2FO9A

Structure of porcine pancreatic elastase in 95% acetone
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fo9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fo9A01
1AE8H 3PLKA 1S5SA 4Q7YA 2Y6TA 2BYAX 1EOLA 1XM1A 1FJSA 1QJ7B 2FYQA 1TMBH 3M3TA 1K9OE 1Y5UT 3MO6A 2ZGCA 3MI4A 3PMBB 1C2KA 1A0JA 4FVDA 2OC8A 3QX5H 1NTPA 5LPEA 2ZTYA 1NFYA 3MMGA 1QRZA 1WOFA 1LPKB 1NM6A 1QGFA 3S9CA 1BJUA 3CS7A 1LKBA 2G5NA 3RMLH 4U2WA 2DE8A 4AFSA 1FN8A 2BDHA 4NFFA 3ZZ3A 5DPAA 1TAWA 1BMMH 2ZCKP 5GIBA 1W11U 5L6NH 4MPWA 1HAVB 2H9EH 1LCYA 1TALA 5BPEA 3SUEA 2YOLA 4D76A 5FAHA 1DICA 1TFXA 1TOMH 1XUIA 1E35B 1PQ7A 1BQYA 5HGGA 2BDCA 1SQAA 1BHXF 4AX9H 1IHTH 1G32B 2OXSA 1EASA 2PKAB 2Z3CA 3BF6H 3OYPA 3NUMA 3LH1A 2H2ZA 3SU0A 4ZHLU 1HAVA 3P8GA 5JBTA 1YP9A 4WXVA 4IN1A 3P8FA 1SMFE 4DVAU 3LH3A 1C5TA 4IC5A 3A8DA 1Y3UA 1AGJA 5GDSH 1ZR0A 5A8YA 3UQOA 2A2QH 1ZRBA 1N6XA 3PV4A 2XW9A 2A7CA 4X1NU 3GCHC 2SGAA 5E0HA 1DUAA 2VWOA 4I7YH 2WUCA 3LGTA 3MOCA 3GDVA 1AZZA 1K2I1 9ESTA 1O2QA 2AEIH 1DWDH 2V3OH 3GCHB 3MWIU 4HZHA 2ZHDA 4AZ2B 7LPRA 1FY3A 1PPBH 2W3KA 5H4IB 3VFEA 1QHRB 3H7TA 3SJIA 2FOHA 4U30A 4ABJA 1ANCA 1A5IA 1KLTA 1O2SA 2G51A 2FOCA 3ZVGA 1H9IE 1O3PB 1V2ST 1AWFH 3LJJA 4Q80A 1TNGA 3RMNH 3MH6A 4ABEA 1GMDF 2C8YB 1P09A 3UIRA 1F0UA 1QJ6B 1GVKB 1SGQE 4MPXA 1GI7B 3RC6A 1TGNA 2P16A 3UUZA 3WY8A 1TGSZ 2BY5X 1AVGH 1O3GA 1C2JA 1FZZA 3HGNA 2BXTH 2JH0D 3BTHE 4IMZA 3SGQE 3ZZ4A 5FPYA 1Y5BT 3ATIA 3K6ZA 4GAWA 1J17T 1DANH 1W10U 3RXAA 4LXBH 4DIHH 4UFDH 2OD3B 5A2MH 4ZKSU 3M36A 4BTIB 2ALPA 1HUTH 3SHCH 3ZYDA 2BQWB 4OGYA 1VITG 1QQ4A 1OXGA 3UWJH 4AYVB 4A7IB 5LGOA 1ZHRA 1XUGA 2PTNA 1P2OA 3RU4E 2A4RA 1C1PA 3VXFH 4THNH 1KXFA 2F83A 5HXFA 1O2ZA 1ZHMA 3UNRA 3NZIA 5JPMH 1RJXB 2EI7A 2ZDMA 1KSNA 5DP7A 3H7OA 