1QRZA

Catalytic domain of plasminogen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYMVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVLRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the proenzyme domain of plasminogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PLASMINOGEN
total genus 51
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA01
1SOZA 1ZYOA 3QK1A 4D8NA 1P03A 1SHYA 4Y79A 2J4IA 1C5YB 1MQ6A 1NZQH 3E1XB 1GG6B 1UHBA 3LJOA 3QDZB 1PPEE 1YCPM 1NFYA 1NU9A 4TPYA 2V0BA 3GCTF 2NU3E 1GMCF 2VIWA 2J92A 1XUIA 1XM1A 2BB4A 1E38B 1ZRKA 3KGPA 1L4ZA 2FYRA 1SI5H 2VVUA 1S0RA 5K0HA 1T4UH 4B73A 3I77A 1G3DA 3MYWA 1GMHF 3ZV9A 1AB9B 1FY1A 3SI4H 1Z8RA 3UOUA 1NC6A 3ZZ8A 1SGIB 2WYGA 1C2FA 3T62A 2HOBA 1O3FA 2OD3B 1C2LA 1DOJA 1JXPA 2ANWA 2XTTB 5F03A 1SB1H 2VWNA 1MKWH 1BTXA 2TGTA 1UTMA 3UQOA 2TGPZ 4I8KA 1GHAF 1FY5A 3FP8E 3UQVA 5DP6A 3RXGA 1WQVH 3BTDE 1DSUA 1O2PA 2H2ZA 3SJ8A 1YPHC 4DIHH 3BF6H 4BAOB 3BSQA 1MTSA 2NU0E 4X1SU 2PLXA 2PGBB 4OGXA 2Y80A 2VB0A 1LPZB 1LKBA 1QJ6B 5C3NA 1O3EA 1ZSLA 3ZZ4A 1KYNA 2QA9E 1ANEA 1YC0A 3GY4A 5FPSA 3SO3A 4Q7XA 2VIOA 3RXVA 3NUMA 2THFB 1GBAA 6CHAC 4JZFH 2ZDNA 3SQEE 1ZOMA 4NGAH 4B2CA 3SU5A 2H5CA 3HGPA 3U69H 3ZZ7A 5FBIA 4E7RG 2FPZA 6ESTA 2O8WA 1SOTA 3UPEA 3MH4A 1Z6JH 1DICA 3MTYA 3Q3XA 1G2LA 2D1JA 1FPCH 1K22H 2ZDAH 1Z8JB 2TRMA 3M3VA 3Q76A 2AIQA 4Y71A 5GDSH 1QRXA 2AMPA 3ZVGA 2SNVA 5I46H 2O8MA 2H5DA 1S85A 2ZTXA 4I31A 1RTFB 1A7SA 1V2QT 1C2DA 1P12E 1O2TA 1PFXC 2H9TH 4DVAU 5BRRE 5GWZA 3NXPA 4UFEH 1VCPA 1VGCC 3MI4A 4HZHA 1VR1H 3RXBA 3RXFA 1EKBB 4MPVA 5FHTA 1P2JA 2ZP0H 4ISNA 1V2VT 1A5IA 1LHFH 3RP2A 1TGCA 2VINA 3AAUA 3K65B 1FQ3A 2WV4A 1S84A 4BXWA 1QB1A 2TGAA 5DKMA 3VXFH 3KN2A 4XFQA 2Z6BD 2FI3E 3ZVCA 4LXBH 3TITA 1OXGA 2FP7B 1O3PB 1O2VA 1RTKA 4Y7BA 2AGEX 3FP7E 4BAQB 1KLIH 2D26C 1C5MD 2AH4X 1P10A 2TBSA 4AX9H 1BA8B 1GBFA 1BHXF 3V12A 4M7GA 1YPGH 1K9OE 2W5EA 3ATKA 2PV9B 1GDUA 2HPQH 4Y7AA 5JPMH 4AYYB 1O33A 1UVUH 4DW2U 4CBOA 1B0EA 2PTNA 4TYDA 2ZIQH 3RXLA 1SL3A 5JBTA 3VXEH 3LH1A 2XBXA 3PWBA 1C5UA 1ZTKA 4KELA 4CHAB 3BEIB 3LONA 1BJVA 2OC1A 4KTCA 1MUEB 8LPRA 2BXTH 4AN7A 8GCHF 1TBQH 1ZSKA 1FZZA 3SU6A 1EP5A 4TWWA 1ETRH 2BM2A 3DUXH 4F49A 2F9VA 5DGJA 4JZDH 1XKBC 5F6MA 3S9CA 1C5NH 1T4VH 2ZU4A 1J8AA 4NG9H 3TU7H 1DITH 4JZEH 2O9QA 9ESTA 1O30A 2SNWA 4ZHLU 1AGJA 2PW8H 1C1NA 1OWKA 3VGCB 3HGNA 5HM9A 1THRH 2R2WU 1Z71A 4IMZA 4A1TA 2FWWA 3STJA 2PGQB 3RXSA 2A4OA 2AEIH 4O03A 1TGTA 3PV4A 1BT7A 1TMUH 1WOFA 2PKSB 4ABHA 4MNVA 5LPFA 4ZROA 4BAMB 1BOQA 3PO1B 2IJOB 4Y0ZE 3I78A 1GDQA 2BLQA 2RA0A 1GHBG 5ETXA 1ZJDA 1YLDA 4AYVB 2W7UA 1F2SE 4INHA 4NIYA 1Y3VA 1F0SA 2RCEA 2ZDVH 3QX5H 3UWJH 3M3SA 1C9PA 3F9FA 1XX9A 4XBCA 1UVSH 2QF3A 2ULLA 1TFXA 2DE9A 1P2KA 2QXIA 1TNJA 1V2OT 3EAJA 3RXMA 1QIXB 4IGDA 1QRWA 1YP9A 1ESTA 4AZ2B 2OLGA 1QGFA 1V2ST 4HTCH 1GJ4H 4TWYA 1V2KT 1TNLA 1CO7E 4ZH8A 3GY8A 1HXFH 1ACBE 1ZLRA 2BD4A 1GGDC 3E16B 1HAVA 1CA0C 1H8DH 1OWHA 1MBQA 2J34A 1GBMA 3NZIA 4R8TB 4XDEA 4XSKU 1MU8B 3VEQB 3O8BA 5ESTE 5EXMA 1ANDA 4IBLH 3A81A 5I25A 1EB2A 1OOKB 1TGSZ 2QCYA 2AS9A 2R2MB 3GY2A 1LMWB 1ZTJA 4DGJA 3MH5A 2WPKS 1O3LA 1YPKH 2BLWA 4Q80A 3KL6A 2ZDKA 2GMTB 5EXNA 2KAIB 1RTLA 2Z94A 3ZZ9A 1O5FH 4JK5A 5PTPA 5CHAB 2Y6TA 1YKTA 3PM3A 4DOQA 3M5MA 1EZQA 1LTOA 1D4PB 2WPJS 3NKKA 4JK6A 2H9EH 1A61H 1CHGA 5FPYA 1G9IE 2SGAA 1SGFG 2GX4A 3GY5A 4HGCA 1C5OH 3TH3H 1UVOA 2STBE 2ZU5A 5LH8A 4J2YB 1O2ZA 4ZHMU 3MFJA 2HALA 4CBNA 2ZECA 3GCHB 9LPRA 5HXFA 2Z9IA 2A7CA 1GL0E 1EATA 1VITH 3EA7A 4X6PA 4AB9A 3LGYA 3M7QA 1BCUH 1GMDF 3UTUH 1D9IA 1LVOA 2HGTH 4X2YA 5HM2A 5AHGH 2OINA 2OTVA 4INLA 1P05A 3ZZ6A 1G32B 4FUCA 1SSXA 1TQ0B 2BTCE 1O2RA 1EJMA 3LOXA 1PYTC 1A0JA 3RXUA 3SZNA 2PWXA 1UTKA 5LPEA 2CN0H 1UTQA 2FIRH 1UTJA 1J17T 1Z1IA 3M35A 2XCNA 3FP6E 1ELCA 3RMLH 4CRBA 4Y0YE 1O3MA 2TGDA 1PPZA 1K1IA 3BTGE 3RM2H 1AWFH 1VITG 2CHAB 2OUAA 3E91A 4B71A 2FI5E 4THNH 3S9BA 4D9RA 2DUCA 1CSOE 5JBBS 1QFKH 4MNWA 3ZZAA 2XC4A 2ZGBH 1C1QA 2GT7A 2A2XH 4CHAC 4B74A 4ZUHA 1QB6A 2QXJA 1ZR0A 3M61U 1SGEE 3N7OA 1G30B 2G52A 3SV7A 5GXPA 5J4SA 2JH6D 1MMJN 4NIVA 2QF0A 4ZXXH 1GWAA 1G3CA 3SORA 3PLPA 3SUFA 1O2SA 1JMOH 3NWUA 1BTWA 1GCTB 3RXTA 1E0FD 1PPCE 3DFJA 3HATH 4DG4A 4A1VA 3SNCA 1NPMA 3EQ0H 1ZTLA 1T32A 2R9PA 2WINI 1OWDA 3HK6B 2HNTC 5EW1H 1ABIH 1GMCG 1TALA 2Z3EA 1AVWA 3ZV8A 3F9EA 3G01A 1S6HA 5LPRA 7GCHG 1DLEA 3UY9A 1AQ7A 3HKJB 2WYJA 1XXFA 1GJAB 1OWEA 3VFEA 1EZSC 1W2KH 4I8HA 3ZZ3A 5DK1A 4TY7A 4OGYA 1LHGH 3JZ1B 1F0TA 1DSTA 2PFEA 4I7YH 1VGCB 1O5GH 3MU0A 3SJKA 1C5PA 1NN6A 3ATWA 3AAVA 3C1KA 3MNCA 2FOGA 2GCHF 2GTBA 1D6RA 1UVPA 3E0PB 3SGQE 4AORA 3R3GB 2XWBI 4B76A 1DWDH 4ZKRU 1MTNB 1P11E 2SFAA 1GHAG 2ZTZA 1C1UH 1ELBA 3KQBA 4FUEA 4O97A 2STAE 2YOLA 1KXAA 1UCYK 3H7OA 2NWNA 1BBRK 4NA9H 2ZGHA 3MU8A 1DPOA 2A4RA 4CR5A 1SBWA 2V6NA 4K8BA 2FLBH 3SNEA 2GD4B 2A45B 2D2DA 4IN2A 4IW4E 1NFUA 3O8DA 4MTBA 2BX4A 2VWMA 2W26A 4AGJA 3SV9A 2FMJA 4ASHA 4CRGA 2P95A 3BTQE 2EC9H 1P0SH 1EQ9A 2BVRH 2VWOA 1S6FA 2ZHWH 4WF8A 5C1YA 2PTCE 1N8OB 3SJIA 1TPSA 3TK6A 1KLTA 3O8CA 2ZI2H 3FAOA 1LVBA 2BY7X 2XWAA 1TA6A 4BTUB 4AOQA 1HAVB 2GVFA 5EG4A 2FOHA 3RMNH 1J15A 