1QRZA

Catalytic domain of plasminogen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYMVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVLRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PLASMINOGEN
publication title Crystal structure of the proenzyme domain of plasminogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrzA01
4ABEA 5DK1A 2BD7A 1HAZB 2WV5A 4AFSA 1W8BH 4AORA 1Q31A 2AIQA 2F9BH 1HIAB 2XC0A 2EI6A 4E7RG 4E06H 4I8GA 2THFB 3SGBE 1GBKA 2XCNA 1MBMA 2ZHFH 2SGFE 3VB3A 1YLDA 3SU0A 1C5YB 1QR3E 4UONA 1HAXB 3UPEA 3GY7A 1C5TA 4YO9A 1AVXA 4UD9H 1MTSA 3MTYA 4THNH 2FLBH 5DKMA 1JXPA 3ZZDA 1XUFA 3EA7A 3RXJA 2RDLA 1O2VA 1LMWB 1GJAB 5HGGA 4GVUA 4RN6A 3DT0H 1C1QA 1YPHE 1HYLA 1Z6JH 4D8NA 3EQ0H 2PTNA 1EPTB 4U30A 1SG8B 2W7UA 1O2JA 1FN6A 3HGNA 1XKBC 2CMYA 1IHTH 3A89A 1BTHH 1ZPBA 1ZOMA 1SOTA 1H9HE 1GBMA 2C8XB 3KQCA 1VITG 3T27A 3MH6A 1K21H 3I29A 3O8RA 1UK3A 1BB0B 4NIYA 1ELFA 2R2WU 2UUFB 2HNTE 1WSSH 4X2WA 3KQEA 4AGJA 1EAUA 5EQSA 2Q1JA 4YZUA 4B2CA 5L2ZH 1P2NA 2ZCKP 1OWHA 5A8YA 3CS7A 1E38B 1B0EA 5CHAB 1C5MD 1LVYA 2BDAA 1BMAA 4UEHH 1SR5C 3F9GA 3DHKH 5FX5A 1TPPA 3TU7H 5JBAS 2JH5D 2AERH 1IQKA 4R0IA 4XDEA 1CGIE 2A7HA 1O5GH 1A5IA 1N8OB 3TK5A 2XTTB 3ITIA 1EXFA 1DUEA 3QGNB 3NZIA 4JK6A 3QZQA 2CHAC 4X1SU 5HYOA 1G36A 2IOTA 2TGAA 1SGPE 1P06A 1SQTA 4TYDA 1YCPM 3PYHA 3QGJA 4D76A 1E36B 1GJ8B 2FXRA 4AFZA 3TITA 1NFUA 2BLVA 1EZXC 1K1LA 1BRBE 1Z7KA 1LPGB 2C4FH 2ZCHP 1Z1IA 1V6DA 2BQ6B 4ISNA 1AI8H 1KY9A 3F9HA 1S6FA 3A85A 3BTDE 4CRDA 4LZ1H 4CBOA 3FZDA 4I8JA 4SGBE 1AGJA 3SQHE 1C1WH 4NIVA 2FI4E 2FOMB 3T26A 1A1RA 2G5VA 1DLKB 3VGCB 5CE1A 5EQQA 1GBBA 4GSOA 2F83A 5C1UA 4I7YH 1GBFA 1O2UA 3R0FA 1JIMA 1AFEH 3RMLH 1YCPH 5IDKA 1QY6A 1UHBA 1GBTA 1TPAE 1F7ZA 2AMQA 3MOCA 1S5SA 2VIOA 1NN6A 2UWOA 5A8XA 1EKBB 2GDDA 2PKSC 1NU9A 1MKWH 1C1TA 2G55A 1HAIH 5G4BA 4MVNA 1BQYA 3M5MA 2H6MA 3D23A 1Z8RA 1B0FA 3GCHB 1EB1H 1ZPCA 1HB0B 1Y5BT 1W11U 4ZHMU 2VNTA 2Z9LA 4FUDA 4UE7H 1VZQH 1VCQA 1LHFH 1NS3A 3AAVA 1C2IA 1BDAA 1F0UA 1VR1H 1GI4A 2XNIA 2ZPSA 1P2IA 1YPEH 5FCKA 2BXUH 3ZVCA 3T28A 5JDUB 1D9IA 1GHXH 1Z8GA 2EI7A 2WINI 5FPSA 5T6DA 1VITH 1LHCH 1VITF 1P03A 1GI1A 3TH2H 3GDVA 1TQ7B 3K6ZA 5FPTA 3GYMA 1U6QA 3VPKA 1XUJA 2FOHA 4DG4A 1TWXB 3P6ZB 1C2DA 2V0BA 7GCHG 1GHWH 3RXCA 1UCYH 1NO9H 4AG1A 1O2HA 2D26C 4X1NU 1SGTA 1G9IE 1K1PA 3RXTA 2STAE 1YPHC 2ZFFH 2VWOA 2ZC9H 2B5TB 5DP8A 2TGTA 1A2CH 1O2OA 1OP2A 4OS2A 1KLJH 1T7CA 1W0YH 4A5TS 2LNCA 1HNEE 1W7XH 2A2QH 1THPB 3P95A 1WQVH 3MWIU 3DD2H 1EJAA 3TJNA 1O5AB 4OS7A 3RXAA 4TY6A 1BRCE 3TPIZ 1PPFE 3VEQB 1ZHPA 5HXFA 1QL7A 2P3FH 2PGBB 4O03A 4B76A 5ABWA 1L2EA 2ZA5A 1HAOH 3PTBA 3HGPA 2R9PA 1GBLA 3GCOA 1GMHG 2PW8H 2HRVA 1QB6A 2Y5GA 1FI8A 1MCTA 1Q2WA 1AQ7A 1AE5A 1P02A 2SGDE 4XE4A 1ESAA 1V2ST 2GT7A 1O3BA 2P3TB 1GBIA 2BTCE 4WH6A 5EU8A 4BAHB 1ZLRA 3EDXB 1J9CH 1AVGH 4MNVA 1OSSA 1C2HA 1DLEA 1CBWC 5JBCS 4K1TA 4Q2KA 1KXEA 2FODA 3TJUA 2ZGJA 4Y8XA 2C90B 1OWKA 3MNBA 3U8OH 3OX7U 1GI8B 1P2OA 4YOGA 2ZTZA 1OX1A 1C1MA 4DIIH 4A7IB 4Y8YA 1O3FA 2BLQA 3LT3A 1KLTA 4JZFH 3OY5U 1SPJA 5EG4A 2GP9B 5L30H 2CV3A 5DPAA 1QA0A 3PO1B 2A4OA 1QRWA 3Q76A 2A7CA 1AB9C 4D9RA 3K9XB 2BVSH 3DA9B 3O8BA 3UREA 3V13A 3MU0A 1MQ5A 3MFJA 3T5FH 4YM9A 4ISHH 5E2OA 5C3NA 1F5LA 4ABDA 1GGDC 1TGNA 3PMJA 4ESTE 1H9LB 4BOHA 3BEFB 2QF3A 1D3PB 3BSQA 3D62A 1SGDE 3EGKH 1DITH 2GTBA 1DOJA 2FS9A 2ZU4A 2P95A 1S84A 1EATA 1LQDB 1WTHD 1XX9A 5TCAA 6CHAB 3RM0H 2GVFA 1EZUC 1IAUA 1O3IA 2H5DA 3RC4A 1ZTJA 2G5NA 3S7HB 1BTPA 1C1OA 4ZUHA 4ABGA 1DWDH 1TGCA 4NWLA 3H7TA 6GCHG 1UTQA 2A32A 1CE5A 1WQSA 2BXTH 4UFGH 4MNYA 1G2MA 4WMEA 3SV9A 2DE8A 3BV9B 1A7SA 3GY6A 4NWKA 2WYJA 3SNDA 1TRYA 1C5PA 2C8WB 2ZFSA 5ESBA 1P9UA 2FLRH 3LJJA 3Q3YA 1XUIA 2BD4A 3CENA 1ZGIA 3E0NB 2C8YB 2J34A 4XFQA 1NFWA 1P57B 1C2FA 4X6PA 3C27B 4UFFH 1C5ZB 3LC3A 5K0HA 2F9NA 2ZU2A 1E35B 4UFEH 3UNSA 2BY9X 1GVLA 2B8OH 2JH0D 3E6PH 1ELBA 2XBWA 5ESTE 4OS1A 3F9EA 1TMTH 4UDWH 4GCHG 4X2YA 2ODYB 3TGIE 1OYQA 3M35A 1N6XA 2VVCA 1P0SH 3MU4A 1LPKB 2FOGA 1GMHF 4BAOB 2AGEX 2ZKSA 4CRBA 4AOQA 1ZYOA 1PPZA 4RSPA 1AKSB 1W10U 1MZDA 1O2NA 1YYY1 4R8TB 4ABHA 3PMBB 4CRGA 1ELGA 2H9EH 4FU7A 3SJIA 3SZNA 2A4RA 1ARBA 3RLWH 2FTMA 2QC2A 1C5XB 2WUBA 1Z71A 2O8LA 2CJIA 2FWWA 5I46H 1SLUB 1QB9A 3P8OA 3D65E 4OS6A 4YT6H 3HKJB 1YBWA 2QYIA 1O2SA 1QTFA 4Y11E 1DS2E 1P3EA 3WY8A 1EZSC 4KP0A 1EB2A 2AEIH 2VH0A 4NIWA 3GOVB 1W12U 4FU9A 1EX3A 2PKAB 2FOBA 1ORFA 1LHGH 1PYTD 1VCWA 4K8YA 1N6YA 2Z3EA 5JBTA 1O31A 4Y7BA 1IOEA 2BLWA 2R0KA 4PROA 3GY3A 3MO3A 1TQ0B 3RMMH 1EPTA 3PMAB 1O3DA 2W26A 1IQGA 5BPEA 1SBWA 1SI5H 4INHA 3M61U 5I25A 1GJ4H 2G51A 5T6GA 2AGIX 2ZGXH 3M5NA 5DGJA 2TGDA 1KXDA 3KCGH 5EPNA 1C1RA 3MU5A 1TRNA 6GCHF 1NTPA 5E8EH 3VB5A 3TH4H 1KXBA 5T6FA 2C93B 1VJAU 3E91A 1W14U 5IYTA 2H5CA 4B71A 2JH6D 1DWCH 5BRRE 3ZVAA 1S6HA 4FUFA 1SQAA 3IITA 3KN2A 1O2LA 1TFXA 1TOCB 1XVMA 1AFQC 3BTEE 3E0PB 4FU8A 5DG6A 1V2QT 1WAYB 3A7ZA 1K1JA 1W2KH 2QA9E 3UOPA 1ZR0A 1BMMH 1SHYA 5EW2H 1P10A 1SGQE 2ZEBA 3QLPH 1BZXE 1K22H 3ZV8A 5TJXA 1Z8JB 2GV7A 2ANWA 3LONA 1JBUH 2ZFTA 2GCTB 2ZP0H 3K6YA 1UK4A 4ZROA 3RXDA 3B23B 4JZEH 1G3EA 4MPUA 4GCHF 1C5UA 