1ZSLA 1E38B 4ABBA 5JBAS 1MD7A 5DP8A 1RIWC 3HPTB 1EJMA 1FY8E 4X1SU 5C20A 1UCYE 1CO7E 1AMHA 6ESTA 3F68H 2F3CE 4BAMB 1J16A 1GBEA 3LGWA 1HXFH 1THSH 4MPVA 1XUHA 1ELBA 3MYWA 5IDKA 3TJOA 2QIQA 1MTVA 1V2UT 1KDQB 4K1SA 1ZPBA 4O3TA 1YF4A 2PW8H 5FHTA 4K3JA 1HJAC 2QXIA 3IG6B 1ANEA 3UWIA 3MHWU 1B7XB 1C2EA 1N8OC 3RXRA 1LHFH 1YPGH 3URCA 3UR6A 3B8JA 2A31A 1K1MA 1GBMA 1N8OB 1KDQA 1HAOH 3A7TA 1NC6A 1YBWA 3VPKA 4K60A 1AU8A 2UUKB 2ANMH 1GL0E 1O2NA 1MCVA 3O8BA 1F0RA 1D6WA 1N1LA 2EEKA 1C5PA 3BIUH 5EW2H 2ZU5A 2JKHA 1GJDB 2G00A 5A8XA 1NFXA 2AGGX 4HTCH 4MDSA 4RKJB 2PWXA 3T29A 1PPGE 5EODA 3RXEA 4AYYB 1EQ9A 3D65E 1DLKB 3LPRA 2XBXA 1PYTC 2OQ5A 5EPNA 4CRGA 1AUJA 1GCTB 3CENA 1O2UA 4KP0A 1NFUA 3ZV8A 3BG4C 1T31A 1H1BA 2BY7X 2KAIB 4MQAA 4MVNA 5EGMA 3G01A 3RM0H 4ABAA 4IW4E 1GJ4H 3C1KA 3RLWH 3E0NB 3ZZ5A 3RXBA 2QF0A 1LQDB 2RCEA 1F0SA 1TE0A 2Y80A 2ZO3H 1V2JT 3QTVH 1GDQA 3SGAE 3SV9A 2FI5E 2KAIA 1DVAH 2AERH 2ZHEH 3RXKA 2CV3A 2ZFRH 1G30B 1IQNA 1YCPH 4BAHB 1W2KH 2C3SA 2BOHB 4ZHMU 1SB1H 2ANWA 1QRXA 3B23B 4NWKA 4JYUH 1O2HA 1T4UH 1O38A 1C5SA 1JOUB 4MNXA 3FAOA 4AFZA 1DWEH 2UWPA 6GCHG 1F5KU 1O2IA 1QBOA 4HGCA 5LH8A 1ZMLA 3RC4A 1AWHB 1SC8U 1BRAA 1Z8IB 2BMGB 2CN0H 3ATKA 2OUAA 2ODYB 1FXYA 1V2VT 4GPGA 2ZU2A 4NCYA 5JB8S 4D9QA 5AF9H 1DLEA 1WV7H 1EAIA 3Q3XA 3ZVFA 2Y5GA 2QAAA 2B8OH 1G3CA 2OTVA 4ZKOU 2C90B 4LZ4B 3SU3A 4J2YB 2A2XH 3LC3A 4Y71A 1E36B 2NWNA 2FS8A 2HRVA 3U9AH 1P2IA 4YT6H 1L1GA 1TABE 3FP7E 3VGCB 4I8LA 5EG4A 3HK3B 1A0LA 2VVUA 1MBQA 2Z3DA 4I8HA 3KF2A 1IQFA 1UK3A 2R9PA 1PQ8A 3MH5A 4E06H 3K6YA 1C4Y2 3SU2A 3UY9A 2BD7A 1PPEE 1ZJKA 2GD4B 4NA9H 2ZG0H 1O2WA 1V2LT 4TWYA 1TBRH 3V0XA 1NO9H 5J4SA 3M3SA 1Y3XA 4JZEH 1NU9A 4ZKRU 3RXCA 1DSUA 1AO5A 4DT7B 1GI1A 1W12U 3SNEA 3GCTF 2FDAA 2F9NA 3A80A 