1QRZA

Catalytic domain of plasminogen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYMVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVLRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLASMINOGEN
publication title Crystal structure of the proenzyme domain of plasminogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA01
4WY3A 5A8YA 4NG9H 1Y3YA 1T4VH 1H9IE 1YF4A 2BDYA 3M5LA 4DJZB 1V2KT 2DE8A 1GBCA 2OC7A 7ESTE 1LCYA 3BIVH 2J9NA 3MO3A 1AB9B 2ZHFH 3ZVCA 3DFLA 1KXAA 1F92A 2IPHA 1KSNA 2PUQH 3E91A 4UONA 1G36A 1GBMA 1RTKA 1O5GH 1BUIA 4ZXYH 2GT7A 1BTPA 3P92A 3LT3A 1V2WT 4B2CA 3PMHB 3SV2H 3BTQE 2FMJA 5EG4A 2TRMA 1O2IA 4WH6A 4XFQA 5ABWA 4YM9A 1EAXA 2A4QA 4ZROA 1AN1E 1MKWH 3RXTA 4D8NA 1FJSA 1K1OA 1PPEE 1EAWA 2STBE 5LPRA 1XXDA 2TGTA 9ESTA 2ULLA 2GZ8A 1GMDG 1Y3XA 1XUHA 2GP9B 3V7TA 1MZDA 1P09A 4WMEA 2ZDAH 1XXFA 1NROH 3NPSA 4YOGA 1P3CA 3GDSA 3O8CA 1O5CB 3LOXA 3UOPA 3PLPA 2TGPZ 1T7CA 3FP7E 4ABHA 3U98H 1LHGH 1EAUA 2FOCA 1YPJH 4BXWA 1ZLRA 2RDLA 3F9FA 2ZC9H 3URCA 4J2YB 1DITH 2NWNA 2FS9A 1XUJA 1S0RA 3H5CB 3KCGH 3RXKA 2BMGB 4ESTE 2C8WB 1O35A 1YP9A 3UWIA 4I32A 1SG8B 5TJXA 1NRSH 1AE5A 3V3MA 1OWDA 1A4WH 3TK6A 2KAIB 1O2OA 2RA3A 4MPUA 5BPEA 3OU0A 1H4WA 4AZ2B 1AB9C 4K3JA 1Y3WA 1W0YH 4ABJA 5L2ZH 1O3JA 5IDKA 4JZEH 5JYIA 4UFEH 5EPYA 2OCVB 1YCPK 2HNTF 4NFFA 2CN0H 4ABEA 3A85A 2UUFB 1S6HA 3GY5A 1MU6B 4A1VA 4A1TA 4XBBA 1BRBE 1O2WA 2H5DA 3SNCA 1O37A 3D23A 3NKKA 2SGPE 2QXHA 2GX4A 1OSSA 5I25A 3UNRA 1WUNH 1F5KU 2WV4A 3A81A 4B2AA 1TBZH 2XC4A 4Y6DA 5C2ZA 2R3YA 1YPHC 3K65B 1UTLM 1BJVA 2ZFRH 3RDZA 2G52A 3SV7A 3LC3A 1T8NA 2OTVA 1GVZA 1DWBH 3P8GA 4D7FA 3QWCH 4TWYA 3T62A 4YZUA 1QL9A 5C1UA 1K9OE 4ABDA 3KQCA 4JK6A 1TALA 2FM2A 1O3NA 4Y7AA 1VGCB 4GCHF 2VVVA 3T27A 3PV4A 1UVOA 3PLKA 4Y76A 1JXPA 1YPLH 5GXPA 1OOKB 1TGTA 3A7WA 3GYLB 1MTVA 4BOHA 3ESTA 2ZHQH 2ZU1A 2V0BA 1VCQA 1A7SA 5JB9S 2A7CA 4CR5A 4FUFA 2PFEA 2P95A 1IQGA 3RXFA 2FPZA 3TIUA 1MUEB 1MKXH 3LGWA 1GI0A 2NU3E 2BXUH 4WH8A 1HAGE 1FN8A 3AASA 3BTFE 5C1XA 1HCGA 3SU0A 1S83A 2P93A 5SGAE 1VJAU 4ISOA 4IN2A 4K60A 1ELDE 1K21H 1OS8A 1RFNA 1VCWA 1SHHB 3RC5A 1QA7A 1GHBF 3QX5H 1HUTH 2WPMS 1BRUP 4XSKU 2GV6A 1SGPE 4Y79A 3SORA 3A84A 1DWCH 1HJ9A 4CRGA 3HPTB 4K1TA 2ZHWH 2WPLS 4U30A 1OWJA 5FHTA 4F49A 3KQDA 5FPSA 3EA8A 3MU5A 3AW1A 1D6RA 3BEIB 2EC9H 1QA0A 4Y0ZE 2R0LA 2O8TA 1GI5A 1EKBB 1EZSC 1BZXE 4A1XA 2BDCA 1BBRE 3U8TH 5GPIB 5A09A 3ZZ3A 5DP6A 3MFJA 3S9CA 1MD8A 1PQAA 3A7YA 3C27B 3HGNA 3A7VA 1SOZA 1VGCC 2QXGA 1CO7E 4K1EA 4ZKOU 4B74A 1PYTC 5FX5A 3LC5A 1UHBA 1BBRK 2W26A 2FOBA 1G3BA 3SHCH 5T3HA 1QBOA 2BX3A 2Q1JA 2ZFFH 3PYHA 4K5ZA 2UUKB 2GMTC 3MH7A 2CV3A 4I8JA 4YESB 5HYOA 1N1LA 2ANYA 3ATWA 3NUMA 1AD8H 3ATKA 3CS7A 2HWLB 2TGAA 3V13A 1WAYB 4ZHLU 2WPIS 1FUJA 3UR9A 1YGCH 1P3EA 1NU9A 1FAKH 4NWKA 5DP3A 1GJ4H 1GBLA 1C2FA 3OYPA 3NWUA 2BB4A 3A87A 2ODQA 2QIQA 3VB6A 2I6SA 1CHOF 1BHXF 2G4UA 5L30H 2BVXH 2AEIH 1CA0C 3SJ8A 4CBNA 4DT7B 3ZVEA 1IQHA 1P2OA 2J94A 3MNCA 1VITF 3KQBA 1HIAB 2SGDE 2VIPA 3RU4D 4AGKA 1P03A 2ZG0H 4SGBE 4LZ4B 3I77A 1O2NA 2Y5GA 2FI5E 4NSYA 1DICA 1QFKH 2VVUA 2JH0D 4A7IB 1IHTH 4CREA 3SW2B 1H8DH 2FIRH 3BEUA 1QBVH 4E06H 2HALA 1FIZA 2QXIA 1O36A 2FDAA 5AHGH 1SGRE 5C5OA 2VNTA 3Q00A 1O3EA 1IQFA 4DW2U 1BTUA 1A0JA 1FLEE 1TFXA 1YCPH 1ACBE 3I29A 3T25A 5GWZA 2R0KA 1OP8A 1UTKA 4FUCA 1K1LA 1KXEA 1WCZA 1NS3A 4UFDH 1ETSH 2GGVB 5E2PA 3T28A 3BIUH 3T26A 1OPHB 5J4QA 2ZCHP 1F0SA 1O3GA 4AB9A 4D76A 2QAAA 1FPHH 2LNCA 1QRXA 3U8RH 4K69A 1HAPH 2KAIA 3S7KB 2QY0B 2WPHS 1D3DB 1ZHPA 2QGRA 1C5OH 1TNGA 1DSTA 1ZSJA 5DO4H 1G3EA 2ZTZA 1O2VA 2YNAA 5F8TA 1KTSB 2HPPH 1P2QA 2R9PA 1PPZA 4AORA 4BTTB 1EQ9A 1Z71A 1ELAA 1H8IH 2F9PA 4JK5A 3RXAA 4NFEA 1HAVB 1SOTA 1V6DA 2ZKSA 2ZDMA 4MNVA 4AYVB 3OY5U 2BLOA 1A5GH 2G81E 4B76A 1SVPA 4XBDA 1AMHA 1AUTC 1ZPZA 3H7OA 1LVBA 4DOQA 2ZCLP 2WYGA 2V35A 2Y6TA 3KN2A 2H6MA 1MTNB 1P9SA 3VEQB 5JDUB 3WY8A 5F6MA 1E34B 2I6QA 1AVWA 1O3CA 3EE0B 1TB6H 4ZKSU 1GHWH 1ARBA 1GHZA 4NCYA 1T8LA 3RXOA 4R8TB 4ZHMU 1TONA 5A0BA 2A0QB 3MWIU 3MH6A 3QTOH 1V2RT 3SGQE 2A31A 1ANCA 3M37A 3TLOA 4NGAH 2D2DA 2BTCE 1P04A 4ZKNU 3SZNA 2R3UA 5JPMH 1J8AA 1RJXB 1HXEH 5CE1A 2GZ9A 4ZMAH 3ZZ9A 1GJ8B 3SV9A 2ZGBH 2P3FH 2R2WU 4IS5A 1ANEA 2PKAB 2EA3A 2H9HA 2Z9IA 2BVRH 5EU8A 2FI3E 1HV7A 1TE0A 1BHXB 3MU8A 1AWHB 2ZGXH 3GYMA 1TYNA 3ZVAA 1SLVB 4OS7A 1GVLA 2O8UA 1VITG 2F9NA 4ZH8A 3ZVGA 4MNYA 2TIOA 3U1JB 1KYNA 3BG8A 2F9VA 2JH6D 3IG6B 3FP6E 1BBRH 4B71A 1HAIH 1C1OA 1C4Y2 4QT8C 2ANWA 1GI9B 2A5KA 2OD3B 2FOGA 2LPRA 3PMJA 2Q6DA 1IQEA 4BTUB 4B75A 1Z6EA 1W14U 1PPHE 2H5CA 1K1NA 2EI6A 1AVGH 2Z7FE 5BRRE 1JRSA 1O0DH 3SU4A 1KXCA 4I7YH 1UVSH 3QZRA 4FUBA 4X6NA 1Q2WA 1O5EH 1MTNC 1NM6A 1GBBA 1FY3A 3BG4B 1BB0B 4NA9H 1GI3A 2P3UB 2FYRA 2XBVA 5AFYH 3RUOA 1GI7B 5EXLA 4NIVA 3Q77A 2C8ZB 1LQEA 7KMEH 3RMMH 5AFZH 1S6FA 1GL0E 1CVWH 2SGAA 3BTHE 5K0HA 3PO1C 1FXYA 3UNQA 3PB1E 1HDTH 3EGKH 4I31A 1QGFA 1ABJH 1J17T 1GJCB 1JMOH 2HVXA 1ZRKA 1XUGA 1UK3A 5TCAA 1DXWA 3VPKA 3O8RA 3SN8A 5DP5A 5DJ7A 4YT7H 1T32A 4Z0KA 2OBOA 1J16A 1C1SA 2VIQA 1HAZB 1FN6A 1MKXK 1O2JA 1GBTA 3LGIA 5E0JA 3LDXH 4X8VH 3VB7A 1MQ5A 2OUAA 2B8OH 1BCUH 