1Q31A

Crystal structure of the tobacco etch virus protease c151a mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
227
Chain Sequence
b'LFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEMNELVYSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear inclusion protein A
publication title Crystal structure of tobacco etch virus protease shows the protein C terminus bound within the active site.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein, hydrolase
total genus 52
structure length 227
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A02
4X1RU 2K1QA 1DWCH 1E34B 4FUHA 2Z9IA 2XC4A 1K1NA 4FU9A 3AASA 1TNKA 5IYTA 1KLIH 4CREA 1CA0B 1ETTH 5ABWA 4K1SA 4UFDH 2NU0E 1LHCH 3A84A 1GMCG 1XUKA 1MMJN 1DANH 2V3HH 4JCNA 1TRMA 1F0TA 1K1LA 1O2MA 1XUIA 1FN8A 2FX4A 3C1KA 2OD3B 1K1OA 3BEIB 1GCDA 2ZIQH 1LQEA 5A8XA 3B23B 1C1WH 6CHAC 1GDUA 1O5GH 1C5WB 1C2DA 3SV6A 4YOIA 1MQ6A 8GCHG 1IOEA 1GHWH 4INHA 1UCYH 4K5ZA 3LGVA 3QX5H 2C4FH 1UTKA 2AIQA 1GCTB 4UONA 1HUTH 3TLOA 3LPRA 2A4OA 3UOUA 1GJBB 2BYAX 1QB1A 2BLOA 3LGWA 6GCHG 5F03A 1O39A 2G55A 4WXIA 4ABEA 1ZLRA 1P12E 1ZMNA 3GY3A 4IBLH 3HGPA 2ZHWH 1J14A 4NG9H 2ZFTA 2PKAA 1O3FA 5J4SA 5GWZA 3EQ0H 1S0QA 4CR5A 3G01A 4AFQA 5E0JA 1GI2A 2PKSC 2FX6A 3GOVB 3RXJA 1EZQA 1L1NA 1TWXB 2Z9JA 4AYYB 4AB8A 2UWOA 1BMAA 2Y5GA 1YPKH 2FOHA 3RXTA 2ZTZA 5F8XA 4KP0A 5EPNA 1ZSJA 2ANYA 1P2MA 1GJCB 5C5OA 2B9LA 5AVDA 3UQOA 3A7XA 3NPSA 1J8AA 3GYLB 2QC2A 3NZIA 4FVBA 1BTYA 1KXDA 4INKA 1CT4E 2HWLB 5JB8S 1O3NA 1D6WA 3VGCC 2NWNA 4YLUA 3Q3KA 2CV3A 2BHGA 5E2OA 4Y7AA 3VXFH 2FIRH 4A5TS 1TGSZ 3BTDE 3UREA 1IQKA 3IG6B 2ZDAH 5I25A 1GHBF 1O5DH 1YP9A 2AGIX 1MQ5A 2XXLA 1CBWC 4NZLA 1BB0B 3Q00A 4ISNA 2H9EH 1ELBA 1F5KU 2FOGA 4B2CA 4X1PU 1G3CA 3VB5A 1O2HA 1QBOA 1CT2E 1YF4A 1V2RT 1MZAA 3ZVFA 1A0HB 2YNBA 1C1SA 4NIWA 3ZZDA 1GMDG 3S9BA 1NRSH 3ZZBA 1SC8U 4XE4A 5DJ7A 3RXSA 2OUAA 2VWMA 4CRGA 2ANKH 5T6DA 5SGAE 1ESBA 3S7KB 3H5CB 3MNXA 3RM2H 1UHBA 5LPRA 1RXPA 4AOQA 4B2AA 2THFB 1JRTA 1Q31A 3GCHB 1HB0B 3AAUA 4BAOB 4E05H 1TNHA 3FAOA 2J9NA 3M7QA 4HZHA 1B5GH 1NO9H 1KSNA 2ZHQH 4XBCA 3FANA 1GBEA 2BY5X 2JH5D 4OS5A 1UTNA 1SGYE 3M36A 4DIHH 2HPQH 3SNAA 3UWIA 3SN8A 1GBTA 1SLWB 3RLYH 2XCFA 2FLRH 2ZWLH 1P2JA 3KQCA 5A09A 1XUJA 3VB7A 1ANCA 1WSSH 3UNQA 2BXUH 2A45B 4X6MA 3SHAH 2OBOA 5HGGA 2AGGX 3A85A 2VVCA 3RUOA 3K6ZA 2CF8H 2BQ7B 1Z8JB 1YPGH 1TPSA 2XCNA 1Y59T 1V2ST 2IPHA 3GCTF 2FOEA 1TAWA 1YM0A 1DE7H 1YPHC 2FMJA 1JIMA 1DY9A 3KQDA 3K9XB 2ZCLP 5FPYA 1A5HA 3NKKA 4K8BA 1AUTC 2HPPH 1QL7A 4IN1A 3JZ1B 1AU8A 1O3HA 3Q77A 2A0QB 3AAVA 1BJUA 3KEEA 2Q1JA 3BG8A 3SQHE 1QFKH 1W11U 1TPPA 1CU1A 2VGCC 3KGPA 2PW8H 1GHVH 1MKXK 1P2NA 3LC5A 1UTLM 4FUJA 1FJSA 2XWBI 4I8GA 1TALA 1O5BB 1UVPA 4WVPE 3ZZ4A 1IQGA 5A0AE 3M7UA 4AGKA 2J92A 2ZU2A 4OS6A 5AFZH 3OTJE 1P0SH 4H6TA 2FXRA 2EI8A 5DP7A 1SOZA 1O31A 4X2XA 3MNCA 2GKVE 4CHAC 3IWMA 4VGCC 1C4U2 3OY6U 1OWKA 4IGDA 1TQ0B 3PYHA 3M5NA 2OC1A 3VB6A 3PTNA 4X8VH 1SGTA 2ZECA 3T5FH 2FS9A 4FU8A 1NFWA 2O8LA 3PLPA 3TH2H 5HM9A 5EGMA 2Z9LA 3PO1C 1EAUA 1O3OA 3SW2B 3EYDA 2PSYA 1Z1IA 2FYRA 3A88A 1F0RA 1H9LB 2FTLE 3B8JA 4DIIH 3SJKA 3PB1E 3SHCH 1X7AC 3SUDA 3R0FA 2VH6A 1TA2A 1Z8RA 1SGQE 2A31A 4B74A 5IDKA 1NS3A 1O0DH 4FUIA 1SR5C 1GHZA 1K1IA 2IN2A 3M37A 2CMYA 3BTKE 1D3TB 4GVUA 2FP7B 1KXCA 3ZZ7A 1XUFA 1O32A 5C20A 2P3UB 1O34A 2R9PA 3I77A 4BAMB 1AIXH 2G8TA 1BA8B 5FCRA 1G9IE 2QV1A 3TK5A 1Y5AT 4X1QU 1FDPA 1S85A 4J1YA 2FOCA 3JZ2B 2ZO3H 3T62A 2HLCA 4CBOA 2BQ6B 1TX8A 1EZUC 1HAIH 2J38A 2RA0A 1N6YA 4ZXYH 1CQQA 2GDEH 1TYNA 3SJ9A 4X2VA 1GL0E 3RXLA 4DG4A 1K1PA 1LHFH 5T3HA 4ABBA 1O2NA 2J2UA 1ELFA 1XKAC 4ZKSU 1DT2A 1FV9A 4Q80A 1C2HA 4B76A 2GV7A 4K8YA 1RTKA 2PSXA 4O9VA 4B1TA 1DUAA 1RIWB 2HNTF 4Y71A 1V2WT 5GIBA 5EW2H 2Y81A 1KXEA 1GJ5H 1ZHRA 4JZDH 5E0GA 3SU0A 2STAE 4GAWA 2WV4A 1CSOE 4ZHLU 2FTMA 1NN6A 4X1NU 1RTLA 1OWHA 2ZU5A 4I31A 1ELVA 1BRBE 1UTMA 3HGNA 5ESBA 5FCKA 1A7SA 4IMQA 2AMDA 1O3KA 4IC6A 1TONA 3TIUA 1P02A 5DGJA 3T27A 1A5GH 3TNTA 3EDXB 3A7VA 3LC3A 3VFEA 1YLCA 1GJ8B 3LH3A 1FY1A 4HTCH 3URDA 4MPVA 3SGAE 3ATIA 1SGFA 2VIWA 4KTSA 3QZQA 1BBRE 1MTVA 1TNJA 2XC0A 1O2TA 1SL3A 1GI8B 1W0YH 2DE9A 2W26A 3ZZCA 1SI5H 2QN5T 5LGOA 1NESE 2OXSA 1FMGA 2G4UA 2OC0A 3SUEA 3SV8A 1CO7E 4IC5A 1A46H 1TBZH 2ZTYA 3RMNH 4RKJB 5L2ZH 4XSKU 1HPGA 1O2RA 1ID5H 3MU0A 3PV4A 1C5MD 2BY9X 4TY7A 1F0UA 3ZYDA 2SGFE 1QGFA 2XBVA 5EOKA 3RXQA 2TGPZ 2P8OB 4BAKB 1O36A 4NA9H 2XW9A 1XVMA 1C4Y2 1NRNH 9LPRA 2Z3CA 3RM0H 3SV7A 3URCA 3RMMH 1PPBH 2Z9GA 2TPIZ 1AQ7A 3A80A 3BTFE 1YPHE 1BTZA 1LPGB 4K60A 1P2KA 4WXVA 1ELEE 1WTGH 3U8RH 1FPCH 2Y80A 1HAVA 1CE5A 4R0IA 1A3EH 2ZU3A 1O3BA 4J2YB 4NA8A 3PMAB 2NU1E 1QRZA 3CENA 3QK1A 4ABGA 3M35A 4D9RA 2BDCA 4HI3A 4U32A 1G3BA 1G32B 4ISOA 1QBVH 1IHSH 3ZVAA 1ZPCA 4CBNA 1V2QT 3S0NA 4X2YA 2O9QA 1LHEH 3M3TA 5EXNA 7ESTE 1J17T 1Z8IB 4ISHH 1AWFH 1AVXA 1MTSA 1YPLH 5FX5A 1IAUA 2VWNA 3AVZA 3LOXA 1ZTKA 4ABIA 2CXVA 3F6UH 2XTTB 1BRCE 3ODFA 4MPXA 3FZZA 2Y6TA 1A2CH 1V2PT 4UE7H 4DCDA 3NK8A 3DD2H 4Y8XA 3FP6E 1NRPH 1ZMJA 2ZEBA 3BTTE 4Y6DA 1G2LA 3F68H 2G5VA 1TX6A 4CH2B 1ZTJA 1GG6C 3RDZA 3TK6A 4NFFA 1HYLA 1O2UA 4GCHG 1GBLA 1QHRB 1RGQA 3RXKA 