BDGA 1DWEH 2H6MA 2F9BH 1HB0B 1YLCA 5AFYH 2PSYA 4LXBH 4MLFB 4CBOA 3AW0A 3TJOA 1DUEA 3MYWA 2C90B 4ZKSU 1WAYB 1GJDB 1TX6A 2ODPA 2AIQA 1QTFA 3I77A 1WQSA 4Y8ZA 1DSUA 1VITG 3RXRA 2BMGB 1DWCH 3NZIA 1C2JA 2QAAA 1AFEH 2JH6D 2HWLB 1C5RA 5F8ZA 1WUNH 4B75A 1TOCB 1P05A 4X2WA 1UJ1A 3IWMA 4UFFH 1VJAU 2Y7XA 1V2PT 3VPKA 2F9OA 2Z3DA 2J4IA 4FUFA 1F7ZA 1G3EA 2BDCA 1O5GH 3BF6H 5A8XA 1D6RA 2FP7B 2OBOA 4U30A 3RLWH 1H4WA 1QNJA 1MAXA 1JMOH 1ZJDA 2VIPA 1GMHF 2ZNKH 8LPRA 3PMAB 1DANH 1C2GA 3KGPA 2ZG0H 3ZVCA 3ZV8A 4CHAB 1V2ST 2XCNA 1TE0A 2GT7A 3E0PB 4OS1A 1GMCG 1LKAA 5DP4A 5TJXA 1ANBA 5EPNA 2K1QA 3BG4C 1GI6A 3VB7A 1O3BA 4JK5A 5JBTA 4VGCC 1C1MA 1S6FA 1SGCA 1B0EA 3GDUA 3P8NA 3A85A 1UVSH 1JOUB 3TK5A 1GI8B 1FONA 3C1KA 3QX5H 4YOGA 4BTIB 2ZGBH 2XYAA 5HM2A 2C8WB 4B2BA 4H6TA 1FI8A 3HGPA 5DP8A 1UTJA 2XBWA 4Y8YA 3RC4A 5ESBA 1SBWA 1FY4A 1M9UA 2A7JA 1C1VH 2ZHFH 1OWEA 4OS2A 4TPIZ 1WYKA 3JZ1B 3DFLA 1HFDA 4AGKA 3ZZ3A 9ESTA 1K9OE 4XSKU 2F9UA 4JCNA 3MTYA 4Y0ZE 4WVPE 5CMXH 4AYYB 1AFQC 5FXLA 3O8DA 3SJ8A 1A7SA 4AZ2B 3U1JB 1SLUB 2FXRA 2Q1JA 5BPEA 4MDSA 1G3DA 1T8OA 1O2SA 2ZEBA 4NIYA 5C1XA 4GAWA 3DD2H 1L1NA 1MQ5A 5EW1H 2QXGA 1CA0C 2SGEE 2NU2E 2ZC9H 4MNYA 4NA9H 1Y5AT 1DPOA 2A2QH 4B2AA 4ABAA 2ZKSA 1Z8IB 1QJ6B 1TLDA 3A88A 1UTMA 3RXBA 4BANB 3UR6A 1KLTA 1QQUA 4B71A 1WTHD 3V3MA 3SU5A 1BOQA 4K69A 4IS5A 1B7XB 2H2ZA 1YPKH 1QB1A 1YCPM 2BLWA 3KN2A 5DP3A 3PO1C 2M5TA 1F0RA 1SVPA 3RXMA 5EXLA 1LPGB 2OC0A 3LGIA 2VWNA 3SBKA 4RKOB
chains in the Genus database with same CATH superfamily
4JZIA 2GMTC 2ANKH 4GSOA 1TIOA 3BTQE 4Y10E 1YP9A 1XXFA 1S0RA 1WTGH 1CA8B 2FIRH 5GWZA 1C2MA 1TRNA 1QB6A 3UFAA 2Y80A 1TRYA 1MZDA 4TWWA 3RMNH 2TGDA 1FZZA 3ESTA 4Q63A 4JYVH 1GCTB 1QBOA 3D65E 3QWCH 4FXGH 1D4PB 5J4SA 2FOFA 1V6DA 5JPMH 1BITA 4ZCNA 1ANEA 3UQVA 3I29A 1C1UH 3FZZA 1L1JA 2VVCA 3F3BA 5DPAA 2UWOA 1TA6A 1MTNC 2ILNA 2ALVA 2VINA 3SV6A 3ZVFA 1BRAA 2CF9H 1TBRH 1DXWA 1GBBA 3U98H 1QL9A 1GI7B 2GV6A 1EQ9A 1BMAA 1GBKA 1ID5H 1MTUA 2JKHA 1VKYA 2CV3A 2BY9X 3A7ZA 4R0IA 2BYAX 3VG8A 3E0NB 3GCHC 1UCYK 1JIMA 4K5ZA 4CR5A 1O39A 2F9PA 2GJGA 3SGAE 5I46H 1O3HA 2QV1A 2ZFSA 3EQ0H 3ZVAA 4AFUA 2VIDA 2OCVB 1QFKH 1C1OA 5FPSA 3UNRA 3SV8A 1HAYB 2ZCKP 3RXVA 3GCOA 4FUBA 4ZROA 5F8TA 4IMZA 3F68H 3BTTE 4ZKRU 3SUGA 3S9BA 1BHXB 4OS7A 1UTLM 3LGTA 1RXPA 1TNLA 3U8RH 2FI4E 3M5NA 1Z8JB 3GYMA 1QGFA 3GYLB 3RXIA 2EA3A 3TLOA 3GY7A 1P10A 1BTPA 4P00A 1EAWA 1NM6A 1BTHH 4X2VA 1TMBH 2IJD1 1QA0A 1KTTB 4RSPA 2LPRA 2D8WA 3BTWE 2IPQX 3Q00A 3M7QA 3S7KB 3OU0A 4X1RU 1PPZA 2G8TA 1O3OA 1NFXA 2ZA5A 4FUDA 5FCKA 1TGCA 1FDPA 4AFSA 4WH8A 1KIGH 1P2IA 4LZ4B 1GJ7B 1O2XA 3CENA 3P8FA 1TGNA 5EOKA 3NWUA 2ZFPH 3A8AA 4WH6A 5EIYA 5AVDA 2ZU3A 4XOJA 1KDQB 2A4QA 1V2JT 5FHTA 3K2UA 2DE8A 4D8NA 1HLTH 3U9AH 2JJ1D 2XBXA 3E8LA 6LPRA 2Y81A 1Y59T 3BTGE 1C5WB 2ZFTA 3SNAA 3TJVA 2BY7X 4X1QU 5JBAS 2H9EH 3GISB 3CP7A 2FOHA 3SNCA 1ZZZA 3T5FH 2J34A 1F0UA 2A7CA 1T8LA 2FMJA 1K1OA 2OQ5A 4R8TB 3P92A 1SQTA 1ARCA 2C8YB 5GCHG 3SQEE 1A3BH 3KQEA 3EAJA 3EE7A 1J16A 2BZ6H 1G3BA 2BQWB 6ESTA 1YPJH 4MNWA 1MKXK 2C8XB 2AHME 3Q77A 2GTBA 1NESE 1H1BA 3S9CA 3L6PA 1O30A 4ZHAA 2KCYA 1GBJA 3E16B 3SNDA 1AKSB 4CH8B 1EAUA 2ZECA 3SV2H 5GJ4B 3QLPH 3ZYDA 2RA3A 4NWKA 2GCTB 5C67A 3QZRA 4X6MA 1KDQA 1MUEB 2R3UA 1O2YA 1A5HA 5C0TA 1TNHA 1BRBE 2H9HA 2WSSD 