1UTMA 5FCKA 5FPTA 1EAIA 3E6PH 1M9UA 1C5QA 6ESTA 3BTGE 2ZU5A 1HAYB 2XBYA 3P8OA 1CBWB 5ESTE 5TCCA 4WJG2 1UHBB 1Q3XA 2CGAA 3TJOA 1IQJA 4NA7A 4FU7A 1QCPA 3RM0H 2FTMA 1W12U 2W3IA 1T8MA 2IOTA 1N8OB 3SNBA 2AYWA 4MVNA 4Q7YA 3SU6A 1C2MA 1X7AC 4UFFH 2EI8A 1QB9A 1EJAA 1FY1A 3NCLA 4GVUA 4JYVH 2TGDA 2ZDLA 2Y7XA 1TMTH 2GDEH 2BDBA 3OSYA 3RMNH 1GBIA 2BDGA 2BDHA 1P10A 4INKA 1RIWB 3RP2A 1HB0B 1C2LA 1ELTA 1SGCA 2ZTYA 2BX4A 1GI8B 3ATLA 2A5AA 1TPPA 2FOHA 1BRAA 1H9HE 1P05A 2BVSH 1MCTA 3T5FH 1JOUB 1XM1A 2ZIQH 2OP9A 3ZZBA 3DT0H 3RXQA 3RXUA 1TLDA 1G9IE 4Z6AH 5F03A 5EXMA 4AG2A 3F9HA 1TAWA 3QGJA 3MH4A 8ESTE 2J95A 4J1YA 4U32A 1BTWA 2QF3A 1UTJA 4X8UH 4X6OA 1SGEE 3A8BA 3SJKA 1OWEA 3R0FA 1EZQA 1O32A 4LOYH 3D65E 3UIRA 1GHXH 3EYDA 5T6DA 2FESH 2ZDVH 1GJ7B 2THFB 4U01A 1O2TA 3RXHA 2QA9E 1C2GA 1UMAH 2PGQB 1W7GH 1Z8JB 1S5SA 1UTPA 2V3HH 4THNH 1PPCE 2VGCB 1ZOMA 3RXSA 2VINA 3NXPA 1P06A 1RTLA 1DY9A 1JWTA 4K2YA 3PLBA 4ABGA 4ZXXH 1CBWC 1QL8A 1EB2A 1GDNA 1GMCG 1HAVA 4I33A 2H1UA 3RC6A 4OS4A 1DX5M 3P17H 1QHRB 1VJ9U 1W7XH 2BLWA 1FV9A 2FTLE 5JBTA 2ESTE 2W7UA 4NWLA 5AVDA 3HK6B 1A5HA 1N8OC 2W7SA 1C5WB 2NU2E 1C2IA 2ZTXA 1LMWB 4IC5A 1EX3A 1O3DA 2QV1A 3AVZA 3E16B 1HFDA 2C90B 2G4TA 3B23B 2GT8A 4JZIA 1GHAF 2XNIA 2ZCKP 1BMNH 3QLPH 1ESBA 4LZ1H 3RXRA 2J38A 1DFPA 1HYLA 1UTOA 1O2SA 2AFQB 4I8LA 1CT0E 5CMXH 1RIWC 4X8SH 1PFXC 1AZZA 4JCNA 1Z7KA 3L33A 1LVYA 1DOJA 1P57B 4ZKRU 4WVPE 4TWWA 4A6LA 3MO6A 4RN6A 1Z8IB 3ZZ8A 1QL7A 1EP6A 2A2QH 2ODPA 4DG4A 1BQYA 3A89A 2FOMB 2V6NA 3TNTA 2STAE 3MI4A 3BTEE 4DVAU 3AAVA 1G32B 1QY6A 1WQVH 1AFQB 3LKWA 4MPXA 1QTFA 1T31A 4X6MA 1G3CA 2PKAA 5DKMA 4GLYA 1F7ZA 2FOAA 1MD7A 3Q76A 3RXVA 2GKVE 1PPFE 5A8ZA 1LPKB 1AQ7A 1L1GA 2XYAA 3A8AA 1IQMA 3SUDA 2ZDNA 2GTBA 1LHFH 1SLUB 2VGCC 1N6XA 2O8MA 3SGAE 3P70B 2FYQA 3SHAH 3S9AA 3HK3B 5CHAB 1YPHE 2A1DB 4VGCB 5EQQA 2FO9A 2VIWA 1MTUA 2Q6FA 3BTME 3A82A 4KP0A 1O2HA 3MH5A 5DP7A 4UDWH 3RLYH 1C5TA 4OGXA 1G37A 2PKSB 3OTJE 5EODA 4A5TS 2XXLA 2GD4B 4YT6H 2ZWLH 4KTCA 1ZYOA 1TBQH 3TGKE 1ZRBA 2M5TA 1CT4E 2BQWB 5FBIA 1LO6A 3SBKA 1A3BH 3ATMA 2F9OA 3GY4A 3SUFA 2AMDA 1TGCA 1GHVH 1CHGA 3GY3A 3IITA 4FVBA 2AS9A 4HGCA 3TH4H 1O3HA 3A80A 4DCDA 3RXLA 2ZFSA 2OC1A 4CRDA 2VIOA 1D4PB 3STIA 1BIOA 2FX4A 4FUGA 1L2EA 2AMQA 1SC8U 3TK5A 3UY9A 2Z6BD 2ZHDA 4X2YA 3PMBB 1NFUA 2UUYA 4OS1A 5ESBA 5FX6A 3KIDU 4OS5A 1D3TB 1SGFG 1QURH 1EPTB 1MMJN 1SGNE 1O3LA 3M3TA 4K8BA 1SGTA 3UREA 2AERH 1ANBA 3TH2H 1AVXA 5CHAC 4CH8B 1NFYA 1TX6A 3FP8E 1B7XB 1FMGA 4VGCC 1GL1A 6GCHF 1YPGH 2BY5X 4UD9H 3K9XB 5LPEA 4BAQB 2FI4E 2GV7A 4Q80A 3BF6H 1GBAA 4ABBA 1HJAB 1QJ1B 4MDSA 3M35A 2UWPA 1NN6A 1TX7A 1C4V2 1ZSLA 1TMUH 7GCHF 3ZVFA 4IC6A 3SNEA 4INHA 5HGGA 3ATIA 3TU7H 1LTOA 4INLA 4CRBA 1GCTB 2JH5D 4Y0YE 2FWWA 1GBEA 1MAYA 3VGCB 2Z94A 1WOFA 3MOCA 1FZZA 2VWOA 1NC6A 4UE7H 2FEQH 2P8OB 2DE9A 3ENSB 4Y71A 5C20A 1RGQA 1NY22 5FBEA 4CHAB 2W3KA 1SQAA 5F8XA 1QQ4A 2D26C 2H9TH 4XDEA 1TIOA 2XC0A 4ISNA 1TNJA 1ZJDA 3TGIE 4X8TH 1S84A 1C1PA 3RXEA 1EJMA 1GVKB 4YOIA 3RXGA 4RSPA 4Y7BA 4CRFA 5DGJA 2A5IA 2P16A 1Y59T 5C1YA 4GCHG 2P59A 2PR3A 4MPWA 2BY8X 1CGHA 4AFZA 4JMYA 1O31A 3SQHE 1K1IA 5EQSA 1K1PA 3RXPA 4CRAA 1XX9A 4YLQH 2Z9JA 3SV8A 1FONA 1E35B 1QQUA 1V3XA 3Q3YA 3RM2H 3GDVA 1KXFA 2BDAA 2C4FH 1UTQA 2A7JA 4CRCA 1D9IA 1EZUC 2CXVA 1QRWA 1AKSB 2BD4A 3K2UA 3LGUA 1FIWA 1SPJA 1PYTD 2ODYB 3QUMP 2F9UA 2FP7B 3ZV9A 2GVFA 1V2UT 1ZMNA 4NIWA 1AUJA 1C5YB 3TJUA 2A45B 1O2LA 1U6QA 1S85A 3GCOA 1C5RA 3LGVA 1ZGIA 2XRCA 4ABFA 1L0ZA 1CQQA 1GHBG 1V2VT 5JB8S 2FZZA 4E7RG 3F9GA 1KXDA 2FX6A 2UUJB 1C1QA 1AWFH 3L6PA 3QN7A 1UJ1A 1TABE 3VGCC 2Z3EA 1ZJKA 4DIIH 2TBSA 2HNTC 1TNKA 4O3TA 1F0UA 2P8OC 1O2PA 1GG6B 3W94A 3TITA 3UQOA 8GCHF 1L1JA 4NA8A 1ELBA 3TJNA 2HRVA 1L4ZA 4GUXA 3GCHB 4CHAC 2BD9A 1C9PA 1P01A 1DVAH 4X6PA 1TNHA 3E3TA 1WTGH 2SGEE 2W5EA 4TY6A 3SNDA 1QRZA 1KXBA 1NRNH 1YCPM 1ESTA 1O2XA 5DK1A 2C93B 1W3CA 1FQ3A 1DLEA 1O3BA 4FXGH 3OX7U 1SLXB 1N6YA 1EUFA 3LH1A 5FPYA 1HLTH 1WTHD 3BEFB 1ELFA 3QO6A 2PUXB 3SI4H 3D62A 3LJOA 3STJA 3IWMA 2WPKS 3F9EA 4HFPB 1EATA 1LVMA 5A0CA 1C1VH 6GCHG 1OP2A 1C5NH 3CP7A 3SI3H 2WINI 1A46H 2ZO3H 2QCYA 1YPEH 3LGTA 2Z9GA 1OKXA 1FY8E 1KLIH 1BJUA 3PWCA 2Y7ZA 3QK1A 1VCPA 1SGDE 1P2JA 1UVPA 7GCHG 1Y5AT 4DIHH 2Y80A 3A83A 4JZ1A 4XBCA 3SNAA 4YLUA 5AF9H 1OYQA 4BAMB 2BXTH 2WPJS 3UTUH 1P12E 3GY8A 1CHOG 2PGBB 2RA0A 1W2KH 2FXRA 4OS2A 1O2YA 1EOLA 4FUJA 1TRMA 3ZZDA 1LPZB 3E8LA 5HM2A 4K8YA 5FAHA 1NT1A 4I8HA 1Y8TA 2P94A 1KDQA 1UCYE 4D9QA 1NRQH 4TPIZ 2RG3A 2XTTB 3ZVDA 2BQ6B 1GG6C 1OWIA 3RXIA 1LVOA 3P6ZB 3GCHC 1UCYK 1O3PB 1GMDF 1FNIA 3U69H 3GICB 1P0SH 3K6YA 1SFQB 2F91A 4BAOB 5L6NH 3B8JA 3UOUA 3VFEA 4HI3A 1C2DA 1EP5A 1PJPA 5HMAA 4FVDA 4IBLH 1GBFA 4K1SA 3A88A 5FCRA 3RXBA 1C5MD 1TQ0B 1MH0A 1XUIA 4NIXA 1GBJA 3A86A 3PMAB 2Y5FA 1E36B 4FUEA 1EB1H 4WXIA 1K2I1 1XKAC 1EPTA 1FI8A 2ZZUH 3TH3H 4WXVA 2Y5HA 1W0ZU 2G55A 4ZHAA 1SGFA 2PTCE 3QDZB 1B0FA 4FUDA 4X2WA 1MBMA 1IQNA 2AGEX 4M7GA 4OGYA 5G4BA 1XUKA 1WV7H 1DY8A 6CHAB 2VJ1A 2VH0A 1C5UA 4F4OC 1PPBH 1MAXA 1C9TA 2CF9H 4Y8YA 4H6TA 5JBBS 3RC4A 4AOQA 2ZPQA 4WMDA 3GY7A 1NFXA 1VR1H 1O2MA 4E7NA 7LPRA 4FU8A 1TX8A 