1DWBH 3KF2A 1J9CH 2V3OH 2GD4B 1O2QA 1D3PB 4JYVH 3RXDA 1CGJE 1HLTH 1V2NT 5GXPA 2ZFRH 4MPUA 1BUIA 3OY5U 2STBE 5FPSA 4ABAA 1BTXA 2BVXH 1Y3VA 2P3TB 4U30A 1TIOA 5HYOA 1S0RA 2RA3A 5C5NA 1TNGA 2FODA 1QL8A 1U6QA 2A5KA 5J4QA 2V0BA 1GI3A 4I8LA 1O35A 4RSPA 2BD4A 2PLXA 4UEHH 2B0FA 1GJAB 1DSUA 2ZKSA 2P16A 1O33A 2TBSA 5EODA 3PLKA 2VNTA 4O03A 2Z3DA 1GI0A 1S83A 3ITIA 1Z6EA 3ZVCA 1J15A 3RXBA 2ZP0H 3O8BA 1YCPH 1MKWH 2AMPA 1MU6B 1ZSKA 3UNRA 5EG4A 1HFDA 4AFZA 2H1UA 4MNYA 1MCTA 1TQ7B 1SQOA 4FUCA 1QJ7B 2BD7A 3U1IB 4YOGA 2SGQE 1DM4B 1TMUH 1YPMH 2A7JA 3B9FH 1L4DA 1AB9C 1QL9A 1FY3A 2OINA 5L2YH 1VJAU 1KDQB 3RLWH 1JRSA 5GDSH 3SJ8A 3SNCA 3MTYA 1UJ1A 5JBCS 2M5TA 1VITH 3QWCH 5CE1A 5C1UA 3GY2A 1RTFB 3MOCA 5CMXH 3KQBA 1P03A 2ZU4A 3HK6B 4H6SB 1NZQH 2ZHFH 1Y3YA 1VITF 1S6FA 2JKHA 7GCHG 3SOSA 2UUFB 1TBQH 1HNEE 4LOYH 2ZDLA 1GVKB 2WPHS 2CGAA 2PV9B 2R0KA 1N8OC 1YC0A 1UTPA 1XKBC 2ZGXH 1BQYA 2GGVB 4D76A 1EB1H 1P11E 4I8JA 4A1VA 2C3SA 2BD3A 2KAIA 5FX6A 4X6OA 2R3YA 4D8NA 5GJ4B 4BAQB 1EX3A 2AH4X 2BDGA 1Z8GA 4Q7ZA 3WY8A 1QBNA 2ZTXA 1TGNA 1OKXA 1KYNA 2BM2A 1S81A 1AN1E 2SGEE 2GZ8A 1F7ZA 1W8BH 2FZZA 2PTNA 1UK2A 4GLYA 2H5CA 1SHHB 2PTCE 1GI4A 1P57B 3GCNA 3AW1A 2F83A 4BAHB 1O2LA 1FXYA 5A2MH 1IQMA 1PPEE 1AFQC 2ALPA 1Z6JH 5FBIA 5LPEA 1GMCF 1ZHMA 2SGDE 1P01A 1IQHA 4AORA 1OP8A 4CRCA 1GGDC 1YGCH 1QA0A 2F9VA 4Y11E 1EQ9A 4AFUA 4MTBA 1T8OA 2A32A 2BOKA 4LZ4B 3GY5A 3UTUH 1ZYOA 3MH6A 3A87A 1V2MT 1ELCA 4Y0ZE 2I6QA 8GCHF 4DVAU 1ELTA 2Q6DA 3GY8A 1O2WA 4ZKRU 4GPGA 4LXBH 3MU4A 1N1LA 4NZQA 1DS2E 4ZROA 2ODQA 3ZVEA 1LVMA 1C1VH 1PQ8A 2A7HA 1BMMH 3TH3H 1CA0C 4WH6A 2BD9A 3KCGH 4I8KA 4X8UH 1L2EA 4A7IB 4ABDA 4D7GA 6GCHF 3LT3A 2BB4A 2ULLA 2F9NA 4Y10E 1OPHB 2PKAB 2F9PA 2XBYA 4MG3A 1E0FD 2A4RA 2GCHG 2GV6A 1QIXB 1C5XB 1C2MA 3S9CA 1CHGA 3BTEE 3MH7A 1ZPBA 3SO3A 1H1BA 1ELDE 4JMYA 3BN9A 5G4BA 1GBIA 1NT1A 1GCTC 5E0HA 2CN0H 2OCVB 1C5OH 3D62A 1MUEB 9ESTA 1UO6A 5H4IB 5A0CA 1XM1A 1O5AB 1A3BH 3Q3YA 1GL1A 2PUQH 3TITA 1GJ9B 4NIVA 4JK6A 1HXEH 3L3TA 1EAXA 2VIQA 5DP5A 2LNCA 5TJXA 1GBBA 1Y8TA 4SGBE 2SNWA 1MTNB 2Y5FA 3OSYA 1C5TA 1P06A 2ZF0H 3HPTB 1AE5A 4A1XA 5C3NA 2A5AA 3E91A 3SGBE 3P92A 2VWOA 1QB9A 1E35B 2A2XH 2TGAA 4ZHMU 4CH8B 3ZZ9A 3RU4D 1UTJA 1BTWA 1OOKB 5AF9H 1C1UH 1OXGA 1SLXB 1QY6A 4FU7A 4GHTA 4FUDA 2GCTB 2J94A 1FONA 2BDYA 1W13U 3LJJA 1EJNA 4IN2A 4JZ1A 2NU3E 4I7YH 5ETXA 1Z1JA 3TGIE 4R8TB 2XC5A 4ABJA 5DP4A 1NPMA 3D23A 1BMNH 1P9SA 4KTCA 1BHXF 3Q3XA 3M5OA 1D9IA 3TJOA 1A0LA 1TGCA 4NGAH 1GMDF 1THRH 3TH4H 2VVVA 2QXHA 4K2YA 1BRAA 4TYDA 3GISB 1SQAA 1UHBB 2ZZUH 5JBBS 4Q2KA 2GMTB 1P2QA 3EA8A 1C2EA 3RC4A 1SPJA 4HFPB 4TPIZ 5JPMH 4ZKOU 1NRRH 2J4IA 4JK5A 3S9AA 2IJOB 1TMBH 4MNXA 1O30A 1LHDH 1YKTA 1EPTA 2XNIA 3M3SA 2JETB 3ZVDA 2B5TB 4WWYA 4JZFH 2OQ5A 4OS7A 3KQEA 3K2UA 4YO9A 1CA8B 5BPEA 1G3DA 4UD9H 2PHBA 2FM2A 2HGTH 1W12U 1F2SE 1W7XH 1T4UH 3SUGA 2VIVA 1A1RA 1ETSH 2FOFA 1Y5BT 2B8OH 2W5EA 4Y79A 4DJZB 2R2MB 1AMHA 3LU9B 3TU7H 2VU8E 4XBBA 4D9QA 1AHTH 2A4GA 4MPWA 2OQUA 4OGYA 1PPZA 2C8YB 5CHAB 1RRKA 1AZZA 2HALA 3GCHC 1K1MA 2BDHA 1AZ8A 2YOLA 4DW2U 3W94A 4M7GA 1O2IA 2ZFPH 1KXAA 1DWDH 5EQRA 5DP9A 3RXEA 1BT7A 2A1DB 4Q7YA 1V2TT 5FPTA 1EOJA 4Q7XA 3SNEA 1O38A 5JBAS 2RG3A 2ESTE 2BDBA 4DGJA 2AEIH 1LVOA 1BTHH 2BVRH 1W10U 2C93B 1EJAA 1RD3B 2PGBB 1K28D 2D2DA 5GPIB 2AERH 3A83A 2ANMH 1YPEH 4DY7B 4IS5A 3KNXA 1RJXB 3SU6A 1MBMA 3SORA 1SHYA 1V6DA 3UPEA 4CRDA 1SG8B 1BOQA 4BTIB 1E36B 4A92A 3U8TH 2ZU1A 2Y7ZA 3ZZAA 1ELGA 1JIRA 2XYAA 5A0BA 1TPOA 2VWLA 4O97A 1ACBE 1HJ9A 4B2BA 1VCWA 3QGNB 5T6GA 1ZJKA 4WMFA 1G30B 3UIRA 5FBEA 2BVSH 3QTVH 2GT8A 1MD8A 4NIYA 2BD2A 3ZYEA 3BTWE 3MO6A 1EXFA 2GX4A 3BG4B 1KTSB 1GMHF 4X0WU 8ESTE 2CF9H 2C90B 2G51A 1GHYH 3D65E 3D49H 4HGCA 1FIWA 4AG1A 1P3EA 3V7TA 3E8LA 4AN7A 5DP6A 3TVJB 1UTOA 5PTPA 1O5EH 3ZV8A 4OS2A 3CS7A 3P8FA 2HVXA 1CT0E 1P2IA 1ZR0A 5TCCA 1W2KH 3RXAA 2PFEA 3P8OA 3OYPA 1T8LA 1OX1A 3RMLH 3W95A 1EZXC 4NSVA 3VB3A 1SGRE 1EPTC 3QTOH 3R3GB 3T29A 3E3TA 4X8SH 2EC9H 5GCHG 4BNRA 4B73A 3EGKH 3IITA 4Y8YA 1HAXB 1PQAA 3P95A 1CGIE 3SZNA 1FN6A 1EB2A 2ANWA 4B75A 1LKBA 2F9UA 1P09A 3UQVA 2V35A 4X8TH 5EPYA 4F4OC 3RP2A 1LPKB 1LVYA 3EA7A 3H7TA 3FP7E 1C1QA 3RC6A 3PWBA 2WUBA 1K9OE 1EATA 1RS0A 2G4TA 1MKXH 2CHAB 4GSOA 5DP8A 1HV7A 1T8NA 1A5IA 2ODPA 2BX4A 2VIPA 4TY6A 1C2FA 1HJAB 1SLUB 1Y5UT 1KLJH 2P95A 1ZHPA 2Q6FA 4NFEA 5DKMA 1SFQB 3RXFA 4OS4A 2ZDKA 1GHAF 1DUEA 2EI7A 5C1YA 1BTUA 4E06H 2QXIA 3ESTA 4FUGA 4RKOB 2PWXA 4AX9H 4YOJA 1O2SA 3FP8E 4NA7A 1ELAA 1M9UA 4DURA 1HAPH 4UDWH 4GHQA 2EI6A 1MD7A 1QB6A 1QQUA 1P2OA 2OC8A 3E16B 3LGUA 3LJOA 1GPZA 1ARCA 3T28A 3UR9A 2H6MA 2H5DA 1D3DB 1LVBA 1TNIA 2WPKS 3ELAH 5EXMA 4Y7BA 4I8HA 3VB4A 7KMEH 3O8DA 5EU8A 2TIOA 1NU7B 2TRMA 3UWJH 2UUYA 2QXGA 1ZZZA 1WBGB 2ODYB 3MU1A 1TMTH 4AG2A 4WF8A 2GTBA 1SOTA 3BTME 1VGCB 2WINI 3DHKH 4MVNA 3SV2H 3M5LA 1O3MA 1PQ5A 2ZGCA 2TGTA 1JMOH 1MTWA 1THPB 1UCYK 4YTAA 3T26A 1AWHB 1AGJA 1ANBA 1UVTH 1ZGVA 4INLA 1RIWC 2O8UA 1K22H 3PMBB 4O3TA 1P10A 1SLVB 1WAYB 1GI6A 1BBRH 3VXEH 2ZGHA 2BXTH 1AKSA 3BSQA 1BJVA 5K7RA 1EKBB 1K21H 1O3AA 1WQVH 1C1MA 1O2VA 2ZG0H 2F9OA 3SBKA 2VJ1A 4CRAA 5JBTA 5JDUB 1ETRH 2R3UA 2WPMS 4D7FA 