1O2UA 1TWXB 1ZJKA 2VVCA 2P94A 3ZVDA 3Q3KA 4GPGA 3ESTA 1O35A 2XRCA 4F4OC 3PB1E 1Q2WA 3LGIA 1BTZA 3SU3A 2B8OH 5E0JA 2A4QA 2QXHA 2UWPA 1LHEH 1EAIA 2B9LA 1GJ7B 1AVXA 3KQDA 4AGKA 4H4FA 1P06A 2JETB 1C1SA 1WYKA 2ASUB 2QXGA 3DFLA 1EZXC 2JETC 4NIWA 3ZVFA 2ZGCA 4RSPA 4FUBA 3U8TH 1HAGE 2BVSH 4LK4A 2VNTA 3P6ZB 4B1TA 1MTUA 3MH6A 3RXQA 2Y81A 2YNBA 2PR3A 1CGHA 1QTFA 2OC0A 1WTGH 1OSSA 1QL8A 1TPPA 1HAPH 1MTVA 1L1JA 2A2QH 4X8UH 1A5HA 1BTYA 5JBAS 1BMMH 1QQ4A 3ZZDA 3LKWA 1XMNB 2EI7A 1EASA 2VIQA 5TCCA 3TLOA 2JH0D 1P2OA 3P8GA 2C93B 1GPZA 2Q6FA 3A84A 3UNSA 1AO5A 1GCTC 4KKDA 3KF2A 1D6WA 4ABJA 1ELTA 1O3OA 4NWKA 1C2GA 1C4U2 3NK8A 3ATLA 3H5CB 4FVDA 4IC6A 5E8EH 3TH4H 2BDGA 2BVXH 4LZ1H 4D7FA 1SPJA 2UUFB 4KP0A 2OQ5A 3A8CA 3SI3H 3GDUA 4UFFH 1OP0A 4Y76A 2VGCC 3A7WA 1HAIH 2VJ1A 3P8FA 1PPFE 2Q6DA 1A0LA 1HAYB 3D23A 4FUDA 3T5FH 3CS7A 4TPIZ 1F7ZA 3HPTB 3QO6A 2F3CE 5JBCS 1XUGA 3LT3A 5FXLA 1MU6B 3OY5U 5E0GA 5K7RA 2H6MA 4X2XA 1MAXA 1ARCA 3V7TA 3TJNA 1FN8A 2A31A 1GVLA 3AW0A 2VWLA 1TGNA 2ALPA 3RC6A 1GJDB 3RXJA 7KMEH 2GV7A 2UUKB 3BTHE 3KCGH 4R0IA 1C1TA 1D3QB 1GI7B 2BD8A 1TQ7B 3A89A 5T6GA 2PSXA 3K9XB 4DIIH 2R0LA 1S0QA 5T6FA 2O8TA 1C2EA 1LVYA 2GV6A 4FU8A 4ABEA 1ZGIA 3OU0A 1YPMH 3GOVB 3SNDA 4OS6A 2ZQ1A 3BN9A 2A32A 3U8OH 3Q77A 1P04A 2ZFRH 2A1DB 1C9TA 3LC5A 3MNSA 1EJNA 1IQGA 1C1WH 4UEHH 5J4QA 1SGPE 4MNYA 2OBQA 3SOSA 2FM2A 3A7VA 1P02A 2F9BH 4MPUA 2AGGX 1RIWC 2PKAB 1IQJA 5JB9S 3QZRA 5GCHF 1P9SA 1FONA 5JB8S 1DVAH 1TNIA 1D3DB 5TJXA 4Z6AH 1H1BA 2ANYA 1GVKB 4MPWA 3VGCC 3M37A 3M5OA 1U6QA 2PSYA 4YO9A 1ZMJA 3MU1A 4JZIA 2AGIX 3VB6A 1DX5M 1K1PA 3U9AH 2FOEA 2ZG0H 1TBRH 2A7HA 1T8NA 3GICB 3ZVBA 1A3EH 1VCQA 5FCRA 1DUEA 3GY6A 5B6OA 1H9HE 3RMOH 1SHHB 1GI9B 3AASA 2ZU2A 1SLVB 1DM4B 1NRNH 3T2NA 2VU8E 1LCYA 3M7UA 1UK3A 1JOUB 4MDSA 1EUFA 1H9IE 1CBWB 1DWEH 2ILNA 1VITF 2ZPQA 2Y7ZA 1QQUA 1TRYA 2ZTYA 2FODA 1UJ1A 4A92A 4B75A 1C2HA 1AN1E 1O3IA 2XXLA 1K1NA 1GBIA 1PQ5A 3U8RH 3PWCA 2AIPA 4ZXYH 1AB9C 2W3KA 1O2OA 2P3UB 1AU8A 1O34A 3KQEA 1IQHA 4A1XA 3TGKE 3T29A 5FX5A 1J9CH 4MNXA 1KLJH 2SGFE 1A5GH 1IQLA 3EDXB 3UOPA 1FIZA 3SQHE 1ABJH 1N6YA 3T27A 4ZKNU 2ODYB 2F83A 1GI4A 2FX4A 1ZSJA 5A2MH 1P2QA 1PQ7A 1TPOA 2J9NA 2ZZUH 1FDPA 4K3JA 1HBTH 1Y5AT 2BQ7B 4HI3A 3ZYDA 4FU9A 1G37A 3L33A 3GYLB 2UUJB 1AHTH 2BZAA 3RXIA 3BIVH 1CT4E 4ZMAH 2ZGXH 3OY6U 1Y3XA 2C8XB 1B0FA 1TRNA 1YPLH 1O3HA 2FDAA 3A8BA 1GI1A 3SUEA 1SGQE 3E0NB 1UTPA 1O5DH 1IQMA 3LC3A 2OC7A 3BEUA 3RXAA 1KSNA 2XCFA 6CHAB 1TX6A 5DPAA 5DP8A 2BOKA 1GBBA 1RGQA 1EOJA 1S82A 3LGWA 1THPB 3SV8A 1O38A 4X1PU 4WXVA 1GI3A 4ABFA 1TONA 2LPRA 8KME2 2GDEH 5EXLA 5CHAC 2QGRA 2FXRA 5EU8A 3A85A 5JDUB 1ZHPA 1WV7H 1XUJA 1O2NA 1BRUP 4X1QU 1GGDB 1THSH 2HWLB 1TBZH 2OCVB 4Q2KA 1QNJA 1ELVA 1L2EA 4YOJA 3GDVA 4Y8XA 1AIXH 5A09A 5TCAA 1SQOA 2P8OB 3P95A 1KXDA 1TB6H 5GPIB 2NU1E 4X6MA 1FLEE 1CHOF 1KTTB 1O3DA 1IQKA 1L4DA 1FN6A 4AFQA 1TIOA 2ANMH 3FANA 1PQ8A 2Z9KA 3VB4A 1L1GA 4IS5A 4ABDA 1AVGH 3WY8A 1Y3WA 2ZHEH 3RU4E 3CP7A 3NCLA 4RN6A 1DXWA 2ZNKH 2Y7XA 1W11U 1BHXB 4AB8A 2ZCLP 2A7JA 2FOFA 3E6PH 1ELEE 2QIQA 1QL9A 1IQFA 2F9NA 2QC2A 5DP3A 1ELAA 4X8VH 4BNRA 2A0QB 1O0DH 2CMYA 2QN5T 4ABAA 1O5CB 3IG6B 4MLFB 3KNXA 1Q31A 3SUGA 1BB0B 5T3HA 1HIAB 1NFXA 1YYY1 3T25A 1PQAA 3MO3A 3ZVAA 2ZPSA 4K69A 3A83A 3F9HA 4X0WU 1CVWH 5SGAE 1O2QA 3ZVEA 2AMQA 3L6PA 1IQIA 2SGDE 1EAUA 3RXKA 1XVMA 1LVMA 5GIBA 1O3GA 4I8LA 3SJOA 5ABWA 1Y5UT 1SC8U 3ENSB 3U1IB 4UDWH 1MZDA 1YF4A 3SUDA 2ZWLH 1BIOA 1DY9A 1T8LA 5A0BA 1O5AB 4YLUA 5CE1A 1MH0A 5HGGA 1G36A 4A5TS 2FOCA 1P2IA 1XUKA 1W14U 1P9UA 1OWJA 3B8JA 3RU4D 3OYPA 4FUFA 4K1TA 1O2HA 2CHAC 4ABIA 1GBCA 3A87A 2UWOA 3LH3A 1C5SA 1SGFA 1F92A 3MOCA 2ZEBA 2B7DH 1C1OA 3GCTG 1ESAA 1TX8A 1C5RA 1NESE 2WV5A 2PHBA 3UREA 1C5XB 5L6NH 1LDTT 1O2JA 2OQUA 3EE0B 3V13A 1J16A 4YOIA 2ZU3A 3TGIE 5C20A 2Y5GA 2P16A 3TJOA 1Q3XA 5A8YA 3SGAE 2ZHDA 4K60A 1BUIA 4NZQA 2VVVA 1GI5A 4J1YA 1NM6A 2FYQA 1VCWA 3UR9A 3MWIU 2Z3DA 1JIRA 2Q1JA 5EPNA 1GBTA 3W95A 1O2LA 4RKOB 2LNCA 1BDAA 5DP5A 1O3BA 3A7ZA 1O2GH 4JZ1A 1GI6A 1VJ9U 4U01A 2BDIA 4BTIB 1C2JA 3ITIA 4ZHAA 4WWYA 1HV7A 3MO6A 4ISIH 3VPKA 3GCHC 1QL7A 3RC5A 2XC0A 3BEFB 1GBKA 2FS9A 2I6QA 2BX3A 2ODPA 1TOMH 4FU7A 1XXDA 5H4IB 2BDAA 1SG8B 2ZCKP 4XBDA 1TABE 1HJAC 4ABBA 4WJG2 1H8IH 4JYUH 2BMGB 3EGKH 2ZHFH 2OC8A 1HJAB 1ANBA 1K21H 1QCPA 4WMFA 4PROA 2PKSC 1DFPA 3LPRA 2BQ6B 4I33A 1X7AC 2V35A 1G3EA 1K1JA 3QTVH 3T28A 3QZQA 1S81A 2DE8A 2ODQA 1NRRH 3PMHB 2ZA5A 1HB0B 2K1QA 1E36B 3P92A 5C67A 1C5VA 3RXEA 1MD8A 1DWCH 1C1MA 5FCKA 1RXPA 1KIGH 3ZZBA 6LPRA 4CR9A 2Y5HA 4AFSA 5C5NA 3A8DA 5EOKA 2IPHA 3MU4A 3SV6A 1MKXK 1V2LT 1EOLA 3QWCH 3W94A 2XBYA 4CREA 1W0ZU 1ELDE 1LQDB 2CF9H 1AI8H 3PMAB 2HLCA 3GISB 4NFFA 4TY6A 1B7XB 1YPJH 3SBKA 2FS8A 4K1SA 1MBMA 1FNIA 2FI4E 4MVNA 4O3TA 1Z8GA 2BHGA 1N8OC 1GHWH 4AFUA 4O9VA 3PTBA 2FOBA 5F8ZA 2ZQ2A 1FY3A 3E90B 2Z9LA 3SNBA 1E34B 3D65E 2Z9GA 3BG8A 1D3PB 5T6DA 4CRFA 4ISOA 4JYTA 3UUZA 2A5AA 1O3CA 2GT8A 1OKXA 3BTME 3RM0H 1PPHE 3KQCA 1CGJE 2P93A 2J95A 1WAYB 1AKSA 3V0XA 3M3TA 3F9GA 2VH6A 3F1SB 4IC5A 1V2WT 3BG4B 4WMEA 1GBHA 1QJ1B 4ISLA 3GDSA 2VIVA 1EZUC 1K28D 3VB5A 2ESTE 3DA9B 1E35B 7ESTE 