1Q31A

Crystal structure of the tobacco etch virus protease c151a mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
227
Chain Sequence
LFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEMNELVYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, hydrolase
molecule keywords Nuclear inclusion protein A
publication title Crystal structure of tobacco etch virus protease shows the protein C terminus bound within the active site.
pubmed doi rcsb
source organism Tobacco etch virus
total genus 52
structure length 227
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A02
3UQOA 4INKA 4NSVA 1ELVA 1C2GA 1TLDA 2FPZA 5EGMA 4K1SA 2GT7A 4Y8YA 1BRBE 3EQ0H 2GD4B 1D3DB 4IS5A 4HZHA 4NFEA 1FN8A 1WSSH 4FU7A 1C5XB 1UVTH 3M37A 3P92A 1SGRE 3UOPA 1ZRBA 1LMWB 2PSYA 1SGFG 2Y5FA 3PLKA 5PTPA 3M3SA 1QQUA 1ZTLA 2VGCB 4Y8XA 3MHWU 2QXGA 3IG6B 2AFQB 4TPYA 1P2IA 1TRYA 3LT3A 5LH8A 5EU8A 3TU7H 2C93B 3KF2A 2A5KA 4CH8B 1AKSA 2OC7A 3BTDE 1UTMA 5T6FA 1HJAC 4KP0A 1SQTA 1LTOA 1KTSB 3A83A 1XUHA 1CU1A 1DE7H 1BBRK 4TWYA 1AVGH 2Z94A 4MVNA 1NO9H 4MPUA 5ESTE 4LK4A 2PUXB 1TAWA 4WY3A 2FOCA 1CE5A 4K60A 1HAHH 1MBMA 1RIWC 1F0UA 4B2AA 1LQEA 4DVAU 1C1MA 1W3CA 2VIOA 3A8CA 1DANH 4ABDA 3RU4E 6ESTA 1K1IA 5A09A 1K1PA 3MOCA 4ISIH 3A82A 1A5IA 3KQEA 4U2WA 5LPEA 2PSXA 1SLVB 2CHAB 4JYUH 1A0LA 5AF9H 1V2OT 2VVCA 4K69A 4AYVB 3URDA 2BD7A 3NZIA 1P12E 3P8NA 3O8RA 1W14U 2THFB 3ODDA 1DPOA 1ARBA 1ZTJA 1J9CH 3ZZDA 1WTHD 3PO1C 1F5LA 2FZZA 1S6FA 4GUXA 1O3MA 1MCTA 3U8TH 4CBNA 2HLCA 3VB4A 1Q3XA 1FIZA 1IQHA 3GDVA 5A0CA 2ZU2A 3RXDA 1QQ4A 2FX6A 1O5DH 2ZDAH 3RXVA 1O3LA 1HNEE 3B9FH 3U8RH 1ZSJA 5C2ZA 1O32A 4CR5A 1NFXA 1EKBB 1MTNB 4O3TA 3ZVGA 1BZXE 4MLFB 4YTAA 3CP7A 5F8TA 1BUIA 1ZGIA 3VPKA 4GLYA 1QCPA 4ZHMU 3T29A 3ZZ6A 3A7ZA 1AFEH 2F3CE 3UREA 1IQLA 2Z9LA 2ODPA 1PPGE 3SV2H 1GI2A 1GGDC 1TE0A 4NA7A 1JRTA 3SW2B 3FP6E 1KDQA 4IC6A 5DP3A 2TBSA 1K1NA 2BQWB 2BOKA 1JIMA 1EQ9A 3KGPA 2G4UA 1GMCG 1SLXB 2Z9JA 1O3GA 4D7FA 1XXDA 4AN7A 5H4IB 1SMFE 1C1VH 3SJIA 2O8WA 3M5LA 5FCKA 2ZDMA 1C1RA 1SQOA 2SGPE 4NCYA 4AGJA 3A80A 1QB9A 2B0FA 4Q2KA 4OS1A 1ZZZA 2DE8A 1XVOA 2RCEA 3BIVH 2SFAA 2ZTZA 2BDHA 4H6TA 3LU9B 3GYMA 1C2KA 2WPMS 2ZGXH 1HAIH 5C1UA 2BY5X 4ESTE 5FBIA 1TMTH 2ZG0H 2W26A 1O5CB 2XC5A 2O8MA 2PV9B 3K6YA 3SU5A 2GGVB 1LPGB 1KY9A 1IHTH 2H9EH 3OY5U 1F92A 4WH6A 1FAKH 1FPCH 1YPJH 2XBVA 4U01A 1P2MA 4X1RU 1GL1A 1EJMA 3B23B 4RKJB 2G55A 1EP5A 3LDXH 5TJXA 3PM3A 3EA9A 2F83A 2HPQH 1W13U 1Y3YA 4FVBA 1O2KA 5JBBS 1EPTB 1TNGA 4NG9H 1OX1A 4FXGH 5E2PA 3DHKH 1W12U 5B6OA 2Y7XA 1HRTH 3URCA 2XC4A 1ELCA 1UVSH 3M3VA 1Z8JB 4IC5A 1DS2E 4U32A 2H5DA 3M7QA 1HXFH 1Z1IA 4ABHA 1KLJH 3DFLA 1GJ6A 2ZIQH 4JK5A 2OP9A 3RXUA 2BD8A 3EDXB 4B1TA 4DIHH 1BMLA 1UTOA 4AFQA 4ZMAH 1V2KT 4X6MA 3I29A 2AIQA 2ZTYA 4I31A 4DCDA 1D4PB 1MTUA 3LGYA 3L6PA 2XNIA 4X2WA 1A5GH 1S82A 2XYAA 1K1OA 3GCOA 2GCTB 4H6SB 3MH6A 1GVZA 2RA3A 1MTSA 1HDTH 3PROA 1V2VT 1EASA 1KIGH 3P95A 4K8YA 1ZTKA 4FVDA 2P93A 1FONA 3SNAA 1CHOG 1J15A 5T6DA 1LDTT 1T4VH 2H5CA 3RC4A 4TY6A 4CHAB 4RN6A 3SV8A 4FUEA 5CHAC 3RXEA 1O3AA 2ALPA 3UWJH 1TBRH 3ZVEA 1EZXC 2A0QB 4BOHA 1KXFA 1V3XA 1QBNA 2ZECA 3MFJA 1MKWH 1O2XA 1OSSA 4KGAA 2A2XH 4YZUA 1YCPH 3SU2A 1FMGA 4WXVA 3RXAA 1Z1JA 3PYHA 1LVOA 2CF8H 1NC6A 1GMDF 2FI5E 3P8OA 1V2JT 1QHRB 3RXLA 2YNBA 1CVWH 3TJNA 4DIIH 3BSQA 2TGDA 1NFYA 1TX7A 3SGQE 2Z9GA 1CT4E 3SV6A 2ODYB 5ETXA 2WV5A 1AY6H 2TPIZ 3SOSA 2ZF0H 1O2IA 1PQ7A 4DGJA 1XX9A 2ZFQH 1O5BB 2Y5GA 3I78A 3TITA 2WV4A 3RP2A 5EQQA 1V2LT 1L1JA 1V2MT 1HFDA 2F9NA 3RU4D 1DSTA 2NU3E 1TA6A 1BDAA 3UNQA 4LZ4B 4ABBA 4GPGA 2XW9A 1E38B 3W94A 2ZCHP 1AO5A 3F9FA 4NIWA 1FN6A 1LHCH 1WOFA 1A0HB 2NU1E 3LONA 5EXLA 9ESTA 1ZOMA 1DFPA 1FY4A 3HGNA 2FMJA 2Y82A 4KTCA 3RDZA 3VGCB 1TQ7B 4J1YA 3T5FH 4YOIA 5AHGH 1OKXA 1TGSZ 1SOZA 2QF3A 5JBCS 1IQJA 3TIUA 1UTNA 1O3JA 1EOJA 2ANWA 2DE9A 2V3HH 3M5OA 2EC9H 1T8LA 2OLGA 4MTBA 1ANEA 3Q3YA 1TPAE 3ZVDA 1GL0E 1VJAU 1GDUA 3RXQA 4Y71A 1AKSB 1F2SE 1W7XH 3E8LA 5E0JA 1Z71A 1AUTC 1EB2A 3ATIA 3OSYA 2AMQA 1QY6A 3LPRA 4OS4A 3P8GA 1SOTA 1THSH 3QTOH 1GHBG 2B8OH 3O8BA 4ZAEA 5FBEA 4ISOA 1QL7A 3GOVB 4OS5A 3OU0A 2K1QA 1KXCA 4PROA 3TJOA 7KMEH 1G37A 1UTQA 4XFQA 1ELFA 3A87A 1D3QB 2WUBA 3ZZ5A 1V2QT 1OWIA 4RSPA 1PPCE 1C4V2 3QN7A 2UUYA 1BMAA 3A88A 4IN2A 3U1IB 1TFXA 4ISNA 1FY8E 1O3HA 1GJ5H 1MAXA 1AZZA 4BAQB 1H1BA 4IMQA 3N7OA 3LGWA 3ODFA 1YPLH 1O2HA 3ENSB 1KLTA 1P03A 1RRKA 6GCHF 5TCCA 1ARCA 2JH5D 1TQ0B 2LNCA 2ASUB 2ZDKA 2VIPA 1RS0A 1QBVH 2TGTA 1G2MA 1KXEA 4AFSA 1PQ5A 3L33A 3GCTG 5G4BA 3V7TA 1WYKA 2V35A 3LOXA 1GBAA 5I25A 3QZRA 1QBOA 4FUIA 2VIVA 1P01A 1GHVH 5FX6A 2C90B 2VWLA 1O31A 3VB5A 1OS8A 1AVXA 2C8WB 4ZHAA 3F6UH 3C27B 3K65B 1HLTH 1UK3A 2GX4A 3RMMH 4OS6A 2ZU5A 3VXEH 2P95A 3A81A 3O8DA 1ZJKA 3AAVA 3RM0H 2FIRH 1C9TA 1N6YA 1ZHPA 3WY8A 1C5NH 6CHAC 2SGFE 4CRGA 1G3DA 1HUTH 1Q2WA 3P70B 3ZV8A 2WUCA 5EQRA 1DICA 2W5EA 2QC2A 1TBZH 1QNJA 1SLUB 4OS7A 5GIBA 4Y0YE 1O3BA 1GHWH 1ABIH 2R3YA 1DITH 1GHAF 2XBXA 1P8VC 2W3IA 3CS7A 3KN2A 3QWCH 1CHGA 1LVBA 3KHVA 1AIXH 4D8NA 3T28A 4AB8A 1BQYA 1KDQB 3LGVA 4WH8A 2Y5HA 1O2MA 1O34A 1XVMA 3GY7A 8ESTE 1HAPH 2ZFFH 3NKKA 5T3HA 3S7KB 3TLOA 