1CHOG 1NU9A 2DE8A 1ARBA 5HM2A 1O2ZA 3TNSA 1HGTH 3MYWA 3PLBA 3RXGA 1OP0A 3TJVA 2ILNA 2WPJS 1HIAA 4H4FA 3F9EA 3MU5A 1QJ1B 4ABFA 2ZDVH 3E0PB 1YCPM 2G5NA 1GBJA 1OWIA 1TRNA 3GDSA 6CHAB 1XX9A 2P94A 4WMEA 1DY8A 1HAVB 3KHVA 1W14U 1NY22 1SGIB 3A8DA 4IW4E 1GI1A 1DITH 2G81E 1EAIA 1VCPA 3P70B 1PJPA 1H4WA 4CRBA 2A7CA 3ZVBA 3LGYA 2R0LA 3MH4A 2ZFSA 2PGQB 1TLDA 2P8OC 4I33A 5L30H 1OWEA 2OBQA 3UNSA 4FVDA 1O3JA 1S6HA 1B0EA 5TCAA 2ZCHP 4ZHAA 4LK4A 1JBUH 3SJOA 1V3XA 2PKSB 2PR3A 1V2JT 4ZXXH 2ZPSA 4H42U 4KKDA 1OYTH 2W7SA 2BD8A 5F8TA 1PYTC 1TOCB 3GY6A 3P8GA 1EJMA 4AB9A 1QJ6B 2V6NA 4I32A 1O5CB 2NU4E 1BMLA 2BLVA 2P3FH 3RU4E 4GCHF 1CVWH 7LPRA 1QQ4A 4DOQA 1FY8E 2GT7A 3TGKE 1P05A 2BLQA 2VB0A 3BIVH 2D8WA 3VGCB 3C27B 1AUJA 1C2KA 3V3MA 1C2IA 3U98H 3ZVGA 1O3GA 5HXFA 3MFJA 2ALVA 1ABIH 1H9IE 4XOJA 1K2I1 3MWIU 1UVSH 2XRCA 1ZOMA 1VR1H 5E2PA 3A86A 1PPHE 1C9PA 4U2WA 1L1JA 1O2KA 2J95A 1GJ6A 1D6RA 4F49A 5DO4H 3AW0A 4E7NA 2VINA 1CBWB 1FLEE 2FDAA 1GI9B 3A82A 1IQLA 3BEFB 4A1TA 3A89A 5I46H 3MO9A 1NM6A 1T7CA 4YZUA 1F5LA 1P3CA 1E37B 1IQIA 3V0XA 1DVAH 4WH8A 2WV5A 3ATLA 3TK9A 2D26C 2HNTC 3N7OA 1GBMA 1YPJH 1JWTA 1C1OA 8KME2 1W3CA 1GBHA 1DLKB 4X6PA 1O2PA 1GHBG 3LIWA 1PPFE 2RDLA 2BDIA 2UUJB 2WPLS 3F9GA 4ZH8A 1L0ZA 1T4VH 3M5MA 1C4V2 3RC5A 1HCGA 3U9AH 3VPKA 1ANDA 2BY6X 3NUMA 1EP5A 2ZGBH 2QF3A 4DT7B 1DLEA 3I78A 2O8MA 1TE0A 3MHWU 3MU8A 2ZNKH 1P04A 1C9TA 1OP2A 2ZDMA 3RXMA 1QTFA 2LPRA 1E38B 4QT8C 2UWPA 5E8EH 1C1PA 1UK4A 4WJG2 4WY3A 3S7HB 7GCHF 3TJUA 4AGJA 1MCVA 1SBWA 5A8ZA 2OLGA 2G00A 5DG6A 2KAIB 1LCYA 3LDXH 1HDTH 8LPRA 4A6LA 1HAYB 2W7UA 1TBRH 1O3CA 1C5PA 1OSSA 2ZQ2A 1SGPE 3O8RA 1O3IA 2QCYA 2A4QA 3KL6A 5EQSA 5A8YA 1H8IH 3A7ZA 3ENSB 2FS8A 3GCOA 2O8WA 1GI7B 1GBCA 1SVPA 1FY4A 4B71A 3ATKA 4UFFH 1XXDA 1HJ8A 3RXRA 3SU3A 4K1EA 2BY8X 1CGHA 1O3PB 1UK3A 2VIDA 1S5SA 4O3UA 2VGCB 3SQEE 2WYJA 4ESTE 4ISLA 1P9UA 1SFIA 1NTPA 1GDNA 2QF0A 4KELA 1O2GH 3F1SB 1C1TA 2QYIA 1FZZA 2JH0D 4BXWA 1H8DH 3GCTG 4UFGH 4ZMAH 3O8CA 1WUNH 4Y0YE 3SU1A 1TB6H 2JH6D 1TX7A 1GJ7B 1UMAH 1MH0A 3Q76A 2IOTA 2J34A 4FUEA 1PPCE 3GY4A 2B7DH 2FI3E 3SJIA 3RXHA 1SMFE 3SU4A 2ZHDA 1AI8H 2ZPQA 2AMQA 4CHAB 3BIUH 4VGCB 1TA6A 4MNVA 2XWAA 1D4PB 3SGQE 1PQ7A 5EXLA 2ZFFH 1KY9A 4BANB 3K6YA 3QDZB 4YLQH 4NIXA 3V13A 3KIDU 1ESAA 2FYQA 1HAOH 1WTHD 1MTUA 1O2JA 2Z6BD 3ATMA 1A4WH 3EA9A 5AHGH 5C67A 4BTTB 3A8CA 5K0HA 3ODDA 3LONA 1SB1H 2GCHF 5DPAA 4THNH 4PROA 2BZAA 3PO1B 2SGPE 3MH5A 4K3JA 1GWAA 1EZSC 1WCZA 2Z94A 3ZZ8A 4AYVB 2Z9KA 1FNIA 1GBDA 1NFYA 1DICA 1GBAA 1D3QB 1IQNA 1SGCA 2PUXB 1L4ZA 4X6NA 4MLFB 1FUJA 4KGAA 2GDDA 3GDVA 4JZEH 1V2LT 3DA9B 3OU0A 1NROH 1TGTA 1HRTH 2R2WU 1GDQA 3A81A 2QGRA 2FO9A 1JXPA 1LDTT 2FEQH 4OS1A 1QRXA 4MDSA 2GZ7A 1AFEH 4TWYA 2F91A 3PMHB 4Z0KA 3BTQE 5JYIA 1FIZA 2BTCE 3NXPA 1IHTH 2Q6GA 1KTTB 3U69H 1TRYA 2AIPA 1SGDE 2C8XB 3A8AA 3SU2A 3BEUA 4MNWA 3ATWA 1WOFA 5JB9S 1C2GA 6ESTA 1IQJA 3RXVA 3HKJB 3LKWA 1SGFG 2C8ZB 1B7XB 3GDUA 3M61U 3F9FA 2Z3EA 3QZRA 3MI4A 1MTNC 3K65B 1UVOA 3M3VA 1A61H 1THSH 2UUKB 1K1JA 1AO5A 2RCEA 4BOHA 3QUMP 2VVUA 2QY0B 1B0FA 2ZQ1A 2GZ9A 2GVFA 1L1GA 2BY7X 2FESH 1DPOA 1EPTB 1TABE 1N6XA 1Y3UA 1GMHG 2GCTC 2AS9A 2FLBH 1HAHH 3EE0B 4MQAA 2QIQA 3ZZ6A 1DWEH 1O37A 2FOBA 1V2OT 2ZPRA 3U8OH 1KXFA 4ZAEA 3ZV9A 1V2UT 5FAHA 1C2LA 2HNTE 1TPAE 4JYUH 4TWWA 5ESTE 2SFAA 1EASA 1F92A 3RU4T 2VIOA 1SSXA 3HATH 3RXPA 2C8WB 1SGEE 1C1NA 2FPZA 5DK1A 2GMTC 4BTUB 3HKIB 1DXPA 3MNBA 3GICB 3PWCA 3DUXH 1PFXC 3SNBA 1Y3XA 3M7TA 2BLWA 1G36A 3P6ZB 1BZXE 4CR9A 2JETC 3STIA 4AFSA 1ZTLA 1BBRK 4ABHA 1BRUP 1YBWA 4FXGH 1BIOA 3LGTA 5HMAA 1INCA 4Z6AH 3SNDA 3RMOH 1V2KT 1C5YB 3S69A 3A8BA 5FHTA 3P17H 5F8ZA 4E7RG 3TPIZ 1MZDA 1Z71A 4K69A 2OP9A 1WU1A 1Y3WA 1SQTA 3L33A 2F3CE 3CS0A 2P59A 4U01A 5CHAC 4X2WA 4YM9A 1ZMLA 1LKAA 3E90B 1ESTA 1BHXB 4YESB 2ZDNA 4UFEH 1OYQA 3FVFB 1KIGH 1GHAG 1GJ4H 5B6OA 1AY6H 1AVWA 1BITA 2BOHB 1MAXA 1GVLA 1W7GH 4NSYA 1YYY1 1XVOA 4CRFA 2SNVA 1C5ZB 2XBXA 6LPRA 1EP6A 3PTBA 1LQDB 2WPIS 1DDJA 2BX3A 1ANEA 3GY7A 4GUXA 2H9TH 2H9HA 1XUHA 1DSTA 1GJDB 2QAAA 1S84A 1SGNE 3MNSA 4Y76A 1YLDA 2A2QH 2Y7XA 3E6PH 1Q3XA 3RXOA 1NRQH 1KXBA 5C1XA 3OX7U 1GHXH 2G52A 3E1XB 2AFQB 1Q2WA 3A7TA 1C5RA 4XDEA 2I6SA 1FI8A 3QLPH 1AVGH 3SI3H 3E0NB 1BDAA 1PYTD 2HRVA 2F9BH 1LMWB 3SV9A 3QN7A 1BTPA 1F5RA 1ZPZA 1C5LH 1YCPK 1MKWK 2GP9B 3UFAA 4WMDA 3MMGA 4FUFA 1C5QA 1DXWA 5LH8A 4AZ2B 1ORFA 2D1JA 3RXUA 1W0ZU 1VCQA 1GG6B 1KLTA 4IMZA 4ZUHA 1LTOA 2FWWA 1HBTH 1ZRBA 1OWJA 2BD5A 2QXJA 4NWLA 1AD8H 3U1JB 1V2VT 1XUGA 2FI4E 1O5FH 2FI5E 3GYMA 4Y8ZA 5EQQA 3TGJE 1GI5A 2W3IA 2QA9E 2VH0A 3BG4C 3T2NA 5GCHF 2Y82A 3TJNA 1J16A 1S82A 1XXFA 1NC6A 2H2ZA 1TNLA 3A7WA 1F0SA 1FAXA 4TPYA 2YNAA 3QGJA 1ABJH 2ZCKP 1EUFA 2EA3A 3H7OA 3BTHE 3CP7A 1PPGE 3UUZA 4X1SU 4XFQA 4JZIA 1LHGH 1GBKA 2BZ6H 3BV9B 1FAKH 2ZC9H 1HAGE 1MBQA 4ISIH 1JOUB 1TGBA 3VEQB 1DOJA 4FUBA 1UVUH 3PMJA 4ZKNU 4YT6H 1QCPA 5C2ZA 2XBWA 1G37A 2ZHEH 3PROA 3NWUA 1Z7KA 1FQ3A 4SGAE 1C5NH 1RFNA 2FOMB 2CJIA 4YT7H 2P93A 5F6MA 1EOLA 4K1TA 1T31A 1ZSLA 4LZ1H 1AB9B 3L6PA 2AGEX 2DUCA 5DP3A 3FFGA 1NFUA 2W3KA 1WQSA 2BQWB 3NCLA 1FY5A 1WYKA 4JYTA 1BCUH 1OWDA 3UOPA 1FPHH 1VZQH 2CHAC 2NU2E 3DFJA 