1Z1JA 2BVRH 2P94A 4WJG2 4ABJA 1HAGE 5EJZA 5K7RA 3MU0A 2XW9A 3P6ZB 2FOGA 2CF8H 2A4GA 3A8CA 1P2KA 6CHAB 4Q80A 2GVFA 1OSSA 4NG9H 1HAHH 1YYY1 3LKWA 4I31A 4Y8XA 3RXFA 2KCOA 2GDEH 4ESTE 1FAKH 1MKWH 4THNH 4A1TA 1YC0A 5LPEA 2ANWA 1L4ZA 1PQAA 5C5NA 4ZKOU 1TB6H 2ALPA 3H7TA 1DDJA 1C1TA 3M5OA 5EW2H 4UONA 2FYQA 2XC0A 2PUQH 4I8LA 2FX6A 2HOBA 5C17A 1O3AA 4O97A 1L0ZA 1O3KA 4GLYA 3WWFA 1ZGIA 2ZGJA 5KECA 3SHCH 3PLPA 4WXVA 1L1GA 1K1PA 1XVOA 2SGDE 1EZUC 3SJOA 1YBWA 1E1QD 1ZHPA 4IBLH 4X6NA 1G30B 1TX8A 1ZMLA 2ZDKA 2J97A 2AEIH 2FI5E 3A81A 3QK1A 2BDAA 4U2WA 3GY2A 5E2PA 3M7UA 2CHAC 2A1DB 1GBLA 2BY6X 4B76A 1V2MT 1H8HD 4I8KA 3T2NA 5F03A 4B73A 3UAIC 3WWBA 1U6QA 5IDKA 1CVWH 1INCA 3Q3KA 3AASA 1UTNA 3BTHE 3ZVBA 1O3FA 1O37A 1FQ3A 3LONA 3PM3A 2ASUB 2CHAB 1P04A 1T31A 1YPGH 5T1VA 1FY3A 2XNDD 8KME2 5EJLA 1GJ9B 3QO6A 1GBCA 4NIXA 1O34A 2IN2A 2WPMS 4ISHH 1WBGB 1LO6A 1LVYA 3DCLA 2PTCE 3S9AA 2BLQA 2HPPH 1FY8E 1RRKA 1UTKA 2UWPA 1G2LA 1O2LA 1BRCE 2ZFFH 3RXUA 2OUAA 4ISIH 1CU1A 2B0FA 2A45B 2BLOA 5DP7A 3R3GB 2VB0A 2WPHS 1Y3VA 1W14U 1H9IE 3RXOA 2BVXH 1A46H 1O2NA 1V2NT 2F3CE 1GHWH 3QDZB 5EPYA 3WW7A 4I8JA 2AERH 1LPKB 4Y76A 1LKBA 1KLJH 4E06H 5EODA 3S0NA 1BRUP 2NU3E 2ZQ2A 3HKJB 5EXNA 3A82A 1GHAG 1O5AB 5DK1A 1K2I1 1ZHMA 2KX4A 1YPMH 2G52A 1TMTH 2JH5D 1JRSA 4K60A 1H9HE 1OP8A 1TQ7B 3BTFE 3K6ZA 1DVAH 2WPIS 4UFGH 1EXFA 4X8VH 2BD2A 1G9IE 3VB5A 2BOKA 1E0FD 4Y0YE 1K21H 3M3SA 1TWXB 4ZHMU 1BBRE 4K8BA 3K9XB 1XUIA 1SSXA 1O35A 5FX6A 1PPGE 2FESH 1ZJKA 4WXIA 1AWFH 1Y3UA 3BN9A 2WV5A 3F2HA 4FU9A 4YM9A 1OP0A 3KQDA 2GKVE 2HPQH 2P8OC 1HBTH 1MH0A 5C2ZA 1O2MA 1C1QA 3RLYH 3KEEA 2ZHDA 4ZMAH 1UO6A 1W0JD 1BMNH 1FXYA 2FOCA 1AU8A 1EB2A 4BOHA 1OYQA 3RP2A 4DOQA 1D9IA 2ZCHP 2P16A 3PLKA 4U32A 4ACBA 1Y8TA 2ZTYA 4INLA 2GZ7A 3MHWU 1OWIA 2W3KA 1WXRA 3RDZA 3OYPA 4X1PU 1XUHA 6GCHF 3URCA 5ETXA 3PTBA 2YNBA 1MD8A 1B5GH 5PTPA 1TPSA 7KMEH 1BBRK 2GCTC 2G5NA 1MU8B 2SGFE 3WY8A 1Y3XA 2PTNA 3VB6A 2ANYA 1C2EA 3MU4A 1AWHB 4I8HA 4X2XA 1G32B 1O38A 1EJMA 1S84A 3HK6B 3RU4E 3P95A 1UTPA 1AKSA 3M5MA 2KCAA 4UD9H 3UNQA 4YLQH 1LDTT 1UVUH 5GDSH 2Y82A 3TH4H 4M9FA 4DT4A 2L6OA 5GXPA 1P9UA 1EX3A 1DICA 2VVVA 4Y7AA 1WOFA 2GV7A 2I6SA 1XX9A 1C2DA 2WUCA 3ZZ4A 3Q76A 2J5UA 4AC9A 1O3DA 4UFEH 1KTSB 2Z9JA 3MH7A 2J2UA 4Q2KA 3PLBA 5T6DA 5CHAB 3RMMH 1GVKB 1IOEA 2H5CA 3HGNA 3QN7A 2VWLA 4NFFA 3VFEA 2A5KA 3W1EA 1YGCH 1FUJA 3UQOA 5K0HA 1C1NA 2V0BA 2RG3A 2Z3EA 1V2VT 1ARBA 5T6FA 3V13A 4X8TH 5E2OA 3VEQB 2UUKB 4I86A 3ATMA 1Z8RA 4XFQA 3LIWA 1GBFA 2QF5A 2ZDLA 1QB9A 4ACAA 1OHHD 1YWUA 1S0QA 4IN2A 1FNIA 3LDXH 3VXFH 2VU8E 2CJIA 1SR5C 3RMLH 1AY6H 1HJAB 3E6PH 2LNCA 2G00A 4YLUA 2BD7A 1SHYA 5DO4H 4FUIA 2QCYA 2BDIA 3RXGA 3PB1E 2G5VA 4KTSA 4FUEA 1UW7A 3GCHB 4WMFA 5FL7D 1K1IA 2J98A 1C5YB 3ZYEA 1VGCB 3O8RA 4IC5A 4AG2A 4YOJA 2F43B 2SNWA 1EOLA 1BMFD 1F2SE 3F1SB 1CHOG 4GCHG 4JYUH 5JYIA 3LOXA 1TPPA 3SGQE 4NA8A 1BMMH 2PWXA 1MBQA 2BZAA 5E0HA 3TIUA 3BG8A 4BTUB 4KGAA 1Z71A 1C2FA 3UTUH 3QZQA 4I33A 1MTNB 1P2JA 4MG3A 2TRMA 2R2WU 1UVPA 3AK5A 1O2VA 1PPFE 4XBBA 1K22H 1YM0A 2ZU2A 1O2HA 3M36A 4KTUA 1O5BB 1KXFA 1GI3A 3GY3A 1O2ZA 4A6LA 4BAOB 5HKKD 2C3SA 3NUMA 1O2GH 2AGGX 2JIZD 1GBIA 2VGCC 1MABB 1O2UA 2BM2A 5FBEA 1W0ZU 2TGPZ 1AIXH 1DLEA 2A5IA 1VGCC 1ABJH 3FP8E 3SHAH 1A4WH 2HGTH 1OWHA 2GD4B 1UCYE 5EQQA 3QTOH 