3SU5A 3P17H 2BX4A 1O3GA 5GDSH 6CHAC 1GMDF 3UNQA 1GDUA 3CS0A 3RXMA 1TIOA 5EODA 2FYQA 5PTPA 2P94A 1FDPA 1O35A 1E37B 2TPIZ 1O5EH 1FJSA 1YC0A 1O2RA 1JMOH 2OCVB 2QGRA 3SU4A 2GT8A 1Y3XA 3MU8A 4XBCA 5E0JA 1K1IA 1FXYA 2ZU3A 5A0CA 2BYAX 3U69H 3LGUA 3TGJE 4BXSA 2WPKS 4O3TA 5J4QA 1BHXB 1DM4B 3H7OA 1FUJA 1JOUB 2AMDA 3SOSA 5EW1H 3PLPA 3NKKA 2GKVE 1SGEE 3Q3KA 4J1YA 1C9TA 2XW9A 2ZPRA 5LPFA 4Y7AA 4ZKNU 1OPHB 1OWIA 1K2I1 4IN2A 1CHOG 3UR9A 3MH7A 4VGCC 1NROH 3Q77A 1QURH 2EEKA 2C8ZB 1LVMA 1GHBG 1TONA 2TGPZ 1MTNB 1TE0A 3GY8A 7KMEH 5FHTA 4D9QA 4Z0KA 4ABAA 3PLBA 2Q6GA 1P8VC 5A2MH 2QV1A 3I77A 1DICA 5B6OA 1O3EA 1AY6H 3VXFH 2BDGA 3P92A 5FAHA 1H8DH 3AASA 3ZYEA 3V12A 3U8TH 3W95A 4CH8B 4CRFA 1YPKH 2RCEA 2ZGBH 1XKAC 1NC6A 2Z9GA 1GG6C 3BTME 1SQOA 2P8OC 5DP9A 5LGOA 1GBEA 1NT1A 3LGTA 2AIPA 4U32A 3SV8A 4YTAA 1MAYA 3SUDA 2Z94A 1V2JT 1DVAH 3LGYA 2I6QA 2P3UB 4IBLH 2C3SA 2VWMA 3LU9B 3M3VA 3TIUA 1YPGH 4YOIA 4ZKRU 4FUIA 1AU8A 4X1PU 2UWLA 3JZ1B 3SNAA 1ZSKA 1O3HA 1QQ4A 2BY8X 3SQEE 2TBSA 3PTNA 1GL0E 4Y79A 4JCNA 5JB9S 1WCZA 2G4TA 3BF6H 2J4IA 3MMGA 4TWWA 2OBQA 4F49A 5GIBA 4YT7H 1LDTT 1VJ9U 4A92A 1BHXF 1Y3WA 1INCA 1CA0C 1TX7A 2VINA 1D4PB 1HXFH 1Y8TA 2GMTB 1FPCH 3GISB 1QFKH 1GJBB 3A8AA 4XOJA 1YPMH 1RTKA 3QN7A 2F9OA 3VFEA 1GI2A 1TOMH 1AO5A 2LPRA 2ZDAH 2AMPA 1H1BA 1OWDA 2A0QB 2NU3E 4H6TA 1GVZA 5ETXA 4Y6DA 3SNBA 1OXGA 2BD3A 4Y76A 2PWXA 4K60A 2VIQA 3A88A 4JYTA 1BRUP 3I78A 3JZ2B 3ZVFA 2ZDMA 2ZHEH 3UOUA 3U98H 3ATLA 1K1NA 5C5NA 1M9UA 4HGCA 4RKJB 1GCTC 1XM1A 2OP9A 2W3KA 4H42U 4BXWA 1LKBA 1PQ5A 1DXWA 1UCYE 2A7JA 4Y0YE 1XUHA 2DUCA 4NA7A 1X7AC 1TGBA 4FUEA 2JETB 3BG4B 4INKA 3KHVA 3M3SA 5DJ7A 3BTTE 2BHGA 3PV4A 1HV7A 1NU7B 1SGCA 2ZGCA 1S82A 4IW4E 1KTSB 1HJAB 4Y71A 2XRCA 3MI4A 1BMNH 2BDCA 1TLDA 2R0LA 1QRXA 1CHOF 3A8DA 5C2ZA 1DFPA 4CR9A 1TGSZ 2ZQ1A 1BTUA 1TNKA 1ZRBA 2IJOB 3OU0A 1V2UT 3M37A 1MMJN 4CRAA 4HI3A 4YLUA 2V3HH 1B5GH 1GHBF 1GWAA 2FEQH 1GI0A 1MUEB 4YOJA 1YPJH 2QCYA 4CBNA 1BCUH 3L6PA 3TGKE 4K3JA 3SGQE 1FY1A 1VGCC 1O3JA 1D3TB 1ANCA 1JRTA 2TIOA 2P16A 2XCFA 2A5AA 1HAPH 2ZNKH 1WUNH 2QY0B 1SGYE 1RIWC 3D49H 2JKHA 4X6MA 2HGTH 3BEUA 1EOLA 3P8GA 1EJNA 3SGAE 1G37A 1W13U 1F0SA 1OKXA 3A8BA 4ABFA 4LZ4B 1SFQB 4NSYA 3DFJA 1EJMA 2FESH 4ZXYH 3KQDA 1NY22 5EXMA 4NFFA 2SGQE 1SL3A 1FY8E 4D7FA 1C5NH 2O8TA 1UVUH 1AVWA 3ZZ5A 1ZMNA 3PLKA 2BDYA 2BZ6H 2WPHS 3NUMA 3ATKA 1GPZA 4FVDA 2G52A 2FMJA 3Q00A 4ABJA 2GX4A 2EI8A 1EUFA 4B75A 4X6NA 4X8TH 5C20A 2PV9B 4K1SA 1T31A 4MG3A 3TJVA 1MD8A 4X1RU 3IG6B 4DCDA 2H9TH 4NCYA 1TBZH 1GI7B 1EPTC 1QHRB 3GY2A 3LKWA 3URCA 2HVXA 1NRRH 4SGAE 1A3EH 2VGCB 3SI4H 1QL8A 2P93A 4NZLA 1AZ8A 4ABBA 1P9SA 1SSXA 1MU8B 1V2NT 2J2UA 2BOKA 2FOEA 2BX3A 3A86A 4CHAB 4JYVH 1ACBE 2BQWB 2PR3A 1E0FD 1TNJA 3M7TA 4Y10E 3MU1A 2QXHA 4GUXA 1TGTA 1MKWK 1AUTC 1J8AA 4ZH8A 1GBCA 3LIWA 4KGAA 1EZQA 2BDHA 1L1NA 4IMQA 1W3CA 4I32A 3QTVH 2OD3B 2ALPA 4XBDA 3RXIA 4FVBA 1UVSH 2FX4A 2ZIQH 1NESE 5CHAC 3V0XA 2J92A 1AKSA 2Y80A 3SI3H 1C1UH 3ODFA 1CT2E 1XXDA 4HZHA 4DVAU 3URDA 3LH3A 3ODDA 1E34B 1LHDH 8ESTE 1KXCA 1NPMA 4WMDA 1N8OC 3KF2A 4X2XA 1BA8B 1S85A 5JBBS 2BM2A 5HM2A 1C5SA 5FBIA 1ETSH 1ELDE 2B7DH 4FUJA 1O3CA 1LCYA 1LPZB 3RC5A 2FP7B 1YKTA 3LGVA 2GMTC 1THRH 4O9VA 5SGAE 4B2BA 1GJ6A 5J4SA 3AW1A 1QL9A 1J14A 1P12E 5DP5A 3HATH 1NFYA 2I6SA 1MQ6A 1Z1JA 2PKAA 1SVPA 1HUTH 1V2RT 2A45B 2FX6A 4AB9A 1UCYK 5L6NH 1C5OH 1GVKB 3EA9A 4DGJA 4I8LA 3SBKA 5GPIB 1XUKA 2NU0E 3GDUA 5C67A 2FO9A 4IMZA 1DSTA 2XWBI 3G01A 1P01A 4O97A 4XSKU 4F4OC 3VGCC 3BTKE 2PHBA 1P2JA 1TBQH 3MH5A 3QZRA 5F8TA 2RA3A 1BBRE 3GCTG 3ZZ6A 4MPVA 2F3CE 1V2MT 2UWPA 4CH2B 5DP4A 1SC8U 5FPYA 3ZYDA 3SUEA 1AZZA 7GCHF 1EAWA 2F9PA 1GJDB 1ZHMA 5FX6A 4UFDH 2GZ9A 3RU4T 1LHEH 3FP8E 4B73A 2QIQA 3SO3A 3AVZA 3GCHC 1DANH 3S9BA 1Q3XA 3VB4A 1LTOA 5T3HA 1GJ9B 2UUYA 3SU3A 1BIOA 4U2WA 1P2QA 1MTVA 2Z3DA 4MNWA 2BOHB 1K1MA 1KIGH 5C5OA 3BIUH 2XC4A 1C1VH 4AFQA 2F9UA 3E16B 1ZTKA 1FIZA 1GBHA 3NWUA 4OS5A 1NZQH 2J95A 4FXGH 4JK5A 4TPYA 1BTYA 1LVOA 1PPEE 1H9IE 3A82A 5FBEA 1F5KU 1O30A 1ELAA 3BTFE 1KDQB 1QBOA 1AIXH 3AAUA 2PSXA 3SJKA 4I33A 1GMCG 2Z9KA 4I31A 2WPIS 4E05H 2AH4X 5GCHG 3RXLA 1CT4E 2BDIA 1S0RA 4Q80A 2OC1A 1FY4A 1HGTH 1UMAH 1KTTB 1KSNA 2VWNA 2PLXA 1C2KA 3UY9A 1C4U2 9ESTA 4BTIB 2EA3A 1C4Y2 3RXGA 1RS0A 4NZQA 1GI6A 3ZVEA 3U8RH 3QX5H 1AE8H 1HIAA 5E2PA 1C5RA 1WYKA 3RUOA 4O3UA 3M3TA 5AFYH 2WV4A 1FLEE 1O3KA 1OWJA 4AFUA 3TK9A 3FVFB 4U01A 2PTCE 2VIPA 1CGJE 1GL1A 1OYTH 1DE7H 3IWMA 3CP7A 2VGCC 3MNCA 2FI3E 4Q7YA 2ZFPH 3ESTA 3LJOA 1O2MA 1O2PA 3V3MA 2Y81A 4MPWA 1O2KA 1J17T 2A4QA 4CHAC 3A7XA 1EQ9A 1SGNE 1GJCB 4K5ZA 1THSH 3SN8A 1UVPA 1IQEA 2AYWA 1FIWA 1O3PB 4INLA 1P11E 1LO6A 4RKOB 1T8MA 1J16A 1Y3YA 1UTNA 1KXFA 1DWEH 2CHAB 2SGPE 2UUJB 1PJPA 3BTGE 1A46H 2HPPH 2OINA 3MHWU 3TVJB 3SV2H 1RGQA 1G3CA 3DFLA 1O36A 1GHZA 3Q3XA 3O8CA 1F0TA 3RU4E 3MNXA 3UFAA 3PROA 3KIDU 2D8WA 1PPBH 3GCTF 1BJVA 1ZPZA 2J9NA 2CGAA 3STJA 1O5CB 1HAVB 4AX9H 1BOQA 2Z9IA 1D6RA 1N1LA 2SFAA 4I8KA 1H8IH 1O2XA 4A1TA 1FY5A 2B9LA 3ZZ8A 3ZZAA 3PM3A 1UTMA 3FFGA 1ZSJA 5DP7A 2ODQA 4WWYA 1MKXK 3PO1C 2G8TA 2OQUA 1FQ3A 4DW2U 1O39A 1DWBH 1WU1A 2CN0H 2XBVA 2J94A 