3P8NA 3UR6A 3V12A 1IQEA 4KTUA 4XBDA 1HJAC 1C1RA 1O2OA 2BMGB 3STJA 1C5VA 3LH1A 1C5UA 1XMNB 3T25A 1DFPA 1P8VC 2Z7FE 3A7YA 3KN2A 3UY9A 3BTGE 2WYGA 1GVZA 2ASUB 5T6FA 3HK3B 5BRRE 1MAYA 1VJ9U 3I29A 3SU5A 1QURH 1ZJDA 1T8MA 2ZI2H 1LPZB 1AE8H 3DT0H 3F9HA 2HOBA 1TOMH 1N8OB 3QO6A 1WV7H 1A0JA 4ASHA 1KDQA 3MO3A 2SGAA 1O2XA 1C2JA 1AKSB 1H9HE 1LO6A 2AYWA 1GBFA 1QRWA 3EAJA 1T32A 3FZDA 5AFYH 1OS8A 3PM3A 1QR3E 1O3EA 1O2YA 1O3DA 2A5IA 3ZZ3A 2ZA5A 3SI4H 5EW1H 4RN6A 1HXFH 1ZRKA 4OGXA 2FOAA 1VITG 2OTVA 1HAZB 1NFXA 1TFXA 1VGCC 1UCYE 1G3EA 2TGDA 5LPFA 4NCYA 1CHOF 3SUFA 1IQFA 1DX5M 3RXCA 2BDAA 1AFQB 5FXLA 2OC7A 3DFLA 2Y5HA 1HIAB 1ZGIA 4BXSA 1G2MA 1C5SA 1GGDB 2UWLA 1QNJA 2EEKA 4NWKA 2O8TA 1EAWA 1MU8B 2WUCA 1QA7A 1UTQA 3BF6H 1O3LA 2ZFQH 5L6NH 3RXIA 3ZZ5A 3LGIA 2ZGJA
chains in the Genus database with same CATH superfamily
4X1RU 2K1QA 1DWCH 1E34B 4FUHA 2Z9IA 2XC4A 1K1NA 4FU9A 3AASA 1TNKA 5IYTA 1KLIH 4CREA 1CA0B 1ETTH 5ABWA 4K1SA 4UFDH 2NU0E 2HLDD 1LHCH 3A84A 1GMCG 1XUKA 1MMJN 1DANH 1BMFD 2V3HH 5EJ1A 4JCNA 1TRMA 1F0TA 1K1LA 1O2MA 1XUIA 1FN8A 2FX4A 3C1KA 2OD3B 1K1OA 3BEIB 1GCDA 2ZIQH 1LQEA 5A8XA 3B23B 1C1WH 6CHAC 1GDUA 1O5GH 1C5WB 1C2DA 3SV6A 4YOIA 1MQ6A 8GCHG 1IOEA 3SZEA 1GHWH 4INHA 1UCYH 4K5ZA 3LGVA 3QX5H 2C4FH 1YLNA 1UTKA 2AIQA 1GCTB 4UONA 1HUTH 3TLOA 3LPRA 2A4OA 3UOUA 1GJBB 2BYAX 1QB1A 2BLOA 3LGWA 2GJGA 6GCHG 5F03A 1O39A 2G55A 4WXIA 4ABEA 1ZLRA 1P12E 1ZMNA 3GY3A 4IBLH 3HGPA 2ZHWH 1J14A 4NG9H 2ZFTA 2PKAA 1O3FA 5J4SA 5GWZA 3EQ0H 3DSPA 1S0QA 4CR5A 3G01A 4AFQA 5E0JA 1GI2A 2PKSC 2FX6A 3GOVB 3RXJA 1EZQA 5DN6D 1L1NA 1TWXB 2Z9JA 4AYYB 4AB8A 2UWOA 1BMAA 2Y5GA 1YPKH 2FOHA 3RXTA 2ZTZA 5F8XA 4KP0A 5EPNA 1ZSJA 2ANYA 1P2MA 1GJCB 5C5OA 2B9LA 5AVDA 3UQOA 3A7XA 3NPSA 1J8AA 3CNRA 3GYLB 2QC2A 3NZIA 4FVBA 1BTYA 1KXDA 4INKA 1CT4E 2HWLB 5JB8S 1O3NA 1D6WA 3VGCC 2NWNA 4YLUA 3Q3KA 2CV3A 2BHGA 5E2OA 4Y7AA 3VXFH 2FIRH 4A5TS 1TGSZ 3BTDE 3UREA 1IQKA 3IG6B 2ZDAH 5I25A 1GHBF 1O5DH 1YP9A 2AGIX 1MQ5A 2XXLA 1CBWC 4NZLA 1BB0B 3Q00A 2VBCA 4ISNA 2H9EH 1ELBA 1F5KU 2FOGA 4B2CA 4X1PU 1G3CA 3VB5A 1O2HA 1QBOA 1CT2E 1YF4A 1V2RT 1MZAA 3ZVFA 1A0HB 2YNBA 1C1SA 4NIWA 3ZZDA 1GMDG 3S9BA 1NRSH 3ZZBA 1SC8U 4XE4A 5DJ7A 3RXSA 2OUAA 2VWMA 4CRGA 1YY3A 2ANKH 5T6DA 5SGAE 1ESBA 3S7KB 3H5CB 3MNXA 3RM2H 1UHBA 5LPRA 1RXPA 4AOQA 4B2AA 2THFB 1JRTA 1Q31A 2KCPA 3GCHB 3F2FA 1HB0B 3AAUA 4BAOB 4E05H 1TNHA 3FAOA 2J9NA 3M7QA 4HZHA 1B5GH 1NO9H 1KSNA 2ZHQH 4XBCA 3FANA 1GBEA 2BY5X 2JH5D 4OS5A 1UTNA 1SGYE 3M36A 4DIHH 2HPQH 3SNAA 3UWIA 3SN8A 1GBTA 3SYJA 1SLWB 3RLYH 2XCFA 2FLRH 2ZWLH 1P2JA 3KQCA 5A09A 1XUJA 3VB7A 1ANCA 1WSSH 3UNQA 2BXUH 2A45B 2F4LA 4X6MA 3SHAH 2OBOA 5HGGA 2AGGX 3A85A 2VVCA 3RUOA 3NRLA 3K6ZA 2CF8H 2BQ7B 1Z8JB 1YPGH 1TPSA 2XCNA 1Y59T 1V2ST 2IPHA 3GCTF 2FOEA 1TAWA 1YM0A 2QF5A 1DE7H 1YPHC 2KX4A 3OEED 2FMJA 1JIMA 1DY9A 3KQDA 3K9XB 2ZCLP 5FPYA 1A5HA 3NKKA 4K8BA 1AUTC 2HPPH 2K8IA 1QL7A 1H8ED 4IN1A 3JZ1B 1AU8A 1O3HA 3Q77A 2A0QB 3AAVA 1BJUA 3KEEA 2Q1JA 3BG8A 3SQHE 1QFKH 1W11U 1TPPA 4M9FA 1CU1A 2VGCC 3KGPA 2PW8H 1GHVH 1MKXK 1P2NA 3WW7A 3PRDA 3LC5A 1UTLM 4FUJA 1FJSA 2XWBI 4I8GA 1TALA 1O5BB 1UVPA 4WVPE 3ZZ4A 1IQGA 5A0AE 3M7UA 4AGKA 2J92A 2ZU2A 4OS6A 5AFZH 3OTJE 1P0SH 4H6TA 2FXRA 2EI8A 5DP7A 1SOZA 1O31A 2V7QD 4X2XA 3MNCA 2GKVE 4CHAC 3IWMA 4VGCC 1C4U2 3OY6U 1OWKA 4IGDA 1TQ0B 3PYHA 3M5NA 2OC1A 3VB6A 3PTNA 4X8VH 1SGTA 2ZECA 1VKYA 3T5FH 2FS9A 4FU8A 1NFWA 2O8LA 3PLPA 3TH2H 5HM9A 5EGMA 2Z9LA 3PO1C 1EAUA 1O3OA 3SW2B 3EYDA 2PSYA 1Z1IA 1E79D 3OTPA 2FYRA 3OAAD 3A88A 1F0RA 1H9LB 2FTLE 3B8JA 4DIIH 3SJKA 3PB1E 3SHCH 1X7AC 3SUDA 3R0FA 2VH6A 5GNDA 1TA2A 1Z8RA 2KFWA 1SGQE 2A31A 4B74A 5IDKA 1NS3A 1O0DH 4FUIA 1SR5C 1GHZA 1K1IA 2IN2A 3M37A 2CMYA 3BTKE 1D3TB 4GVUA 5KECA 2FP7B 1KXCA 3ZZ7A 1XUFA 1O32A 5C20A 2P3UB 1O34A 2R9PA 3I77A 4BAMB 1AIXH 2G8TA 1BA8B 5FCRA 1G9IE 2QV1A 3TK5A 1Y5AT 4X1QU 1FDPA 1S85A 4J1YA 2FOCA 3JZ2B 2ZO3H 3T62A 2HLCA 4CBOA 2BQ6B 1TX8A 1EZUC 1HAIH 2J38A 2RA0A 1N6YA 4ZXYH 1CQQA 2GDEH 1NBME 1TYNA 3SJ9A 4X2VA 1GL0E 3RXLA 4DG4A 1K1PA 1LHFH 5T3HA 4ABBA 1O2NA 2J2UA 1ELFA 1XKAC 5FL7D 4ZKSU 3DSOA 1DT2A 1FV9A 4Q80A 4RT0A 1C2HA 4B76A 2GV7A 4K8YA 2WSSD 4F55A 1RTKA 2PSXA 4O9VA 4B1TA 1DUAA 1RIWB 2HNTF 4Y71A 1V2WT 5GIBA 2KCAA 5EW2H 2Y81A 1KXEA 1GJ5H 1ZHRA 4JZDH 5E0GA 3SU0A 2STAE 4GAWA 2WV4A 1CSOE 4P00A 4ZHLU 2FTMA 1NN6A 4X1NU 1RTLA 1OWHA 2ZU5A 4I31A 1ELVA 1BRBE 1UTMA 3HGNA 5ESBA 5FCKA 1A7SA 4IMQA 2AMDA 1O3KA 4IC6A 1TONA 3TIUA 1P02A 5DGJA 5EIYA 3T27A 1A5GH 3TNTA 3EDXB 3A7VA 3LC3A 3VFEA 1YLCA 1GJ8B 3LH3A 1FY1A 4HTCH 3URDA 4MPVA 3SGAE 3ATIA 1SGFA 2VIWA 4KTSA 3QZQA 1BBRE 1MTVA 1TNJA 2XC0A 1O2TA 1SL3A 1GI8B 1W0YH 2DE9A 2W26A 3ZZCA 1SI5H 2QN5T 5LGOA 3KYGA 3KQ5A 1NESE 2OXSA 1FMGA 2G4UA 2OC0A 3SUEA 3SV8A 1CO7E 4IC5A 1A46H 1TBZH 1H8HD 2ZTYA 3RMNH 4RKJB 5L2ZH 4XSKU 1HPGA 1O2RA 1ID5H 3MU0A 3PV4A 1C5MD 2BY9X 4TY7A 1F0UA 3ZYDA 2SGFE 1QGFA 2XBVA 5EOKA 3RXQA 2TGPZ 2P8OB 4BAKB 1O36A 4NA9H 2XW9A 1XVMA 1C4Y2 1NRNH 9LPRA 2Z3CA 3RM0H 3SV7A 3URCA 3RMMH 1PPBH 2Z9GA 2TPIZ 1AQ7A 3A80A 3BTFE 1YPHE 1BTZA 1LPGB 4ACAA 3N99A 4K60A 1P2KA 3F0OA 4WXVA 1ELEE 1WTGH 3U8RH 1FPCH 2Y80A 