3KNXA 1NFWA 2EI6A 1C5PA 2GT8A 1DT2A 1W11U 4CRDA 1XUKA 2G51A 3LGWA 2OQUA 3MFJA 1FN8A 1QCPA 5A09A 3LPRA 1DY9A 2CMYA 1P01A 3T26A 1C9PA 1XUJA 1UHBB 3MNSA 1NBME 4AFQA 4I7YH 3RXJA 3OFND 4A5TS 1RIWC 3M5LA 5HM9A 1BQYA 1GMDF 2FOEA 5F6MA 2ULLA 1MD7A 2AMQA 1EPTA 2EI7A 3UY9A 1ZOMA 2AGEX 2KR7A 3RXHA 1QL8A 3EA9A 2XRCA 2A4OA 4TY6A 4HGCA 1YCPK 2WV9A 3P8GA 1GJ6A 1GMDG 4JYTA 3C27B 4FUJA 5BRRE 1O3MA 2Q6GA 4CHAC 4IW4E 1SOZA 3BTEE 3DHKH 1AVXA 1FJSA 5JBCS 3KIDU 3ZVDA 1PYTD 1GDUA 3ODFA 2PFEA 3SV7A 4AFZA 1ZPBA 2PHBA 5GCHF 4FOUC 1W13U 4O9VA 1C5TA 1ETSH 4AYVB 3UREA 3KYGA 4CREA 2ZDNA 1NPMA 1S6LA 1SPJA 1ZSKA 4FU7A 4PROA 3SO3A 1CHOF 1LVBA 1YPLH 3ATWA 1S6HA 4ISOA 1OWDA 3M35A 2ZWLH 2RA0A 2XWAA 4CRFA 3RUOA 1RD3B 1HAPH 2THFB 1O2IA 5GIBA 3ATLA 4DIIH 2Z94A 4IGDA 1S83A 2ZHEH 2O8MA 1C1SA 3CS7A 1EP6A 4AG1A 1KXBA 2PSXA 5A2MH 3TJNA 1IQGA 1O2PA 3MO3A 1GI4A 3M7TA 4Y7BA 1ORFA 2OP9A 5F8XA 4MVNA 2IOTA 1WU1A 1LHEH 2GX4A 1DSTA 1ELFA 1DITH 3V7TA 1TMUH 1RFNA 4F49A 1N8OC 2BD8A 1XMNB 4ABHA 2KM0A 4AB9A 2P8OB 1MKXH 2PGBB 2AMDA 1GHBF 3KL6A 4NA7A 1NU7B 4K1TA 5GPIB 1S85A 1ELVA 4F4OC 2P95A 3SU4A 1V2LT 2GGVB 4P02A 2PKAB 2A31A 2BD5A 3FN8A 2V3HH 1C5UA 4UE7H 1QZ8A 3LH3A 4HG6A 2Y5GA 2W26A 5FPTA 3ZZ9A 1P11E 1EATA 4X2YA 1SGTA 1UTQA 4Z1MD 1BA8B 1C5QA 1SGRE 1LHCH 4Q4LA 1GHBG 4INHA 1EOJA 2WPJS 3KHVA 2JETB 3RXPA 4DJZB 4Q7XA 2J9NA 2HNTE 2KAIA 3SZEA 4AB8A 2WV4A 4OGXA 2V3MA 3MI4A 1AMHA 1Y5BT 3E90B 5JBBS 1ELDE 2A32A 3OY6U 1HIAA 5AF9H 3UIRA 1T32A 1VCQA 4CR9A 2WYGA 1C5NH 1THRH 1JRTA 1HAIH 2OD3B 1N8OB 4Q7YA 4UEHH 1BTZA 3H5CB 1SQAA 2GCHG 2YMSD 5J4QA 1LVMA 3RC5A 4AX9H 2BDBA 4F55A 1EAIA 2ZP0H 1AUJA 1E37B 3OTJE 3PROA 4MNVA 1LVOA 4FUGA 4U01A 2FS9A 4E7RG 1O5CB 1FX0B 1XKAC 1ZR0A 3LC5A 1FIWA 3UWIA 3SZNA 3SJ9A 1GGDB 1CGJE 1F5RA 1SGIB 4INKA 3RXSA 3SW2B 2DE9A 1XUFA 3F9HA 5A0BA 2F83A 4D9QA 2OC8A 3FP7E 4A1XA 3MNBA 2WYJA 1GHVH 2WUBA 3B9FH 1TBQH 2NU4E 2P3TB 3O8BA 5H4IB 1QRZA 1THSH 3BV9B 1WCZA 3DFJA 3S7HB 2FOBA 2O9QA 1TNKA 1O3LA 5ABWA 2J98B 2AH4X 2QIQA 2W7SA 1C5OH 1HCGA 4MPVA 1C5VA 3F2FA 5F53A 1FY5A 1GBTA 2G4UA 1VZQH 1ANDA 3QTVH 2PR3A 1O5EH 2VIQA 1ELBA 3MU5A 1P09A 1HAOH 3U28C 1A5GH 4D7GA 1AE8H 1V2QT 1SGDE 2C8ZB 2VIWA 8GCHF 3KYFA 1QJ7B 1SGFA 2Y7ZA 1TALA 2JH0D 1TNIA 3BIVH 3GY8A 2KZ4A 1O2OA 4FUCA 1NRSH 1O5FH 2Z9IA 5DSFA 2FO9A 6GCHG 3TH2H 1AB9C 2TGAA 4GCHF 4CBNA 1F5KU 3G01A 4H6SB 3SU0A 3TJUA 2LP6A 3BEIB 3MH4A 1FN6A 1CT2E 3MQKC 3BIUH 1L4DA 1F0TA 5DP5A 5LH8A 1CQQA 2IPHA 4A7IB 2BD9A 1RIWB 5CHBA 2FEQH 1EJNA 3NXPA 1ABIH 4JZEH 2BLVA 2O8LA 3M3TA 3NCLA 4TPYA 2ODQA 1C5SA 4NIVA 1AVGH 1VITH 1QIXB 4JZDH 1Y3YA 2Z3CA 3N7EA 2F91A 1J8AA 2NU1E 1QRXA 1TPOA 3EGKH 3LU9B 4DW2U 1H8IH 3RXAA 4XRNA 1CHGA 3NKKA 2BOHB 1LHGH 1AVWA 4TSFD 1XXDA 4JZ1A 4ZHLU 3TK6A 2VGCB 5A8YA 1QBNA 2DUCA 1BJVA 3A86A 4WY3A 2XBYA 1O5DH 4B2CA 5A8ZA 1HRTH 1AZZA 1P02A 7GCHG 3DSOA 5T3HA 5EXMA 1HDTH 2AGIX 2QF3A 1T8MA 5CE1A 2SFAA 2Q6DA 1ZSLA 1QHRB 1C9TA 4NCYA 3MOCA 1VCPA 4X8UH 1C2IA 4ZKNU 3AAUA 2ZFRH 1GBDA 1B0FA 1S5SA 2KFWA 5E8EH 3E3TA 1BTYA 1SC8U 4Y71A 4ASUD 3SGBE 3ZZ7A 5ESTE 1C1RA 2AYWA 2GDDA 4B6FA 1DE7H 4BAMB 1O2KA 3UOPA 1O3PB 1GG6B 1AUTC 1HJ9A 2FZZA 2PGQB 1P2MA 2QGRA 2W3IA 4Y6DA 1OKXA 1S81A 1O2QA 3LGVA 1O36A 1OX1A 3PWCA 2EEKA 2BDYA 1E34B 2QC2A 5HIYA 4A1VA 3RU4D 1BMLA 3VGCB 4NWLA 4OS6A 