1QRZA

Catalytic domain of plasminogen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYMVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVLRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the proenzyme domain of plasminogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PLASMINOGEN
total genus 51
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA01
2LNCA 1TB6H 1ELFA 3A87A 1G30B 1MTNB 1ELVA 1HJAC 2FI3E 5GCHG 5E8EH 4AFSA 3KQBA 2G5NA 3SV6A 1DS2E 5A09A 3SW2B 2A2XH 2SGAA 1P57B 3P70B 2ZHEH 4MTBA 1NO9H 2R3YA 2VWNA 2VVUA 1GBHA 1VGCC 2ALVA 4XE4A 1GJ8B 2A32A 3UUZA 2TIOA 2ZU5A 1GI4A 5DP5A 3S7HB 1NFXA 4D76A 1P02A 3QN7A 3SU0A 1F0TA 1THRH 5T6FA 1DE7H 1GCTB 3L33A 4Y8XA 1QFKH 2G51A 1VCWA 1QBOA 4GLYA 2VWLA 2OXSA 3QTVH 3SNAA 3BEFB 2BDGA 1WU1A 2HLCA 1AWFH 3H7TA 1THPB 3KEEA 3NK8A 4H6SB 2YNBA 3CS0A 2ZHWH 3RXVA 5DP3A 1C5RA 2GCHF 1NFWA 3MNXA 4YTAA 4NG9H 1GBMA 1SMFE 3GYLB 1SQAA 2VIWA 1FMGA 3DD2H 1P2NA 2QF0A 1QL7A 1TFXA 2BY8X 1BMAA 2ZDMA 1CT2E 3TK6A 2CJIA 1HAVA 1GBTA 1SFQB 1VCPA 1GI0A 3GY7A 3OSYA 1AI8H 1NY22 2A5IA 1T31A 3LC3A 3ZV9A 4INHA 1PPCE 1FNIA 1PQ7A 1GHVH 2JH6D 1DLEA 3I77A 1ELAA 2PHBA 3FP6E 2BXTH 2H9HA 2STBE 1SC8U 4TWYA 1O3GA 2WPMS 2HNTC 3DT0H 2AGEX 5B6OA 4CR5A 1BITA 3RU4D 1P2KA 5GJ4B 1GJ6A 4H42U 4LZ4B 2STAE 3SU5A 1UCYH 1D3DB 1HJAB 5AFZH 3ATIA 1EOLA 1QGFA 3RXIA 1EJNA 1AUJA 1ABJH 1S81A 3GDVA 2OC8A 3LIWA 1HGTH 2BD2A 2Y80A 4AGJA 1QY6A 1YF4A 2VWMA 1ANDA 1K21H 1TGBA 4X6PA 3GCTG 3H5CB 3H7OA 1JIMA 1AGJA 2Y6TA 1F5LA 3UIRA 1UVPA 2WYJA 4XDEA 2XWAA 2PWXA 4RN6A 1P9UA 1EX3A 1O2LA 2V0BA 1TYNA 2ZFTA 4MPVA 2FS9A 5CHAB 2V6NA 2PV9B 1ABIH 1O2QA 4CH8B 1ELTA 1GWAA 2RG3A 3A86A 3K2UA 2BLWA 1UHBB 1O3DA 2HOBA 2BVXH 2QN5T 2TGDA 1MCTA 1O35A 1O2KA 1TMBH 2VIPA 4MPWA 4CREA 1GCTC 1NM6A 2VNTA 1MZAA 4CBOA 1ANCA 4ZKRU 3TPIZ 3EE0B 2BD5A 2IN2A 2WUCA 1J8AA 3BTGE 4IW4E 1SOZA 1A5IA 3KQCA 1L4ZA 1Z6EA 3ATLA 4LK4A 4TY7A 1BQYA 4IGDA 1NROH 2ZGXH 1TAWA 1P11E 3O8DA 4ZHAA 1VITH 1W14U 4OS5A 4BAMB 1K1PA 3SU3A 3SN8A 3FP7E 3L6PA 3G01A 1V2UT 1LVMA 3RU4T 4CHAC 4KTUA 1HAVB 1C1TA 3AW0A 3MNSA 3OY6U 2J92A 1AHTH 4X8UH 3PB1E 3T29A 4OS4A 2QC2A 1EAIA 4FXGH 4HZHA 1IQJA 1Z8JB 2D1JA 5EQRA 1DPOA 5L2YH 1TMTH 3ELAH 1SGYE 2ZC9H 1FXYA 8LPRA 4B71A 4ASHA 1TONA 2FLRH 1TA2A 2UWPA 3BTQE 1TQ7B 3E3TA 1IAUA 3LGTA 2W5EA 1GBCA 3QTOH 2NU2E 4I33A 1O0DH 3F9FA 4FUIA 2VU8E 4AB8A 2FI5E 1LO6A 2WPKS 1QA7A 1AQ7A 1EOJA 1G3CA 1P10A 2ZNKH 4Y8ZA 1O2UA 4NWLA 1GG6C 1EP6A 1XUGA 2ZTZA 4YM9A 4HFPB 3M5MA 2ZFPH 1GJ7B 1C1QA 3PLKA 4A92A 3TH4H 1PQ5A 2AMDA 3TITA 5FCRA 2SGDE 3P95A 3SV7A 3GCOA 4AYVB 1P8VC 1QNJA 3Q00A 4TYDA 3QLPH 1EAXA 2ZGBH 3QZRA 1GMCF 3TK9A 2GCTB 1GHBG 1QJ6B 5HXFA 1B0EA 1CVWH 4FUJA 3SJKA 1EB2A 4YO9A 2XC4A 2SGPE 4UFEH 1IQNA 8ESTE 3MI4A 1GDNA 2IOTA 5IDKA 4JYTA 2PW8H 4Q7YA 1GBDA 1EPTA 2A7CA 1C2JA 1GMDG 1QURH 1HAYB 3BEUA 1FAXA 2ZGCA 4UDWH 3UPEA 2GMTC 1IQIA 1LPKB 2QAAA 1FI8A 1A5GH 1TGCA 5JBAS 1A0LA 1HIAB 1W10U 2FOMB 3T26A 4GHQA 1FQ3A 3DFLA 4NIVA 1UMAH 1TALA 4BTUB 1N8OC 4ZXXH 1EJAA 1YCPK 1FY3A 3QX5H 5FX5A 1F0SA 2V3OH 1SOTA 2OCVB 3QWCH 1MZDA 1XUFA 2B7DH 1A61H 3R0FA 4KELA 3RC4A 2KAIB 3NZIA 3SGQE 1SGFA 1HAIH 1S85A 1XKBC 1LPZB 3F1SB 5JBTA 3SQEE 1GGDB 2PSYA 2EI7A 1WV7H 3SV9A 1LHEH 4WMFA 1TMUH 3A7XA 1BCUH 1W13U 1WQVH 2BD7A 4OGXA 2K1QA 1J15A 5DG6A 1C9TA 1BBRK 4UONA 2W7UA 1ANEA 3LONA 2O8MA 2QF3A 5K7RA 4Z0KA 1UJ1A 6LPRA 1K22H 5A0AE 1PJPA 5LPRA 1W8BH 4Q7ZA 1LPGB 2UUKB 5EOKA 4NA8A 1MD8A 1VZQH 2AFQB 4OS6A 4AFQA 1C5PA 4XFQA 1C5VA 2XBXA 3BTWE 4O3UA 1VGCB 3RMNH 4OS1A 1DWEH 2ZTYA 3PV4A 4K8YA 4J2YB 1ETTH 1MAXA 1E38B 1TLDA 4Y10E 3TNSA 1LHDH 1P12E 2P94A 1QBNA 4AFUA 5EPYA 4X2WA 1V2TT 2RDLA 2BDYA 2GP9B 4A5TS 3QK1A 1S6HA 3C1KA 1MKXK 2BX3A 1SGEE 1D3TB 1C5XB 3HKJB 3RXSA 4YZUA 2B9LA 8GCHF 4ABEA 3TJOA 3MU1A 1GBFA 3BIUH 2GV7A 4GPGA 2XBYA 3LGWA 2XYAA 2AIQA 4K1SA 1EZXC 3VGCC 1IQFA 3UFAA 1TNHA 1U6QA 1ZTLA 1C2LA 1H9HE 1RIWB 1VITG 1G2LA 1NRNH 1QA0A 2G55A 2CXVA 3NKKA 2PKSB 1TNJA 3A8BA 1O2ZA 1BRUP 3A7ZA 1UK3A 4TPIZ 1EKBB 2BQ6B 4DT7B 5AF9H 3M3SA 3SQHE 3Q77A 4VGCC 5E0GA 2VIDA 3LJOA 3SJ9A 1F2SE 4KTSA 1ZHRA 3K6YA 4BOHA 4Y0YE 3ZVBA 2BHGA 3K6ZA 1A4WH 5A8ZA 1ZSKA 3M7UA 5JYIA 1FY8E 3VB4A 1S5SA 1XKAC 4Y11E 4NZQA 5DJ7A 2RCEA 2O9QA 1O5GH 1ZPCA 1SGRE 1LCYA 4GCHF 5T3HA 1B0FA 1G37A 1H9LB 2O8TA 1QL9A 3SUEA 1A3BH 5I25A 2FMJA 1SQTA 1BOQA 3A88A 3BTKE 1CE5A 1ZPBA 3T25A 3M5NA 1EATA 3TH2H 3ZVDA 1FN6A 1EZUC 3AVZA 4I8KA 1CBWB 1FN8A 1Y3UA 1C2KA 4JZ1A 1GJAB 2JH5D 1DWBH 4ABAA 4WWYA 3A7VA 4WXVA 1KLTA 1YM0A 1BBRH 1HXEH 2ZGHA 2BLQA 1LDTT 6CHAC 1HAHH 1A2CH 1Y8TA 2JH0D 1DXPA 4NIWA 1UCYE 3RDZA 2A0QB 1M9UA 2BDCA 1T8OA 2B5TB 4QT8C 1MU8B 1GDQA 3MO6A 2ANKH 2FX4A 2W7SA 3M36A 3SGAE 1TNLA 1O5DH 3RXUA 4U32A 5SGAE 5DP4A 3PO1C 1GHYH 1HLTH 1LVOA 3F68H 3K9XB 4E05H 2F91A 1K9OE 4F4OC 2AEIH 1ZTJA 1BBRE 2A5AA 1Y5UT 4INLA 3LT3A 1MH0A 2QYIA 1YPMH 1KXEA 1K1MA 3SV8A 4LZ1H 3E0NB 1B5GH 2GV6A 1LVYA 1ESTA 3PTBA 2FOAA 3GY6A 4JZIA 1IQKA 2HPQH 3SI3H 4MPXA 2OBOA 1DUEA 3UOPA 2Q6FA 2ZCLP 4ABBA 2A4QA 2ZIQH 3ZVFA 2VH0A 5DP6A 1YLCA 1BJVA 1O3CA 2PLXA 2GVFA 3D65E 5JBCS 2ZHQH 2JETB 2AH4X 1GCDA 2V3HH 4Y7AA 