3M61U 1KXDA 3PMHB 1D3TB 2J2UA 1HAYB 4OS5A 3SJ8A 4UFGH 4WMDA 5PTPA 1NRNH 1OWDA 4FVBA 4JZIA 4Y8XA 3BTME 1DY9A 4ZKNU 1CGIE 1O2KA 2XYAA 1GWAA 4ZXXH 3BTQE 2A1DB 1VCPA 1GBLA 1QTFA 4K8BA 4YZUA 2VIWA 3AAUA 2WYGA 1O5DH 2J94A 3UTUH 8GCHF 1O2OA 2STBE 1LVBA 1TA6A 1C5OH 1TPOA 3M5NA 4GVUA 2F9BH 1YPJH 1XUKA 1YPEH 3TJVA 1PPZA 4OGXA 4ABDA 3A7WA 4JZ1A 4BAKB 1T8NA 2GTBA 1DPOA 1TBQH 1LDTT 3EYDA 2ZU4A 1OWEA 4RKOB 1AHTH 1H9LB 1ELFA 1TNIA 1CU1A 2AMPA 2D1JA 5EOKA 3SV2H 1FQ3A 1KTSB 1C1MA 3GCOA 4XSKU 1TWXB 3SV7A 2QXJA 2Z6BD 4TYDA 2A4GA 2BXUH 1LHDH 1ETRH 2Y82A 3T25A 2R0KA 3LDXH 4D7FA 1EB1H 2EI8A 3QTOH 1CE5A 1O36A 4BAQB 5L2YH 2Z9KA 4ZAEA 1UTNA 1VJAU 2Q6FA 2BLVA 5SGAE 1EAWA 2FX4A 1QBNA 1FLEE 2BDBA 1ELCA 1DXWA 4CH2B 4GCHF 1SGDE 1P04A 2K1QA 4CHAB 4OS2A 1HGTH 2D2DA 2J38A 1SLXB 4VGCC 1GGDB 1ELAA 1L0ZA 1B0EA 2GCTB 1GJAB 3TPIZ 4B2BA 4PROA 3F9GA 4O3UA 3BV9B 4O03A 5DP3A 4FU7A 4NIYA 5A0BA 2Z9LA 1TQ0B 1F92A 4BTTB 2VINA 5E0GA 2CMYA 1GHAG 4I8JA 5TJXA 2BY8X 3ATMA 1C1SA 2A7HA 2HGTH 2XC4A 2WINI 5LPRA 1Q2WA 2IJOB 1K21H 1TMTH 2FIRH 1V2KT 1GL1A 3S69A 4X2WA 4ZMAH 1GMHG 3KNXA 2FZZA 3QO6A 3GOVB 4UFFH 1O5EH 2XWAA 3SI4H 2OC0A 1GDUA 3RXOA 2WV5A 1YPMH 3SN8A 1GI6A 1GMCG 1XUJA 1X7AC 2QXHA 2FESH 1P02A 3L3TA 3SBKA 1XKAC 3W95A 3S9AA 1T8LA 2OP9A 3RUOA 1O3BA 5A09A 1HNEE 3TK5A 1XX9A 1EJAA 3TGIE 7GCHF 2V35A 3BTKE 3UOUA 3T26A 4WH6A 5ESBA 3TGKE 1O3DA 3ZVBA 2P3FH 1DWCH 2YNBA 1C1RA 4NG9H 1O5FH 2QY0B 3U8OH 4AFQA 4CRFA 3PWCA 4UDWH 3K9XB 1IOEA 3OX7U 1O2VA 1ELEE 4FUHA 1TLDA 4ISIH 5B6OA 2Y5FA 1BHXB 1QNJA 2BD3A 2NU0E 1MAYA 3E6PH 5GWZA 3HATH 3QN7A 3PWBA 3PB1E 2WPJS 2C8XB 2R2MB 3F6UH 2OBQA 4K5ZA 1LHGH 5T6DA 4INHA 5GCHF 2RG3A 4WMEA 2GKVE 2ZQ1A 3A7ZA 3S7HB 1UVOA 3E16B 3Q76A 2Q6GA 1BTUA 1VITF 3SUFA 1V2MT 2ODPA 1BDAA 