1HAVA 1CE5A 2J98A 1A3EH 2ZU3A 1O3BA 4J2YB 4NA8A 4R0IA 3PMAB 2NU1E 1QRZA 3CENA 3QK1A 4ABGA 3M35A 4D9RA 2BDCA 3F2GA 4HI3A 4U32A 1G3BA 1G32B 4ISOA 1QBVH 1IHSH 3ZVAA 1ZPCA 4CBNA 1YWUA 5C94A 1V2QT 3S0NA 4X2YA 2O9QA 1LHEH 3DCLA 3F2HA 3M3TA 5EXNA 2M2AA 2CK3D 7ESTE 1J17T 1Z8IB 4ISHH 1AWFH 1AVXA 1MTSA 1YPLH 3F0PA 5FX5A 1IAUA 2VWNA 3AVZA 3LOXA 1ZTKA 4ABIA 2CXVA 3F6UH 2XTTB 1BRCE 3ODFA 2WZQA 4MPXA 3FZZA 2Y6TA 1A2CH 1V2PT 4UE7H 4DCDA 3NK8A 3DD2H 4Y8XA 1W0JD 3FP6E 1NRPH 1ZMJA 2K0QA 2ZEBA 3BTTE 4Y6DA 1G2LA 3F68H 2G5VA 1MABB 1TX6A 2AHME 4CH2B 1ZTJA 1GG6C 3RDZA 3TK6A 4NFFA 1HYLA 1O2UA 4GCHG 1GBLA 1QHRB 1RGQA 3RXKA 5C17A 1DWBH 3KF2A 1J9CH 3W1EA 2V3OH 2GD4B 1O2QA 1D3PB 4JYVH 3RXDA 1CGJE 1HLTH 1V2NT 2YMSB 3AK5A 2WHXA 5GXPA 2ZFRH 4MPUA 1BUIA 3OY5U 2STBE 5FPSA 2KZ4A 4ABAA 1BTXA 2BVXH 1Y3VA 2P3TB 4U30A 1TIOA 5HYOA 1S0RA 2RA3A 5C5NA 1TNGA 2FODA 1QL8A 3MQKC 1U6QA 2A5KA 5J4QA 2V0BA 1GI3A 4I8LA 1O35A 4RSPA 2BD4A 2PLXA 4UEHH 2B0FA 1GJAB 2XNDD 1DSUA 2ZKSA 2P16A 1O33A 2TBSA 5EODA 3PLKA 2VNTA 4O03A 1K0HA 2Z3DA 1GI0A 1S83A 3ITIA 3FKSD 1Z6EA 3ZVCA 1J15A 3RXBA 2ZP0H 3O8BA 1YCPH 1MKWH 2AMPA 1MU6B 1ZSKA 3UNRA 5EG4A 1HFDA 4AFZA 2H1UA 4MNYA 1MCTA 1TQ7B 1SQOA 3EE7A 4FUCA 1QJ7B 2BD7A 3U1IB 4YOGA 2SGQE 1DM4B 1TMUH 1YPMH 2A7JA 3B9FH 1L4DA 1AB9C 1QL9A 1FY3A 2OINA 5L2YH 1VJAU 1KDQB 3RLWH 1JRSA 5GDSH 3SJ8A 3SNCA 1W0KD 3MTYA 1UJ1A 5JBCS 2M5TA 1VITH 3QWCH 5CE1A 5C1UA 5F53A 3GY2A 1RTFB 3MOCA 5CMXH 3KQBA 1P03A 2ZU4A 3HK6B 4H6SB 1NZQH 2ZHFH 1Y3YA 1VITF 1S6FA 2JKHA 7GCHG 3SOSA 2UUFB 1TBQH 1HNEE 4LOYH 2ZDLA 1GVKB 5EJZA 2WPHS 2CGAA 2PV9B 2R0KA 1N8OC 3UB0A 1YC0A 1UTPA 1XKBC 2ZGXH 1BQYA 2GGVB 4D76A 1EB1H 1P11E 4I8JA 4A1VA 2C3SA 2BD3A 2KAIA 5FX6A 4X6OA 2R3YA 4D8NA 5EJLA 4ASUD 5GJ4B 4BAQB 1EX3A 2AH4X 2BDGA 1Z8GA 4Q7ZA 3WY8A 1FX0B 1QBNA 2ZTXA 1TGNA 1OKXA 1KYNA 2BM2A 1S81A 1AN1E 2SGEE 2GZ8A 1F7ZA 1W8BH 2FZZA 2PTNA 1UK2A 4GLYA 2H5CA 1SHHB 2PTCE 1GI4A 1P57B 3GCNA 3AW1A 2F83A 4BAHB 1O2LA 1FXYA 5A2MH 1IQMA 1PPEE 1AFQC 2ALPA 1Z6JH 5FBIA 5LPEA 5CHBA 1GMCF 1ZHMA 2SGDE 1P01A 1IQHA 4AORA 1OP8A 4CRCA 1GGDC 1YGCH 1QA0A 2F9VA 4Y11E 1EQ9A 4AFUA 4MTBA 1T8OA 2A32A 2BOKA 4LZ4B 3GY5A 3UTUH 1ZYOA 3MH6A 3A87A 1V2MT 1ELCA 4Y0ZE 2I6QA 8GCHF 4DVAU 1ELTA 2Q6DA 3GY8A 1O2WA 4ZKRU 4GPGA 4LXBH 3MU4A 1N1LA 4NZQA 1DS2E 4ZROA 5KGOA 2ODQA 3ZVEA 3OEHD 1LVMA 1C1VH 1PQ8A 2A7HA 1BMMH 2PP6A 3TH3H 1CA0C 4WH6A 2BD9A 3KCGH 4I8KA 4X8UH 1L2EA 4A7IB 4ABDA 4D7GA 6GCHF 3LT3A 2BB4A 2ULLA 2F9NA 2KCYA 4Y10E 1OPHB 2PKAB 2F9PA 2XBYA 4MG3A 1E0FD 2A4RA 2GCHG 2GV6A 1QIXB 1C5XB 4YXWD 1C2MA 3S9CA 1CHGA 3BTEE 3MH7A 1ZPBA 3SO3A 1H1BA 1ELDE 4JMYA 3BN9A 5G4BA 1GBIA 4F48B 1NT1A 1GCTC 5E0HA 2CN0H 2OCVB 1C5OH 3D62A 1MUEB 9ESTA 2WV9A 1UO6A 5H4IB 5A0CA 1XM1A 1O5AB 1A3BH 3Q3YA 1GL1A 2PUQH 3TITA 1GJ9B 4NIVA 4JK6A 1HXEH 3L3TA 1EAXA 2VIQA 5DP5A 2RFKC 2LNCA 5TJXA 1GBBA 1Y8TA 4SGBE 2SNWA 1MTNB 2Y5FA 3OSYA 1C5TA 1P06A 2ZF0H 3HPTB 1AE5A 4A1XA 5C3NA 2A5AA 3E91A 3SGBE 3P92A 2VWOA 1QB9A 1E35B 2A2XH 2TGAA 4ZHMU 2RDEA 4CH8B 3ZZ9A 3RU4D 1UTJA 1BTWA 1OOKB 5AF9H 1C1UH 1OXGA 1SLXB 1QY6A 4FU7A 4GHTA 4FUDA 2GCTB 2J94A 1FONA 2BDYA 1W13U 3LJJA 1EJNA 4IN2A 4JZ1A 2NU3E 4I7YH 5ETXA 1Z1JA 3N7DA 3TGIE 4R8TB 2QE7D 2XC5A 4ABJA 5DP4A 1NPMA 3D23A 1BMNH 1P9SA 4KTCA 1KMHB 1BHXF 3Q3XA 3M5OA 1D9IA 3TJOA 1A0LA 1TGCA 4NGAH 1GMDF 1THRH 3TH4H 2VVVA 2QXHA 4K2YA 1BRAA 4TYDA 3GISB 1SQAA 1UHBB 2ZZUH 5JBBS 4Q2KA 2GMTB 1P2QA 3EA8A 1C2EA 3RC4A 1SPJA 4HFPB 4TPIZ 5JPMH 2LP6A 4ZKOU 1NRRH 2J4IA 4JK5A 1E1QD 3S9AA 2IJOB 1TMBH 4MNXA 1O30A 1LHDH 1YKTA 1EPTA 2XNIA 3M3SA 2JETB 3ZVDA 2B5TB 4WWYA 4JZFH 2OQ5A 4OS7A 3KQEA 3K2UA 4YO9A 1CA8B 5BPEA 1G3DA 4UD9H 2PHBA 2FM2A 2HGTH 2L74A 1W12U 1F2SE 1W7XH 1T4UH 3SUGA 2VIVA 1A1RA 1S6LA 1ETSH 2FOFA 1Y5BT 2B8OH 2W5EA 4Y79A 4DJZB 2R2MB 5HIZA 1AMHA 3LU9B 3TU7H 2VU8E 4XBBA 4D9QA 1AHTH 2A4GA 4MPWA 2OQUA 4OGYA 1PPZA 2C8YB 5CHAB 1RRKA 1AZZA 2HALA 3GCHC 1K1MA 2BDHA 1AZ8A 2YOLA 4DW2U 3W94A 4M7GA 1O2IA 2ZFPH 1KXAA 1DWDH 5EQRA 5DP9A 3RXEA 1BT7A 2A1DB 4Q7YA 1V2TT 5FPTA 1EOJA 4Q7XA 3SNEA 1O38A 5JBAS 2RG3A 2ESTE 2BDBA 4DGJA 2AEIH 1LVOA 1BTHH 3PV5A 2BVRH 1W10U 2C93B 1EJAA 1RD3B 2PGBB 1K28D 2D2DA 5GPIB 2AERH 3A83A 2ANMH 1YPEH 4DY7B 4IS5A 3KNXA 1RJXB 3SU6A 1MBMA 3SORA 1SHYA 1V6DA 3UPEA 4CRDA 1SG8B 1BOQA 4BTIB 1E36B 4A92A 3U8TH 2ZU1A 2Y7ZA 3ZZAA 1ELGA 1JIRA 2XYAA 5A0BA 1TPOA 2VWLA 4O97A 1ACBE 1HJ9A 4B2BA 1VCWA 3QGNB 5T6GA 1ZJKA 4WMFA 1G30B 3UIRA 5FBEA 2BVSH 3QTVH 2GT8A 1MD8A 4NIYA 2BD2A 3ZYEA 3BTWE 3MO6A 1EXFA 2GX4A 3BG4B 1KTSB 1GMHF 4X0WU 8ESTE 2CF9H 4HG6A 2C90B 2G51A 1GHYH 3D65E 3D49H 4HGCA 1FIWA 4AG1A 1P3EA 3V7TA 3E8LA 4AN7A 5DP6A 3TVJB 3DSGA 1UTOA 5PTPA 1O5EH 3ZV8A 4OS2A 3CS7A 3P8FA 2HVXA 1CT0E 1P2IA 1ZR0A 5TCCA 1W2KH 3RXAA 2PFEA 3FOAA 3OYPA 1T8LA 3P8OA 1OX1A 3RMLH 3W95A 1EZXC 4NSVA 2QF4A 3VB3A 1SGRE 1EPTC 3QTOH 1WXRA 3R3GB 3T29A 3E3TA 4X8SH 2EC9H 5GCHG 4BNRA 1WDIA 4B73A 3EGKH 3IITA 4Y8YA 1HAXB 1PQAA 3P95A 1CGIE 3SZNA 1FN6A 1EB2A 2ANWA 4B75A 1LKBA 2F9UA 1P09A 3UQVA 2V35A 4X8TH 5EPYA 4F4OC 3RP2A 1LPKB 2J5UA 1LVYA 3EA7A 3H7TA 3FP7E 1C1QA 3RC6A 3UAIC 3PWBA 2WUBA 1K9OE 1EATA 1RS0A 2G4TA 1MKXH 