4DY7B 1UTKA 1UTPA 1BTWA 1TAWA 1HLTH 2GCHG 2XWAA 3RC6A 3GY4A 1GDNA 2PSYA 1ELEE 5EGMA 1D3QB 1SGFG 1AWHB 3K65B 3M36A 4BTUB 3K2UA 1EP5A 3A7TA 1TNHA 4GLYA 1BBRK 1MZAA 4ZKSU 5F03A 3RXRA 4X8SH 2A2XH 3ZZ7A 1L4DA 1C1NA 3LC5A 1XMNB 1C1PA 2ZU1A 1NRQH 1O2ZA 1GMCF 3M7UA 5GCHF 1DDJA 1GCDA 1SHHB 3QUMP 3EAJA 3S9AA 1QQUA 4X0WU 2ILNA 5JYIA 2SNWA 3KL6A 4Q7XA 3A87A 3E1XB 1LQEA 1W0ZU 2NWNA 1L0ZA 3RXBA 4AYVB 2GGVB 1C9PA 5EXNA 1IQIA 1F0RA 4JYUH 4MLFB 2XC5A 3SU1A 1FMGA 3RM2H 3OTJE 2ZO3H 3M7QA 5EOKA 3UQOA 1RJXB 1K1OA 2BD5A 2VIDA 1A5GH 2Y7ZA 1P2MA 3FZZA 5E0GA 1O2QA 2FOAA 4JMYA 3ZZCA 2HLCA 4KELA 3DUXH 2W5EA 4FUGA 4GHQA 2FTLE 2V35A 5GXPA 1DX5M 2IPHA 3MNSA 4MQAA 3SJOA 3SU6A 1PQ8A 3BTWE 3GYLB 4AG2A 4OGXA 1FN8A 1ELTA 1TA6A 5E0HA 3S69A 3S0NA 1XVOA 1T4UH 3GDSA 1ETRH 1W7GH 4DT7B 5F8ZA 1F5RA 3TK6A 1O33A 3BTQE 1PQ7A 3KNXA 2OC8A 1V2OT 1BUIA 1O5BB 2KAIB 2OUAA 4WH8A 5GJ4B 2ZDKA 4LXBH 3PB1E 1TPSA 8LPRA 1P04A 3UNRA 4KTUA 1WOFA 1C4V2 1QBVH 3HK3B 4H6SB 4H4FA 1BTZA 3T29A 1A3BH 4NFEA 1AN1E 4CREA 2OTVA 2IN2A 4ABIA 2SNVA 1RTFB 4AB8A 1GI9B 4IS5A 1CVWH 2B0FA 2YNBA 1T8NA 1ZRKA 2NU4E 3A7VA 2AS9A 1ETTH 1CA8B 5DP6A 3RMOH 4ISOA 2O9QA 4BNRA 1HDTH 3OY6U 2ASUB 3V7TA 1O3NA 3BN9A 1CU1A 2FOCA 2M5TA 1T8LA 3RXPA 1FNIA 2VB0A 3SV6A 1JRSA 1BRAA 1CBWB 2H2ZA 4ISIH 3SORA 1YP9A 1BITA 2GCHF 4HTCH 4K69A 2QN5T 2AFQB 1GJ7B 3HK6B 3PMHB 3RXKA 4GAWA 4BAKB 4NG9H 7ESTE 1Y5UT 4DJZB 1C1SA 1S0QA 2FIRH 3HKIB 7LPRA 2HWLB 2ZHQH 4NGAH 2Y6TA 1NRSH 3BIVH 1L4ZA 8KME2 2GZ7A 1AB9B 1MTUA 1O5FH 2R3YA 4JZIA 4MTBA 2FM2A 4KTSA 5GWZA 1MU6B 2O8WA 4WJG2 3FP6E 4A6LA 4IC5A 1K28D 2Q6FA 5AF9H 3A7YA 4IN1A 1QBNA 1HAHH 4FUHA 1GGDB 1L1JA 3EA8A 3GICB 1SMFE 3ZZ3A 4OGYA 1T4VH 3UUZA 1TNIA 2HOBA 1HXEH 4WY3A 1DPOA 2R3UA 1O2WA 1IQHA 5A09A 3RXQA 5A0BA 1SLVB 1L1GA 1DY8A 3ENSB 2ZG0H 1O32A 5FXLA 1OP0A 1SGRE 3F6UH 1ABIH 4DURA 1XUGA 2Z9JA 3NCLA 4K1EA 1TABE 1DSUA 2W3IA 2HNTF 4X2VA 1D3DB 4BAQB 2ZDVH 1ESTA 1RD3B 3O8DA 1HAYB 3LDXH 3RU4D 1NFXA 3A83A 1K9OE 2K1QA 2GCTC 1KYNA 1S83A 1F2SE 3TH3H 1T32A 3FP7E 2ZZUH 1FONA 2BLOA 2YOLA 1BT7A 1Z8IB 1C5WB 2ZGHA 4E7NA 3T62A 2FZZA 2BDBA 2A5KA 1AMHA 1TMUH 1ZTLA 1JIRA 1FV9A 2ZF0H 4DIHH 2ZDLA 4ASHA 4B2AA 3LPRA 2WPMS 3ZVGA 2BQ7B 1C2JA 4ISLA 1UTOA 1QJ7B 2O8UA 1TX8A 2CF9H 1S81A 2FI5E 3TJOA 3M5OA 4WVPE 3KGPA 2W7SA 2F91A 1QIXB 4WXVA 4WMFA 3S7KB 4D7GA 3EYDA 1MTWA 2O8MA 2ZI2H 3L3TA 3UQVA 4MNXA 1ZHRA 4ZKOU 3SU2A 3PWBA 1LKAA 4IGDA 2DE9A 1RXPA 1HBTH 2RA0A 3SHCH 4TY7A 3RXUA 4ZMAH 5LH8A 1ELCA 2ZTXA 5FCRA 2OC7A 4YLQH 1MTNC 3M5LA 2CF8H 2VIWA 3F68H 1BMLA 2OQ5A 1QNJA 1A0JA 1G32B 2EC9H 5EXLA 2HALA 3BG8A 1YCPK 2BD2A 2ZPQA 1A0HB 1AD8H 2FDAA 1GI3A 2G81E 1GJ5H 4B74A 3HPTB 4JZ1A 1VCPA 1SLWB 2QXIA 3E90B 2D2DA 3A84A 1OP8A 2Z3CA 2NU1E 2A31A 1O0DH 4CR5A 1KDQA 1CHGA 3GY5A 2ULLA 1P09A 1OOKB 5C1XA 6LPRA 5AHGH 3ATWA 1G2LA 1HPGA 2VU8E 2HNTC 1AHTH 1ANBA 5DP3A 1C5LH 1UVOA 2TRMA 2ZU5A 1RTLA 1TNLA 1Y3UA 1MAXA 4NIXA 2BY6X 3QO6A 4QT8C 3RLYH 2OLGA 1PPHE 1GDQA 1P05A 1V2PT 2BMGB 8GCHG 5K7RA 4KTCA 3SJ9A 4Y0ZE 4ZHLU 1UHBB 1PPGE 1RRKA 3GCNA 1UO6A 3P8FA 3A7WA 5F8XA 1EOJA 3TNTA 1UJ1A 2YNAA 1ZMLA 1TX6A 2P59A 3MH4A 1V2TT 3TNSA 4AYYB 1O34A 3UR6A 3OSYA 3P8NA 1C2LA 2WYGA 3LGIA 1QB1A 2ESTE 1TMBH 1UTLM 2ZHDA 3NPSA 3SHAH 2ZTYA 3U9AH 3UIRA 4IC6A 2A5IA 3A80A 3RDZA 3NXPA 4GHTA 4TPIZ 3E3TA 2GDEH 2ZCLP 2QXJA 3RXOA 1KXAA 1DXPA 1OS8A 4A1VA 2G4UA 1CQQA 1TBRH 1V3XA 2ANKH 2XBYA 2Z6BD 1AFQB 1V2LT 4BANB 4AGKA 3S9CA 4NA8A 2XXLA 4OS4A 1NRPH 1Y59T 4JZDH 2RG3A 2V6NA 3W94A 1A61H 1GI5A 5H4IB 2GD4B 1QGFA 1ESBA 2JETC 3FAOA 3BG4C 3VXEH 3RXSA 1CGHA 2PUQH 2VIVA 1A4WH 4MPXA 1AWFH 1YGCH 2CXVA 4M7GA 2FOFA 1CSOE 1C2MA 1HJAC 1ZZZA 2H9HA 3ATMA 2ANYA 4CRCA 4I8HA 3RXEA 2BB4A 1FZZA 3R3GB 1IQFA 1HCGA 2FPZA 3SNEA 2J38A 1IQMA 1ZJKA 1HAVA 3OYPA 4FUBA 1HAGE 3SNCA 3C1KA 1QA7A 1O37A 1TRMA 2WPJS 1C2GA 1B7XB 1O3AA 5AFZH 5HM9A 1BJUA 1D6WA 1O2IA 3ZZBA 4Z6AH 1EAIA 1MCVA 1UTJA 4BAMB 3F1SB 5EPYA 2ZECA 1F92A 3SW2B 2R2MB 3VB6A 1TPOA 2VVVA 1O3OA 2BZAA 5HMAA 5EQRA 1O2YA 4TWYA 1TYNA 1YLCA 1TB6H 3UWJH 3T25A 1HJ8A 1PPCE 4Q7ZA 1YPLH 2XBXA 3B8JA 1UVTH 1UK2A 4A1XA 3MO6A 4VGCB 1TA2A 1RFNA 1Y5AT 1AUJA 4K2YA 1ZJDA 1GBAA 1EAXA 1C5VA 3ATIA 3RXHA 1YF4A 1EP6A 2PUXB 3RMNH 9LPRA 1G3DA 1NM6A 2QAAA 2XYAA 1BTXA 2ZFQH 4KKDA 4Y8ZA 1O3LA 1IQJA 1GMDG 3BTHE 3AW0A 2ZHWH 2GZ8A 4X8UH 3KEEA 1MKXH 3A8CA 3KQBA 5DO4H 1PYTC 2A1DB 3FANA 3QK1A 4AZ2B 2STBE 1G3BA 1GG6B 4X8VH 1CT0E 3NK8A 1TALA 1EASA 1GHAG 2P8OB 1SB1H 1MH0A 5L2YH 8GCHF 3ZZ9A 5LPEA 4J2YB 4NSVA 3UWIA 2OC0A 1QCPA 1V2KT 2PFEA 1H4WA 2BY7X 2HPQH 1ELVA 1BBRH 1FY3A 1V2WT 3N7OA 4HFPB 1SGFA 2WUCA 4LOYH 5JPMH 3L33A 1ANDA 1FAKH 2AGGX 1GBJA 1T8OA 2BVXH 3ZZ4A 4XBBA 3UTUH 4WF8A 1WTGH 6ESTA 4ZAEA 4BTTB 1IQLA 5F6MA 1PFXC 2QF0A 3ZVBA 4ZHAA 4WXIA 3SV7A 2FYRA 2Y7XA 1J15A 4AN7A 3ZVDA 3U1JB 1GBDA 1CA0B 3B9FH 1V2VT 2PGQB 1NRNH 2Y82A 4MDSA 2NU2E 3SJ8A 3LGWA 5CMXH 1QJ1B 5LPRA 2FS8A 1O3MA 1ARCA 3QTOH 3F9FA 1IHSH 1DT2A 1WBGB 1A0LA 1LVBA 2KAIA 1ZGVA 1ID5H 3A81A 3BEIB 4YESB 5AVDA 2G00A 2BD9A 2ANMH 3SUFA 4FUCA 2Y5FA 2QXGA 3EE0B 1Y3VA 2A4GA 3PWCA 3QDZB 4GPGA 5JB8S 1O2GH 1GCTB 2OXSA 2H1UA 2ZWLH 5A0AE 3MYWA 2VH6A 3E8LA 1Z6EA 2VVUA 1FAXA 2V3OH 3TLOA 3ZV9A 1TNGA 1SFIA 1HRTH 1HJ9A 3RP2A 1GHYH 1ABJH 1O38A 2WPLS 2BVRH 1CO7E 1MBQA 1WV7H 1DUAA 1XXFA 4X1QU 2VJ1A 1QJ6B 1OWEA 2ALVA 4NA9H 2PKSB 2UUKB 1P2KA 3VB7A 5TCCA 1G30B 2Q6DA 2ZFRH 1DY9A 1O2TA 3U1IB 1MD7A 2ZDNA 3RXFA 2SGAA 1IQNA 3RXVA 1SOZA 1A5HA 1C2EA 3H5CB 4DOQA 3SUGA 2Y5HA 1PQAA 2OBOA 1QRZA 1FPHH 1KLIH 1SLXB 3LOXA 3QWCH 2ZQ2A 1JWTA 4K8BA 3LH1A 2D1JA 4B1TA 1O5DH 1ZMJA 1ANEA 2F9VA 3P70B 1SGIB 2VWLA 1P3CA 2Z7FE 1ZSLA 3T2NA 3STIA 1VGCB 2GV6A 1HFDA 2ODPA 1YM0A 2BY5X 5C1YA 3ELAH 2SGEE 1RIWB 4ZXXH 1C5QA 1GHVH 2BD8A 5A8ZA 4X6OA 3MO9A 4LK4A 1GHAF