1GHYH 3ZZ7A 2GDDA 2XTTB 1CGHA 5JBAS 3UY9A 2D2DA 3UWIA 3M61U 5JYIA 1EAXA 1OYTH 1LHGH 1O3NA 2BDBA 1VCQA 4KELA 4INLA 2JETB 2FTLE 2D26C 1GG6B 2FOBA 2A32A 1C5ZB 1P2JA 4DJZB 1CGJE 2A1DB 1OP2A 1ZMLA 1FPHH 1P3EA 1L1GA 1B0EA 1HAGE 2KAIA 5L2ZH 5GPIB 2Q6DA 2VVUA 4ASHA 4X6OA 5CMXH 4AORA 3SNBA 1CT0E 2A45B 1IQEA 2FOEA 3A86A 3PMJA 1LO6A 4NWKA 1AFQC 1FQ3A 1D3PB 2BVSH 1FUJA 2WINI 4AOQA 3ZVFA 1TX6A 1YM0A 4Y79A 4MG3A 2AERH 3E3TA 1UTPA 2BYAX 3M7UA 2ZU1A 4BAKB 7GCHG 2PTNA 2HGTH 1ELAA 3MNXA 1O37A 2ZQ2A 2H9HA 1P0SH 2RA0A 1C5RA 2G5VA 3MO3A 1MZDA 1GBKA 2ZPQA 2VGCC 1GVLA 1C2MA 1A4WH 2ZFPH 4JZ1A 1DOJA 1O5FH 2QA9E 1T32A 1ELBA 3M7TA 1NU7B 1IQIA 1BJVA 1G32B 4UONA 4ZXXH 3RXMA 3SUGA 1TWXB 1GBIA 1MAYA 4UFEH 4YT6H 8GCHF 2G51A 1K28D 1QIXB 2A5AA 3HKJB 1ZPBA 1BB0B 2ZFTA 2BX4A 4GCHG 1YPKH 2BXUH 4X1QU 1C5WB 5DO4H 1GBBA 1SGYE 2R2MB 3RXBA 1P2KA 4HTCH 1EX3A 1NFWA 4AFZA 3PWCA 1YCPM 2BZAA 5FPTA 4WMFA 1TGBA 2H6MA 2OQUA 1TMUH 2JKHA 1TA2A 2CHAC 1AB9B 5J4SA 2I6QA 1TGNA 3OY6U 1GI6A 1W10U 1C5YB 5GWZA 1RJXB 1W2KH 2Q1JA 1Y3VA 5F03A 1Y3WA 2BLWA 1V2TT 1EOLA 3LIWA 2BVRH 1DVAH 1O2UA 1TNHA 1ANDA 2J94A 4X2VA 2GV7A 2QIQA 3TGJE 5DP9A 1UK4A 2EA3A 1C2IA 2VH6A 3EA8A 1TALA 3U69H 2GCHF 3HKIB 1C5TA 4K5ZA 4ZKSU 5GJ4B 2QGRA 3BTTE 2GV6A 2A4GA 1WTGH 3E16B 3E0NB 4SGBE 1AWHB 3MTYA 2CV3A 4K8BA 3S7HB 3CENA 3P6ZB 2W7SA 2BHGA 4E7NA 1IAUA 1UMAH 2ZA5A 1RIWB 1TABE 4X0WU 2GMTB 5EW1H 4MDSA 1C5PA 1SPJA 3KNXA 2LPRA 3MNSA 2C8ZB 2STBE 3SI3H 4YT7H 1WBGB 3SJ9A 1CSOE 4JYTA 1FIWA 1VITH 1YPHE 3EYDA 4XDEA 1E34B 4CRFA 1E36B 3SZNA 2BB4A 3OX7U 1JIRA 3H5CB 1UVOA 2PW8H 2ZI2H 4CR9A 3TVJB 3SORA 1A46H 4Y0ZE 2YOLA 1SQAA 1P10A 1IOEA 1ID5H 1S84A 1J14A 1OP0A 4DOQA 1BA8B 3Q00A 1A1RA 3ZZCA 1QURH 2ZCLP 2ZNKH 3S69A 4FUJA 1BTYA 1E0FD 1NY22 1XUJA 1OYQA 3NPSA 1C4U2 1HB0B 3KL6A 4OS2A 1V2UT 1BMMH 5AFZH 3UIRA 3BV9B 2ZHFH 2PWXA 4FUGA 1AE5A 1HAVB 5JBTA 1E37B 2ZFSA 4UEHH 3LGTA 1PYTD 1KSNA 2R0KA 4AZ2B 1G36A 1FY3A 2Z3EA 3SI4H 1H9IE 1N8OC 1GMHF 2OINA 3OTJE 1FZZA 1PPBH 3GY4A 3H7TA 1JXPA 3GISB 1ZPCA 2ZHQH 6LPRA 1AE8H 2G5NA 1HGTH 3TH4H 2PHBA 4IW4E 3NXPA 1T8MA 5GDSH 1FNIA 2JH6D 1LHDH 1GBDA 3MU8A 2QXHA 3RMOH 1SGIB 1Z6EA 1K21H 2AEIH 4ZKNU 2VNTA 1KXBA 3MU5A 4IN1A 1GHZA 1DM4B 3BEUA 1F7ZA 2FOGA 4XBCA 3PB1E 1GI1A 4X8UH 4ABJA 2F91A 4K1TA 3P8FA 4WMDA 4ZH8A 1FY5A 3MU4A 4IGDA 2BDIA 4BXSA 5E2OA 5DKMA 1O2GH 4A1TA 4NSYA 1P9UA 1EPTC 3SNEA 1C2DA 1DXPA 3SJKA 1C9PA 4RKOB 3SU6A 1H4WA 4XSKU 1O3PB 2AGIX 1H9HE 2VWMA 3DUXH 2ZPRA 1DSUA 1MKWK 4JYVH 4ISHH 4B73A 1ANBA 1TOMH 3S9AA 4J2YB 1YCPK 1NROH 2BY8X 2BD2A 2XBWA 3MU1A 4I33A 4U30A 2Z6BD 1C5QA 1MH0A 3LJJA 1D3TB 1O2QA 4DY7B 1MD7A 1UCYE 5L30H 2P8OC 3FZZA 1C1UH 4GAWA 3K9XB 3BG8A 1ZLRA 2O8LA 3MNCA 2OTVA 2BDCA 1ZJDA 1XM1A 4BAMB 3QTVH 5BRRE 5HYOA 3A89A 3VXFH 1GBHA 3MI4A 2GCTC 3NK8A 1AUJA 3V3MA 2Q6FA 2XBYA 4X6NA 4UDWH 1O33A 3MH5A 2RG3A 1SGCA 1CT2E 1DT2A 1V2NT 2FODA 2SGDE 1OWKA 5C20A 2RDLA 4JZIA 3U9AH 1F5RA 3DT0H 4KTSA 4I8JA 2VB0A 2GT8A 1FDPA 3UOUA 4CBOA 1O3KA 1UTLM 3TGKE 1S5SA 1AMHA 2QCYA 3ATKA 2FM2A 1O3IA 4B74A 1O3OA 1JBUH 3A7YA 1TNJA 1YBWA 4B75A 1GI8B 3RXKA 1FAXA 4K3JA 5LPFA 3SNCA 2GVFA 1QRZA 2ZWLH 3Q3KA 4CREA 1NU9A 1ZSLA 1AHTH 4MNVA 1EXFA 5HGGA 1S0QA 2OBQA 1NRQH 4X1SU 1K2I1 1OWHA 3K2UA 5FPYA 2F9UA 1BIOA 1ZPZA 2IOTA 1QL8A 1VZQH 1C1TA 1GBJA 4FUDA 1SGDE 3D65E 1LHEH 1WQSA 5AVDA 4ABEA 3LH3A 5DP8A 1EZQA 3AW0A 4FUCA 1J17T 1MU6B 1NT1A 1A7SA 2V6NA 4Y7BA 2HRVA 3LGUA 1Y59T 2BY9X 4XE4A 1CA0C 3SNDA 5LPRA 3MWIU 1O5AB 4MQAA 2ODQA 2AMPA 4XOJA 5C1YA 3DD2H 5FX5A 1A3BH 4K1EA 1U6QA 5SGAE 1SI5H 4QT8C 3U98H 3MNBA 1MTVA 1AU8A 1UCYH 2W3KA 3AW1A 1SBWA 3VEQB 2A4QA 1RTKA 1T7CA 2ZHEH 4AG2A 3SGAE 4NIXA 1DLKB 2EEKA 2NU4E 2Z7FE 2OBOA 1WQVH 1TIOA 4F4OC 5A2MH 2BLVA 4MNXA 1O35A 1GJ7B 2BZ6H 1O2SA 2PLXA 1OWEA 3KQDA 3QDZB 3ZZ9A 4I7YH 4MNWA 1GVKB 5DJ7A 3EE0B 7LPRA 3QK1A 3SQHE 4AX9H 3RUOA 4DG4A 2P3FH 1AVWA 2BLOA 2Z3DA 5DK1A 1VCWA 4H4FA 2FS8A 2J92A 1C5VA 1G3CA 1IQFA 4Z0KA 2A2QH 5GCHF 1EP6A 4GSOA 1Q31A 4TWWA 2UUKB 2A4RA 4DURA 2WPJS 3H7OA 1S0RA 4H42U 3RXFA 5EQSA 2OQ5A 2IN2A 1UO6A 5JB9S 1TBQH 3RLYH 3NUMA 1WAYB 3F9GA 2YNAA 1ZHRA 1VITF 1EB1H 4FUBA 4ABGA 5JDUB 1THPB 1BCUH 1J8AA 2TIOA 4JMYA 1EATA 3BN9A 1A61H 5ABWA 5HMAA 2PKSB 2V3OH 1SGFA 1A5HA 2OXSA 2FI3E 4FU9A 2J34A 3SV9A 2B5TB 1LQDB 3FZDA 1IQMA 3M5NA 5F6MA 3F68H 3HGPA 2FI4E 1VJ9U 3TGIE 1P09A 2QF0A 4YOGA 2GTBA 1BTXA 4OGXA 3RXRA 1DUEA 2ESTE 2O8TA 3GYLB 3D62A 4DT7B 3F9EA 2G52A 2ZZUH 1SGEE 4HI3A 4THNH 1GMDG 1ELTA 2CGAA 3BTEE 3V12A 1DWCH 2AMDA 3V0XA 1C1OA 4Z6AH 1O3DA 1O2PA 5DG6A 5A8XA 2BD9A 1P05A 2QV1A 4NWLA 2BY6X 2BX3A 2STAE 3MYWA 1GBMA 2FDAA 1UVUH 3FP7E 1C2HA 1ZSKA 3HK6B 2B9LA 1CBWC 2Z9KA 1GI7B 1O0DH 5E0GA 1G9IE 1TMBH 3RXOA 2HWLB 2ZO3H 3GDUA 1IQGA 3JZ2B 3R3GB 1Y3XA 3ZZ3A 1AGJA 1K1MA 1S81A 3QZQA 1JMOH 1CGIE 1PQAA 1TPSA 1ZGVA 5EPYA 4WMEA 2PR3A 1ZHMA 5DGJA 2BQ7B 2ILNA 3LC3A 2G00A 1PFXC 3OYPA 4A1VA 2FYRA 1C1NA 3UR6A 4D76A 1GJ4H 1DWDH 2WYGA 1GCTB 1SHHB 1PPHE 4JZDH 1VGCB 4I8HA 3STIA 3QLPH 2VVVA 4B76A 1PPZA 1W0YH 1MBQA 1XUGA 3SU3A 3ZVCA 1K1LA 4BAOB 3VFEA 1H9LB 5IYTA 5FAHA 1P2QA 5GXPA 3TNSA 3SJOA 2A5IA 3SV7A 4MPWA 1O5EH 2F9PA 2R2WU 3BG4B 2ZHWH 