1IOEA 2G51A 5DP9A 1ZTJA 2F3CE 3LJJA 1ARCA 5GIBA 3BTKE 1HAXB 2SNVA 4YO9A 1E37B 1TPAE 1SBWA 3A7XA 1O5AB 2XWBI 3R3GB 1ZMLA 1TOMH 4MNXA 4AFQA 5DG6A 3P8NA 1DUEA 1HAOH 4DY7B 5PTPA 3RXCA 2OQUA 3ZZ7A 3MU1A 1GBKA 2VIDA 1ANDA 1O3IA 3M61U 4H4FA 3MU0A 1O34A 4HZHA 1TRNA 2G00A 2NU1E 1CT2E 4Y8ZA 3Q3XA 1Y5BT 2IJOB 1YPKH 2A4OA 4AX9H 1CA8B 3UNSA 3QZQA 4MNWA 1TWXB 4X1SU 1Q31A 1ELGA 3SJOA 1A61H 4NSVA 1MTWA 1P2MA 4JZFH 2BQ7B 3V0XA 1ORFA 4GSOA 1W13U 1CGJE 1LKBA 1OP0A 1XKBC 2GCHF 3A7ZA 3DFJA 3LGYA 2H9EH 1O3MA 4ABIA 4ZUHA 4BXSA 2OXSA 1NRPH 2QYIA 4ZAEA 3ZZ4A 3FFGA 2A2XH 1UK4A 1E0FD 1QB1A 3BG4C 2SGQE 1TA6A 2K1QA 3ZV8A 4X1QU 3KEEA 4AB8A 2AIPA 3EA9A 2FOEA 3JZ2B 5A2MH 2AIQA 4MQAA 3HGPA 1AKSA 1W10U 2BD2A 3K6ZA 4NZQA 1TOCB 1NTPA 2PV9B 4X2XA 3TNSA 6CHAC 3BV9B 2B5TB 1GBHA 1YLDA 8LPRA 2OLGA 4DURA 1GGDB 2A7HA 1TGNA 1GCDA 2BOKA 1EASA 4X0WU 3MHWU 2XW9A 1GDQA 3OY6U 1C1WH 1ETTH 3GCTF 1ZZZA 1BDAA 4CH2B 2ZA5A 1A0LA 3CS0A 3D49H 4FUIA 4B1TA 1AGJA 3FZDA 1C2JA 2XC5A 2WUBA 1LHCH 3DUXH 5L2YH 2OINA 1SSXA 1SHYA 2J34A 1B5GH 9LPRA 3O8DA 5GDSH 3S7HB 1DWDH 5HM9A 5JBAS 4BAKB 2ZU4A 3M7QA 1SI5H 2C8XB 1NFWA 4FU9A 2BZ6H 2VU8E 3SQEE 1BTZA 3U8OH 1S0QA 1SQOA 1O2RA 1TRYA 3FZZA 1BMAA 2Q6GA 2FLBH 1KY9A 2ZQ2A 1SL3A 4YTAA 1C4U2 1DXPA 1C5LH 1TPOA 1CU1A 3GCNA 1PQ8A 4KKDA 1YLCA 3GOVB 3MMGA 1C1UH 4KTUA 2EI7A 1C2KA 3LPRA 4X1PU 1OXGA 1P9UA 1ZTLA 4UFGH 1O3FA 3F1SB 4I8GA 3ZZ6A 2ILNA 1UVUH 1F5RA 2EEKA 4FUHA 1YPMH 2ZPSA 3KGPA 1PPGE 5F8ZA 1O5BB 2BD5A 3ODFA 1TPSA 3TGJE 1QJ7B 1V2PT 3O8BA 4JZDH 4IGDA 1JBUH 3ZZCA 4IW4E 1UCYH 5GCHF 5J4SA 1GGDC 2VVCA 5DP4A 2ZFTA 3BTWE 1TBRH 1ELCA 4O9VA 3VB5A 4KELA 2GCTB 3UQVA 4RKOB 3BTDE 1UK2A 3M5MA 1ABIH 1DANH 4IMQA 1JIRA 4GAWA 2VH6A 1TGSZ 2HGTH 1SQTA 1WU1A 1CSOE 3LIWA 1AU8A 1GHYH 2J92A 1SFIA 4ISLA 1G3DA 1UTNA 3P95A 1T8OA 3CENA 1KLJH 1GWAA 4GHQA 1XVMA 5H4IB 1NPMA 3DD2H 1GI6A 2GZ7A 2ZGHA 1J15A 5FXLA 3MNBA 2C8YB 5JBCS 3HKJB 2GCHG 1O5DH 1F0TA 2J4IA 4LXBH 1T4UH 1FY4A 4WF8A 1THRH 1OWHA 1S81A 3VXEH 1BT7A 1O2QA 1Z6JH 1F2SE 1A3EH 5DP8A 2BOHB 1O3OA 4MTBA 1AE8H 1P2KA 4TPYA 2F9BH 2QC2A 3QGNB 1O2UA 2B0FA 4O97A 2J2UA 3RXMA 1HGTH 2Z9KA 1WQSA 2GMTB 3ZYEA 4B2BA 2ZNKH 2BYAX 1G2LA 1ID5H 1YM0A 3KF2A 1C5VA 1KLTA 1C1MA 3M5NA 1KDQB 1RD3B 3GDUA 3B9FH 4Y10E 1P11E 3F6UH 2R2MB 1AY6H 1CGIE 5EGMA 3GCTG 2BY6X 1P2NA 1NZQH 1DS2E 3SU3A 3T2NA 1ZMJA 4O03A 1V2NT 1V2JT 1G2MA 3MO9A 1J14A 1AFQC 2ANKH 1CA0B 5EXNA 4NIYA 1YC0A 1AFEH 2GCTC 4PROA 4O3UA 2ZF0H 1DPOA 2G5VA 1HAHH 1ELVA 1TNLA 1K22H 4TY7A 1E38B 2YOLA 2VWNA 3E0NB 4GPGA 3RMOH 1INCA 1BMLA 1O38A 1Z1JA 4MPVA 3PTNA 4A92A 1O3AA 5GJ4B 1DT2A 1DWEH 2VWMA 4AG1A 2ZHEH 3FAOA 3PM3A 1VITH 3SO3A 4UEHH 1F0RA 3Q3KA 1BA8B 1HJ8A 2WV5A 2PW8H 5E0HA 3NK8A 5EQRA 3SJIA 3L3TA 4Y11E 3SU2A 3U1IB 3RU4E 1DDJA 2JETB 1D6WA 1GHAG 1QIXB 2QXJA 4KGAA 4I8KA 2NU0E 3U9AH 1Y3VA 3AW0A 3TK9A 2PLXA 1EZXC 2BD8A 4R0IA 5C5NA 1BTXA 1ZR0A 1XUFA 2PKSC 4ABAA 2ZI2H 1C5SA 3PROA 1NRRH 1KTTB 1GJ5H 2OQ5A 2Z9LA 3E1XB 1AO5A 1GJ9B 1H9LB 3FVFB 3EA7A 5E8EH 3A7TA 4SGAE 1BOQA 1Z1IA 2RCEA 3MNSA 3ODDA 4DGJA 1SMFE 4OS6A 3SJ9A 5GCHG 5E0GA 3W95A 2BDIA 1EOJA 1GMHF 4X2VA 1O33A 3ZVBA 1UO6A 3SGBE 1JIMA 1ZHMA 2G8TA 1SGYE 3MYWA 2FS8A 1GJDB 1IQKA 1RRKA 2ZFPH 1BTHH 1YBWA 2JKHA 1OYTH 3E90B 1WYKA 1D3QB 2TPIZ 1LKAA 5LPFA 1FPCH 1JRTA 1NU7B 1O39A 3I78A 3ZYDA 4ISHH 1Y3UA 1TA2A 3ZZ5A 1LDTT 1PQ7A 2ZEBA 2OC0A 3LU9B 2ZGCA 3KNXA 2A32A 1A1RA 1BRCE 1C1NA 1EPTC 1EXFA 2AH4X 5EW1H 1GI1A 2SNWA 2PSYA 1Z8RA 1SR5C 1ESAA 2XCNA 2YNBA 2ZQ1A 2A4GA 3KHVA 1IQIA 4BAHB 1GJAB 2HPQH 1RS0A 3PTBA 2XCFA 5IYTA 1TGBA 2JETC 1BMMH 2VWLA 3PWBA 1MTSA 4JYUH 1LHDH 2ZFQH 3UPEA 4B73A 1C5XB 3FANA 4HTCH 3S69A 4D9RA 4NZLA 2ZU3A 4AGJA 1Y5UT 1HJAC 1UVTH 2AMPA 3BTTE 1V2TT 1C2EA 2P3TB 3SUGA 4ISIH 2HLCA 1G30B 1GBDA 1LPGB 1WSSH 2SGFE 1DE7H 1D3PB 2HOBA 1V2MT 3KQEA 1HBTH 3HATH 5A8XA 1GCTC 3M36A 1A0HB 3SU1A 2XBXA 5EPNA 3NZIA 4ASHA 4E05H 1XVOA 1ZTKA 3EAJA 3M7TA 1GJ6A 2BHGA 1ZPCA 2BLQA 1AZ8A 1O30A 1S82A 2BD7A 1THPB 3M5OA 3GISB 3MU4A 4AN7A 1MBQA 2H2ZA 2F83A 4TYDA 5EW2H 3SU5A 2ALVA 5T6FA 2HNTE 3ITIA 1FAXA 1MQ6A 3F68H 2VIVA 2PWXA 1SGQE 5T6GA 1C1RA 1IAUA 2Y81A 2XBWA 2ALPA 2NU4E 4Q2KA 1PQ5A 4H42U 4RKJB 1V2OT 3GY2A 1A2CH 1MKWK 3UR6A 1W11U 5I46H 3ELAH 4BNRA 1C5PA 1H1BA 8KME2 1O5FH 1YYY1 4X1NU 5HXFA 2PTNA 4CR9A 3BSQA 4AFSA 1GI4A 3M3VA 2QF0A 1K1JA 1F5LA 2CMYA 1SLWB 4LK4A 1ELEE 2BZAA 4AFUA 1Z8GA 2SFAA 1K28D 4BANB 5EOKA 3E0PB 5LGOA 3PO1B 2AGIX 4XOJA 3P8FA 1C5ZB 2Z3CA 1AI8H 1ZPBA 2V3OH 4GHTA 1L4DA 2AGGX 3A8CA 3RMLH 1GMHG 3SUEA 2CHAB 3MNXA 4MLFB 2CJIA 3M3SA 4Q7XA 1C2HA 1DM4B 2ZECA 1O3KA 1KIGH 1CE5A 3TPIZ 3UFAA 1QBNA 1IQLA 2VB0A 1QR3E 1O2KA 1MCVA 2G5NA 1ZHRA 2BD3A 4XE4A 3S0NA 2B9LA 3RU4T 3DA9B 2XWAA 3EDXB 1ETRH 5ETXA 3URDA 2O8WA 1J9CH 1BTYA 2BM2A 2O9QA 5DPAA 3AAUA 3T29A 4JYTA 1HRTH 1RXPA 1P2IA 3LH3A 2ZGJA 3GY6A 2ZPRA 2FODA 2UWLA 1B0EA 1MZAA 3BN9A 4X1RU 2B7DH 3G01A 3UWJH 3MTYA 4H6SB 1GMCF 2OC8A 3QTVH 2FOFA 1DUAA 4Q7ZA 2D8WA 1P8VC 3UUZA 2PSXA 1V2QT 1HPGA 5E2OA 1SB1H 1L1NA 1FY5A 3RXJA 1AIXH 2WUCA 3N7OA 5A0AE 1DSUA 1YKTA 1SGIB 3DHKH 2IN2A 2Z3DA 3HKIB 2WYJA 5B6OA 2C3SA 1GI2A 3H7TA 3ZZAA 2QN5T 3S9BA 1P02A 1HNEE 4AYYB 4KTSA 4U2WA 1OX1A 1K1MA 2ZP0H 2ANMH 3TVJB 3RXDA 2BLVA 4WWYA 1V2ST 1W8BH 8GCHG 2CHAC 3TJVA 5K7RA 5C67A 1TQ7B 1TMBH 3VB3A 2OBQA 4MG3A 3KL6A 1RTFB 3SOSA 1TNIA 3JZ1B 1AHTH 1THSH 3RLWH 3LONA 1WBGB 2Y82A 4BTIB 1EJNA 4WMFA 1O2GH 3VB4A 1HXFH 1GJBB 4YOJA 1VZQH 1A5IA 1ZGVA 2PHBA 2O8LA 2DUCA 1O2ZA 1C1TA 3EQ0H 1QB6A 2ASUB 2FLRH 1XMNB 2BY7X 2GDDA 2UWOA 3VXFH 3SV6A 4Y8XA 1QJ6B 2ZDKA 3M7UA 4D7GA 1GDUA 1NO9H 1FDPA 1HIAA 3C1KA 1NESE 4IN1A 1QNJA 1BITA 2BY9X 2A4RA 1GPZA 1OWKA 5LH8A 2ZU2A 1LQDB 1ZSKA 1V2LT 2CF8H 6LPRA 4IMZA 1LHEH 4CBOA 3V12A 1IHSH 1DLKB 5C3NA 1MU8B 3A8DA 2D1JA