chains in the Genus database with same CATH superfamily
4ABEA 5DK1A 2BD7A 1HAZB 2WV5A 4AFSA 1W8BH 4AORA 1Q31A 2AIQA 2F9BH 1HIAB 2XC0A 2EI6A 4E7RG 4E06H 4I8GA 2THFB 3SGBE 1GBKA 2XCNA 1MBMA 2ZHFH 2SGFE 3VB3A 1YLDA 3SU0A 1C5YB 1QR3E 4UONA 1HAXB 3UPEA 3GY7A 1C5TA 4YO9A 1AVXA 4UD9H 1MTSA 3MTYA 4THNH 3KYGA 2FLBH 5DKMA 1JXPA 3ZZDA 2WHXA 1XUFA 3EA7A 3RXJA 2RDLA 1O2VA 1LMWB 1COWD 1GJAB 5HGGA 4GVUA 4RN6A 3DT0H 1C1QA 1YPHE 1HYLA 1Z6JH 4D8NA 1K0HA 3EQ0H 2PTNA 1EPTB 4U30A 1SG8B 2W7UA 1O2JA 1FN6A 3HGNA 1XKBC 2CMYA 1IHTH 3A89A 1BTHH 1ZPBA 1ZOMA 1SOTA 3GS9A 1H9HE 1GBMA 3F2FA 2C8XB 3KQCA 1VITG 3T27A 3MH6A 1K21H 3I29A 3O8RA 1UK3A 1BB0B 4NIYA 1ELFA 2R2WU 2UUFB 2HNTE 1WSSH 4X2WA 3KQEA 4AGJA 1EAUA 5EQSA 2F4LA 2Q1JA 4YZUA 4B2CA 5L2ZH 1P2NA 2ZCKP 1OWHA 2EQNA 5A8YA 3CS7A 1E38B 1B0EA 5CHAB 1C5MD 1LVYA 2BDAA 1BMAA 4UEHH 1SR5C 3F9GA 3DHKH 5FX5A 1TPPA 3TU7H 5JBAS 2JH5D 2AERH 1EFRD 4F48B 1IQKA 4R0IA 4XDEA 1CGIE 2A7HA 1O5GH 1A5IA 1N8OB 3TK5A 2XTTB 3ITIA 1EXFA 1DUEA 3QGNB 3NZIA 4JK6A 3QZQA 2CHAC 4X1SU 5HYOA 1G36A 2IOTA 2TGAA 1SGPE 5DN6D 1P06A 5T1VA 4F55A 1SQTA 4TYDA 1YCPM 1BMFD 3PYHA 3QGJA 4D76A 1E36B 1GJ8B 2F43B 2FXRA 4DT4A 4AFZA 3TITA 1NFUA 2BLVA 1EZXC 1K1LA 1BRBE 1Z7KA 1LPGB 3DSPA 4ACBA 1H8ED 2C4FH 2ZCHP 1Z1IA 1V6DA 2BQ6B 4ISNA 1AI8H 1KY9A 3F9HA 1S6FA 3A85A 3BTDE 4CRDA 4LZ1H 4CBOA 3FZDA 4I8JA 4SGBE 1AGJA 3SQHE 5HIYA 1C1WH 4NIVA 2FI4E 2FOMB 3T26A 1A1RA 2G5VA 1DLKB 3VGCB 5CE1A 5EQQA 1GBBA 4GSOA 2F83A 5C1UA 4I7YH 1GBFA 1O2UA 1S6LA 3R0FA 1JIMA 1AFEH 3RMLH 1YCPH 5IDKA 1QY6A 1UHBA 1GBTA 1TPAE 1F7ZA 2AMQA 3MOCA 1S5SA 2VIOA 1NN6A 2UWOA 5A8XA 1EKBB 2GDDA 2PKSC 1NU9A 1MKWH 1C1TA 2G55A 1HAIH 5G4BA 4MVNA 1BQYA 3M5MA 2H6MA 3D23A 1Z8RA 1B0FA 3GCHB 2PP6A 1EB1H 1ZPCA 1HB0B 1Y5BT 1W11U 4ZHMU 2VNTA 2Z9LA 4FUDA 4UE7H 1VZQH 1VCQA 1LHFH 1NS3A 3AAVA 1C2IA 3EE7A 3FOAA 1BDAA 1F0UA 1VR1H 1GI4A 2XNIA 2ZPSA 3AK5A 1P2IA 1YPEH 5FCKA 2BXUH 3ZVCA 3T28A 5JDUB 1D9IA 1WDIA 1GHXH 1Z8GA 2EI7A 2WINI 5FPSA 5T6DA 1VITH 1LHCH 1VITF 2HVYB 1P03A 1GI1A 3TH2H 3GDVA 1TQ7B 3K6ZA 5FPTA 3GYMA 1U6QA 3VPKA 1XUJA 2FOHA 4DG4A 1TWXB 3P6ZB 1C2DA 2V0BA 1SQRA 7GCHG 1GHWH 3RXCA 1UCYH 1NO9H 4AG1A 1O2HA 2D26C 4X1NU 1SGTA 1G9IE 1K1PA 3RXTA 1H8HD 2STAE 1YPHC 2ZFFH 2VWOA 2ZC9H 2B5TB 5DP8A 2TGTA 1A2CH 1O2OA 2RFKC 1OP2A 4OS2A 1KLJH 1T7CA 1W0YH 4A5TS 2LNCA 1HNEE 4P00A 1W7XH 2A2QH 1THPB 3P95A 1WQVH 3MWIU 3DD2H 1EJAA 3TJNA 1O5AB 4OS7A 3RXAA 4TY6A 1BRCE 3TPIZ 1PPFE 2QF5A 3VEQB 1ZHPA 5DSFA 5HXFA 1QL7A 2P3FH 2PGBB 4O03A 4B76A 5ABWA 1L2EA 2ZA5A 1HAOH 3PTBA 3HGPA 2R9PA 2QE7D 1GBLA 3GCOA 1GMHG 2PW8H 2HRVA 1QB6A 2Y5GA 1FI8A 1MCTA 1Q2WA 1YLNA 1AQ7A 1AE5A 1P02A 2SGDE 4XE4A 1ESAA 1V2ST 2GT7A 1O3BA 2P3TB 1GBIA 2BTCE 4WH6A 5EU8A 4BAHB 1ZLRA 3EDXB 1J9CH 1AVGH 4MNVA 1OSSA 2J5UA 1C2HA 1DLEA 1CBWC 5JBCS 4K1TA 4Q2KA 5HIZA 1KXEA 2FODA 3TJUA 2ZGJA 4Y8XA 2C90B 1OWKA 3MNBA 3U8OH 3OX7U 1GI8B 1P2OA 4YOGA 2ZTZA 1OX1A 1C1MA 4DIIH 4A7IB 4Y8YA 1O3FA 2BLQA 2YMSC 3LT3A 1KLTA 4JZFH 3OY5U 1SPJA 5EG4A 2GP9B 5L30H 2CV3A 5DPAA 1QA0A 3OEHD 3PO1B 2A4OA 1QRWA 3Q76A 2A7CA 1AB9C 4D9RA 3K9XB 2BVSH 3DA9B 3O8BA 3UREA 3V13A 3MU0A 1MQ5A 4FETA 3MFJA 3T5FH 4YM9A 4ISHH 5E2OA 5C3NA 1F5LA 4ABDA 1GGDC 1TGNA 3PMJA 4ESTE 1H9LB 4BOHA 3BEFB 2QF3A 1D3PB 3BSQA 3D62A 1SGDE 3EGKH 1DITH 2GTBA 1DOJA 2FS9A 2ZU4A 2P95A 1S84A 1EATA 1LQDB 1WTHD 1XX9A 5TCAA 6CHAB 3RM0H 2GVFA 1EZUC 1IAUA 1O3IA 2H5DA 3RC4A 1ZTJA 2G5NA 3S7HB 1BTPA 1C1OA 4ZUHA 4ABGA 1DWDH 1TGCA 4NWLA 3H7TA 6GCHG 1UTQA 2A32A 1CE5A 1WQSA 2BXTH 2J98B 4UFGH 4MNYA 1G2MA 4WMEA 3SV9A 2DE8A 3BV9B 1A7SA 3GY6A 4NWKA 2WYJA 3SNDA 1TRYA 4YXWD 1C5PA 2C8WB 2ZFSA 4RI0A 5ESBA 1P9UA 2FLRH 3LJJA 3Q3YA 1XUIA 2BD4A 3CENA 1ZGIA 3E0NB 2C8YB 2J34A 4XFQA 1NFWA 1P57B 1C2FA 4X6PA 3C27B 4UFFH 1C5ZB 3LC3A 5K0HA 2F9NA 2ZU2A 1E35B 4UFEH 2K8IA 3UNSA 2BY9X 1GVLA 2B8OH 2JH0D 3E6PH 1ELBA 2XBWA 5ESTE 4OS1A 3F9EA 1TMTH 3DSGA 3PV2A 4UDWH 4GCHG 4X2YA 2ODYB 3TGIE 1OYQA 3M35A 1N6XA 2VVCA 1E1RD 1P0SH 3MU4A 1LPKB 2FOGA 1GMHF 4BAOB 2AGEX 2ZKSA 4CRBA 4AOQA 1ZYOA 1PPZA 4RSPA 1W0JD 1AKSB 1W10U 1MZDA 1O2NA 1YYY1 4R8TB 4ABHA 3PMBB 4CRGA 1ELGA 2H9EH 4FU7A 3SJIA 3SZNA 2A4RA 1ARBA 1YWUA 3RLWH 2FTMA 4RT0A 2QC2A 1C5XB 2WUBA 1Z71A 2O8LA 2CJIA 2FWWA 5I46H 1SLUB 1QB9A 3P8OA 1VKYA 3D65E 4OS6A 4YT6H 3HKJB 1YBWA 2QYIA 1O2SA 1QTFA 4Y11E 1DS2E 1P3EA 3WY8A 1EZSC 4KP0A 1EB2A 2AEIH 2VH0A 4NIWA 3GOVB 1W12U 4FU9A 1EX3A 2PKAB 2FOBA 1ORFA 1LHGH 3SYJA 1PYTD 1VCWA 4K8YA 1N6YA 2Z3EA 5JBTA 1O31A 4Y7BA 