1LKBA 2P16A 1DXWA 3KIDU 1EZUC 4NFFA 4A92A 1Y5BT 2JETC 3RXIA 2IJOB 1TX8A 3MU0A 1XUFA 3ZZBA 1GG6C 3GCHB 4NA9H 4ABIA 1VCPA 3KQCA 1C2LA 3CS0A 3M3TA 3ATLA 1L2EA 2ZCKP 1FI8A 1P06A 1ZMNA 3PTBA 1V2ST 3IITA 3RXTA 4A7IB 4ZKOU 1PYTC 5LGOA 5EW2H 1SHYA 4OGYA 1HYLA 1BTHH 2H2ZA 1C5LH 2XCFA 2BD5A 3PTNA 1TGTA 2I6SA 1KTTB 1NZQH 3GY5A 2HNTC 1C1SA 3T27A 1ZMJA 1BTPA 4I8KA 4VGCB 4BTTB 3A85A 2IPHA 3ZVBA 2VIDA 4R8TB 1GJBB 3LKWA 2C3SA 2FOHA 2J38A 2A7CA 2BQ6B 2AS9A 2UWLA 3D49H 3I77A 3L3TA 1N1LA 4Q7XA 1C5UA 1SL3A 4BTIB 1XXFA 4DW2U 1B5GH 2QYIA 6GCHG 2ZDVH 3C1KA 2P3UB 1GBLA 1ZR0A 5J4QA 3BEFB 3MH7A 3MMGA 1O2OA 1SR5C 1BT7A 4UD9H 3STJA 3B8JA 3T25A 1UTJA 1S6HA 1NN6A 2FOFA 3UTUH 1BHXB 1YC0A 3FFGA 5FXLA 2AIPA 3Q77A 1V2WT 1W7GH 4INHA 1SGQE 1QFKH 1SGTA 2FOAA 3BTQE 1T4UH 3S9CA 1O5GH 1W8BH 1T8NA 5DPAA 2ZPSA 2XC0A 1GJAB 4ZROA 4X6PA 2GKVE 3AVZA 2QY0B 1BRCE 1C4Y2 1HIAA 3S0NA 3SGBE 2TRMA 4Y7AA 5BPEA 3RXJA 1DY9A 2EI8A 1SLWB 1H8IH 4AB9A 4TY7A 3PV4A 3SHCH 3EA7A 1RTFB 3LC5A 4Y6DA 1OP8A 4ZHLU 5TCAA 1YPEH 1HJ9A 4WVPE 4D9RA 1UVPA 1GHAG 5FHTA 1AB9C 1O3EA 3BEIB 4UFDH 4WWYA 1SFIA 2FEQH 2AYWA 3U1JB 1JRSA 1G3EA 1ETTH 1MUEB 1Y8TA 1QR3E 1UJ1A 3M5MA 1PQ8A 4ZXYH 3SUEA 4O9VA 3SU0A 4UFFH 1BBRE 5T6GA 1YP9A 4JK6A 1BMNH 1M9UA 1GMCF 1ANCA 1YLDA 2FXRA 4FU8A 1ESAA 1UHBA 1YF4A 3GCNA 1SVPA 2OCVB 1QTFA 1DWBH 1EZSC 1MKXH 2Y81A 1ESBA 3ZVAA 2HALA 4WF8A 2VU8E 2ZQ1A 1GPZA 3RXPA 2XCNA 1INCA 3LJOA 2ZU4A 1QJ6B 3P17H 1HJAB 5HM2A 1O2WA 2GMTC 5F8XA 2PUQH 4M7GA 2Q6GA 2C8YB 4LZ1H 2FESH 4A1XA 1LHFH 5HXFA 2WPKS 3QX5H 5JPMH 1P2NA 2GZ7A 5EODA 8LPRA 2HPPH 2PKAA 1O2VA 3VB6A 4CRCA 1EAIA 1EAWA 4O3UA 5C1XA 3PLPA 1Z8IB 2CF9H 1N6XA 1MTNC 1KLIH 1YLCA 1SFQB 1XKBC 1WV7H 4X1PU 3MH4A 1O30A 2AGEX 4WJG2 1ZRKA 4AG1A 4FUHA 2OC0A 1DY8A 3RM2H 2Z9IA 3SHAH 1C1PA 1C1WH 3U8OH 1P9SA 5K0HA 1FLEE 1K1JA 2OC1A 4NGAH 1THRH 3RC6A 2ALVA 3PO1B 1HAOH 1SB1H 1P2OA 2FS9A 4Y76A 1SSXA 2Y6TA 1LPZB 3GY3A 2FTMA 1CA8B 1Y3UA 1C1QA 4GHTA 1F0TA 3ATMA 1G2LA 3E1XB 1EJAA 1P02A 2ZDNA 1RD3B 2ZC9H 8GCHG 5E8EH 1RFNA 2UWOA 1BBRH 4X2YA 3E0PB 3TNTA 2ZGCA 2ZGJA 5K7RA 2D8WA 2GP9B 2ZU3A 4E7RG 1J16A 3RU4T 1O2ZA 1BITA 2Y7ZA 4E06H 1TNLA 2A31A 2VINA 1UTKA 1QGFA 1IQNA 1AZ8A 1OWDA 1DX5M 3M36A 2FOMB 2VIWA 5DP5A 1GGDB 3QO6A 1D6RA 1AN1E 3KEEA 1CHOF 2SGAA 2SNVA 2P94A 3AASA 2ULLA 4LOYH 1YPHC 1YPGH 1TRNA 2AGGX 2D1JA 2NWNA 2FYQA 1C2FA 3A8DA 1SC8U 5EOKA 4Q80A 1IQKA 2FX4A 3R0FA 2ZP0H 2UUJB 1BJUA 4KTUA 2VWOA 2PTCE 1QB6A 1N8OB 1A3EH 7ESTE 2GCHG 4YM9A 5EG4A 3BTHE 1HPGA 3FP8E 3QUMP 1O2JA 2G81E 3E90B 5IDKA 4O97A 1ZYOA 4HFPB 3TJVA 1HAXB 3A7VA 4BXWA 4A5TS 1FJSA 1CQQA 3ZZAA 3HATH 3NWUA 1FY1A 1Y5UT 1O2RA 3SUDA 3GY8A 1TB6H 1LVYA 4JZEH 1DDJA 1SG8B 2ZKSA 1D6WA 3ATWA 2XWBI 1O2TA 4ZUHA 2VH0A 1F5KU 1GI0A 1RTLA 2BDGA 1TNIA 1RXPA 3TK9A 2BY7X 4ISLA 2NU2E 2UUFB 4TPIZ 1ELGA 1ETSH 1UCYK 2TGAA 2CMYA 2V0BA 3PLBA 1MZAA 4YLQH 1C5MD 1NESE 4X8TH 3SUFA 1LPKB 4ABFA 3S9BA 2QXIA 1HV7A 2CJIA 1O38A 1SGNE 1YKTA 1GBEA 1PPFE 4CHAC 1C2JA 3DFJA 3QGNB 3AAUA 2FLBH 4R0IA 2BDAA 2P8OB 4MPXA 3ZZ4A 2FP7B 1P11E 2BXTH 3O8CA 1W0ZU 2ZFRH 1NM6A 4NIYA 2ZEBA 3T62A 1ORFA 1SGPE 1XUKA 1O3FA 1BTUA 5F8ZA 1QJ1B 3NCLA 1GMHG 3F9HA 1BTZA 3RXGA 2HNTF 1NTPA 1V2PT 2WPLS 2ZDLA 4D9QA 1EJNA 5E0HA 2A7JA 5L6NH 1K9OE 2F9BH 1BHXF 3GY2A 1HAYB 2ZGBH 1QRWA 2EI7A 3TPIZ 3TH3H 4CRAA 4IBLH 1O2YA 3FANA 2CN0H 1GHBF 1OOKB 2PGBB 1ETRH 1WUNH 4ZKRU 3ITIA 1HBTH 4YLUA 2KAIB 2PFEA 3ELAH 4K2YA 1ACBE 4YESB 3EGKH 5EPNA 2BDYA 5FCRA 1WU1A 1XKAC 1RGQA 5DP6A 2QN5T 2Y80A 2P3TB 4A6LA 5CHAB 1QA0A 1H8DH 4Q7ZA 1LKAA 5FPSA 1BRAA 4FUFA 5CE1A 9LPRA 1C2EA 1NFUA 2PGQB 2R9PA 4BANB 1HAZB 1TPOA 3TH2H 1A2CH 1JWTA 1ABJH 2ZHDA 1IHSH 3HK3B 1GDNA 2F9OA 2VWNA 1VR1H 1DUAA 2WPHS 1QB1A 5C67A 1Z8GA 4SGAE 1D9IA 2R3UA 3ZV9A 3GCTF 2TGPZ 1ELDE 3ESTA 3VGCC 4F49A 3KQBA 2A4OA 3BTME 1F0SA 1LVMA 3PMAB 3Q76A 1C5OH 4JZFH 4NZLA 3SBKA 4D7GA 4BAHB 3UR9A 2WYJA 4CH2B 1CA0B 1TPPA 2W7UA 1GJDB 1AQ7A 2VJ1A 3V13A 1GI9B 4I8LA 5C5OA 2ANYA 1PJPA 1OWJA 4ABAA 4MNYA 1BTWA 1HXEH 3FAOA 3SO3A 1T8OA 2O8UA 4NA8A 1MTWA 1WCZA 1HIAB 2ANMH 2NU0E 4BNRA 3F1SB 3A8AA 4Y10E 3IWMA 4CRBA 1YGCH 1QL9A 3UUZA 2ANKH 4I32A 2G4TA 2SGEE 3EAJA 4GVUA 1TONA 2P59A 2SGQE 3UFAA 1GI3A 3DA9B 1OPHB 1HAVA 1BOQA 1EUFA 2PKSC 4Y11E 3FVFB 1TYNA 1GWAA 1P04A 1XUIA 3JZ1B 4CRDA 2ZTXA 5ESBA 3A84A 2J2UA 1E35B 1YPMH 1O3CA 1GJCB 3TK6A 1NRPH 1FV9A 4Y8ZA 2R0LA 2OC8A 5JB8S 1HCGA 2G8TA 1O36A 4Q7YA 5I46H 4B2BA 3RXCA 1EAUA 1UHBB 2QXJA 1GBFA 1AWFH 1Z8RA 2ZGHA 1GBCA 1O2NA 2UWPA 3W95A 2M5TA 2J4IA 4NIVA 2J9NA 1L4ZA 2BD4A 2GZ8A 1NPMA 3VB3A 1B0FA 4TYDA 1QRXA 4YO9A 1L4DA 1KXAA 3T26A 3SJ8A 1TGCA 3ZYDA 3PMBB 2FWWA 4AGKA 1O39A 1C5SA 1NS3A 1GJ9B 1MMJN 2Z3CA 2F9VA 3PWBA 4B71A 3E91A 3VB7A 5L2YH 1Y5AT 3BF6H 4UE7H 3BTWE 3Q3XA 1KXDA 2PKAB 3BTFE 1TRMA 5AFYH 1X7AC 1B7XB 1MCVA 4NZQA 1GCDA 4X1NU 1K22H 1O2LA 2JH0D 3M35A 1CO7E 3BIUH 3PMHB 1EPTA 2EI6A 1JOUB 1QA7A 1PPEE 7GCHF 1GCTC 5DP4A 2QAAA 5A8ZA 3UNRA 2BMGB 1VGCC 3UNSA 3UQVA 1NRNH 2AH4X 3QGJA 2WPIS 8KME2 2FLRH 1MU8B 2XRCA 2GDEH 1V2RT 1V6DA 1TOCB 3K6ZA 1G30B 1L1NA 3ZZ8A 2HNTE 3BG4C 1LCYA 4HGCA 3SN8A 3LH1A 4KKDA 1G3BA 1TNKA 5A8YA 2BLQA 1GBTA 2H9TH 1CBWB 2DUCA 