chains in the Genus database with same CATH superfamily
4WY3A 5A8YA 4NG9H 1Y3YA 1T4VH 1H9IE 1YF4A 2BDYA 3M5LA 4DJZB 1V2KT 2DE8A 1GBCA 2M2AA 2OC7A 3PRBA 7ESTE 1LCYA 3BIVH 2J9NA 3MO3A 1AB9B 2ZHFH 3ZVCA 3DFLA 1KXAA 1F92A 2IPHA 1KSNA 2PUQH 3E91A 4UONA 1G36A 1GBMA 1RTKA 1O5GH 1BUIA 4ZXYH 2GT7A 1BTPA 3P92A 3LT3A 1V2WT 4B2CA 3PMHB 3SV2H 3BTQE 2FMJA 5EG4A 2TRMA 1O2IA 2YMSC 4WH6A 4XFQA 5ABWA 4YM9A 1EAXA 2A4QA 4ZROA 1AN1E 1MKWH 3RXTA 4D8NA 1FJSA 1K1OA 1PPEE 1EAWA 2STBE 5LPRA 1XXDA 2TGTA 9ESTA 1W0JD 2ULLA 2GZ8A 1GMDG 1Y3XA 1XUHA 2GP9B 3V7TA 1MZDA 1P09A 4WMEA 2ZDAH 3MQKC 1XXFA 1NROH 3NPSA 4YOGA 1P3CA 3GDSA 3O8CA 1O5CB 3LOXA 3UOPA 3PLPA 2TGPZ 1T7CA 3FP7E 4ABHA 3U98H 1LHGH 1EAUA 2FOCA 4FETA 1YPJH 4BXWA 1ZLRA 2WSSD 3F2FA 2RDLA 3F9FA 2ZC9H 3URCA 1H8HD 4J2YB 1DITH 2NWNA 2FS9A 1XUJA 1S0RA 3H5CB 3KCGH 3RXKA 2KM0A 2BMGB 4ESTE 2C8WB 1O35A 1YP9A 3OFND 3UWIA 4I32A 1SG8B 5HIYA 1NRSH 1AE5A 5TJXA 3V3MA 1OWDA 1A4WH 3TK6A 2KAIB 1O2OA 2RA3A 4MPUA 5BPEA 3OU0A 1H4WA 4AZ2B 1AB9C 4K3JA 1Y3WA 1W0YH 4ABJA 5L2ZH 1O3JA 5IDKA 4P00A 4JZEH 5JYIA 4UFEH 5EPYA 2OCVB 1YCPK 2HNTF 4NFFA 2CN0H 4ABEA 3A85A 2UUFB 1S6HA 2JDID 3GY5A 1MU6B 4A1VA 4A1TA 4XBBA 1BRBE 1O2WA 2H5DA 3SNCA 1O37A 3D23A 3NKKA 2SGPE 2QXHA 2GX4A 1OSSA 5I25A 3UNRA 1WUNH 1F5KU 2WV4A 3A81A 4B2AA 1TBZH 2XC4A 4Y6DA 5C2ZA 2R3YA 1YPHC 3K65B 1UTLM 1BJVA 2ZFRH 3RDZA 2G52A 3SV7A 3LC3A 1T8NA 2OTVA 1GVZA 1DWBH 3P8GA 2QF4A 4D7FA 3QWCH 4TWYA 3T62A 4YZUA 1QL9A 5C17A 5C1UA 1K9OE 4I86A 4ABDA 3KQCA 4JK6A 1TALA 2FM2A 1O3NA 4Y7AA 1VGCB 4GCHF 2VVVA 3T27A 3PRDA 3PV4A 1UVOA 3PLKA 4Y76A 1JXPA 1YPLH 5GXPA 1OOKB 1TGTA 3A7WA 3GYLB 1MTVA 4BOHA 3ESTA 2ZHQH 2ZU1A 2V0BA 1VCQA 1A7SA 2KX4A 5JB9S 2A7CA 5FL7D 4CR5A 4FUFA 2PFEA 2P95A 1IQGA 3RXFA 2FPZA 3TIUA 1MUEB 1MKXH 3LGWA 1GI0A 2KCAA 2NU3E 2BXUH 4WH8A 1HAGE 1FN8A 3AASA 3BTFE 5C1XA 1HCGA 3SU0A 1S83A 2P93A 5SGAE 1VJAU 4ISOA 4IN2A 4K60A 1VKYA 1ELDE 1K21H 1OS8A 1RFNA 1VCWA 1SHHB 2WHXA 3RC5A 1QA7A 1GHBF 3QX5H 1HUTH 2WPMS 1BRUP 4XSKU 2GV6A 1SGPE 4Y79A 3SORA 3A84A 1DWCH 1HJ9A 4CRGA 3HPTB 4K1TA 2ZHWH 1WDIA 2WPLS 4U30A 1OWJA 5FHTA 4F49A 3KQDA 5FPSA 3EA8A 3MU5A 3AW1A 1D6RA 3BEIB 2EC9H 1QA0A 4Y0ZE 2R0LA 2O8TA 1GI5A 1EKBB 1EZSC 1BZXE 4A1XA 2BDCA 1BBRE 3U8TH 5GPIB 5A09A 3ZZ3A 5DP6A 3MFJA 3S9CA 1MD8A 1PQAA 3A7YA 3C27B 3HGNA 3A7VA 1SOZA 1VGCC 2QXGA 1CO7E 4K1EA 4ZKOU 4B74A 1PYTC 5FX5A 3LC5A 1UHBA 1BBRK 2W26A 2FOBA 1G3BA 3SHCH 5T3HA 1QBOA 2BX3A 2Q1JA 2ZFFH 3PYHA 4K5ZA 2UUKB 2GMTC 3MH7A 2CV3A 4I8JA 4YESB 5HYOA 1N1LA 2ANYA 3ATWA 3U28C 3NUMA 1AD8H 3ATKA 3CS7A 2HWLB 2TGAA 3V13A 1WAYB 4ZHLU 2WPIS 1FUJA 3UR9A 1YGCH 1P3EA 1NU9A 1FAKH 4NWKA 5DP3A 1GJ4H 1GBLA 1C2FA 3OYPA 3NWUA 2BB4A 3A87A 2ODQA 2QIQA 3VB6A 2I6SA 1CHOF 1BHXF 2G4UA 5L30H 2BVXH 2AEIH 1CA0C 3SJ8A 4CBNA 4DT7B 3ZVEA 1IQHA 1P2OA 2J94A 3MNCA 1VITF 3KQBA 1HIAB 4XD7D 2SGDE 2VIPA 3RU4D 4AGKA 1P03A 2ZG0H 4OM9A 4SGBE 4LZ4B 3I77A 1O2NA 2Y5GA 2FI5E 4NSYA 1DICA 1QFKH 2VVUA 2JH0D 4A7IB 1IHTH 4CREA 3SW2B 1H8DH 2FIRH 3BEUA 1QBVH 2XNDD 4E06H 2HALA 1FIZA 2QXIA 1O36A 2FDAA 5AHGH 1SGRE 5C5OA 2VNTA 3Q00A 1O3EA 1IQFA 4DW2U 1BTUA 1A0JA 1FLEE 1TFXA 1YCPH 1ACBE 3I29A 3T25A 5GWZA 2R0KA 1OP8A 1UTKA 4FUCA 1K1LA 1KXEA 1WCZA 1NS3A 4UFDH 1ETSH 2GGVB 5E2PA 3T28A 3BIUH 3T26A 5KEDA 1OPHB 5J4QA 2ZCHP 1F0SA 1O3GA 4AB9A 4D76A 4P02A 2QAAA 1FPHH 2LNCA 1QRXA 3U8RH 4K69A 1HAPH 2KAIA 3S7KB 2QY0B 2WPHS 1D3DB 1ZHPA 2QGRA 1C5OH 1TNGA 1DSTA 5F53A 1ZSJA 3H09A 5DO4H 1G3EA 2ZTZA 1O2VA 1SQRA 2EY4C 2YNAA 5F8TA 1KTSB 2HPPH 1P2QA 2R9PA 1W0KD 1PPZA 4AORA 4BTTB 1EQ9A 1Z71A 1ELAA 1H8IH 2F9PA 4JK5A 3RXAA 4NFEA 1HAVB 1SOTA 1V6DA 2ZKSA 2ZDMA 4MNVA 4AYVB 3OY5U 5HIZA 2BLOA 1A5GH 5DSFA 2G81E 4B76A 1SVPA 4XBDA 1AMHA 1AUTC 1ZPZA 3H7OA 1LVBA 4DOQA 2ZCLP 2WYGA 2V35A 2Y6TA 3KN2A 2H6MA 1MTNB 1P9SA 3VEQB 5JDUB 3WY8A 5F6MA 1E34B 2I6QA 1AVWA 1O3CA 3EE0B 1TB6H 4ZKSU 1GHWH 1ARBA 3UAIC 1GHZA 4NCYA 1T8LA 2KZ4A 3RXOA 2KR7A 4R8TB 1TONA 4ZHMU 5A0BA 2K8IA 2A0QB 3MWIU 3MH6A 3QTOH 1V2RT 3SGQE 2A31A 1ANCA 3M37A 3TLOA 4NGAH 2D2DA 2BTCE 1P04A 4ZKNU 3SZNA 2R3UA 5JPMH 1J8AA 1RJXB 1HXEH 5CE1A 2GZ9A 4ZMAH 3ZZ9A 1GJ8B 3SV9A 2ZGBH 2P3FH 2R2WU 4IS5A 1ANEA 4M9FA 2PKAB 2EA3A 2H9HA 2Z9IA 2BVRH 5EU8A 2FI3E 1HV7A 1TE0A 4TT3D 1BHXB 3MU8A 1AWHB 2ZGXH 3GYMA 1TYNA 3ZVAA 1SLVB 4OS7A 1GVLA 2O8UA 1VITG 2F9NA 4ZH8A 3ZVGA 4MNYA 2TIOA 3U1JB 1KYNA 1YWUA 3BG8A 4DT4A 2F9VA 2JH6D 3IG6B 3FP6E 1BBRH 4B71A 1HAIH 1C1OA 1C4Y2 4QT8C 2ANWA 1GI9B 2A5KA 2OD3B 2FOGA 2LPRA 3PMJA 2Q6DA 