1IOEA 2BLWA 2R0KA 4PROA 3GY3A 3MO3A 1TQ0B 3RMMH 1EPTA 3PMAB 1O3DA 2CK3D 2W26A 1IQGA 5BPEA 1SBWA 1SI5H 4INHA 3M61U 5I25A 1GJ4H 2G51A 5T6GA 2AGIX 2ZGXH 3M5NA 5DGJA 2TGDA 1KXDA 3KCGH 5EPNA 1C1RA 3MU5A 1TRNA 6GCHF 1NTPA 5E8EH 2V3MA 3VB5A 3TH4H 4I86A 1KXBA 5T6FA 2C93B 1VJAU 3E91A 1W14U 5IYTA 2H5CA 4B71A 2JH6D 1DWCH 5BRRE 2L6OA 3ZVAA 1S6HA 4FUFA 1SQAA 3IITA 3KN2A 1O2LA 2KCYA 1TFXA 1TOCB 1XVMA 3WW7A 1AFQC 3BTEE 3E0PB 4FU8A 5DG6A 1V2QT 1WAYB 3A7ZA 1K1JA 1W2KH 2QA9E 3UOPA 1ZR0A 1BMMH 1SHYA 5EW2H 1P10A 1SGQE 2ZEBA 3PRBA 3QLPH 2WZQA 1BZXE 1K22H 3ZV8A 5TJXA 1Z8JB 2GV7A 2ANWA 3LONA 1JBUH 3UB0A 2ZFTA 2GCTB 2ZP0H 3K6YA 1UK4A 4ZROA 3RXDA 3B23B 4JZEH 1G3EA 4MPUA 4GCHF 1C5UA 3SU5A 3P17H 2BX4A 1O3GA 5GDSH 6CHAC 1GMDF 3UNQA 4B6EA 1GDUA 3CS0A 2KM0A 3RXMA 1TIOA 5EODA 2FYQA 5PTPA 2P94A 1FDPA 1O35A 1E37B 2TPIZ 1O5EH 1FJSA 1YC0A 1O2RA 1JMOH 2OCVB 2QGRA 3SU4A 2GT8A 1Y3XA 3MU8A 4XBCA 5E0JA 1K1IA 1FXYA 2ZU3A 5A0CA 2BYAX 3U69H 3KQ5A 3LGUA 3TGJE 4BXSA 2WPKS 4O3TA 5J4QA 1BHXB 2JIZD 1DM4B 3H7OA 1FUJA 1JOUB 2AMDA 3SOSA 5EW1H 3ZIAD 3PLPA 3NKKA 2GKVE 1SGEE 3Q3KA 4J1YA 1C9TA 2XW9A 2ZPRA 3F0OA 5LPFA 4Y7AA 4ZKNU 1OPHB 1OWIA 1K2I1 4IN2A 1QZ8A 1CHOG 3UR9A 3MH7A 4VGCC 1NROH 3Q77A 1QURH 4TT3D 2EEKA 2C8ZB 1LVMA 1GHBG 1TONA 2TGPZ 1MTNB 1TE0A 3GY8A 7KMEH 5FHTA 4D9QA 4Z0KA 4ABAA 3PLBA 2Q6GA 1P8VC 5A2MH 2QV1A 3I77A 1DICA 5B6OA 1O3EA 1AY6H 3VXFH 2BDGA 3P92A 5FAHA 1H8DH 3AASA 3ZYEA 3V12A 3U8TH 3W95A 4CH8B 4CRFA 1YPKH 2RCEA 2ZGBH 1XKAC 1NC6A 2Z9GA 1GG6C 3BTME 1SQOA 2P8OC 5DP9A 2LELA 5LGOA 1GBEA 1NT1A 3LGTA 2AIPA 4U32A 3SV8A 5GNDA 4YTAA 4XRNA 1MAYA 3SUDA 5KEDA 2Z94A 1V2JT 1DVAH 3LGYA 2I6QA 2P3UB 4IBLH 2C3SA 2VWMA 3LU9B 3M3VA 3TIUA 1YPGH 4YOIA 4ZKRU 4FUIA 5FL7D 1AU8A 4X1PU 2UWLA 3JZ1B 3SNAA 1ZSKA 1O3HA 1QQ4A 2BY8X 3SQEE 2TBSA 3FKSD 3PTNA 1GL0E 4Y79A 4JCNA 5JB9S 1WCZA 2G4TA 3BF6H 2J4IA 3F0PA 3MMGA 4TWWA 2OBQA 4F49A 5GIBA 4YT7H 1LDTT 3WWBA 1VJ9U 2JJ1D 4A92A 1BHXF 1Y3WA 1INCA 1CA0C 1TX7A 2V7QD 2VINA 1D4PB 1HXFH 1Y8TA 2GMTB 1FPCH 3GISB 1QFKH 1GJBB 3A8AA 4XOJA 1YPMH 1RTKA 3QN7A 2F9OA 3VFEA 1GI2A 1TOMH 3N99A 3VG8A 1AO5A 2LPRA 2ZDAH 2AMPA 1H1BA 1OWDA 2A0QB 2NU3E 4H6TA 1GVZA 5ETXA 4Y6DA 3SNBA 1OXGA 2BD3A 4Y76A 2PWXA 4K60A 2VIQA 3A88A 4JYTA 1BRUP 3I78A 3JZ2B 3ZVFA 2ZDMA 4ZCNA 2ZHEH 3UOUA 2LP6A 3U98H 3ATLA 1K1NA 5C5NA 1M9UA 4HGCA 4RKJB 1GCTC 1XM1A 2OP9A 2W3KA 4H42U 4BXWA 1LKBA 1PQ5A 1DXWA 1UCYE 2A7JA 4Y0YE 1XUHA 2DUCA 4NA7A 1X7AC 1TGBA 4FUEA 2JETB 3BG4B 4INKA 4RT1A 3KHVA 3M3SA 5DJ7A 3BTTE 2BHGA 3PV4A 1HV7A 1NU7B 1SGCA 2ZGCA 1S82A 4FOUC 3NRLA 1KTSB 4IW4E 1HJAB 4Y71A 2XRCA 3MI4A 1BMNH 4HG6A 2BDCA 1TLDA 2R0LA 1QRXA 1CHOF 3A8DA 5C2ZA 1DFPA 4CR9A 1TGSZ 2ZQ1A 1BTUA 1TNKA 1ZRBA 2IJOB 3OU0A 1V2UT 3M37A 1MMJN 4CRAA 4HI3A 4YLUA 2V3HH 1B5GH 1GHBF 1GWAA 2GJGA 3N7EA 2FEQH 1GI0A 1MUEB 4YOJA 1YPJH 2QCYA 4CBNA 1BCUH 3L6PA 3TGKE 4K3JA 3SGQE 1FY1A 1VGCC 1O3JA 2KCPA 1D3TB 1ANCA 1JRTA 2TIOA 2P16A 2XCFA 2A5AA 1HAPH 2ZNKH 1WUNH 2QY0B 1SGYE 1RIWC 2JDID 3D49H 2JKHA 4X6MA 2HGTH 3BEUA 1EOLA 3P8GA 1EJNA 3SGAE 1G37A 1W13U 1F0SA 1OKXA 3A8BA 4ABFA 4LZ4B 1SFQB 4NSYA 3DFJA 1EJMA 2FESH 4ZXYH 3KQDA 2KZ4A 1NY22 5EXMA 4NFFA 2SGQE 1SL3A 1FY8E 4D7FA 1C5NH 2O8TA 1UVUH 1AVWA 3U28C 3ZZ5A 1ZMNA 3N7DA 3PLKA 2BDYA 2BZ6H 2WPHS 3NUMA 3ATKA 1GPZA 4FVDA 2G52A 2FMJA 3Q00A 4ABJA 2J98A 2GX4A 2EI8A 1EUFA 4B75A 4X6NA 4X8TH 5C20A 5EIYA 2PV9B 4K1SA 1T31A 4MG3A 2W6JD 1MD8A 3TJVA 4X1RU 3IG6B 4DCDA 2H9TH 4NCYA 1TBZH 1GI7B 1EPTC 1QHRB 3GY2A 3LKWA 3URCA 2HVXA 1NRRH 4SGAE 1A3EH 4B6FA 2VGCB 3SI4H 1QL8A 2P93A 4NZLA 1AZ8A 4P02A 4ABBA 1P9SA 1SSXA 1MU8B 1V2NT 2J2UA 2BOKA 2FOEA 2BX3A 3A86A 4CHAB 3H09A 5EJLA 4JYVH 3MQKC 1ACBE 2BQWB 2PR3A 1E0FD 1TNJA 3M7TA 4Y10E 3UAIC 3MU1A 3PRDA 2QXHA 4GUXA 4ACAA 1TGTA 1MKWK 1AUTC 1J8AA 4ZH8A 1GBCA 3LIWA 4KGAA 1EZQA 2BDHA 1L1NA 4IMQA 1W3CA 4I32A 3QTVH 2OD3B 2ALPA 4XBDA 3RXIA 4FVBA 1UVSH 2FX4A 2ZIQH 1NESE 5CHAC 3V0XA 2J92A 1AKSA 2Y80A 3SI3H 1C1UH 3ODFA 1CT2E 1XXDA 4HZHA 4DVAU 3URDA 3LH3A 3ODDA 1E34B 1LHDH 8ESTE 1KXCA 1NPMA 4WMDA 1N8OC 3KF2A 4X2XA 1BA8B 1S85A 5JBBS 5F53A 2BM2A 5HM2A 1C5SA 5FBIA 1ETSH 1ELDE 2B7DH 4FUJA 1O3CA 1LCYA 1LPZB 3RC5A 2FP7B 1YKTA 3LGVA 2GMTC 1THRH 4O9VA 5SGAE 4B2BA 1GJ6A 4Q4LA 5J4SA 3AW1A 1QL9A 1J14A 1P12E 5C17A 5DP5A 3HATH 1NFYA 2I6SA 1MQ6A 1Z1JA 2PKAA 1SVPA 3FN8A 1HUTH 1V2RT 2A45B 2FX6A 4AB9A 1UCYK 5L6NH 1C5OH 1GVKB 3EA9A 4DGJA 4I8LA 3SBKA 5GPIB 3W1EA 1XUKA 2NU0E 3GDUA 5C67A 2FO9A 4IMZA 1DSTA 2XWBI 3G01A 1P01A 4O97A 4XSKU 4F4OC 3VGCC 3BTKE 2PHBA 1P2JA 1TBQH 3MH5A 3QZRA 5F8TA 2RA3A 1BBRE 3GCTG 3ZZ6A 4MPVA 2F3CE 1V2MT 2UWPA 4CH2B 2YMSD 5DP4A 1SC8U 2KR7A 5FPYA 3ZYDA 3SUEA 5IK2D 1AZZA 7GCHF 1EAWA 2F9PA 1GJDB 1ZHMA 5FX6A 4UFDH 2GZ9A 3RU4T 1LHEH 3FP8E 4B73A 2QIQA 3SO3A 3AVZA 3GCHC 1DANH 3S9BA 1Q3XA 3VB4A 1LTOA 5T3HA 1GJ9B 2UUYA 3SU3A 1BIOA 4U2WA 1P2QA 1MTVA 2Z3DA 4MNWA 2BOHB 1K1MA 1KIGH 5C5OA 3BIUH 2XC4A 1C1VH 4AFQA 2F9UA 1YY3A 4M9FA 3E16B 1ZTKA 1FIZA 1E1QD 1GBHA 3NWUA 4OS5A 5HKKD 1NZQH 2J95A 4FXGH 4JK5A 4TPYA 1BTYA 1LVOA 1PPEE 1H9IE 3A82A 5FBEA 1F5KU 1O30A 1ELAA 3BTFE 3WWFA 1KDQB 1QBOA 2WSSD 