1Q31A

Crystal structure of the tobacco etch virus protease c151a mutant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
227
Chain Sequence
LFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEMNELVYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tobacco etch virus protease shows the protein C terminus bound within the active site.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein, hydrolase
molecule keywords Nuclear inclusion protein A
total genus 52
structure length 227
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q31A02
1QJ7B 3PLBA 1BHXB 2B8OH 1O2KA 3E16B 3AW1A 3TK5A 4Y79A 1EQ9A 1LMWB 1PQ5A 1VITF 2FDAA 2W7SA 3A85A 1SGNE 3ZVAA 1D9IA 1XX9A 1TX8A 3TJUA 1EOJA 3QLPH 1UTNA 4J1YA 3RXFA 1LKAA 3U8RH 1ANDA 3LC3A 3QZQA 1UK3A 2VIQA 2R0LA 3UOPA 1C5QA 1O30A 3SI3H 3ZZ4A 1DVAH 5E8EH 3RM2H 1TYNA 5IDKA 1HGTH 1VITH 3U1JB 1THRH 3ZZBA 3URCA 1ZHRA 2WPJS 1KXCA 2H9EH 2K1QA 2V35A 2NU1E 1Z6EA 3A84A 2PHBA 2FS9A 1FY5A 1NC6A 2GT7A 2F9OA 4LOYH 4AGKA 1T8MA 1P11E 4FUHA 5EGMA 1TBQH 2XWBI 3MU1A 3RU4T 1GI6A 2ZGJA 1RXPA 3O8BA 3Q3YA 3LGWA 3ZZAA 1ABIH 4KGAA 4MG3A 1UTOA 1QY6A 3SV9A 1OP0A 4XBDA 3AASA 4AG1A 1JBUH 3VB6A 2FOEA 2OD3B 2ZG0H 2PKSC 1G30B 1EZQA 1KTSB 5DJ7A 2ZU2A 4A92A 1CA0B 3OY5U 1TX7A 1C9PA 2VVUA 2F9NA 1AWHB 3ZZ8A 1TA6A 3DT0H 1VCWA 4DJZB 1W0YH 3S9BA 1C2DA 3PLKA 2ZGXH 4KTCA 5CE1A 1VGCC 2Z9LA 1ESTA 3U8TH 1OP8A 4TWWA 3LGYA 3VGCC 1V6DA 7ESTE 2O8MA 1W11U 2ANWA 3HK3B 1YPMH 1MTNB 5GCHG 3MHWU 1EUFA 3HPTB 5DP7A 2UUFB 4U30A 1EPTB 1TPPA 1GJ9B 2BM2A 4YO9A 1EOLA 1DT2A 2PV9B 1Z7KA 3SUDA 1K1OA 4MPXA 3TH2H 3OTJE 1O2RA 4FUIA 1Y3YA 1FI8A 1SGDE 1SL3A 2NU0E 3SZNA 1MTSA 1HAGE 1V2WT 1SQOA 3PO1C 1CU1A 4ABEA 5DP4A 1ZMJA 3U9AH 1JOUB 3TNTA 2PR3A 1DS2E 1MQ6A 1HYLA 4WY3A 2R2MB 1O36A 4XFQA 1SGIB 1PPZA 1WCZA 3A7TA 2AEIH 4X8UH 3E0NB 1AI8H 3SHCH 1HAYB 3BIVH 1W0ZU 4M7GA 1EP6A 1UTJA 2PUQH 5C1UA 3E3TA 3MO6A 3QDZB 4X6NA 4O03A 5JPMH 1QRWA 2CF9H 4RKOB 2ZCHP 1BRBE 3TGJE 1HPGA 1BOQA 3BTGE 1SVPA 1UCYE 5LPEA 1BCUH 2QAAA 1SHYA 1NRRH 2C90B 3FP8E 3A81A 2OBOA 1AGJA 1GMCG 1V2LT 3H7OA 2W3IA 4FU7A 1Z8IB 1E37B 3KF2A 2PKAA 1QJ6B 4D8NA 1K1LA 2BOKA 3UQVA 1O3NA 3OY6U 4X1RU 5L6NH 1K22H 1Z8JB 3A8DA 1CT0E 4X2VA 2J2UA 1TNKA 1SGRE 4CR5A 1BTXA 1L4ZA 2BLQA 3RU4E 1CGIE 2HNTE 3AAUA 5F8XA 3MTYA 1SC8U 1CT2E 1FN6A 1ELDE 1QQUA 3HGPA 1GBKA 1GL0E 1KDQB 2EI6A 4K1SA 4WH8A 2BVRH 5EXMA 1QIXB 5HM9A 3LDXH 2BHGA 4CRBA 3VXEH 1GHBF 2D8WA 2FO9A 1HAXB 4MNWA 3RMNH 5FBEA 2UWPA 1HUTH 1A5GH 1K9OE 1ZPBA 1RRKA 1TNHA 1ZSJA 1LPZB 1ZTLA 2ANMH 1NRSH 1W7GH 1DUAA 4IN2A 1O34A 2AIQA 1O39A 4YTAA 1FLEE 2EEKA 3P6ZB 3URDA 1AB9C 1GMHF 4GHTA 4Y8ZA 3UNSA 5J4SA 2Q6DA 2RCEA 1XXFA 2OINA 1PYTD 4X2YA 4JYTA 1XVMA 3LJJA 4O3TA 1FJSA 4ISLA 1MBMA 1C1MA 2J9NA 1BUIA 1UTKA 3SNDA 3VB5A 1LVYA 3L33A 1AUJA 1N8OC 4TWYA 1Y5UT 1YP9A 2VU8E 1O2YA 3M5MA 2BQ7B 1HAVA 1QRZA 2ZIQH 3QTVH 5IYTA 1QA0A 4CBOA 1CGJE 1G2LA 3RDZA 4A5TS 2QGRA 2VGCC 1TBZH 3MNBA 1AIXH 3M36A 4KTSA 2FTLE 3IG6B 3SORA 3A80A 3SNEA 4A1TA 1C1QA 1S84A 2ZDLA 4IMQA 3E0PB 2STBE 5ETXA 2OBQA 2XW9A 2FI5E 4CHAB 1HAOH 4MNXA 2PW8H 2PWXA 1VJ9U 1DDJA 1P2MA 1QTFA 1F0RA 3GDVA 4RSPA 2ZFFH 5C5OA 1P02A 2BMGB 1Y5BT 1DLKB 3ZVCA 3E90B 5T6GA 1YF4A 4UFGH 1SGPE 1CBWB 4WXIA 1LPGB 4FUEA 1W12U 1TMTH 5T6DA 1CHOG 2V6NA 4ASHA 5EQSA 2ZFRH 1MCVA 4GCHF 3RUOA 1JIMA 3BTQE 4WMDA 4D76A 3VXFH 1CSOE 1HCGA 2SGQE 3RXSA 5BRRE 1OWIA 4FUDA 1UO6A 2D2DA 1Z8GA 1KYNA 5AVDA 2CGAA 2Y5FA 3LONA 3ZZ5A 2VH0A 1VCPA 2QIQA 1SHHB 2ODQA 3RXGA 1NU9A 3STIA 1DWDH 2FWWA 3LOXA 3SNBA 1OWHA 1ELCA 1C2LA 1TNGA 2FOAA 2UUYA 1BRCE 5F6MA 2ZFPH 2AERH 2CMYA 3SU3A 1P03A 1HAPH 5FHTA 7KMEH 1C2EA 1UVUH 1O3CA 2TPIZ 4Q7XA 2ZHEH 3KIDU 3EA7A 1EKBB 3R3GB 3SNAA 2V0BA 3K2UA 1NRNH 2ZQ1A 1YCPH 1BTYA 1KLIH 4U2WA 1V2QT 2Y7ZA 4I8JA 2CV3A 3S0NA 3ZVBA 4NZLA 5L30H 1QA7A 3VEQB 4AYYB 1IQJA 1WUNH 3P8FA 3M5LA 4CBNA 1NRQH 3MH7A 3KQCA 2H5DA 4NG9H 4AYVB 2WPHS 1CGHA 4I8KA 3TJNA 1GG6B 1SI5H 2FXRA 2ZA5A 1Z1JA 5A8ZA 3S69A 3MH5A 3SU0A 1UCYH 3KEEA 5CHAB 1CT4E 1F5LA 5HMAA 2YNBA 1RTLA 4NA7A 5FAHA 1KXEA 4INHA 1DANH 3SNCA 2GZ8A 4YM9A 2VWOA 1ARBA 1W14U 1BTZA 1LCYA 1Y3VA 4OS5A 1LO6A 1Z8RA 5GXPA 1D3QB 1INCA 2FI3E 1C5MD 5C5NA 1O2OA 1CQQA 2FOFA 1T32A 2P3FH 1GJ4H 4ISOA 3PM3A 4K1EA 1H9IE 2LPRA 1LDTT 2O8TA 1KXDA 1IQNA 1P9SA 4KTUA 2BLWA 2EI8A 2AMDA 2WPLS 1BMMH 3AAVA 1DX5M 1O5FH 1OWJA 3RXOA 2NU4E 4GHQA 2A5KA 1DWCH 1SLUB 6CHAC 3T2NA 5A8XA 1GI9B 3QGNB 2J94A 2XBYA 4FUFA 4BAKB 1MBQA 1YYY1 2HOBA 1S0QA 1UVOA 1YCPM 4UD9H 5GIBA 4B1TA 4DURA 2SNWA 5I46H 1UTLM 4YT6H 2ZDAH 3RMOH 3VPKA 1SOTA 5HM2A 1MTUA 1NO9H 2AS9A 3E8LA 1P3CA 2IOTA 1G3EA 1L4DA 1C2FA 1GBDA 2H1UA 3SV2H 3MMGA 2SGEE 1TX6A 4WXVA 1K1IA 1P57B 2DE8A 1Y3UA 1S5SA 1TLDA 3UIRA 1O2SA 1HXFH 4OS6A 4B75A 3BTWE 3P8OA 4ABFA 3RXRA 3DFJA 1P2IA 3RXLA 1TABE 1TMBH 2XWAA 3QN7A 1DM4B 1MU8B 1WQVH 2HVXA 1AE5A 2OC8A 1GHAG 2XTTB 4JYVH 2ZI2H 4X2WA 2AMPA 1V2OT 1MTWA 1G2MA 3SN8A 2FZZA 3SU4A 2UWOA 1GBFA 1MUEB 2IN2A 4HGCA 3M61U 2ZP0H 3OSYA 4DOQA 2XCNA 5A0CA 2F3CE 1SFQB 3LKWA 1NPMA 2VNTA 4B2BA 1O35A 1C2MA 1OP2A 4JZDH 5EODA 2ZECA 1NFYA 2Y7XA 3MYWA 1DY8A 1OSSA 1E34B 5JYIA 3UFAA 2BVSH 3G01A 