1GJ9B 2OINA 2WPMS 2A4OA 1O2RA 3PMJA 1UO6A 1HIAB 3KQBA 1ZTJA 2O8WA 1AKSB 1QL9A 1WTGH 1AUTC 3NKKA 2OQUA 2TBSA 1ANBA 1INCA 3LGIA 2BQ7B 4JYVH 4NA8A 5JB9S 1QJ1B 2BB4A 5FPSA 2V3HH 1YCPK 2FXRA 2BDAA 2W26A 5AFZH 1HV7A 2CXVA 2FMJA 3KQCA 2WPIS 2FM2A 2BQ6B 3RXPA 1LVOA 1K1NA 5ABWA 3V12A 1EJNA 1GG6C 1O30A 2AIPA 2ZC9H 3VEQB 4ABIA 1HAHH 1GHVH 1D6RA 1FV9A 1Q31A 2HOBA 1T4VH 2RDLA 3RXHA 1HLTH 1V6DA 4OS7A 4ABGA 1J8AA 1O5BB 3Q3KA 1WQSA 1BA8B 1G37A 3U8RH 1GBAA 2LPRA 1YYY1 1D9IA 2FLRH 2WPLS 1GCDA 1FDPA 1O2MA 2G8TA 2ZCHP 3PM3A 4A1XA 1CT2E 1O3CA 4M7GA 2G4TA 1C2HA 1EATA 2ZZUH 5I25A 4CBOA 1FY1A 1YCPM 5T6FA 1V2QT 4MNVA 1VGCC 2R2WU 4E7NA 3P70B 1IQGA 2G81E 3VB5A 3HKIB 4O97A 2ZQ2A 4KKDA 2BDGA 1TYNA 3KQEA 1VGCB 4ABFA 2TGDA 3FVFB 5F8TA 3ZZCA 2ZIQH 2BD5A 3OY6U 3M5MA 2Q6DA 4WY3A 1O2XA 1BTHH 1TX8A 2QN5T 4AG1A 3I77A 1EP6A 1P2KA 1C5NH 1SBWA 2WPKS 3MNBA 2BHGA 1E34B 1THPB 1UTKA 1CT4E 2F9OA 1HBTH 1P05A 1OS8A 1Q3XA 1W8BH 2PGQB 1SHHB 3UREA 1TONA 1YGCH 1TA2A 3RDZA 3F9FA 4Y8ZA 1C5LH 3KN2A 1ABIH 1UK2A 2ZWLH 1CHGA 2ZU3A 4YTAA 5FCKA 2XBVA 6GCHF 1CA0C 1VZQH 3E91A 2STAE 2Y5HA 5ETXA 1BJVA 1L4DA 4INKA 3W94A 2GMTC 2BLQA 2ZP0H 4TWWA 1S83A 1CA0B 1BCUH 3GY2A 4X1RU 4ISHH 1O3EA 2ODQA 2GMTB 2Y81A 4SGAE 1G3EA 1XVMA 2B5TB 2H9HA 4CH8B 3MNCA 4YLUA 4WXIA 1Z8JB 5C1XA 1SGFA 1ZGVA 4Q7ZA 3T2NA 1V2OT 2GV6A 1WSSH 4X2VA 2PKSC 5HMAA 4DY7B 1W0ZU 2SNVA 1FY4A 1OWKA 4NIVA 1C2MA 1Z71A 1NZQH 2TPIZ 4X8UH 3SQHE 1LKAA 3T5FH 4MPUA 2PKSB 3B9FH 1O0DH 4K1EA 1O2LA 3KEEA 1C1UH 4ZUHA 1FAXA 1CHOG 4DG4A 5E8EH 1GHBF 2GZ9A 2J95A 1VR1H 1BTWA 3L6PA 2VJ1A 2PSYA 3MNSA 2XNIA 5AFYH 3T28A 1XXDA 2J92A 3A8AA 1RFNA 4I8KA 1QR3E 3UOPA 2GT7A 2P93A 1WUNH 1RIWB 1WAYB 2ZDLA 2VIQA 4F49A 1ESTA 3RXDA 3ZVCA 1SSXA 1Y5AT 2PR3A 5EQSA 2O8TA 3QDZB 