4KTUA 4UD9H 1YGCH 1BMAA 5C1XA 3TK9A 1GI8B 2P59A 3LJJA 2O8LA 4BOHA 1F5LA 3UNRA 3ATIA 3M7TA 1Y8TA 2ZFQH 1SGNE 3E8LA 3A80A 1NFWA 2B5TB 2BDCA 2I6SA 5ESBA 4DJZB 2Z7FE 5L2YH 2ZFFH 1RRKA 1TRMA 2BY6X 2J2UA 5DP7A 2IOTA 3RUOA 2GMTC 4DY7B 1TGBA 2GCHG 1UK4A 1C5WB 1HRTH 1W7XH 4GLYA 2R0KA 3S0NA 1SFQB 4K2YA 2WPHS 2V3OH 2OXSA 1SMFE 3HKIB 2F9PA 1CHOG 4UFGH 3GCOA 1KDQA 3MO9A 2G81E 3RXHA 1GJBB 2FX6A 3TGJE 3M5LA 4JYVH 1INCA 5A8ZA 2NU2E 3UR6A 1GI0A 1MTWA 2AMDA 3TPIZ 3UIRA 8ESTE 4I32A 3LDXH 4A7IB 3BG4C 3SU0A 1FV9A 2GZ7A 4CRCA 1QBVH 1UCYH 1OPHB 1J14A 1FUJA 2ZFSA 1GVZA 4A6LA 4JCNA 1IHTH 4IMQA 1LPKB 2QYIA 3RXPA 1RJXB 3FVFB 1OP8A 4HFPB 1SGCA 4GCHF 1F5RA 3FFGA 1V2UT 4X1RU 1NTPA 2P3TB 4AG2A 1GL1A 2ZHQH 4U32A 1GJ5H 5FBEA 3CS0A 5A8XA 2CXVA 4XE4A 2BY8X 5G4BA 5DP9A 3SW2B 3KHVA 6GCHG 3CENA 1BTUA 3GY3A 1LHCH 4X8TH 1A3BH 3DHKH 4FUGA 1ZMNA 2W3IA 2ZC9H 2Z9JA 2R3UA 1MKWK 5L30H 2G55A 3O8RA 2NU4E 4H6TA 5LGOA 3B23B 3TK5A 1DUAA 1ESBA 1O36A 4ZKOU 1A1RA 2GP9B 2ZGJA 3S7KB 4ESTE 1HFDA 2RDLA 1GMHG 1NO9H 3NPSA 1UO6A 3TIUA 1KDQB 5DJ7A 5CMXH 1H4WA 4FUIA 3PO1C 1T8OA 2WPLS 3DD2H 1ZMLA 2WUBA 1QB9A 1DDJA 1ELFA 1EPTC 1RIWB 3TVJB 4GCHG 1FIWA 1AFQC 3A7TA 5AVDA 1JWTA 1TX7A 1C1PA 1WTHD 2GKVE 1ZZZA 3LU9B 3SU4A 1IQEA 3UNQA 1BRAA 1GHZA 1Z7KA 2C8YB 3H7TA 4O3UA 1ORFA 4Q7YA 1GHVH 4INKA 1OYQA 4YTAA 1V2PT 2JKHA 3AW1A 1MAYA 1UTNA 2WPIS 2SGEE 1XKAC 1O2WA 1O3NA 1ETSH 1GBLA 2J38A 3PLKA 2TIOA 1O5EH 2BDYA 3QUMP 4YM9A 3M36A 4WMDA 2G5VA 1DWBH 3MHWU 4DT7B 1O3KA 3A88A 1P2NA 3UFAA 3U1JB 1DLKB 1AFEH 1O37A 2BD5A 2PKAA 1MCVA 1YCPK 1Y5BT 1CBWC 3SV2H 1C1RA 3F6UH 4OS1A 4CH8B 1QY6A 2G4UA 3L3TA 1S83A 2V3HH 1ZHMA 1YPEH 5FX6A 4BANB 1HAXB 1CE5A 1NRPH 4Y8YA 8GCHG 2GZ9A 5C1UA 1AKSB 2P3FH 4VGCC 2WPMS 4X1NU 4WVPE 1BBRH 3IITA 1FAKH 2BD9A 4Y11E 1P01A 4DCDA 1EJAA 3E3TA 1SFIA 1C1VH 2ZCHP 1HAZB 4AFZA 3TNTA 1V2TT 4WH8A 2HVXA 3Q3YA 2FTMA 1KY9A 1SQTA 1QA0A 1V6DA 3A82A 3P8OA 1TA2A 4NSYA 3A8AA 4FXGH 1HXEH 4K1EA 2A5KA 1PPGE 2G00A 4JMYA 1WQSA 5E2PA 5GCHG 1H9LB 3KEEA 1AZZA 1LHDH 2ZDMA 1E37B 1HGTH 3D62A 1NT1A 3T26A 3LGTA 4QT8C 4NFEA 3RU4T 4UFDH 2GGVB 1FY8E 2BDHA 3BTTE 1TLDA 1UTOA 1RFNA 3JZ2B 1UCYE 1AFQB 1BMNH 4ZAEA 5IYTA 5EQQA 1KXCA 1OS8A 3LGVA 4FVBA 4SGAE 1W12U 1K1MA 2ZO3H 3PMBB 2AFQB 3V3MA 1Z6EA 4MQAA 1RD3B 2F91A 1WU1A 3QGJA 4BTTB 1O2YA 1YPHE 5A0AE 2BDBA 4GSOA 2BQWB 1MCTA 1Y59T 5EW2H 1ANCA 3AVZA 4SGBE 4YT7H 3Q00A 5FAHA 3ATMA 4MPXA 1GBJA 2QY0B 1AE5A 4D9QA 1SGYE 3P70B 1A46H 3K6ZA 3MNBA 4LOYH 1JRSA 1PJPA 2Z3CA 2BY9X 2BXUH 1HDTH 3TJVA 2PUXB 1QURH 3PYHA 2FEQH 1OP2A 1V2RT 1GHXH 5HYOA 1PPBH 1C2MA 3BIUH 4I8JA 5AF9H 3QGNB 1SLWB 2F9OA 3EYDA 5EQSA 1BMLA 1HAHH 1EAWA 5DP4A 1MD7A 4Q7ZA 1IOEA 3GYMA 3B9FH 1O2KA 2BZ6H 2FOMB 4NA7A 1BBRE 2BY5X 1CU1A 1GCDA 3S7HB 3RXDA 1FY4A 4CH2B 3ODFA 1TAWA 1DXPA 2G4TA 1FPHH 1C5ZB 1DT2A 3DT0H 1RS0A 3PTNA 3VB3A 4IN1A 3ZZCA 1HYLA 1MKXH 2ZFTA 2CV3A 3K2UA 3URCA 1BTHH 5E0HA 3TJUA 1TMBH 3FZDA 4GAWA 1KXEA 1N1LA 4GHTA 2G8TA 3BTWE 2ZPRA 3QLPH 1A2CH 3LIWA 1EP6A 6GCHF 2VIPA 1Y3UA 1O3JA 1HCGA 2FOAA 2GZ8A 3SHAH 1O2XA 2C90B 2OBOA 7LPRA 1Y3YA 1ID5H 1QBOA 2HRVA 1BRCE 1FXYA 1HPGA 1BQYA 1XUFA 1TPAE 1FAXA 4FUHA 2C4FH 2UWLA 5IDKA 5EGMA 1C4Y2 3M5NA 2C8WB 1UMAH 1T31A 1CA8B 2EEKA 3A7XA 4K5ZA 2BD3A 1CT0E 1SGTA 1SVPA 4E06H 3SGBE 1TMTH 2HPPH 1NRQH 2BLOA 2CJIA 1VJAU 1AD8H 3R0FA 1L1NA 1C2KA 1YCPH 2JH5D 1TNGA 5F8TA 1AY6H 1F0RA 5AFZH 2D8WA 1GHYH 4XBBA 2ZF0H 4UONA 4LZ4B 3SU1A 1IQNA 1W0YH 5FPTA 1IHSH 2ALVA 4YOGA 1Z1JA 1CGIE 1P3CA 1C4V2 2IN2A 2FTLE 4U30A 2AERH 4CRDA 3FZZA 1GJ6A 1EAXA 3I29A 1O2MA 2XBWA 3QN7A 4OS5A 1D3TB 2P8OC 1C5LH 2GDDA 1HUTH 4KGAA 3A86A 3F68H 1SLUB 2H9HA 2Q6GA 5A0CA 1P8VC 3A7YA 3RLWH 1W8BH 2R3YA 4Y6DA 4K8YA 4CRAA 3MH7A 1TOCB 4BXSA 4YLQH 3ZYEA 1PYTD 3SJ9A 1TE0A 3SHCH 1V2NT 2EI8A 4E7NA 4E05H 1V2MT 1AUTC 1O39A 2XW9A 3P8NA 1P57B 2RA3A 2ZFPH 4ZKSU 1QHRB 1NROH 5GJ4B 1GG6C 1P09A 1GBEA 1HNEE 2Y5FA 4X2WA 4NWLA 4UE7H 4X2VA 1JIMA 1MQ5A 1SQAA 1EX3A 4ABGA 4BAKB 1AUJA 4FUJA 3EA9A 1WCZA 2VH0A 1K1OA 5DG6A 2BD7A 2UUYA 4Y10E 4Y8ZA 1K1LA 4YESB 3OTJE 4X8SH 4YT6H 1HLTH 1BITA 1O31A 1AMHA 2ZU1A 7GCHF 4KTSA 4D7GA 1JRTA 1GDNA 3BTEE 4H42U 2BYAX 4Z0KA 4BAHB 3BTKE 3URDA 3ODDA 1LO6A 3S69A 1QRZA 3LGUA 3RLYH 1EPTA 1BJUA 1W10U 1WBGB 1K2I1 2EI6A 1EB1H 3S9AA 1YBWA 2ANKH 1DE7H 2VGCB 1DY8A 4B2AA 2ZKSA 1CA0B 1N6XA 2VIDA 3D49H 4OS2A 5F8XA 3BTFE 1OWIA 2GCTC 2EA3A 1G3BA 2XBVA 3HK3B 1QBNA 3PMJA 2FO9A 1NU7B 2AYWA 4NCYA 3MNXA 3RXCA 5C2ZA 2WUCA 1C2IA 3RDZA 1BRBE 1V3XA 1QR3E 5EPYA 1S5SA 5L2ZH 2XC5A 4WY3A 3SNAA 2YNAA 4OS7A 1SLXB 4NIXA 1BZXE 1ELGA 1GHBF 4I8GA 4GUXA 1OX1A 3SU2A 1NY22 3RXRA 1MZAA 1WUNH 1ZPZA 1O3AA 1CQQA 2M5TA 1UK2A 1NS3A 1CT2E 1FJSA 1QA7A 2G5NA 3BV9B 1ZPBA 2B0FA 3RXOA 1BTPA 1KXBA 2FZZA 3MMGA 1O2IA 1UTLM 2PUQH 1OYTH 1SGRE 1O32A 1ETTH 1Z8IB 3SN8A 4B2BA 2SGQE 1ZRBA 2A5IA 1DS2E 2FESH 2HNTF 1GJCB 1L0ZA 1TNHA 1YLCA 2SGPE 3TNSA 1V2JT 1YM0A 1KXFA 1M9UA 4YZUA 1P2MA 1T7CA 2RG3A 1LKAA 1TYNA 1ZGVA 1B5GH 1EPTB 3PROA 5AFYH 3RMMH 1C5QA 5BPEA 2G51A 2XNIA 1IAUA 3GY7A 5HMAA 1HJ9A 1AWHB 2CGAA 3MU5A 1UHBB 2J94A 5EODA 4NA8A 2H1UA 1SR5C 1ZPCA 2BOHB 2C3SA 1ARBA 4D76A 2CF8H 5E2OA 4H6SB 1GJ9B 1GJ8B 2XYAA 1FMGA 1WSSH 2A4GA 1GI2A 2F9UA 4VGCB 3K6YA 1O5BB 1W3CA 3U98H 2BLVA 3GCNA 4GHQA 1QJ7B 2C8ZB 3RC4A 1T8MA 4RKJB 4NSVA 2TPIZ 2GCTB 2OP9A 4GVUA 1SGDE 4X6NA 3TH2H 4DURA 1F5KU 1W7GH 3P17H 4MG3A 3IWMA 1XUHA 1LPGB 1P3EA 1A0HB 1C5TA 3ZZ5A 4X6OA 4ISHH 4WH6A 4WXIA 2QAAA 4NZLA 1HAOH 2KAIA 3OX7U 3VB7A 5JYIA 1GBDA 3C27B 1VZQH 1FI8A 1KTSB 2FLRH 1DANH 2W7SA 1GMDG 2QV1A 1HJ8A 3KIDU 2O8UA 1UVTH 4AG1A 1LQEA 1TNKA 1A4WH 1AZ8A 4XOJA 1W13U 1HIAA 4U2WA 5DO4H 1EXFA 3PLBA 1G2MA 1ZHRA 3EA8A 1XVOA 2BD2A 3OSYA 5EQRA 2Y82A 2ZDLA 4OS4A 3QTOH 1NRSH 1F0UA 5C5OA 1AE8H 3UWIA 3STIA 1JBUH 3ELAH 1MTNC 2HNTE