1RGQA 3IWMA 1BA8B 5GDSH 2GZ8A 2IJOB 2VIQA 1YPJH 3RXEA 5FBIA 1O2WA 2J38A 2Q6GA 4X1PU 2HRVA 2PUQH 3MH5A 4FUDA 3I78A 2C8ZB 2VJ1A 4YESB 1TRNA 2A31A 1O2RA 1K1NA 5ESBA 3HKIB 3GISB 4D9QA 4VGCB 3GICB 1O2TA 1GL0E 1ZOMA 3RXQA 4LOYH 3EGKH 1SI5H 2ZU4A 3Q3YA 2BYAX 4NGAH 4BNRA 5A2MH 1BDAA 1BRAA 1C4Y2 3B8JA 4PROA 2GZ7A 2C8WB 3RMOH 4FU7A 3MU5A 1MKWH 4U01A 1AB9B 2ZWLH 3O8CA 3LJJA 1O2IA 3RXAA 3VGCB 2D2DA 2ZQ1A 1O2PA 1SR5C 2H6MA 2BD8A 3SZNA 4CH2B 2R0LA 2H9TH 4FUCA 1AZZA 1GVLA 2ZCHP 4NWKA 2A7JA 4KTCA 1ELBA 1G32B 4FVDA 1TX6A 3V3MA 1V2NT 2HVXA 3BG4C 2DE9A 1SSXA 4Y71A 3T5FH 3F6UH 1S6FA 1Z8GA 2FOHA 1IHTH 1MKWK 5FPTA 5LPEA 3N7OA 1O36A 2C8XB 3ZZ8A 1NT1A 3Q3KA 2VGCB 2BZ6H 6GCHG 1KSNA 1NS3A 4FUBA 1W0YH 1T8LA 2GGVB 2Q6DA 4ZROA 1MTVA 2BB4A 1YPHC 1SGTA 2THFB 1D3QB 1D6WA 1PQ8A 1E0FD 2XXLA 2Y81A 3E0PB 1GHXH 2PGQB 1A1RA 3EQ0H 1L4DA 3V0XA 1CHOF 1WTHD 2GZ9A 2NU0E 1H9IE 3UREA 1PQAA 4XBDA 3PWCA 2ZDLA 1NFYA 4K2YA 4DW2U 2I6QA 5J4QA 1ELCA 1GGDC 4NZLA 3DHKH 4Q7XA 1ZYOA 3QO6A 4K1TA 1OP8A 3D23A 2FO9A 4WF8A 1NFUA 1XMNB 3A83A 3S9AA 3U9AH 1E36B 2UUFB 1O5BB 1AN1E 3E6PH 3T2NA 4I8HA 4E06H 1IQLA 2BVRH 2ESTE 1A7SA 3A80A 5TCCA 1YPHE 1PFXC 1FY1A 1HAGE 1RTFB 5FXLA 4RKOB 1Y59T 1EUFA 4WXIA 1C5YB 1YLDA 1G36A 1TA6A 3RXTA 5LH8A 1C2GA 1SVPA 4NA9H 3TGIE 1MAYA 2FOBA 1C2IA 1D4PB 1WAYB 4JZFH 3QZQA 3RUOA 4MPUA 5A0CA 4DVAU 1V3XA 5JBBS 1BTHH 4O03A 2WPHS 2NWNA 2ZFRH 1TPAE 1OWHA 1F5KU 3ZZAA 1PPFE 3LH1A 3MNCA 3TU7H 2FYQA 2P3UB 4UE7H 1BJUA 1C5WB 3ENSB 3OU0A 2A1DB 1UTJA 1ZGIA 1ZMJA 1OOKB 1PPEE 2V35A 2OQ5A 2BD9A 5AFYH 3UR9A 1KXDA 3BTME 5C5NA 1AMHA 4IS5A 4ZKNU 3TJNA 3KF2A 4ISIH 2OQUA 1GPZA 2RA3A 4J1YA 3BTTE 3O8RA 3SU1A 1W2KH 1WYKA 2CHAB 1O3BA 3T28A 4FU8A 1GI1A 2TGTA 5T6DA 5FBEA 4GVUA 4SGAE 2G4TA 3GY2A 3URCA 4JYVH 3M3TA 2WINI 1T4UH 3ZVEA 4K60A 3U8OH 2R2MB 3T62A 4WJG2 3BSQA 2QXJA 5GXPA 1AZ8A 1VJ9U 4AN7A 3QUMP 1GHBF 5EW2H 1C1WH 1V2ST 3MU0A 5JDUB 1Z7KA 8KME2 3MTYA 4CRFA 3LGVA 4NA7A 3PO1B 3SJ8A 2XCFA 1Z1JA 4MNYA 4YLUA 1BRCE 3DA9B 4BTIB 4TPYA 2YNAA 4WH6A 4ISOA 1LQEA 1PYTC 1BT7A 3TNTA 1AFQB 1C5QA 1V2PT 1GJ5H 2XC0A 3SV2H 3L3TA 1YPGH 1LHGH 2BDHA 2A2QH 3OY5U 1AIXH 1WQSA 1TWXB 1OS8A 1K1IA 4CBNA 1SB1H 3T27A 1JMOH 4XBCA 1O5AB 2TGPZ 1C9PA 1CA0B 1O2GH 3E1XB 4IN2A 2C93B 3VXEH 1HAPH 3MWIU 4YLQH 1T7CA 2Y5GA 2Z3CA 3A7YA 3RXOA 1AE8H 2WPIS 1Z1IA 2VVCA 1NC6A 1RFNA 4U2WA 4Y6DA 4XBBA 2OINA 4ZHMU 2ZFSA 5FPYA 1CT0E 2F9NA 1ZJKA 3ZVAA 1TX7A 2P93A 5CMXH 4DG4A 1OXGA 3PMJA 3SGBE 2EI6A 2VINA 5FPSA 1OP2A 3MO3A 3URDA 3F9HA 2FM2A 4Q80A 3M35A 2ANWA 2FESH 2R3UA 3RXDA 1MU6B 4MVNA 5IYTA 1GG6B 3MHWU 4I8GA 4ABDA 1O34A 1CO7E 1SGCA 2ALPA 1OWIA 2J95A 3ZYEA 1UTNA 1GJDB 3A84A 4RSPA 1GHAF 1K28D 1GBAA 3PM3A 4OS7A 4CRDA 2GDEH 2FS8A 4ZHLU 1O3FA 1Q2WA 1CT4E 1MUEB 2PKSC 1NRRH 1YYY1 5CHAC 3UWIA 2F9BH 2G8TA 1X7AC 4ZMAH 5K0HA 1RIWC 4WVPE 2SNVA 1DY8A 3M61U 2QXGA 2FX6A 1TGNA 3GDUA 3SHAH 1GI9B 1KXCA 3GOVB 2ZDKA 1H8DH 1C5NH 7KMEH 1C1RA 1OKXA 3SHCH 1XXFA 3GYMA 2SGQE 1EZQA 1O3AA 3SUFA 3E8LA 3ATWA 2O8LA 1LTOA 1DT2A 3STJA 3RC6A 5T6GA 3LGUA 5A0BA 5LPFA 4X2VA 2P8OC 4CR9A 1HPGA 4AG1A 5LGOA 4CHAB 2FI4E 1C2FA 3FZDA 2G4UA 3RXRA 3P6ZB 7GCHG 1H1BA 1OYTH 2ZDNA 1GBBA 4IC5A 2A5KA 4IBLH 5F03A 1SHYA 1CSOE 2ZEBA 4WMDA 5DKMA 3M5LA 1QB1A 1KY9A 4JK6A 4NFEA 3SU4A 1RXPA 3GY8A 4B2BA 3BG8A 3R3GB 3UWJH 1TOCB 3SJOA 4DURA 2HNTE 2ZI2H 4ISNA 3OYPA 2XCNA 5C1YA 4ZKSU 1IHSH 1ZHPA 1O3HA 3EA8A 3B9FH 2BY6X 1Y5BT 1TBQH 1W12U 3SO3A 1Y5AT 2R0KA 1QB6A 3LPRA 1Y3YA 4UFFH 1V2WT 1GBLA 2FOCA 1Y3XA 3MNBA 4Y79A 1PPGE 3TJUA 1SLVB 1YCPH 4K5ZA 2FP7B 1A5HA 1XUHA 1V2QT 3A82A 1PYTD 4ABJA 5FHTA 1MTWA 1EQ9A 1ID5H 2BOHB 1SGQE 4UD9H 4AORA 3EAJA 2KAIA 1OWJA 2VIVA 2ZPQA 1CA8B 5E2OA 2FWWA 1QRXA 1SGNE 1H8IH 1SFIA 1EZSC 2H9EH 1O5CB 1O3EA 1LQDB 3PLPA 3TGKE 2FODA 1ZGVA 1KXFA 3EA7A 3SORA 1O2HA 1GMCG 1GI6A 4K8BA 1V2MT 4CRAA 3A81A 3RXGA 1GJBB 3TIUA 1AO5A 2FIRH 2AMPA 2ZP0H 3AAVA 3I29A 3RXBA 1HAOH 4U30A 1OSSA 2BVSH 3GCHC 4CRCA 2UUYA 3GCHB 4AGKA 3A89A 1NRPH 3NCLA 5DO4H 3SNBA 2CN0H 1GMHF 1MTNC 5TCAA 1AU8A 1C5MD 2G81E 1WBGB 3HGPA 5L30H 1TQ0B 2PR3A 4IC6A 1P3EA 1F0UA 2BDAA 1ARBA 1J17T 2AYWA 1JXPA 3Q76A 4BAOB 2AIPA 1GMHG 5EODA 1VJAU 5HM9A 4X1SU 2BOKA 2BDIA 4DY7B 5F8XA 3BEIB 2OUAA 5HGGA 3ZZ5A 3ZZ6A 1OYQA 2PUXB 5DP7A 3SBKA 3RM0H 3P8GA 3ZZ4A 3KGPA 2C90B 2WUBA 2XNIA 3WY8A 4X1NU 4MG3A 3RXCA 1MTUA 4O9VA 2ZDVH 3VB3A 1MKXH 1KLIH 1T32A 4GHTA 1GI2A 1P2QA 2OLGA 2ZPRA 1C1PA 7GCHF 1N6XA 2PKAB 2EEKA 1HXFH 2HALA 5HYOA 2FXRA 5C5OA 2Z9JA 2VWOA 3CP7A 1L1JA 3RXJA 4MNXA 3VB5A 4WH8A 5C3NA 1UHBA 1AVWA 3TH3H 3UR6A 1SL3A 2BQWB 4UFDH 1OX1A 1BMNH 5TJXA 3P8OA 1SLXB 8GCHG 1G2MA 1S83A 1O3LA 2YOLA 1BMMH 5EQSA 3ZZBA 2UWLA 1EP5A 1ZRBA 3UOUA 1NESE 3PLBA 4KP0A 4YT7H 1O3PB 3PMAB 2EI8A 3BTHE 3A7TA 1C1NA 3LGYA 3MH4A 4E7RG 1ESBA 3FANA 1QBVH 5J4SA 1YPKH 1GVZA 5C67A 1BZXE 1TOMH 4X1RU 4R0IA 3RXKA 5C1UA 1ORFA 1HRTH 3UQOA 1GI5A 4I7YH 1IQEA 1CA0C 4BXWA 3AAUA 2P8OB 1ZMLA 1W7GH 2GCTC 3JZ2B 1G3DA 1Z6JH 2ZKSA 4OS2A 3LKWA 3SNDA 2CMYA 2SGFE 4E7NA 2ULLA 1AFQC 3U69H 3RC5A 1EPTC 3KQDA 1KXAA 1O3NA 1K2I1 2J34A 1YPEH 2LPRA 1YBWA 2XW9A 1P3CA 1DOJA 2XC5A 3U8RH 2OC1A 1AKSB 1HFDA 1GI3A 