1NRPH 4HZHA 4A92A 2OC7A 3PRDA 1EAXA 5DGJA 1O3CA 3RXEA 1GI0A 5C20A 1HJAC 4X1NU 1SGYE 1W10U 2A0QB 1O3GA 4KELA 5L6NH 1QJ1B 2ZTXA 1W3CA 5DKMA 5IYTA 3FOAA 4DGJA 2BY5X 3ODDA 4LOYH 1CBWC 2RFKC 3F9FA 4OS5A 1AGJA 1Z1IA 2ZPRA 4X1SU 1MZAA 2EQNA 2OINA 2FWWA 2VVUA 2VIOA 4X6OA 1A0JA 3SU1A 4AGJA 3E1XB 1TONA 4MTBA 4ABGA 1GBMA 1CGIE 2ESTE 1SQOA 1ZMNA 5L30H 3MU1A 1C2KA 1PJPA 3FZDA 1EP5A 1KLIH 5A0AE 1Z6JH 2XWBI 4OGYA 1K0HA 1ELAA 1C5MD 1JIRA 1V2RT 1TA2A 3P8OA 1C5ZB 1RTLA 2GMTB 3MH6A 5HXFA 2ZFQH 1TPAE 3P70B 2JJ2D 4YTAA 1O33A 5JB8S 3V12A 4QT8C 4DG4A 3BTDE 1LTOA 1EB1H 5DP6A 3UR9A 3VGCC 2HLDD 1N6XA 2PP6A 3SUDA 1EASA 3RXCA 1C1PA 3IG6B 3IITA 4DURA 3TNTA 3OE7D 1IHTH 2L74A 3LGYA 1ZMJA 3L33A 1MTSA 4YESB 1AFQB 3NK8A 3OTPA 2FI3E 4NZLA 1GI1A 2PKSC 1EZSC 4JK6A 5B6OA 1SGFG 4BTTB 1AZ8A 2QA9E 1KSNA 5JB9S 3A8DA 2FODA 1T4VH 1FV9A 1GCTC 4UFDH 2ZIQH 3ITIA 1KXAA 5FCRA 2BQ7B 2ANMH 1ELTA 1G2MA 1ETTH 1HAVB 1GPZA 4ZXYH 2ZQ1A 3Q3XA 3SQHE 1UK2A 3LGUA 1A0HB 3FO8D 3ZZBA 3D23A 1QBVH 1V2KT 2WHXA 2BVSH 2GP9B 1G36A 1CGHA 1YPHC 1TBZH 3GCTG 1FY1A 3FVFB 1A61H 1GMHG 3SUFA 2EI8A 1HAZB 2PV9B 4OS4A 4B1TA 2Y5FA 2FTMA 3EA7A 1IQLA 1GBAA 1SLVB 4RT0A 1EKBB 1BZXE 2LELA 2BHGA 1NZQH 1QR3E 3BTME 1PYTC 2J92A 1W0KD 2KCPA 2CGAA 4ASHA 4GUXA 1FMGA 3ZVEA 4ABIA 5DG6A 1F5LA 3ELAH 1YPEH 4H4FA 3RM2H 1SGNE 1TRMA 3LH1A 5EGMA 1OP2A 2TBSA 3A80A 2XC5A 1GGDC 4GVUA 5C1YA 3W95A 4D76A 3MO9A 3FP6E 2G55A 5L2YH 1PQ5A 1P3EA 5CHAC 5EQSA 3U8OH 1E36B 1IQJA 2PLXA 1LHFH 3A87A 1SB1H 4AORA 2EC9H 1HXFH 1BUIA 1TGTA 1G3CA 5EU8A 3AVZA 1SL3A 1Z8GA 1T7CA 4Z6AH 4NFEA 4J2YB 1KXCA 1J17T 2H1UA 3OSYA 3TH3H 1FPCH 2ZDAH 3OEED 1QQ4A 1HIAB 1W8BH 3VXEH 1TGSZ 3UNSA 1O31A 3AW1A 1P3CA 3TGIE 1GBEA 5FX5A 1RS0A 3QGNB 1W12U 5E0GA 1DX5M 3EA8A 2B7DH 1P03A 2FOMB 4FVDA 2ZHWH 2O8TA 1ZGVA 2NU0E 1GI9B 3D62A 3T25A 4ABBA 4HFPB 4SGBE 2BXUH 1DLKB 2ZF0H 1Q2WA 1GL1A 3W94A 3FKSD 3MH5A 1JWTA 1UMAH 2UUYA 2W7UA 5A0CA 4DY7B 3GICB 2BDHA 3H7OA 2BY8X 4X8SH 5HIZA 3PWBA 2ZI2H 3CS0A 1HNEE 2HVXA 4RT1A 2YNAA 4FVBA 5EQRA 4MPXA 5AHGH 3PV2A 4XBDA 4DIHH 3SJIA 1OYTH 3F6UH 3A7TA 2CK3D 2SGAA 1GJ4H 1ESBA 3K65B 1MCTA 2AMPA 2TPIZ 1HJ8A 1PPHE 2Q6FA 1O2JA 1K28D 1XVMA 3HPTB 4GHQA 4LK4A 5I25A 1ELGA 7ESTE 1FPHH 1N1LA 1ZPZA 2RCEA 2PW8H 3MO6A 8ESTE 3DUXH 5JDUB 2VNTA 2HNTF 2A7HA 1E35B 2F9NA 1MQ6A 1IQNA 2ZO3H 1V2TT 7LPRA 5TCCA 1VCWA 5FPYA 1J15A 3GCNA 2J38A 2ZDMA 4BAQB 2A4RA 3RXDA 1PPBH 1YY3A 2V3OH 4K1EA 1RTFB 1ZSJA 1GHAF 1T8NA 1ZTKA 1GDNA 3FANA 2M2AA 1ANCA 1BB0B 2D2DA 3PMBB 4YOIA 4AN7A 4H42U 2WINI 2R2MB 3R0FA 1OS8A 3OAAD 3LJJA 3VB3A 1ETRH 4DVAU 1P0SH 1SGQE 1IQEA 1V2WT 1SHHB 2FDAA 3PV4A 4Y11E 4TYDA 1FIZA 1WV7H 2TGTA 2BD4A 1W7GH 5EG4A 1P8VC 4RKJB 1ELCA 1GHYH 1UK4A 1AHTH 1NC6A 1CT0E 2ZU5A 3F2GA 1YCPH 1NTPA 2TIOA 2R0LA 3GY5A 2SGQE 2XOKD 1SLXB 1EZQA 3S69A 1Z6EA 1IAUA 3T62A 3ZV9A 2K8IA 5FAHA 2Y5HA 3GDSA 3EDXB 2FYRA 2QY0B 3SNBA 1GJ5H 2ZDVH 3N99A 1P2OA 2P59A 1AO5A 3RXKA 2SNVA 1KXDA 1BT7A 4M7GA 4I32A 4WF8A 1YPHE 1BBRH 3NRLA 1DS2E 3SI3H 3MNCA 1UHBA 1IQFA 1UVOA 1PPEE 2FLRH 5SGAE 1NRNH 4MQAA 1HPGA 3CNRA 2WPKS 1IQMA 3GS9A 2XTTB 5DP9A 1IQIA 1GJCB 1Y3WA 4FETA 3A7YA 1QL7A 3PMHB 2RDEA 1YF4A 3M61U 1GMCF 2OTVA 1VJ9U 4KKDA 4RI0A 1V2OT 1JBUH 2OK5A 4ABFA 1EUFA 4TWYA 4IN1A 1A1RA 3B8JA 1MCVA 2JETC 3SJKA 1BCUH 1C1WH 2STAE 5HYOA 