1ZSKA 5CE1A 1YPLH 1K22H 1SVPA 1HJAB 1GBDA 3HKJB 1QB9A 1HAPH 3VB6A 4Y7AA 2EA3A 1BZXE 3BEUA 2ANKH 3TNSA 2GZ8A 5HYOA 1O2GH 2AFQB 5DP5A 1M9UA 1HFDA 1EKBB 1FY5A 1SGEE 1O35A 4BAOB 3D23A 2ZFSA 3V3MA 1ARCA 3KQDA 3A87A 3O8RA 4B2AA 3GYMA 4WJG2 3BEFB 2H9TH 3A84A 3P6ZB 1A5HA 1ZMNA 4XFQA 1C4U2 4SGBE 2TGAA 5EQQA 1Z1IA 5FCRA 1PQAA 3QLPH 1TNJA 1OYTH 1P2NA 1F2SE 1NN6A 3GY6A 3H5CB 3GY5A 1HXEH 1K28D 1GHZA 3M37A 1O37A 1BMNH 4I33A 5BRRE 5AVDA 2Y7XA 1IQEA 3BG4B 3VB4A 5C5NA 1Z6EA 4TPYA 4B1TA 1GI0A 1PQ5A 3LGYA 2UUYA 3UNSA 1GBFA 4NGAH 3UR9A 1Y59T 2R3YA 2Z7FE 1S0RA 2H6MA 1KXCA 4R0IA 4A6LA 1JBUH 1A5GH 1ZGIA 1OP0A 2PSXA 1GI9B 3DFJA 1EB2A 3V7TA 4X6MA 1OWIA 1OP8A 3TJNA 4U01A 4ESTE 3TK6A 2PGBB 2SNWA 1AVWA 5GPIB 1GBKA 2NU4E 3TNTA 1Z7KA 1GHAF 3U1IB 1K1JA 1EAUA 1HAGE 2TGTA 3SNAA 3VB3A 4X6OA 2ZU1A 2HLCA 5L30H 5F03A 4Y11E 3FP8E 3JZ2B 2ZNKH 1NY22 1SG8B 5JYIA 4AFUA 1GI8B 2ZGHA 1PPHE 1GDNA 2FLBH 3A7YA 3QZRA 2O8MA 1D4PB 2ILNA 2P95A 8ESTE 3DHKH 1LMWB 1LTOA 1DDJA 4MNWA 4CRCA 3A7XA 1GMDG 1V2NT 1Z1JA 1GPZA 1A7SA 4GHQA 3QUMP 2F91A 1PPCE 1GBJA 1ABJH 5C2ZA 2PLXA 4E7RG 1UMAH 2CGAA 4BANB 4X8SH 4FUIA 1G3BA 1O3JA 4LK4A 1NROH 2C4FH 7ESTE 3STIA 5FX6A 1FUJA 3TK9A 1OWJA 4ABHA 1UVTH 4X2YA 1SQOA 2G55A 2BD8A 3E90B 2ZPRA 2GX4A 5HM9A 2Z9GA 3RXSA 1H9HE 2JETC 3TLOA 1HRTH 1SQTA 1FN6A 4KELA 5EXNA 4NZLA 1XXFA 1ZRKA 4Y7BA 3SV6A 2V6NA 2BM2A 3LKWA 1N6YA 1ZYOA 3ATWA 2ZPSA 1QCPA 5A0CA 1QA7A 3M35A 2C8ZB 2A7JA 2ZFPH 1HJ8A 4I32A 4FUBA 1MQ5A 1IQMA 1DWBH 1NRRH 2ZF0H 1UTOA 1AY6H 1SOTA 3LJOA 3SNBA 8KME2 1BMLA 3EGKH 1CGHA 1SL3A 3LGVA 1IQHA 3GY4A 2BZAA 2SGQE 3D62A 3ZZDA 4UFEH 3RC5A 1WCZA 2IPHA 2TRMA 1A1RA 1V2TT 3STJA 2P59A 4A1TA 3NPSA 1IHSH 3AW1A 2JH6D 1GJ6A 1SLVB 5E2PA 1SPJA 3S9BA 1FPHH 1MKXH 1C4V2 4Y10E 2F9PA 