1NPMA 1A0JA 2G00A 5F8TA 2G5VA 4Z6AH 1ZSLA 5F6MA 3FVFB 4AFZA 1MMJN 4JCNA 5EU8A 1BMLA 2QV1A 4I31A 4JZDH 4WMEA 4MLFB 2ZFQH 2TPIZ 4FVBA 3KN2A 1C5OH 2DE8A 1TNGA 1CU1A 2BXUH 3HK6B 1GBKA 1P06A 1WOFA 3LOXA 3ODDA 3SNEA 1FY5A 3ZVCA 3U1IB 3ZZCA 3V12A 4AG2A 5I46H 1ZTKA 4K69A 4MDSA 1P05A 2GT8A 2WV5A 3STIA 2CHAC 2FOFA 1GHWH 2P3FH 2EC9H 1D3PB 2H5DA 2PSXA 1E34B 3TVJB 3LH3A 1TPOA 3W95A 3W94A 4FU9A 1WTGH 3E90B 2ZFFH 1O5FH 2BQ7B 2TGAA 3LU9B 4X1QU 2NU3E 3RXLA 1NU7B 1FZZA 1QQUA 5E0HA 4DCDA 3F9EA 1DUAA 2PGBB 1AD8H 1FJSA 1ZPZA 2UUJB 4Y0ZE 3A8DA 3A85A 2ZU2A 2QIQA 2Y5FA 4FUFA 3C27B 1NZQH 5C1XA 5CE1A 3ITIA 1DX5M 2M5TA 3M7QA 5ABWA 4NIYA 4TWWA 4HGCA 2OP9A 1WUNH 3GCNA 4BANB 2GX4A 2GCHG 1IQMA 1TBZH 1O2XA 1LKAA 4O3TA 1S0RA 1SG8B 1HBTH 5DGJA 1UTOA 2ODPA 4B73A 1DSUA 7LPRA 2ZA5A 1FLEE 1BRBE 1BTYA 4ISHH 2Z6BD 1EAUA 4THNH 2G52A 1KIGH 3MFJA 3Q3XA 4NFFA 3GY3A 2P59A 1SBWA 2Z3DA 1P2IA 3P8NA 5E2PA 2BY9X 1AE5A 2Z9LA 5E0JA 5EW1H 1TX8A 3K65B 3ODFA 3OX7U 4B75A 2Q1JA 1O30A 1TE0A 1JWTA 1C2EA 4IN1A 2GTBA 1QCPA 2C8YB 1UVSH 1XM1A 2VH6A 4GAWA 2BZAA 3ATMA 1P2JA 1Q31A 1INCA 1C1VH 1TBRH 2IPHA 1XUJA 4OGYA 4D9RA 5GCHF 2ZHDA 1TRYA 2FZZA 4MNWA 1G9IE 1DY9A 4DIHH 1CQQA 2FEQH 4DGJA 1GBJA 2ZU1A 4X8TH 1KYNA 3SUGA 4A1VA 1L1GA 3A7WA 2A4OA 1K1OA 1QHRB 3SU2A 2QGRA 1DSTA 3GDSA 3PTNA 5GWZA 5BRRE 1HUTH 2Y7ZA 3GY5A 3UY9A 1V2JT 9ESTA 2A4GA 1XVOA 2HNTF 1P9SA 3P17H 1QRZA 3EA9A 2FOEA 3KNXA 5DP8A 1Q3XA 1LHCH 1EXFA 2OTVA 1OWEA 1PPBH 1J9CH 3SNCA 2GT7A 1Z8IB 4DJZB 2EA3A 1QJ7B 1SGPE 4NSYA 1LVBA 1XUIA 2AGIX 1NU9A 4HI3A 4X6MA 3SOSA 4IMQA 4BAKB 2FOGA 4K3JA 1ARCA 3ATKA 4INKA 1TNKA 3NXPA 1AY6H 3BF6H 3D62A 1C4U2 2C3SA 3FP8E 1AB9C 1ZLRA 3A8AA 1GJCB 1A3EH 2Z94A 3SI4H 4SGBE 1DICA 3RLWH 1D6RA 2B8OH 2BX4A 1T8NA 5L2ZH 1J16A 2ZTXA 3TK5A 2PFEA 1N6YA 1HV7A 1GVKB 1T8MA 3S69A 5A8YA 2OC0A 1O37A 5H4IB 1MBMA 1LKBA 2D8WA 1IQHA 2B0FA 1EB1H 3GCTF 1HYLA 1FPHH 2OBQA 2W26A 3AASA 2Y7XA 2PTCE 4A1TA 1FV9A 3BTFE 1IOEA 5EQQA 3RMLH 3M37A 2Y82A 1E37B 2Z3EA 1FAKH 4JZEH 1TABE 1VCQA 1C1MA 1JRSA 5ETXA 4AB9A 1V2LT 4A6LA 1O2MA 2SGEE 5AVDA 1UVOA 1XXDA 1ELDE 1RTKA 3KQEA 3BG4B 3SU6A 2H5CA 2BTCE 1P04A 4AZ2B 1PPHE 1Z71A 4ESTE 2R9PA 2ANYA 1C5LH 3NPSA 3DUXH 1OP0A 2C4FH 5PTPA 2P3TB 1C5UA 1SGIB 1ESAA 4X0WU 1UK4A 3MOCA 4JYUH 4WY3A 3HK3B 2ZU3A 1DXWA 2ASUB 1ELGA 4B76A 3E16B 1O38A 1O3KA 2TRMA 1HJ9A 3PWBA 1C5ZB 4D7FA 1BTXA 1K1LA 2SNWA 2ZO3H 2ZGJA 3BIVH 1RS0A 3QGJA 1O2YA 4XSKU 2XBWA 3LDXH 1HB0B 1S0QA 1SGFG 2BD3A 2JKHA 5FX6A 1C1OA 1IQGA 1W0ZU 2F9UA 2ZF0H 3GY4A 4AYYB 1BTPA 4D8NA 4ZH8A 1P0SH 1QB9A 1YKTA 1W3CA 2PTNA 2Z9GA 1A46H 3FFGA 4NSVA 9LPRA 3M7TA 4YT6H 5C20A 1KXBA 1KDQA 4B2AA 3KL6A 1N1LA 4UEHH 4B2CA 3QDZB 1BTUA 1C2MA 1BUIA 1P2OA 4NCYA 1FIWA 3UTUH 4DIIH 3VB6A 5DP9A 1V2VT 3PROA 1GHZA 1CHGA 1ZZZA 4X2YA 3RLYH 3ZVGA 3S7KB 2QCYA 4BAQB 1HAXB 3ZZ7A 4ABIA 2A4RA 4RKJB 2ILNA 1L1NA 2FPZA 3EYDA 2GD4B 1QR3E 1TPPA 4Y8YA 4ZXYH 1YPLH 2NU4E 4YOGA 3TGJE 4ZKOU 1F7ZA 4I8LA 4ABHA 3JZ1B 2AGGX 3MH7A 1HDTH 2AMQA 4ZUHA 4UFGH 1AVGH 2ZECA 2WYGA 1UVTH 4CRBA 3SJIA 4KKDA 1W7XH 3O8BA 1UTPA 1GI8B 3FZZA 2ZDAH 1DM4B 1O39A 1O3MA 2J94A 5A8XA 1AFEH 4K1EA 1GBIA 3F9GA 1TRMA 4ABFA 1HJ8A 1S82A 3RXHA 3VB7A 1TGSZ 1YCPM 2ZCKP 2XRCA 3VPKA 4GCHG 1GL1A 4FUGA 1P03A 1MTSA 4GUXA 2ANMH 1GBEA 6ESTA 2GDDA 1OWDA 1DLKB 5DPAA 1TIOA 2I6SA 4H4FA 5JPMH 2ODYB 2F9VA 2BMGB 1P09A 3UQVA 1S84A 5EG4A 1NRQH 1MQ6A 2H1UA 2BLOA 3VXFH 1ETSH 2QA9E 1JIRA 1UO6A 1G3EA 2Z9IA 1CGJE 1GMDF 1NN6A 1BIOA 5ESTE 3U8TH 1SQOA 1RRKA 1BHXF 3AW1A 4X6NA 1BHXB 1C4V2 1Z8RA 1MBQA 3ZZ9A 1RD3B 3M3VA 2A45B 2HWLB 3A8CA 1QTFA 1QRWA 1VITF 4DOQA 1EJMA 1D9IA 4JK5A 3BTDE 2J9NA 3LC5A 1V2RT 4I32A 3U98H 3RP2A 3PMHB 1KDQB 4XOJA 4GSOA 2W3IA 1SPJA 3VEQB 3BV9B 2AERH 4H6TA 1E35B 1ZRKA 1P01A 5L6NH 5HMAA 2WPJS 3P8FA 1UTLM 3RXMA 2Z7FE 1A0HB 3CENA 2BDBA 3UNRA 3CS7A 3ZYDA 1CHOG 1UVUH 2P95A 4HTCH 2W3KA 2QY0B 2VVVA 3S0NA 4TY6A 3FAOA 3ZV8A 1BB0B 4D7GA 1NTPA 1XVMA 3UNSA 2XBVA 4BAHB 1KTTB 1O2NA 1K1JA 4YOIA 4Q2KA 6GCHF 1O2OA 3SUDA 1O2VA 1MQ5A 3V7TA 2FYRA 3VFEA 1HCGA 1J14A 1SHHB 2SFAA 1C1SA 1N8OB 2F3CE 5EGMA 2OD3B 1JRTA 3QGNB 1WSSH 1FONA 2J2UA 1O2SA 2ZPSA 2R2WU 4NIXA 3S9BA 2QXHA 1QL8A 1THSH 1HAZB 1MCVA 1ZJDA 4JMYA 3V13A 2PKAA 2GMTB 4KGAA 2CF9H 4R8TB 2FTLE 2BM2A 3RXFA 3TJVA 1DVAH 3BTEE 3ZZDA 2ZZUH 2FDAA 4B1TA 1RTLA 2BY5X 2OC7A 5GIBA 2VB0A 2VGCC 1L0ZA 3B23B 3LGIA 1F5RA 4A1XA 3KIDU 3OTJE 5EXLA 2O8WA 1SGDE 2JETC 2WPLS 1L2EA 2ODQA 2J4IA 1QQ4A 1GJ4H 1LHFH 2F83A 1XUKA 1O32A 1BTWA 4B74A 3IITA 1TGTA 2GKVE 5JB8S 2RA0A 5G4BA 1GJ9B 2ZG0H 4M7GA 1UTMA 2P16A 1YP9A 2NU1E 4A7IB 1AWHB 4X8SH 2XTTB 5EPNA 3KHVA 3MU8A 1ANBA 1HNEE 1VR1H 1C5SA 5C2ZA 1FPCH 1EAWA 4FUHA 5FAHA 1ZSJA 3UNQA 1OPHB 5EXNA 1MD7A 7ESTE 3HGNA 1BTZA 1JBUH 1C2HA 5EXMA 3U1JB 3P92A 1YGCH 1O5EH 2D26C 4YOJA 1UTQA 1SLUB 5FCKA 1FUJA 5BPEA 3S9CA 4I8JA 3HATH 1QJ1B 3RU4E 1AVXA 1FIZA 1NRSH 1UK2A 1DWDH 2F9OA 1QIXB 4AOQA 1XX9A 1ZR0A 1TNIA 1C5TA 3D49H 1FY4A 1GI7B 1RJXB 2HGTH 1KLJH 4X6OA 1EPTB 1UTKA 1O2JA 3ESTA 1O3JA 1ZMNA 1F0RA 2HPPH 1EASA 2CV3A 1V2KT 3RMMH 1PPZA 1DITH 1TPSA 2BLVA 2CGAA 1GHAG 4X8VH 1C1UH 2BD4A 1CBWC 4O97A 3E91A 2Y5HA 1AUTC 1V2OT 3PMBB 1O3IA 1SLWB 1DANH 2AS9A 2WV4A 2A7HA 1B7XB 1T4VH 2QXIA 2DUCA 3KCGH 2FLBH 4ABGA 2BY7X 2FTMA 4LXBH 4MQAA 4CRGA 3EDXB 2VIOA 2XWBI 4FUEA 3M5OA 3DFJA 2O8UA 1V6DA 3NWUA 5JB9S 1DDJA 3RM2H 3BN9A 1H4WA 1ZHMA 4Y7BA 1ACBE 5F8ZA 1DFPA 1O3OA 4ISLA 1DWCH 1LMWB 4BXSA 2Z9KA 4IMZA 1W11U 4X2XA 1CGIE 1F92A 1G3BA 4Y76A 1P2MA 2ZHFH 2H2ZA 3IG6B 4F49A 3TLOA 1ELEE 1FDPA 1AKSA 3RXPA 1GDUA 1WCZA 1HIAA 4MNVA 3ZZ3A 5GPIB 1JOUB 4ZAEA 3MO9A 1CGHA 3MMGA 1UCYK 3HPTB 3PYHA 1Y3WA 2ZQ2A 3MH6A 5AHGH 1OWKA 2TBSA 2UWOA 2F9PA 3MU4A 5DK1A 3MYWA 4BTTB 6CHAB 1C2DA 1KTSB 1YC0A 1O31A 2CF8H 5HM2A 1ETRH 3NUMA 1O33A 4AX9H 1Y3VA