3QO6A 3CENA 1Q3XA 1F7ZA 4XBCA 2PLXA 3BG4B 1O5EH 2VGCB 4AG2A 3D23A 1P05A 1SGCA 1MH0A 1WTGH 1QB9A 2BQWB 1ACBE 4JK5A 1H8DH 2BLOA 3SW2B 2ZEBA 1KXAA 4AZ2B 1MKWK 1LVOA 3SI4H 1DFPA 1O3BA 1NS3A 2GCHF 1ETRH 2BDIA 4BOHA 3TU7H 2J34A 4FUGA 3UREA 1IHSH 3A86A 3RMMH 1HJAC 3KN2A 2BY5X 3ELAH 3T5FH 3TIUA 1GHVH 1EPTA 1BRAA 3H7TA 2BDGA 4I31A 4Q7ZA 1K1JA 1Y59T 2QF0A 6GCHF 2QC2A 4O3UA 1O3LA 2BDYA 1FAKH 4Y8YA 3V12A 1EAIA 1P9UA 1FY4A 4RN6A 2FOCA 3K6ZA 4K5ZA 1GJCB 1N6XA 2OP9A 2WPMS 4YLUA 2ODPA 1HV7A 1G37A 3KCGH 2GP9B 1A0LA 2THFB 1LTOA 2W5EA 2A7CA 1HFDA 3UUZA 4FU9A 4YOIA 1EAWA 5GDSH 1O5BB 1THSH 1ZZZA 3TH3H 2AGIX 4R8TB 1YPLH 3P70B 2NU3E 1AB9B 1GGDC 3TJOA 2VIWA 1FN8A 2Z6BD 3L3TA 1OXGA 4Y8XA 1O5AB 3SQHE 4MVNA 1GMDG 3T25A 3KL6A 4NGAH 1QB6A 1E0FD 2DUCA 1C5YB 2HALA 1DOJA 1ELAA 1EASA 1GJ7B 4I8GA 1SG8B 1YPKH 4QT8C 1MTNC 1Z71A 3BN9A 2P95A 5AFYH 3FP6E 3A8CA 4GCHG 4Y11E 2PGBB 3K65B 4CH8B 1QBNA 4WWYA 4AN7A 1QNJA 1ZJDA 3KHVA 4CRFA 1ARCA 1BBRK 1GVKB 1EJNA 3KQDA 2VH6A 1FQ3A 2BQ6B 1F92A 1Y3XA 3UTUH 1BDAA 3B9FH 1ESBA 1C5LH 8GCHG 1P2QA 4ZH8A 4BXSA 2HPQH 1ZRKA 3PMJA 1O3AA 2GTBA 1FPCH 1L1GA 1GHXH 1D6RA 1ELBA 3I77A 1RGQA 3MNCA 3SU5A 1C5TA 1C5SA 1ELTA 1TRYA 1EB1H 1GHZA 1FY3A 3TGIE 1S6HA 1H4WA 2WV5A 5LGOA 1H9LB 1KY9A 1V2MT 5AFZH 3NUMA 3TLOA 1CO7E 2FX4A 1HXEH 4NWLA 1XKAC 1PFXC 1J15A 5E0HA 2GZ9A 2JKHA 2H5CA 1O2VA 1V2RT 1O33A 5ESBA 1NFXA 4YZUA 2FPZA 1LHEH 3ZV8A 1O3FA 1O2MA 1T8NA 2XRCA 4B2CA 3LGIA 3OX7U 3F6UH 5GJ4B 4ZMAH 1P2JA 1P04A 1E35B 1DICA 3ATKA 1M9UA 2RA3A 1GL1A 1FXYA 2BY9X 1SLWB 2QCYA 2Z3DA 2BD9A 3VFEA 1BTHH 4U32A 4ZKRU 1AO5A 1QHRB 3ZVFA 1J9CH 2JH6D 3RXJA 2R9PA 4Q80A 4ISNA 2ZZUH 2Z7FE 3RM0H 1HAHH 8LPRA 1DXWA 1L1JA 1ZOMA 4IC6A 4Y71A 1ZTKA 4MTBA 5A8YA 1A0HB 1VGCB 4OS7A 1JRTA 4ZHAA 1SQAA 2OXSA 1GJAB 1UMAH 2BXUH 3A8AA 1GBMA 3LGUA 2Z3CA 1TPOA 3SJOA 2ZU5A 5JBAS 2GCTC 2F9PA 1TALA 2ESTE 4AORA 1QL8A 1Z1IA 2A4RA 4NA8A 1RTKA 1RIWC 1UVTH 3GICB 1PPHE 1SPJA 3BF6H 3E6PH 2D1JA 3GDSA 3L6PA 2H9HA 2IJOB 1J17T 3A88A 5ABWA 4ABIA 2JETB 1QL7A 1J8AA 2GMTC 1GCTC 5FBIA 1TONA 3TH4H 3BV9B 3LC5A 1SGFG 2A4QA 4MPWA 4XE4A 4X6MA 1HRTH 2O8WA 1O2UA 1V2VT 4RKJB 1THPB 3FP7E 3SOSA 3FANA 1FPHH 1G36A 2ZPQA 2BLVA 3EYDA 1NM6A 1P2NA 1VJAU 3T62A 2GDEH 4D9QA 1EJMA 4K8YA 1L2EA 2C8XB 3UNQA 1CVWH 1XXDA 2QY0B 3PMAB 3ATMA 2A2QH 4ISHH 2Z94A 2WV4A 1TNJA 2ZU3A 1W10U 2TGPZ 2Q6GA 1Y8TA 1AN1E 3UNRA 1YLCA 1QBOA 1K21H 1EATA 1GI5A 3ODDA 3M37A 1K28D 3F9FA 1GBJA 7LPRA 1AFEH 4ZXXH 2XXLA 4X1NU 2PFEA 4WF8A 2GCHG 1ZYOA 1SLXB 6LPRA 3OYPA 4I7YH 3RXQA 1SFIA 3LH3A 1O0DH 2ZDMA 2RA0A 2YNAA 1HAZB 1V2UT 2BZ6H 1JIRA 4OGYA 1MCTA 2FOMB 1SMFE 2FLBH 1LHCH 5C1YA 3MFJA 1AY6H 1KLJH 3RC6A 2F9UA 1B0EA 2BDBA 2CF8H 1AU8A 1HJAB 1W3CA 2ZCKP 4X0WU 1O31A 1T7CA 1S85A 2O8UA 2JETC 2WPKS 4H6TA 1V2KT 4FVDA 1TPAE 2WPIS 3A83A 4CREA 1E38B 4XBBA 3Q3XA 5H4IB 3UWIA 1T8OA 2ZGHA 1OKXA 3F9GA 3GY8A 3V3MA 1NT1A 5K7RA 3ZYEA 4DT7B 1GWAA 2P59A 4E06H 1HLTH 1B7XB 3GCTF 1ID5H 2F83A 2TGDA 3M5OA 3STJA 5HYOA 3MO9A 5C67A 1TOMH 7GCHF 2A7JA 2XYAA 3VB4A 5GWZA 2I6QA 2ULLA 3CS0A 2J95A 1C5VA 3ZZDA 4OS1A 1VZQH 4F49A 5TJXA 2BDAA 4GSOA 2ZDVH 1NY22 5EXNA 1G3CA 1TE0A 3GYLB 3EE0B 4Y6DA 3GY5A 2FP7B 2ASUB 2EC9H 4ZAEA 1GJDB 1SGQE 3PLPA 3T28A 2ALPA 2Z9GA 1O2QA 4IS5A 4AGJA 2CHAC 3W94A 5EPNA 1QR3E 5HGGA 3RU4D 2QYIA 5C2ZA 1C2KA 3P95A 1GI0A 2FTMA 2VWMA 3UR6A 2PKAB 1LPKB 1P2KA 1UTQA 5DKMA 2CHAB 1V2PT 1F5KU 2GMTB 2OUAA 1C1RA 1HAVB 4MDSA 1OPHB 1AVXA 2G52A 3BEUA 4HZHA 1O2PA 2FODA 2A31A 2ZKSA 4OGXA 4CRAA 4WMFA 3SGBE 1C1NA 1N1LA 1JWTA 2R2WU 1C2JA 1X7AC 1ZSLA 1O2XA 1JRSA 5AF9H 3M3VA 1PQAA 1IQMA 4HFPB 3V13A 1HIAB 1O2ZA 1ZSKA 2BTCE 3BTKE 2ZTYA 3NPSA 4CH2B 1TBRH 1P09A 2FMJA 4IW4E 5FCKA 1FY1A 1C4Y2 4Y76A 1U6QA 2NU2E 2A1DB 3A7XA 2CN0H 5DK1A 3TITA 3ZZ6A 3M3TA 4HI3A 1W8BH 2ZPSA 4BXWA 1HDTH 1YM0A 1ZLRA 1CA8B 2Y5HA 2FS8A 4OS2A 2PKSB 2ZQ2A 1ETTH 1GI3A 1OYTH 1SB1H 3SJ9A 1D6WA 1ZTJA 4SGBE 4H4FA 1D3PB 3ZV9A 4MLFB 3E91A 3UQOA 1O2GH 4DGJA 2TIOA 1GGDB 3ITIA 3S7KB 4DVAU 1WV7H 1SBWA 1OWKA 1T8LA 3EA8A 3T27A 1YPGH 5TCAA 3GCTG 1QQ4A 1C5WB 4Q7YA 2AH4X 2BD8A 2EA3A 1PQ8A 1UHBA 4MPUA 4NCYA 2V3OH 1C4U2 2XC5A 1TNLA 4IC5A 2ZTZA 3D49H 1FIZA 1YBWA 3GY3A 2BZAA 1DSTA 4ABBA 1P2OA 1DY9A 2GVFA 4TY7A 3QWCH 3GYMA 1GDQA 2P3UB 2QA9E 2J4IA 5EQRA 3HKJB 3A89A 1P3EA 4ABJA 1TFXA 4GPGA 3MNSA 2XBXA 1FONA 4PROA 1SQTA 3ZZ7A 4DCDA 2OC0A 3O8RA 1QCPA 2GCTB 1O3OA 1AZ8A 2KAIB 4WMEA 2A4GA 5EXLA 5F8TA 1AZZA 1BTUA 2GGVB 1C1PA 1O2NA 5DP6A 1SR5C 1UVPA 5FX5A 1UVSH 3AVZA 5EPYA 1EZXC 2C3SA 3SBKA 1HB0B 3SJIA 3EAJA 2HNTF 2AIPA 3GY2A 3ODFA 5C3NA 3DFLA 5JBTA 1O5CB 1S83A 2VWLA 1IAUA 3ATIA 4TPYA 2BD3A 5I25A 2C8YB 1QFKH 2GD4B 1O3KA 2AMQA 4I32A 1GJ5H 1TPSA 3ATWA 2SGAA 1MU6B 4F4OC 5EU8A 1A3BH 2FEQH 4TYDA 3RXAA 4KELA 2BVXH 2OCVB 4I8LA 3RXTA 4ABHA 1QJ1B 8ESTE 3TPIZ 1ELEE 3C1KA 5JB8S 1SSXA 2O8LA 5GCHF 2ZGCA 4B71A 4AFSA 1GHBG 1XKBC 2Y5GA 2R3UA 1AFQB 1HJ8A 1C9TA 4KKDA 3GY4A 1DWEH 2BB4A 2TRMA 4NSYA 2O9QA 1GBBA 1MD7A 1EB2A 2OQUA 1BMAA 3WY8A 2FX6A 1TQ0B 3KQEA 5L2ZH 3PMHB 2GX4A 1SGTA 1GBLA 3S9CA 5JB9S 4K8BA 1V2JT 3IITA 1EAXA 1EXFA 1BA8B 1W7XH 4FU8A 1BJUA 5F8ZA 1ZR0A 1PPFE 2Y6TA 3O8DA 1O5DH 3MU0A 