2XWAA 4X8SH 3GCHC 3T2NA 5GCHG 3RXSA 2BTCE 1QJ7B 1A0JA 2C8XB 1FXYA 3HPTB 1OXGA 3G01A 3RLWH 4AYYB 3MO6A 2H1UA 4GCHF 2BOHB 4XBDA 2GZ9A 2HOBA 1MQ6A 6CHAB 3RMNH 3RMLH 2BVXH 4UFGH 1W11U 1VITG 4JCNA 4I8GA 2J95A 1UK2A 4VGCC 4BTUB 3GDSA 1AI8H 2B7DH 1P3CA 1GHXH 1MD8A 1GDQA 2CXVA 4XBBA 4MPVA 5EXNA 1GI4A 1Z6JH 1DWEH 3A7XA 2OUAA 5EXMA 3GICB 1NRRH 3RXHA 3UPEA 2SNWA 4B2CA 2HVXA 5HM9A 1ESTA 4E05H 1DLEA 1ELEE 1KYNA 2FO9A 1Z7KA 3D23A 4LXBH 1L0ZA 1S83A 2BD3A 3KCGH 3RC5A 5A0BA 1MKXK 3E6PH 1P57B 5C5NA 2C4FH 3SU4A 3SU1A 5A0AE 4X2XA 1MQ5A 3A7TA 1XMNB 2A7HA 1YYY1 1F0RA 1HJ8A 4IMZA 2OD3B 3SQEE 3BTKE 3MO9A 4YOJA 3TK5A 2O9QA 4GHQA 1BRUP 3A7WA 1GI5A 1T31A 1AD8H 3GY6A 3TJUA 3ZYEA 2BM2A 1S85A 5DP7A 5C3NA 4WXIA 4O03A 4X8VH 2XXLA 3LGIA 4AFUA 2VIQA 1NRSH 3A8BA 3BTGE 1AFQB 1GJ8B
chains in the Genus database with same CATH superfamily
3UQOA 4INKA 4NSVA 1ELVA 1C2GA 1TLDA 2FPZA 5EGMA 4K1SA 2GT7A 4Y8YA 1BRBE 3EQ0H 2GD4B 1D3DB 4IS5A 4HZHA 4NFEA 1FN8A 1WSSH 4FU7A 1C5XB 1UVTH 3M37A 3P92A 1SGRE 3UOPA 1ZRBA 1LMWB 2PSYA 1SGFG 2Y5FA 3PLKA 5PTPA 3M3SA 1QQUA 1ZTLA 2VGCB 4Y8XA 3MHWU 2QXGA 5EIYA 3IG6B 2AFQB 2F43B 4TPYA 1P2IA 1TRYA 3LT3A 5LH8A 5EU8A 2EY4C 3TU7H 2C93B 5C0TA 2YMSB 3KF2A 2A5KA 4CH8B 1AKSA 2OC7A 3BTDE 1UTMA 5T6FA 1HJAC 4KP0A 1SQTA 3PV2A 3F2GA 1LTOA 1KTSB 3A83A 1XUHA 1CU1A 1DE7H 1BBRK 4TWYA 1AVGH 2Z94A 4MVNA 1NO9H 4MPUA 5ESTE 5FL7D 4ASUD 4LK4A 2PUXB 1TAWA 4WY3A 2FOCA 1CE5A 4K60A 1HAHH 1MBMA 1RIWC 1F0UA 4B2AA 1LQEA 4DVAU 1C1MA 1W3CA 2VIOA 3A8CA 1DANH 4ABDA 3RU4E 6ESTA 1K1IA 5A09A 1K1PA 3MOCA 4ISIH 5CHBA 3A82A 1A5IA 3KQEA 4U2WA 5LPEA 3WWBA 2PSXA 1SLVB 2CHAB 4JYUH 1A0LA 5AF9H 1V2OT 2VVCA 4K69A 4AYVB 3URDA 2BD7A 3NZIA 1P12E 3P8NA 3O8RA 2RDEA 1W14U 2THFB 3ODDA 1DPOA 4YXWD 1ARBA 1ZTJA 1J9CH 3ZZDA 1WTHD 3PO1C 1F5LA 2FZZA 1S6FA 4GUXA 3F0OA 1O3MA 1MCTA 3U8TH 4CBNA 1NBMD 2HLCA 1OHHD 3VB4A 1Q3XA 1FIZA 1IQHA 3GDVA 5A0CA 2ZU2A 3RXDA 1QQ4A 2FX6A 1O5DH 2ZDAH 3RXVA 3KYGA 1O3LA 1HNEE 1W0JD 3B9FH 3U8RH 1ZSJA 5C2ZA 1O32A 4CR5A 1NFXA 1EKBB 1MTNB 4O3TA 3ZVGA 1BZXE 4MLFB 4YTAA 3CP7A 5F8TA 1BUIA 1ZGIA 3VPKA 4GLYA 5IK2D 1QCPA 4ZHMU 3T29A 3ZZ6A 3A7ZA 1AFEH 2F3CE 3UREA 1IQLA 2Z9LA 2ODPA 2IPQX 1PPGE 3SV2H 1GI2A 1GGDC 1TE0A 2OK5A 4NA7A 1JRTA 3SW2B 3FP6E 1KDQA 4IC6A 5DP3A 2TBSA 1K1NA 2BQWB 2BOKA 1JIMA 1EQ9A 3KGPA 2G4UA 1GMCG 1SLXB 2Z9JA 1O3GA 4D7FA 1XXDA 4AN7A 4F55A 3DSGA 1SMFE 5H4IB 1C1VH 3SJIA 2O8WA 3M5LA 5FCKA 2ZDMA 4Z1MD 1C1RA 1SQOA 2SGPE 4NCYA 4AGJA 3A80A 1QB9A 2B0FA 3OFND 4Q2KA 4OS1A 1ZZZA 2DE8A 1XVOA 2RCEA 3BIVH 2SFAA 2ZTZA 2BDHA 4H6TA 4XRNA 3LU9B 2KCPA 2V7QD 3GYMA 1C2KA 2WPMS 2ZGXH 1HAIH 5C1UA 2BY5X 4ESTE 5FBIA 1TMTH 2ZG0H 2W26A 1O5CB 2XC5A 2O8MA 2PV9B 5EJ1A 5F53A 3K6YA 3SU5A 2GGVB 1LPGB 1KY9A 1IHTH 2H9EH 3OY5U 5EJZA 1F92A 2KCOA 4WH6A 1FAKH 1FPCH 1YPJH 2XBVA 4U01A 1P2MA 4X1RU 1GL1A 3CNRA 1EJMA 3B23B 4RKJB 2G55A 1EP5A 3LDXH 4M9FA 3PM3A 5TJXA 3EA9A 2F83A 2HPQH 1W13U 1Y3YA 4FVBA 1O2KA 5GNDA 5JBBS 1EPTB 1TNGA 3OTPA 4NG9H 1OX1A 4FXGH 5E2PA 3DHKH 1W12U 5B6OA 2Y7XA 3WW7A 1HRTH 3URCA 2XC4A 2YMSD 1ELCA 1UVSH 3M3VA 1Z8JB 4IC5A 1DS2E 4U32A 2H5DA 3M7QA 1HXFH 1Z1IA 4ABHA 1KLJH 3DFLA 1GJ6A 5C0UA 2ZIQH 4JK5A 2OP9A 3RXUA 2BD8A 3EDXB 4B1TA 4DIHH 1BMLA 1UTOA 4AFQA 4ZMAH 1V2KT 4X6MA 3I29A 2AIQA 2ZTYA 4I31A 4DCDA 1D4PB 1MTUA 3LGYA 3L6PA 2XNIA 4X2WA 1A5GH 1S82A 2XYAA 1K1OA 3GCOA 2GCTB 4H6SB 3MH6A 1GVZA 2RA3A 1MTSA 1HDTH 3PROA 1V2VT 1EASA 1KIGH 3P95A 4K8YA 1ZTKA 3PRDA 4FVDA 2P93A 1FONA 3SNAA 1CHOG 1J15A 5T6DA 1LDTT 1T4VH 1K0HA 2H5CA 3RC4A 4TY6A 4CHAB 4RN6A 3SV8A 4FUEA 3F0PA 5CHAC 3RXEA 1O3AA 2ALPA 3UWJH 1TBRH 3ZVEA 1EZXC 2A0QB 4BOHA 1KXFA 1V3XA 1QBNA 2ZECA 3MFJA 1MKWH 1O2XA 1OSSA 4KGAA 2A2XH 4YZUA 1YCPH 3SU2A 1FMGA 4WXVA 3RXAA 1Z1JA 3PYHA 1LVOA 2CF8H 1NC6A 1GMDF 2FI5E 3P8OA 1V2JT 1QHRB 2JJ1D 3RXLA 2YNBA 1CVWH 3TJNA 2KX4A 4DIIH 3BSQA 2TGDA 3PRBA 1NFYA 1TX7A 3SGQE 2Z9GA 1CT4E 3SV6A 2ODYB 5ETXA 2WV5A 1AY6H 2TPIZ 3SOSA 2ZF0H 1O2IA 1PQ7A 4DGJA 1E79D 1XX9A 2ZFQH 1O5BB 2Y5GA 3I78A 3TITA 2WV4A 3RP2A 5EQQA 1V2LT 1L1JA 1V2MT 1HFDA 2F9NA 3RU4D 1DSTA 2NU3E 1TA6A 1BDAA 5C17A 3UNQA 4LZ4B 4ABBA 4GPGA 2XW9A 1E38B 3W94A 2ZCHP 1AO5A 3F9FA 3KQ5A 4NIWA 1FN6A 1LHCH 1WOFA 1A0HB 2NU1E 3LONA 5EXLA 9ESTA 1ZOMA 1DFPA 1FY4A 3HGNA 2FMJA 2Y82A 2M2AA 4KTCA 3RDZA 3VGCB 1TQ7B 4J1YA 3T5FH 4YOIA 5AHGH 1OKXA 1TGSZ 1SOZA 2QF3A 5JBCS 1IQJA 3TIUA 1UTNA 1O3JA 1EOJA 2ANWA 2DE9A 2V3HH 3M5OA 2EC9H 1T8LA 2OLGA 4MTBA 1ANEA 3Q3YA 1TPAE 3ZVDA 1GL0E 1VJAU 1GDUA 3RXQA 4Y71A 1AKSB 1F2SE 1W7XH 2EQNA 3E8LA 3F3BA 2JJ2D 5E0JA 1Z71A 1AUTC 1EB2A 3ATIA 3OSYA 2AMQA 1QY6A 3LPRA 4OS4A 3P8GA 1SOTA 1THSH 3QTOH 1GHBG 2B8OH 3O8BA 4ZAEA 2JIZD 5FBEA 4ISOA 1QL7A 3GOVB 4OS5A 3OU0A 2K1QA 1KXCA 4PROA 3TJOA 7KMEH 1G37A 3FO8D 1UTQA 4XFQA 1ELFA 3A87A 1D3QB 1KMHB 2WUBA 3ZZ5A 1V2QT 1OWIA 4RSPA 1PPCE 1C4V2 2PP6A 3QN7A 4FOUC 2UUYA 1BMAA 3A88A 4IN2A 3U1IB 1TFXA 4ISNA 1FY8E 1O3HA 1GJ5H 1MAXA 1AZZA 4BAQB 1H1BA 4IMQA 3N7OA 3LGWA 3ODFA 1YPLH 1O2HA 3ENSB 1KLTA 1P03A 1RRKA 6GCHF 5TCCA 1ARCA 2JH5D 1TQ0B 2LNCA 2ASUB 2ZDKA 2VIPA 1RS0A 1QBVH 2TGTA 1G2MA 1KXEA 4AFSA 1PQ5A 3L33A 3GCTG 5G4BA 3V7TA 1WYKA 