chains in the Genus database with same CATH superfamily
2LNCA 3F2FA 3W1EA 1TB6H 1ELFA 3A87A 1G30B 1MTNB 1ELVA 1HJAC 2FI3E 5GCHG 5E8EH 4AFSA 3KQBA 2G5NA 3SV6A 1DS2E 5A09A 3SW2B 2A2XH 2SGAA 1P57B 3P70B 2ZHEH 4MTBA 1NO9H 2R3YA 2VWNA 5EJZA 1WDIA 2VVUA 1GBHA 1VGCC 2ALVA 3F2HA 4XE4A 1GJ8B 2A32A 3UUZA 2TIOA 2ZU5A 1GI4A 5DP5A 5HIYA 3S7HB 1NFXA 4D76A 1P02A 3QN7A 3SU0A 1F0TA 1THRH 5T6FA 1DE7H 1GCTB 3L33A 4Y8XA 1QFKH 2JDID 2G51A 1VCWA 1QBOA 4GLYA 2VWLA 2OXSA 3QTVH 3SNAA 3BEFB 2BDGA 1WU1A 2HLCA 1AWFH 4ACBA 3H7TA 1THPB 3KEEA 3NK8A 4H6SB 2YNBA 3CS0A 2ZHWH 3RXVA 5DP3A 1C5RA 2GCHF 1NFWA 1MABB 3MNXA 4YTAA 4NG9H 1GBMA 1SMFE 3GYLB 1SQAA 2VIWA 1FMGA 3DD2H 1P2NA 2QF0A 1QL7A 1TFXA 2BY8X 1BMAA 2ZDMA 1CT2E 3TK6A 2CJIA 1HAVA 1GBTA 1SFQB 1VCPA 1GI0A 3GY7A 3OSYA 1AI8H 1NY22 2A5IA 1T31A 3LC3A 3ZV9A 4INHA 1PPCE 1FNIA 1PQ7A 1GHVH 2JH6D 2QF4A 1DLEA 3I77A 1ELAA 2PHBA 3FP6E 2BXTH 2H9HA 2STBE 1SC8U 4TWYA 1O3GA 2WPMS 2HNTC 2XOKD 2AGEX 3DT0H 5B6OA 4CR5A 1BITA 3RU4D 1P2KA 5GJ4B 1GJ6A 4H42U 4LZ4B 2STAE 3KYFA 3SU5A 1UCYH 1D3DB 1HJAB 5AFZH 3ATIA 1EOLA 1QGFA 3RXIA 1EJNA 1AUJA 1ABJH 5KGOA 2IPQX 1S81A 3GDVA 3N99A 2OC8A 3LIWA 1HGTH 2BD2A 2Y80A 4AGJA 1QY6A 1YF4A 2VWMA 1ANDA 1K21H 1TGBA 4X6PA 3GCTG 2QF5A 3H5CB 1JIMA 1NBMD 3H7OA 1AGJA 2Y6TA 1F5LA 3UIRA 1UVPA 2WYJA 4XDEA 2XWAA 2J5UA 2PWXA 4RN6A 1P9UA 1EX3A 1O2LA 2V0BA 2HVYB 1TYNA 2ZFTA 4MPVA 2FS9A 5CHAB 2V6NA 2PV9B 1ABIH 1O2QA 4CH8B 1ELTA 1GWAA 2RG3A 3A86A 3K2UA 2BLWA 1UHBB 1O3DA 2HOBA 2BVXH 2QN5T 5C0TA 2TGDA 1MCTA 2WSSD 1O35A 1O2KA 1TMBH 2VIPA 4MPWA 4CREA 1GCTC 1NM6A 2VNTA 1MZAA 4CBOA 1ANCA 4ZKRU 3TPIZ 3EE0B 2BD5A 2IN2A 2WUCA 1J8AA 3BTGE 4IW4E 1SOZA 1A5IA 3KQCA 1L4ZA 1Z6EA 3ATLA 4LK4A 4TY7A 1BQYA 4IGDA 5CHBA 1NROH 2ZGXH 1TAWA 1P11E 3O8DA 4ZHAA 1VITH 1W14U 4OS5A 4BAMB 1K1PA 3SU3A 3SN8A 3FP7E 3L6PA 3G01A 1V2UT 1LVMA 3RU4T 4CHAC 4KTUA 3DSGA 1HAVB 1C1TA 3AW0A 3MNSA 3OY6U 2J92A 1AHTH 4X8UH 3PB1E 3T29A 4DT4A 1E1RD 4OS4A 2QC2A 1EAIA 4FXGH 4HZHA 1IQJA 1Z8JB 2D1JA 5EQRA 5IK2D 1DPOA 5L2YH 1TMTH 3ELAH 1SGYE 2ZC9H 1FXYA 8LPRA 4B71A 5DN6D 4ASHA 1TONA 2FLRH 1TA2A 2UWPA 3BTQE 1TQ7B 3E3TA 1IAUA 3LGTA 2W5EA 1GBCA 3QTOH 2L6OA 2NU2E 4I33A 1O0DH 3F9FA 3OE7D 4FUIA 2VU8E 4AB8A 2FI5E 1LO6A 2WPKS 1QA7A 1AQ7A 1EOJA 1G3CA 1P10A 2ZNKH 4Y8ZA 1O2UA 2YMSB 4NWLA 1GG6C 1EP6A 1XUGA 2ZTZA 4YM9A 4HFPB 3M5MA 2ZFPH 1GJ7B 1C1QA 3PLKA 4A92A 3TH4H 1PQ5A 2AMDA 3TITA 5FCRA 2SGDE 3P95A 3SV7A 3GCOA 4AYVB 1P8VC 1QNJA 3Q00A 4TYDA 3QLPH 1EAXA 2ZGBH 3QZRA 1GMCF 3TK9A 2GCTB 1GHBG 1QJ6B 5HXFA 1B0EA 1CVWH 4FUJA 3SJKA 1EB2A 2RDEA 4YO9A 2XC4A 2SGPE 4UFEH 1IQNA 8ESTE 3MI4A 1GDNA 2IOTA 5IDKA 4JYTA 2PW8H 4Q7YA 1GBDA 1EPTA 2A7CA 1C2JA 1GMDG 1QURH 1HAYB 3BEUA 1FAXA 2ZGCA 4UDWH 3UPEA 2GMTC 1IQIA 1LPKB 2QAAA 1FI8A 1A5GH 1TGCA 5JBAS 1A0LA 1HIAB 1W10U 2FOMB 3T26A 4GHQA 1FQ3A 3DFLA 4NIVA 1UMAH 1TALA 4BTUB 1N8OC 4ZXXH 1EJAA 1YCPK 1FY3A 3QX5H 5FX5A 1F0SA 2V3OH 1SOTA 2OCVB 3QWCH 1MZDA 1XUFA 4FETA 4ACAA 2B7DH 1A61H 3R0FA 4KELA 3RC4A 2KAIB 3NZIA 3SGQE 1SGFA 2KCPA 1HAIH 1S85A 1XKBC 1LPZB 3F1SB 4P02A 5JBTA 3SQEE 1GGDB 2PSYA 3VG8A 2EI7A 1WV7H 3SV9A 1LHEH 4WMFA 1TMUH 3A7XA 1BCUH 3NRLA 1W13U 1WQVH 2BD7A 4OGXA 2K1QA 1J15A 5DG6A 1C9TA 1BBRK 4UONA 2W7UA 1ANEA 3LONA 2O8MA 2QF3A 5K7RA 4Z0KA 1UJ1A 6LPRA 1K22H 5A0AE 1PJPA 5LPRA 1W8BH 4Q7ZA 1LPGB 3KYGA 2UUKB 5EOKA 4NA8A 1MD8A 1VZQH 2AFQB 4OS6A 4AFQA 1C5PA 1COWD 4XFQA 1C5VA 2XBXA 3BTWE 4O3UA 1VGCB 3RMNH 4OS1A 1DWEH 2ZTYA 3PV4A 4K8YA 4J2YB 1ETTH 1MAXA 1E38B 1TLDA 3F3BA 4Y10E 3TNSA 1LHDH 1P12E 2P94A 1QBNA 4AFUA 5EPYA 4X2WA 1V2TT 2RDLA 2BDYA 2GP9B 4A5TS 3QK1A 1S6HA 3C1KA 1MKXK 2BX3A 1SGEE 1D3TB 1C5XB 3HKJB 3RXSA 4YZUA 2B9LA 8GCHF 4ABEA 3TJOA 3MU1A 1GBFA 3BIUH 2GV7A 4GPGA 2XBYA 3LGWA 2XYAA 2AIQA 4K1SA 1EZXC 1KMHB 3VGCC 1IQFA 3UFAA 1TNHA 4HG6A 1U6QA 1ZTLA 1C2LA 1H9HE 3DSPA 1RIWB 1VITG 1G2LA 1NRNH 1QA0A 2G55A 2CXVA 3NKKA 2PKSB 1TNJA 3A8BA 1O2ZA 1BRUP 2M2AA 1UK3A 3A7ZA 4TPIZ 1EKBB 4B6EA 2BQ6B 4DT7B 5AF9H 3M3SA 4TSFD 3SQHE 3Q77A 4VGCC 5E0GA 2OK5A 2VIDA 3LJOA 3SJ9A 1F2SE 4KTSA 2W6JD 1ZHRA 3K6YA 4BOHA 4Y0YE 3ZVBA 2BHGA 3K6ZA 1A4WH 5A8ZA 1ZSKA 3M7UA 5JYIA 1FY8E 3VB4A 1S5SA 1XKAC 4Y11E 4NZQA 4P00A 5DJ7A 2RCEA 2O9QA 1O5GH 1ZPCA 1SGRE 1LCYA 4GCHF 5T3HA 1B0FA 1G37A 1H9LB 2O8TA 1QL9A 3SUEA 1A3BH 5I25A 2FMJA 1SQTA 1BOQA 3A88A 3DSOA 3BTKE 1CE5A 1ZPBA 3T25A 3M5NA 1EATA 3TH2H 3ZVDA 1FN6A 1EZUC 3AVZA 4I8KA 1CBWB 1FN8A 1Y3UA 1C2KA 4JZ1A 1GJAB 2JH5D 1DWBH 2F4LA 4WWYA 4ABAA 3A7VA 