2ZF0H 3JZ2B 3DUXH 1GVLA 2LNCA 4YLQH 2ZFTA 4SGAE 5A2MH 3TGKE 5E0GA 4E7RG 4LZ4B 1EP5A 1FV9A 5FPTA 3SGAE 5T6FA 2XCFA 2VIDA 1MMJN 3P8GA 5FXLA 1O37A 1QGFA 2W7UA 3M5NA 1FIWA 4ZKOU 3PTBA 4AX9H 1BT7A 1G3BA 2ANKH 1C4V2 1O32A 1P0SH 3MO3A 1NRPH 3VGCB 1V3XA 4WVPE 2FOHA 4D9RA 2B0FA 2P94A 1RS0A 2DE9A 2QXJA 1K2I1 1AKSB 1C1SA 3FZDA 2GKVE 1WBGB 1O3GA 5DPAA 3BTHE 1HJ9A 2A7HA 5DP3A 1AVWA 3KGPA 3S9AA 4ABDA 5JBBS 5L2YH 1A0JA 3P17H 3MU5A 1KIGH 1ZGIA 2A5AA 3TJVA 3ZZ9A 3JZ1B 3SUEA 4UONA 4AFQA 2P93A 4D7FA 2P16A 1TWXB 3QUMP 1QRXA 4IN1A 4E05H 3RXCA 1P12E 2PGQB 4JZEH 1BQYA 2CXVA 2IPHA 5T3HA 1UK4A 5E2OA 1O3DA 4ZKNU 3P92A 4MPVA 2QXIA 5E0JA 3U69H 1BZXE 4TPIZ 2HGTH 1O2IA 3F1SB 2ZU1A 3FFGA 1BHXF 1GHWH 4YESB 4K3JA 2Y82A 1DE7H 3QX5H 3LPRA 4LXBH 1S82A 4JZIA 2ILNA 1Q31A 3HK6B 2SGDE 1MQ5A 3HATH 1NU7B 1ANCA 4K60A 4BNRA 4BAHB 3MNXA 6CHAB 3ZZ3A 3D62A 5HXFA 4NIYA 2STAE 1SOZA 2ZCLP 1AVGH 1W13U 1C2HA 3R0FA 3LH1A 2YOLA 4LK4A 2G5VA 2F9VA 2BD5A 2ZFQH 3TVJB 1G9IE 2G8TA 1O3PB 1O3JA 4H42U 1DXPA 2HNTC 2GT8A 1P01A 2B9LA 3RXKA 3I78A 4BANB 1LKBA 1C2GA 2ZC9H 1WAYB 1TMUH 3BIUH 1BIOA 1CHGA 1HNEE 2W26A 1MKWH 2ZGBH 3Q77A 2ODYB 2D26C 3HKIB 2Y80A 5JBCS 2I6SA 3N7OA 3RP2A 2FI4E 1O3HA 1VITG 1KTTB 2B7DH 2VIVA 1IQKA 1ZGVA 3OU0A 3NXPA 3TNSA 3Q3KA 4ZUHA 3F9HA 4Y0ZE 1TRMA 3SU2A 3M7UA 4A1VA 4E7NA 1T31A 3LGVA 3S7HB 3F68H 4R0IA 1UCYK 2C8WB 4CRGA 2ZO3H 4AB8A 1PYTC 1LQEA 3RXBA 5SGAE 3GY6A 1UJ1A 5EQQA 2PUXB 1O2JA 5FPSA 3GDUA 1L0ZA 1NTPA 4ESTE 3IWMA 4X8VH 3SUFA 3T29A 1V2TT 4NSVA 1TRNA 4Y10E 1A61H 3RXDA 3ZYDA 3UOUA 2C4FH 3PB1E 5PTPA 1ZMLA 4NIVA 2Y81A 2ZDKA 1UHBB 2SGFE 4XDEA 7GCHG 4Y0YE 4DY7B 1D4PB 1LHFH 1C1TA 1SGYE 2FOGA 4JK6A 1O38A 5K0HA 1XUFA 1ELGA 1B5GH 3RXVA 1V2ST 2AGEX 3DD2H 5A0BA 3M3SA 2BOHB 1TGSZ 1NROH 3SHAH 1A46H 2ZDNA 1K1NA 3VB7A 1TB6H 1P8VC 3BSQA 1CE5A 3GY7A 1XUKA 1BBRE 1N6YA 1BBRH 2WYJA 2VVCA 3GISB 1A1RA 1BITA 1QB1A 1FAXA 1AE8H 4DIIH 3SO3A 3ESTA 2OLGA 1S81A 4X6OA 3GCNA 1DPOA 3BTDE 2OQ5A 3TK9A 1TA2A 2BY7X 2P8OB 1PQ7A 4Q2KA 1KXBA 1QURH 4KP0A 2AYWA 2ZHFH 4MNVA 5EOKA 2XC0A 2ZHDA 1LVBA 1F2SE 1OX1A 1O3MA 3ZZCA 1XUIA 2OTVA 2G55A 3SV7A 1ZMNA 2G81E 2BY6X 5EW2H 3RLYH 1RIWB 1C5XB 5TCCA 1IQHA 2TGAA 1GBIA 5LPRA 3DA9B 1O2TA 3P8NA 3PYHA 2ZFSA 1GVZA 2A4OA 4ZKSU 3O8CA 4NZQA 4Y7AA 2A0QB 4XSKU 1NN6A 3RC5A 1KSNA 2F91A 1GI1A 2FM2A 1BRUP 3NKKA 3QZRA 1O2WA 3MU8A 1YPJH 1CA0C 2ZPRA 3MH4A 1TQ7B 5B6OA 1Z6JH 1AMHA 1A2CH 3A8BA 4X1PU 5DG6A 3RXHA 1AFQC 1TGNA 1F0TA 2FYQA 2ZU4A 4CRDA 6GCHG 4JMYA 1GI8B 1SLVB 1IQGA 1J14A 2M5TA 1YPEH 2A45B 3K9XB 4NIXA 2KAIA 2GV7A 1WTHD 2HRVA 4NWKA 1PPGE 2BXTH 3QGJA 4VGCB 8KME2 4INKA 1A4WH 1DLEA 3KQBA 4FUBA 3ZVDA 4AFZA 3PMBB 1UK2A 1PPCE 1WSSH 3PV4A 2CJIA 4NA9H 1T4UH 2FOBA 4UE7H 3RMLH 1GCTB 4ISIH 1UTMA 1DITH 2QF3A 4AOQA 4ABAA 2SNVA 4X6PA 1DWBH 3NK8A 3PO1B 1YPHE 2WUCA 4NFFA 1AUTC 4ZHMU 5ESTE 1IQFA 4BTTB 2ZTXA 2GV6A 1VR1H 1GJ8B 5BPEA 4IGDA 3RLWH 1HBTH 4B76A 1EX3A 2B5TB 4WH6A 5FPYA 3MH6A 3A7ZA 1GPZA 2EI7A 1AHTH 1C1VH 1LHGH 1YKTA 3LT3A 2V3HH 2BDCA 2VB0A 3U1IB 5DP5A 2HWLB 4X8TH 1CHOF 1WYKA 2PTNA 2AFQB 3FZZA 4U01A 4JCNA 2VIOA 3E1XB 2H2ZA 4ZXYH 3UR9A 4ABGA 2QXHA 1H1BA 1W2KH 1TOCB 1C5ZB 1RFNA 2RG3A 4X1SU 1OWDA 1GI2A 1GCDA 3T26A 1GBTA 3QK1A 1FUJA 1F0SA 5A09A 8GCHF 2FIRH 1RTFB 1L1NA 4HTCH 4X2XA 3SU6A 1BMNH 4MQAA 1ZHPA 2W3KA 2NWNA 1SGFA 3BG8A 6ESTA 1XVOA 1AQ7A 2GDDA 3GCHC 2QV1A 4VGCC 1S6FA 1C1WH 5GPIB 1Y5AT 1K1MA 1LVMA 3KNXA 1GJ6A 1ABJH 1MZDA 1ZPCA 2OC7A 1G32B 5LH8A 3ZVGA 1ESAA 1TNIA 4ZHLU 2Z3EA 2ANYA 3SU1A 1IQIA 4GLYA 1FDPA 2ZHWH 4Z6AH 1NFUA 2A5IA 2FLRH 1O3IA 3BTFE 1O5GH 1RJXB 2G00A 3LIWA 4K69A 3AW0A 1MKXK 1GBEA 4I33A 3CP7A 4TY6A 5EG4A 2ZWLH 1T4VH 3BEIB 3A7VA 5J4QA 2H6MA 1WOFA 4FVBA 4O9VA 1ORFA 2WUBA 3GCOA 1BJVA 1C1OA 4XOJA 4B2AA 1BTWA 1GDNA 2VVVA 1A7SA 1XUHA 2QN5T 1ETSH 1SGEE 1G3DA 3M35A 1MZAA 4YT7H 1GBCA 3SJKA 3UWJH 4CRCA 2PTCE 4DG4A 5C20A 1H8IH 1HIAA 1LQDB 3W95A 1Q2WA 2F9BH 2ZNKH 2XNIA 3Q76A 3NZIA 1XUGA 2BYAX 4FXGH 1QBVH 2JH5D 1EZSC 1ANBA 1WQSA 2BY8X 5C1XA 4NFEA 5F03A 1XM1A 2VJ1A 1AKSA 2FYRA 3U98H 1TGTA 1A5IA 3BG4C 4B73A 4INLA 1TAWA 1HAIH 2A2XH 1DSUA 1NZQH 1O3EA 1UTPA 3B8JA 4IMZA 1GI4A 2G51A 1EPTC 3EGKH 5LPFA 3A87A 3PTNA 4GAWA 3QTOH 5JDUB 2XBWA 3RXEA 1C2IA 1GMCF 2BD4A 4AFUA 4FUCA 1S0RA 2VINA 1GBAA 3SUGA 3BEFB 1TGCA 5CMXH 3MWIU 3PWCA 1AWFH 2XC4A 3A82A 2HLCA 4D7GA 1OOKB 2ALVA 1GDUA 2G4UA 1GG6C 1YC0A 3EDXB 5G4BA 4UFDH 4I8HA 1C5PA 2UWLA 3D65E 1B0FA 1IHTH 4H6SB 1RD3B 4BAMB 4GUXA 4O97A 3VB3A 4JZFH 1OYQA 3MOCA 1FZZA 2R0KA 2TBSA 3HGNA 1BTPA 4UFEH 3UPEA 2P3TB 3A7YA 3LU9B 1DUEA 3BTEE 1VCQA 3M7QA 3U8OH 2GZ7A 3MI4A 2JH0D 2BD7A 2PSYA 2Z9KA 3GOVB 4UEHH 3V0XA 3LJOA 1EJAA 1NESE 5DGJA 1PJPA 2H9TH 3C27B 3PWBA 3TK6A 4A1XA 1E36B 2BD2A 2BDHA 3RXIA 5A0AE 1MD8A 1H9HE 1EZUC 4BTUB 3NCLA 1ELVA 4B74A 1D3DB 4J2YB 4WJG2 3F9EA 1XUJA 1PPBH 3UY9A 3SGQE 3BTME 1GHYH 1A3EH 2VWNA 1P06A 4LZ1H 5FCRA 4THNH 1MTVA 4A7IB 3GCHB 3PROA 4UDWH 1CBWC 3RXMA 2SFAA 4CHAC 1IQEA 4A6LA 2A32A 2Z9IA 2P8OC 3DHKH 1FY8E 4CR9A 4DIHH 4NIWA 1MKXH 1WU1A 4IBLH 1BMLA 2J92A 1OWEA 1QL9A 5CHAC 1V2NT 1C5RA 1A5HA 1O2HA 2BX4A 4X8SH 1YLDA 1JMOH 3M7TA 4BTIB 2R3YA 4MNYA 5DP9A 1C5UA 3ZVEA 