chains in the Genus database with same CATH superfamily
1SOZA 1ZYOA 3QK1A 4D8NA 1P03A 1SHYA 3FO8D 4Y79A 2J4IA 1C5YB 1MQ6A 1NZQH 3E1XB 1GG6B 1UHBA 2KZ4A 3LJOA 3QDZB 1PPEE 1YCPM 1NFYA 1NU9A 4TPYA 2V0BA 3GCTF 2NU3E 1GMCF 2VIWA 2J92A 1XUIA 1XM1A 2BB4A 1E38B 1ZRKA 3KGPA 1L4ZA 2FYRA 1SI5H 2VVUA 1S0RA 5K0HA 1T4UH 4B73A 3I77A 1G3DA 3MYWA 1GMHF 3ZV9A 1AB9B 1FY1A 3SI4H 1Z8RA 3UOUA 1NC6A 3ZZ8A 1SGIB 2WYGA 1C2FA 3T62A 2HOBA 1O3FA 2OD3B 1BMFD 1C2LA 1DOJA 1JXPA 2ANWA 2XTTB 5F03A 4XRNA 1SB1H 2VWNA 1E79D 1MKWH 1BTXA 2TGTA 1UTMA 3UQOA 2TGPZ 4I8KA 1GHAF 1FY5A 3FP8E 3UQVA 5DP6A 3RXGA 1WQVH 3BTDE 1DSUA 1O2PA 2H2ZA 4P00A 1YPHC 3SJ8A 4DIHH 3BF6H 4BAOB 3BSQA 1MTSA 2NU0E 4X1SU 2PLXA 2PGBB 4OGXA 2Y80A 2VB0A 1LPZB 1LKBA 1QJ6B 5C3NA 1O3EA 1ZSLA 3ZZ4A 1KYNA 2QA9E 1ANEA 1YC0A 3GY4A 5FPSA 3SO3A 4Q7XA 2VIOA 3RXVA 3NUMA 2THFB 1GBAA 6CHAC 4JZFH 2ZDNA 3SQEE 1ZOMA 4NGAH 4B2CA 5C17A 3SU5A 2H5CA 3HGPA 3U69H 3ZZ7A 5FBIA 4E7RG 2FPZA 6ESTA 2O8WA 1SOTA 3UPEA 3MH4A 2KFWA 1Z6JH 1DICA 3MTYA 3Q3XA 1G2LA 2D1JA 1FPCH 1K22H 2ZDAH 1Z8JB 2TRMA 3M3VA 3Q76A 2AIQA 4Y71A 5GDSH 1QRXA 2AMPA 3ZVGA 2SNVA 5I46H 2O8MA 2H5DA 1S85A 2ZTXA 1SKYE 4I31A 1RTFB 1A7SA 1V2QT 1C2DA 1P12E 1O2TA 1PFXC 2H9TH 4DVAU 5BRRE 5GWZA 3NXPA 4UFEH 1VCPA 1VGCC 3MI4A 4HZHA 1VR1H 3RXBA 3RXFA 3DCLA 1EKBB 4MPVA 5FHTA 1P2JA 2ZP0H 4ISNA 1V2VT 1A5IA 1LHFH 5EJLA 3RP2A 1TGCA 2VINA 3AAUA 3K65B 1FQ3A 2WV4A 1S84A 4BXWA 1QB1A 2TGAA 5DKMA 3VXFH 3KN2A 4XFQA 3SZEA 2Z6BD 2FI3E 3ZVCA 4LXBH 3TITA 1OXGA 2FP7B 1O3PB 1O2VA 1RTKA 4Y7BA 2AGEX 3FP7E 4BAQB 1KLIH 2D26C 1C5MD 2AH4X 1P10A 2TBSA 4AX9H 1BA8B 1GBFA 1BHXF 3V12A 4M7GA 1YPGH 1K9OE 2W5EA 2EQNA 3ATKA 2PV9B 1GDUA 2HPQH 4Y7AA 5JPMH 4AYYB 1O33A 1UVUH 4DW2U 4CBOA 1B0EA 2PTNA 4TYDA 2ZIQH 3RXLA 1SL3A 5JBTA 3VXEH 3LH1A 2XBXA 3PWBA 5FL7D 1C5UA 1ZTKA 4KELA 4CHAB 3BEIB 3LONA 1BJVA 2OC1A 4KTCA 1MUEB 8LPRA 2BXTH 4AN7A 8GCHF 1TBQH 1ZSKA 1FZZA 3SU6A 1EP5A 4TWWA 1ETRH 2BM2A 3DUXH 4F49A 2F9VA 5DGJA 4JZDH 1XKBC 5F6MA 3FKSD 1C5NH 3S9CA 1T4VH 2ZU4A 5KECA 1J8AA 4NG9H 3TU7H 1DITH 4JZEH 2O9QA 9ESTA 1O30A 2SNWA 4ZHLU 1AGJA 5B6LA 2PW8H 1C1NA 1COWD 1OWKA 2RDEA 1YY3A 3VGCB 3HGNA 5HM9A 2YMSC 1THRH 2R2WU 1Z71A 4IMZA 4A1TA 2FWWA 2OK5A 3SYJA 3STJA 2PGQB 3RXSA 2A4OA 2AEIH 2W6JD 3W1EA 4O03A 1TGTA 3PV4A 1BT7A 1TMUH 1WOFA 2PKSB 4ABHA 4MNVA 5LPFA 4ZROA 4BAMB 1BOQA 3PO1B 2IJOB 4Y0ZE 3I78A 1GDQA 2BLQA 2RA0A 1GHBG 5ETXA 1ZJDA 1YLDA 4AYVB 2W7UA 1F2SE 4INHA 4NIYA 1Y3VA 1F0SA 2RCEA 2ZDVH 3QX5H 3UWJH 3M3SA 1C9PA 3F9FA 1XX9A 4XBCA 1UVSH 2QF3A 2ULLA 1TFXA 2DE9A 1P2KA 2QXIA 1TNJA 1V2OT 3EAJA 3RXMA 1QIXB 4IGDA 1QRWA 1YP9A 1ESTA 4AZ2B 2OLGA 1QGFA 1V2ST 4HTCH 1GJ4H 4TWYA 1V2KT 1TNLA 1CO7E 4ZH8A 3GY8A 1HXFH 1ACBE 1ZLRA 2BD4A 1GGDC 3E16B 1HAVA 1CA0C 1H8DH 1OWHA 1MBQA 2J34A 1GBMA 3NZIA 4R8TB 4XDEA 4XSKU 1MU8B 3VEQB 1K0HA 3O8BA 5ESTE 5EXMA 1ANDA 4IBLH 3A81A 5I25A 1EB2A 4OM9A 1OOKB 1TGSZ 2QCYA 2AS9A 2R2MB 3GY2A 1LMWB 1ZTJA 4DGJA 3MH5A 2WPKS 1O3LA 1YPKH 2BLWA 4Q80A 3KL6A 2ZDKA 2GMTB 5EXNA 2KAIB 1RTLA 2Z94A 3ZZ9A 1O5FH 4JK5A 5PTPA 5CHAB 1YKTA 2Y6TA 3PM3A 4DOQA 2JJ2D 3M5MA 1EZQA 1LTOA 1D4PB 2WHXA 3N99A 2WPJS 3NKKA 4JK6A 2H9EH 1A61H 1CHGA 5FPYA 1G9IE 2SGAA 1SGFG 2GX4A 3GY5A 4HGCA 1C5OH 3TH3H 1UVOA 2STBE 2ZU5A 5LH8A 4J2YB 3UB0A 1O2ZA 4ZHMU 3MFJA 2HALA 4CBNA 2ZECA 3GCHB 9LPRA 5HXFA 3OFND 2Z9IA 2A7CA 5KGOA 1GL0E 1EATA 1VITH 3EA7A 4X6PA 4AB9A 3LGYA 3M7QA 1BCUH 1GMDF 3UTUH 1D9IA 1LVOA 2HGTH 4X2YA 5HM2A 5AHGH 2OINA 3OE7D 2OTVA 4INLA 1P05A 3ZZ6A 1G32B 4FUCA 1SSXA 1TQ0B 2BTCE 1O2RA 1EJMA 3LOXA 1PYTC 2JJ1D 1A0JA 3RXUA 3SZNA 2PWXA 1UTKA 5LPEA 2CN0H 1UTQA 2FIRH 1UTJA 1J17T 1Z1IA 3M35A 2XCNA 3FP6E 1ELCA 3RMLH 4CRBA 4Y0YE 1O3MA 2TGDA 1PPZA 2M2AA 1K1IA 3BTGE 3RM2H 1AWFH 1VITG 2CHAB 2OUAA 3E91A 4B71A 2FI5E 4THNH 3S9BA 4D9RA 5KEDA 2DUCA 1CSOE 3OTPA 5JBBS 1QFKH 4MNWA 3ZZAA 2XC4A 2ZGBH 4TT3D 1C1QA 2GT7A 2A2XH 4CHAC 4B74A 4ZUHA 1QB6A 4RT0A 2QXJA 1ZR0A 3M61U 1SGEE 3N7OA 1G30B 2G52A 3SV7A 5GXPA 5J4SA 2JH6D 1MMJN 4NIVA 2QF0A 4ZXXH 1GWAA 1G3CA 3SORA 3PLPA 3SUFA 1O2SA 1JMOH 3NWUA 4I86A 1BTWA 1GCTB 3RXTA 1E0FD 1PPCE 3DFJA 3HATH 4DG4A 4A1VA 3SNCA 1NPMA 3EQ0H 1ZTLA 1T32A 2R9PA 2WINI 1OWDA 3HK6B 2HNTC 5EW1H 1ABIH 1GMCG 1TALA 2Z3EA 1AVWA 3ZV8A 3F9EA 3G01A 1S6HA 5LPRA 7GCHG 1DLEA 3UY9A 1AQ7A 3HKJB 2WYJA 1XXFA 1GJAB 1OWEA 3WW7A 3VFEA 1EZSC 1W2KH 4I8HA 3ZZ3A 5DK1A 4TY7A 4OGYA 1LHGH 3JZ1B 1F0TA 1DSTA 2PFEA 4I7YH 1VGCB 1O5GH 3MU0A 3SJKA 1C5PA 1NN6A 3ATWA 3AAVA 3C1KA 3MNCA 