4WXVA 1KLTA 1YM0A 1BBRH 1HXEH 2ZGHA 2BLQA 1LDTT 6CHAC 1HAHH 1A2CH 1Y8TA 2JH0D 1DXPA 4NIWA 1UCYE 3RDZA 2A0QB 4B6FA 1M9UA 2BDCA 1T8OA 2B5TB 4QT8C 1MU8B 1GDQA 3MO6A 2ANKH 2FX4A 2W7SA 3M36A 3SGAE 1TNLA 1O5DH 3RXUA 4U32A 5SGAE 5DP4A 3PO1C 1GHYH 1HLTH 3KQ5A 1LVOA 3F68H 3K9XB 4E05H 2F91A 1K9OE 4F4OC 2AEIH 1ZTJA 1BBRE 2A5AA 1Y5UT 4F48B 4INLA 3LT3A 1MH0A 2QYIA 2KR7A 1YPMH 1KXEA 1K1MA 3SV8A 4LZ1H 3E0NB 1B5GH 2GV6A 1LVYA 1ESTA 3PTBA 2FOAA 3GY6A 4JZIA 2KM0A 1IQKA 2HPQH 3SI3H 4MPXA 2OBOA 1DUEA 3UOPA 2Q6FA 2ZCLP 4ABBA 2A4QA 2ZIQH 3ZVFA 1WXRA 2VH0A 5DP6A 1YLCA 2JJ1D 1BJVA 1O3CA 2PLXA 2GVFA 3D65E 5JBCS 2ZHQH 2JETB 2AH4X 1GCDA 2V3HH 4Y7AA 1RGQA 1UW7A 2QE7D 3IWMA 1BA8B 1SKYE 5GDSH 2GZ8A 2IJOB 2VIQA 1YPJH 3RXEA 5FBIA 1O2WA 2J38A 2Q6GA 4X1PU 2HRVA 2PUQH 3MH5A 4FUDA 3I78A 2C8ZB 2VJ1A 4YESB 1TRNA 5DSFA 2A31A 1O2RA 1K1NA 5ESBA 3HKIB 3GISB 5FL7D 4D9QA 4VGCB 3GICB 1O2TA 1GL0E 1ZOMA 4M9FA 3RXQA 4LOYH 3EGKH 1SI5H 2ZU4A 3Q3YA 2BYAX 4NGAH 4BNRA 5A2MH 1BDAA 1BRAA 1C4Y2 3B8JA 4PROA 2GZ7A 2C8WB 3RMOH 4FU7A 3MU5A 2VBCA 1MKWH 4U01A 1AB9B 2ZWLH 3O8CA 3LJJA 1O2IA 3RXAA 3VGCB 2D2DA 2ZQ1A 3FOAA 1O2PA 1SR5C 3OTPA 2H6MA 2BD8A 3SZNA 4CH2B 2R0LA 2H9TH 3WWBA 4FUCA 1AZZA 1GVLA 2ZCHP 4NWKA 4XD7D 2A7JA 4KTCA 1ELBA 1G32B 4FVDA 1TX6A 3V3MA 1V2NT 2HVXA 3BG4C 2DE9A 1SSXA 4Y71A 3T5FH 3F6UH 1S6FA 1Z8GA 2FOHA 1IHTH 1MKWK 5FPTA 5LPEA 3N7OA 2J97A 1O36A 2C8XB 3ZZ8A 1NT1A 3Q3KA 2VGCB 2BZ6H 6GCHG 1KSNA 1NS3A 4FUBA 1W0YH 2JIZD 3PRBA 1T8LA 2GGVB 3PRDA 2Q6DA 4ZROA 1MTVA 2BB4A 1YPHC 1SGTA 2THFB 1D3QB 1D6WA 1PQ8A 1E0FD 2XXLA 2Y81A 3E0PB 1GHXH 3EE7A 2PGQB 1A1RA 3EQ0H 1L4DA 3V0XA 1CHOF 1WTHD 2GZ9A 2NU0E 1H9IE 3UREA 1PQAA 4XBDA 3PWCA 2ZDLA 1NFYA 4K2YA 4DW2U 2I6QA 5J4QA 1ELCA 1GGDC 4NZLA 3DHKH 4Q7XA 1ZYOA 3QO6A 4K1TA 1OP8A 3D23A 2FO9A 4WF8A 1NFUA 1XMNB 3A83A 3S9AA 3U9AH 1E36B 2UUFB 1O5BB 1AN1E 4FOUC 3E6PH 3T2NA 4I8HA 4E06H 1IQLA 1E1QD 2BVRH 2ESTE 1A7SA 3A80A 5TCCA 1YPHE 1FX0B 1PFXC 1FY1A 1HAGE 1RTFB 5FXLA 4RKOB 1Y59T 1EUFA 4WXIA 1C5YB 1YLDA 1G36A 1TA6A 3RXTA 5LH8A 1C2GA 1SVPA 4NA9H 3TGIE 1MAYA 2FOBA 1C2IA 1D4PB 1WAYB 4JZFH 3QZQA 3RUOA 4MPUA 5A0CA 4DVAU 1V3XA 5JBBS 1BTHH 4O03A 2WPHS 2NWNA 2ZFRH 1TPAE 1OWHA 1F5KU 3ZZAA 1PPFE 3LH1A 3MNCA 3TU7H 2FYQA 2P3UB 4UE7H 1BJUA 1YWUA 1C5WB 3ENSB 3OU0A 2A1DB 1UTJA 1ZGIA 1ZMJA 1OOKB 1PPEE 2CK3D 2V35A 3WW7A 2OQ5A 2BD9A 5AFYH 3UR9A 1KXDA 3BTME 5C5NA 1AMHA 4IS5A 4ZKNU 3TJNA 3KF2A 4ISIH 5KECA 2OQUA 1GPZA 2RA3A 4J1YA 3BTTE 3O8RA 3SU1A 3N7EA 1W2KH 1WYKA 2CHAB 1O3BA 3T28A 4FU8A 1GI1A 2TGTA 5T6DA 5FBEA 4GVUA 4SGAE 2G4TA 3GY2A 3URCA 4JYVH 3M3TA 2WINI 1T4UH 3ZVEA 1VKYA 2YMSC 4K60A 3U8OH 2R2MB 3T62A 4WJG2 3BSQA 2QXJA 5GXPA 1AZ8A 3OFND 1VJ9U 1YY3A 4AN7A 3QUMP 1GHBF 5EW2H 1C1WH 1V2ST 3MU0A 5JDUB 1Z7KA 8KME2 3MTYA 4CRFA 3LGVA 4NA7A 4ZCNA 3PO1B 3SJ8A 2XCFA 1Z1JA 4MNYA 4YLUA 1BRCE 3DA9B 4BTIB 4TPYA 2YNAA 4WH6A 5EJLA 4ISOA 1LQEA 2EY4C 1PYTC 1BT7A 3TNTA 1AFQB 1C5QA 1V2PT 1GJ5H 2XC0A 3SV2H 3L3TA 1YPGH 1LHGH 2BDHA 2A2QH 3OY5U 1AIXH 1WQSA 2KFWA 1TWXB 1OS8A 1K1IA 4CBNA 1SB1H 3T27A 4Q4LA 1JMOH 4XBCA 1O5AB 2TGPZ 1C9PA 1CA0B 1O2GH 3E1XB 4IN2A 2C93B 3VXEH 1HAPH 3MWIU 4YLQH 1T7CA 2Y5GA 2Z3CA 3A7YA 3RXOA 1AE8H 2WPIS 2V3MA 1Z1IA 2VVCA 1NC6A 1RFNA 2KCAA 4U2WA 4Y6DA 4XBBA 2J98A 2OINA 4ZHMU 2ZFSA 5FPYA 1CT0E 2F9NA 1ZJKA 3ZVAA 1TX7A 2P93A 5CMXH 4DG4A 1OXGA 3PMJA 3SGBE 2EI6A 2VINA 5FPSA 1OP2A 3MO3A 3URDA 3F9HA 2FM2A 4Q80A 3M35A 2ANWA 4ASUD 2FESH 2R3UA 3RXDA 1MU6B 4MVNA 5IYTA 1GG6B 3MHWU 4I8GA 4ABDA 1O34A 1CO7E 1SGCA 2ALPA 1OWIA 2J95A 3ZYEA 1UTNA 1GJDB 3A84A 4RSPA 1GHAF 1K28D 1GBAA 3PM3A 4OS7A 4CRDA 2GDEH 2FS8A 4ZHLU 1H8HD 1O3FA 1Q2WA 1CT4E 1MUEB 2PKSC 1NRRH 1YYY1 3UB0A 5CHAC 3UWIA 2F9BH 2G8TA 1X7AC 4ZMAH 5K0HA 1RIWC 4WVPE 2SNVA 1DY8A 3M61U 2QXGA 2FX6A 1TGNA 3GDUA 3SHAH 1GI9B 1KXCA 3GOVB 2ZDKA 1H8DH 1C5NH 7KMEH 1C1RA 1OKXA 3SHCH 1XXFA 5F53A 3GYMA 2SGQE 1EZQA 1O3AA 3SUFA 3E8LA 3ATWA 2O8LA 1LTOA 1DT2A 1NBME 3STJA 3RC6A 5T6GA 3LGUA 5A0BA 5LPFA 4X2VA 2P8OC 4CR9A 1HPGA 4AG1A 5LGOA 4CHAB 4YXWD 2FI4E 1C2FA 3FZDA 2G4UA 3RXRA 3P6ZB 7GCHG 1H1BA 1OYTH 2ZDNA 1GBBA 4IC5A 2A5KA 4IBLH 5F03A 1SHYA 1CSOE 2ZEBA 4WMDA 5DKMA 3M5LA 1QB1A 1KY9A 4JK6A 2KCOA 4NFEA 3SU4A 1RXPA 2HLDD 3GY8A 4B2BA 3BG8A 3R3GB 3UWJH 1TOCB 4RT1A 3SJOA 3F0OA 4DURA 2HNTE 2ZI2H 4ISNA 2WPDD 3OYPA 2XCNA 5C1YA 4ZKSU 1IHSH 3MQKC 1ZHPA 1O3HA 3EA8A 3B9FH 2BY6X 1Y5BT 1TBQH 1W12U 3SO3A 1Y5AT 2R0KA 1QB6A 3LPRA 1Y3YA 4UFFH 1V2WT 3OEHD 1GBLA 2FOCA 1Y3XA 3MNBA 4Y79A 1PPGE 3TJUA 1SLVB 1YCPH 4K5ZA 2FP7B 1A5HA 1XUHA 1V2QT 3A82A 1PYTD 4ABJA 5FHTA 1MTWA 1EQ9A 1ID5H 2BOHB 1SGQE 4UD9H 4AORA 3EAJA 2KAIA 1OWJA 2VIVA 2ZPQA 4TT3D 1CA8B 5E2OA 2FWWA 1QRXA 1SGNE 1H8IH 1SFIA 1EZSC 2H9EH 1O5CB 1O3EA 1LQDB 3PLPA 3TGKE 2FODA 1ZGVA 1KXFA 3EA7A 3SORA 5C17A 1O2HA 1GMCG 1GI6A 4K8BA 1V2MT 4CRAA 3A81A 3RXGA 1GJBB 3TIUA 1AO5A 2FIRH 2AMPA 2ZP0H 3AAVA 3I29A 3RXBA 1HAOH 4U30A 1OSSA 2BVSH 3GCHC 4CRCA 2UUYA 3GCHB 4AGKA 3A89A 1NRPH 3NCLA 5DO4H 3SNBA 2CN0H 1GMHF 1MTNC 5TCAA 1S6LA 1AU8A 1C5MD 2G81E 1WBGB 3HGPA 5L30H 1TQ0B 2PR3A 4IC6A 1P3EA 1F0UA 2BDAA 1ARBA 1J17T 2AYWA 1JXPA 