1IQEA 4BTUB 4B75A 1Z6EA 1W14U 1PPHE 2H5CA 1K1NA 2EI6A 3WWBA 1AVGH 2Z7FE 5BRRE 1JRSA 1O0DH 3SU4A 1KXCA 4I7YH 1UVSH 3QZRA 4FUBA 4X6NA 1Q2WA 3FKSD 1O5EH 1MTNC 1NM6A 1GBBA 1FY3A 3BG4B 1BB0B 4NA9H 1GI3A 2P3UB 2FYRA 2XBVA 5AFYH 3RUOA 1GI7B 5EXLA 4NIVA 3Q77A 2C8ZB 1LQEA 7KMEH 3RMMH 5AFZH 1S6FA 1GL0E 1CVWH 2SGAA 3BTHE 2LP6A 5K0HA 5IK2D 3PO1C 1FXYA 3UNQA 3PB1E 1HDTH 3EGKH 4I31A 1QGFA 1ABJH 1J17T 1GJCB 2W6ID 3OE7D 1JMOH 2HVXA 1ZRKA 1XUGA 1UK3A 5TCAA 1DXWA 3VPKA 3O8RA 3SN8A 5DP5A 5DJ7A 4YT7H 1T32A 4Z0KA 2OBOA 2GJGA 1J16A 1C1SA 2VIQA 1HAZB 1FN6A 1MKXK 1O2JA 1GBTA 4ACAA 3LGIA 5E0JA 3LDXH 4X8VH 3VB7A 1MQ5A 2OUAA 2B8OH 1BCUH 1UTMA 5FCKA 5FPTA 1EAIA 3E6PH 1M9UA 1C5QA 6ESTA 3BTGE 2ZU5A 1HAYB 2XBYA 3P8OA 1CBWB 5ESTE 5TCCA 4WJG2 1UHBB 1Q3XA 2CGAA 3TJOA 1IQJA 4NA7A 4FU7A 1QCPA 3RM0H 2FTMA 1W12U 2W3IA 1T8MA 4TSFD 2IOTA 1N8OB 3SNBA 2AYWA 4MVNA 4Q7YA 3SU6A 1C2MA 1X7AC 4UFFH 2EI8A 1QB9A 1EJAA 1FY1A 3NCLA 4GVUA 4JYVH 2TGDA 2ZDLA 2Y7XA 1TMTH 2GDEH 3F0PA 2BDBA 3OSYA 1KMHB 1GBIA 3RMNH 2BDGA 2BDHA 1P10A 4INKA 1RIWB 1NBMD 3RP2A 1HB0B 1C2LA 1ELTA 1SGCA 2ZTYA 2BX4A 2L74A 1GI8B 3ATLA 2A5AA 1TPPA 2FOHA 1BRAA 1H9HE 1P05A 2BVSH 1MCTA 3T5FH 1JOUB 1XM1A 2ZIQH 2OP9A 3ZZBA 3DT0H 3RXQA 3RXUA 1TLDA 1G9IE 4Z6AH 5F03A 5EXMA 4AG2A 3F9HA 1TAWA 3QGJA 3MH4A 8ESTE 2J95A 4J1YA 4U32A 1BTWA 2QF3A 3GS9A 1UTJA 1YLNA 4X8UH 4X6OA 1SGEE 3A8BA 3SJKA 1OWEA 3R0FA 1EZQA 1O32A 4LOYH 3D65E 3UIRA 1GHXH 3EYDA 5T6DA 2FESH 2ZDVH 1GJ7B 2THFB 2XOKD 4U01A 1O2TA 3RXHA 2QA9E 1C2GA 1UMAH 2PGQB 1W7GH 1Z8JB 2EQNA 1S5SA 1UTPA 2V3HH 4THNH 1PPCE 2VGCB 1ZOMA 3RXSA 2VINA 3NXPA 1P06A 1RTLA 1DY9A 1JWTA 4K2YA 3PLBA 4ABGA 4ZXXH 1CBWC 1QL8A 1EB2A 1GDNA 1GMCG 1HAVA 4I33A 2W6JD 2H1UA 3RC6A 4OS4A 1DX5M 3P17H 1QHRB 1VJ9U 1W7XH 2BLWA 1FV9A 2FTLE 5JBTA 2ESTE 2W7UA 4NWLA 5AVDA 3HK6B 1A5HA 1N8OC 2W7SA 1C5WB 2NU2E 1C2IA 2ZTXA 1LMWB 4IC5A 1EX3A 1O3DA 2QV1A 3AVZA 3E16B 1HFDA 2C90B 2G4TA 3B23B 2GT8A 4JZIA 1GHAF 2XNIA 2ZCKP 1BMNH 3QLPH 4RI0A 1ESBA 4LZ1H 3RXRA 2J38A 1DFPA 5HKKD 1HYLA 1UTOA 1O2SA 2AFQB 4I8LA 1CT0E 5CMXH 5CDFE 1RIWC 4X8SH 1PFXC 1AZZA 4JCNA 1Z7KA 3L33A 1LVYA 1DOJA 1P57B 4ZKRU 4WVPE 4TWWA 4A6LA 3MO6A 4RN6A 1Z8IB 3ZZ8A 1QL7A 1EP6A 2A2QH 1UW7A 1MABB 2ODPA 4DG4A 1BQYA 3A89A 2FOMB 2V6NA 3TNTA 2STAE 3MI4A 3BTEE 2YMSD 4B6EA 4DVAU 3AAVA 1G32B 1QY6A 1WQVH 1AFQB 3LKWA 4MPXA 1QTFA 1T31A 4X6MA 1G3CA 2PKAA 5DKMA 4GLYA 1F7ZA 2FOAA 1MD7A 3Q76A 3RXVA 2GKVE 1PPFE 5A8ZA 1LPKB 1AQ7A 1L1GA 2XYAA 3A8AA 1IQMA 3SUDA 2ZDNA 2GTBA 1LHFH 1SLUB 2VGCC 1N6XA 2O8MA 3SGAE 1WXRA 3P70B 2FYQA 3SHAH 3S9AA 3HK3B 5CHAB 1YPHE 2A1DB 4VGCB 5EQQA 2FO9A 5KGOA 2VIWA 1MTUA 2Q6FA 3BTME 3A82A 4KP0A 1O2HA 3MH5A 5DP7A 4UDWH 3RLYH 1C5TA 4OGXA 1G37A 2PKSB 3OTJE 5EODA 4A5TS 2XXLA 2GD4B 4YT6H 2ZWLH 4KTCA 1ZYOA 1TBQH 3TGKE 1ZRBA 2M5TA 1CT4E 2BQWB 5FBIA 1E1QD 1LO6A 3F0OA 3SBKA 1A3BH 3ATMA 2F9OA 3GY4A 3SUFA 2AMDA 1TGCA 1GHVH 1CHGA 3GY3A 5T1VA 3IITA 4FVBA 2AS9A 4HGCA 3TH4H 1O3HA 3A80A 4DCDA 3RXLA 2ZFSA 2OC1A 4CRDA 2VIOA 1D4PB 3STIA 1BIOA 2FX4A 4FUGA 1L2EA 2AMQA 1SC8U 3TK5A 3UY9A 2Z6BD 2ZHDA 4X2YA 2K0QA 3PMBB 1NFUA 2UUYA 4OS1A 5ESBA 5FX6A 3KIDU 4OS5A 1D3TB 1SGFG 4HG6A 1QURH 1EPTB 1MMJN 1SGNE 1O3LA 3M3TA 4K8BA 1SGTA 3UREA 4RT0A 2AERH 1ANBA 4ACBA 3TH2H 1AVXA 5CHAC 4CH8B 1NFYA 1TX6A 3FP8E 1B7XB 3DSPA 1FMGA 2KFWA 4VGCC 1GL1A 6GCHF 1YPGH 2QF5A 2BY5X 4UD9H 3K9XB 3DSOA 3OEHD 5LPEA 4BAQB 2FI4E 2GV7A 4Q80A 3BF6H 1GBAA 5C0UA 4ABBA 1HJAB 1QJ1B 4MDSA 3M35A 2UWPA 1NN6A 1TX7A 1C4V2 1ZSLA 1TMUH 7GCHF 3ZVFA 4IC6A 3SNEA 4INHA 5HGGA 3ATIA 2RDEA 3TU7H 1LTOA 4INLA 4CRBA 1GCTB 2JH5D 4Y0YE 3SZEA 2FWWA 1GBEA 1MAYA 3VGCB 2Z94A 1WOFA 3MOCA 3NRLA 1FZZA 2VWOA 1NC6A 4UE7H 2FEQH 2P8OB 2DE9A 3ENSB 4Y71A 5C20A 1RGQA 1NY22 5FBEA 4CHAB 2W3KA 1SQAA 5F8XA 1QQ4A 2D26C 2H9TH 4YXWD 2KCPA 4XDEA 2J5UA 1TIOA 2XC0A 4ISNA 1TNJA 4Z1MD 1ZJDA 3TGIE 4X8TH 1S84A 1C1PA 3RXEA 1EJMA 1GVKB 4YOIA 3RXGA 4RSPA 4Y7BA 4CRFA 5DGJA 2A5IA 2P16A 1Y59T 5C1YA 4GCHG 2P59A 2PR3A 4MPWA 2BY8X 1CGHA 3OAAD 4AFZA 4JMYA 1O31A 3SQHE 1K1IA 5B6LA 5EQSA 1K1PA 3RXPA 4CRAA 3WW7A 1XX9A 4YLQH 2Z9JA 3SV8A 1FONA 1E35B 3FOAA 1QQUA 3PV5A 1V3XA 3Q3YA 3RM2H 3GDVA 1KXFA 2BDAA 2C4FH 1UTQA 2A7JA 4CRCA 1D9IA 1EZUC 2CXVA 1QRWA 1AKSB 2BD4A 3K2UA 3LGUA 1FIWA 1SPJA 2OK5A 1PYTD 2ODYB 3QUMP 2F9UA 2FP7B 3ZV9A 2GVFA 1V2UT 1ZMNA 4NIWA 1AUJA 4XRNA 1C5YB 3TJUA 2A45B 1O2LA 1U6QA 1S85A 3GCOA 1C5RA 3LGVA 1ZGIA 2XRCA 4ABFA 1L0ZA 1CQQA 1GHBG 1V2VT 5JB8S 2FZZA 4E7RG 3F9GA 1KXDA 2FX6A 2UUJB 1C1QA 1AWFH 3L6PA 3QN7A 1UJ1A 1TABE 3VGCC 2Z3EA 1ZJKA 4DIIH 3WWFA 4ZCNA 2TBSA 2HNTC 1TNKA 2J98B 4O3TA 1F0UA 2P8OC 1O2PA 1GG6B 3W94A 3TITA 3UQOA 8GCHF 1L1JA 4NA8A 1ELBA 3TJNA 2HRVA 2JJ2D 1L4ZA 4GUXA 3GCHB 3N7DA 4CHAC 2BD9A 1C9PA 1P01A 1DVAH 4X6PA 1TNHA 3E3TA 1WTGH 4F55A 2SGEE 2W5EA 4TY6A 3SNDA 1QRZA 1KXBA 1NRNH 1YCPM 1ESTA 1O2XA 2IPQX 5DK1A 2C93B 1W3CA 1FQ3A 1DLEA 1O3BA 4FXGH 3OX7U 1SLXB 1N6YA 2J97A 1EUFA 3LH1A 5FPYA 1HLTH 1WTHD 2AHME 3BEFB 1ELFA 3QO6A 2PUXB 3SI4H 3D62A 3LJOA 3STJA 3IWMA 2WPKS 3F9EA 4HFPB 1EATA 1LVMA 3N99A 5A0CA 1C1VH 6GCHG 1OP2A 1C5NH 3CP7A 2WZQA 3SI3H 