1D3DB 1A0LA 4YZUA 1X7AC 4ZAEA 3QUMP 3T27A 2XC4A 1HGTH 1WQVH 2ZGCA 1XM1A 1O3EA 1P9SA 3TGKE 3GCTF 2SGPE 1O0DH 1HV7A 3BTKE 1FAXA 2HRVA 3F0OA 4NGAH 2OLGA 3N7OA 1C4U2 4ISNA 5HGGA 3PV5A 1UVTH 4FU8A 2VH0A 3F9GA 4NIWA 2FS8A 1TAWA 2CXVA 2P3UB 2J95A 1ZHRA 4YXWD 2YOLA 4ZUHA 3GOVB 3L3TA 4NZQA 1SFIA 1C4V2 4D9RA 1SMFE 1DFPA 2B9LA 3SOSA 1ESAA 4E7NA 2HLCA 1NROH 4RN6A 3SORA 1C5XB 1P57B 2H9TH 2V6NA 1V3XA 3UUZA 1SG8B 1UTOA 3DA9B 3F0PA 4E05H 1THPB 2GCHF 3HATH 2G4TA 2ZGHA 3SI4H 1BIOA 3ENSB 3E91A 1O3NA 1O32A 3EYDA 1ZLRA 1ZRBA 1PFXC 4BAKB 4GHTA 1UCYH 1C4Y2 4HI3A 2YMSC 2BB4A 1GHZA 2UWLA 9LPRA 3RXQA 1ZRKA 2VJ1A 2AFQB 1MMJN 4K2YA 3P17H 5C94A 4K8YA 1GWAA 2W6JD 4MPWA 1FLEE 1BDAA 4SGAE 3V0XA 3KQCA 4CRGA 3GDVA 3SU2A 4B74A 1J14A 1HYLA 4CH2B 3MU8A 4CRAA 4ZXXH 4CRCA 4JZFH 4GPGA 3LC3A 3ZZ5A 3NPSA 3KQBA 2I6QA 1AN1E 3MMGA 2FM2A 1KMHB 3F9EA 2HVYB 2P3FH 5G4BA 3M37A 1IQHA 1MTVA 1TYNA 1W0YH 5KEDA 1C2LA 4X0WU 1LHDH 4X6PA 4YT6H 2BQ6B 1T4UH 5FBIA 1HUTH 1NFUA 4O03A 4BXWA 2OXSA 1E38B 3H09A 1W2KH 3O8CA 3A8BA 1Z7KA 1HXEH 1WSSH 2ZU4A 1CSOE 1P12E 1GHXH 2ZPSA 2YMSB 4ABEA 3DSPA 1AQ7A 2A5AA 4TY7A 1CBWB 4OM9A 1GJ8B 3TU7H 1O3JA 1ESTA 1A5IA 1DY8A 1H8DH 1ACBE 4F48B 2PUXB 1TQ0B 1AE5A 1GVLA 1SLWB 1OWJA 3ATKA 2FPZA 1BHXF 3TGJE 3MNXA 3ZIAD 1Y5UT 2Z7FE 2H5DA 1OOKB 5HMAA 3SV9A 1OWKA 2F4LA 2W5EA 1K1LA 1KXEA 3D49H 2C4FH 3PMJA 2BXTH 1L2EA 2UUFB 3B23B 3BEFB 4YO9A 1C2HA 5L2ZH 2VH6A 4KP0A 1C5LH 1MTWA 3KCGH 1GG6C 1NRRH 1TNJA 2O8UA 3SU3A 2F9VA 2VIVA 4WMEA 2AIPA 1ZYOA 5EJ1A 1LQEA 3SNEA 4ABDA 3VB4A 1K1NA 4DT7B 1LCYA 3JZ2B 5TCAA 1GCDA 1P06A 3A7XA 2BD3A 2P93A 1A2CH 2ZHQH 4J1YA 5T6GA 3DSGA 1ELEE 2PKSB 1NRQH 4IC6A 4BAHB 1K1MA 2QN5T 3MWIU 2WPLS 1LQDB 2ZPQA 3TITA 3M3VA 1H8ED 4KTCA 4I8GA 2ZU1A 4CRBA 1O2WA 1J9CH 1DXPA 3SUEA 1NN6A 2JDID 2A2XH 4XBCA 1G37A 3SN8A 3KQ5A 1DOJA 2D26C 1BTUA 1VR1H 8GCHG 1D3QB 2FOAA 1MU6B 2UUJB 2V7QD 1RTKA 2FTLE 3RXLA 1BTWA 3FAOA 4MPUA 5LPFA 1HAXB 1CE5A 1TFXA 2Z9KA 1SI5H 3PYHA 2J94A 2FX4A 1JXPA 1P2QA 1GJBB 3GY4A 4HTCH 2QE7D 1BJUA 1PQ8A 1MBMA 2BTCE 1GI5A 1LPZB 3PO1B 2CN0H 3OX7U 1SGPE 3PTNA 1KY9A 1P2NA 3A7WA 2OC1A 1TGBA 1S82A 1PQ7A 2HALA 2ODYB 2FLBH 2STBE 1HAVA 2Z9GA 3ZZAA 3URDA 1F0SA 1H9LB 3ZZ8A 2QF0A 1NY22 1PPCE 1D6WA 3LT3A 1O2RA 3STJA 1E1RD 1ZTLA 2ZZUH 3UPEA 2VWOA 3ZZDA 1OXGA 3RXTA 1A3EH 4JMYA 1GBHA 1KYNA 2ZTZA 1NFYA 4Q7ZA 2R3YA 3Q3YA 1AI8H 2XBVA 2QXHA 1XKBC 4MNXA 5C3NA 4XDEA 2V35A 1NS3A 1TABE 3ZVGA 2PKAA 3A83A 3TVJB 2G81E 3LJOA 1D3TB 1VITF 1MAYA 3RMOH 1EZXC 3BSQA 5CDFE 1ZPCA 3EE0B 1N6YA 2EY4C 2GZ8A 4NSVA 3ZZ6A 5LGOA 1K1JA 1MKWK 4NSYA 3RC6A 5E0JA 2R9PA 1GJAB 3KF2A 1V2UT 1RJXB 2VWMA 2KAIB 1CA0B 1E79D 1YKTA 1CO7E 5C5OA 1DWDH 2W6ID 4D7FA 1TX7A 1W7XH 4K1SA 3ZZCA 4K3JA 1QA7A 2Y6TA 1SGEE 1EPTB 1OPHB 2BX4A 3K6YA 3QGJA 1NO9H 4AOQA 2XXLA 3I78A 1BTXA 3OY5U 7GCHF 3TPIZ 1F92A 5GNDA 3U8TH 4WWYA 2XNIA 4TT3D 4IMQA 4XE4A 3BG4B 2Z6BD 1TOMH 3RM0H 3HK3B 1YLDA 1ZTJA 3U1IB 1O3IA 2ZGXH 1SFQB 3UOUA 2QXIA 2O8WA 2HNTC 3DT0H 5C1UA 3ATIA 3TK9A 3SYJA 1QURH 5LPRA 3BEUA 2QF4A 4UDWH 1AD8H 3UB0A 2RDLA 5B6LA 2R0KA 3TNSA 1TNGA 3A89A 2C93B 4Y79A 3U69H 3FFGA 1SKYE 2K0QA 1DM4B 3AAVA 2B8OH 3HKIB 2OBQA 1Q31A 2Z9LA 1EPTC 1RGQA 2QYIA 4VGCB 2ZCLP 4WMDA 4BXSA 1UK3A 1GVZA 2QXJA 3A7VA 5DJ7A 1GL0E 1O2TA 2AS9A 4Z0KA 3GY6A 4YT7H 2D1JA 1NU9A 