2CHAB 4GSOA 5DP8A 1HV7A 1T8NA 1A5IA 2ODPA 2BX4A 2VIPA 3N7EA 3FN8A 4TY6A 1C2FA 1HJAB 1SLUB 1Y5UT 1KLJH 2P95A 1ZHPA 2Q6FA 4NFEA 5DKMA 1SFQB 3RXFA 4OS4A 2ZDKA 2W6ID 1GHAF 1DUEA 2EI7A 5C1YA 1BTUA 4E06H 2QXIA 3ESTA 4FUGA 4RKOB 2PWXA 4AX9H 4YOJA 1O2SA 3FP8E 4NA7A 1ELAA 1M9UA 4DURA 1HAPH 4UDWH 4GHQA 2EI6A 1MD7A 1QB6A 1QQUA 1P2OA 2OC8A 3E16B 3LGUA 3LJOA 1GPZA 1ARCA 3T28A 3UR9A 2H6MA 2H5DA 1D3DB 1LVBA 1TNIA 3VG8A 2WPKS 3ELAH 5EXMA 4Y7BA 4I8HA 3VB4A 7KMEH 3O8DA 5EU8A 2TIOA 1NU7B 2TRMA 3UWJH 2UUYA 2QXGA 1ZZZA 1WBGB 2ODYB 3MU1A 1TMTH 4AG2A 4WF8A 2GTBA 1SOTA 3BTME 1VGCB 2WINI 3DHKH 4MVNA 3SV2H 3M5LA 1O3MA 1PQ5A 2ZGCA 2TGTA 1JMOH 1MTWA 1THPB 1UCYK 4YTAA 2YMSD 3T26A 1AWHB 1AGJA 1ANBA 1UVTH 1ZGVA 4INLA 1RIWC 2O8UA 1K22H 3PMBB 4O3TA 1P10A 1SLVB 1WAYB 1GI6A 1BBRH 3VXEH 2EY4C 2ZGHA 2BXTH 1AKSA 3BSQA 1BJVA 5K7RA 1EKBB 1K21H 1O3AA 1WQVH 1C1MA 1O2VA 2ZG0H 2F9OA 3SBKA 2VJ1A 4CRAA 5JBTA 5JDUB 1ETRH 2R3UA 2WPMS 4D7FA 1CHOG 1NU9A 2DE8A 1ARBA 5HM2A 1O2ZA 3TNSA 1HGTH 3MYWA 3PLBA 3RXGA 1OP0A 5CDFE 3TJVA 2ILNA 2WPJS 1HIAA 4H4FA 3F9EA 3MU5A 1QJ1B 4ABFA 2ZDVH 3E0PB 1YCPM 3PRBA 5B6LA 2G5NA 1GBJA 1OWIA 1TRNA 3GDSA 6CHAB 1XX9A 2P94A 4WMEA 1DY8A 1HAVB 2J98B 3KHVA 1W14U 1NY22 1SGIB 5C0TA 3A8DA 4IW4E 1GI1A 1DITH 2G81E 1EAIA 1VCPA 3P70B 1PJPA 1H4WA 4CRBA 2A7CA 3ZVBA 1COWD 3LGYA 2R0LA 3MH4A 2ZFSA 2PGQB 1TLDA 2P8OC 3PV2A 4I33A 1OWEA 5L30H 2OBQA 3UNSA 4FVDA 1O3JA 1S6HA 1B0EA 5TCAA 2ZCHP 4ZHAA 4LK4A 1JBUH 3SJOA 1V3XA 2PKSB 2PR3A 1V2JT 4ZXXH 2ZPSA 4H42U 4KKDA 1OYTH 2W7SA 2BD8A 5F8TA 1PYTC 4I86A 1TOCB 4AC9A 3GY6A 2KM0A 3P8GA 1EJMA 4AB9A 1QJ6B 2V6NA 4I32A 1O5CB 2NU4E 1BMLA 2BLVA 2P3FH 3RU4E 4GCHF 1CVWH 7LPRA 1QQ4A 4DOQA 1FY8E 2GT7A 3TGKE 1P05A 2BLQA 2VB0A 3BIVH 2D8WA 3VGCB 3C27B 1AUJA 1C2KA 3V3MA 1C2IA 3U98H 3ZVGA 1O3GA 5HXFA 3MFJA 2ALVA 1ABIH 1H9IE 4XOJA 1SQRA 1K2I1 3MWIU 4ZCNA 1UVSH 2XRCA 4RI0A 4XD7D 5HIYA 1ZOMA 1VR1H 5E2PA 3A86A 1PPHE 1C9PA 4U2WA 1L1JA 1O2KA 2J95A 5KEDA 1GJ6A 1D6RA 4F49A 5DO4H 3AW0A 4E7NA 2VINA 1CBWB 1FLEE 2FDAA 1GI9B 3A82A 1IQLA 3BEFB 4A1TA 3A89A 5I46H 3MO9A 1NM6A 1T7CA 4YZUA 1F5LA 1P3CA 1E37B 1IQIA 2YMSC 3V0XA 1DVAH 4WH8A 2WV5A 2EQNA 3ATLA 3TK9A 2D26C 2HNTC 3N7OA 1GBMA 1YPJH 1JWTA 1C1OA 8KME2 1W3CA 1GBHA 1DLKB 4X6PA 1O2PA 1GHBG 3LIWA 1PPFE 2RDLA 2BDIA 2UUJB 2WPLS 3F9GA 4ZH8A 1L0ZA 1T4VH 3M5MA 1C4V2 3RC5A 1HCGA 3U9AH 3VPKA 1ANDA 2BY6X 3NUMA 1EP5A 2ZGBH 2QF3A 4DT7B 4DT4A 1DLEA 3I78A 2O8MA 1TE0A 3MHWU 3MU8A 2ZNKH 1E1RD 1C9TA 1OP2A 1P04A 2ZDMA 3RXMA 1QTFA 2LPRA 1E38B 4QT8C 2UWPA 5E8EH 1C1PA 1UK4A 4WJG2 4WY3A 3S7HB 7GCHF 3TJUA 2LELA 4AGJA 1MCVA 1SBWA 5A8ZA 2OLGA 2G00A 5DG6A 2KAIB 1LCYA 3LDXH 1HDTH 4Z1MD 8LPRA 4A6LA 1HAYB 2W7UA 1TBRH 1O3CA 4B6EA 1C5PA 1OSSA 2ZQ2A 1SGPE 3O8RA 1O3IA 2QCYA 2A4QA 3KL6A 5EQSA 5A8YA 1H8IH 3A7ZA 3ENSB 3KYFA 2FS8A 3GCOA 2O8WA 4OM9A 1GI7B 1GBCA 1SVPA 1FY4A 4Q63A 4B71A 3ATKA 4UFFH 1XXDA 1HJ8A 3RXRA 3SU3A 4K1EA 2BY8X 1CGHA 1O3PB 1UK3A 2VIDA 1S5SA 4O3UA 1QZ8A 2VGCB 3SQEE 2WYJA 4ESTE 4ISLA 1P9UA 1SFIA 4P02A 1NTPA 1GDNA 2QF0A 4KELA 1O2GH 3F1SB 1C1TA 2QYIA 1FZZA 2JH0D 2JJ1D 4BXWA 1H8DH 3GCTG 4UFGH 3OFND 4ZMAH 3O8CA 1WUNH 4Y0YE 3SU1A 1TB6H 2JH6D 4TSFD 1TX7A 1GJ7B 1UMAH 1MH0A 3Q76A 2IOTA 2J34A 4FUEA 1PPCE 3GY4A 2B7DH 2FI3E 3SJIA 3WWBA 3RXHA 1SMFE 3SU4A 2ZHDA 1AI8H 1UW7A 2ZPQA 1OHHD 2AMQA 4CHAB 3BIUH 4VGCB 1TA6A 4MNVA 2XWAA 1D4PB 3SGQE 1PQ7A 5EXLA 2ZFFH 1KY9A 4BANB 3K6YA 3QDZB 4YLQH 4NIXA 3V13A 3KIDU 1ESAA 2FYQA 1HAOH 1WTHD 1MTUA 1O2JA 2Z6BD 3ATMA 1A4WH 3EA9A 5AHGH 5C67A 4BTTB 3A8CA 5K0HA 3ODDA 3LONA 3U28C 1SB1H 2GCHF 5DPAA 4THNH 4PROA 2BZAA 3PO1B 2SGPE 3MH5A 4K3JA 1GWAA 1EZSC 1WCZA 2Z94A 3ZZ8A 4AYVB 2Z9KA 1FNIA 1GBDA 3GS9A 1NFYA 1DICA 1GBAA 1D3QB 1IQNA 1SGCA 2PUXB 2KR7A 1L4ZA 4X6NA 4MLFB 1FUJA 4KGAA 2GDDA 3GDVA 4JZEH 1V2LT 3DA9B 3OU0A 1NROH 1TGTA 1HRTH 2R2WU 1GDQA 3A81A 2QGRA 2FO9A 1JXPA 1LDTT 2FEQH 4OS1A 1QRXA 5DSFA 4MDSA 2GZ7A 1AFEH 4TWYA 2F91A 3PMHB 4Z0KA 3BTQE 5JYIA 1FIZA 2BTCE 3NXPA 1IHTH 2Q6GA 1KTTB 3U69H 1TRYA 2AIPA 1SGDE 1EFRD 2C8XB 3A8AA 3SU2A 3BEUA 4MNWA 3ATWA 1WOFA 5JB9S 1C2GA 4XRNA 6ESTA 1IQJA 3RXVA 3HKJB 3LKWA 1SGFG 2C8ZB 1B7XB 3GDUA 3M61U 3F9FA 2Z3EA 3QZRA 3MI4A 1MTNC 3K65B 1UVOA 3M3VA 1A61H 3WWFA 1THSH 2UUKB 1K1JA 1AO5A 2RCEA 2WPDD 4BOHA 3QUMP 3H09A 2IPQX 2VVUA 4RT1A 2QY0B 1B0FA 2ZQ1A 2GZ9A 2GVFA 1L1GA 2BY7X 2FESH 1DPOA 1EPTB 1TABE 1N6XA 1Y3UA 1GMHG 2GCTC 2AS9A 2FLBH 1HAHH 2JDID 3EE0B 4MQAA 2QIQA 3ZZ6A 1DWEH 1O37A 2FOBA 1V2OT 2ZPRA 4TT3D 1KXFA 3U8OH 4FETA 4ZAEA 3ZV9A 1V2UT 5FAHA 1C2LA 2HNTE 1TPAE 4JYUH 4TWWA 5ESTE 2SFAA 1EASA 1F92A 3RU4T 5T1VA 2VIOA 1SSXA 3HATH 3RXPA 2V3MA 2C8WB 1SGEE 1C1NA 2FPZA 5DK1A 2GMTC 4BTUB 3HKIB 1DXPA 3MNBA 3GICB 3PWCA 3DUXH 1PFXC 3SNBA 1Y3XA 3M7TA 2BLWA 1G36A 3P6ZB 1BZXE 2OK5A 4CR9A 2JETC 3STIA 4AFSA 1ZTLA 1BBRK 4ABHA 1BRUP 3ZIAD 1YBWA 4FXGH 1BIOA 3LGTA 5HMAA 1INCA 4Z6AH 2JIZD 3SNDA 3RMOH 1V2KT 1C5YB 3S69A 3A8BA 5FHTA 3P17H 5F8ZA 4E7RG 3TPIZ 2KCOA 1MZDA 1Z71A 4K69A 2OP9A 1WU1A 1Y3WA 1SQTA 3L33A 2F3CE 3CS0A 2P59A 4U01A 5CHAC 4X2WA 4YM9A 1ZMLA 1LKAA 3E90B 1ESTA 1BHXB 4YESB 2F43B 2ZDNA 4UFEH 1OYQA 3FVFB 1KIGH 