2FOGA 1W0JD 2GCHF 2GTBA 1D6RA 1UVPA 3F3BA 3E0PB 3SGQE 4AORA 3R3GB 2XWBI 4B76A 1DWDH 4ZKRU 1MTNB 1P11E 2SFAA 1GHAG 2ZTZA 1C1UH 1ELBA 3KQBA 4FUEA 4O97A 2STAE 2YOLA 1KXAA 1UCYK 3H7OA 2NWNA 1BBRK 4NA9H 2ZGHA 3MU8A 1DPOA 2A4RA 4CR5A 1SBWA 2V6NA 4B6EA 4K8BA 2FLBH 3SNEA 2GD4B 3CNRA 2A45B 2D2DA 4IN2A 4IW4E 5DSFA 1NFUA 3O8DA 4MTBA 2BX4A 2VWMA 2W26A 4AGJA 3SV9A 2FMJA 4ASHA 4CRGA 2P95A 3BTQE 2EC9H 1P0SH 1EQ9A 2BVRH 2VWOA 1S6FA 2ZHWH 3N7DA 4WF8A 5C1YA 2PTCE 1N8OB 2LELA 3SJIA 1TPSA 3TK6A 1KLTA 3O8CA 2ZI2H 3FAOA 1LVBA 2IJD1 2BY7X 2XWAA 1TA6A 4BTUB 4AOQA 1HAVB 2GVFA 5EG4A 2FOHA 3RMNH 1J15A 1O2UA 1TWXB 1ZJKA 2VVCA 2P94A 3ZVDA 3Q3KA 4GPGA 5HKKD 3ESTA 1O35A 2K0QA 2XRCA 4F4OC 3PB1E 3PRBA 1Q2WA 3LGIA 1BTZA 3SU3A 2B8OH 5E0JA 2L6OA 2A4QA 2QXHA 2UWPA 1LHEH 1EAIA 2B9LA 1GJ7B 1AVXA 3KQDA 4AGKA 5DN6D 4H4FA 1P06A 2JETB 1C1SA 1WYKA 2ASUB 2QXGA 3DFLA 1EZXC 2JETC 4NIWA 3ZVFA 2ZGCA 3F2GA 4RSPA 3WWBA 4FUBA 3U8TH 1HAGE 2BVSH 4LK4A 2VNTA 1OHHD 3P6ZB 4B1TA 1MTUA 3MH6A 3RXQA 2Y81A 2YNBA 2PR3A 1CGHA 1QTFA 2OC0A 3WWFA 1WTGH 1OSSA 1QL8A 1TPPA 1HAPH 1MTVA 1L1JA 2A2QH 4X8UH 1A5HA 1BTYA 5JBAS 1BMMH 1QQ4A 3ZZDA 3LKWA 1XMNB 2EI7A 1EASA 2VIQA 5TCCA 3TLOA 2JH0D 1P2OA 1YWUA 2KR7A 3P8GA 2C93B 1GPZA 2Q6FA 3A84A 3UNSA 1AO5A 1GCTC 4KKDA 3KF2A 1D6WA 4ABJA 1ELTA 1O3OA 4NWKA 1C2GA 1C4U2 3NK8A 3ATLA 3H5CB 4FVDA 4IC6A 5E8EH 3TH4H 2BDGA 2BVXH 1QZ8A 5C0TA 4LZ1H 4D7FA 1SPJA 2UUFB 4KP0A 2OQ5A 3A8CA 5F53A 3SI3H 3GDUA 4UFFH 1OP0A 4Y76A 2VGCC 3A7WA 3MQKC 1HAIH 2VJ1A 3F2HA 3P8FA 1PPFE 2Q6DA 1A0LA 1HAYB 3D23A 4FUDA 3T5FH 3CS7A 4TPIZ 1F7ZA 3HPTB 3QO6A 2F3CE 5JBCS 3KYFA 1XUGA 3LT3A 5FXLA 1MU6B 3OY5U 5E0GA 5K7RA 3PRDA 2H6MA 4X2XA 1MAXA 1ARCA 3V7TA 3TJNA 1FN8A 2A31A 1GVLA 3AW0A 2VWLA 1TGNA 2ALPA 3RC6A 1KMHB 1GJDB 3RXJA 7KMEH 2GV7A 2UUKB 2V7QD 3BTHE 3KCGH 1C1TA 4R0IA 1D3QB 1GI7B 2BD8A 1TQ7B 3A89A 5T6GA 2PSXA 3K9XB 4DIIH 2R0LA 1S0QA 5T6FA 2O8TA 1C2EA 1LVYA 2GV6A 5CHBA 4FU8A 4ABEA 1ZGIA 3OU0A 1YPMH 3GOVB 3SNDA 5HIYA 4OS6A 2ZQ1A 3BN9A 2A32A 3U8OH 3Q77A 1P04A 2ZFRH 2A1DB 1C9TA 3LC5A 3MNSA 1EJNA 1IQGA 1C1WH 4UEHH 5J4QA 1SGPE 4MNYA 2OBQA 3VG8A 3SOSA 2FM2A 3A7VA 1P02A 2F9BH 4MPUA 2AGGX 1RIWC 2PKAB 1IQJA 5JB9S 3QZRA 5GCHF 1P9SA 1FONA 5JB8S 1DVAH 1TNIA 1D3DB 5TJXA 4Z6AH 1H1BA 2ANYA 1GVKB 4MPWA 3VGCC 3M37A 3M5OA 1U6QA 2PSYA 4YO9A 1ZMJA 3MU1A 4JZIA 2AGIX 3VB6A 1DX5M 1K1PA 3U9AH 2FOEA 2ZG0H 1TBRH 2A7HA 1T8NA 3GICB 3ZVBA 1A3EH 1VCQA 5FCRA 1DUEA 3GY6A 5B6OA 1H9HE 3RMOH 1SHHB 1GI9B 3AASA 2ZU2A 1SLVB 1DM4B 1NRNH 3T2NA 1E1RD 1LCYA 2VU8E 3M7UA 1UK3A 1JOUB 4MDSA 1EUFA 1H9IE 1CBWB 1DWEH 2ILNA 4Z1MD 1VITF 2ZPQA 2Y7ZA 1QQUA 1TRYA 2ZTYA 2FODA 1UJ1A 4A92A 4B75A 1C2HA 1AN1E 2WZQA 3OEHD 1O3IA 2XXLA 1K1NA 2WSSD 1GBIA 1PQ5A 3U8RH 3PWCA 2AIPA 4ZXYH 1AB9C 2W3KA 1O2OA 2P3UB 1AU8A 1O34A 4TSFD 3KQEA 1IQHA 4A1XA 3TGKE 3T29A 5FX5A 1J9CH 4MNXA 1KLJH 2SGFE 1A5GH 1IQLA 3EDXB 3UOPA 2QE7D 1FIZA 3SQHE 1ABJH 1N6YA 3T27A 4ZKNU 2ODYB 2F83A 1GI4A 2FX4A 4RT1A 1ZSJA 5A2MH 1P2QA 2J9NA 1PQ7A 1TPOA 2ZZUH 1FDPA 4K3JA 1HBTH 1Y5AT 2BQ7B 4HI3A 3ZYDA 4FU9A 1G37A 3L33A 3GYLB 2UUJB 5HIZA 1AHTH 2BZAA 3RXIA 3BIVH 1CT4E 4ZMAH 2ZGXH 3OY6U 1Y3XA 2C8XB 1B0FA 1TRNA 1YPLH 1O3HA 2FDAA 3A8BA 1GI1A 3SUEA 1SGQE 3E0NB 1UTPA 2CK3D 1O5DH 1IQMA 3LC3A 2OC7A 3BEUA 3RXAA 1KSNA 2XCFA 6CHAB 1TX6A 5DPAA 5DP8A 2BOKA 1GBBA 1RGQA 5EJZA 1EOJA 5T1VA 1S82A 3LGWA 1THPB 3SV8A 1O38A 4X1PU 4WXVA 1GI3A 4ABFA 1TONA 2LPRA 8KME2 2GDEH 5EXLA 5CHAC 2QGRA 2FXRA 2AHME 5EU8A 3A85A 5JDUB 1ZHPA 1WV7H 1XUJA 1O2NA 1BRUP 4X1QU 1GGDB 1THSH 2HWLB 1TBZH 2OCVB 4Q2KA 1QNJA 1ELVA 1L2EA 4YOJA 3GDVA 4Y8XA 1AIXH 5A09A 5TCAA 1SQOA 2P8OB 3F0OA 1KXDA 1TB6H 3P95A 5GPIB 2NU1E 4X6MA 1FLEE 1CHOF 1KTTB 1O3DA 1IQKA 1L4DA 4RI0A 1FN6A 4AFQA 1TIOA 2ANMH 3FANA 1PQ8A 2Z9KA 2JDID 3VB4A 1L1GA 4IS5A 4ABDA 1AVGH 3WY8A 1Y3WA 2ZHEH 3RU4E 1WXRA 3CP7A 3NCLA 4RN6A 1DXWA 2ZNKH 2Y7XA 1W11U 1BHXB 4AB8A 2ZCLP 2A7JA 2FOFA 3E6PH 1ELEE 2QIQA 1QL9A 4M9FA 1IQFA 1UW7A 2F9NA 2QC2A 5DP3A 1ELAA 4X8VH 4BNRA 2A0QB 1O0DH 2CMYA 2QN5T 4ABAA 1O5CB 3IG6B 4MLFB 3KNXA 1Q31A 3SUGA 1BB0B 5T3HA 1HIAB 1NFXA 1YYY1 3T25A 1PQAA 3MO3A 3ZVAA 2ZPSA 4ZCNA 4K69A 3A83A 3F9HA 4X0WU 1CVWH 2RFKC 4ASUD 5SGAE 1O2QA 3ZVEA 2AMQA 3L6PA 1IQIA 2SGDE 1EAUA 3RXKA 1XVMA 1LVMA 5GIBA 1O3GA 4I8LA 3SJOA 5ABWA 1Y5UT 1SC8U 3ENSB 3U1IB 4UDWH 1MZDA 1YF4A 3SUDA 2ZWLH 1BIOA 1EFRD 1DY9A 1T8LA 5A0BA 1O5AB 4YLUA 5CE1A 1MH0A 5HGGA 1G36A 1E1QD 4A5TS 2FOCA 1P2IA 1XUKA 1W14U 1P9UA 1OWJA 3B8JA 3RU4D 3OYPA 4FUFA 4K1TA 1O2HA 2CHAC 1S6LA 4ABIA 1GBCA 3A87A 2UWOA 3LH3A 1C5SA 1SGFA 1F92A 3MOCA 2ZEBA 2B7DH 1C1OA 3GCTG 1ESAA 1TX8A 1C5RA 1NESE 2WV5A 4AC9A 2PHBA 3UREA 1C5XB 5L6NH 1LDTT 1O2JA 2OQUA 3EE0B 3V13A 1J16A 4YOIA 2ZU3A 3TGIE 5C20A 2Y5GA 2P16A 3TJOA 1Q3XA 5A8YA 3SGAE 2ZHDA 4K60A 1BUIA 4NZQA 2VVVA 1GI5A 4J1YA 3UAIC 1NM6A 2FYQA 1VCWA 3UR9A 3MWIU 2Z3DA 1JIRA 2Q1JA 5EPNA 1GBTA 3W95A 1O2LA 4RKOB 2LNCA 1BDAA 5DP5A 2WPDD 1O3BA 3A7ZA 1O2GH 4JZ1A 1GI6A 1VJ9U 4U01A 2BDIA 4BTIB 1C2JA 3ITIA 4ZHAA 4WWYA 1HV7A 3MO6A 4ISIH 3VPKA 3GCHC 1QL7A 3RC5A 2XC0A 2IPQX 3BEFB 1GBKA 2FS9A 2I6QA 2BX3A 2ODPA 1TOMH 