3Q76A 4BAOB 2AIPA 1GMHG 5EODA 1VJAU 2L74A 5HM9A 4X1SU 2BOKA 2BDIA 4DY7B 1W0KD 5F8XA 3BEIB 2OUAA 5HGGA 3ZZ5A 3ZZ6A 1OYQA 2PUXB 5DP7A 3SBKA 3RM0H 3P8GA 3ZZ4A 3KGPA 5B6LA 2C90B 2WUBA 2XNIA 3WY8A 4X1NU 4MG3A 3ZIAD 3RXCA 1MTUA 4O9VA 2ZDVH 3VB3A 1MKXH 1KLIH 1T32A 4GHTA 1GI2A 1P2QA 2OLGA 2ZPRA 1C1PA 7GCHF 1N6XA 2PKAB 2EEKA 1HXFH 2HALA 5HYOA 2FXRA 5C5OA 2Z9JA 2VWOA 3CP7A 1L1JA 3RXJA 4MNXA 3VB5A 4WH8A 5C3NA 1UHBA 1AVWA 3TH3H 3UR6A 4I86A 1SL3A 2BQWB 4UFDH 1OX1A 1BMNH 5TJXA 3P8OA 1SLXB 8GCHG 2V7QD 1G2MA 1S83A 1O3LA 2K8IA 2YOLA 1BMMH 5EQSA 3ZZBA 2UWLA 1EP5A 1ZRBA 3UOUA 1NESE 3PLBA 4KP0A 4YT7H 1O3PB 3PMAB 2EI8A 3BTHE 5CDFE 3A7TA 1C1NA 3LGYA 3MH4A 4E7RG 1ESBA 3FANA 1QBVH 5J4SA 1YPKH 1GVZA 5C67A 1BZXE 1TOMH 4X1RU 4R0IA 3RXKA 5C1UA 1ORFA 1HRTH 3UQOA 1GI5A 4I7YH 1IQEA 1CA0C 4BXWA 3AAUA 2P8OB 1ZMLA 1W7GH 2GCTC 2WHXA 3JZ2B 1G3DA 1Z6JH 2LP6A 2ZKSA 4OS2A 3LKWA 3SNDA 2CMYA 2SGFE 4E7NA 2ULLA 1AFQC 3U69H 3RC5A 1EPTC 3KQDA 1KXAA 5HKKD 1O3NA 1K2I1 2J34A 1YPEH 2LPRA 1YBWA 2XW9A 1P3CA 1DOJA 2XC5A 3U8RH 2OC1A 1AKSB 1HFDA 1GI3A 1NPMA 1A0JA 2G00A 5F8TA 2G5VA 4Z6AH 1ZSLA 5F6MA 3FVFB 4AFZA 1MMJN 4JCNA 5EU8A 1BMLA 2QV1A 4I31A 4JZDH 4WMEA 4MLFB 2ZFQH 2TPIZ 4FVBA 3KN2A 1C5OH 2DE8A 1TNGA 5KEDA 1CU1A 2BXUH 3HK6B 1GBKA 1P06A 1WOFA 3LOXA 3ODDA 3SNEA 1FY5A 3ZVCA 3U1IB 3ZZCA 3V12A 4AG2A 5I46H 1ZTKA 4K69A 4MDSA 1P05A 2GT8A 2WV5A 1H8ED 3STIA 2CHAC 2FOFA 1GHWH 2P3FH 2EC9H 1D3PB 1QZ8A 2H5DA 2PSXA 1E34B 3TVJB 3LH3A 1TPOA 3W95A 3W94A 4FU9A 1WTGH 3E90B 2ZFFH 1O5FH 2BQ7B 2TGAA 3LU9B 4X1QU 2NU3E 3RXLA 1NU7B 1FZZA 1QQUA 5E0HA 4DCDA 3F9EA 1DUAA 2PGBB 1AD8H 1FJSA 1ZPZA 2UUJB 4Y0ZE 3A8DA 3A85A 2ZU2A 2QIQA 2Y5FA 4FUFA 3C27B 1NZQH 5C1XA 5CE1A 3ITIA 1DX5M 2M5TA 3M7QA 5ABWA 3F2GA 4NIYA 4TWWA 4HGCA 2OP9A 1WUNH 3GCNA 3FKSD 2WV9A 4RT0A 4BANB 2GX4A 2GCHG 1IQMA 1TBZH 1O2XA 1LKAA 4O3TA 1S0RA 1SG8B 1HBTH 5DGJA 1UTOA 2ODPA 4B73A 1DSUA 7LPRA 2ZA5A 1E79D 1FLEE 1BRBE 1BTYA 4ISHH 2Z6BD 1EAUA 4THNH 2G52A 1KIGH 3F0PA 3MFJA 3Q3XA 4NFFA 3GY3A 2P59A 1SBWA 2Z3DA 1P2IA 3P8NA 5E2PA 2BY9X 2F43B 4Q63A 1AE5A 2Z9LA 5E0JA 5EW1H 1TX8A 3K65B 3ODFA 3OX7U 4B75A 5EIYA 2Q1JA 3UAIC 4XRNA 1O30A 1TE0A 1JWTA 1C2EA 4IN1A 2GTBA 1QCPA 2C8YB 5HIZA 1UVSH 1XM1A 2VH6A 4GAWA 2BZAA 3ATMA 3U28C 1P2JA 1Q31A 1INCA 1C1VH 1TBRH 2IPHA 1XUJA 4OGYA 4D9RA 5GCHF 2RFKC 2ZHDA 1TRYA 2FZZA 4MNWA 1G9IE 1DY9A 4DIHH 1CQQA 2FEQH 4DGJA 1GBJA 2ZU1A 4X8TH 1KYNA 3SUGA 4A1VA 1L1GA 3A7WA 4RI0A 2A4OA 3CNRA 1K1OA 1QHRB 3SU2A 2QGRA 1DSTA 3GDSA 3PTNA 5GWZA 5BRRE 1HUTH 2Y7ZA 3GY5A 3UY9A 1V2JT 9ESTA 2A4GA 1XVOA 2HNTF 1P9SA 3P17H 1QRZA 3EA9A 2FOEA 3KNXA 5DP8A 1Q3XA 1LHCH 1EXFA 2OTVA 1OWEA 1PPBH 1J9CH 3N7DA 2WZQA 3SNCA 2GT7A 1Z8IB 4DJZB 2EA3A 1QJ7B 1SGPE 4NSYA 1LVBA 1XUIA 2AGIX 1NU9A 4HI3A 4X6MA 3SOSA 4IMQA 4BAKB 2FOGA 4K3JA 1ARCA 3ATKA 4INKA 1TNKA 3NXPA 1AY6H 3BF6H 3D62A 1C4U2 2C3SA 3FP8E 1AB9C 1ZLRA 3A8AA 3H09A 1GJCB 1A3EH 2Z94A 3SI4H 4SGBE 1DICA 3FO8D 3RLWH 1D6RA 2B8OH 2BX4A 1T8NA 5L2ZH 1J16A 2ZTXA 3TK5A 2PFEA 1N6YA 1HV7A 1GVKB 1T8MA 3S69A 5A8YA 2OC0A 1O37A 5H4IB 1MBMA 1LKBA 2D8WA 2PP6A 1IQHA 2B0FA 1EB1H 3GCTF 1HYLA 1FPHH 2OBQA 2W26A 3AASA 2Y7XA 2PTCE 1SQRA 3SYJA 4A1TA 1FV9A 3BTFE 1IOEA 5EQQA 3RMLH 3M37A 2Y82A 1E37B 2Z3EA 1FAKH 4JZEH 1TABE 1VCQA 1C1MA 1JRSA 2KX4A 5ETXA 4AB9A 1V2LT 4A6LA 1O2MA 2SGEE 5AVDA 1UVOA 1XXDA 1ELDE 1RTKA 3KQEA 3BG4B 3SU6A 2H5CA 2BTCE 1P04A 4AZ2B 1PPHE 1Z71A 4ESTE 2R9PA 2ANYA 1C5LH 3NPSA 3DUXH 1W0JD 1OP0A 2C4FH 5PTPA 2P3TB 1C5UA 1SGIB 1ESAA 4X0WU 1UK4A 3MOCA 4JYUH 4WY3A 3HK3B 2ZU3A 1DXWA 2ASUB 1ELGA 4B76A 3E16B 1O38A 1O3KA 2TRMA 1HJ9A 3PWBA 1C5ZB 4D7FA 2EQNA 1BTXA 1K1LA 2SNWA 2ZO3H 2ZGJA 3BIVH 1RS0A 3QGJA 1EFRD 1O2YA 2XBWA 4XSKU 3LDXH 1HB0B 1S0QA 1SGFG 2BD3A 2JKHA 5FX6A 1C1OA 1IQGA 1W0ZU 2F9UA 2ZF0H 3GY4A 4AYYB 1BTPA 4D8NA 4ZH8A 1P0SH 1QB9A 1YKTA 2JJ2D 1W3CA 2PTNA 2Z9GA 1A46H 3FFGA 4NSVA 9LPRA 1K0HA 3M7TA 4YT6H 5C20A 1KXBA 1KDQA 4B2AA 3KL6A 1N1LA 4UEHH 4B2CA 3QDZB 1BTUA 1C2MA 1BUIA 1P2OA 4NCYA 1FIWA 3UTUH 4DIIH 3VB6A 4OM9A 5DP9A 1V2VT 3PROA 1GHZA 1CHGA 1ZZZA 4X2YA 3RLYH 3ZVGA 3S7KB 5EJ1A 2QCYA 4BAQB 1HAXB 3ZZ7A 4ABIA 2A4RA 4RKJB 2ILNA 1L1NA 2FPZA 3EYDA 2GD4B 1QR3E 3SZEA 1TPPA 4Y8YA 4ZXYH 1YPLH 2KZ4A 2NU4E 4YOGA 3TGJE 4ZKOU 1F7ZA 4I8LA 4ABHA 3JZ1B 2AGGX 3MH7A 1HDTH 2AMQA 4ZUHA 4UFGH 1AVGH 2ZECA 2WYGA 1UVTH 4CRBA 3SJIA 4KKDA 5T1VA 1W7XH 3O8BA 1UTPA 1GI8B 3FZZA 2ZDAH 1DM4B 1O39A 1O3MA 2J94A 5A8XA 1AFEH 4K1EA 1GBIA 3F9GA 1TRMA 4ABFA 1HJ8A 1S82A 3RXHA 3VB7A 1TGSZ 1YCPM 2ZCKP 2XRCA 3VPKA 4GCHG 1GL1A 4FUGA 1P03A 1MTSA 4GUXA 2ANMH 1GBEA 6ESTA 2GDDA 1OWDA 1DLKB 2K0QA 5DPAA 1TIOA 2I6SA 4H4FA 5JPMH 2J98B 2ODYB 2F9VA 2BMGB 1P09A 3UQVA 1S84A 5EG4A 1NRQH 1MQ6A 2H1UA 2BLOA 3VXFH 1ETSH 2QA9E 1JIRA 1UO6A 1G3EA 2Z9IA 1CGJE 1GMDF 1NN6A 1BIOA 5ESTE 3U8TH 1SQOA 1RRKA 1BHXF 3AW1A 4X6NA 1BHXB 1C4V2 1Z8RA 1MBQA 1YLNA 3ZZ9A 1RD3B 3M3VA 2A45B 2HWLB 3A8CA 1QTFA 2W6ID 1QRWA 1OHHD 1VITF 4DOQA 1EJMA 1D9IA 4JK5A 3BTDE 2J9NA 3LC5A 1V2RT 4I32A 3U98H 3RP2A 3PMHB 1KDQB 4XOJA 4GSOA 2W3IA 1SPJA 3VEQB 3BV9B 2AERH 4H6TA 1E35B 1ZRKA 1P01A 5L6NH 5HMAA 2WPJS 4Z1MD 3P8FA 