1AIXH 3AAUA 2PSXA 3SJKA 4I33A 1GMCG 2Z9KA 4I31A 2WPIS 4E05H 2AH4X 5GCHG 3RXLA 1CT4E 2BDIA 1S0RA 4Q80A 2OC1A 1FY4A 1HGTH 1UMAH 3OEED 1KTTB 1KSNA 2VWNA 2PLXA 2JJ2D 1C2KA 3UY9A 1C4U2 9ESTA 4BTIB 2EA3A 1C4Y2 3RXGA 1RS0A 4NZQA 1GI6A 3ZVEA 3U8RH 3QX5H 1AE8H 1HIAA 5E2PA 1C5RA 1OHHD 1WYKA 3RUOA 4O3UA 3M3TA 5AFYH 2WV4A 1FLEE 1O3KA 1OWJA 4AFUA 3TK9A 3FVFB 4U01A 2PTCE 2VIPA 1CGJE 4Q63A 2KFWA 1GL1A 1OYTH 1DE7H 3IWMA 3CP7A 2VGCC 3MNCA 2FI3E 4Q7YA 2ZFPH 3ESTA 3LJOA 1O2MA 1O2PA 3V3MA 2KCAA 2Y81A 4MPWA 1O2KA 1J17T 2A4QA 4CHAC 3A7XA 1EQ9A 1SGNE 1GJCB 4K5ZA 1THSH 3SN8A 1UVPA 1IQEA 2AYWA 1FIWA 1O3PB 4INLA 1P11E 1LO6A 4RKOB 1T8MA 1J16A 1Y3YA 1UTNA 1KXFA 1DWEH 2CHAB 2SGPE 2UUJB 1PJPA 3BTGE 1A46H 2HPPH 2OINA 3MHWU 3TVJB 3SV2H 1RGQA 1G3CA 3DFLA 1O36A 1GHZA 3Q3XA 3O8CA 1F0TA 3RU4E 3MNXA 3UFAA 3PROA 3KIDU 2D8WA 1PPBH 3GCTF 1BJVA 1ZPZA 2J9NA 2CGAA 3STJA 1O5CB 4OM9A 1HAVB 4ASUD 4AX9H 1BOQA 2Z9IA 1D6RA 1N1LA 2SFAA 4I8KA 1H8IH 1O2XA 4A1TA 1FY5A 2B9LA 3ZZ8A 3ZZAA 3PM3A 1UTMA 3FFGA 1ZSJA 5DP7A 2ODQA 4WWYA 1MKXK 3PO1C 2G8TA 2OQUA 1FQ3A 4DW2U 1O39A 1DWBH 1WU1A 2CN0H 2XBVA 2J94A 4DY7B 1UTKA 1UTPA 1BTWA 1TAWA 1HLTH 2GCHG 2XWAA 3RC6A 3GY4A 1KMHB 1GDNA 2PSYA 1ELEE 5EGMA 1D3QB 1SGFG 1AWHB 3K65B 3M36A 4BTUB 3K2UA 1EP5A 3A7TA 1TNHA 4GLYA 1BBRK 1MZAA 4ZKSU 5F03A 3RXRA 4X8SH 2A2XH 3ZZ7A 1L4DA 1C1NA 2L74A 3LC5A 1XMNB 1C1PA 2ZU1A 1NRQH 1O2ZA 1GMCF 3M7UA 5GCHF 1DDJA 1GCDA 1SHHB 3QUMP 3EAJA 3S9AA 1QQUA 4X0WU 2ILNA 5JYIA 2SNWA 3KL6A 4Q7XA 3A87A 3E1XB 1LQEA 1W0ZU 2NWNA 1L0ZA 3RXBA 4AYVB 2GGVB 1C9PA 5EXNA 1IQIA 1F0RA 4JYUH 4MLFB 2XC5A 3SU1A 1FMGA 3RM2H 3OTJE 2ZO3H 3M7QA 5EOKA 3UQOA 1RJXB 3DSOA 5EJZA 1K1OA 2BD5A 2VIDA 1A5GH 2Y7ZA 1P2MA 3FZZA 5E0GA 1O2QA 2FOAA 4JMYA 3ZZCA 3SZEA 2HLCA 4KELA 3DUXH 2W5EA 4FUGA 4GHQA 2FTLE 2V35A 2WV9A 5GXPA 1DX5M 2IPHA 3MNSA 4MQAA 3SJOA 3SU6A 1PQ8A 3BTWE 3GYLB 4AG2A 4OGXA 1FN8A 1ELTA 1TA6A 5E0HA 3S69A 3S0NA 5C0UA 1XVOA 1T4UH 3GDSA 1ETRH 1W7GH 4DT7B 5F8ZA 1F5RA 3TK6A 2EY4C 1O33A 3BTQE 1PQ7A 3KNXA 2OC8A 1V2OT 2KX4A 1BUIA 1O5BB 2KAIB 2M2AA 2OUAA 4WH8A 5GJ4B 2ZDKA 4LXBH 3PB1E 1TPSA 8LPRA 1P04A 2IJD1 3UNRA 4KTUA 1WOFA 1C4V2 1QBVH 3HK3B 4H6SB 4H4FA 1BTZA 3T29A 1A3BH 4NFEA 1AN1E 4CREA 2OTVA 2IN2A 4ABIA 2SNVA 1RTFB 4AB8A 1GI9B 4IS5A 5KGOA 1CVWH 2B0FA 2YNBA 1T8NA 1ZRKA 2NU4E 2OK5A 3A7VA 2AS9A 1ETTH 1CA8B 5DP6A 3RMOH 4ISOA 2O9QA 1W0KD 4BNRA 1HDTH 3OY6U 2ASUB 3V7TA 1O3NA 3BN9A 1CU1A 2FOCA 2M5TA 1T8LA 3OFND 3RXPA 1FNIA 2VB0A 3SV6A 1JRSA 1BRAA 1CBWB 2H2ZA 4ISIH 3SORA 1YP9A 1BITA 2GCHF 2IPQX 3PV5A 4HTCH 4K69A 2QN5T 2AFQB 1GJ7B 3FO8D 3HK6B 3PMHB 3RXKA 4GAWA 4BAKB 4NG9H 5EJ1A 7ESTE 1Y5UT 4DJZB 2YMSB 1C1SA 1S0QA 2FIRH 3HKIB 7LPRA 2HWLB 4XD7D 2ZHQH 4NGAH 2Y6TA 1NRSH 3BIVH 1L4ZA 8KME2 2GZ7A 1AB9B 1MTUA 1O5FH 2R3YA 4JZIA 4MTBA 2FM2A 4KTSA 5GWZA 1MU6B 2O8WA 4WJG2 3FP6E 4A6LA 4IC5A 1K28D 2Q6FA 5AF9H 3A7YA 4IN1A 1QBNA 1HAHH 4FUHA 1GGDB 1L1JA 3EA8A 3GICB 1SMFE 3ZZ3A 4OGYA 1SKYE 1T4VH 4Z1MD 3UUZA 1TNIA 2HOBA 1HXEH 4WY3A 1DPOA 2R3UA 1O2WA 1IQHA 5A09A 3RXQA 5A0BA 1SLVB 1L1GA 1DY8A 3ENSB 2ZG0H 1O32A 5FXLA 1OP0A 1SGRE 3F6UH 1ABIH 4DURA 1XUGA 2Z9JA 1E79D 3NCLA 4K1EA 1TABE 1DSUA 2W3IA 2HNTF 4AC9A 4X2VA 1D3DB 4BAQB 2ZDVH 1ESTA 1RD3B 3O8DA 1HAYB 3LDXH 3RU4D 1NFXA 3A83A 3CNRA 1K9OE 2K1QA 2GCTC 1KYNA 1S83A 1F2SE 3TH3H 1T32A 3FP7E 2ZZUH 1FONA 2BLOA 2YOLA 1BT7A 1Z8IB 1C5WB 2ZGHA 4E7NA 3T62A 2FZZA 2BDBA 2A5KA 1AMHA 1TMUH 1ZTLA 1JIRA 1FV9A 2ZF0H 4DIHH 2ZDLA 4ASHA 4B2AA 3LPRA 2WPMS 3ZVGA 2BQ7B 1C2JA 4ISLA 1UTOA 1QJ7B 2O8UA 1TX8A 2CF9H 1S81A 2FI5E 3TJOA 3M5OA 2QF4A 4WVPE 3KGPA 2W7SA 2F91A 1QIXB 4WXVA 4WMFA 3S7KB 4D7GA 3EYDA 1MTWA 2O8MA 2ZI2H 3L3TA 3UQVA 4MNXA 1ZHRA 4ZKOU 3SU2A 3PWBA 1LKAA 4IGDA 2KCOA 2DE9A 1RXPA 5CDFE 1HBTH 2RA0A 3SHCH 4TY7A 3RXUA 4ZMAH 5LH8A 1ELCA 2ZTXA 5FCRA 2OC7A 4YLQH 1MTNC 3M5LA 2CF8H 2VIWA 3F68H 1BMLA 2OQ5A 1QNJA 1A0JA 1G32B 2EC9H 5EXLA 2HALA 3BG8A 1YCPK 2BD2A 2ZPQA 1A0HB 1AD8H 2FDAA 1GI3A 2G81E 1GJ5H 4B74A 3HPTB 4JZ1A 1VCPA 1SLWB 2QXIA 3E90B 2D2DA 3A84A 1OP8A 2Z3CA 1FX0B 2NU1E 2A31A 1O0DH 4CR5A 1KDQA 1CHGA 3GY5A 2ULLA 1P09A 1OOKB 5C1XA 6LPRA 5AHGH 3ATWA 1G2LA 1HPGA 2VU8E 2HNTC 1AHTH 1ANBA 5DP3A 1C5LH 1UVOA 2TRMA 2ZU5A 1NBME 1RTLA 1TNLA 1Y3UA 1MAXA 4NIXA 2BY6X 3QO6A 4QT8C 3RLYH 2OLGA 1PPHE 1GDQA 1P05A 1V2PT 2BMGB 8GCHG 5K7RA 4KTCA 3SJ9A 4Y0ZE 4ZHLU 1UHBB 1PPGE 1RRKA 3GCNA 1UO6A 3P8FA 3A7WA 5F8XA 1EOJA 3TNTA 1UJ1A 2YNAA 3OTPA 1ZMLA 1TX6A 2P59A 2XOKD 1V2TT 3MH4A 3TNSA 4AYYB 1O34A 3UR6A 3OSYA 3OE7D 3P8NA 1C2LA 2WYGA 3LGIA 1QB1A 2ESTE 1TMBH 1UTLM 2ZHDA 3NPSA 3SHAH 2ZTYA 3U9AH 3UIRA 4IC6A 2A5IA 3A80A 3RDZA 3NXPA 4GHTA 4TPIZ 2XNDD 3E3TA 2GDEH 2ZCLP 2QXJA 3RXOA 1KXAA 1DXPA 1OS8A 4A1VA 2G4UA 5CHBA 1CQQA 1TBRH 1V3XA 2ANKH 2XBYA 2Z6BD 1AFQB 1V2LT 4BANB 4AGKA 3S9CA 4NA8A 2XXLA 4OS4A 1NRPH 1Y59T 4JZDH 2RG3A 2V6NA 4TSFD 3W94A 1UW7A 1A61H 1GI5A 5H4IB 2GD4B 1QGFA 1ESBA 2JETC 3FAOA 3BG4C 3VXEH 3RXSA 1CGHA 2PUQH 2VIVA 1A4WH 4MPXA 1AWFH 1YGCH 2CXVA 4M7GA 2FOFA 1CSOE 1C2MA 1HJAC 1ZZZA 2H9HA 3ATMA 2ANYA 4CRCA 4I8HA 3RXEA 2BB4A 1FZZA 3R3GB 1IQFA 1HCGA 2FPZA 3SNEA 2J38A 1IQMA 