2LP6A 4FU7A 1XXDA 5H4IB 2BDAA 1SG8B 2ZCKP 4XBDA 1TABE 1HJAC 4ABBA 4WJG2 1H8IH 4JYUH 2BMGB 3EGKH 2ZHFH 2OC8A 1HJAB 1ANBA 1K21H 1QCPA 4WMFA 4PROA 2PKSC 1DFPA 3LPRA 2BQ6B 4I33A 1X7AC 3H09A 1FX0B 2V35A 1G3EA 1K1JA 3QTVH 3T28A 3QZQA 1S81A 2DE8A 2ODQA 1NRRH 3PMHB 2ZA5A 1HB0B 2K1QA 1E36B 3P92A 5C67A 1C5VA 3RXEA 1MD8A 1DWCH 1C1MA 5FCKA 1RXPA 1KIGH 2KCYA 3ZZBA 6LPRA 4CR9A 2Y5HA 4AFSA 5C5NA 3A8DA 5EOKA 2IPHA 3MU4A 3SV6A 1MKXK 1V2LT 1EOLA 3QWCH 3W94A 2WV9A 2XBYA 4CREA 1W0ZU 1ELDE 1LQDB 2CF9H 1AI8H 3PMAB 2HLCA 3GISB 4NFFA 4TY6A 1B7XB 1YPJH 3SBKA 2FS8A 4K1SA 1MBMA 1FNIA 2FI4E 4MVNA 4O3TA 1Z8GA 2BHGA 1N8OC 1GHWH 4AFUA 4O9VA 3PTBA 2FOBA 5F8ZA 2ZQ2A 1FY3A 3E90B 2Z9LA 3SNBA 1E34B 3D65E 2Z9GA 3BG8A 1D3PB 5T6DA 4CRFA 4ISOA 4JYTA 3UUZA 2A5AA 1O3CA 2GT8A 1OKXA 3BTME 3RM0H 1PPHE 3KQCA 1CGJE 2P93A 3GS9A 2J95A 1WAYB 1AKSA 3V0XA 3M3TA 3F9GA 2VH6A 3F1SB 4IC5A 1V2WT 3BG4B 4WMEA 1GBHA 1QJ1B 4ISLA 3GDSA 2VIVA 1EZUC 1K28D 3U28C 3VB5A 2ESTE 2EY4C 3DA9B 1E35B 3KYGA 7ESTE 4KTUA 4UD9H 1YGCH 1BMAA 5C1XA 3TK9A 1GI8B 2P59A 3LJJA 2O8LA 2YMSD 4BOHA 1F5LA 3UNRA 3ATIA 3M7TA 1Y8TA 2ZFQH 1SGNE 3E8LA 3A80A 1NFWA 2B5TB 2BDCA 2I6SA 5ESBA 4DJZB 2Z7FE 5L2YH 2ZFFH 1RRKA 1TRMA 2BY6X 2J2UA 2K8IA 2IOTA 5DP7A 2GMTC 3RUOA 4DY7B 1TGBA 2GCHG 1UK4A 1C5WB 1HRTH 1W7XH 4GLYA 2R0KA 3S0NA 1SFQB 4K2YA 2WPHS 2V3OH 2OXSA 1SMFE 3HKIB 2F9PA 1CHOG 4UFGH 3GCOA 1KDQA 3MO9A 2G81E 3RXHA 1GJBB 2FX6A 3TGJE 3M5LA 4JYVH 1INCA 5A8ZA 2NU2E 3UR6A 1GI0A 1MTWA 2AMDA 3TPIZ 3UIRA 8ESTE 4I32A 3LDXH 4A7IB 3BG4C 3SU0A 1FV9A 2GZ7A 4CRCA 1QBVH 1UCYH 1OPHB 1J14A 1FUJA 2ZFSA 1GVZA 4A6LA 4JCNA 1IHTH 4IMQA 1LPKB 2QYIA 3RXPA 1RJXB 3FVFB 1OP8A 4HFPB 1SGCA 4GCHF 1F5RA 3FFGA 1V2UT 4X1RU 1NTPA 2KX4A 2P3TB 4AG2A 1GL1A 2ZHQH 4U32A 1GJ5H 5FBEA 3CS0A 5A8XA 2CXVA 4XE4A 2BY8X 5G4BA 5DP9A 3SW2B 3KHVA 6GCHG 3CENA 1BTUA 3GY3A 1LHCH 4X8TH 1A3BH 3DHKH 4FUGA 1ZMNA 2W3IA 2ZC9H 3DSPA 2Z9JA 2R3UA 1MKWK 5L30H 2G55A 3O8RA 2NU4E 4H6TA 5LGOA 3B23B 3TK5A 1DUAA 1ESBA 1O36A 4ZKOU 1A1RA 2PP6A 2GP9B 2ZGJA 3S7KB 4ESTE 1HFDA 2RDLA 1WDIA 1GMHG 1NO9H 3NPSA 1UO6A 2HLDD 3TIUA 1KDQB 5DJ7A 5CMXH 1H4WA 4FUIA 4FETA 3PO1C 1T8OA 2WPLS 3DD2H 1ZMLA 2WUBA 4ACBA 1QB9A 1DDJA 1ELFA 1EPTC 1RIWB 3TVJB 4GCHG 1FIWA 1AFQC 3A7TA 5AVDA 1JWTA 1TX7A 1C1PA 1WTHD 2GKVE 1ZZZA 3LU9B 3SU4A 1VKYA 2HVYB 1IQEA 3UNQA 1BRAA 1GHZA 1Z7KA 2C8YB 3H7TA 4O3UA 3FOAA 1ORFA 4Q7YA 4Q4LA 1GHVH 4INKA 1OYQA 4YTAA 1V2PT 2JKHA 3AW1A 1MAYA 1UTNA 2WPIS 2SGEE 1XKAC 1O2WA 1O3NA 1ETSH 1GBLA 2J38A 3PLKA 2TIOA 1O5EH 2BDYA 3QUMP 4YM9A 3M36A 4WMDA 2G5VA 1DWBH 3MHWU 4DT7B 1O3KA 1SQRA 3A88A 1P2NA 3UFAA 3U1JB 1DLKB 1AFEH 1O37A 2BD5A 2PKAA 1MCVA 1YCPK 1Y5BT 3PV5A 1CBWC 3SV2H 1C1RA 3F6UH 4OS1A 4CH8B 1QY6A 2G4UA 3L3TA 1S83A 2V3HH 1ZHMA 1YPEH 5FX6A 4BANB 1HAXB 1CE5A 1NRPH 4Y8YA 8GCHG 2GZ9A 5C1UA 1AKSB 2P3FH 4VGCC 2WPMS 4X1NU 1NBME 4WVPE 1BBRH 3IITA 1FAKH 2BD9A 4Y11E 1P01A 4DCDA 1EJAA 3E3TA 1SFIA 1C1VH 2ZCHP 1HAZB 4AFZA 3TNTA 1V2TT 4WH8A 2HVXA 3Q3YA 2FTMA 1KY9A 1SQTA 1QA0A 1V6DA 3A82A 3P8OA 1TA2A 4NSYA 3A8AA 4FXGH 1HXEH 4K1EA 2A5KA 1PPGE 2G00A 2VBCA 1WQSA 4JMYA 5E2PA 5GCHG 1H9LB 3KEEA 1AZZA 1LHDH 2ZDMA 1E37B 1HGTH 3D62A 2KCOA 1NT1A 3T26A 3LGTA 4QT8C 4NFEA 3RU4T 4UFDH 2GGVB 1FY8E 2BDHA 1MABB 3BTTE 1TLDA 1UTOA 1RFNA 3JZ2B 2YMSB 1UCYE 1AFQB 1BMNH 4ZAEA 5IYTA 5EQQA 1KXCA 4DT4A 1OS8A 3LGVA 4FVBA 4SGAE 1W12U 1K1MA 2ZO3H 3PMBB 2AFQB 3V3MA 1Z6EA 4MQAA 1RD3B 2F91A 1WU1A 3QGJA 4BTTB 1O2YA 1YPHE 5A0AE 2BDBA 4GSOA 2BQWB 1MCTA 1Y59T 5EW2H 1ANCA 3AVZA 4SGBE 4YT7H 3Q00A 5FAHA 3ATMA 4MPXA 5C94A 1GBJA 4ACAA 2QY0B 1AE5A 2F43B 1SGYE 4D9QA 3P70B 1A46H 2J98A 3K6ZA 3MNBA 4LOYH 1JRSA 1PJPA 2Z3CA 2BY9X 2BXUH 1HDTH 3TJVA 2PUXB 1QURH 3PYHA 2FEQH 1OP2A 1V2RT 1GHXH 5HYOA 1PPBH 1C2MA 3BIUH 4I8JA 5AF9H 3QGNB 1SLWB 2F9OA 3EYDA 5EQSA 1BMLA 1HAHH 1EAWA 3PV2A 5DP4A 1MD7A 2KM0A 4Q7ZA 1IOEA 3GYMA 3B9FH 1O2KA 2BZ6H 2FOMB 4NA7A 1BBRE 2BY5X 1CU1A 1GCDA 3S7HB 3RXDA 1FY4A 4CH2B 3ODFA 2GJGA 1TAWA 1DXPA 2G4TA 1FPHH 1C5ZB 1DT2A 3DT0H 1RS0A 3AK5A 3PTNA 3VB3A 4IN1A 3ZZCA 1HYLA 1MKXH 2ZFTA 2CV3A 3K2UA 3URCA 1BTHH 5E0HA 3TJUA 1TMBH 3FZDA 4GAWA 3ZIAD 1KXEA 1N1LA 4GHTA 2G8TA 2QF4A 3BTWE 2ZPRA 3QLPH 1A2CH 3LIWA 1EP6A 6GCHF 2VIPA 1Y3UA 1O3JA 1HCGA 2FOAA 2GZ8A 3SHAH 1O2XA 1YLNA 2C90B 3KQ5A 2OBOA 7LPRA 1Y3YA 1ID5H 1QBOA 2HRVA 3OAAD 1BRCE 1FXYA 1HPGA 1BQYA 1XUFA 1TPAE 1FAXA 4FUHA 2C4FH 2UWLA 5IDKA 5EGMA 2QF5A 1C4Y2 2J98B 3M5NA 2C8WB 1UMAH 1T31A 1CA8B 2EEKA 3A7XA 4K5ZA 2BD3A 1CT0E 1SGTA 1SVPA 4E06H 3SGBE 1TMTH 2HPPH 1NRQH 2BLOA 2CJIA 1VJAU 4P02A 1AD8H 3N7EA 3R0FA 1L1NA 1C2KA 1YCPH 2JH5D 1TNGA 5F8TA 1AY6H 4XD7D 1F0RA 5AFZH 2D8WA 1GHYH 4XBBA 2ZF0H 4UONA 4LZ4B 3SU1A 2J5UA 4FOUC 1IQNA 1W0YH 5FPTA 1IHSH 2ALVA 4YOGA 2JIZD 1Z1JA 1CGIE 1P3CA 1C4V2 3F0PA 2IN2A 2FTLE 4U30A 2AERH 4CRDA 3FZZA 1GJ6A 1EAXA 3I29A 1O2MA 2XBWA 3QN7A 4OS5A 1D3TB 2P8OC 1C5LH 3F2FA 2GDDA 1HUTH 4KGAA 3A86A 3F68H 1SLUB 2H9HA 2Q6GA 5A0CA 1P8VC 5CDFE 3A7YA 3RLWH 1W8BH 2R3YA 4Y6DA 4K8YA 4CRAA 3MH7A 1TOCB 4BXSA 4YLQH 3ZYEA 1PYTD 4HG6A 3SJ9A 1TE0A 3SHCH 1V2NT 2EI8A 4E7NA 4E05H 1V2MT 1AUTC 1O39A 2XW9A 3P8NA 