1UTLM 3RXMA 2Z7FE 1A0HB 3CENA 2BDBA 3UNRA 3CS7A 3ZYDA 1CHOG 1UVUH 2P95A 4HTCH 2W3KA 2QY0B 2VVVA 3S0NA 4TY6A 3FAOA 3ZV8A 1BB0B 4D7GA 1NTPA 1XVMA 2LELA 3UNSA 2XBVA 4BAHB 1KTTB 1O2NA 1K1JA 4YOIA 3GS9A 4Q2KA 6GCHF 1O2OA 3SUDA 1O2VA 1MQ5A 3WWFA 3V7TA 2FYRA 3VFEA 1HCGA 1J14A 1SHHB 2SFAA 1C1SA 1N8OB 2F3CE 5EGMA 2OD3B 1JRTA 3QGNB 1WSSH 1FONA 2J2UA 1O2SA 2ZPSA 2R2WU 4NIXA 3S9BA 2QXHA 1QL8A 1THSH 1HAZB 1BMFD 1MCVA 1ZJDA 4JMYA 3V13A 2PKAA 2GMTB 4KGAA 2CF9H 4R8TB 2FTLE 2BM2A 3RXFA 3TJVA 1DVAH 3BTEE 3ZZDA 2ZZUH 5C0UA 2FDAA 4B1TA 1RTLA 2BY5X 2OC7A 5GIBA 2VB0A 2VGCC 1L0ZA 3B23B 3LGIA 1F5RA 4A1XA 3KIDU 3OTJE 5EXLA 2O8WA 1SGDE 2JETC 2WPLS 1L2EA 5C94A 2ODQA 2XNDD 2J4IA 1QQ4A 1GJ4H 2GJGA 1LHFH 2F83A 1XUKA 1O32A 1BTWA 4B74A 3IITA 1TGTA 2GKVE 5JB8S 2RA0A 5G4BA 1GJ9B 2ZG0H 4M7GA 1UTMA 2P16A 1YP9A 2NU1E 4A7IB 1AWHB 2IJD1 4X8SH 2XTTB 5EPNA 3KHVA 3MU8A 1ANBA 1HNEE 1VR1H 1C5SA 5C2ZA 1FPCH 1EAWA 4FUHA 5FAHA 1ZSJA 3UNQA 1OPHB 5EXNA 1MD7A 7ESTE 3HGNA 1BTZA 3PV2A 1JBUH 1C2HA 5EXMA 3U1JB 3P92A 1YGCH 1O5EH 2D26C 4YOJA 1UTQA 1SLUB 5FCKA 1FUJA 5GNDA 3DCLA 5BPEA 3S9CA 4I8JA 3HATH 1QJ1B 3RU4E 1AVXA 3AK5A 1FIZA 1NRSH 1UK2A 1DWDH 2F9OA 1QIXB 4AOQA 1XX9A 1ZR0A 1TNIA 1C5TA 3D49H 1FY4A 1GI7B 1RJXB 2HGTH 1KLJH 4X6OA 1EPTB 1UTKA 1O2JA 3ESTA 4F55A 1O3JA 1ZMNA 1F0RA 2HPPH 1EASA 2CV3A 1V2KT 3RMMH 1PPZA 1DITH 1TPSA 2BLVA 2CGAA 1GHAG 3OEED 4X8VH 1C1UH 2BD4A 1CBWC 4O97A 3E91A 2Y5HA 1AUTC 1V2OT 3PMBB 1O3IA 1SLWB 1DANH 2AS9A 2WV4A 2A7HA 1B7XB 1T4VH 2QXIA 2DUCA 3KCGH 2FLBH 4ABGA 2BY7X 2FTMA 4LXBH 4MQAA 4CRGA 3EDXB 2VIOA 2XWBI 4FUEA 3M5OA 3DFJA 2O8UA 1V6DA 3NWUA 3PV5A 5JB9S 1DDJA 3RM2H 3BN9A 1H4WA 1ZHMA 4Y7BA 1ACBE 5F8ZA 1DFPA 1O3OA 4ISLA 1DWCH 1LMWB 4BXSA 2Z9KA 4IMZA 4AC9A 1W11U 4X2XA 1CGIE 1F92A 1G3BA 4Y76A 1P2MA 2ZHFH 2H2ZA 3FN8A 3IG6B 4F49A 3TLOA 1ELEE 1FDPA 1AKSA 3RXPA 1GDUA 1WCZA 1HIAA 4MNVA 3ZZ3A 5GPIB 1JOUB 4ZAEA 3MO9A 1CGHA 3MMGA 1UCYK 3HPTB 3PYHA 1Y3WA 2ZQ2A 3MH6A 2KCYA 5AHGH 1OWKA 2TBSA 2UWOA 2F9PA 3MU4A 2YMSD 3OAAD 5DK1A 3MYWA 4BTTB 6CHAB 1C2DA 1KTSB 1YC0A 1O31A 2CF8H 5HM2A 1ETRH 3NUMA 1O33A 4AX9H 2AHME 1Y3VA
chains in the Genus database with same CATH topology
2LNCA 1TB6H 1ELFA 3A87A 1G30B 1MTNB 1ELVA 1HJAC 2FI3E 5GCHG 5E8EH 4AFSA 3KQBA 2G5NA 3SV6A 1DS2E 5A09A 3SW2B 2A2XH 2SGAA 1P57B 3P70B 2ZHEH 4MTBA 1NO9H 2R3YA 2VWNA 2VVUA 1GBHA 1VGCC 2ALVA 4XE4A 1GJ8B 2A32A 3UUZA 2TIOA 2ZU5A 1GI4A 5DP5A 3S7HB 1NFXA 4D76A 1P02A 3QN7A 3SU0A 1F0TA 1THRH 5T6FA 1DE7H 1GCTB 3L33A 4Y8XA 1QFKH 2G51A 1VCWA 1QBOA 4GLYA 2VWLA 2OXSA 3QTVH 3SNAA 3BEFB 2BDGA 1WU1A 2HLCA 1AWFH 3H7TA 1THPB 3KEEA 3NK8A 4H6SB 2YNBA 3CS0A 2ZHWH 3RXVA 5DP3A 1C5RA 2GCHF 1NFWA 3MNXA 4YTAA 4NG9H 1GBMA 1SMFE 3GYLB 1SQAA 2VIWA 1FMGA 3DD2H 1P2NA 2QF0A 1QL7A 1TFXA 2BY8X 1BMAA 2ZDMA 1CT2E 3TK6A 2CJIA 1HAVA 1GBTA 1SFQB 1VCPA 1GI0A 3GY7A 3OSYA 1AI8H 1NY22 2A5IA 1T31A 3LC3A 3ZV9A 4INHA 1PPCE 1FNIA 1PQ7A 1GHVH 2JH6D 1DLEA 3I77A 1ELAA 2PHBA 3FP6E 2BXTH 2H9HA 2STBE 1SC8U 4TWYA 1O3GA 2WPMS 2HNTC 3DT0H 2AGEX 5B6OA 4CR5A 1BITA 3RU4D 1P2KA 5GJ4B 1GJ6A 4H42U 4LZ4B 2STAE 3SU5A 1UCYH 1D3DB 1HJAB 5AFZH 3ATIA 1EOLA 1QGFA 3RXIA 1EJNA 1AUJA 1ABJH 1S81A 3GDVA 2OC8A 3LIWA 1HGTH 2BD2A 2Y80A 4AGJA 1QY6A 1YF4A 2VWMA 1ANDA 1K21H 1TGBA 4X6PA 3GCTG 3H5CB 3H7OA 1JIMA 1AGJA 2Y6TA 1F5LA 3UIRA 1UVPA 2WYJA 4XDEA 2XWAA 2PWXA 4RN6A 1P9UA 1EX3A 1O2LA 2V0BA 1TYNA 2ZFTA 4MPVA 2FS9A 5CHAB 2V6NA 2PV9B 1ABIH 1O2QA 4CH8B 1ELTA 1GWAA 2RG3A 3A86A 3K2UA 2BLWA 1UHBB 1O3DA 2HOBA 2BVXH 2QN5T 2TGDA 1MCTA 1O35A 1O2KA 1TMBH 2VIPA 4MPWA 4CREA 1GCTC 1NM6A 2VNTA 1MZAA 4CBOA 1ANCA 4ZKRU 3TPIZ 3EE0B 2BD5A 2IN2A 2WUCA 1J8AA 3BTGE 4IW4E 1SOZA 1A5IA 3KQCA 1L4ZA 1Z6EA 3ATLA 4LK4A 4TY7A 1BQYA 4IGDA 1NROH 2ZGXH 1TAWA 1P11E 3O8DA 4ZHAA 1VITH 1W14U 4OS5A 4BAMB 1K1PA 3SU3A 3SN8A 3FP7E 3L6PA 3G01A 1V2UT 1LVMA 3RU4T 4CHAC 4KTUA 1HAVB 1C1TA 3AW0A 3MNSA 3OY6U 2J92A 1AHTH 4X8UH 3PB1E 3T29A 4OS4A 2QC2A 1EAIA 4FXGH 4HZHA 1IQJA 1Z8JB 2D1JA 5EQRA 1DPOA 5L2YH 1TMTH 3ELAH 1SGYE 2ZC9H 1FXYA 8LPRA 4B71A 4ASHA 1TONA 2FLRH 1TA2A 2UWPA 3BTQE 1TQ7B 3E3TA 1IAUA 3LGTA 2W5EA 1GBCA 3QTOH 2NU2E 4I33A 1O0DH 3F9FA 4FUIA 2VU8E 4AB8A 2FI5E 1LO6A 2WPKS 1QA7A 1AQ7A 1EOJA 1G3CA 1P10A 2ZNKH 4Y8ZA 1O2UA 4NWLA 1GG6C 1EP6A 1XUGA 2ZTZA 4YM9A 4HFPB 3M5MA 2ZFPH 1GJ7B 1C1QA 3PLKA 4A92A 3TH4H 1PQ5A 2AMDA 3TITA 5FCRA 2SGDE 3P95A 3SV7A 3GCOA 4AYVB 1P8VC 1QNJA 3Q00A 4TYDA 3QLPH 1EAXA 2ZGBH 3QZRA 1GMCF 3TK9A 2GCTB 1GHBG 1QJ6B 5HXFA 1B0EA 1CVWH 4FUJA 3SJKA 1EB2A 4YO9A 2XC4A 2SGPE 4UFEH 1IQNA 8ESTE 3MI4A 1GDNA 2IOTA 5IDKA 4JYTA 2PW8H 4Q7YA 1GBDA 1EPTA 2A7CA 1C2JA 1GMDG 1QURH 1HAYB 3BEUA 1FAXA 2ZGCA 4UDWH 3UPEA 2GMTC 1IQIA 1LPKB 2QAAA 1FI8A 1A5GH 1TGCA 5JBAS 1A0LA 1HIAB 1W10U 2FOMB 3T26A 4GHQA 1FQ3A 3DFLA 4NIVA 1UMAH 1TALA 4BTUB 1N8OC 4ZXXH 1EJAA 1YCPK 1FY3A 3QX5H 5FX5A 1F0SA 2V3OH 1SOTA 2OCVB 3QWCH 1MZDA 1XUFA 2B7DH 1A61H 3R0FA 4KELA 3RC4A 2KAIB 3NZIA 3SGQE 1SGFA 1HAIH 1S85A 1XKBC 1LPZB 3F1SB 5JBTA 3SQEE 1GGDB 2PSYA 2EI7A 1WV7H 3SV9A 1LHEH 4WMFA 1TMUH 3A7XA 1BCUH 1W13U 1WQVH 2BD7A 4OGXA 2K1QA 1J15A 5DG6A 1C9TA 1BBRK 