2C93B 1IQLA 3RXUA 3SV8A 1ANEA 2Q1JA 3SQEE 1N8OB 2ZHQH 1MAXA 4UFFH 2C8ZB 3ATLA 3V7TA 2XBVA 1EAUA 3RXPA 3BTTE 3Q00A 1GMHG 1J16A 1ZRBA 2UUJB 3ENSB 2Z9JA 5DP8A 1TIOA 1XMNB 4YOJA 1ZHMA 1GI7B 2WYGA 4OS4A 5E2PA 4ZROA 1OS8A 2VIPA 2WINI 3EQ0H 1IOEA 9LPRA 2FESH 3I29A 1KXFA 1NFWA 4Z0KA 2RDLA 4BAQB 4AB9A 1ZPZA 2J38A 4BAOB 1ELFA 1FNIA 1F5RA 3CS7A 1YCPK 4DW2U 2PSXA 2Q6FA 4YOGA 3SJ8A 2UUKB 3MU4A 4K2YA 1LHDH 1O2LA 3K6YA 2SGPE 4JYUH 1FMGA 1C5OH 5DO4H 2BX3A 3LGTA 1PPEE 2G5NA 4X1QU 1K1PA 1D3TB 3B23B 1YGCH 3FAOA 3A7WA 4FUJA 4Y7BA 1Y3WA 1KLTA 4GVUA 2G4TA 3RC4A 5FX6A 9ESTA 1KDQA 2TGTA 1F0UA 1P10A 1BB0B 2QXGA 3SV6A 2AGGX 4JZ1A 1TGBA 1C5NH 5EW1H 3NWUA 1AD8H 1GBHA 4K1TA 2OC1A 3H5CB 2HPPH 1ZJKA 1GMDF 1YPHC 1C1UH 5AHGH 1GHAF 1GJBB 3EA9A 3FVFB 1JXPA 1MAYA
chains in the Genus database with same CATH superfamily
1QJ7B 3PLBA 1BHXB 2B8OH 4XRNA 1O2KA 3E16B 3AW1A 3TK5A 4Y79A 1EQ9A 1LMWB 1PQ5A 1VITF 2FDAA 2W7SA 3A85A 1SGNE 3ZVAA 1D9IA 1XX9A 2WPDD 1TX8A 3TJUA 1EOJA 3QLPH 1UTNA 3SZEA 4J1YA 3RXFA 1LKAA 3U8RH 1ANDA 2J5UA 3LC3A 3QZQA 5C94A 2JJ2D 1UK3A 2VIQA 2R0LA 2JIZD 3UOPA 1C5QA 1O30A 3SI3H 2XNDD 3ZZ4A 1DVAH 5E8EH 3RM2H 1TYNA 5IDKA 1HGTH 1VITH 3U1JB 1THRH 3ZZBA 3URCA 1ZHRA 2WPJS 4F48B 1KXCA 2H9EH 5EJLA 2K1QA 2V35A 2NU1E 1Z6EA 3FN8A 3A84A 5EJZA 2PHBA 2FS9A 1FY5A 1NC6A 2GT7A 2F9OA 4LOYH 2K8IA 4AGKA 1T8MA 1P11E 4FUHA 5EGMA 1TBQH 2KCOA 2XWBI 3MU1A 3RU4T 1GI6A 2ZGJA 1RXPA 3O8BA 3Q3YA 3LGWA 3ZZAA 1ABIH 4KGAA 4MG3A 1UTOA 2IJD1 1QY6A 3SV9A 1OP0A 4XBDA 3AASA 4AG1A 1JBUH 3VB6A 2FOEA 2OD3B 2ZG0H 2PKSC 1G30B 1EZQA 1KTSB 5DJ7A 2ZU2A 4A92A 1CA0B 3OY5U 1TX7A 1C9PA 2VVUA 1SKYE 2F9NA 1AWHB 3ZZ8A 1TA6A 3DT0H 1VCWA 4DJZB 1W0YH 3S9BA 1C2DA 3PLKA 2ZGXH 4KTCA 5CE1A 1VGCC 2Z9LA 1ESTA 3U8TH 1OP8A 4TWWA 3PRBA 1EFRD 3LGYA 3VGCC 1V6DA 7ESTE 2O8MA 1W11U 2ANWA 3HK3B 3N7EA 1YPMH 1MTNB 5GCHG 3MHWU 1EUFA 1YWUA 3HPTB 5DP7A 2UUFB 2QE7D 4U30A 1EPTB 1TPPA 1GJ9B 2BM2A 4YO9A 1EOLA 1WDIA 1DT2A 2PV9B 1Z7KA 3SUDA 1K1OA 4MPXA 3TH2H 3OTJE 1O2RA 4FUIA 1Y3YA 1FI8A 1SGDE 5IK2D 4RT1A 1SL3A 2NU0E 3SZNA 1MTSA 1HAGE 1V2WT 1SQOA 3PO1C 1CU1A 4ABEA 5DP4A 1ZMJA 3U9AH 1JOUB 3TNTA 2PR3A 1DS2E 1MQ6A 1HYLA 4WY3A 2R2MB 1O36A 4XFQA 1SGIB 1PPZA 1WCZA 3A7TA 2AEIH 4X8UH 3E0NB 1AI8H 3SHCH 1HAYB 3BIVH 1W0ZU 4M7GA 1EP6A 1UTJA 2PUQH 5C1UA 3E3TA 3MO6A 3QDZB 4X6NA 4O03A 5JPMH 1QRWA 2CF9H 4RKOB 2ZCHP 1BRBE 3TGJE 1HPGA 1BOQA 3BTGE 1SVPA 1UCYE 5HKKD 5LPEA 1BCUH 2QAAA 1SHYA 1NRRH 2C90B 3FP8E 3A81A 2OBOA 1AGJA 1GMCG 1V2LT 3H7OA 2W3IA 4FU7A 1Z8IB 1E37B 3KF2A 2PKAA 1QJ6B 4D8NA 1K1LA 2BOKA 3UQVA 1O3NA 3OY6U 4X1RU 5L6NH 1K22H 1Z8JB 3A8DA 1CT0E 4X2VA 2J2UA 1TNKA 1SGRE 4CR5A 1BTXA 1L4ZA 2BLQA 3RU4E 1CGIE 2HNTE 3AAUA 5F8XA 3MTYA 1SC8U 1CT2E 1FN6A 1ELDE 1QQUA 3HGPA 1GBKA 1GL0E 1KDQB 2WSSD 2EI6A 4K1SA 4WH8A 2BVRH 5EXMA 1QIXB 5HM9A 3LDXH 2BHGA 4CRBA 3VXEH 1GHBF 2D8WA 2FO9A 1HAXB 1BMFD 4MNWA 2XOKD 5FBEA 2UWPA 3RMNH 1HUTH 1A5GH 1K9OE 1ZPBA 2LP6A 1RRKA 3MQKC 4FETA 2F4LA 1TNHA 1ZSJA 1LPZB 1ZTLA 2ANMH 2RFKC 1NRSH 1NBME 1W7GH 1DUAA 4IN2A 1O34A 2AIQA 1O39A 4YTAA 1FLEE 2GJGA 2EEKA 3P6ZB 3URDA 1AB9C 1GMHF 4GHTA 4Y8ZA 1W0JD 3UNSA 5J4SA 2Q6DA 2RCEA 1XXFA 2OINA 1PYTD 4X2YA 4JYTA 1XVMA 3LJJA 4O3TA 1FJSA 4ISLA 1MBMA 1C1MA 2J9NA 1BUIA 1UTKA 3SNDA 3VB5A 1LVYA 3L33A 4RI0A 1AUJA 2IPQX 1YY3A 1N8OC 2V3MA 4TWYA 1Y5UT 1YP9A 2VU8E 1O2YA 3M5MA 2BQ7B 1HAVA 1QRZA 2W6ID 2ZIQH 3QTVH 5IYTA 1QA0A 4CBOA 1CGJE 1G2LA 2L74A 1COWD 3RDZA 4A5TS 2QGRA 2VGCC 1TBZH 3MNBA 1AIXH 3M36A 4KTSA 2FTLE 3IG6B 3SORA 3A80A 3SNEA 4A1TA 1C1QA 1S84A 2ZDLA 3F2FA 3E0PB 2STBE 4IMQA 5ETXA 4F55A 2OBQA 2XW9A 2FI5E 4CHAB 1HAOH 4MNXA 2PW8H 2PWXA 3FOAA 1VJ9U 1DDJA 1P2MA 1QTFA 1F0RA 3GDVA 4RSPA 2ZFFH 5C5OA 1P02A 2BMGB 1Y5BT 1DLKB 3ZVCA 3E90B 5T6GA 1YF4A 4UFGH 1SGPE 1CBWB 4WXIA 1LPGB 4FUEA 1W12U 1TMTH 5T6DA 1CHOG 2V6NA 4ASHA 5EQSA 2ZFRH 1MCVA 4Q4LA 4GCHF 3RUOA 1JIMA 3BTQE 4WMDA 4D76A 3VXFH 1CSOE 1HCGA 2SGQE 3RXSA 5BRRE 1OWIA 4FUDA 1UO6A 2D2DA 1Z8GA 1KYNA 5AVDA 2CGAA 2Y5FA 3LONA 3ZZ5A 2VH0A 5HIYA 1VCPA 2QIQA 1SHHB 2ODQA 3RXGA 1NU9A 3STIA 1DWDH 2FWWA 3LOXA 3SNBA 1OWHA 1ELCA 1C2LA 1TNGA 2FOAA 2UUYA 1BRCE 2J98B 5F6MA 2ZFPH 2AERH 2CMYA 1SQRA 3SU3A 1P03A 1HAPH 5FHTA 7KMEH 1C2EA 1UVUH 1O3CA 2TPIZ 4Q7XA 2ZHEH 3KIDU 3EA7A 1EKBB 3R3GB 3SNAA 2V0BA 3K2UA 1NRNH 2ZQ1A 1YCPH 1BTYA 1KLIH 4U2WA 1V2QT 2Y7ZA 4I8JA 2CV3A 3S0NA 3ZVBA 2HVYB 4NZLA 5L30H 1QA7A 3VEQB 4AYYB 1IQJA 1WUNH 3P8FA 3M5LA 4CBNA 1NRQH 3MH7A 3KQCA 2H5DA 4NG9H 4AYVB 5EJ1A 2WPHS 1CGHA 4I8KA 3TJNA 1GG6B 1SI5H 2FXRA 2ZA5A 1Z1JA 5A8ZA 3S69A 3MH5A 3SU0A 1UCYH 3KEEA 5CHAB 1CT4E 1F5LA 5HMAA 2YNBA 1RTLA 4NA7A 5FAHA 1KXEA 4INHA 1DANH 3SNCA 2GZ8A 4YM9A 1ARBA 2VWOA 1W14U 1BTZA 1LCYA 1Y3VA 4OS5A 1LO6A 1Z8RA 5GXPA 1D3QB 1INCA 2FI3E 1C5MD 5C5NA 2WHXA 4AC9A 1O2OA 1CQQA 2FOFA 1T32A 2P3FH 1GJ4H 4ISOA 3PM3A 4K1EA 1H9IE 2LPRA 4HG6A 1LDTT 2O8TA 1KXDA 1IQNA 1P9SA 4KTUA 2BLWA 2EI8A 2AMDA 2WPLS 1BMMH 3AAVA 5EIYA 1DX5M 1O5FH 1OWJA 3RXOA 2NU4E 4GHQA 2A5KA 1DWCH 1SLUB 6CHAC 3T2NA 5A8XA 1GI9B 3QGNB 2J94A 2XBYA 4FUFA 4BAKB 1MBQA 1YYY1 2HOBA 1S0QA 1UVOA 1YCPM 4UD9H 5GIBA 4B1TA 1MABB 4DURA 2SNWA 