4O3TA 1SOTA 1AB9B 1D3PB 2GZ9A 3STIA 4ZH8A 1QRWA 5AFZH 3T28A 1GDQA 1DUAA 1Q3XA 3T29A 4FUHA 3RU4T 1YLNA 4ISLA 2XCFA 1IQKA 4DCDA 1IHSH 2BX3A 1XUGA 3UWJH 1GI2A 1LMWB 1NT1A 2IJOB 6CHAC 1EJAA 1DWBH 4BNRA 1CT4E 4LZ1H 1QY6A 3PRBA 4XD7D 3SU6A 3A84A 4B6EA 2B5TB 4O3UA 2NWNA 2BDGA 1DWEH 2H6MA 2F9BH 1HB0B 1YLCA 5AFYH 2PSYA 4LXBH 4MLFB 4CBOA 1WDIA 3AW0A 3TJOA 1DUEA 3MYWA 2C90B 4ZKSU 1WAYB 5IK2D 1GJDB 1TX6A 2ODPA 2AIQA 1QTFA 3I77A 1WQSA 4Y8ZA 1DSUA 1VITG 3RXRA 2BMGB 1DWCH 3NZIA 1C2JA 2QAAA 1AFEH 2JH6D 2HWLB 1C5RA 5F8ZA 1WUNH 4B75A 1TOCB 1P05A 4X2WA 1UJ1A 3IWMA 4UFFH 1VJAU 2Y7XA 1V2PT 1NBMD 3VPKA 2F9OA 2Z3DA 2J4IA 4FUFA 1F7ZA 1G3EA 2BDCA 1O5GH 3BF6H 5A8XA 1D6RA 2FP7B 2OBOA 4U30A 3RLWH 1H4WA 1QNJA 1MAXA 1JMOH 1ZJDA 2VIPA 1GMHF 2ZNKH 8LPRA 3PMAB 1DANH 3N7DA 1C2GA 3KGPA 2ZG0H 3ZVCA 3ZV8A 4CHAB 1V2ST 2XCNA 1TE0A 2GT7A 3E0PB 4OS1A 1GMCG 1LKAA 5DP4A 5TJXA 1ANBA 5EPNA 2K1QA 3BG4C 1GI6A 3VB7A 1O3BA 4JK5A 5JBTA 4VGCC 1C1MA 1S6FA 1SGCA 1B0EA 3GDUA 3P8NA 3A85A 1UVSH 1JOUB 3TK5A 1GI8B 1FONA 3C1KA 3QX5H 4YOGA 4BTIB 2ZGBH 2XYAA 5HM2A 2C8WB 4B2BA 4H6TA 1FI8A 3HGPA 5DP8A 1UTJA 2XBWA 4Y8YA 3RC4A 5ESBA 1SBWA 1FY4A 1M9UA 2A7JA 1C1VH 2ZHFH 1OWEA 4OS2A 4TPIZ 1WYKA 3JZ1B 3DFLA 1HFDA 4AGKA 3ZZ3A 9ESTA 1K9OE 4XSKU 2F9UA 4JCNA 3MTYA 4Y0ZE 4WVPE 5CMXH 4AYYB 1AFQC 5FXLA 3OEHD 3O8DA 3SJ8A 1A7SA 4AZ2B 3U1JB 1SLUB 2FXRA 2Q1JA 5BPEA 1SQRA 4MDSA 1G3DA 1T8OA 1O2SA 2ZEBA 2VBCA 4NIYA 2WZQA 5C1XA 4GAWA 3DD2H 1L1NA 1MQ5A 5EW1H 2QXGA 1CA0C 2SGEE 2NU2E 2ZC9H 1COWD 4MNYA 4NA9H 1Y5AT 1DPOA 2A2QH 4B2AA 4ABAA 2ZKSA 1Z8IB 1QJ6B 1EFRD 1TLDA 3A88A 1UTMA 3RXBA 4BANB 3UR6A 1KLTA 1QQUA 4B71A 1WTHD 3V3MA 3SU5A 5DN6D 1BOQA 4K69A 4IS5A 1B7XB 2H2ZA 2WPDD 1YPKH 1QB1A 1YCPM 2BLWA 3KN2A 5KGOA 5DP3A 3PO1C 2M5TA 1F0RA 1SVPA 3RXMA 5EXLA 1LPGB 2OC0A 3LGIA 2VWNA 3SBKA 5C0UA 4RKOB
chains in the Genus database with same CATH topology
4JZIA 2GMTC 2ANKH 4GSOA 1TIOA 3BTQE 4Y10E 1YP9A 1XXFA 1S0RA 1WTGH 1CA8B 2FIRH 5GWZA 1C2MA 1TRNA 1QB6A 3UFAA 2Y80A 1TRYA 1MZDA 4TWWA 3RMNH 2TGDA 1FZZA 3ESTA 4JYVH 1GCTB 1QBOA 3D65E 3QWCH 4FXGH 1D4PB 5J4SA 2FOFA 1V6DA 5JPMH 1BITA 1ANEA 3UQVA 3I29A 1C1UH 3FZZA 1L1JA 2VVCA 5DPAA 2UWOA 1TA6A 1MTNC 2ILNA 2ALVA 2VINA 3SV6A 3ZVFA 1BRAA 2CF9H 1TBRH 1DXWA 1GBBA 3U98H 1QL9A 1GI7B 2GV6A 1EQ9A 1BMAA 1GBKA 1ID5H 1MTUA 2JKHA 2CV3A 2BY9X 3A7ZA 4R0IA 2BYAX 3E0NB 3GCHC 1UCYK 1JIMA 4K5ZA 4CR5A 1O39A 2F9PA 3SGAE 5I46H 1O3HA 2QV1A 2ZFSA 3EQ0H 3ZVAA 4AFUA 2VIDA 2OCVB 1QFKH 1C1OA 5FPSA 3UNRA 3SV8A 1HAYB 2ZCKP 3RXVA 3GCOA 4FUBA 4ZROA 5F8TA 4IMZA 3F68H 3BTTE 4ZKRU 3SUGA 3S9BA 1BHXB 4OS7A 1UTLM 3LGTA 1RXPA 1TNLA 3U8RH 2FI4E 3M5NA 1Z8JB 3GYMA 1QGFA 3GYLB 3RXIA 2EA3A 3TLOA 3GY7A 1P10A 1BTPA 1EAWA 1NM6A 1BTHH 4X2VA 1TMBH 1QA0A 1KTTB 4RSPA 2LPRA 2D8WA 3BTWE 3Q00A 3M7QA 3S7KB 3OU0A 4X1RU 1PPZA 2G8TA 1O3OA 1NFXA 2ZA5A 4FUDA 5FCKA 1TGCA 1FDPA 4AFSA 4WH8A 1KIGH 1P2IA 4LZ4B 1GJ7B 1O2XA 3CENA 3P8FA 1TGNA 5EOKA 3NWUA 2ZFPH 3A8AA 4WH6A 5AVDA 2ZU3A 4XOJA 1KDQB 2A4QA 1V2JT 5FHTA 3K2UA 2DE8A 4D8NA 1HLTH 3U9AH 2XBXA 3E8LA 6LPRA 2Y81A 1Y59T 3BTGE 1C5WB 2ZFTA 3SNAA 3TJVA 2BY7X 4X1QU 5JBAS 2H9EH 3GISB 3CP7A 2FOHA 3SNCA 1ZZZA 3T5FH 2J34A 1F0UA 2A7CA 1T8LA 2FMJA 1K1OA 2OQ5A 4R8TB 3P92A 1SQTA 1ARCA 2C8YB 5GCHG 3SQEE 1A3BH 3KQEA 3EAJA 