1GHAG 1GJ4H 5B6OA 1AY6H 1AVWA 1BITA 2BOHB 2W6JD 4Q4LA 1MAXA 1GVLA 1W7GH 4NSYA 1YYY1 1XVOA 4CRFA 2SNVA 1C5ZB 2XBXA 6LPRA 1EP6A 3PTBA 1LQDB 2WPIS 1DDJA 2BX3A 1ANEA 3GY7A 4GUXA 2H9TH 2H9HA 1XUHA 1DSTA 1GJDB 2QAAA 1S84A 1SGNE 3MNSA 4Y76A 1YLDA 2A2QH 2Y7XA 3E6PH 1Q3XA 3FO8D 3RXOA 1NRQH 1KXBA 5C1XA 3OX7U 1GHXH 2G52A 3E1XB 2AFQB 1Q2WA 3A7TA 1C5RA 4XDEA 2I6SA 1FI8A 5C0UA 3QLPH 1AVGH 3SI3H 3E0NB 1BDAA 1PYTD 2HRVA 2F9BH 1LMWB 3SV9A 3QN7A 1BTPA 1F5RA 1ZPZA 1C5LH 1YCPK 1MKWK 2GP9B 3UFAA 4WMDA 3MMGA 4FUFA 1C5QA 1DXWA 5LH8A 4AZ2B 1ORFA 2D1JA 3RXUA 1W0ZU 2HVYB 1VCQA 1GG6B 1KLTA 2L6OA 4IMZA 1LTOA 4ZUHA 2FWWA 1HBTH 1ZRBA 1OWJA 2BD5A 2QXJA 4NWLA 1AD8H 3U1JB 1V2VT 1XUGA 2FI4E 1O5FH 2FI5E 3GYMA 4Y8ZA 5EQQA 3TGJE 1GI5A 2W3IA 2QA9E 2VH0A 3BG4C 3T2NA 5GCHF 2Y82A 4FOUC 3TJNA 1J16A 1S82A 1XXFA 1NC6A 2H2ZA 1TNLA 3A7WA 1F0SA 1FAXA 4TPYA 5IK2D 2YNAA 3QGJA 1ABJH 2ZCKP 1EUFA 2EA3A 3H7OA 2J97A 3BTHE 3CP7A 1PPGE 3UUZA 4X1SU 4XFQA 4JZIA 1LHGH 1GBKA 2BZ6H 3BV9B 1FAKH 3F3BA 2ZC9H 1HAGE 1MBQA 4ISIH 1JOUB 1TGBA 5HKKD 3VEQB 1DOJA 4FUBA 1UVUH 3PMJA 4ZKNU 4YT6H 1QCPA 5C2ZA 2XBWA 1G37A 2ZHEH 3PROA 3NWUA 1Z7KA 1FQ3A 4SGAE 1C5NH 1RFNA 2FOMB 2CJIA 4YT7H 2P93A 5F6MA 1EOLA 4K1TA 1T31A 1ZSLA 4LZ1H 1AB9B 3L6PA 2AGEX 2DUCA 5DP3A 3FFGA 1NFUA 2W3KA 1WQSA 2BQWB 3NCLA 1FY5A 1WYKA 4JYTA 1BCUH 1OWDA 3UOPA 1FPHH 1VZQH 2CHAC 2NU2E 3DFJA 3P8NA 3UR6A 2JJ2D 2XOKD 3V12A 1IQEA 4KTUA 4XBDA 1HJAC 1C1RA 1O2OA 2BMGB 3STJA 1C5VA 3LH1A 1C5UA 1XMNB 3T25A 1DFPA 1P8VC 2Z7FE 3A7YA 3KN2A 3UY9A 3BTGE 2WYGA 1GVZA 2ASUB 5T6FA 3HK3B 5BRRE 1MAYA 1VJ9U 3I29A 3SU5A 1QURH 1ZJDA 1T8MA 1NBMD 2ZI2H 1LPZB 1AE8H 3DT0H 3F9HA 4ACBA 2HOBA 1TOMH 1N8OB 3QO6A 1WV7H 1A0JA 4ASHA 1KDQA 3MO3A 2SGAA 1O2XA 1C2JA 1AKSB 1H9HE 1LO6A 2AYWA 1GBFA 1QRWA 3EAJA 1T32A 3FZDA 1SKYE 5AFYH 1OS8A 3PM3A 1QR3E 1O3EA 1O2YA 1O3DA 2A5IA 3ZZ3A 2ZA5A 3SI4H 5EW1H 2IJD1 4RN6A 1HXFH 1ZRKA 4OGXA 2FOAA 1VITG 2OTVA 1HAZB 1NFXA 1TFXA 1VGCC 1UCYE 1G3EA 2TGDA 5LPFA 4NCYA 1CHOF 3SUFA 1IQFA 1DX5M 3RXCA 2BDAA 3OE7D 1AFQB 5FXLA 2OC7A 3DFLA 2Y5HA 1HIAB 1ZGIA 4BXSA 1G2MA 1C5SA 1GGDB 2UWLA 1QNJA 2EEKA 4NWKA 2O8TA 1EAWA 1MU8B 2WUCA 1QA7A 1UTQA 3BF6H 4B6FA 1O3LA 2ZFQH 5L6NH 3RXIA 3ZZ5A 3LGIA 2ZGJA
chains in the Genus database with same CATH topology
4X1RU 2K1QA 1DWCH 1E34B 4FUHA 2Z9IA 2XC4A 1K1NA 4FU9A 3AASA 1TNKA 5IYTA 1KLIH 4CREA 1CA0B 1ETTH 5ABWA 4K1SA 4UFDH 2NU0E 1LHCH 3A84A 1GMCG 1XUKA 1MMJN 1DANH 2V3HH 4JCNA 1TRMA 1F0TA 1K1LA 1O2MA 1XUIA 1FN8A 2FX4A 3C1KA 2OD3B 1K1OA 3BEIB 1GCDA 2ZIQH 1LQEA 5A8XA 3B23B 1C1WH 6CHAC 1GDUA 1O5GH 1C5WB 1C2DA 3SV6A 4YOIA 1MQ6A 8GCHG 1IOEA 1GHWH 4INHA 1UCYH 4K5ZA 3LGVA 3QX5H 2C4FH 1UTKA 2AIQA 1GCTB 4UONA 1HUTH 3TLOA 3LPRA 2A4OA 3UOUA 1GJBB 2BYAX 1QB1A 2BLOA 3LGWA 6GCHG 5F03A 1O39A 2G55A 4WXIA 4ABEA 1ZLRA 1P12E 1ZMNA 3GY3A 4IBLH 3HGPA 2ZHWH 1J14A 4NG9H 2ZFTA 2PKAA 1O3FA 5J4SA 5GWZA 3EQ0H 1S0QA 4CR5A 3G01A 4AFQA 5E0JA 1GI2A 2PKSC 2FX6A 3GOVB 3RXJA 1EZQA 1L1NA 1TWXB 2Z9JA 4AYYB 4AB8A 2UWOA 1BMAA 2Y5GA 1YPKH 2FOHA 3RXTA 2ZTZA 5F8XA 4KP0A 5EPNA 1ZSJA 2ANYA 1P2MA 1GJCB 5C5OA 2B9LA 5AVDA 3UQOA 3A7XA 3NPSA 1J8AA 3GYLB 2QC2A 3NZIA 4FVBA 1BTYA 1KXDA 4INKA 1CT4E 2HWLB 5JB8S 1O3NA 1D6WA 3VGCC 2NWNA 4YLUA 3Q3KA 2CV3A 2BHGA 5E2OA 4Y7AA 3VXFH 2FIRH 4A5TS 1TGSZ 3BTDE 3UREA 1IQKA 3IG6B 2ZDAH 5I25A 1GHBF 1O5DH 1YP9A 2AGIX 1MQ5A 2XXLA 1CBWC 4NZLA 1BB0B 3Q00A 4ISNA 2H9EH 1ELBA 1F5KU 2FOGA 4B2CA 4X1PU 1G3CA 3VB5A 1O2HA 1QBOA 1CT2E 1YF4A 1V2RT 1MZAA 3ZVFA 1A0HB 2YNBA 1C1SA 4NIWA 3ZZDA 1GMDG 3S9BA 1NRSH 3ZZBA 1SC8U 4XE4A 5DJ7A 3RXSA 2OUAA 2VWMA 4CRGA 2ANKH 5T6DA 5SGAE 1ESBA 3S7KB 3H5CB 3MNXA 3RM2H 1UHBA 5LPRA 1RXPA 4AOQA 4B2AA 2THFB 1JRTA 1Q31A 3GCHB 1HB0B 3AAUA 4BAOB 4E05H 1TNHA 3FAOA 2J9NA 3M7QA 4HZHA 1B5GH 1NO9H 1KSNA 2ZHQH 4XBCA 3FANA 1GBEA 2BY5X 2JH5D 4OS5A 1UTNA 1SGYE 3M36A 4DIHH 2HPQH 3SNAA 3UWIA 3SN8A 1GBTA 1SLWB 3RLYH 2XCFA 2FLRH 2ZWLH 1P2JA 3KQCA 5A09A 1XUJA 3VB7A 1ANCA 1WSSH 3UNQA 2BXUH 2A45B 4X6MA 3SHAH 2OBOA 5HGGA 2AGGX 3A85A 2VVCA 3RUOA 3K6ZA 2CF8H 2BQ7B 1Z8JB 1YPGH 1TPSA 2XCNA 1Y59T 1V2ST 2IPHA 3GCTF 2FOEA 1TAWA 1YM0A 1DE7H 1YPHC 2FMJA 1JIMA 1DY9A 3KQDA 3K9XB 2ZCLP 5FPYA 1A5HA 3NKKA 4K8BA 1AUTC 2HPPH 1QL7A 4IN1A 3JZ1B 1AU8A 1O3HA 3Q77A 2A0QB 3AAVA 1BJUA 3KEEA 2Q1JA 3BG8A 3SQHE 1QFKH 1W11U 1TPPA 1CU1A 2VGCC 3KGPA 2PW8H 1GHVH 1MKXK 1P2NA 3LC5A 1UTLM 4FUJA 1FJSA 2XWBI 4I8GA 1TALA 1O5BB 1UVPA 4WVPE 3ZZ4A 1IQGA 5A0AE 3M7UA 4AGKA 2J92A 2ZU2A 4OS6A 5AFZH 3OTJE 1P0SH 4H6TA 2FXRA 2EI8A 5DP7A 1SOZA 1O31A 4X2XA 3MNCA 2GKVE 4CHAC 3IWMA 4VGCC 1C4U2 3OY6U 1OWKA 4IGDA 1TQ0B 3PYHA 3M5NA 2OC1A 3VB6A 3PTNA 4X8VH 1SGTA 2ZECA 3T5FH 2FS9A 4FU8A 1NFWA 2O8LA 3PLPA 3TH2H 5HM9A 5EGMA 2Z9LA 3PO1C 1EAUA 1O3OA 3SW2B 3EYDA 2PSYA 1Z1IA 2FYRA 3A88A 1F0RA 1H9LB 2FTLE 3B8JA 4DIIH 3SJKA 3PB1E 3SHCH 1X7AC 3SUDA 3R0FA 2VH6A 1TA2A 1Z8RA 1SGQE 2A31A 4B74A 5IDKA 1NS3A 1O0DH 4FUIA 1SR5C 1GHZA 1K1IA 2IN2A 3M37A 2CMYA 3BTKE 1D3TB 4GVUA 2FP7B 1KXCA 3ZZ7A 1XUFA 1O32A 5C20A 2P3UB 1O34A 2R9PA 3I77A 4BAMB 1AIXH 2G8TA 1BA8B 5FCRA 1G9IE 2QV1A 3TK5A 1Y5AT 4X1QU 1FDPA 1S85A 4J1YA 2FOCA 3JZ2B 