1ZJKA 1HAVA 3OYPA 4FUBA 1HAGE 3SNCA 3C1KA 1QA7A 1O37A 1TRMA 2WPJS 1C2GA 1B7XB 1O3AA 5AFZH 5HM9A 1BJUA 1D6WA 1O2IA 3ZZBA 4Z6AH 1EAIA 1MCVA 1UTJA 4BAMB 3F1SB 5EPYA 2K0QA 2ZECA 1F92A 3SW2B 2R2MB 3VB6A 1TPOA 2VVVA 1O3OA 2BZAA 5HMAA 3OAAD 5EQRA 1O2YA 4TWYA 1TYNA 1YLCA 1TB6H 3UWJH 3T25A 1HJ8A 1PPCE 4Q7ZA 5C0TA 1YPLH 2XBXA 3B8JA 1UVTH 1UK2A 4A1XA 3MO6A 4VGCB 1TA2A 1RFNA 1Y5AT 1AUJA 4K2YA 1ZJDA 1GBAA 1EAXA 1C5VA 3ATIA 3RXHA 1YF4A 1EP6A 2PUXB 3RMNH 9LPRA 1G3DA 1NM6A 2QAAA 2XYAA 1BTXA 2ZFQH 4KKDA 4Y8ZA 1O3LA 1IQJA 1GMDG 3BTHE 3AW0A 2ZHWH 2GZ8A 4X8UH 3KEEA 1MKXH 3A8CA 2HLDD 3KQBA 5DO4H 1PYTC 2A1DB 3FANA 3F2GA 3QK1A 4AZ2B 2STBE 1G3BA 1GG6B 4X8VH 1CT0E 3NK8A 1TALA 1EASA 1GHAG 2P8OB 1SB1H 1MH0A 5KECA 8GCHF 3ZZ9A 5L2YH 4J2YB 5LPEA 4NSVA 3UWIA 2OC0A 1QCPA 1V2KT 2PFEA 1H4WA 2BY7X 2HPQH 1ELVA 1BBRH 1FY3A 1V2WT 3N7OA 4HFPB 1SGFA 2WUCA 4LOYH 5JPMH 3L33A 1ANDA 1FAKH 2AGGX 1GBJA 1T8OA 2BVXH 3ZZ4A 4XBBA 3UTUH 4WF8A 1WTGH 6ESTA 4ZAEA 1WXRA 4BTTB 1IQLA 5F6MA 1PFXC 2QF0A 3ZVBA 4ZHAA 4WXIA 3SV7A 2FYRA 2Y7XA 1J15A 4AN7A 3ZVDA 3U1JB 1GBDA 3F2HA 1CA0B 2W6ID 3B9FH 1V2VT 2PGQB 1NRNH 2Y82A 4MDSA 2NU2E 3SJ8A 3LGWA 5CMXH 1QJ1B 5LPRA 2FS8A 1O3MA 1ARCA 3QTOH 3F9FA 1IHSH 1DT2A 1WBGB 1A0LA 1LVBA 2KAIA 1ZGVA 1ID5H 3A81A 1MABB 3BEIB 4YESB 5AVDA 2G00A 2BD9A 2ANMH 3SUFA 4FUCA 2Y5FA 2QXGA 3EE0B 1Y3VA 2A4GA 3PWCA 3QDZB 4GPGA 5JB8S 1O2GH 1GCTB 2OXSA 2H1UA 2ZWLH 5A0AE 3MYWA 2VH6A 3E8LA 1Z6EA 2VVUA 1FAXA 2V3OH 3TLOA 3ZV9A 1TNGA 1SFIA 1HRTH 1HJ9A 3RP2A 1GHYH 1ABJH 1O38A 2WPLS 2BVRH 1CO7E 1MBQA 1WV7H 1DUAA 1NBMD 1XXFA 4X1QU 2VJ1A 2WPDD 1QJ6B 1OWEA 2ALVA 4NA9H 2PKSB 2UUKB 1P2KA 3VB7A 5TCCA 1G30B 2Q6DA 2ZFRH 1DY9A 1O2TA 3U1IB 1MD7A 2ZDNA 2VBCA 2SGAA 1IQNA 3RXFA 1SOZA 3RXVA 1A5HA 1C2EA 3H5CB 4DOQA 3SUGA 2Y5HA 1PQAA 2J97A 2OBOA 1QRZA 1FPHH 1KLIH 1SLXB 3LOXA 3QWCH 2ZQ2A 1JWTA 4K8BA 2AHME 3LH1A 2D1JA 4B1TA 1O5DH 1ZMJA 1ANEA 2F9VA 3P70B 1SGIB 2VWLA 1P3CA 5C94A 2Z7FE 3DCLA 1ZSLA 3T2NA 3STIA 1VGCB 2GV6A 1HFDA 2ODPA 1YM0A 5B6LA 2BY5X 5C1YA 3ELAH 2SGEE 1RIWB 4ZXXH 3F3BA 1C5QA 1GHVH 2BD8A 5A8ZA 4X6OA 3KYFA 3MO9A 2RDEA 4LK4A 1GHAF
chains in the Genus database with same CATH topology
4ABEA 5DK1A 2BD7A 1HAZB 2WV5A 4AFSA 1W8BH 4AORA 1Q31A 2AIQA 2F9BH 1HIAB 2XC0A 2EI6A 4E7RG 4E06H 4I8GA 2THFB 3SGBE 1GBKA 2XCNA 1MBMA 2ZHFH 2SGFE 3VB3A 1YLDA 3SU0A 1C5YB 1QR3E 4UONA 1HAXB 3UPEA 3GY7A 1C5TA 4YO9A 1AVXA 4UD9H 1MTSA 3MTYA 4THNH 2FLBH 5DKMA 1JXPA 3ZZDA 1XUFA 3EA7A 3RXJA 2RDLA 1O2VA 1LMWB 1GJAB 5HGGA 4GVUA 4RN6A 3DT0H 1C1QA 1YPHE 1HYLA 1Z6JH 4D8NA 3EQ0H 2PTNA 1EPTB 4U30A 1SG8B 2W7UA 1O2JA 1FN6A 3HGNA 1XKBC 2CMYA 1IHTH 3A89A 1BTHH 1ZPBA 1ZOMA 1SOTA 1H9HE 1GBMA 2C8XB 3KQCA 1VITG 3T27A 3MH6A 1K21H 3I29A 3O8RA 1UK3A 1BB0B 4NIYA 1ELFA 2R2WU 2UUFB 2HNTE 1WSSH 4X2WA 3KQEA 4AGJA 1EAUA 5EQSA 2Q1JA 4YZUA 4B2CA 5L2ZH 1P2NA 2ZCKP 1OWHA 5A8YA 3CS7A 1E38B 1B0EA 5CHAB 1C5MD 1LVYA 2BDAA 1BMAA 4UEHH 1SR5C 3F9GA 3DHKH 5FX5A 1TPPA 3TU7H 5JBAS 2JH5D 2AERH 1IQKA 4R0IA 4XDEA 1CGIE 2A7HA 1O5GH 1A5IA 1N8OB 3TK5A 2XTTB 3ITIA 1EXFA 1DUEA 3QGNB 3NZIA 4JK6A 3QZQA 2CHAC 4X1SU 5HYOA 1G36A 2IOTA 2TGAA 1SGPE 1P06A 1SQTA 4TYDA 1YCPM 3PYHA 3QGJA 4D76A 1E36B 1GJ8B 2FXRA 4AFZA 3TITA 1NFUA 2BLVA 1EZXC 1K1LA 1BRBE 1Z7KA 1LPGB 2C4FH 2ZCHP 1Z1IA 1V6DA 2BQ6B 4ISNA 1AI8H 1KY9A 3F9HA 1S6FA 3A85A 3BTDE 4CRDA 4LZ1H 4CBOA 3FZDA 4I8JA 4SGBE 1AGJA 3SQHE 1C1WH 4NIVA 2FI4E 2FOMB 3T26A 1A1RA 2G5VA 1DLKB 3VGCB 5CE1A 5EQQA 1GBBA 4GSOA 2F83A 5C1UA 4I7YH 1GBFA 1O2UA 3R0FA 1JIMA 1AFEH 3RMLH 1YCPH 5IDKA 1QY6A 1UHBA 1GBTA 1TPAE 1F7ZA 2AMQA 3MOCA 1S5SA 2VIOA 1NN6A 2UWOA 5A8XA 1EKBB 2GDDA 2PKSC 1NU9A 1MKWH 1C1TA 2G55A 1HAIH 5G4BA 4MVNA 1BQYA 3M5MA 2H6MA 3D23A 1Z8RA 1B0FA 3GCHB 1EB1H 1ZPCA 1HB0B 1Y5BT 1W11U 4ZHMU 2VNTA 2Z9LA 4FUDA 4UE7H 1VZQH 1VCQA 1LHFH 1NS3A 3AAVA 1C2IA 1BDAA 1F0UA 1VR1H 1GI4A 2XNIA 2ZPSA 1P2IA 1YPEH 5FCKA 2BXUH 3ZVCA 3T28A 5JDUB 1D9IA 1GHXH 1Z8GA 2EI7A 2WINI 5FPSA 5T6DA 1VITH 1LHCH 1VITF 1P03A 1GI1A 3TH2H 3GDVA 1TQ7B 3K6ZA 5FPTA 3GYMA 1U6QA 3VPKA 1XUJA 2FOHA 4DG4A 1TWXB 3P6ZB 1C2DA 2V0BA 7GCHG 1GHWH 3RXCA 1UCYH 1NO9H 4AG1A 1O2HA 2D26C 4X1NU 1SGTA 1G9IE 1K1PA 3RXTA 2STAE 1YPHC 2ZFFH 2VWOA 2ZC9H 2B5TB 5DP8A 2TGTA 1A2CH 1O2OA 1OP2A 4OS2A 1KLJH 1T7CA 1W0YH 4A5TS 2LNCA 1HNEE 1W7XH 2A2QH 1THPB 3P95A 1WQVH 3MWIU 3DD2H 1EJAA 3TJNA 1O5AB 4OS7A 3RXAA 4TY6A 1BRCE 3TPIZ 1PPFE 3VEQB 1ZHPA 5HXFA 1QL7A 2P3FH 2PGBB 4O03A 4B76A 5ABWA 1L2EA 2ZA5A 1HAOH 3PTBA 3HGPA 2R9PA 1GBLA 3GCOA 1GMHG 2PW8H 2HRVA 1QB6A 2Y5GA 1FI8A 1MCTA 1Q2WA 1AQ7A 1AE5A 1P02A 2SGDE 4XE4A 1ESAA 1V2ST 2GT7A 1O3BA 2P3TB 1GBIA 2BTCE 4WH6A 5EU8A 4BAHB 1ZLRA 3EDXB 1J9CH 1AVGH 4MNVA 1OSSA 1C2HA 1DLEA 1CBWC 5JBCS 4K1TA 4Q2KA 1KXEA 2FODA 3TJUA 2ZGJA 4Y8XA 2C90B 1OWKA 3MNBA 3U8OH 3OX7U 1GI8B 1P2OA 4YOGA 2ZTZA 1OX1A 1C1MA 4DIIH 4A7IB 4Y8YA 1O3FA 2BLQA 3LT3A 1KLTA 4JZFH 3OY5U 1SPJA 5EG4A 2GP9B 5L30H 2CV3A 5DPAA 1QA0A 3PO1B 2A4OA 1QRWA 3Q76A 2A7CA 1AB9C 4D9RA 3K9XB 2BVSH 3DA9B 3O8BA 3UREA 3V13A 3MU0A 1MQ5A 3MFJA 3T5FH 4YM9A 4ISHH 5E2OA 5C3NA 1F5LA 4ABDA 1GGDC 1TGNA 3PMJA 4ESTE 1H9LB 4BOHA 