2WINI 1A46H 2ZO3H 2QCYA 1YPEH 3LGTA 2Z9GA 1OKXA 1FY8E 1KLIH 1BJUA 3PWCA 2Y7ZA 3QK1A 1VCPA 1SGDE 1P2JA 1UVPA 7GCHG 1Y5AT 4DIHH 2Y80A 3A83A 4JZ1A 4XBCA 3SNAA 4YLUA 5AF9H 4Q63A 4RT1A 1OYQA 4BAMB 4B6FA 2BXTH 2WPJS 3UTUH 1P12E 3GY8A 1CHOG 2PGBB 2RA0A 1W2KH 2FXRA 1E79D 4OS2A 5C0TA 1O2YA 1EOLA 4FUJA 1TRMA 3ZZDA 1LPZB 3E8LA 5HM2A 4K8YA 5FAHA 1NT1A 4I8HA 1Y8TA 2P94A 1KDQA 1UCYE 4D9QA 4ASUD 1NRQH 4TPIZ 2RG3A 2XTTB 3ZVDA 2BQ6B 1GG6C 1OWIA 3RXIA 1LVOA 3P6ZB 3GCHC 1UCYK 1O3PB 1GMDF 1FNIA 3U69H 3GICB 1P0SH 3K6YA 1SFQB 2F91A 4BAOB 1QZ8A 3B8JA 5L6NH 3UOUA 3VFEA 4HI3A 1C2DA 1EP5A 1PJPA 5HMAA 4FVDA 4IBLH 1GBFA 4K1SA 3A88A 5FCRA 3RXBA 1C5MD 1TQ0B 1MH0A 1XUIA 4NIXA 1GBJA 3A86A 3PMAB 3ZIAD 2Y5FA 1E36B 4FUEA 1EB1H 4WXIA 1K2I1 1XKAC 1EPTA 1FI8A 2ZZUH 3TH3H 4WXVA 2Y5HA 1W0ZU 2G55A 4ZHAA 1SGFA 2PP6A 2PTCE 1B0FA 3QDZB 4FUDA 4X2WA 1MBMA 1IQNA 2AGEX 4M7GA 4OGYA 5G4BA 1XUKA 1WV7H 1DY8A 6CHAB 2VJ1A 2VH0A 1C5UA 4F4OC 1PPBH 1MAXA 1C9TA 2CF9H 4Y8YA 4H6TA 5JBBS 3RC4A 4AOQA 2ZPQA 4WMDA 3GY7A 1NFXA 1VR1H 1O2MA 4E7NA 7LPRA 4FU8A 1TX8A 1IOEA 2G51A 5DP9A 1ZTJA 2F3CE 3LJJA 1ARCA 5GIBA 3BTKE 1HAXB 2SNVA 2YMSB 4YO9A 1E37B 1TPAE 1SBWA 2V3MA 3A7XA 1O5AB 1COWD 2XWBI 3R3GB 1ZMLA 1TOMH 4MNXA 4AFQA 5DG6A 3P8NA 1DUEA 1HAOH 4DY7B 5EJ1A 5PTPA 3RXCA 2OQUA 3ZZ7A 3MU1A 1GBKA 2VIDA 1ANDA 1O3IA 3M61U 4H4FA 3MU0A 1O34A 1E1RD 4HZHA 1TRNA 2G00A 2NU1E 1CT2E 4Y8ZA 3Q3XA 1Y5BT 2IJOB 1YPKH 2A4OA 4AX9H 1CA8B 3UNSA 3QZQA 4MNWA 1TWXB 4X1SU 1Q31A 1ELGA 3SJOA 1A61H 4NSVA 1MTWA 2JIZD 1P2MA 4JZFH 2BQ7B 3V0XA 1ORFA 4GSOA 1W13U 1CGJE 1LKBA 1OP0A 1XKBC 2GCHF 3A7ZA 3DFJA 3FN8A 3LGYA 2H9EH 1O3MA 4ABIA 4ZUHA 4BXSA 2OXSA 1NRPH 2QYIA 4ZAEA 3ZZ4A 3FFGA 2A2XH 1UK4A 1E0FD 1QB1A 3BG4C 2SGQE 5C94A 1TA6A 1SKYE 2K1QA 3ZV8A 4X1QU 3KEEA 4AB8A 3FO8D 2AIPA 3EA9A 5EJZA 2FOEA 3JZ2B 5A2MH 2AIQA 4MQAA 3DCLA 3HGPA 1AKSA 1W10U 2BD2A 3K6ZA 4NZQA 1TOCB 1NTPA 2PV9B 4X2XA 3TNSA 6CHAC 3BV9B 2B5TB 1GBHA 1YLDA 8LPRA 2OLGA 4DURA 1GGDB 2A7HA 1TGNA 1GCDA 2BOKA 1EASA 4X0WU 3MHWU 2XW9A 1GDQA 3OY6U 1C1WH 1ETTH 3GCTF 1ZZZA 1BDAA 4CH2B 2ZA5A 1A0LA 3CS0A 3D49H 4FUIA 4B1TA 1AGJA 3FZDA 1C2JA 2XC5A 2WUBA 1LHCH 3DUXH 5L2YH 2OINA 3F3BA 1EFRD 1SSXA 1SHYA 2J34A 1B5GH 9LPRA 3O8DA 5GDSH 3S7HB 1DWDH 5HM9A 5JBAS 2J98A 2ZU4A 4BAKB 2WPDD 3M7QA 1SI5H 2C8XB 1NFWA 4FU9A 2BZ6H 2VU8E 3SQEE 1BTZA 3U8OH 1S0QA 3OEED 1SQOA 1O2RA 1TRYA 3FZZA 5DN6D 1BMAA 2Q6GA 2FLBH 1KY9A 2ZQ2A 1SL3A 4YTAA 1C4U2 1DXPA 1C5LH 1TPOA 1CU1A 3GCNA 1PQ8A 4KKDA 1YLCA 5CHBA 3GOVB 3MMGA 1C1UH 4KTUA 2EI7A 1C2KA 3LPRA 4X1PU 2F43B 1OXGA 1P9UA 2KCYA 1ZTLA 4UFGH 1O3FA 3F1SB 4I8GA 3ZZ6A 2ILNA 1UVUH 1F5RA 2EEKA 4FUHA 1YPMH 2ZPSA 3KGPA 1PPGE 5F8ZA 1O5BB 2BD5A 3ODFA 1TPSA 3TGJE 1QJ7B 1V2PT 3O8BA 4JZDH 3N7EA 4IGDA 1JBUH 3ZZCA 4IW4E 1UCYH 5GCHF 5J4SA 1GGDC 2VVCA 5DP4A 2ZFTA 3BTWE 3KQ5A 1TBRH 2RFKC 1ELCA 4O9VA 3VB5A 4KELA 2GCTB 1H8ED 3UQVA 4RKOB 3BTDE 1UK2A 3M5MA 1ABIH 1DANH 4IMQA 4F48B 1JIRA 4GAWA 2VH6A 1TGSZ 2HGTH 1SQTA 1WU1A 1CSOE 3LIWA 1AU8A 1GHYH 2J92A 1SFIA 4ISLA 1G3DA 1UTNA 3P95A 1T8OA 3CENA 1KLJH 1GWAA 4GHQA 1XVMA 5H4IB 1NPMA 3DD2H 1GI6A 2GZ7A 2ZGHA 1J15A 5FXLA 3MNBA 2C8YB 5JBCS 3HKJB 2GCHG 1O5DH 1F0TA 2J4IA 4LXBH 1T4UH 1FY4A 4WF8A 2KCOA 1THRH 1OWHA 1S81A 3VXEH 1BT7A 1O2QA 1Z6JH 1F2SE 1A3EH 5DP8A 2BOHB 1O3OA 4MTBA 1AE8H 1P2KA 4TPYA 2F9BH 2QC2A 3QGNB 1O2UA 2B0FA 4O97A 2J2UA 3RXMA 1HGTH 2Z9KA 1WQSA 2GMTB 3ZYEA 4B2BA 2ZNKH 2WV9A 2BYAX 1G2LA 1ID5H 1YM0A 3KF2A 1C5VA 1KLTA 1C1MA 3M5NA 1KDQB 1RD3B 3GDUA 3B9FH 4Y10E 1P11E 3F6UH 3KYGA 2R2MB 1AY6H 1CGIE 5EGMA 3GCTG 2BY6X 1P2NA 1NZQH 1DS2E 3SU3A 3T2NA 1ZMJA 4O03A 1V2NT 1V2JT 1G2MA 5KECA 3AK5A 3MO9A 1J14A 1AFQC 2ANKH 1CA0B 5EXNA 4NIYA 1YC0A 1AFEH 2GCTC 4PROA 4O3UA 2ZF0H 1DPOA 2G5VA 1HAHH 1ELVA 5EJLA 1TNLA 1K22H 4TY7A 1E38B 2YOLA 2VWNA 3E0NB 4GPGA 3RMOH 1INCA 1BMLA 1O38A 1Z1JA 4MPVA 3PTNA 4A92A 1O3AA 5GJ4B 1DT2A 1DWEH 2VWMA 2HVYB 4AG1A 2ZHEH 3FAOA 3PM3A 1VITH 3SO3A 4UEHH 1F0RA 3Q3KA 1BA8B 1HJ8A 2WV5A 2PW8H 5E0HA 3NK8A 5EQRA 3SJIA 3L3TA 4Y11E 3SU2A 3U1IB 3RU4E 1DDJA 2JETB 1D6WA 1GHAG 1QIXB 2QXJA 4KGAA 4I8KA 2NU0E 3U9AH 1Y3VA 3AW0A 3TK9A 2PLXA 1EZXC 2JJ1D 2BD8A 4R0IA 5C5NA 1BTXA 1ZR0A 3F2HA 1XUFA 2PKSC 4ABAA 2ZI2H 1C5SA 3PROA 1NRRH 1KTTB 4Q4LA 1GJ5H 2OQ5A 2Z9LA 3E1XB 1AO5A 1GJ9B 1H9LB 3FVFB 3EA7A 5E8EH 3A7TA 4SGAE 1BOQA 1Z1IA 2RCEA 3MNSA 3ODDA 4DGJA 1SMFE 4OS6A 3SJ9A 5GCHG 5E0GA 3W95A 2BDIA 1EOJA 1GMHF 4X2VA 1O33A 3ZVBA 1UO6A 3SGBE 1JIMA 1ZHMA 2G8TA 1SGYE 4FOUC 3MYWA 2FS8A 1GJDB 2F4LA 3F2GA 1IQKA 1RRKA 2ZFPH 1BTHH 1YBWA 2JKHA 1OYTH 3E90B 1WYKA 1D3QB 2TPIZ 1LKAA 5LPFA 3PV2A 1FPCH 1JRTA 1NU7B 1O39A 2VBCA 3I78A 3ZYDA 3DSGA 4ISHH 1Y3UA 1TA2A 3ZZ5A 1LDTT 1PQ7A 2ZEBA 2OC0A 3LU9B 2ZGCA 3KNXA 2A32A 1A1RA 1BRCE 1C1NA 2QE7D 1EPTC 1EXFA 2AH4X 5EW1H 1GI1A 2SNWA 2PSYA 1Z8RA 1SR5C 1ESAA 2XCNA 2YNBA 2ZQ1A 2A4GA 3KHVA 1IQIA 4BAHB 1GJAB 2HPQH 1RS0A 3PTBA 2XCFA 5IYTA 1TGBA 2JETC 1BMMH 2VWLA 3PWBA 1MTSA 4JYUH 1LHDH 2ZFQH 3UPEA 4B73A 1C5XB 3FANA 4HTCH 3S69A 4D9RA 4NZLA 2ZU3A 4AGJA 1Y5UT 5GNDA 1HJAC 1UVTH 2AMPA 3BTTE 1V2TT 1C2EA 2P3TB 3SUGA 4ISIH 2HLCA 1G30B 1GBDA 