2V35A 3LOXA 1GBAA 5I25A 3DSPA 3QZRA 1QBOA 4FUIA 2VIVA 1P01A 1GHVH 5FX6A 2C90B 2VWLA 1O31A 3VB5A 1OS8A 1AVXA 2C8WB 4ZHAA 3F6UH 3C27B 3K65B 1HLTH 1UK3A 2GX4A 3RMMH 4OS6A 2ZU5A 3VXEH 2P95A 3A81A 3O8DA 1ZJKA 3AAVA 3RM0H 2FIRH 1C9TA 1N6YA 1ZHPA 3WY8A 1C5NH 6CHAC 2SGFE 4CRGA 1G3DA 1HUTH 1Q2WA 3P70B 3F2HA 3ZV8A 2WUCA 5EQRA 1DICA 2W5EA 2QC2A 1TBZH 3F2FA 1QNJA 1SLUB 4OS7A 5GIBA 4Y0YE 1O3BA 1GHWH 1ABIH 2R3YA 1DITH 1GHAF 2XBXA 1P8VC 2W3IA 3CS7A 3KN2A 3QWCH 1CHGA 1LVBA 3KHVA 1AIXH 4D8NA 3T28A 4AB8A 1BQYA 1KDQB 3LGVA 4WH8A 2Y5HA 1O2MA 1O34A 1XVMA 3GY7A 8ESTE 1HAPH 2ZFFH 3NKKA 5T3HA 3S7KB 3TLOA 1GHYH 3ZZ7A 2GDDA 2XTTB 1CGHA 5JBAS 3UY9A 2D2DA 3UWIA 3M61U 4ACAA 5JYIA 1EAXA 1OYTH 1LHGH 1O3NA 2BDBA 1VCQA 4KELA 3FKSD 4INLA 2JETB 2FTLE 2D26C 2KR7A 1GG6B 2FOBA 2HLDD 2A32A 1C5ZB 1P2JA 4DJZB 1CGJE 2A1DB 1OP2A 1ZMLA 1FPHH 1P3EA 1L1GA 1B0EA 1HAGE 2KAIA 5L2ZH 5GPIB 2Q6DA 2VVUA 4ASHA 4X6OA 5CMXH 4AORA 3SNBA 1CT0E 2A45B 1IQEA 2FOEA 3A86A 3PMJA 1LO6A 4NWKA 1AFQC 1FQ3A 1D3PB 2BVSH 1FUJA 2WINI 4AOQA 3ZVFA 1TX6A 1YM0A 4Y79A 4MG3A 2AERH 3E3TA 4FETA 1UTPA 2BYAX 3M7UA 2ZU1A 4BAKB 7GCHG 2PTNA 2HGTH 1ELAA 3MNXA 1O37A 2ZQ2A 2H9HA 1P0SH 2RA0A 1C5RA 2G5VA 3MO3A 1MZDA 1GBKA 2ZPQA 5HKKD 2VGCC 1GVLA 1C2MA 1A4WH 2ZFPH 4JZ1A 1DOJA 4Q4LA 1O5FH 2QA9E 1T32A 1ELBA 3M7TA 1NU7B 1IQIA 1BJVA 1G32B 4UONA 4ZXXH 3RXMA 3SUGA 1TWXB 2YMSC 1GBIA 1MAYA 4UFEH 4YT6H 8GCHF 2G51A 1K28D 1QIXB 2A5AA 3HKJB 1ZPBA 1BB0B 2ZFTA 2BX4A 4GCHG 1YPKH 2BXUH 4X1QU 1C5WB 5DO4H 1GBBA 1SGYE 2R2MB 3RXBA 1P2KA 4HTCH 1EX3A 1NFWA 4AFZA 2J97A 3PWCA 1YCPM 2BZAA 5FPTA 4WMFA 1TGBA 2H6MA 2OQUA 1TMUH 2JKHA 1TA2A 2CHAC 1AB9B 5J4SA 2I6QA 1TGNA 3OY6U 1GI6A 1W10U 1C5YB 2XNDD 5GWZA 1RJXB 1W2KH 2Q1JA 1Y3VA 5F03A 1Y3WA 2BLWA 1V2TT 1EOLA 3LIWA 2BVRH 1DVAH 4HG6A 1O2UA 1TNHA 1ANDA 2J94A 4X2VA 2GV7A 2QIQA 3TGJE 5DP9A 1UK4A 2EA3A 1C2IA 2VH6A 3EA8A 1TALA 3U69H 2GCHF 3HKIB 1C5TA 4K5ZA 4ZKSU 5GJ4B 2QGRA 3BTTE 2GV6A 2A4GA 1WTGH 3E16B 3E0NB 4SGBE 1AWHB 3MTYA 2CV3A 4K8BA 3S7HB 3CENA 3H09A 3P6ZB 2W7SA 2BHGA 4E7NA 2WHXA 1IAUA 1UMAH 2ZA5A 1RIWB 1TABE 4X0WU 2GMTB 5EW1H 4MDSA 1C5PA 1SPJA 3KNXA 2LPRA 3MNSA 2C8ZB 2STBE 3SI3H 4YT7H 1WBGB 3N99A 3SJ9A 1CSOE 4JYTA 1FIWA 3SYJA 1VITH 1YPHE 3EYDA 4XDEA 1E34B 4CRFA 1E36B 3SZNA 2BB4A 3OX7U 1JIRA 3H5CB 1UVOA 1YLNA 4I86A 1EFRD 2PW8H 2ZI2H 4CR9A 3TVJB 3SORA 1A46H 4Y0ZE 2YOLA 1W0KD 1SQAA 1P10A 1IOEA 1ID5H 1S84A 1J14A 1OP0A 4DOQA 1BA8B 3Q00A 1A1RA 3ZZCA 1QURH 2ZCLP 2ZNKH 3S69A 4FUJA 1BTYA 1E0FD 1NY22 1XUJA 1OYQA 3NPSA 1C4U2 1HB0B 3KL6A 4OS2A 1V2UT 1BMMH 5AFZH 3UIRA 3BV9B 2ZHFH 2PWXA 4FUGA 1AE5A 1HAVB 5JBTA 1H8HD 3AK5A 1E37B 2ZFSA 4UEHH 3LGTA 1PYTD 1KSNA 2R0KA 4AZ2B 1G36A 1FY3A 2Z3EA 3SI4H 1H9IE 1N8OC 1GMHF 2OINA 3OTJE 1FZZA 1PPBH 3GY4A 3H7TA 1JXPA 3GISB 1ZPCA 2ZHQH 6LPRA 1AE8H 2G5NA 1HGTH 3TH4H 2PHBA 4IW4E 3NXPA 3WWFA 1T8MA 5GDSH 1FNIA 2JH6D 1LHDH 1GBDA 3MU8A 2QXHA 3RMOH 1SGIB 1Z6EA 1K21H 2AEIH 4ZKNU 2VNTA 1KXBA 3MU5A 4IN1A 1GHZA 1DM4B 3BEUA 1F7ZA 2FOGA 4XBCA 3PB1E 1GI1A 4X8UH 4ABJA 2F91A 4K1TA 3P8FA 4WMDA 4ZH8A 1FY5A 3MU4A 4IGDA 1QZ8A 2BDIA 4BXSA 5E2OA 5DKMA 5HIYA 1O2GH 4A1TA 4NSYA 3UB0A 1P9UA 1EPTC 1WDIA 3SNEA 1C2DA 1DXPA 3SJKA 1C9PA 4RKOB 3SU6A 1H4WA 4XSKU 1O3PB 2AGIX 1H9HE 2VWMA 3DUXH 3FOAA 2ZPRA 1DSUA 1MKWK 4JYVH 4ISHH 4B73A 1ANBA 1TOMH 3S9AA 4J2YB 1YCPK 1NROH 2BY8X 2BD2A 2XBWA 3MU1A 4I33A 4U30A 2Z6BD 1C5QA 1MH0A 3LJJA 1D3TB 1O2QA 4Q63A 4DY7B 1MD7A 1UCYE 5L30H 2P8OC 3FZZA 1C1UH 4GAWA 3K9XB 3BG8A 2L6OA 4XD7D 1ZLRA 2O8LA 3MNCA 2OTVA 2BDCA 1ZJDA 1XM1A 4BAMB 3QTVH 5BRRE 2LELA 5HYOA 3A89A 3VXFH 1GBHA 3MI4A 2GCTC 3NK8A 2KM0A 1AUJA 4RT0A 3V3MA 2Q6FA 2XBYA 4X6NA 4UDWH 2KFWA 1O33A 3MH5A 2RG3A 1SGCA 1CT2E 1DT2A 1V2NT 2FODA 1MABB 2SGDE 1OWKA 5C20A 2RDLA 4JZIA 3U9AH 1F5RA 3DT0H 4KTSA 4I8JA 2VB0A 2GT8A 3EE7A 1FDPA 3UOUA 4CBOA 1O3KA 1UTLM 3TGKE 1S5SA 1AMHA 2QCYA 3ATKA 2FM2A 1O3IA 4B74A 1O3OA 1JBUH 3A7YA 1E1RD 1TNJA 1YBWA 4B75A 1GI8B 3RXKA 1FAXA 4K3JA 2AHME 5LPFA 3SNCA 2GVFA 1QRZA 2ZWLH 3Q3KA 4CREA 1NU9A 4F48B 1ZSLA 3UAIC 2RFKC 1AHTH 4MNVA 1EXFA 5HGGA 1S0QA 2OBQA 1NRQH 4X1SU 1K2I1 1OWHA 3K2UA 5FPYA 2F9UA 1BIOA 1ZPZA 2IOTA 1QL8A 1VZQH 1C1TA 3PV5A 1GBJA 4FUDA 1SGDE 3D65E 1LHEH 1WQSA 5AVDA 4ABEA 3LH3A 5DP8A 1EZQA 3AW0A 1E1QD 4FUCA 1J17T 1MU6B 1NT1A 1A7SA 2V6NA 4Y7BA 2HRVA 3LGUA 1Y59T 2BY9X 4XE4A 1CA0C 3DCLA 3SNDA 5LPRA 3MWIU 1O5AB 4MQAA 3SZEA 2GJGA 2ODQA 2AMPA 4XOJA 5C1YA 3DD2H 1UW7A 5FX5A 1A3BH 4K1EA 1U6QA 5SGAE 1SI5H 4QT8C 3U98H 3MNBA 1MTVA 1AU8A 1UCYH 2W3KA 3AW1A 1SBWA 3VEQB 2A4QA 1RTKA 1T7CA 2ZHEH 4AG2A 3SGAE 4NIXA 1DLKB 2EEKA 2NU4E 2Z7FE 2OBOA 1WQVH 1TIOA 4F4OC 5A2MH 2BLVA 4MNXA 1O35A 1GJ7B 2BZ6H 1O2SA 2PLXA 1OWEA 3KQDA 3QDZB 3ZZ9A 4I7YH 4MNWA 1GVKB 5DJ7A 3EE0B 7LPRA 3QK1A 3SQHE 4AX9H 3RUOA 4DG4A 2P3FH 1AVWA 2BLOA 2Z3DA 5DK1A 1VCWA 4H4FA 2FS8A 2J92A 1C5VA 1G3CA 1IQFA 4Z0KA 2A2QH 5GCHF 1EP6A 4GSOA 1Q31A 4TWWA 2UUKB 2A4RA 4DURA 3OEED 2WPJS 3H7OA 1S0RA 4H42U 3RXFA 5EQSA 5DN6D 2OQ5A 2IN2A 1UO6A 5JB9S 1TBQH 3RLYH 3NUMA 1WAYB 2K0QA 3F9GA 2YNAA 1ZHRA 1VITF 1EB1H 4FUBA 4ABGA 5JDUB 1THPB 1BCUH 1J8AA 2TIOA 4JMYA 1EATA 3BN9A 1A61H 5ABWA 