3BEFB 2QF3A 1D3PB 3BSQA 3D62A 1SGDE 3EGKH 1DITH 2GTBA 1DOJA 2FS9A 2ZU4A 2P95A 1S84A 1EATA 1LQDB 1WTHD 1XX9A 5TCAA 6CHAB 3RM0H 2GVFA 1EZUC 1IAUA 1O3IA 2H5DA 3RC4A 1ZTJA 2G5NA 3S7HB 1BTPA 1C1OA 4ZUHA 4ABGA 1DWDH 1TGCA 4NWLA 3H7TA 6GCHG 1UTQA 2A32A 1CE5A 1WQSA 2BXTH 4UFGH 4MNYA 1G2MA 4WMEA 3SV9A 2DE8A 3BV9B 1A7SA 3GY6A 4NWKA 2WYJA 3SNDA 1TRYA 1C5PA 2C8WB 2ZFSA 5ESBA 1P9UA 2FLRH 3LJJA 3Q3YA 1XUIA 2BD4A 3CENA 1ZGIA 3E0NB 2C8YB 2J34A 4XFQA 1NFWA 1P57B 1C2FA 4X6PA 3C27B 4UFFH 1C5ZB 3LC3A 5K0HA 2F9NA 2ZU2A 1E35B 4UFEH 3UNSA 2BY9X 1GVLA 2B8OH 2JH0D 3E6PH 1ELBA 2XBWA 5ESTE 4OS1A 3F9EA 1TMTH 4UDWH 4GCHG 4X2YA 2ODYB 3TGIE 1OYQA 3M35A 1N6XA 2VVCA 1P0SH 3MU4A 1LPKB 2FOGA 1GMHF 4BAOB 2AGEX 2ZKSA 4CRBA 4AOQA 1ZYOA 1PPZA 4RSPA 1AKSB 1W10U 1MZDA 1O2NA 1YYY1 4R8TB 4ABHA 3PMBB 4CRGA 1ELGA 2H9EH 4FU7A 3SJIA 3SZNA 2A4RA 1ARBA 3RLWH 2FTMA 2QC2A 1C5XB 2WUBA 1Z71A 2O8LA 2CJIA 2FWWA 5I46H 1SLUB 1QB9A 3P8OA 3D65E 4OS6A 4YT6H 3HKJB 1YBWA 2QYIA 1O2SA 1QTFA 4Y11E 1DS2E 1P3EA 3WY8A 1EZSC 4KP0A 1EB2A 2AEIH 2VH0A 4NIWA 3GOVB 1W12U 4FU9A 1EX3A 2PKAB 2FOBA 1ORFA 1LHGH 1PYTD 1VCWA 4K8YA 1N6YA 2Z3EA 5JBTA 1O31A 4Y7BA 1IOEA 2BLWA 2R0KA 4PROA 3GY3A 3MO3A 1TQ0B 3RMMH 1EPTA 3PMAB 1O3DA 2W26A 1IQGA 5BPEA 1SBWA 1SI5H 4INHA 3M61U 5I25A 1GJ4H 2G51A 5T6GA 2AGIX 2ZGXH 3M5NA 5DGJA 2TGDA 1KXDA 3KCGH 5EPNA 1C1RA 3MU5A 1TRNA 6GCHF 1NTPA 5E8EH 3VB5A 3TH4H 1KXBA 5T6FA 2C93B 1VJAU 3E91A 1W14U 5IYTA 2H5CA 4B71A 2JH6D 1DWCH 5BRRE 3ZVAA 1S6HA 4FUFA 1SQAA 3IITA 3KN2A 1O2LA 1TFXA 1TOCB 1XVMA 1AFQC 3BTEE 3E0PB 4FU8A 5DG6A 1V2QT 1WAYB 3A7ZA 1K1JA 1W2KH 2QA9E 3UOPA 1ZR0A 1BMMH 1SHYA 5EW2H 1P10A 1SGQE 2ZEBA 3QLPH 1BZXE 1K22H 3ZV8A 5TJXA 1Z8JB 2GV7A 2ANWA 3LONA 1JBUH 2ZFTA 2GCTB 2ZP0H 3K6YA 1UK4A 4ZROA 3RXDA 3B23B 4JZEH 1G3EA 4MPUA 4GCHF 1C5UA 3SU5A 3P17H 2BX4A 1O3GA 5GDSH 6CHAC 1GMDF 3UNQA 1GDUA 3CS0A 3RXMA 1TIOA 5EODA 2FYQA 5PTPA 2P94A 1FDPA 1O35A 1E37B 2TPIZ 1O5EH 1FJSA 1YC0A 1O2RA 1JMOH 2OCVB 2QGRA 3SU4A 2GT8A 1Y3XA 3MU8A 4XBCA 5E0JA 1K1IA 1FXYA 2ZU3A 5A0CA 2BYAX 3U69H 3LGUA 3TGJE 4BXSA 2WPKS 4O3TA 5J4QA 1BHXB 1DM4B 3H7OA 1FUJA 1JOUB 2AMDA 3SOSA 5EW1H 3PLPA 3NKKA 2GKVE 1SGEE 3Q3KA 4J1YA 1C9TA 2XW9A 2ZPRA 5LPFA 4Y7AA 4ZKNU 1OPHB 1OWIA 1K2I1 4IN2A 1CHOG 3UR9A 3MH7A 4VGCC 1NROH 3Q77A 1QURH 2EEKA 2C8ZB 1LVMA 1GHBG 1TONA 2TGPZ 1MTNB 1TE0A 3GY8A 7KMEH 5FHTA 4D9QA 4Z0KA 4ABAA 3PLBA 2Q6GA 1P8VC 5A2MH 2QV1A 3I77A 1DICA 5B6OA 1O3EA 1AY6H 3VXFH 2BDGA 3P92A 5FAHA 1H8DH 3AASA 3ZYEA 3V12A 3U8TH 3W95A 4CH8B 4CRFA 1YPKH 2RCEA 2ZGBH 1XKAC 1NC6A 2Z9GA 1GG6C 3BTME 1SQOA 2P8OC 5DP9A 5LGOA 1GBEA 1NT1A 3LGTA 2AIPA 4U32A 3SV8A 4YTAA 1MAYA 3SUDA 2Z94A 1V2JT 1DVAH 3LGYA 2I6QA 2P3UB 4IBLH 2C3SA 2VWMA 3LU9B 3M3VA 3TIUA 1YPGH 4YOIA 4ZKRU 4FUIA 1AU8A 4X1PU 2UWLA 3JZ1B 3SNAA 1ZSKA 1O3HA 1QQ4A 2BY8X 3SQEE 2TBSA 3PTNA 1GL0E 4Y79A 4JCNA 5JB9S 1WCZA 2G4TA 3BF6H 2J4IA 3MMGA 4TWWA 2OBQA 4F49A 5GIBA 4YT7H 1LDTT 1VJ9U 4A92A 1BHXF 1Y3WA 1INCA 1CA0C 1TX7A 2VINA 1D4PB 1HXFH 1Y8TA 2GMTB 1FPCH 3GISB 1QFKH 1GJBB 3A8AA 4XOJA 1YPMH 1RTKA 3QN7A 2F9OA 3VFEA 1GI2A 1TOMH 1AO5A 2LPRA 2ZDAH 2AMPA 1H1BA 1OWDA 2A0QB 2NU3E 4H6TA 1GVZA 5ETXA 4Y6DA 3SNBA 1OXGA 2BD3A 4Y76A 2PWXA 4K60A 2VIQA 3A88A 4JYTA 1BRUP 3I78A 3JZ2B 3ZVFA 2ZDMA 2ZHEH 3UOUA 3U98H 3ATLA 1K1NA 5C5NA 1M9UA 4HGCA 4RKJB 1GCTC 1XM1A 2OP9A 2W3KA 4H42U 4BXWA 1LKBA 1PQ5A 1DXWA 1UCYE 2A7JA 4Y0YE 1XUHA 2DUCA 4NA7A 1X7AC 1TGBA 4FUEA 2JETB 3BG4B 4INKA 3KHVA 3M3SA 5DJ7A 3BTTE 2BHGA 3PV4A 1HV7A 1NU7B 1SGCA 2ZGCA 1S82A 4IW4E 1KTSB 1HJAB 4Y71A 2XRCA 3MI4A 1BMNH 2BDCA 1TLDA 2R0LA 1QRXA 1CHOF 3A8DA 5C2ZA 1DFPA 4CR9A 1TGSZ 2ZQ1A 1BTUA 1TNKA 1ZRBA 2IJOB 3OU0A 1V2UT 3M37A 1MMJN 4CRAA 4HI3A 4YLUA 2V3HH 1B5GH 1GHBF 1GWAA 2FEQH 1GI0A 1MUEB 4YOJA 1YPJH 2QCYA 4CBNA 1BCUH 3L6PA 3TGKE 4K3JA 3SGQE 1FY1A 1VGCC 1O3JA 1D3TB 1ANCA 1JRTA 2TIOA 2P16A 2XCFA 2A5AA 1HAPH 2ZNKH 1WUNH 2QY0B 1SGYE 1RIWC 3D49H 2JKHA 4X6MA 2HGTH 3BEUA 1EOLA 3P8GA 1EJNA 3SGAE 1G37A 1W13U 1F0SA 1OKXA 3A8BA 4ABFA 4LZ4B 1SFQB 4NSYA 3DFJA 1EJMA 2FESH 4ZXYH 3KQDA 1NY22 5EXMA 4NFFA 2SGQE 1SL3A 1FY8E 4D7FA 1C5NH 2O8TA 1UVUH 1AVWA 3ZZ5A 1ZMNA 3PLKA 2BDYA 2BZ6H 2WPHS 3NUMA 3ATKA 1GPZA 4FVDA 2G52A 2FMJA 3Q00A 4ABJA 2GX4A 2EI8A 1EUFA 4B75A 4X6NA 4X8TH 5C20A 2PV9B 4K1SA 1T31A 4MG3A 3TJVA 1MD8A 4X1RU 3IG6B 4DCDA 2H9TH 4NCYA 1TBZH 1GI7B 1EPTC 1QHRB 3GY2A 3LKWA 3URCA 2HVXA 1NRRH 4SGAE 1A3EH 2VGCB 3SI4H 1QL8A 2P93A 4NZLA 1AZ8A 4ABBA 1P9SA 1SSXA 1MU8B 1V2NT 2J2UA 2BOKA 2FOEA 2BX3A 3A86A 4CHAB 4JYVH 1ACBE 2BQWB 2PR3A 1E0FD 1TNJA 3M7TA 4Y10E 3MU1A 2QXHA 4GUXA 1TGTA 1MKWK 1AUTC 1J8AA 4ZH8A 1GBCA 3LIWA 4KGAA 1EZQA 2BDHA 1L1NA 4IMQA 1W3CA 4I32A 3QTVH 2OD3B 2ALPA 4XBDA 3RXIA 4FVBA 1UVSH 2FX4A 2ZIQH 1NESE 5CHAC 3V0XA 2J92A 1AKSA 2Y80A 3SI3H 1C1UH 3ODFA 1CT2E 1XXDA 4HZHA 4DVAU 3URDA 3LH3A 3ODDA 1E34B 1LHDH 8ESTE 1KXCA 1NPMA 4WMDA 1N8OC 3KF2A 4X2XA 1BA8B 1S85A 5JBBS 2BM2A 5HM2A 1C5SA 5FBIA 1ETSH 1ELDE 2B7DH 4FUJA 1O3CA 1LCYA 1LPZB 3RC5A 2FP7B 1YKTA 3LGVA 2GMTC 1THRH 4O9VA 5SGAE 4B2BA 1GJ6A 5J4SA 3AW1A 1QL9A 1J14A 1P12E 5DP5A 3HATH 1NFYA 2I6SA 1MQ6A