1LPGB 1WSSH 2SGFE 1DE7H 1D3PB 2HOBA 1V2MT 3KQEA 1HBTH 3HATH 5A8XA 1GCTC 3M36A 1A0HB 3SU1A 2XBXA 2HLDD 5EPNA 3NZIA 4ASHA 4E05H 1XVOA 1ZTKA 1FX0B 3KYFA 3EAJA 3M7TA 1GJ6A 2BHGA 1ZPCA 2BLQA 1AZ8A 1O30A 1S82A 2BD7A 1THPB 3M5OA 3GISB 3MU4A 4AN7A 1MBQA 2H2ZA 2F83A 4TYDA 5EW2H 3SU5A 2ALVA 5T6FA 2HNTE 3ITIA 1FAXA 1MQ6A 3F68H 2VIVA 2PWXA 1SGQE 5T6GA 1C1RA 1IAUA 2Y81A 2XBWA 2ALPA 2NU4E 4Q2KA 2LELA 1PQ5A 4H42U 4RKJB 1V2OT 3GY2A 1A2CH 1MKWK 3UR6A 1W11U 5I46H 3ELAH 4BNRA 1C5PA 1H1BA 8KME2 1O5FH 1YYY1 4X1NU 5HXFA 3W1EA 2PTNA 4CR9A 3BSQA 4AFSA 1GI4A 3M3VA 3EE7A 2QF0A 1K1JA 1F5LA 2CMYA 1SLWB 4LK4A 1ELEE 2BZAA 4AFUA 1YY3A 1Z8GA 2SFAA 1K28D 4BANB 5EOKA 3E0PB 5LGOA 3PO1B 2AGIX 4XOJA 3P8FA 1C5ZB 2Z3CA 1AI8H 1ZPBA 2V3OH 4GHTA 1L4DA 2AGGX 3A8CA 3RMLH 1GMHG 3SUEA 2CHAB 3MNXA 4MLFB 2CJIA 3M3SA 4Q7XA 1C2HA 1DM4B 2ZECA 1O3KA 1KIGH 1CE5A 3TPIZ 3UFAA 1QBNA 3UB0A 1IQLA 2VB0A 1QR3E 1O2KA 1MCVA 2G5NA 1ZHRA 2BD3A 4XE4A 3S0NA 1S6LA 2B9LA 3RU4T 3DA9B 2XWAA 3EDXB 1ETRH 5ETXA 3URDA 2O8WA 1J9CH 1BTYA 2BM2A 2O9QA 5DPAA 3AAUA 3T29A 4JYTA 1HRTH 1RXPA 1P2IA 3LH3A 2ZGJA 3GY6A 2ZPRA 2FODA 2UWLA 3CNRA 1B0EA 1K0HA 1MZAA 3BN9A 4X1RU 2B7DH 3G01A 2V7QD 3UWJH 3MTYA 4H6SB 1GMCF 2OC8A 3QTVH 2FOFA 1DUAA 4Q7ZA 2D8WA 1P8VC 3UUZA 2PSXA 1V2QT 1HPGA 5E2OA 1SB1H 1L1NA 1FY5A 3RXJA 1AIXH 2WUCA 3N7OA 5A0AE 1DSUA 1YKTA 1SGIB 3DHKH 2IN2A 2Z3DA 3HKIB 3SYJA 2WYJA 2CK3D 2L6OA 5B6OA 3VG8A 2C3SA 1GI2A 3H7TA 3ZZAA 2QN5T 3S9BA 1OHHD 1P02A 1HNEE 4AYYB 4KTSA 4U2WA 1NBME 3OTPA 1OX1A 1K1MA 2ZP0H 2IJD1 2ANMH 3TVJB 3RXDA 2BLVA 4AC9A 4WWYA 1V2ST 1W8BH 5EIYA 8GCHG 2CHAC 3TJVA 5K7RA 5C67A 1TQ7B 1TMBH 3VB3A 2OBQA 4MG3A 3KL6A 1RTFB 1BMFD 3SOSA 1TNIA 3JZ1B 1AHTH 1THSH 3RLWH 3LONA 1WBGB 2Y82A 4BTIB 1EJNA 4WMFA 1O2GH 3VB4A 1HXFH 1GJBB 4YOJA 1VZQH 1A5IA 1ZGVA 2PHBA 2O8LA 2DUCA 1O2ZA 1C1TA 3EQ0H 1QB6A 2ASUB 2FLRH 1XMNB 2BY7X 2GDDA 2UWOA 3VXFH 3SV6A 4Y8XA 1QJ6B 2ZDKA 3M7UA 4D7GA 1GDUA 1NO9H 1FDPA 1HIAA 3C1KA 1NESE 4IN1A 1QNJA 1BITA 2BY9X 2A4RA 1GPZA 1OWKA 5LH8A 2ZU2A 1LQDB 1ZSKA 1V2LT 2CF8H 6LPRA 4IMZA 1LHEH 4CBOA 3V12A 1IHSH 1DLKB 5C3NA 1MU8B 3A8DA 2D1JA
chains in the Genus database with same CATH topology
4WY3A 5A8YA 4NG9H 1Y3YA 1T4VH 1H9IE 1YF4A 2BDYA 3M5LA 4DJZB 1V2KT 2DE8A 1GBCA 2OC7A 7ESTE 1LCYA 3BIVH 2J9NA 3MO3A 1AB9B 2ZHFH 3ZVCA 3DFLA 1KXAA 1F92A 2IPHA 1KSNA 2PUQH 3E91A 4UONA 1G36A 1GBMA 1RTKA 1O5GH 1BUIA 4ZXYH 2GT7A 1BTPA 3P92A 3LT3A 1V2WT 4B2CA 3PMHB 3SV2H 3BTQE 2FMJA 5EG4A 2TRMA 1O2IA 4WH6A 4XFQA 5ABWA 4YM9A 1EAXA 2A4QA 4ZROA 1AN1E 1MKWH 3RXTA 4D8NA 1FJSA 1K1OA 1PPEE 1EAWA 2STBE 5LPRA 1XXDA 2TGTA 9ESTA 2ULLA 2GZ8A 1GMDG 1Y3XA 1XUHA 2GP9B 3V7TA 1MZDA 1P09A 4WMEA 2ZDAH 1XXFA 1NROH 3NPSA 4YOGA 1P3CA 3GDSA 3O8CA 1O5CB 3LOXA 3UOPA 3PLPA 2TGPZ 1T7CA 3FP7E 4ABHA 3U98H 1LHGH 1EAUA 2FOCA 1YPJH 4BXWA 1ZLRA 2RDLA 3F9FA 2ZC9H 3URCA 4J2YB 1DITH 2NWNA 2FS9A 1XUJA 1S0RA 3H5CB 3KCGH 3RXKA 2BMGB 4ESTE 2C8WB 1O35A 1YP9A 3UWIA 4I32A 1SG8B 5TJXA 1NRSH 1AE5A 3V3MA 1OWDA 1A4WH 3TK6A 2KAIB 1O2OA 2RA3A 4MPUA 5BPEA 3OU0A 1H4WA 4AZ2B 1AB9C 4K3JA 1Y3WA 1W0YH 4ABJA 5L2ZH 1O3JA 5IDKA 4JZEH 5JYIA 4UFEH 5EPYA 2OCVB 1YCPK 2HNTF 4NFFA 2CN0H 4ABEA 3A85A 2UUFB 1S6HA 3GY5A 1MU6B 4A1VA 4A1TA 4XBBA 1BRBE 1O2WA 2H5DA 3SNCA 1O37A 3D23A 3NKKA 2SGPE 2QXHA 2GX4A 1OSSA 5I25A 3UNRA 1WUNH 1F5KU 2WV4A 3A81A 4B2AA 1TBZH 2XC4A 4Y6DA 5C2ZA 2R3YA 1YPHC 3K65B 1UTLM 1BJVA 2ZFRH 3RDZA 2G52A 3SV7A 3LC3A 1T8NA 2OTVA 1GVZA 1DWBH 3P8GA 4D7FA 3QWCH 4TWYA 3T62A 4YZUA 1QL9A 5C1UA 1K9OE 4ABDA 3KQCA 4JK6A 1TALA 2FM2A 1O3NA 4Y7AA 1VGCB 4GCHF 2VVVA 3T27A 3PV4A 1UVOA 3PLKA 4Y76A 1JXPA 1YPLH 5GXPA 1OOKB 1TGTA 3A7WA 3GYLB 1MTVA 4BOHA 3ESTA 2ZHQH 2ZU1A 2V0BA 1VCQA 1A7SA 5JB9S 2A7CA 4CR5A 4FUFA 2PFEA 2P95A 1IQGA 3RXFA 2FPZA 3TIUA 1MUEB 1MKXH 3LGWA 1GI0A 2NU3E 2BXUH 4WH8A 1HAGE 1FN8A 3AASA 3BTFE 5C1XA 1HCGA 3SU0A 1S83A 2P93A 5SGAE 1VJAU 4ISOA 4IN2A 4K60A 1ELDE 1K21H 1OS8A 1RFNA 1VCWA 1SHHB 3RC5A 1QA7A 1GHBF 3QX5H 1HUTH 2WPMS 1BRUP 4XSKU 2GV6A 1SGPE 4Y79A 3SORA 3A84A 1DWCH 1HJ9A 4CRGA 3HPTB 4K1TA 2ZHWH 2WPLS 4U30A 1OWJA 5FHTA 4F49A 3KQDA 5FPSA 3EA8A 3MU5A 3AW1A 1D6RA 3BEIB 2EC9H 1QA0A 4Y0ZE 2R0LA 2O8TA 1GI5A 1EKBB 1EZSC 1BZXE 4A1XA 2BDCA 1BBRE 3U8TH 5GPIB 5A09A 3ZZ3A 5DP6A 3MFJA 3S9CA 1MD8A 1PQAA 3A7YA 3C27B 3HGNA 3A7VA 1SOZA 1VGCC 2QXGA 1CO7E 4K1EA 4ZKOU 4B74A 1PYTC 5FX5A 3LC5A 1UHBA 1BBRK 2W26A 2FOBA 1G3BA 3SHCH 5T3HA 1QBOA 2BX3A 2Q1JA 2ZFFH 3PYHA 4K5ZA 2UUKB 2GMTC 3MH7A 2CV3A 4I8JA 4YESB 5HYOA 1N1LA 2ANYA 3ATWA 3NUMA 1AD8H 3ATKA 3CS7A 2HWLB 2TGAA 3V13A 1WAYB 4ZHLU 2WPIS 1FUJA 3UR9A 1YGCH 1P3EA 1NU9A 1FAKH 4NWKA 5DP3A 1GJ4H 1GBLA 1C2FA 3OYPA 3NWUA 2BB4A 3A87A 2ODQA 2QIQA 3VB6A 2I6SA 1CHOF 1BHXF 2G4UA 5L30H 2BVXH 2AEIH 1CA0C 3SJ8A 4CBNA 4DT7B 3ZVEA 1IQHA 1P2OA 2J94A 3MNCA 1VITF 3KQBA 1HIAB 2SGDE 2VIPA 3RU4D 4AGKA 1P03A 2ZG0H 4SGBE 4LZ4B 3I77A 1O2NA 2Y5GA 2FI5E 4NSYA 1DICA 1QFKH 2VVUA 2JH0D 4A7IB 1IHTH 4CREA 3SW2B 1H8DH 2FIRH 3BEUA 1QBVH 4E06H 2HALA 1FIZA 2QXIA 1O36A 2FDAA 5AHGH 1SGRE 5C5OA 2VNTA 3Q00A 1O3EA 1IQFA 4DW2U 1BTUA 1A0JA 1FLEE 1TFXA 1YCPH 1ACBE 3I29A 