5HMAA 2PKSB 2V3OH 1SGFA 1A5HA 2OXSA 2FI3E 4FU9A 2J34A 3SV9A 2B5TB 1LQDB 3FZDA 1IQMA 3M5NA 2WZQA 5F6MA 3F68H 3HGPA 2FI4E 1VJ9U 3TGIE 1P09A 2QF0A 4YOGA 2GTBA 1BTXA 4OGXA 3RXRA 1DUEA 2ESTE 2O8TA 3GYLB 3D62A 4DT7B 3F9EA 1YWUA 2G52A 2ZZUH 1SGEE 4HI3A 4THNH 1GMDG 1ELTA 2CGAA 3BTEE 5C94A 3V12A 1DWCH 2AMDA 3V0XA 1C1OA 4Z6AH 1O3DA 1O2PA 5DG6A 5A8XA 2BD9A 1P05A 2QV1A 4NWLA 2BY6X 2BX3A 2STAE 3MYWA 1GBMA 2FDAA 1UVUH 3FP7E 1C2HA 1ZSKA 3HK6B 2B9LA 1CBWC 2Z9KA 1GI7B 1O0DH 5E0GA 1G9IE 1TMBH 3RXOA 3OEHD 2HWLB 2ZO3H 3GDUA 1IQGA 3JZ2B 3R3GB 1Y3XA 3ZZ3A 1AGJA 1K1MA 1S81A 3QZQA 1JMOH 1CGIE 3FN8A 1PQAA 1TPSA 1ZGVA 5EPYA 4WMEA 2PR3A 1ZHMA 5DGJA 2BQ7B 2ILNA 3LC3A 2G00A 1PFXC 3OYPA 4A1VA 2FYRA 1C1NA 3UR6A 4D76A 1GJ4H 1DWDH 2WYGA 1GCTB 1SHHB 1PPHE 4JZDH 1VGCB 4I8HA 3STIA 3QLPH 2VVVA 1S6LA 1PPZA 4B76A 1W0YH 1MBQA 1XUGA 3SU3A 3ZVCA 1K1LA 4BAOB 3VFEA 1H9LB 5KECA 5IYTA 5FAHA 3W1EA 1P2QA 2XOKD 5GXPA 3TNSA 3SJOA 2A5IA 3SV7A 4MPWA 1O5EH 1COWD 2F9PA 2R2WU 3BG4B 2ZHWH 1LKBA 2P16A 1DXWA 3KIDU 1EZUC 4NFFA 4A92A 1Y5BT 2JETC 3RXIA 2IJOB 1TX8A 3MU0A 1XUFA 3ZZBA 1GG6C 3GCHB 4NA9H 4ABIA 1VCPA 3KQCA 1C2LA 3CS0A 3M3TA 3ATLA 1L2EA 4RI0A 2ZCKP 1FI8A 1P06A 1ZMNA 3PTBA 1V2ST 3IITA 3RXTA 4A7IB 4ZKOU 1PYTC 5LGOA 5EW2H 5KGOA 1SHYA 4OGYA 1HYLA 1BTHH 2H2ZA 1C5LH 2XCFA 2BD5A 3PTNA 1TGTA 2I6SA 1KTTB 1NZQH 3GY5A 2HNTC 1C1SA 3T27A 1ZMJA 1BTPA 4I8KA 4AC9A 4VGCB 4BTTB 3A85A 2IPHA 3ZVBA 2VIDA 4R8TB 1GJBB 3LKWA 2C3SA 2FOHA 2J38A 4P02A 3GS9A 2A7CA 2BQ6B 2AS9A 2UWLA 3D49H 3I77A 3L3TA 1N1LA 4Q7XA 1C5UA 1SL3A 4BTIB 2HVYB 1XXFA 4DW2U 1B5GH 2QYIA 6GCHG 2ZDVH 3C1KA 5KEDA 2P3UB 1GBLA 1ZR0A 2W6ID 5J4QA 3BEFB 3MH7A 3MMGA 1O2OA 1SR5C 1BT7A 4UD9H 3STJA 3B8JA 3T25A 1UTJA 1S6HA 1NN6A 2FOFA 3UTUH 2K8IA 1BHXB 1YC0A 3FFGA 5FXLA 2AIPA 2QF5A 3Q77A 1V2WT 1W7GH 4INHA 1SGQE 1QFKH 1SGTA 2FOAA 3BTQE 1T4UH 3S9CA 1O5GH 1W8BH 1T8NA 5DPAA 2ZPSA 2XC0A 4TT3D 1GJAB 4ZROA 4X6PA 2GKVE 3AVZA 2QY0B 4B6EA 1BRCE 1C4Y2 1HIAA 3S0NA 3SGBE 2TRMA 4Y7AA 5BPEA 3RXJA 1DY9A 2EI8A 1SLWB 1BMFD 1H8IH 1SKYE 2V3MA 4AB9A 4TY7A 3PV4A 3SHCH 3EA7A 1RTFB 3LC5A 4Y6DA 1OP8A 4ZHLU 5TCAA 1YPEH 1HJ9A 4WVPE 4D9RA 1UVPA 1GHAG 5FHTA 1AB9C 1O3EA 3BEIB 4UFDH 4WWYA 1SFIA 2FEQH 2AYWA 3U1JB 1JRSA 1G3EA 2JDID 1ETTH 1MUEB 1Y8TA 1QR3E 1UJ1A 3M5MA 1PQ8A 4ZXYH 3SUEA 4O9VA 3SU0A 4UFFH 1BBRE 5T6GA 1YP9A 4JK6A 1BMNH 1M9UA 1GMCF 1ANCA 1YLDA 2FXRA 4FU8A 1ESAA 1UHBA 1YF4A 3GCNA 1SVPA 2OCVB 1QTFA 1DWBH 1EZSC 1MKXH 2Y81A 1ESBA 3ZVAA 2HALA 4WF8A 2VU8E 2ZQ1A 2KCAA 3KYFA 1GPZA 3RXPA 2XCNA 1INCA 3LJOA 2ZU4A 1QJ6B 3P17H 1HJAB 2VBCA 5HM2A 1O2WA 2L74A 2GMTC 5F8XA 2PUQH 4M7GA 2Q6GA 2C8YB 5DSFA 4LZ1H 2FESH 4A1XA 4DT4A 1LHFH 5HXFA 2WPKS 3QX5H 5JPMH 1P2NA 2GZ7A 5EODA 8LPRA 2HPPH 2PKAA 1O2VA 3VB6A 4CRCA 1EAIA 1EAWA 4O3UA 5C1XA 2J5UA 3PLPA 1Z8IB 2CF9H 1N6XA 1MTNC 1WXRA 1KLIH 1YLCA 1SFQB 1XKBC 1WV7H 4X1PU 1VKYA 3MH4A 1O30A 2AGEX 4WJG2 1ZRKA 4AG1A 4FUHA 2OC0A 4B6FA 3N7DA 1DY8A 3RM2H 2Z9IA 3SHAH 1C1PA 1C1WH 3U8OH 1P9SA 5K0HA 1FLEE 1K1JA 2KZ4A 2WPDD 2OC1A 4NGAH 4ACBA 1THRH 3RC6A 2ALVA 3PO1B 1HAOH 1SB1H 1P2OA 2FS9A 4Y76A 1SSXA 2Y6TA 1LPZB 3GY3A 2FTMA 1CA8B 1Y3UA 1C1QA 4GHTA 1F0TA 3ATMA 1G2LA 3E1XB 1EJAA 1P02A 2ZDNA 1RD3B 2ZC9H 8GCHG 5E8EH 2WV9A 1RFNA 2UWOA 2J98A 1BBRH 4X2YA 3E0PB 3TNTA 2ZGCA 2ZGJA 5K7RA 2D8WA 2GP9B 2CK3D 2ZU3A 4E7RG 1J16A 3RU4T 1O2ZA 1BITA 2Y7ZA 4E06H 1TNLA 2A31A 2VINA 1UTKA 1QGFA 1IQNA 1AZ8A 1OWDA 1DX5M 3M36A 2FOMB 2VIWA 5DP5A 1GGDB 3QO6A 1D6RA 1AN1E 3KEEA 1CHOF 2SGAA 2SNVA 2P94A 3AASA 2ULLA 4LOYH 1YPHC 1YPGH 1TRNA 2AGGX 2D1JA 2NWNA 2FYQA 1C2FA 3A8DA 1SC8U 5EOKA 4Q80A 1IQKA 2FX4A 3R0FA 2ZP0H 2UUJB 5T1VA 1BJUA 4KTUA 2VWOA 2PTCE 1QB6A 1N8OB 1A3EH 7ESTE 2GCHG 4YM9A 5EG4A 3BTHE 1HPGA 3FP8E 3QUMP 1O2JA 2G81E 3E90B 5IDKA 4O97A 1ZYOA 4HFPB 3TJVA 1HAXB 3A7VA 4BXWA 4A5TS 1FJSA 1CQQA 3ZZAA 3HATH 3NWUA 1FY1A 1Y5UT 1O2RA 3SUDA 3GY8A 1TB6H 1LVYA 4JZEH 1DDJA 1SG8B 2ZKSA 1D6WA 3ATWA 2XWBI 1O2TA 4ZUHA 2VH0A 3OAAD 1F5KU 1GI0A 1RTLA 2BDGA 1TNIA 1RXPA 3TK9A 2BY7X 4ISLA 2NU2E 2UUFB 4TPIZ 1ELGA 1ETSH 1UCYK 2TGAA 2CMYA 2V0BA 3PLBA 1MZAA 4YLQH 1C5MD 1NESE 4X8TH 3SUFA 1LPKB 4ABFA 3S9BA 2F4LA 2QXIA 1HV7A 2CJIA 4P00A 1O38A 1SGNE 1YKTA 1GBEA 1PPFE 4CHAC 2LP6A 1C2JA 3DFJA 3QGNB 3AAUA 2FLBH 4R0IA 2BDAA 2P8OB 4MPXA 3ZZ4A 2FP7B 1P11E 2BXTH 3O8CA 1W0ZU 2ZFRH 1NM6A 4NIYA 2ZEBA 3T62A 1ORFA 1SGPE 4OM9A 1XUKA 1O3FA 1BTUA 5F8ZA 1QJ1B 3NCLA 1GMHG 3F9HA 1BTZA 3RXGA 2HNTF 1NTPA 1V2PT 2WPLS 2ZDLA 4D9QA 1EJNA 5E0HA 2A7JA 5L6NH 1K9OE 2F9BH 1BHXF 3GY2A 1HAYB 2WSSD 2ZGBH 1QRWA 2EI7A 3TPIZ 3TH3H 4CRAA 4IBLH 1O2YA 3FANA 2CN0H 1GHBF 1OOKB 2PGBB 1ETRH 1H8ED 1WUNH 4ZKRU 3ITIA 1HBTH 4YLUA 2KAIB 2PFEA 3ELAH 4K2YA 1ACBE 4YESB 3EGKH 5EPNA 2BDYA 5FCRA 1WU1A 1XKAC 1RGQA 5DP6A 4ZCNA 2QN5T 2Y80A 2P3TB 4A6LA 5CHAB 1QA0A 1H8DH 4Q7ZA 1LKAA 1SQRA 5FPSA 1BRAA 4FUFA 5CE1A 9LPRA 1C2EA 1NFUA 2PGQB 2R9PA 4BANB 1HAZB 1TPOA 3TH2H 1A2CH 1JWTA 1ABJH 2ZHDA 1IHSH 3HK3B 5CDFE 1GDNA 2F9OA 2VWNA 1VR1H 1DUAA 2WPHS 1QB1A 5C67A 1Z8GA 4SGAE 1D9IA 2R3UA 3ZV9A 3GCTF 2TGPZ 1ELDE 3ESTA 3VGCC 4F49A 3KQBA 2A4OA 3BTME 1F0SA 1LVMA 3PMAB 3U28C 3Q76A 1C5OH 4JZFH 