1J16A 2BZ6H 1G3BA 2BQWB 6ESTA 1YPJH 4MNWA 1MKXK 2C8XB 3Q77A 2GTBA 1NESE 1H1BA 3S9CA 3L6PA 1O30A 4ZHAA 1GBJA 3E16B 3SNDA 1AKSB 4CH8B 1EAUA 2ZECA 3SV2H 5GJ4B 3QLPH 3ZYDA 2RA3A 4NWKA 2GCTB 5C67A 3QZRA 4X6MA 1KDQA 1MUEB 2R3UA 1O2YA 1A5HA 1TNHA 1BRBE 2H9HA 1Z1JA 2BVRH 2P94A 4WJG2 4ABJA 1HAGE 5K7RA 3MU0A 2XW9A 3P6ZB 2FOGA 2CF8H 2A4GA 3A8CA 1P2KA 6CHAB 4Q80A 2GVFA 1OSSA 4NG9H 1HAHH 1YYY1 3LKWA 4I31A 4Y8XA 3RXFA 2GDEH 4ESTE 1FAKH 1MKWH 4THNH 4A1TA 1YC0A 5LPEA 2ANWA 1L4ZA 1PQAA 5C5NA 4ZKOU 1TB6H 2ALPA 3H7TA 1DDJA 1C1TA 3M5OA 5EW2H 4UONA 2FYQA 2XC0A 2PUQH 4I8LA 2FX6A 2HOBA 1O3AA 4O97A 1L0ZA 1O3KA 4GLYA 1ZGIA 2ZGJA 3SHCH 3PLPA 4WXVA 1L1GA 1K1PA 1XVOA 2SGDE 1EZUC 3SJOA 1YBWA 1ZHPA 4IBLH 4X6NA 1G30B 1TX8A 1ZMLA 2ZDKA 2AEIH 2FI5E 3A81A 3QK1A 2BDAA 4U2WA 3GY2A 5E2PA 3M7UA 2CHAC 2A1DB 1GBLA 2BY6X 4B76A 1V2MT 4I8KA 3T2NA 5F03A 4B73A 1U6QA 5IDKA 1CVWH 1INCA 3Q3KA 3AASA 1UTNA 3BTHE 3ZVBA 1O3FA 1O37A 1FQ3A 3LONA 3PM3A 2ASUB 2CHAB 1P04A 1T31A 1YPGH 1FY3A 8KME2 1GJ9B 3QO6A 1GBCA 4NIXA 1O34A 2IN2A 2WPMS 4ISHH 1WBGB 1LO6A 1LVYA 2PTCE 3S9AA 2BLQA 2HPPH 1FY8E 1RRKA 1UTKA 2UWPA 1G2LA 1O2LA 1BRCE 2ZFFH 3RXUA 2OUAA 4ISIH 1CU1A 2B0FA 2A45B 2BLOA 5DP7A 3R3GB 2VB0A 2WPHS 1Y3VA 1W14U 1H9IE 3RXOA 2BVXH 1A46H 1O2NA 1V2NT 2F3CE 1GHWH 3QDZB 5EPYA 4I8JA 2AERH 1LPKB 4Y76A 1LKBA 1KLJH 4E06H 5EODA 3S0NA 1BRUP 2NU3E 2ZQ2A 3HKJB 5EXNA 3A82A 1GHAG 1O5AB 5DK1A 1K2I1 1ZHMA 1YPMH 2G52A 1TMTH 2JH5D 1JRSA 4K60A 1H9HE 1OP8A 1TQ7B 3BTFE 3K6ZA 1DVAH 2WPIS 4UFGH 1EXFA 4X8VH 2BD2A 1G9IE 3VB5A 2BOKA 1E0FD 4Y0YE 1K21H 3M3SA 1TWXB 4ZHMU 1BBRE 4K8BA 3K9XB 1XUIA 1SSXA 1O35A 5FX6A 1PPGE 2FESH 1ZJKA 4WXIA 1AWFH 1Y3UA 3BN9A 2WV5A 4FU9A 4YM9A 1OP0A 3KQDA 2GKVE 2HPQH 2P8OC 1HBTH 1MH0A 5C2ZA 1O2MA 1C1QA 3RLYH 3KEEA 2ZHDA 4ZMAH 1UO6A 1BMNH 1FXYA 2FOCA 1AU8A 1EB2A 4BOHA 1OYQA 3RP2A 4DOQA 1D9IA 2ZCHP 2P16A 3PLKA 4U32A 1Y8TA 2ZTYA 4INLA 2GZ7A 3MHWU 1OWIA 2W3KA 3RDZA 3OYPA 4X1PU 1XUHA 6GCHF 3URCA 5ETXA 3PTBA 2YNBA 1MD8A 1B5GH 5PTPA 1TPSA 7KMEH 1BBRK 2GCTC 2G5NA 1MU8B 2SGFE 3WY8A 1Y3XA 2PTNA 3VB6A 2ANYA 1C2EA 3MU4A 1AWHB 4I8HA 4X2XA 1G32B 1O38A 1EJMA 1S84A 3HK6B 3RU4E 3P95A 1UTPA 1AKSA 3M5MA 4UD9H 3UNQA 4YLQH 1LDTT 1UVUH 5GDSH 2Y82A 3TH4H 5GXPA 1P9UA 1EX3A 1DICA 2VVVA 4Y7AA 1WOFA 2GV7A 2I6SA 1XX9A 1C2DA 2WUCA 3ZZ4A 3Q76A 1O3DA 4UFEH 1KTSB 2Z9JA 3MH7A 2J2UA 4Q2KA 3PLBA 5T6DA 5CHAB 3RMMH 1GVKB 1IOEA 2H5CA 3HGNA 3QN7A 2VWLA 4NFFA 3VFEA 2A5KA 1YGCH 1FUJA 3UQOA 5K0HA 1C1NA 2V0BA 2RG3A 2Z3EA 1V2VT 1ARBA 5T6FA 3V13A 4X8TH 5E2OA 3VEQB 2UUKB 3ATMA 1Z8RA 4XFQA 3LIWA 1GBFA 2ZDLA 1QB9A 1S0QA 4IN2A 1FNIA 3LDXH 3VXFH 2VU8E 2CJIA 1SR5C 3RMLH 1AY6H 1HJAB 3E6PH 2LNCA 2G00A 4YLUA 2BD7A 1SHYA 5DO4H 4FUIA 2QCYA 2BDIA 3RXGA 3PB1E 2G5VA 4KTSA 4FUEA 3GCHB 4WMFA 1K1IA 1C5YB 3ZYEA 1VGCB 3O8RA 4IC5A 4AG2A 4YOJA 2SNWA 1EOLA 1F2SE 3F1SB 1CHOG 4GCHG 4JYUH 5JYIA 3LOXA 1TPPA 3SGQE 4NA8A 1BMMH 2PWXA 1MBQA 2BZAA 5E0HA 3TIUA 3BG8A 4BTUB 4KGAA 1Z71A 1C2FA 3UTUH 3QZQA 4I33A 1MTNB 1P2JA 4MG3A 2TRMA 2R2WU 1UVPA 1O2VA 1PPFE 4XBBA 1K22H 1YM0A 2ZU2A 1O2HA 3M36A 4KTUA 1O5BB 1KXFA 1GI3A 3GY3A 1O2ZA 4A6LA 4BAOB 2C3SA 3NUMA 1O2GH 2AGGX 1GBIA 2VGCC 1O2UA 2BM2A 5FBEA 1W0ZU 2TGPZ 1AIXH 1DLEA 2A5IA 1VGCC 1ABJH 3FP8E 3SHAH 1A4WH 2HGTH 1OWHA 2GD4B 1UCYE 5EQQA 