4UONA 2W7UA 1ANEA 3LONA 2O8MA 2QF3A 5K7RA 4Z0KA 1UJ1A 6LPRA 1K22H 5A0AE 1PJPA 5LPRA 1W8BH 4Q7ZA 1LPGB 2UUKB 5EOKA 4NA8A 1MD8A 1VZQH 2AFQB 4OS6A 4AFQA 1C5PA 4XFQA 1C5VA 2XBXA 3BTWE 4O3UA 1VGCB 3RMNH 4OS1A 1DWEH 2ZTYA 3PV4A 4K8YA 4J2YB 1ETTH 1MAXA 1E38B 1TLDA 4Y10E 3TNSA 1LHDH 1P12E 2P94A 1QBNA 4AFUA 5EPYA 4X2WA 1V2TT 2RDLA 2BDYA 2GP9B 4A5TS 3QK1A 1S6HA 3C1KA 1MKXK 2BX3A 1SGEE 1D3TB 1C5XB 3HKJB 3RXSA 4YZUA 2B9LA 8GCHF 4ABEA 3TJOA 3MU1A 1GBFA 3BIUH 2GV7A 4GPGA 2XBYA 3LGWA 2XYAA 2AIQA 4K1SA 1EZXC 3VGCC 1IQFA 3UFAA 1TNHA 1U6QA 1ZTLA 1C2LA 1H9HE 1RIWB 1VITG 1G2LA 1NRNH 1QA0A 2G55A 2CXVA 3NKKA 2PKSB 1TNJA 3A8BA 1O2ZA 1BRUP 3A7ZA 1UK3A 4TPIZ 1EKBB 2BQ6B 4DT7B 5AF9H 3M3SA 3SQHE 3Q77A 4VGCC 5E0GA 2VIDA 3LJOA 3SJ9A 1F2SE 4KTSA 1ZHRA 3K6YA 4BOHA 4Y0YE 3ZVBA 2BHGA 3K6ZA 1A4WH 5A8ZA 1ZSKA 3M7UA 5JYIA 1FY8E 3VB4A 1S5SA 1XKAC 4Y11E 4NZQA 5DJ7A 2RCEA 2O9QA 1O5GH 1ZPCA 1SGRE 1LCYA 4GCHF 5T3HA 1B0FA 1G37A 1H9LB 2O8TA 1QL9A 3SUEA 1A3BH 5I25A 2FMJA 1SQTA 1BOQA 3A88A 3BTKE 1CE5A 1ZPBA 3T25A 3M5NA 1EATA 3TH2H 3ZVDA 1FN6A 1EZUC 3AVZA 4I8KA 1CBWB 1FN8A 1Y3UA 1C2KA 4JZ1A 1GJAB 2JH5D 1DWBH 4ABAA 4WWYA 3A7VA 4WXVA 1KLTA 1YM0A 1BBRH 1HXEH 2ZGHA 2BLQA 1LDTT 6CHAC 1HAHH 1A2CH 1Y8TA 2JH0D 1DXPA 4NIWA 1UCYE 3RDZA 2A0QB 1M9UA 2BDCA 1T8OA 2B5TB 4QT8C 1MU8B 1GDQA 3MO6A 2ANKH 2FX4A 2W7SA 3M36A 3SGAE 1TNLA 1O5DH 3RXUA 4U32A 5SGAE 5DP4A 3PO1C 1GHYH 1HLTH 1LVOA 3F68H 3K9XB 4E05H 2F91A 1K9OE 4F4OC 2AEIH 1ZTJA 1BBRE 2A5AA 1Y5UT 4INLA 3LT3A 1MH0A 2QYIA 1YPMH 1KXEA 1K1MA 3SV8A 4LZ1H 3E0NB 1B5GH 2GV6A 1LVYA 1ESTA 3PTBA 2FOAA 3GY6A 4JZIA 1IQKA 2HPQH 3SI3H 4MPXA 2OBOA 1DUEA 3UOPA 2Q6FA 2ZCLP 4ABBA 2A4QA 2ZIQH 3ZVFA 2VH0A 5DP6A 1YLCA 1BJVA 1O3CA 2PLXA 2GVFA 3D65E 5JBCS 2ZHQH 2JETB 2AH4X 1GCDA 2V3HH 4Y7AA 1RGQA 3IWMA 1BA8B 5GDSH 2GZ8A 2IJOB 2VIQA 1YPJH 3RXEA 5FBIA 1O2WA 2J38A 2Q6GA 4X1PU 2HRVA 2PUQH 3MH5A 4FUDA 3I78A 2C8ZB 2VJ1A 4YESB 1TRNA 2A31A 1O2RA 1K1NA 5ESBA 3HKIB 3GISB 4D9QA 4VGCB 3GICB 1O2TA 1GL0E 1ZOMA 3RXQA 4LOYH 3EGKH 1SI5H 2ZU4A 3Q3YA 2BYAX 4NGAH 4BNRA 5A2MH 1BDAA 1BRAA 1C4Y2 3B8JA 4PROA 2GZ7A 2C8WB 3RMOH 4FU7A 3MU5A 1MKWH 4U01A 1AB9B 2ZWLH 3O8CA 3LJJA 1O2IA 3RXAA 3VGCB 2D2DA 2ZQ1A 1O2PA 1SR5C 2H6MA 2BD8A 3SZNA 4CH2B 2R0LA 2H9TH 4FUCA 1AZZA 1GVLA 2ZCHP 4NWKA 2A7JA 4KTCA 1ELBA 1G32B 4FVDA 1TX6A 3V3MA 1V2NT 2HVXA 3BG4C 2DE9A 1SSXA 4Y71A 3T5FH 3F6UH 1S6FA 1Z8GA 2FOHA 1IHTH 1MKWK 5FPTA 5LPEA 3N7OA 1O36A 2C8XB 3ZZ8A 1NT1A 3Q3KA 2VGCB 2BZ6H 6GCHG 1KSNA 1NS3A 4FUBA 1W0YH 1T8LA 2GGVB 2Q6DA 4ZROA 1MTVA 2BB4A 1YPHC 1SGTA 2THFB 1D3QB 1D6WA 1PQ8A 1E0FD 2XXLA 2Y81A 3E0PB 1GHXH 2PGQB 1A1RA 3EQ0H 1L4DA 3V0XA 1CHOF 1WTHD 2GZ9A 2NU0E 1H9IE 3UREA 1PQAA 4XBDA 3PWCA 2ZDLA 1NFYA 4K2YA 4DW2U 2I6QA 5J4QA 1ELCA 1GGDC 4NZLA 3DHKH 4Q7XA 1ZYOA 3QO6A 4K1TA 1OP8A 3D23A 2FO9A 4WF8A 1NFUA 1XMNB 3A83A 3S9AA 3U9AH 1E36B 2UUFB 1O5BB 1AN1E 3E6PH 3T2NA 4I8HA 4E06H 1IQLA 2BVRH 2ESTE 1A7SA 3A80A 5TCCA 1YPHE 1PFXC 1FY1A 1HAGE 1RTFB 5FXLA 4RKOB 1Y59T 1EUFA 4WXIA 1C5YB 1YLDA 1G36A 1TA6A 3RXTA 5LH8A 1C2GA 1SVPA 4NA9H 3TGIE 1MAYA 2FOBA 1C2IA 1D4PB 1WAYB 4JZFH 3QZQA 3RUOA 4MPUA 5A0CA 4DVAU 1V3XA 5JBBS 1BTHH 4O03A 2WPHS 2NWNA 2ZFRH 1TPAE 1OWHA 1F5KU 3ZZAA 1PPFE 3LH1A 3MNCA 3TU7H 2FYQA 2P3UB 4UE7H 1BJUA 1C5WB 3ENSB 3OU0A 2A1DB 1UTJA 1ZGIA 1ZMJA 1OOKB 1PPEE 2V35A 2OQ5A 2BD9A 5AFYH 3UR9A 1KXDA 3BTME 5C5NA 1AMHA 4IS5A 4ZKNU 3TJNA 3KF2A 4ISIH 2OQUA 1GPZA 2RA3A 4J1YA 3BTTE 3O8RA 3SU1A 1W2KH 1WYKA 2CHAB 1O3BA 3T28A 4FU8A 1GI1A 2TGTA 5T6DA 5FBEA 4GVUA 4SGAE 2G4TA 3GY2A 3URCA 4JYVH 3M3TA 2WINI 1T4UH 3ZVEA 4K60A 3U8OH 2R2MB 3T62A 4WJG2 3BSQA 2QXJA 5GXPA 1AZ8A 1VJ9U 4AN7A 3QUMP 1GHBF 5EW2H 1C1WH 1V2ST 3MU0A 5JDUB 1Z7KA 8KME2 3MTYA 4CRFA 3LGVA 4NA7A 3PO1B 3SJ8A 2XCFA 1Z1JA 4MNYA 4YLUA 1BRCE 3DA9B 4BTIB 4TPYA 2YNAA 4WH6A 4ISOA 1LQEA 1PYTC 1BT7A 3TNTA 1AFQB 1C5QA 1V2PT 1GJ5H 2XC0A 3SV2H 3L3TA 1YPGH 1LHGH 2BDHA 2A2QH 3OY5U 1AIXH 1WQSA 1TWXB 1OS8A 1K1IA 4CBNA 1SB1H 3T27A 1JMOH 4XBCA 1O5AB 2TGPZ 1C9PA 1CA0B 1O2GH 3E1XB 4IN2A 2C93B 3VXEH 1HAPH 3MWIU 4YLQH 1T7CA 2Y5GA 2Z3CA 3A7YA 3RXOA 1AE8H 2WPIS 1Z1IA 2VVCA 1NC6A 1RFNA 4U2WA 4Y6DA 4XBBA 2OINA 4ZHMU 2ZFSA 5FPYA 1CT0E 2F9NA 1ZJKA 3ZVAA 1TX7A 2P93A 5CMXH 4DG4A 1OXGA 3PMJA 3SGBE 2EI6A 2VINA 5FPSA 1OP2A 3MO3A 3URDA 3F9HA 2FM2A 4Q80A 3M35A 2ANWA 2FESH 2R3UA 3RXDA 1MU6B 4MVNA 5IYTA 1GG6B 3MHWU 4I8GA 4ABDA 1O34A 1CO7E 1SGCA 2ALPA 1OWIA 2J95A 3ZYEA 1UTNA 1GJDB 3A84A 4RSPA 1GHAF 1K28D 1GBAA 3PM3A 4OS7A 4CRDA 2GDEH 2FS8A 4ZHLU 1O3FA 1Q2WA 1CT4E 1MUEB 2PKSC 1NRRH 1YYY1 5CHAC 3UWIA 2F9BH 2G8TA 1X7AC 4ZMAH 5K0HA 1RIWC 4WVPE 2SNVA 1DY8A 3M61U 2QXGA 2FX6A 1TGNA 3GDUA 3SHAH 1GI9B 1KXCA 3GOVB 2ZDKA 1H8DH 1C5NH 7KMEH 1C1RA 1OKXA 3SHCH 1XXFA 3GYMA 2SGQE 1EZQA 1O3AA 3SUFA 3E8LA 3ATWA 2O8LA 1LTOA 1DT2A 3STJA 3RC6A 5T6GA 3LGUA 5A0BA 5LPFA 4X2VA 2P8OC 4CR9A 1HPGA 4AG1A 5LGOA 4CHAB 2FI4E 1C2FA 3FZDA 2G4UA 3RXRA 3P6ZB 7GCHG 1H1BA 1OYTH 2ZDNA 1GBBA 4IC5A 2A5KA 4IBLH 5F03A 1SHYA 1CSOE 2ZEBA 4WMDA 5DKMA 3M5LA 1QB1A 1KY9A 4JK6A 4NFEA 3SU4A 1RXPA 3GY8A 4B2BA 3BG8A 3R3GB 3UWJH 1TOCB 3SJOA 4DURA 2HNTE