4NZLA 3SBKA 4D7GA 4BAHB 3UR9A 2WYJA 4CH2B 1CA0B 1TPPA 2W7UA 1GJDB 1AQ7A 2VJ1A 3V13A 1GI9B 4I8LA 5C5OA 2ANYA 1PJPA 1OWJA 4ABAA 4MNYA 1BTWA 1HXEH 3FAOA 3SO3A 1T8OA 2O8UA 4NA8A 1MTWA 2QE7D 1WCZA 1HIAB 2IJD1 5B6LA 2ANMH 2NU0E 4BNRA 3F1SB 3A8AA 4Y10E 3IWMA 4CRBA 1YGCH 1QL9A 3UUZA 2ANKH 4I32A 2G4TA 3MQKC 2SGEE 3EAJA 4GVUA 1TONA 2P59A 2KCYA 2SGQE 3UFAA 1GI3A 3DA9B 1OPHB 5HIZA 1HAVA 1BOQA 1EUFA 2PKSC 4Y11E 3NRLA 3FVFB 1TYNA 1GWAA 1P04A 1XUIA 3JZ1B 4CRDA 2ZTXA 5ESBA 3A84A 2J2UA 1E35B 1YPMH 1O3CA 1GJCB 3TK6A 1NRPH 1FV9A 4Y8ZA 1NBME 2OC8A 2R0LA 5JB8S 1HCGA 2G8TA 1O36A 4Q7YA 5I46H 4B2BA 3RXCA 1EAUA 1UHBB 2QXJA 1GBFA 1AWFH 1Z8RA 2ZGHA 1GBCA 1O2NA 2UWPA 3W95A 2M5TA 2J4IA 4NIVA 2J9NA 1L4ZA 2BD4A 2GZ8A 1NPMA 3VB3A 1B0FA 4TYDA 1QRXA 4YO9A 1L4DA 1KXAA 3T26A 3SJ8A 1TGCA 3ZYDA 1FX0B 3PMBB 2FWWA 4AGKA 1O39A 1C5SA 1NS3A 2QF4A 1GJ9B 1MMJN 2Z3CA 2F9VA 3PWBA 4B71A 3E91A 3VB7A 5L2YH 1Y5AT 3BF6H 4UE7H 3BTWE 3Q3XA 1KXDA 2PKAB 3BTFE 1TRMA 5AFYH 1X7AC 3DSOA 1B7XB 1MCVA 4NZQA 1GCDA 4X1NU 1K22H 1O2LA 2JH0D 3M35A 1CO7E 3BIUH 3PMHB 1EPTA 2EI6A 1JOUB 1QA7A 1PPEE 7GCHF 1GCTC 5DP4A 2QAAA 4TSFD 5A8ZA 3UNRA 2BMGB 1VGCC 3UNSA 3UQVA 1NRNH 2AH4X 3QGJA 2WPIS 5EJLA 8KME2 2FLRH 1MU8B 2XRCA 2GDEH 1V2RT 1V6DA 1TOCB 3K6ZA 1G30B 1L1NA 3ZIAD 3ZZ8A 2HNTE 3BG4C 1LCYA 4HGCA 3SN8A 3LH1A 4KKDA 1G3BA 1TNKA 5A8YA 2H9TH 1GBTA 2BLQA 1CBWB 2DUCA 2XWAA 4X8SH 3GCHC 3T2NA 5GCHG 3RXSA 2BTCE 1QJ7B 1A0JA 2C8XB 1FXYA 3HPTB 1OXGA 3OE7D 3G01A 3RLWH 4AYYB 3MO6A 2H1UA 4GCHF 2BOHB 4XBDA 2GZ9A 2HOBA 2J98B 1MQ6A 6CHAB 3RMNH 3RMLH 2BVXH 4UFGH 1YY3A 1W11U 1VITG 4JCNA 4I8GA 2J95A 1UK2A 3N7EA 4VGCC 4BTUB 3GDSA 1AI8H 2B7DH 1P3CA 1GHXH 1MD8A 1GDQA 2CXVA 4XBBA 4MPVA 5EXNA 3VG8A 1GI4A 1Z6JH 1DWEH 3A7XA 2OUAA 5EXMA 3GICB 1NRRH 3RXHA 3UPEA 2SNWA 4B2CA 2HVXA 5HM9A 1ESTA 4E05H 1DLEA 1ELEE 1KYNA 2FO9A 1Z7KA 3D23A 4LXBH 1L0ZA 2W6JD 1S83A 2BD3A 3KCGH 3RC5A 5A0BA 1MKXK 3E6PH 1P57B 5C5NA 2C4FH 4RT1A 3SU4A 3SU1A 5A0AE 4X2XA 1MQ5A 3A7TA 1XMNB 2A7HA 1YYY1 1F0RA 1HJ8A 4IMZA 2OD3B 3SQEE 3BTKE 3MO9A 4YOJA 3TK5A 2O9QA 4GHQA 1BRUP 3A7WA 1GI5A 1T31A 1AD8H 3GY6A 3TJUA 3ZYEA 2BM2A 1S85A 5DP7A 5C3NA 4WXIA 4O03A 4X8VH 2XXLA 3LGIA 4AFUA 2VIQA 1NRSH 3A8BA 3BTGE 1AFQB 1GJ8B
chains in the Genus database with same CATH topology
3UQOA 4INKA 4NSVA 1ELVA 1C2GA 1TLDA 2FPZA 5EGMA 4K1SA 2GT7A 4Y8YA 1BRBE 3EQ0H 2GD4B 1D3DB 4IS5A 4HZHA 4NFEA 1FN8A 1WSSH 4FU7A 1C5XB 1UVTH 3M37A 3P92A 1SGRE 3UOPA 1ZRBA 1LMWB 2PSYA 1SGFG 2Y5FA 3PLKA 5PTPA 3M3SA 1QQUA 1ZTLA 2VGCB 4Y8XA 3MHWU 2QXGA 3IG6B 2AFQB 4TPYA 1P2IA 1TRYA 3LT3A 5LH8A 5EU8A 3TU7H 2C93B 3KF2A 2A5KA 4CH8B 1AKSA 2OC7A 3BTDE 1UTMA 5T6FA 1HJAC 4KP0A 1SQTA 1LTOA 1KTSB 3A83A 1XUHA 1CU1A 1DE7H 1BBRK 4TWYA 1AVGH 2Z94A 4MVNA 1NO9H 4MPUA 5ESTE 4LK4A 2PUXB 1TAWA 4WY3A 2FOCA 1CE5A 4K60A 1HAHH 1MBMA 1RIWC 1F0UA 4B2AA 1LQEA 4DVAU 1C1MA 1W3CA 2VIOA 3A8CA 1DANH 4ABDA 3RU4E 6ESTA 1K1IA 5A09A 1K1PA 3MOCA 4ISIH 3A82A 1A5IA 3KQEA 4U2WA 5LPEA 2PSXA 1SLVB 2CHAB 4JYUH 1A0LA 5AF9H 1V2OT 2VVCA 4K69A 4AYVB 3URDA 2BD7A 3NZIA 1P12E 3P8NA 3O8RA 1W14U 2THFB 3ODDA 1DPOA 1ARBA 1ZTJA 1J9CH 3ZZDA 1WTHD 3PO1C 1F5LA 2FZZA 1S6FA 4GUXA 1O3MA 1MCTA 3U8TH 4CBNA 2HLCA 3VB4A 1Q3XA 1FIZA 1IQHA 3GDVA 5A0CA 2ZU2A 3RXDA 1QQ4A 2FX6A 1O5DH 2ZDAH 3RXVA 1O3LA 1HNEE 3B9FH 3U8RH 1ZSJA 5C2ZA 1O32A 4CR5A 1NFXA 1EKBB 1MTNB 4O3TA 3ZVGA 1BZXE 4MLFB 4YTAA 3CP7A 5F8TA 1BUIA 1ZGIA 3VPKA 4GLYA 1QCPA 4ZHMU 3T29A 3ZZ6A 3A7ZA 1AFEH 2F3CE 3UREA 1IQLA 2Z9LA 2ODPA 1PPGE 3SV2H 1GI2A 1GGDC 1TE0A 4NA7A 1JRTA 3SW2B 3FP6E 1KDQA 4IC6A 5DP3A 2TBSA 1K1NA 2BQWB 2BOKA 1JIMA 1EQ9A 3KGPA 2G4UA 1GMCG 1SLXB 2Z9JA 1O3GA 4D7FA 1XXDA 4AN7A 5H4IB 1SMFE 1C1VH 3SJIA 2O8WA 3M5LA 5FCKA 2ZDMA 1C1RA 1SQOA 2SGPE 4NCYA 4AGJA 3A80A 1QB9A 2B0FA 4Q2KA 4OS1A 1ZZZA 2DE8A 1XVOA 2RCEA 3BIVH 2SFAA 2ZTZA 2BDHA 4H6TA 3LU9B 3GYMA 1C2KA 2WPMS 2ZGXH 1HAIH 5C1UA 2BY5X 4ESTE 5FBIA 1TMTH 2ZG0H 2W26A 1O5CB 2XC5A 2O8MA 2PV9B 3K6YA 3SU5A 2GGVB 1LPGB 1KY9A 1IHTH 2H9EH 3OY5U 1F92A 4WH6A 1FAKH 1FPCH 1YPJH 2XBVA 4U01A 1P2MA 4X1RU 1GL1A 1EJMA 3B23B 4RKJB 2G55A 1EP5A 3LDXH 5TJXA 3PM3A 3EA9A 2F83A 2HPQH 1W13U 1Y3YA 4FVBA 1O2KA 5JBBS 1EPTB 1TNGA 4NG9H 1OX1A 4FXGH 5E2PA 3DHKH 1W12U 5B6OA 2Y7XA 1HRTH 3URCA 2XC4A 1ELCA 1UVSH 3M3VA 1Z8JB 4IC5A 1DS2E 4U32A 2H5DA 3M7QA 1HXFH 1Z1IA 4ABHA 1KLJH 3DFLA 1GJ6A 2ZIQH 4JK5A 2OP9A 3RXUA 2BD8A 3EDXB 4B1TA 4DIHH 1BMLA 1UTOA 4AFQA 4ZMAH 1V2KT 4X6MA 3I29A 2AIQA 2ZTYA 4I31A 4DCDA 1D4PB 1MTUA 3LGYA 3L6PA 2XNIA 4X2WA 1A5GH 1S82A 2XYAA 1K1OA 3GCOA 2GCTB 4H6SB 3MH6A 1GVZA 2RA3A 1MTSA 1HDTH 3PROA 1V2VT 1EASA 1KIGH 3P95A 4K8YA 1ZTKA 4FVDA 2P93A 1FONA 3SNAA 1CHOG 1J15A 5T6DA 1LDTT 1T4VH 2H5CA 3RC4A 4TY6A 4CHAB 4RN6A 3SV8A 4FUEA 5CHAC 3RXEA 1O3AA 2ALPA 3UWJH 1TBRH 3ZVEA 1EZXC 2A0QB 4BOHA 1KXFA 1V3XA 1QBNA 2ZECA 3MFJA 1MKWH 1O2XA 1OSSA 4KGAA 2A2XH 4YZUA 1YCPH 3SU2A 1FMGA 4WXVA 3RXAA 1Z1JA 3PYHA 1LVOA 2CF8H 1NC6A 1GMDF 2FI5E 3P8OA 1V2JT 1QHRB 3RXLA 2YNBA 1CVWH 3TJNA 4DIIH 3BSQA 2TGDA 1NFYA 1TX7A 3SGQE 2Z9GA 1CT4E 3SV6A 2ODYB 5ETXA 2WV5A 1AY6H 2TPIZ 3SOSA 2ZF0H 1O2IA 1PQ7A 4DGJA 1XX9A 2ZFQH 1O5BB 2Y5GA 