5I46H 1UTLM 4YT6H 2ZDAH 3RMOH 3VPKA 1SOTA 5HM2A 1MTUA 1NO9H 2AS9A 3E8LA 1P3CA 2IOTA 1G3EA 1L4DA 1C2FA 1GBDA 2H1UA 3SV2H 4OM9A 3MMGA 2SGEE 1TX6A 4WXVA 1K1IA 1P57B 2DE8A 1Y3UA 1S5SA 1TLDA 3UIRA 1O2SA 1HXFH 4OS6A 4B75A 3BTWE 3P8OA 4ABFA 3RXRA 3DFJA 1P2IA 3RXLA 1TABE 1TMBH 2XWAA 3QN7A 1DM4B 1MU8B 1WQVH 2HVXA 5KGOA 1AE5A 2OC8A 1GHAG 2XTTB 4JYVH 2ZI2H 4X2WA 2AMPA 1V2OT 1MTWA 1G2MA 3SN8A 2FZZA 3SU4A 2UWOA 1GBFA 1MUEB 2IN2A 4HGCA 3M61U 2ZP0H 3OSYA 4DOQA 2XCNA 5A0CA 2F3CE 1SFQB 3LKWA 1NPMA 2VNTA 4B2BA 4Q63A 1O35A 1C2MA 1OP2A 4JZDH 5EODA 2ZECA 1NFYA 2Y7XA 3MYWA 1DY8A 1OSSA 1E34B 5JYIA 3UFAA 2BVSH 3G01A 3QO6A 3CENA 1Q3XA 1F7ZA 4XBCA 2PLXA 3BG4B 1O5EH 2VGCB 4AG2A 3D23A 1P05A 1SGCA 1MH0A 1WTGH 1QB9A 2BQWB 1ACBE 4JK5A 1H8DH 2BLOA 3SW2B 2ZEBA 1KXAA 4AZ2B 1MKWK 1LVOA 3SI4H 1DFPA 1O3BA 1NS3A 2GCHF 1ETRH 2BDIA 2WV9A 4BOHA 3TU7H 2J34A 4FUGA 3UREA 1IHSH 3A86A 3RMMH 1HJAC 3KN2A 2BY5X 3ELAH 3T5FH 2OK5A 3TIUA 1GHVH 1EPTA 1BRAA 3H7TA 2BDGA 4I31A 4P02A 4Q7ZA 1K1JA 1Y59T 2QF0A 6GCHF 2QC2A 4O3UA 1O3LA 2BDYA 1FAKH 4Y8YA 3V12A 1EAIA 1P9UA 1FY4A 4RN6A 2FOCA 3K6ZA 4K5ZA 1GJCB 1N6XA 2OP9A 2WPMS 4YLUA 2ODPA 1HV7A 1G37A 3KCGH 2GP9B 1A0LA 2THFB 1LTOA 2W5EA 2A7CA 1HFDA 3UUZA 4FU9A 4YOIA 1EAWA 5GDSH 1O5BB 1THSH 1ZZZA 3TH3H 2AGIX 4R8TB 1YPLH 3P70B 2NU3E 1AB9B 1GGDC 3TJOA 2VIWA 1FN8A 2Z6BD 3L3TA 5B6LA 1OXGA 4Y8XA 1O5AB 3SQHE 4MVNA 1GMDG 3T25A 2JDID 3KL6A 4NGAH 1QB6A 1E0FD 2DUCA 1C5YB 2HALA 1DOJA 1ELAA 1EASA 1GJ7B 4I8GA 1SG8B 1YPKH 4QT8C 1MTNC 1Z71A 3BN9A 2P95A 5AFYH 3FP6E 3A8CA 4GCHG 4Y11E 4ACAA 2PGBB 3K65B 4CH8B 1QBNA 4WWYA 4AN7A 1QNJA 1ZJDA 3KHVA 4CRFA 1ARCA 1BBRK 1GVKB 1EJNA 3KQDA 2VH6A 1FQ3A 2BQ6B 1F92A 1Y3XA 3UTUH 1BDAA 3B9FH 1ESBA 1C5LH 8GCHG 1P2QA 4ZH8A 4BXSA 2HPQH 1ZRKA 3PMJA 1O3AA 2GTBA 1FPCH 1L1GA 1GHXH 1D6RA 1ELBA 3I77A 1RGQA 3MNCA 3SU5A 1C5TA 1C5SA 1ELTA 1TRYA 1EB1H 1GHZA 1FY3A 3TGIE 1S6HA 1H4WA 2WV5A 2AHME 5LGOA 1H9LB 1KY9A 1E79D 1V2MT 5AFZH 3NUMA 3TLOA 1CO7E 2FX4A 1HXEH 4NWLA 1XKAC 1PFXC 1J15A 4B6FA 5E0HA 2GZ9A 2JKHA 5C20A 2H5CA 1O2VA 1V2RT 1O33A 5ESBA 1NFXA 4YZUA 2FPZA 1LHEH 3ZV8A 1O3FA 1O2MA 1T8NA 2XRCA 4B2CA 3LGIA 3OX7U 3F6UH 5GJ4B 4ZMAH 1P2JA 1P04A 1E35B 1DICA 3ATKA 1M9UA 2RA3A 1GL1A 1FXYA 2BY9X 5KEDA 1SLWB 2QCYA 2Z3DA 2BD9A 3VFEA 1BTHH 1QZ8A 4U32A 4ZKRU 1AO5A 1QHRB 3ZVFA 1J9CH 1H8HD 2JH6D 3RXJA 2R9PA 4Q80A 3F2HA 1H8ED 4ISNA 2ZZUH 2Z7FE 3RM0H 1HAHH 4DT4A 8LPRA 1DXWA 1L1JA 1ZOMA 4IC6A 4Y71A 1ZTKA 4MTBA 5A8YA 1A0HB 1VGCB 4OS7A 1JRTA 4ZHAA 1SQAA 2OXSA 1GJAB 1UMAH 2BXUH 3NRLA 3A8AA 1GBMA 3LGUA 2Z3CA 1TPOA 3SJOA 2ZU5A 5JBAS 2GCTC 2F9PA 1TALA 2ESTE 4AORA 1QL8A 1Z1IA 2A4RA 4NA8A 1RTKA 1RIWC 1UVTH 3GICB 1PPHE 1SPJA 3BF6H 3E6PH 3EE7A 2D1JA 3GDSA 3L6PA 2H9HA 2IJOB 1J17T 3A88A 5ABWA 4ABIA 2JETB 1QL7A 1J8AA 2GMTC 1GCTC 5FBIA 1TONA 3TH4H 3BV9B 3LC5A 1SGFG 2A4QA 4MPWA 4XE4A 4X6MA 1HRTH 2O8WA 1O2UA 1V2VT 4RKJB 3OEHD 1THPB 2RDEA 3FP7E 3SOSA 3FANA 1FPHH 1G36A 2ZPQA 2BLVA 3EYDA 4ASUD 1NM6A 1P2NA 1VJAU 3T62A 2GDEH 4D9QA 1EJMA 4K8YA 1L2EA 2C8XB 3UNQA 1CVWH 1XXDA 2QY0B 3PMAB 3ATMA 2A2QH 4ISHH 2Z94A 2WV4A 1TNJA 2ZU3A 1W10U 2TGPZ 2Q6GA 1Y8TA 1AN1E 3UNRA 1YLCA 1QBOA 1K21H 1EATA 1GI5A 3ODDA 4P00A 3M37A 1K28D 3F9FA 1GBJA 7LPRA 1AFEH 4ZXXH 2XXLA 4X1NU 2PFEA 4WF8A 2GCHG 1ZYOA 1SLXB 6LPRA 3OYPA 4I7YH 3RXQA 1SFIA 3LH3A 1O0DH 2ZDMA 2RA0A 2YNAA 1HAZB 1V2UT 2BZ6H 1JIRA 4OGYA 1MCTA 2FOMB 4B6EA 1SMFE 2FLBH 1LHCH 5C1YA 2KCAA 3MFJA 1AY6H 1KLJH 3RC6A 5DN6D 2F9UA 1B0EA 2BDBA 2CF8H 1AU8A 1HJAB 1W3CA 2ZCKP 4X0WU 1O31A 1T7CA 1S85A 2O8UA 2JETC 2WPKS 4H6TA 1V2KT 4FVDA 1TPAE 2WPIS 3A83A 3KYFA 4CREA 1E38B 4XBBA 3Q3XA 5H4IB 3UWIA 1T8OA 2ZGHA 1OKXA 3F9GA 3KYGA 3GY8A 3V3MA 1NT1A 5K7RA 3ZYEA 5CDFE 4DT7B 1GWAA 2P59A 4E06H 1HLTH 1B7XB 3GCTF 1ID5H 2F83A 2TGDA 3M5OA 3STJA 5HYOA 3MO9A 5C67A 1TOMH 7GCHF 2A7JA 2XYAA 3VB4A 5GWZA 2I6QA 2ULLA 3CS0A 2J95A 1C5VA 3ZZDA 4OS1A 1VZQH 4F49A 5TJXA 2BDAA 4GSOA 2ZDVH 1NY22 5EXNA 1G3CA 1TE0A 3GYLB 3EE0B 4Y6DA 3GY5A 2FP7B 2ASUB 2EC9H 4ZAEA 1GJDB 1SGQE 3PLPA 3T28A 2ALPA 2Z9GA 1O2QA 4IS5A 4AGJA 2CHAC 3W94A 5EPNA 1QR3E 5HGGA 3RU4D 2QYIA 5C2ZA 1C2KA 3P95A 1GI0A 2FTMA 2VWMA 3UR6A 2PKAB 1LPKB 1P2KA 1UTQA 5DKMA 2CHAB 1V2PT 1F5KU 2GMTB 2OUAA 1C1RA 1HAVB 4MDSA 1OPHB 1AVXA 2G52A 3BEUA 4HZHA 1O2PA 2FODA 2A31A 2ZKSA 4OGXA 4CRAA 2L6OA 4RT0A 4WMFA 3SGBE 1C1NA 1N1LA 1JWTA 2KCYA 2R2WU 1C2JA 1X7AC 1ZSLA 1O2XA 1JRSA 5AF9H 3M3VA 1PQAA 1IQMA 4HFPB 3V13A 1HIAB 1E1RD 1O2ZA 1ZSKA 2BTCE 3BTKE 2ZTYA 3NPSA 4CH2B 1TBRH 1P09A 2FMJA 4IW4E 5FCKA 1FY1A 1C4Y2 4Y76A 1U6QA 2NU2E 2A1DB 3A7XA 2CN0H 5DK1A 3TITA 3ZZ6A 3M3TA 4HI3A 1W8BH 2ZPSA 4BXWA 1HDTH 1YM0A 1ZLRA 1CA8B 2Y5HA 3DSPA 2FS8A 4OS2A 2PKSB 2ZQ2A 1ETTH 1GI3A 1OYTH 1SB1H 3SJ9A 5DSFA 1D6WA 1ZTJA 4SGBE 4H4FA 1D3PB 3ZV9A 4MLFB 3E91A 3UQOA 1O2GH 4DGJA 2QF5A 1GGDB 2TIOA 3ITIA 3S7KB 4DVAU 1WV7H 1SBWA 4I86A 1OWKA 1T8LA 3EA8A 3T27A 1YPGH 5TCAA 3GCTG 1QQ4A 1C5WB 4Q7YA 2AH4X 2BD8A 2EA3A 1PQ8A 1UHBA 4MPUA 4NCYA 2V3OH 4TSFD 3SYJA 1C4U2 2XC5A 5KECA 1TNLA 4IC5A 2ZTZA 3D49H 1FIZA 1YBWA 3GY3A 2BZAA 1DSTA 4ABBA 1P2OA 1DY9A 2GVFA 4TY7A 3QWCH 3GYMA 3OAAD 1GDQA 2P3UB 2QA9E 