1P57B 2RA3A 2ZFPH 4ZKSU 1QHRB 1NROH 5GJ4B 1GG6C 1P09A 1GBEA 1HNEE 2Y5FA 4Q63A 4NWLA 4X2WA 4UE7H 4X2VA 1JIMA 1MQ5A 1SQAA 2KCPA 1EX3A 4ABGA 4BAKB 2XNDD 1AUJA 1H8ED 4FUJA 3DSOA 3EA9A 1WCZA 2VH0A 1K1OA 5DG6A 2BD7A 2UUYA 3FN8A 4Y10E 4Y8ZA 1K1LA 3EE7A 4YESB 3OTJE 4X8SH 4YT6H 1HLTH 1BITA 1O31A 1AMHA 2ZU1A 7GCHF 4KTSA 4F48B 5C0UA 4D7GA 1JRTA 1GDNA 3BTEE 4H42U 2BYAX 4Z0KA 4BAHB 3BTKE 3URDA 3ODDA 1LO6A 3S69A 1QRZA 3LGUA 3RLYH 1EPTA 1BJUA 1W10U 1H8HD 1WBGB 1K2I1 2EI6A 1EB1H 3S9AA 1YBWA 2ANKH 1DE7H 2VGCB 1DY8A 4B2AA 2ZKSA 1CA0B 1N6XA 2VIDA 3D49H 4OS2A 5F8XA 2F4LA 3BTFE 1OWIA 2GCTC 2EA3A 1G3BA 2XBVA 3HK3B 1QBNA 3PMJA 2FO9A 1NU7B 2AYWA 4NCYA 3MNXA 3RXCA 5C2ZA 2WUCA 1C2IA 3RDZA 1BRBE 1V3XA 1QR3E 5EPYA 1S5SA 5L2ZH 2XC5A 4WY3A 3SNAA 2YNAA 4OS7A 1SLXB 4NIXA 1W0KD 1BZXE 1ELGA 1GHBF 4I8GA 4GUXA 1OX1A 3SU2A 1NY22 3RXRA 1MZAA 3OEED 1WUNH 1ZPZA 1O3AA 1CQQA 2M5TA 1UK2A 1NS3A 1CT2E 1FJSA 1QA7A 2G5NA 3BV9B 1ZPBA 2B0FA 3RXOA 1BTPA 1KXBA 2FZZA 1NBMD 1O2IA 3MMGA 4F55A 1UTLM 2PUQH 1OYTH 1SGRE 1O32A 1ETTH 1Z8IB 3SN8A 4B2BA 2SGQE 1ZRBA 2A5IA 1DS2E 2FESH 2HNTF 1GJCB 1L0ZA 1TNHA 1YLCA 2SGPE 3TNSA 5EIYA 5EJ1A 1V2JT 1YM0A 4YXWD 2W6ID 1KXFA 1M9UA 4YZUA 1P2MA 1T7CA 2RG3A 1LKAA 1TYNA 1ZGVA 1B5GH 1EPTB 3PROA 5AFYH 3RMMH 1C5QA 5BPEA 2G51A 1IAUA 2XNIA 3GY7A 5HMAA 1HJ9A 1AWHB 2CGAA 3MU5A 1UHBB 4B6FA 2J94A 5EODA 4NA8A 2H1UA 1SR5C 1ZPCA 2BOHB 2C3SA 1ARBA 4D76A 2CF8H 5E2OA 4H6SB 1GJ9B 1GJ8B 1FMGA 1WSSH 2XYAA 2A4GA 1GI2A 2F9UA 4VGCB 3K6YA 1O5BB 1W3CA 3U98H 2BLVA 3GCNA 4GHQA 1QJ7B 2C8ZB 3RC4A 5IK2D 1T8MA 4RKJB 4NSVA 2TPIZ 2GCTB 2OP9A 4GVUA 1SGDE 4X6NA 3TH2H 4DURA 1F5KU 1W7GH 3P17H 4MG3A 3DSGA 3IWMA 1XUHA 1LPGB 1P3EA 1A0HB 2L74A 2J97A 1C5TA 2KCAA 3ZZ5A 3NRLA 4X6OA 4ISHH 4WH6A 4WXIA 2QAAA 4NZLA 1HAOH 2KAIA 3OX7U 3VB7A 5JYIA 1GBDA 3C27B 1VZQH 1FI8A 1KTSB 2V3MA 2FLRH 1DANH 2W7SA 1GMDG 2QV1A 1HJ8A 3KIDU 2O8UA 1UVTH 4AG1A 1LQEA 1TNKA 1A4WH 1AZ8A 4XOJA 1W13U 1HIAA 4U2WA 5DO4H 1EXFA 3PLBA 1G2MA 1ZHRA 3EA8A 1XVOA 2BD2A 3OSYA 5EQRA 2Y82A 2ZDLA 4OS4A 5GNDA 3QTOH 1NRSH 1F0UA 5C5OA 1AE8H 3UWIA 3STIA 1JBUH 2XOKD 3ELAH 1MTNC 2HNTE
chains in the Genus database with same CATH topology
1SOZA 1ZYOA 3QK1A 4D8NA 1P03A 1SHYA 4Y79A 2J4IA 1C5YB 1MQ6A 1NZQH 3E1XB 1GG6B 1UHBA 3LJOA 3QDZB 1PPEE 1YCPM 1NFYA 1NU9A 4TPYA 2V0BA 3GCTF 2NU3E 1GMCF 2VIWA 2J92A 1XUIA 1XM1A 2BB4A 1E38B 1ZRKA 3KGPA 1L4ZA 2FYRA 1SI5H 2VVUA 1S0RA 5K0HA 1T4UH 4B73A 3I77A 1G3DA 3MYWA 1GMHF 3ZV9A 1AB9B 1FY1A 3SI4H 1Z8RA 3UOUA 1NC6A 3ZZ8A 1SGIB 2WYGA 1C2FA 3T62A 2HOBA 1O3FA 2OD3B 1C2LA 1DOJA 1JXPA 2ANWA 2XTTB 5F03A 1SB1H 2VWNA 1MKWH 1BTXA 2TGTA 1UTMA 3UQOA 2TGPZ 4I8KA 1GHAF 1FY5A 3FP8E 3UQVA 5DP6A 3RXGA 1WQVH 3BTDE 1DSUA 1O2PA 2H2ZA 3SJ8A 1YPHC 4DIHH 3BF6H 4BAOB 3BSQA 1MTSA 2NU0E 4X1SU 2PLXA 2PGBB 4OGXA 2Y80A 2VB0A 1LPZB 1LKBA 1QJ6B 5C3NA 1O3EA 1ZSLA 3ZZ4A 1KYNA 2QA9E 1ANEA 1YC0A 3GY4A 5FPSA 3SO3A 4Q7XA 2VIOA 3RXVA 3NUMA 2THFB 1GBAA 6CHAC 4JZFH 2ZDNA 3SQEE 1ZOMA 4NGAH 4B2CA 3SU5A 2H5CA 3HGPA 3U69H 3ZZ7A 5FBIA 4E7RG 2FPZA 6ESTA 2O8WA 1SOTA 3UPEA 3MH4A 1Z6JH 1DICA 3MTYA 3Q3XA 1G2LA 2D1JA 1FPCH 1K22H 2ZDAH 1Z8JB 2TRMA 3M3VA 3Q76A 2AIQA 4Y71A 5GDSH 1QRXA 2AMPA 3ZVGA 2SNVA 5I46H 2O8MA 2H5DA 1S85A 2ZTXA 4I31A 1RTFB 1A7SA 1V2QT 1C2DA 1P12E 1O2TA 1PFXC 2H9TH 4DVAU 5BRRE 5GWZA 3NXPA 4UFEH 1VCPA 1VGCC 3MI4A 4HZHA 1VR1H 3RXBA 3RXFA 1EKBB 4MPVA 5FHTA 1P2JA 2ZP0H 4ISNA 1V2VT 1A5IA 1LHFH 3RP2A 1TGCA 2VINA 3AAUA 3K65B 1FQ3A 2WV4A 1S84A 4BXWA 1QB1A 2TGAA 5DKMA 3VXFH 3KN2A 4XFQA 2Z6BD 2FI3E 3ZVCA 4LXBH 3TITA 1OXGA 2FP7B 1O3PB 1O2VA 1RTKA 4Y7BA 2AGEX 3FP7E 4BAQB 1KLIH 2D26C 1C5MD 2AH4X 1P10A 2TBSA 4AX9H 1BA8B 1GBFA 1BHXF 3V12A 4M7GA 1YPGH 1K9OE 2W5EA 3ATKA 2PV9B 1GDUA 2HPQH 4Y7AA 5JPMH 4AYYB 1O33A 1UVUH 4DW2U 4CBOA 1B0EA 2PTNA 4TYDA 2ZIQH 3RXLA 1SL3A 5JBTA 3VXEH 3LH1A 2XBXA 3PWBA 1C5UA 1ZTKA 4KELA 4CHAB 3BEIB 3LONA 1BJVA 2OC1A 4KTCA 1MUEB 8LPRA 2BXTH 4AN7A 8GCHF 1TBQH 1ZSKA 1FZZA 3SU6A 1EP5A 4TWWA 1ETRH 2BM2A 3DUXH 4F49A 2F9VA 5DGJA 4JZDH 1XKBC 5F6MA 3S9CA 1C5NH 1T4VH 2ZU4A 1J8AA 4NG9H 3TU7H 1DITH 4JZEH 2O9QA 9ESTA 1O30A 2SNWA 4ZHLU 1AGJA 2PW8H 1C1NA 1OWKA 3VGCB 3HGNA 5HM9A 1THRH 2R2WU 1Z71A 4IMZA 4A1TA 2FWWA 3STJA 2PGQB 3RXSA 2A4OA 2AEIH 4O03A 1TGTA 3PV4A 1BT7A 1TMUH 1WOFA 2PKSB 4ABHA 4MNVA 5LPFA 4ZROA 4BAMB 1BOQA 3PO1B 2IJOB 4Y0ZE 3I78A 1GDQA 2BLQA 2RA0A 1GHBG 5ETXA 1ZJDA 1YLDA 4AYVB 2W7UA 1F2SE 4INHA 4NIYA 1Y3VA 1F0SA 2RCEA 2ZDVH 3QX5H 3UWJH 3M3SA 1C9PA 3F9FA 1XX9A 4XBCA 1UVSH 2QF3A 2ULLA 1TFXA 2DE9A 1P2KA 2QXIA 1TNJA 1V2OT 3EAJA 3RXMA 1QIXB 4IGDA 1QRWA 1YP9A 1ESTA 4AZ2B 2OLGA 1QGFA 1V2ST 4HTCH 1GJ4H 4TWYA 1V2KT 1TNLA 1CO7E 4ZH8A 3GY8A 1HXFH 1ACBE 1ZLRA 2BD4A 1GGDC 3E16B 1HAVA 1CA0C 1H8DH 1OWHA 1MBQA 2J34A 1GBMA 3NZIA 4R8TB 4XDEA 4XSKU 1MU8B 3VEQB 3O8BA 5ESTE 5EXMA 1ANDA 4IBLH 3A81A 5I25A 1EB2A 1OOKB 1TGSZ 2QCYA 2AS9A 2R2MB 3GY2A 1LMWB 1ZTJA 4DGJA 3MH5A 2WPKS 1O3LA 1YPKH 2BLWA 4Q80A 3KL6A 2ZDKA 2GMTB 5EXNA 2KAIB 1RTLA 2Z94A 3ZZ9A 1O5FH 4JK5A 5PTPA 5CHAB 2Y6TA 1YKTA 3PM3A 4DOQA 3M5MA 1EZQA 1LTOA 1D4PB 2WPJS 3NKKA 4JK6A 2H9EH 1A61H 1CHGA 