3I78A 3TITA 2WV4A 3RP2A 5EQQA 1V2LT 1L1JA 1V2MT 1HFDA 2F9NA 3RU4D 1DSTA 2NU3E 1TA6A 1BDAA 3UNQA 4LZ4B 4ABBA 4GPGA 2XW9A 1E38B 3W94A 2ZCHP 1AO5A 3F9FA 4NIWA 1FN6A 1LHCH 1WOFA 1A0HB 2NU1E 3LONA 5EXLA 9ESTA 1ZOMA 1DFPA 1FY4A 3HGNA 2FMJA 2Y82A 4KTCA 3RDZA 3VGCB 1TQ7B 4J1YA 3T5FH 4YOIA 5AHGH 1OKXA 1TGSZ 1SOZA 2QF3A 5JBCS 1IQJA 3TIUA 1UTNA 1O3JA 1EOJA 2ANWA 2DE9A 2V3HH 3M5OA 2EC9H 1T8LA 2OLGA 4MTBA 1ANEA 3Q3YA 1TPAE 3ZVDA 1GL0E 1VJAU 1GDUA 3RXQA 4Y71A 1AKSB 1F2SE 1W7XH 3E8LA 5E0JA 1Z71A 1AUTC 1EB2A 3ATIA 3OSYA 2AMQA 1QY6A 3LPRA 4OS4A 3P8GA 1SOTA 1THSH 3QTOH 1GHBG 2B8OH 3O8BA 4ZAEA 5FBEA 4ISOA 1QL7A 3GOVB 4OS5A 3OU0A 2K1QA 1KXCA 4PROA 3TJOA 7KMEH 1G37A 1UTQA 4XFQA 1ELFA 3A87A 1D3QB 2WUBA 3ZZ5A 1V2QT 1OWIA 4RSPA 1PPCE 1C4V2 3QN7A 2UUYA 1BMAA 3A88A 4IN2A 3U1IB 1TFXA 4ISNA 1FY8E 1O3HA 1GJ5H 1MAXA 1AZZA 4BAQB 1H1BA 4IMQA 3N7OA 3LGWA 3ODFA 1YPLH 1O2HA 3ENSB 1KLTA 1P03A 1RRKA 6GCHF 5TCCA 1ARCA 2JH5D 1TQ0B 2LNCA 2ASUB 2ZDKA 2VIPA 1RS0A 1QBVH 2TGTA 1G2MA 1KXEA 4AFSA 1PQ5A 3L33A 3GCTG 5G4BA 3V7TA 1WYKA 2V35A 3LOXA 1GBAA 5I25A 3QZRA 1QBOA 4FUIA 2VIVA 1P01A 1GHVH 5FX6A 2C90B 2VWLA 1O31A 3VB5A 1OS8A 1AVXA 2C8WB 4ZHAA 3F6UH 3C27B 3K65B 1HLTH 1UK3A 2GX4A 3RMMH 4OS6A 2ZU5A 3VXEH 2P95A 3A81A 3O8DA 1ZJKA 3AAVA 3RM0H 2FIRH 1C9TA 1N6YA 1ZHPA 3WY8A 1C5NH 6CHAC 2SGFE 4CRGA 1G3DA 1HUTH 1Q2WA 3P70B 3ZV8A 2WUCA 5EQRA 1DICA 2W5EA 2QC2A 1TBZH 1QNJA 1SLUB 4OS7A 5GIBA 4Y0YE 1O3BA 1GHWH 1ABIH 2R3YA 1DITH 1GHAF 2XBXA 1P8VC 2W3IA 3CS7A 3KN2A 3QWCH 1CHGA 1LVBA 3KHVA 1AIXH 4D8NA 3T28A 4AB8A 1BQYA 1KDQB 3LGVA 4WH8A 2Y5HA 1O2MA 1O34A 1XVMA 3GY7A 8ESTE 1HAPH 2ZFFH 3NKKA 5T3HA 3S7KB 3TLOA 1GHYH 3ZZ7A 2GDDA 2XTTB 1CGHA 5JBAS 3UY9A 2D2DA 3UWIA 3M61U 5JYIA 1EAXA 1OYTH 1LHGH 1O3NA 2BDBA 1VCQA 4KELA 4INLA 2JETB 2FTLE 2D26C 1GG6B 2FOBA 2A32A 1C5ZB 1P2JA 4DJZB 1CGJE 2A1DB 1OP2A 1ZMLA 1FPHH 1P3EA 1L1GA 1B0EA 1HAGE 2KAIA 5L2ZH 5GPIB 2Q6DA 2VVUA 4ASHA 4X6OA 5CMXH 4AORA 3SNBA 1CT0E 2A45B 1IQEA 2FOEA 3A86A 3PMJA 1LO6A 4NWKA 1AFQC 1FQ3A 1D3PB 2BVSH 1FUJA 2WINI 4AOQA 3ZVFA 1TX6A 1YM0A 4Y79A 4MG3A 2AERH 3E3TA 1UTPA 2BYAX 3M7UA 2ZU1A 4BAKB 7GCHG 2PTNA 2HGTH 1ELAA 3MNXA 1O37A 2ZQ2A 2H9HA 1P0SH 2RA0A 1C5RA 2G5VA 3MO3A 1MZDA 1GBKA 2ZPQA 2VGCC 1GVLA 1C2MA 1A4WH 2ZFPH 4JZ1A 1DOJA 1O5FH 2QA9E 1T32A 1ELBA 3M7TA 1NU7B 1IQIA 1BJVA 1G32B 4UONA 4ZXXH 3RXMA 3SUGA 1TWXB 1GBIA 1MAYA 4UFEH 4YT6H 8GCHF 2G51A 1K28D 1QIXB 2A5AA 3HKJB 1ZPBA 1BB0B 2ZFTA 2BX4A 4GCHG 1YPKH 2BXUH 4X1QU 1C5WB 5DO4H 1GBBA 1SGYE 2R2MB 3RXBA 1P2KA 4HTCH 1EX3A 1NFWA 4AFZA 3PWCA 1YCPM 2BZAA 5FPTA 4WMFA 1TGBA 2H6MA 2OQUA 1TMUH 2JKHA 1TA2A 2CHAC 1AB9B 5J4SA 2I6QA 1TGNA 3OY6U 1GI6A 1W10U 1C5YB 5GWZA 1RJXB 1W2KH 2Q1JA 1Y3VA 5F03A 1Y3WA 2BLWA 1V2TT 1EOLA 3LIWA 2BVRH 1DVAH 1O2UA 1TNHA 1ANDA 2J94A 4X2VA 2GV7A 2QIQA 3TGJE 5DP9A 1UK4A 2EA3A 1C2IA 2VH6A 3EA8A 1TALA 3U69H 2GCHF 3HKIB 1C5TA 4K5ZA 4ZKSU 5GJ4B 2QGRA 3BTTE 2GV6A 2A4GA 1WTGH 3E16B 3E0NB 4SGBE 1AWHB 3MTYA 2CV3A 4K8BA 3S7HB 3CENA 3P6ZB 2W7SA 2BHGA 4E7NA 1IAUA 1UMAH 2ZA5A 1RIWB 1TABE 4X0WU 2GMTB 5EW1H 4MDSA 1C5PA 1SPJA 3KNXA 2LPRA 3MNSA 2C8ZB 2STBE 3SI3H 4YT7H 1WBGB 3SJ9A 1CSOE 4JYTA 1FIWA 1VITH 1YPHE 3EYDA 4XDEA 1E34B 4CRFA 1E36B 3SZNA 2BB4A 3OX7U 1JIRA 3H5CB 1UVOA 2PW8H 2ZI2H 4CR9A 3TVJB 3SORA 1A46H 4Y0ZE 2YOLA 1SQAA 1P10A 1IOEA 1ID5H 1S84A 1J14A 1OP0A 4DOQA 1BA8B 3Q00A 1A1RA 3ZZCA 1QURH 2ZCLP 2ZNKH 3S69A 4FUJA 1BTYA 1E0FD 1NY22 1XUJA 1OYQA 3NPSA 1C4U2 1HB0B 3KL6A 4OS2A 1V2UT 1BMMH 5AFZH 3UIRA 3BV9B 2ZHFH 2PWXA 4FUGA 1AE5A 1HAVB 5JBTA 1E37B 2ZFSA 4UEHH 3LGTA 1PYTD 1KSNA 2R0KA 4AZ2B 1G36A 1FY3A 2Z3EA 3SI4H 1H9IE 1N8OC 1GMHF 2OINA 3OTJE 1FZZA 1PPBH 3GY4A 3H7TA 1JXPA 3GISB 1ZPCA 2ZHQH 6LPRA 1AE8H 2G5NA 1HGTH 3TH4H 2PHBA 4IW4E 3NXPA 1T8MA 5GDSH 1FNIA 2JH6D 1LHDH 1GBDA 3MU8A 2QXHA 3RMOH 1SGIB 1Z6EA 1K21H 2AEIH 4ZKNU 2VNTA 1KXBA 3MU5A 4IN1A 1GHZA 1DM4B 3BEUA 1F7ZA 2FOGA 4XBCA 3PB1E 1GI1A 4X8UH 4ABJA 2F91A 4K1TA 3P8FA 4WMDA 4ZH8A 1FY5A 3MU4A 4IGDA 2BDIA 4BXSA 5E2OA 5DKMA 1O2GH 4A1TA 4NSYA 1P9UA 1EPTC 3SNEA 1C2DA 1DXPA 3SJKA 1C9PA 4RKOB 3SU6A 1H4WA 4XSKU 1O3PB 2AGIX 1H9HE 2VWMA 3DUXH 2ZPRA 1DSUA 1MKWK 4JYVH 4ISHH 4B73A 1ANBA 1TOMH 3S9AA 4J2YB 1YCPK 1NROH 2BY8X 2BD2A 2XBWA 3MU1A 4I33A 4U30A 2Z6BD 1C5QA 1MH0A 3LJJA 1D3TB 1O2QA 4DY7B 1MD7A 1UCYE 5L30H 2P8OC 3FZZA 1C1UH 4GAWA 3K9XB 3BG8A 1ZLRA 2O8LA 3MNCA 2OTVA 2BDCA 1ZJDA 1XM1A 4BAMB 3QTVH 5BRRE 5HYOA 3A89A 3VXFH 1GBHA 3MI4A 2GCTC 3NK8A 1AUJA 3V3MA 2Q6FA 2XBYA 4X6NA 4UDWH 1O33A 3MH5A 2RG3A 1SGCA 1CT2E 1DT2A 1V2NT 2FODA 2SGDE 1OWKA 5C20A 2RDLA 4JZIA 3U9AH 1F5RA 3DT0H 4KTSA 4I8JA 2VB0A 2GT8A 1FDPA 3UOUA 4CBOA 1O3KA 1UTLM 3TGKE 1S5SA 1AMHA 2QCYA 3ATKA 2FM2A 1O3IA 4B74A 1O3OA 1JBUH 3A7YA 1TNJA 1YBWA 4B75A 1GI8B 3RXKA 1FAXA 4K3JA 5LPFA 3SNCA 2GVFA 1QRZA 2ZWLH 3Q3KA 4CREA 1NU9A 1ZSLA 1AHTH 4MNVA 1EXFA 5HGGA 1S0QA 2OBQA 1NRQH 4X1SU 1K2I1 1OWHA 3K2UA 5FPYA 2F9UA 1BIOA 1ZPZA 2IOTA 1QL8A 1VZQH 1C1TA 1GBJA 4FUDA 1SGDE 3D65E 1LHEH 1WQSA 5AVDA 4ABEA 3LH3A 5DP8A 1EZQA 3AW0A 4FUCA 1J17T 1MU6B 1NT1A 1A7SA 2V6NA 4Y7BA 2HRVA 3LGUA 1Y59T 2BY9X 4XE4A 1CA0C 3SNDA 5LPRA 3MWIU