2J4IA 5EQRA 3HKJB 3A89A 1P3EA 4ABJA 1TFXA 3OFND 4GPGA 1YLNA 3MNSA 2XBXA 1FONA 4PROA 1SQTA 3ZZ7A 4DCDA 2OC0A 3O8RA 1QCPA 2GCTB 1O3OA 1AZ8A 2KAIB 4WMEA 2A4GA 5EXLA 5F8TA 1AZZA 1BTUA 2GGVB 4TT3D 1C1PA 1O2NA 5DP6A 1SR5C 1UVPA 5FX5A 3OEED 1UVSH 3AVZA 5EPYA 1EZXC 3VG8A 2C3SA 3SBKA 1HB0B 3SJIA 3EAJA 2HNTF 2AIPA 3GY2A 3ODFA 4ZCNA 5C3NA 3DFLA 5JBTA 2J98A 1O5CB 1S83A 2VWLA 1IAUA 3ATIA 4TPYA 2BD3A 5I25A 2C8YB 1QFKH 2GD4B 1O3KA 2AMQA 4I32A 1GJ5H 1TPSA 3ATWA 2SGAA 1MU6B 4F4OC 5EU8A 1A3BH 2FEQH 4TYDA 3RXAA 1FX0B 4KELA 2BVXH 2OCVB 4I8LA 3RXTA 4ABHA 1QJ1B 8ESTE 3TPIZ 1ELEE 3C1KA 5JB8S 1SSXA 2O8LA 5GCHF 2ZGCA 4B71A 4AFSA 1GHBG 2QF4A 1XKBC 2Y5GA 2R3UA 1AFQB 1HJ8A 1UW7A 1C9TA 4KKDA 3GY4A 1DWEH 2BB4A 2TRMA 4NSYA 2O9QA 1GBBA 1MD7A 1EB2A 2OQUA 1BMAA 3WY8A 2FX6A 1TQ0B 3KQEA 5L2ZH 3PMHB 2GX4A 1SGTA 1GBLA 3S9CA 5JB9S 4K8BA 1V2JT 3IITA 1EAXA 1EXFA 4ACBA 3WWFA 1BA8B 1W7XH 4FU8A 1BJUA 5F8ZA 1ZR0A 1PPFE 2Y6TA 3O8DA 1O5DH 3MU0A 2ZF0H 3JZ2B 3DUXH 1GVLA 2LNCA 4YLQH 2ZFTA 4SGAE 5A2MH 3TGKE 5E0GA 3CNRA 4E7RG 4LZ4B 1EP5A 1FV9A 5FPTA 3SGAE 5T6FA 2XCFA 2VIDA 1MMJN 3P8GA 5FXLA 1O37A 1QGFA 3W1EA 2W7UA 3M5NA 1FIWA 4ZKOU 3PTBA 4AX9H 1BT7A 1G3BA 2ANKH 1C4V2 1O32A 1P0SH 3MO3A 1NRPH 3VGCB 1V3XA 3OE7D 4WVPE 2FOHA 4D9RA 2B0FA 2P94A 1RS0A 1E1QD 2DE9A 2QXJA 1K2I1 1AKSB 1C1SA 3FZDA 2GKVE 1WBGB 1O3GA 5DPAA 3BTHE 1HJ9A 2A7HA 5DP3A 1AVWA 3KGPA 3S9AA 5HIZA 4ABDA 3F3BA 5JBBS 5L2YH 1A0JA 3P17H 2J97A 3MU5A 1KIGH 1ZGIA 2A5AA 3TJVA 3ZZ9A 3JZ1B 3SUEA 4UONA 4AFQA 2P93A 4D7FA 2P16A 1TWXB 3QUMP 1QRXA 4IN1A 4E05H 3RXCA 2KX4A 1P12E 2K0QA 2PGQB 4JZEH 1BQYA 2CXVA 2KCPA 2IPHA 3DSGA 5T3HA 1UK4A 5E2OA 1O3DA 4ZKNU 3P92A 3F0OA 4MPVA 2QXIA 5E0JA 2YMSC 3U69H 1BZXE 2F43B 2HGTH 1O2IA 3F1SB 2ZU1A 3FFGA 4TPIZ 1BHXF 1GHWH 4YESB 4K3JA 2Y82A 1DE7H 3QX5H 3LPRA 4LXBH 1S82A 4JZIA 2ILNA 1Q31A 3HK6B 2SGDE 1MQ5A 3HATH 1NU7B 1ANCA 4K60A 2V7QD 4BNRA 4BAHB 3MNXA 6CHAB 3ZZ3A 3D62A 5HXFA 4NIYA 2STAE 1SOZA 3DSOA 2ZCLP 1AVGH 3FO8D 1W13U 1C2HA 3R0FA 3LH1A 2YOLA 4LK4A 2G5VA 2F9VA 2BD5A 2ZFQH 3TVJB 1G9IE 2G8TA 1O3PB 1O3JA 4H42U 1DXPA 2HNTC 5F53A 2GT8A 1P01A 2B9LA 1NBMD 5GNDA 3I78A 3RXKA 4BANB 1LKBA 1C2GA 2ZC9H 1WAYB 1TMUH 3BIUH 1BIOA 1CHGA 1HNEE 2W26A 1MKWH 2ZGBH 3Q77A 2ODYB 2D26C 3HKIB 2Y80A 5JBCS 2I6SA 3N7OA 3RP2A 2FI4E 1O3HA 1VITG 1KTTB 2B7DH 2VIVA 1IQKA 1ZGVA 3OU0A 3NXPA 3TNSA 3Q3KA 4ZUHA 3F9HA 4Y0ZE 1TRMA 3SU2A 3M7UA 4A1VA 4E7NA 1T31A 3LGVA 3S7HB 3F68H 4R0IA 1UCYK 2C8WB 4CRGA 2ZO3H 4AB8A 1PYTC 1LQEA 2EY4C 3RXBA 3GY6A 1UJ1A 5EQQA 5SGAE 2PUXB 1O2JA 1K0HA 5FPSA 3GDUA 1L0ZA 1NTPA 4ESTE 3IWMA 4X8VH 3SUFA 3T29A 1V2TT 4NSVA 1TRNA 4Y10E 1A61H 3RXDA 2W6JD 3ZYDA 3UOUA 2C4FH 3PB1E 2KM0A 5PTPA 1ZMLA 4NIVA 2Y81A 2ZDKA 1UHBB 2SGFE 4XDEA 7GCHG 4Y0YE 4DY7B 1D4PB 1LHFH 1C1TA 1SGYE 2FOGA 4JK6A 1O38A 5K0HA 1XUFA 1ELGA 1B5GH 3RXVA 1V2ST 2AGEX 3DD2H 5A0BA 3M3SA 2BOHB 1TGSZ 1NROH 3SHAH 1A46H 2ZDNA 1K1NA 3VB7A 1TB6H 1P8VC 3BSQA 1CE5A 3GY7A 1XUKA 2JJ1D 1BBRE 1N6YA 1BBRH 2WYJA 2VVCA 3GISB 1A1RA 1BITA 1QB1A 1FAXA 1AE8H 4DIIH 3SO3A 3ESTA 2OLGA 1S81A 4X6OA 3GCNA 1DPOA 3BTDE 2OQ5A 3TK9A 1TA2A 2BY7X 2P8OB 1PQ7A 4Q2KA 1KXBA 1QURH 4KP0A 2AYWA 2ZHFH 4MNVA 5EOKA 3AK5A 2XC0A 2ZHDA 1LVBA 1F2SE 1OX1A 1O3MA 3ZZCA 3DCLA 1XUIA 2OTVA 2G55A 3N99A 3SV7A 1ZMNA 2G81E 2BY6X 5EW2H 3RLYH 1RIWB 1C5XB 5TCCA 1IQHA 2TGAA 1GBIA 5LPRA 3DA9B 1O2TA 3P8NA 3PYHA 3UAIC 2ZFSA 1GVZA 2A4OA 4ZKSU 3O8CA 4NZQA 4Y7AA 2A0QB 4XSKU 1NN6A 3RC5A 1KSNA 2F91A 3PRDA 1GI1A 2FM2A 1BRUP 3NKKA 3QZRA 1O2WA 3MU8A 1YPJH 1CA0C 2ZPRA 3MH4A 1TQ7B 5B6OA 1Z6JH 1AMHA 1A2CH 3A8BA 4X1PU 5DG6A 3RXHA 1AFQC 1TGNA 1F0TA 2FYQA 2ZU4A 4CRDA 6GCHG 4JMYA 1GI8B 1SLVB 1IQGA 1J14A 2M5TA 1YPEH 2A45B 3K9XB 4NIXA 3GS9A 2KAIA 2GV7A 1WTHD 2HRVA 4NWKA 2LELA 2VBCA 3OTPA 1PPGE 2BXTH 3QGJA 4VGCB 8KME2 4INKA 4XD7D 1A4WH 1DLEA 3KQBA 4FUBA 3ZVDA 4AFZA 3WW7A 3PMBB 1UK2A 1PPCE 1WSSH 3PV4A 2CJIA 4NA9H 2KZ4A 1T4UH 2FOBA 4UE7H 5C0UA 3RMLH 1GCTB 4ISIH 1UTMA 1DITH 2QF3A 4AOQA 4ABAA 2SNVA 4X6PA 1DWBH 3NK8A 3PO1B 1YPHE 1W0KD 2WUCA 4NFFA 1AUTC 2EQNA 4ZHMU 5ESTE 1IQFA 4BTTB 2ZTXA 2GV6A 1VR1H 1GJ8B 5BPEA 4IGDA 3RLWH 1HBTH 4B76A 1EX3A 2B5TB 4WH6A 5FPYA 5FL7D 3MH6A 3A7ZA 2YMSB 1GPZA 2EI7A 1AHTH 2KFWA 1C1VH 1LHGH 1YKTA 3LT3A 2V3HH 2BDCA 2VB0A 3U1IB 5DP5A 2HWLB 4X8TH 2PTNA 1CHOF 1WYKA 2AFQB 3FZZA 4U01A 4JCNA 2VIOA 3E1XB 2H2ZA 4ZXYH 3UR9A 4ABGA 2QXHA 5T1VA 1H1BA 1W2KH 1TOCB 1C5ZB 1RFNA 2RG3A 4X1SU 1OWDA 1GI2A 1GCDA 3T26A 1GBTA 3QK1A 1FUJA 1F0SA 5A09A 8GCHF 2FIRH 1RTFB 1L1NA 4HTCH 4X2XA 3SU6A 1BMNH 2WZQA 4MQAA 1ZHPA 2W3KA 2NWNA 1SGFA 3BG8A 6ESTA 1XVOA 1AQ7A 2GDDA 3GCHC 2YMSD 2QV1A 2PP6A 4VGCC 1S6FA 1C1WH 5GPIB 1Y5AT 1K1MA 1LVMA 3KNXA 1GJ6A 1ABJH 1MZDA 1ZPCA 2OC7A 1G32B 5LH8A 3ZVGA 1ESAA 1TNIA 4ZHLU 2Z3EA 2ANYA 3SU1A 1IQIA 4GLYA 1FDPA 2ZHWH 4Z6AH 1NFUA 2A5IA 2FLRH 1O3IA 3BTFE 1O5GH 1RJXB 2G00A 3LIWA 4K69A 3AW0A 1MKXK 1GBEA 3UB0A 4I33A 3CP7A 4TY6A 5EG4A 2ZWLH 1T4VH 3BEIB 3A7VA 5J4QA 2H6MA 3N7DA 1WOFA 3F0PA 4FVBA 4O9VA 1ORFA 2WUBA 3GCOA 1BJVA 1C1OA 4XOJA 4B2AA 3F2GA 1BTWA 1GDNA 1OHHD 2VVVA 1A7SA 1XUHA 2QN5T 3FKSD 1ETSH 1SGEE 3PV2A 1G3DA 3M35A 1KMHB 1MZAA 