3T25A 5GWZA 2R0KA 1OP8A 1UTKA 4FUCA 1K1LA 1KXEA 1WCZA 1NS3A 4UFDH 1ETSH 2GGVB 5E2PA 3T28A 3BIUH 3T26A 1OPHB 5J4QA 2ZCHP 1F0SA 1O3GA 4AB9A 4D76A 2QAAA 1FPHH 2LNCA 1QRXA 3U8RH 4K69A 1HAPH 2KAIA 3S7KB 2QY0B 2WPHS 1D3DB 1ZHPA 2QGRA 1C5OH 1TNGA 1DSTA 1ZSJA 5DO4H 1G3EA 2ZTZA 1O2VA 2YNAA 5F8TA 1KTSB 2HPPH 1P2QA 2R9PA 1PPZA 4AORA 4BTTB 1EQ9A 1Z71A 1ELAA 1H8IH 2F9PA 4JK5A 3RXAA 4NFEA 1HAVB 1SOTA 1V6DA 2ZKSA 2ZDMA 4MNVA 4AYVB 3OY5U 2BLOA 1A5GH 2G81E 4B76A 1SVPA 4XBDA 1AMHA 1AUTC 1ZPZA 3H7OA 1LVBA 4DOQA 2ZCLP 2WYGA 2V35A 2Y6TA 3KN2A 2H6MA 1MTNB 1P9SA 3VEQB 5JDUB 3WY8A 5F6MA 1E34B 2I6QA 1AVWA 1O3CA 3EE0B 1TB6H 4ZKSU 1GHWH 1ARBA 1GHZA 4NCYA 1T8LA 3RXOA 4R8TB 4ZHMU 1TONA 5A0BA 2A0QB 3MWIU 3MH6A 3QTOH 1V2RT 3SGQE 2A31A 1ANCA 3M37A 3TLOA 4NGAH 2D2DA 2BTCE 1P04A 4ZKNU 3SZNA 2R3UA 5JPMH 1J8AA 1RJXB 1HXEH 5CE1A 2GZ9A 4ZMAH 3ZZ9A 1GJ8B 3SV9A 2ZGBH 2P3FH 2R2WU 4IS5A 1ANEA 2PKAB 2EA3A 2H9HA 2Z9IA 2BVRH 5EU8A 2FI3E 1HV7A 1TE0A 1BHXB 3MU8A 1AWHB 2ZGXH 3GYMA 1TYNA 3ZVAA 1SLVB 4OS7A 1GVLA 2O8UA 1VITG 2F9NA 4ZH8A 3ZVGA 4MNYA 2TIOA 3U1JB 1KYNA 3BG8A 2F9VA 2JH6D 3IG6B 3FP6E 1BBRH 4B71A 1HAIH 1C1OA 1C4Y2 4QT8C 2ANWA 1GI9B 2A5KA 2OD3B 2FOGA 2LPRA 3PMJA 2Q6DA 1IQEA 4BTUB 4B75A 1Z6EA 1W14U 1PPHE 2H5CA 1K1NA 2EI6A 1AVGH 2Z7FE 5BRRE 1JRSA 1O0DH 3SU4A 1KXCA 4I7YH 1UVSH 3QZRA 4FUBA 4X6NA 1Q2WA 1O5EH 1MTNC 1NM6A 1GBBA 1FY3A 3BG4B 1BB0B 4NA9H 1GI3A 2P3UB 2FYRA 2XBVA 5AFYH 3RUOA 1GI7B 5EXLA 4NIVA 3Q77A 2C8ZB 1LQEA 7KMEH 3RMMH 5AFZH 1S6FA 1GL0E 1CVWH 2SGAA 3BTHE 5K0HA 3PO1C 1FXYA 3UNQA 3PB1E 1HDTH 3EGKH 4I31A 1QGFA 1ABJH 1J17T 1GJCB 1JMOH 2HVXA 1ZRKA 1XUGA 1UK3A 5TCAA 1DXWA 3VPKA 3O8RA 3SN8A 5DP5A 5DJ7A 4YT7H 1T32A 4Z0KA 2OBOA 1J16A 1C1SA 2VIQA 1HAZB 1FN6A 1MKXK 1O2JA 1GBTA 3LGIA 5E0JA 3LDXH 4X8VH 3VB7A 1MQ5A 2OUAA 2B8OH 1BCUH 1UTMA 5FCKA 5FPTA 1EAIA 3E6PH 1M9UA 1C5QA 6ESTA 3BTGE 2ZU5A 1HAYB 2XBYA 3P8OA 1CBWB 5ESTE 5TCCA 4WJG2 1UHBB 1Q3XA 2CGAA 3TJOA 1IQJA 4NA7A 4FU7A 1QCPA 3RM0H 2FTMA 1W12U 2W3IA 1T8MA 2IOTA 1N8OB 3SNBA 2AYWA 4MVNA 4Q7YA 3SU6A 1C2MA 1X7AC 4UFFH 2EI8A 1QB9A 1EJAA 1FY1A 3NCLA 4GVUA 4JYVH 2TGDA 2ZDLA 2Y7XA 1TMTH 2GDEH 2BDBA 3OSYA 3RMNH 1GBIA 2BDGA 2BDHA 1P10A 4INKA 1RIWB 3RP2A 1HB0B 1C2LA 1ELTA 1SGCA 2ZTYA 2BX4A 1GI8B 3ATLA 2A5AA 1TPPA 2FOHA 1BRAA 1H9HE 1P05A 2BVSH 1MCTA 3T5FH 1JOUB 1XM1A 2ZIQH 2OP9A 3ZZBA 3DT0H 3RXQA 3RXUA 1TLDA 1G9IE 4Z6AH 5F03A 5EXMA 4AG2A 3F9HA 1TAWA 3QGJA 3MH4A 8ESTE 2J95A 4J1YA 4U32A 1BTWA 2QF3A 1UTJA 4X8UH 4X6OA 1SGEE 3A8BA 3SJKA 1OWEA 3R0FA 1EZQA 1O32A 4LOYH 3D65E 3UIRA 1GHXH 3EYDA 5T6DA 2FESH 2ZDVH 1GJ7B 2THFB 4U01A 1O2TA 3RXHA 2QA9E 1C2GA 1UMAH 2PGQB 1W7GH 1Z8JB 1S5SA 1UTPA 2V3HH 4THNH 1PPCE 2VGCB 1ZOMA 3RXSA 2VINA 3NXPA 1P06A 1RTLA 1DY9A 1JWTA 4K2YA 3PLBA 4ABGA 4ZXXH 1CBWC 1QL8A 1EB2A 1GDNA 1GMCG 1HAVA 4I33A 2H1UA 3RC6A 4OS4A 1DX5M 3P17H 1QHRB 1VJ9U 1W7XH 2BLWA 1FV9A 2FTLE 5JBTA 2ESTE 2W7UA 4NWLA 5AVDA 3HK6B 1A5HA 1N8OC 2W7SA 1C5WB 2NU2E 1C2IA 2ZTXA 1LMWB 4IC5A 1EX3A 1O3DA 2QV1A 3AVZA 3E16B 1HFDA 2C90B 2G4TA 3B23B 2GT8A 4JZIA 1GHAF 2XNIA 2ZCKP 1BMNH 3QLPH 1ESBA 4LZ1H 3RXRA 2J38A 1DFPA 1HYLA 1UTOA 1O2SA 2AFQB 4I8LA 1CT0E 5CMXH 1RIWC 4X8SH 1PFXC 1AZZA 4JCNA 1Z7KA 3L33A 1LVYA 1DOJA 1P57B 4ZKRU 4WVPE 4TWWA 4A6LA 3MO6A 4RN6A 1Z8IB 3ZZ8A 1QL7A 1EP6A 2A2QH 2ODPA 4DG4A 1BQYA 3A89A 2FOMB 2V6NA 3TNTA 2STAE 3MI4A 3BTEE 4DVAU 3AAVA 1G32B 1QY6A 1WQVH 1AFQB 3LKWA 4MPXA 1QTFA 1T31A 4X6MA 1G3CA 2PKAA 5DKMA 4GLYA 1F7ZA 2FOAA 1MD7A 3Q76A 3RXVA 2GKVE 1PPFE 5A8ZA 1LPKB 1AQ7A 1L1GA 2XYAA 3A8AA 1IQMA 3SUDA 2ZDNA 2GTBA 1LHFH 1SLUB 2VGCC 1N6XA 2O8MA 3SGAE 3P70B 2FYQA 3SHAH 3S9AA 3HK3B 5CHAB 1YPHE 2A1DB 4VGCB 5EQQA 2FO9A 2VIWA 1MTUA 2Q6FA 3BTME 3A82A 4KP0A 1O2HA 3MH5A 5DP7A 4UDWH 3RLYH 1C5TA 4OGXA 1G37A 2PKSB 3OTJE 5EODA 4A5TS 2XXLA 2GD4B 4YT6H 2ZWLH 4KTCA 1ZYOA 1TBQH 3TGKE 1ZRBA 2M5TA 1CT4E 2BQWB 5FBIA 1LO6A 3SBKA 1A3BH 3ATMA 2F9OA 3GY4A 3SUFA 2AMDA 1TGCA 1GHVH 1CHGA 3GY3A 3IITA 4FVBA 2AS9A 4HGCA 3TH4H 1O3HA 3A80A 4DCDA 3RXLA 2ZFSA 2OC1A 4CRDA 2VIOA 1D4PB 3STIA 1BIOA 2FX4A 4FUGA 1L2EA 2AMQA 1SC8U 3TK5A 3UY9A 2Z6BD 2ZHDA 4X2YA 3PMBB 1NFUA 2UUYA 4OS1A 5ESBA 5FX6A 3KIDU 4OS5A 1D3TB 1SGFG 1QURH 1EPTB 1MMJN 1SGNE 1O3LA 3M3TA 4K8BA 1SGTA 3UREA 2AERH 1ANBA 3TH2H 1AVXA 5CHAC 4CH8B 1NFYA 1TX6A 3FP8E 1B7XB 1FMGA 4VGCC 1GL1A 6GCHF 1YPGH 2BY5X 4UD9H 3K9XB 5LPEA 4BAQB 2FI4E 2GV7A 4Q80A 3BF6H 1GBAA 4ABBA 1HJAB 1QJ1B 4MDSA 3M35A 2UWPA 1NN6A 1TX7A 1C4V2 1ZSLA 1TMUH 7GCHF 3ZVFA 4IC6A 3SNEA 4INHA 5HGGA 3ATIA 3TU7H 1LTOA 4INLA 4CRBA 1GCTB 2JH5D 4Y0YE 2FWWA 1GBEA 1MAYA 3VGCB 2Z94A 1WOFA 3MOCA 1FZZA 2VWOA 1NC6A 4UE7H 2FEQH 2P8OB 2DE9A 3ENSB 4Y71A 5C20A 1RGQA 1NY22 5FBEA 4CHAB 2W3KA 1SQAA 5F8XA 1QQ4A 2D26C 2H9TH 4XDEA 1TIOA 2XC0A 4ISNA 1TNJA 1ZJDA 3TGIE 4X8TH 1S84A 1C1PA 3RXEA 1EJMA 1GVKB 4YOIA 3RXGA 4RSPA 4Y7BA 4CRFA 5DGJA 2A5IA 2P16A 1Y59T 5C1YA 4GCHG 2P59A 2PR3A 4MPWA 2BY8X 1CGHA 4AFZA 4JMYA 1O31A 3SQHE 1K1IA 5EQSA 1K1PA 3RXPA 4CRAA 1XX9A 4YLQH 2Z9JA 3SV8A 1FONA 1E35B 1QQUA 1V3XA 3Q3YA 3RM2H 3GDVA 1KXFA 2BDAA 2C4FH 1UTQA 2A7JA 4CRCA 1D9IA 1EZUC 2CXVA 1QRWA