3QTOH 3KNXA 1NFWA 2EI6A 1C5PA 2GT8A 1DT2A 1W11U 4CRDA 1XUKA 2G51A 3LGWA 2OQUA 3MFJA 1FN8A 1QCPA 5A09A 3LPRA 1DY9A 2CMYA 1P01A 3T26A 1C9PA 1XUJA 1UHBB 3MNSA 4AFQA 4I7YH 3RXJA 4A5TS 1RIWC 3M5LA 5HM9A 1BQYA 1GMDF 2FOEA 5F6MA 2ULLA 1MD7A 2AMQA 1EPTA 2EI7A 3UY9A 1ZOMA 2AGEX 3RXHA 1QL8A 3EA9A 2XRCA 2A4OA 4TY6A 4HGCA 1YCPK 3P8GA 1GJ6A 1GMDG 4JYTA 3C27B 4FUJA 5BRRE 1O3MA 2Q6GA 4CHAC 4IW4E 1SOZA 3BTEE 3DHKH 1AVXA 1FJSA 5JBCS 3KIDU 3ZVDA 1PYTD 1GDUA 3ODFA 2PFEA 3SV7A 4AFZA 1ZPBA 2PHBA 5GCHF 1W13U 4O9VA 1C5TA 1ETSH 4AYVB 3UREA 4CREA 2ZDNA 1NPMA 1SPJA 1ZSKA 4FU7A 4PROA 3SO3A 1CHOF 1LVBA 1YPLH 3ATWA 1S6HA 4ISOA 1OWDA 3M35A 2ZWLH 2RA0A 2XWAA 4CRFA 3RUOA 1RD3B 1HAPH 2THFB 1O2IA 5GIBA 3ATLA 4DIIH 2Z94A 4IGDA 1S83A 2ZHEH 2O8MA 1C1SA 3CS7A 1EP6A 4AG1A 1KXBA 2PSXA 5A2MH 3TJNA 1IQGA 1O2PA 3MO3A 1GI4A 3M7TA 4Y7BA 1ORFA 2OP9A 5F8XA 4MVNA 2IOTA 1WU1A 1LHEH 2GX4A 1DSTA 1ELFA 1DITH 3V7TA 1TMUH 1RFNA 4F49A 1N8OC 2BD8A 1XMNB 4ABHA 4AB9A 2P8OB 1MKXH 2PGBB 2AMDA 1GHBF 3KL6A 4NA7A 1NU7B 4K1TA 5GPIB 1S85A 1ELVA 4F4OC 2P95A 3SU4A 1V2LT 2GGVB 2PKAB 2A31A 2BD5A 4UE7H 2V3HH 1C5UA 3LH3A 2Y5GA 2W26A 5FPTA 3ZZ9A 1P11E 1EATA 4X2YA 1SGTA 1UTQA 1BA8B 1C5QA 1SGRE 1LHCH 1GHBG 4INHA 1EOJA 2WPJS 3KHVA 2JETB 3RXPA 4DJZB 4Q7XA 2J9NA 2HNTE 2KAIA 4AB8A 2WV4A 4OGXA 3MI4A 1AMHA 1Y5BT 3E90B 5JBBS 1ELDE 2A32A 3OY6U 1HIAA 5AF9H 3UIRA 1T32A 1VCQA 4CR9A 2WYGA 1C5NH 1THRH 1JRTA 1HAIH 2OD3B 1N8OB 4Q7YA 4UEHH 1BTZA 3H5CB 1SQAA 2GCHG 5J4QA 1LVMA 3RC5A 4AX9H 2BDBA 1EAIA 2ZP0H 1AUJA 1E37B 3OTJE 3PROA 4MNVA 1LVOA 4FUGA 4U01A 2FS9A 4E7RG 1O5CB 1XKAC 1ZR0A 3LC5A 1FIWA 3UWIA 3SZNA 3SJ9A 1GGDB 1CGJE 1F5RA 1SGIB 4INKA 3RXSA 3SW2B 2DE9A 1XUFA 3F9HA 5A0BA 2F83A 4D9QA 2OC8A 3FP7E 4A1XA 3MNBA 2WYJA 1GHVH 2WUBA 3B9FH 1TBQH 2NU4E 2P3TB 3O8BA 5H4IB 1QRZA 1THSH 3BV9B 1WCZA 3DFJA 3S7HB 2FOBA 2O9QA 1TNKA 1O3LA 5ABWA 2AH4X 2QIQA 2W7SA 1C5OH 1HCGA 4MPVA 1C5VA 1FY5A 1GBTA 2G4UA 1VZQH 1ANDA 3QTVH 2PR3A 1O5EH 2VIQA 1ELBA 3MU5A 1P09A 1HAOH 1A5GH 4D7GA 1AE8H 1V2QT 1SGDE 2C8ZB 2VIWA 8GCHF 1QJ7B 1SGFA 2Y7ZA 1TALA 2JH0D 1TNIA 3BIVH 3GY8A 1O2OA 4FUCA 1NRSH 1O5FH 2Z9IA 2FO9A 6GCHG 3TH2H 1AB9C 2TGAA 4GCHF 4CBNA 1F5KU 3G01A 4H6SB 3SU0A 3TJUA 3BEIB 3MH4A 1FN6A 1CT2E 3BIUH 1L4DA 1F0TA 5DP5A 5LH8A 1CQQA 2IPHA 4A7IB 2BD9A 1RIWB 2FEQH 1EJNA 3NXPA 1ABIH 4JZEH 2BLVA 2O8LA 3M3TA 3NCLA 4TPYA 2ODQA 1C5SA 4NIVA 1AVGH 1VITH 1QIXB 4JZDH 1Y3YA 2Z3CA 2F91A 1J8AA 2NU1E 1QRXA 1TPOA 3EGKH 3LU9B 4DW2U 1H8IH 3RXAA 1CHGA 3NKKA 2BOHB 1LHGH 1AVWA 1XXDA 4JZ1A 4ZHLU 3TK6A 2VGCB 5A8YA 1QBNA 2DUCA 1BJVA 3A86A 4WY3A 2XBYA 1O5DH 4B2CA 5A8ZA 1HRTH 1AZZA 1P02A 7GCHG 5T3HA 5EXMA 1HDTH 2AGIX 2QF3A 1T8MA 5CE1A 2SFAA 2Q6DA 1ZSLA 1QHRB 1C9TA 4NCYA 3MOCA 1VCPA 4X8UH 1C2IA 4ZKNU 3AAUA 2ZFRH 1GBDA 1B0FA 1S5SA 5E8EH 3E3TA 1BTYA 1SC8U 4Y71A 3SGBE 3ZZ7A 5ESTE 1C1RA 2AYWA 2GDDA 1DE7H 4BAMB 1O2KA 3UOPA 1O3PB 1GG6B 1AUTC 1HJ9A 2FZZA 2PGQB 1P2MA 2QGRA 2W3IA 4Y6DA 1OKXA 1S81A 1O2QA 3LGVA 1O36A 1OX1A 3PWCA 2EEKA 2BDYA 1E34B 2QC2A 4A1VA 3RU4D 1BMLA 3VGCB 4NWLA 4OS6A 1NRPH 4HZHA 4A92A 2OC7A 1EAXA 5DGJA 1O3CA 3RXEA 1GI0A 5C20A 1HJAC 4X1NU 1SGYE 1W10U 2A0QB 1O3GA 4KELA 5L6NH 1QJ1B 2ZTXA 1W3CA 5DKMA 5IYTA 4DGJA 2BY5X 3ODDA 4LOYH 1CBWC 3F9FA 4OS5A 1AGJA 1Z1IA 2ZPRA 4X1SU 1MZAA 2OINA