2ZO3H 3T62A 2HLCA 4CBOA 2BQ6B 1TX8A 1EZUC 1HAIH 2J38A 2RA0A 1N6YA 4ZXYH 1CQQA 2GDEH 1TYNA 3SJ9A 4X2VA 1GL0E 3RXLA 4DG4A 1K1PA 1LHFH 5T3HA 4ABBA 1O2NA 2J2UA 1ELFA 1XKAC 4ZKSU 1DT2A 1FV9A 4Q80A 1C2HA 4B76A 2GV7A 4K8YA 1RTKA 2PSXA 4O9VA 4B1TA 1DUAA 1RIWB 2HNTF 4Y71A 1V2WT 5GIBA 5EW2H 2Y81A 1KXEA 1GJ5H 1ZHRA 4JZDH 5E0GA 3SU0A 2STAE 4GAWA 2WV4A 1CSOE 4ZHLU 2FTMA 1NN6A 4X1NU 1RTLA 1OWHA 2ZU5A 4I31A 1ELVA 1BRBE 1UTMA 3HGNA 5ESBA 5FCKA 1A7SA 4IMQA 2AMDA 1O3KA 4IC6A 1TONA 3TIUA 1P02A 5DGJA 3T27A 1A5GH 3TNTA 3EDXB 3A7VA 3LC3A 3VFEA 1YLCA 1GJ8B 3LH3A 1FY1A 4HTCH 3URDA 4MPVA 3SGAE 3ATIA 1SGFA 2VIWA 4KTSA 3QZQA 1BBRE 1MTVA 1TNJA 2XC0A 1O2TA 1SL3A 1GI8B 1W0YH 2DE9A 2W26A 3ZZCA 1SI5H 2QN5T 5LGOA 1NESE 2OXSA 1FMGA 2G4UA 2OC0A 3SUEA 3SV8A 1CO7E 4IC5A 1A46H 1TBZH 2ZTYA 3RMNH 4RKJB 5L2ZH 4XSKU 1HPGA 1O2RA 1ID5H 3MU0A 3PV4A 1C5MD 2BY9X 4TY7A 1F0UA 3ZYDA 2SGFE 1QGFA 2XBVA 5EOKA 3RXQA 2TGPZ 2P8OB 4BAKB 1O36A 4NA9H 2XW9A 1XVMA 1C4Y2 1NRNH 9LPRA 2Z3CA 3RM0H 3SV7A 3URCA 3RMMH 1PPBH 2Z9GA 2TPIZ 1AQ7A 3A80A 3BTFE 1YPHE 1BTZA 1LPGB 4K60A 1P2KA 4WXVA 1ELEE 1WTGH 3U8RH 1FPCH 2Y80A 1HAVA 1CE5A 4R0IA 1A3EH 2ZU3A 1O3BA 4J2YB 4NA8A 3PMAB 2NU1E 1QRZA 3CENA 3QK1A 4ABGA 3M35A 4D9RA 2BDCA 4HI3A 4U32A 1G3BA 1G32B 4ISOA 1QBVH 1IHSH 3ZVAA 1ZPCA 4CBNA 1V2QT 3S0NA 4X2YA 2O9QA 1LHEH 3M3TA 5EXNA 7ESTE 1J17T 1Z8IB 4ISHH 1AWFH 1AVXA 1MTSA 1YPLH 5FX5A 1IAUA 2VWNA 3AVZA 3LOXA 1ZTKA 4ABIA 2CXVA 3F6UH 2XTTB 1BRCE 3ODFA 4MPXA 3FZZA 2Y6TA 1A2CH 1V2PT 4UE7H 4DCDA 3NK8A 3DD2H 4Y8XA 3FP6E 1NRPH 1ZMJA 2ZEBA 3BTTE 4Y6DA 1G2LA 3F68H 2G5VA 1TX6A 4CH2B 1ZTJA 1GG6C 3RDZA 3TK6A 4NFFA 1HYLA 1O2UA 4GCHG 1GBLA 1QHRB 1RGQA 3RXKA 1DWBH 3KF2A 1J9CH 2V3OH 2GD4B 1O2QA 1D3PB 4JYVH 3RXDA 1CGJE 1HLTH 1V2NT 5GXPA 2ZFRH 4MPUA 1BUIA 3OY5U 2STBE 5FPSA 4ABAA 1BTXA 2BVXH 1Y3VA 2P3TB 4U30A 1TIOA 5HYOA 1S0RA 2RA3A 5C5NA 1TNGA 2FODA 1QL8A 1U6QA 2A5KA 5J4QA 2V0BA 1GI3A 4I8LA 1O35A 4RSPA 2BD4A 2PLXA 4UEHH 2B0FA 1GJAB 1DSUA 2ZKSA 2P16A 1O33A 2TBSA 5EODA 3PLKA 2VNTA 4O03A 2Z3DA 1GI0A 1S83A 3ITIA 1Z6EA 3ZVCA 1J15A 3RXBA 2ZP0H 3O8BA 1YCPH 1MKWH 2AMPA 1MU6B 1ZSKA 3UNRA 5EG4A 1HFDA 4AFZA 2H1UA 4MNYA 1MCTA 1TQ7B 1SQOA 4FUCA 1QJ7B 2BD7A 3U1IB 4YOGA 2SGQE 1DM4B 1TMUH 1YPMH 2A7JA 3B9FH 1L4DA 1AB9C 1QL9A 1FY3A 2OINA 5L2YH 1VJAU 1KDQB 3RLWH 1JRSA 5GDSH 3SJ8A 3SNCA 3MTYA 1UJ1A 5JBCS 2M5TA 1VITH 3QWCH 5CE1A 5C1UA 3GY2A 1RTFB 3MOCA 5CMXH 3KQBA 1P03A 2ZU4A 3HK6B 4H6SB 1NZQH 2ZHFH 1Y3YA 1VITF 1S6FA 2JKHA 7GCHG 3SOSA 2UUFB 1TBQH 1HNEE 4LOYH 2ZDLA 1GVKB 2WPHS 2CGAA 2PV9B 2R0KA 1N8OC 1YC0A 1UTPA 1XKBC 2ZGXH 1BQYA 2GGVB 4D76A 1EB1H 1P11E 4I8JA 4A1VA 2C3SA 2BD3A 2KAIA 5FX6A 4X6OA 2R3YA 4D8NA 5GJ4B 4BAQB 1EX3A 2AH4X 2BDGA 1Z8GA 4Q7ZA 3WY8A 1QBNA 2ZTXA 1TGNA 1OKXA 1KYNA 2BM2A 1S81A 1AN1E 2SGEE 2GZ8A 1F7ZA 1W8BH 2FZZA 2PTNA 1UK2A 4GLYA 2H5CA 1SHHB 2PTCE 1GI4A 1P57B 3GCNA 3AW1A 2F83A 4BAHB 1O2LA 1FXYA 5A2MH 1IQMA 1PPEE 1AFQC 2ALPA 1Z6JH 5FBIA 5LPEA 1GMCF 1ZHMA 2SGDE 1P01A 1IQHA 4AORA 1OP8A 4CRCA 1GGDC 1YGCH 1QA0A 2F9VA 4Y11E 1EQ9A 4AFUA 4MTBA 1T8OA 2A32A 2BOKA 4LZ4B 3GY5A 3UTUH 1ZYOA 3MH6A 3A87A 1V2MT 1ELCA 4Y0ZE 2I6QA 8GCHF 4DVAU 1ELTA 2Q6DA 3GY8A 1O2WA 4ZKRU 4GPGA 4LXBH 3MU4A 1N1LA 4NZQA 1DS2E 4ZROA 2ODQA 3ZVEA 1LVMA 1C1VH 1PQ8A 2A7HA 1BMMH 3TH3H 1CA0C 4WH6A 2BD9A 3KCGH 4I8KA 4X8UH 1L2EA 4A7IB 4ABDA 4D7GA 6GCHF 3LT3A 2BB4A 2ULLA 2F9NA 4Y10E 1OPHB 2PKAB 2F9PA 2XBYA 4MG3A 1E0FD 2A4RA 2GCHG 2GV6A 1QIXB 1C5XB 1C2MA 3S9CA 1CHGA 3BTEE 3MH7A 1ZPBA 3SO3A 1H1BA 1ELDE 4JMYA 3BN9A 5G4BA 1GBIA 1NT1A 1GCTC 5E0HA 2CN0H 2OCVB 1C5OH 3D62A 1MUEB 9ESTA 1UO6A 5H4IB 5A0CA 1XM1A 1O5AB 1A3BH 3Q3YA 1GL1A 2PUQH 3TITA 1GJ9B 4NIVA 4JK6A 1HXEH 3L3TA 1EAXA 2VIQA 5DP5A 2LNCA 5TJXA 1GBBA 1Y8TA 4SGBE 2SNWA 1MTNB 2Y5FA 3OSYA 1C5TA 1P06A 2ZF0H 3HPTB 1AE5A 4A1XA 5C3NA 2A5AA 3E91A 3SGBE 3P92A 2VWOA 1QB9A 1E35B 2A2XH 2TGAA 4ZHMU 4CH8B 3ZZ9A 3RU4D 1UTJA 1BTWA 1OOKB 5AF9H 1C1UH 1OXGA 1SLXB 1QY6A 4FU7A 4GHTA 4FUDA 2GCTB 2J94A 1FONA 2BDYA 1W13U 3LJJA 1EJNA 4IN2A 4JZ1A 2NU3E 4I7YH 5ETXA 1Z1JA 3TGIE 4R8TB 2XC5A 4ABJA 5DP4A 1NPMA 3D23A 1BMNH 1P9SA 4KTCA 1BHXF 3Q3XA 3M5OA 1D9IA 3TJOA 1A0LA 1TGCA 4NGAH 1GMDF 1THRH 3TH4H 2VVVA 2QXHA 4K2YA 1BRAA 4TYDA 3GISB 1SQAA 1UHBB 2ZZUH 5JBBS 4Q2KA 2GMTB 1P2QA 3EA8A 1C2EA 3RC4A 1SPJA 4HFPB 4TPIZ 5JPMH 4ZKOU 1NRRH 2J4IA 4JK5A 3S9AA 2IJOB 1TMBH 4MNXA 1O30A 1LHDH 1YKTA 1EPTA 2XNIA 3M3SA 2JETB 3ZVDA 2B5TB 4WWYA 4JZFH 2OQ5A 4OS7A 3KQEA 3K2UA 4YO9A 1CA8B 5BPEA 1G3DA 4UD9H 2PHBA 2FM2A 2HGTH 1W12U 1F2SE 1W7XH 1T4UH 3SUGA 2VIVA 1A1RA 1ETSH 2FOFA 1Y5BT 2B8OH 2W5EA 4Y79A 4DJZB 2R2MB 1AMHA 3LU9B 3TU7H 2VU8E 4XBBA 4D9QA 1AHTH 2A4GA 4MPWA 2OQUA 4OGYA 1PPZA 2C8YB 5CHAB 1RRKA 1AZZA 2HALA 3GCHC 1K1MA 2BDHA 1AZ8A 2YOLA 4DW2U 3W94A 4M7GA 1O2IA 2ZFPH 1KXAA 1DWDH 5EQRA 5DP9A 3RXEA 1BT7A 2A1DB 4Q7YA 1V2TT 5FPTA 1EOJA 4Q7XA 3SNEA 1O38A 5JBAS 2RG3A 2ESTE 2BDBA 4DGJA 2AEIH 1LVOA 1BTHH 2BVRH 1W10U 2C93B 1EJAA 1RD3B 2PGBB 1K28D 2D2DA 5GPIB 2AERH 3A83A 2ANMH 1YPEH 4DY7B 4IS5A 3KNXA 1RJXB 3SU6A 1MBMA 3SORA 1SHYA 1V6DA 3UPEA 4CRDA 1SG8B 1BOQA 4BTIB 1E36B 4A92A 3U8TH 2ZU1A 2Y7ZA 3ZZAA