5FPYA 1G9IE 2SGAA 1SGFG 2GX4A 3GY5A 4HGCA 1C5OH 3TH3H 1UVOA 2STBE 2ZU5A 5LH8A 4J2YB 1O2ZA 4ZHMU 3MFJA 2HALA 4CBNA 2ZECA 3GCHB 9LPRA 5HXFA 2Z9IA 2A7CA 1GL0E 1EATA 1VITH 3EA7A 4X6PA 4AB9A 3LGYA 3M7QA 1BCUH 1GMDF 3UTUH 1D9IA 1LVOA 2HGTH 4X2YA 5HM2A 5AHGH 2OINA 2OTVA 4INLA 1P05A 3ZZ6A 1G32B 4FUCA 1SSXA 1TQ0B 2BTCE 1O2RA 1EJMA 3LOXA 1PYTC 1A0JA 3RXUA 3SZNA 2PWXA 1UTKA 5LPEA 2CN0H 1UTQA 2FIRH 1UTJA 1J17T 1Z1IA 3M35A 2XCNA 3FP6E 1ELCA 3RMLH 4CRBA 4Y0YE 1O3MA 2TGDA 1PPZA 1K1IA 3BTGE 3RM2H 1AWFH 1VITG 2CHAB 2OUAA 3E91A 4B71A 2FI5E 4THNH 3S9BA 4D9RA 2DUCA 1CSOE 5JBBS 1QFKH 4MNWA 3ZZAA 2XC4A 2ZGBH 1C1QA 2GT7A 2A2XH 4CHAC 4B74A 4ZUHA 1QB6A 2QXJA 1ZR0A 3M61U 1SGEE 3N7OA 1G30B 2G52A 3SV7A 5GXPA 5J4SA 2JH6D 1MMJN 4NIVA 2QF0A 4ZXXH 1GWAA 1G3CA 3SORA 3PLPA 3SUFA 1O2SA 1JMOH 3NWUA 1BTWA 1GCTB 3RXTA 1E0FD 1PPCE 3DFJA 3HATH 4DG4A 4A1VA 3SNCA 1NPMA 3EQ0H 1ZTLA 1T32A 2R9PA 2WINI 1OWDA 3HK6B 2HNTC 5EW1H 1ABIH 1GMCG 1TALA 2Z3EA 1AVWA 3ZV8A 3F9EA 3G01A 1S6HA 5LPRA 7GCHG 1DLEA 3UY9A 1AQ7A 3HKJB 2WYJA 1XXFA 1GJAB 1OWEA 3VFEA 1EZSC 1W2KH 4I8HA 3ZZ3A 5DK1A 4TY7A 4OGYA 1LHGH 3JZ1B 1F0TA 1DSTA 2PFEA 4I7YH 1VGCB 1O5GH 3MU0A 3SJKA 1C5PA 1NN6A 3ATWA 3AAVA 3C1KA 3MNCA 2FOGA 2GCHF 2GTBA 1D6RA 1UVPA 3E0PB 3SGQE 4AORA 3R3GB 2XWBI 4B76A 1DWDH 4ZKRU 1MTNB 1P11E 2SFAA 1GHAG 2ZTZA 1C1UH 1ELBA 3KQBA 4FUEA 4O97A 2STAE 2YOLA 1KXAA 1UCYK 3H7OA 2NWNA 1BBRK 4NA9H 2ZGHA 3MU8A 1DPOA 2A4RA 4CR5A 1SBWA 2V6NA 4K8BA 2FLBH 3SNEA 2GD4B 2A45B 2D2DA 4IN2A 4IW4E 1NFUA 3O8DA 4MTBA 2BX4A 2VWMA 2W26A 4AGJA 3SV9A 2FMJA 4ASHA 4CRGA 2P95A 3BTQE 2EC9H 1P0SH 1EQ9A 2BVRH 2VWOA 1S6FA 2ZHWH 4WF8A 5C1YA 2PTCE 1N8OB 3SJIA 1TPSA 3TK6A 1KLTA 3O8CA 2ZI2H 3FAOA 1LVBA 2BY7X 2XWAA 1TA6A 4BTUB 4AOQA 1HAVB 2GVFA 5EG4A 2FOHA 3RMNH 1J15A 1O2UA 1TWXB 1ZJKA 2VVCA 2P94A 3ZVDA 3Q3KA 4GPGA 3ESTA 1O35A 2XRCA 4F4OC 3PB1E 1Q2WA 3LGIA 1BTZA 3SU3A 2B8OH 5E0JA 2A4QA 2QXHA 2UWPA 1LHEH 1EAIA 2B9LA 1GJ7B 1AVXA 3KQDA 4AGKA 4H4FA 1P06A 2JETB 1C1SA 1WYKA 2ASUB 2QXGA 3DFLA 1EZXC 2JETC 4NIWA 3ZVFA 2ZGCA 4RSPA 4FUBA 3U8TH 1HAGE 2BVSH 4LK4A 2VNTA 3P6ZB 4B1TA 1MTUA 3MH6A 3RXQA 2Y81A 2YNBA 2PR3A 1CGHA 1QTFA 2OC0A 1WTGH 1OSSA 1QL8A 1TPPA 1HAPH 1MTVA 1L1JA 2A2QH 4X8UH 1A5HA 1BTYA 5JBAS 1BMMH 1QQ4A 3ZZDA 3LKWA 1XMNB 2EI7A 1EASA 2VIQA 5TCCA 3TLOA 2JH0D 1P2OA 3P8GA 2C93B 1GPZA 2Q6FA 3A84A 3UNSA 1AO5A 1GCTC 4KKDA 3KF2A 1D6WA 4ABJA 1ELTA 1O3OA 4NWKA 1C2GA 1C4U2 3NK8A 3ATLA 3H5CB 4FVDA 4IC6A 5E8EH 3TH4H 2BDGA 2BVXH 4LZ1H 4D7FA 1SPJA 2UUFB 4KP0A 2OQ5A 3A8CA 3SI3H 3GDUA 4UFFH 1OP0A 4Y76A 2VGCC 3A7WA 1HAIH 2VJ1A 3P8FA 1PPFE 2Q6DA 1A0LA 1HAYB 3D23A 4FUDA 3T5FH 3CS7A 4TPIZ 1F7ZA 3HPTB 3QO6A 2F3CE 5JBCS 1XUGA 3LT3A 5FXLA 1MU6B 3OY5U 5E0GA 5K7RA 2H6MA 4X2XA 1MAXA 1ARCA 3V7TA 3TJNA 1FN8A 2A31A 1GVLA 3AW0A 2VWLA 1TGNA 2ALPA 3RC6A 1GJDB 3RXJA 7KMEH 2GV7A 2UUKB 3BTHE 3KCGH 4R0IA 1C1TA 1D3QB 1GI7B 2BD8A 1TQ7B 3A89A 5T6GA 2PSXA 3K9XB 4DIIH 2R0LA 1S0QA 5T6FA 2O8TA 1C2EA 1LVYA 2GV6A 4FU8A 4ABEA 1ZGIA 3OU0A 1YPMH 3GOVB 3SNDA 4OS6A 2ZQ1A 3BN9A 2A32A 3U8OH 3Q77A 1P04A 2ZFRH 2A1DB 1C9TA 3LC5A 3MNSA 1EJNA 1IQGA 1C1WH 4UEHH 5J4QA 1SGPE 4MNYA 2OBQA 3SOSA 2FM2A 3A7VA 1P02A 2F9BH 4MPUA 2AGGX 1RIWC 2PKAB 1IQJA 5JB9S 3QZRA 5GCHF 1P9SA 1FONA 5JB8S 1DVAH 1TNIA 1D3DB 5TJXA 4Z6AH 1H1BA 2ANYA 1GVKB 4MPWA 3VGCC 3M37A 3M5OA 1U6QA 2PSYA 4YO9A 1ZMJA 3MU1A 4JZIA 2AGIX 3VB6A 1DX5M 1K1PA 3U9AH 2FOEA 2ZG0H 1TBRH 2A7HA 1T8NA 3GICB 3ZVBA 1A3EH 1VCQA 5FCRA 1DUEA 3GY6A 5B6OA 1H9HE 3RMOH 1SHHB 1GI9B 3AASA 2ZU2A 1SLVB 1DM4B 1NRNH 3T2NA 2VU8E 1LCYA 3M7UA 1UK3A 1JOUB 4MDSA 1EUFA 1H9IE 1CBWB 1DWEH 2ILNA 1VITF 2ZPQA 2Y7ZA 1QQUA 1TRYA 2ZTYA 2FODA 1UJ1A 4A92A 4B75A 1C2HA 1AN1E 1O3IA 2XXLA 1K1NA 1GBIA 1PQ5A 3U8RH 3PWCA 2AIPA 4ZXYH 1AB9C 2W3KA 1O2OA 2P3UB 1AU8A 1O34A 3KQEA 1IQHA 4A1XA 3TGKE 3T29A 5FX5A 1J9CH 4MNXA 1KLJH 2SGFE 1A5GH 1IQLA 3EDXB 3UOPA 1FIZA 3SQHE 1ABJH 1N6YA 3T27A 4ZKNU 2ODYB 2F83A 1GI4A 2FX4A 1ZSJA 5A2MH 1P2QA 1PQ7A 1TPOA 2J9NA 2ZZUH 1FDPA 4K3JA 1HBTH 1Y5AT 2BQ7B 4HI3A 3ZYDA 4FU9A 1G37A 3L33A 3GYLB 2UUJB 1AHTH 2BZAA 3RXIA 3BIVH 1CT4E 4ZMAH 2ZGXH 3OY6U 1Y3XA 2C8XB 1B0FA 1TRNA 1YPLH 1O3HA 2FDAA 3A8BA 1GI1A 3SUEA 1SGQE 3E0NB 1UTPA 1O5DH 1IQMA 3LC3A 2OC7A 3BEUA 3RXAA 1KSNA 2XCFA 6CHAB 1TX6A 5DPAA 5DP8A 2BOKA 1GBBA 1RGQA 1EOJA 1S82A 3LGWA 1THPB 3SV8A 1O38A 4X1PU 4WXVA 1GI3A 4ABFA 1TONA 2LPRA 8KME2 2GDEH 5EXLA 5CHAC 2QGRA 2FXRA 5EU8A 3A85A 5JDUB 1ZHPA 1WV7H 1XUJA 1O2NA 1BRUP 4X1QU 1GGDB 1THSH 2HWLB 1TBZH 2OCVB 4Q2KA 1QNJA 1ELVA 1L2EA 4YOJA 3GDVA 4Y8XA 1AIXH 5A09A 5TCAA 1SQOA 2P8OB 3P95A 1KXDA 1TB6H 5GPIB 2NU1E 4X6MA 1FLEE 1CHOF 1KTTB 1O3DA 1IQKA 1L4DA 1FN6A 4AFQA 1TIOA 2ANMH 3FANA 1PQ8A 2Z9KA 3VB4A 1L1GA 4IS5A 4ABDA 1AVGH 3WY8A 1Y3WA 2ZHEH 3RU4E 3CP7A 3NCLA 4RN6A 1DXWA 2ZNKH 2Y7XA 1W11U 1BHXB 4AB8A 2ZCLP 2A7JA 2FOFA 3E6PH 1ELEE 2QIQA 1QL9A 1IQFA 2F9NA 2QC2A 5DP3A 1ELAA 4X8VH 4BNRA 2A0QB 1O0DH 2CMYA 2QN5T 4ABAA 1O5CB 3IG6B 4MLFB 3KNXA 1Q31A 3SUGA 1BB0B 5T3HA 1HIAB 1NFXA 1YYY1 3T25A 1PQAA 3MO3A 3ZVAA 2ZPSA 4K69A 3A83A 3F9HA 4X0WU 1CVWH 5SGAE 1O2QA 3ZVEA 2AMQA 3L6PA 1IQIA 2SGDE