1GBCA 3SJKA 3UWJH 4CRCA 2PTCE 4DG4A 4YT7H 1H8IH 1HIAA 1LQDB 3W95A 1Q2WA 2F9BH 2ZNKH 2XNIA 3Q76A 3NZIA 3PV5A 1XUGA 2BYAX 4FXGH 1QBVH 2JH5D 1EZSC 1ANBA 1WQSA 2BY8X 5C1XA 4NFEA 5F03A 1XM1A 2VJ1A 1AKSA 2FYRA 3U98H 1TGTA 1A5IA 3BG4C 4B73A 4INLA 1TAWA 1HAIH 2A2XH 1DSUA 1NZQH 1WXRA 1O3EA 1UTPA 3B8JA 4IMZA 1GI4A 2G51A 1EPTC 3EGKH 5LPFA 3A87A 3PTNA 5C0TA 4GAWA 3QTOH 5JDUB 2XBWA 3RXEA 1C2IA 1GMCF 2BD4A 4AFUA 4FUCA 1S0RA 2VINA 1GBAA 3SUGA 3BEFB 1TGCA 5CMXH 3MWIU 3PWCA 1AWFH 2XC4A 3A82A 2HLCA 4D7GA 1OOKB 2ALVA 1GDUA 2G4UA 1GG6C 3KQ5A 1YC0A 3EDXB 5G4BA 4UFDH 4I8HA 1C5PA 2UWLA 3D65E 1B0FA 1IHTH 4H6SB 1RD3B 4BAMB 2CK3D 4GUXA 4O97A 3VB3A 4JZFH 3WWBA 1OYQA 3MOCA 1FZZA 2R0KA 2TBSA 3HGNA 1BTPA 4UFEH 3UPEA 2P3TB 3A7YA 3LU9B 1DUEA 3BTEE 1VCQA 3M7QA 3U8OH 2GZ7A 3MI4A 2JH0D 2BD7A 2PSYA 2Z9KA 3GOVB 4UEHH 3V0XA 3LJOA 1EJAA 1NESE 5DGJA 1PJPA 2H9TH 3C27B 3PWBA 3TK6A 4A1XA 1E36B 2BD2A 2BDHA 3RXIA 5A0AE 1MD8A 1H9HE 1EZUC 4BTUB 3NCLA 1ELVA 4B74A 1D3DB 4J2YB 4WJG2 3F9EA 1XUJA 1PPBH 3UY9A 3SGQE 3BTME 1GHYH 1A3EH 2VWNA 1P06A 4LZ1H 5FCRA 4THNH 1MTVA 4A7IB 3GCHB 3PROA 4UDWH 1CBWC 3RXMA 2SFAA 4CHAC 1IQEA 5C17A 5CHBA 4A6LA 2A32A 2Z9IA 2P8OC 3DHKH 1FY8E 4CR9A 4DIHH 4NIWA 1MKXH 1WU1A 4IBLH 1BMLA 2J92A 1OWEA 1QL9A 5CHAC 1V2NT 1C5RA 1A5HA 1O2HA 2BX4A 4X8SH 1YLDA 1JMOH 3M7TA 4BTIB 2R3YA 4MNYA 5DP9A 1C5UA 3ZVEA 2C93B 2HLDD 1IQLA 3RXUA 4Z1MD 3SV8A 1ANEA 2Q1JA 3SQEE 1N8OB 2ZHQH 1MAXA 4UFFH 2C8ZB 3ATLA 3V7TA 2XBVA 1EAUA 3RXPA 3BTTE 3Q00A 1GMHG 1J16A 1ZRBA 2UUJB 3ENSB 2Z9JA 5DP8A 1TIOA 1XMNB 4YOJA 1ZHMA 1GI7B 2WYGA 4OS4A 5E2PA 4ZROA 1OS8A 1VKYA 2VIPA 2WINI 3EQ0H 1IOEA 9LPRA 2FESH 4M9FA 3I29A 1KXFA 1NFWA 4Z0KA 2RDLA 4BAQB 4AB9A 1ZPZA 2J38A 4BAOB 1ELFA 1FNIA 1F5RA 3CS7A 1YCPK 4DW2U 2PSXA 3H09A 2Q6FA 4YOGA 3SJ8A 2UUKB 3MU4A 4K2YA 1LHDH 1O2LA 2M2AA 3K6YA 2SGPE 4JYUH 1FMGA 1C5OH 5DO4H 2BX3A 3LGTA 1PPEE 2G5NA 4X1QU 3U28C 1K1PA 1D3TB 3B23B 1YGCH 3FAOA 3A7WA 4FUJA 4Y7BA 1Y3WA 1KLTA 4GVUA 2G4TA 3RC4A 5FX6A 9ESTA 1KDQA 2TGTA 1F0UA 1P10A 1BB0B 2QXGA 4FOUC 3SV6A 2KR7A 2AGGX 4JZ1A 1TGBA 1C5NH 5EW1H 3ZIAD 3NWUA 1AD8H 1GBHA 4K1TA 2OC1A 1S6LA 3H5CB 4YXWD 2HPPH 1ZJKA 1GMDF 1YPHC 1C1UH 5AHGH 1GHAF 1GJBB 3EA9A 3FVFB 1JXPA 1MAYA
chains in the Genus database with same CATH topology
1QJ7B 3PLBA 1BHXB 2B8OH 1O2KA 3E16B 3AW1A 3TK5A 4Y79A 1EQ9A 1LMWB 1PQ5A 1VITF 2FDAA 2W7SA 3A85A 1SGNE 3ZVAA 1D9IA 1XX9A 1TX8A 3TJUA 1EOJA 3QLPH 1UTNA 4J1YA 3RXFA 1LKAA 3U8RH 1ANDA 3LC3A 3QZQA 1UK3A 2VIQA 2R0LA 3UOPA 1C5QA 1O30A 3SI3H 3ZZ4A 1DVAH 5E8EH 3RM2H 1TYNA 5IDKA 1HGTH 1VITH 3U1JB 1THRH 3ZZBA 3URCA 1ZHRA 2WPJS 1KXCA 2H9EH 2K1QA 2V35A 2NU1E 1Z6EA 3A84A 2PHBA 2FS9A 1FY5A 1NC6A 2GT7A 2F9OA 4LOYH 4AGKA 1T8MA 1P11E 4FUHA 5EGMA 1TBQH 2XWBI 3MU1A 3RU4T 1GI6A 2ZGJA 1RXPA 3O8BA 3Q3YA 3LGWA 3ZZAA 1ABIH 4KGAA 4MG3A 1UTOA 1QY6A 3SV9A 1OP0A 4XBDA 3AASA 4AG1A 1JBUH 3VB6A 2FOEA 2OD3B 2ZG0H 2PKSC 1G30B 1EZQA 1KTSB 5DJ7A 2ZU2A 4A92A 1CA0B 3OY5U 1TX7A 1C9PA 2VVUA 2F9NA 1AWHB 3ZZ8A 1TA6A 3DT0H 1VCWA 4DJZB 1W0YH 3S9BA 1C2DA 3PLKA 2ZGXH 4KTCA 5CE1A 1VGCC 2Z9LA 1ESTA 3U8TH 1OP8A 4TWWA 3LGYA 3VGCC 1V6DA 7ESTE 2O8MA 1W11U 2ANWA 3HK3B 1YPMH 1MTNB 5GCHG 3MHWU 1EUFA 3HPTB 5DP7A 2UUFB 4U30A 1EPTB 1TPPA 1GJ9B 2BM2A 4YO9A 1EOLA 1DT2A 2PV9B 1Z7KA 3SUDA 1K1OA 4MPXA 3TH2H 3OTJE 1O2RA 4FUIA 1Y3YA 1FI8A 1SGDE 1SL3A 2NU0E 3SZNA 1MTSA 1HAGE 1V2WT 1SQOA 3PO1C 1CU1A 4ABEA 5DP4A 1ZMJA 3U9AH 1JOUB 3TNTA 2PR3A 1DS2E 1MQ6A 1HYLA 4WY3A 2R2MB 1O36A 4XFQA 1SGIB 1PPZA 1WCZA 3A7TA 2AEIH 4X8UH 3E0NB 1AI8H 3SHCH 1HAYB 3BIVH 1W0ZU 4M7GA 1EP6A 1UTJA 2PUQH 5C1UA 3E3TA 3MO6A 3QDZB 4X6NA 4O03A 5JPMH 1QRWA 2CF9H 4RKOB 2ZCHP 1BRBE 3TGJE 1HPGA 1BOQA 3BTGE 1SVPA 1UCYE 5LPEA 1BCUH 2QAAA 1SHYA 1NRRH 2C90B 3FP8E 3A81A 2OBOA 1AGJA 1GMCG 1V2LT 3H7OA 2W3IA 4FU7A 1Z8IB 1E37B 3KF2A 2PKAA 1QJ6B 4D8NA 1K1LA 2BOKA 3UQVA 1O3NA 3OY6U 4X1RU 5L6NH 1K22H 1Z8JB 3A8DA 1CT0E 4X2VA 2J2UA 1TNKA 1SGRE 4CR5A 1BTXA 1L4ZA 2BLQA 3RU4E 1CGIE 2HNTE 3AAUA 5F8XA 3MTYA 1SC8U 1CT2E 1FN6A 1ELDE 1QQUA 3HGPA 1GBKA 1GL0E 1KDQB 2EI6A 4K1SA 4WH8A 2BVRH 5EXMA 1QIXB 5HM9A 3LDXH 2BHGA 4CRBA 3VXEH 1GHBF 2D8WA 2FO9A 1HAXB 4MNWA 3RMNH 5FBEA 2UWPA 1HUTH 1A5GH 1K9OE 1ZPBA 1RRKA 1TNHA 1ZSJA 1LPZB 1ZTLA 2ANMH 1NRSH 1W7GH 1DUAA 4IN2A 1O34A 2AIQA 1O39A 4YTAA 1FLEE 2EEKA 3P6ZB 3URDA 1AB9C 1GMHF 4GHTA 4Y8ZA 3UNSA 5J4SA 2Q6DA 2RCEA 1XXFA 2OINA 1PYTD 4X2YA 4JYTA 1XVMA 3LJJA 4O3TA 1FJSA 4ISLA 1MBMA 1C1MA 2J9NA 1BUIA 1UTKA 3SNDA 3VB5A 1LVYA 3L33A 1AUJA 1N8OC 4TWYA 1Y5UT 1YP9A 2VU8E 1O2YA 3M5MA 2BQ7B 1HAVA 1QRZA 2ZIQH 3QTVH 5IYTA 1QA0A 4CBOA 1CGJE 1G2LA 3RDZA 4A5TS 2QGRA 2VGCC 1TBZH 3MNBA 1AIXH 3M36A 4KTSA 2FTLE 3IG6B 3SORA 3A80A 3SNEA 4A1TA 1C1QA 1S84A 2ZDLA 4IMQA 3E0PB 2STBE 5ETXA 2OBQA 2XW9A 2FI5E 4CHAB 1HAOH 4MNXA 2PW8H 2PWXA 1VJ9U 1DDJA 1P2MA 1QTFA 1F0RA 3GDVA 4RSPA 2ZFFH 5C5OA 1P02A 2BMGB 1Y5BT 1DLKB 3ZVCA 3E90B 5T6GA 1YF4A 4UFGH 1SGPE 1CBWB 4WXIA 1LPGB 4FUEA 1W12U 1TMTH 5T6DA 1CHOG 2V6NA 4ASHA 5EQSA 2ZFRH 1MCVA 4GCHF 3RUOA 1JIMA 3BTQE 4WMDA 4D76A 3VXFH 1CSOE 1HCGA 2SGQE 3RXSA 5BRRE 1OWIA 4FUDA 1UO6A 2D2DA 1Z8GA 1KYNA 5AVDA 2CGAA 2Y5FA 3LONA 3ZZ5A 2VH0A 1VCPA 2QIQA 1SHHB 2ODQA 3RXGA 1NU9A 3STIA 1DWDH 2FWWA 3LOXA 3SNBA 1OWHA 1ELCA 1C2LA 1TNGA 2FOAA 2UUYA 1BRCE 5F6MA 2ZFPH 2AERH 2CMYA 3SU3A 1P03A 1HAPH 5FHTA 7KMEH 1C2EA 1UVUH 1O3CA 2TPIZ 4Q7XA 2ZHEH 3KIDU 3EA7A 1EKBB 3R3GB 3SNAA 2V0BA 3K2UA 1NRNH 2ZQ1A 1YCPH 1BTYA 1KLIH 4U2WA 1V2QT 2Y7ZA 4I8JA 2CV3A 3S0NA 3ZVBA 4NZLA 5L30H 1QA7A 3VEQB 4AYYB 1IQJA 1WUNH 3P8FA 3M5LA 4CBNA 1NRQH 3MH7A 3KQCA 2H5DA 4NG9H 4AYVB 2WPHS 1CGHA 4I8KA 3TJNA 1GG6B 1SI5H 2FXRA 2ZA5A 1Z1JA 5A8ZA 3S69A 3MH5A 3SU0A 1UCYH 3KEEA 5CHAB 1CT4E 1F5LA 5HMAA 2YNBA 1RTLA 4NA7A 5FAHA 1KXEA 4INHA 1DANH 3SNCA 2GZ8A 4YM9A 2VWOA 1ARBA 1W14U 1BTZA 1LCYA 1Y3VA 4OS5A 1LO6A 1Z8RA 5GXPA 1D3QB 1INCA 2FI3E 1C5MD 5C5NA 1O2OA 1CQQA 2FOFA 1T32A 2P3FH 1GJ4H 4ISOA 3PM3A 4K1EA 1H9IE 2LPRA 1LDTT 2O8TA 1KXDA 1IQNA 1P9SA 4KTUA 2BLWA 2EI8A 2AMDA 2WPLS 1BMMH 3AAVA 1DX5M 1O5FH 1OWJA 3RXOA 2NU4E 4GHQA 2A5KA 1DWCH 1SLUB 6CHAC 3T2NA 5A8XA 1GI9B 3QGNB 2J94A 2XBYA 4FUFA 4BAKB 1MBQA 1YYY1 2HOBA 1S0QA 1UVOA 1YCPM 4UD9H 5GIBA 4B1TA 4DURA 2SNWA 5I46H 1UTLM 4YT6H 2ZDAH 3RMOH 3VPKA 1SOTA 5HM2A 1MTUA 1NO9H 2AS9A 3E8LA 1P3CA 2IOTA 1G3EA 1L4DA 1C2FA 1GBDA 2H1UA 3SV2H 3MMGA 2SGEE 1TX6A 4WXVA 1K1IA 1P57B 2DE8A 1Y3UA 1S5SA 1TLDA 3UIRA 1O2SA 1HXFH 4OS6A 4B75A 3BTWE 3P8OA 4ABFA 3RXRA 3DFJA 1P2IA 3RXLA 1TABE 1TMBH 2XWAA 3QN7A 1DM4B 1MU8B 1WQVH 2HVXA 1AE5A 2OC8A 1GHAG 2XTTB 4JYVH 2ZI2H 4X2WA 2AMPA 1V2OT 1MTWA 1G2MA 3SN8A 2FZZA 3SU4A 2UWOA 1GBFA 1MUEB 2IN2A 4HGCA 3M61U 2ZP0H 3OSYA 4DOQA 2XCNA 5A0CA 2F3CE 1SFQB 3LKWA 1NPMA 2VNTA 4B2BA 1O35A 1C2MA 1OP2A 4JZDH 5EODA 2ZECA 1NFYA 2Y7XA 3MYWA 1DY8A 1OSSA 1E34B 5JYIA 3UFAA 2BVSH 3G01A 3QO6A 3CENA 1Q3XA 1F7ZA 4XBCA 2PLXA 3BG4B 1O5EH 2VGCB 4AG2A 3D23A 1P05A 1SGCA 1MH0A 1WTGH 1QB9A 2BQWB 1ACBE 4JK5A 1H8DH 2BLOA 3SW2B 2ZEBA 1KXAA 4AZ2B 1MKWK 1LVOA 3SI4H 1DFPA 1O3BA 1NS3A 2GCHF 1ETRH 2BDIA 4BOHA 3TU7H 2J34A 4FUGA 3UREA 1IHSH 3A86A 3RMMH 1HJAC 3KN2A 2BY5X 3ELAH 3T5FH 3TIUA 1GHVH 1EPTA 1BRAA 3H7TA 2BDGA 4I31A 4Q7ZA 1K1JA 1Y59T 2QF0A 6GCHF 2QC2A 4O3UA 1O3LA 2BDYA 1FAKH 4Y8YA 3V12A 1EAIA 1P9UA 1FY4A 4RN6A 2FOCA 3K6ZA 4K5ZA 1GJCB 1N6XA 2OP9A 2WPMS 4YLUA 2ODPA 1HV7A 1G37A 3KCGH 2GP9B 1A0LA 2THFB 1LTOA 2W5EA 2A7CA 1HFDA 3UUZA 4FU9A 4YOIA 1EAWA 5GDSH 1O5BB 1THSH 1ZZZA 3TH3H 2AGIX 4R8TB 1YPLH 3P70B 2NU3E 1AB9B 1GGDC 3TJOA 2VIWA 1FN8A 2Z6BD 3L3TA 1OXGA 4Y8XA 1O5AB 3SQHE 4MVNA 1GMDG 3T25A 3KL6A 4NGAH 1QB6A 1E0FD 2DUCA 1C5YB 2HALA 1DOJA 1ELAA 1EASA 1GJ7B 4I8GA 1SG8B 1YPKH 4QT8C 1MTNC 1Z71A 3BN9A 2P95A 5AFYH 3FP6E 3A8CA 4GCHG 4Y11E 2PGBB 3K65B 4CH8B 1QBNA 4WWYA 4AN7A 1QNJA 1ZJDA 3KHVA 4CRFA 1ARCA 1BBRK 1GVKB 1EJNA 3KQDA 2VH6A 1FQ3A 2BQ6B 1F92A 1Y3XA 3UTUH 1BDAA 3B9FH 1ESBA 1C5LH 8GCHG 1P2QA 4ZH8A 4BXSA 2HPQH 1ZRKA 3PMJA 1O3AA 2GTBA 1FPCH 1L1GA 1GHXH 1D6RA 1ELBA 3I77A 1RGQA 3MNCA 3SU5A 1C5TA 1C5SA 1ELTA 1TRYA 1EB1H 1GHZA 1FY3A 3TGIE 1S6HA 1H4WA 2WV5A 5LGOA 1H9LB 1KY9A 1V2MT 5AFZH 3NUMA 3TLOA 1CO7E 2FX4A 1HXEH 4NWLA 1XKAC 1PFXC 1J15A 5E0HA 2GZ9A 2JKHA 2H5CA 1O2VA 1V2RT 1O33A 5ESBA 1NFXA 4YZUA 2FPZA 1LHEH 3ZV8A 1O3FA 1O2MA 1T8NA 2XRCA 4B2CA 3LGIA 3OX7U 3F6UH 5GJ4B 4ZMAH 1P2JA 1P04A 1E35B 1DICA 3ATKA 1M9UA 2RA3A 1GL1A 1FXYA 2BY9X 1SLWB 2QCYA 2Z3DA 2BD9A 3VFEA 1BTHH 4U32A 4ZKRU 1AO5A 1QHRB 3ZVFA 1J9CH 2JH6D 3RXJA 2R9PA 4Q80A 4ISNA 2ZZUH 2Z7FE 3RM0H 1HAHH 8LPRA 1DXWA 1L1JA 1ZOMA 4IC6A 4Y71A 1ZTKA 4MTBA 5A8YA 1A0HB 1VGCB 4OS7A 1JRTA 4ZHAA 1SQAA 2OXSA 1GJAB 1UMAH 2BXUH 3A8AA 1GBMA 3LGUA 2Z3CA 1TPOA 3SJOA 2ZU5A 5JBAS 2GCTC 2F9PA 1TALA 2ESTE 4AORA 1QL8A 1Z1IA 2A4RA 4NA8A 1RTKA 1RIWC 1UVTH 3GICB 1PPHE 1SPJA 3BF6H 3E6PH 2D1JA 3GDSA 3L6PA 2H9HA 2IJOB 1J17T 3A88A 5ABWA 4ABIA 2JETB 1QL7A 1J8AA 2GMTC 1GCTC 5FBIA 1TONA 3TH4H 3BV9B 3LC5A 1SGFG 2A4QA 4MPWA 4XE4A 4X6MA 1HRTH 2O8WA 1O2UA 1V2VT 4RKJB 1THPB 3FP7E 3SOSA 3FANA 1FPHH 1G36A 2ZPQA 2BLVA 3EYDA 1NM6A 1P2NA 1VJAU 3T62A 2GDEH 4D9QA 1EJMA 4K8YA 1L2EA 2C8XB 3UNQA 1CVWH 1XXDA 2QY0B 3PMAB 3ATMA 2A2QH 4ISHH 2Z94A 2WV4A 1TNJA 2ZU3A 1W10U 2TGPZ 2Q6GA 1Y8TA 1AN1E 3UNRA 1YLCA 1QBOA 1K21H 1EATA 1GI5A 3ODDA 3M37A 1K28D 3F9FA 1GBJA 7LPRA 1AFEH 4ZXXH 2XXLA 4X1NU 2PFEA 4WF8A 2GCHG 1ZYOA 1SLXB 6LPRA 3OYPA 4I7YH 3RXQA 1SFIA 3LH3A 1O0DH 2ZDMA 2RA0A 2YNAA 1HAZB 1V2UT 2BZ6H 1JIRA 4OGYA 1MCTA 2FOMB 1SMFE 2FLBH 1LHCH 5C1YA 3MFJA 1AY6H 1KLJH 3RC6A 2F9UA 1B0EA 2BDBA 2CF8H 1AU8A 1HJAB 1W3CA 2ZCKP 4X0WU 1O31A 1T7CA 1S85A 2O8UA 2JETC 2WPKS 4H6TA 1V2KT 4FVDA 1TPAE 2WPIS 3A83A 4CREA 1E38B 4XBBA 3Q3XA 5H4IB 3UWIA 1T8OA 2ZGHA 1OKXA 3F9GA 3GY8A 3V3MA 1NT1A 5K7RA 3ZYEA 4DT7B 1GWAA 2P59A 4E06H 1HLTH 1B7XB 3GCTF 1ID5H 2F83A 2TGDA 3M5OA 3STJA 5HYOA 3MO9A 5C67A 1TOMH 7GCHF 2A7JA 2XYAA 3VB4A 5GWZA 2I6QA 2ULLA 3CS0A 2J95A 1C5VA 3ZZDA 4OS1A 1VZQH 4F49A 5TJXA 2BDAA 4GSOA 2ZDVH 1NY22 5EXNA 1G3CA 1TE0A 3GYLB 3EE0B 4Y6DA 3GY5A 2FP7B 2ASUB 2EC9H 4ZAEA 1GJDB 1SGQE 3PLPA 3T28A 2ALPA 2Z9GA 1O2QA 4IS5A 4AGJA 2CHAC 3W94A 5EPNA 1QR3E 5HGGA 3RU4D 2QYIA 5C2ZA 1C2KA 3P95A 1GI0A 2FTMA 2VWMA 3UR6A 2PKAB 1LPKB 1P2KA 1UTQA 5DKMA 2CHAB 1V2PT 1F5KU 2GMTB 2OUAA 1C1RA 1HAVB 4MDSA 1OPHB 1AVXA 2G52A