3SHAH 1HAIH 1W7GH 2OC7A 1K1LA 1W0YH 4O9VA 2IN2A 3HGPA 2GV7A 3PMAB 3UNQA 4FU8A 3SUGA 1FIZA 6CHAC 2AS9A 2SFAA 4B75A 4IGDA 1OKXA 5K0HA 1DITH 1O3AA 1P2JA 2BD4A 4YLQH 1VJ9U 2Z9IA 1OYQA 1UTQA 1TPSA 2I6QA 2SGPE 4TPIZ 5J4QA 5F8ZA 1DUEA 1KY9A 1OWHA 1TB6H 3SI3H 5TCAA 3AAVA 1Z8GA 4D7GA 3M7TA 2AYWA 1GVLA 2P94A 3SJOA 2Z3EA 3BEIB 1UVUH 1KLIH 4K69A 5A8ZA 4VGCB 3LC5A 1RTLA 3QK1A 1J15A 1MTNC 2VNTA 2Z9JA 4MNYA 4IS5A 3S7KB 1AFEH 1EOJA 3ZZ7A 1RRKA 1IQJA 4ZHAA 1TGBA 3E1XB 3Q3YA 4NFEA 1ANDA 4JCNA 3MO9A 1KYNA 4K8YA 1UCYH 2AH4X 1EAXA 1GI4A 3DFLA 4A1VA 5E0JA 5E2OA 1W3CA 5CHAC 3RXJA 3U8TH 4H4FA 2VWMA 1Z6JH 4NWLA 3BTGE 3LU9B 3EA7A 5CHAB 1NRSH 2AGEX 3TGJE 2ASUB 1C5WB 3ZV9A 4DW2U 2QCYA 1A46H 2FTLE 1BB0B 3EE0B 2BTCE 1ELVA 4XBCA 3IITA 2VIVA 5EQRA 3PLPA 1PJPA 3MTYA 2FPZA 4YM9A 1TBZH 1A0HB 3IWMA 1QBVH 2WYJA 3OTJE 2XCNA 1A3BH 1O39A 2OLGA 3M7UA 3SJKA 2ZDNA 1T8MA 1NRQH 3GISB 2D8WA 4XE4A 1NS3A 2EI6A 1GBHA 3R3GB 4QT8C 4RSPA 3A7VA 3ENSB 1UTJA 2FI3E 5DP4A 3SQEE 1E0FD 2VB0A 3I29A 3TITA 4DCDA 1P2QA 5EXLA 1WBGB 4Y8YA 1C1WH 2VVVA 2FOMB 8LPRA 3A8CA 3U98H 2B9LA 2VIOA 1WQVH 3M3VA 1O33A 4IBLH 1HDTH 1MMJN 1C5UA 4IC6A 4ISOA 4AN7A 2PUQH 1IAUA 4AORA 1ZOMA 4YO9A 5C5OA 4B2CA 1YLCA 3PO1C 3SW2B 1SGCA 4ASHA 2FP7B 1TRNA 1UHBA 3UQVA 1MCTA 4NSYA 1CHOF 1O3MA 3LGUA 1MUEB 3GCTG 3KCGH 4DIIH 3TH3H 3MU1A 1EPTC 1V2PT 1RTKA 3M5LA 2FOAA 1AE5A 1P06A 1P9SA 2BLOA 3GY8A 4A92A 1SGYE 2BOKA 1A61H 1F5RA 1BBRE 4KGAA 1L1NA 5JBBS 3RXMA 2P3UB 4AB8A 1TOCB 3M5OA 3KIDU 1FMGA 1KTTB 2C93B 2W7SA 1A2CH 8GCHG 1DM4B 2ZFFH 1ORFA 4CRBA 1DY8A 1ACBE 1EPTA 1LQEA 1UJ1A 1EP5A 4YOGA 4YOJA 2CHAC 3RLYH 3BTFE 1KIGH 3ZVEA 1SGPE 3SNDA 1J14A 2NU1E 1UVPA 5EU8A 4CBNA 1GG6B 2XBYA 1GJ8B 1ZZZA 3QGNB 1AIXH 2FOFA 2BY9X 2NU2E 3PROA 1BTPA 1TX7A 3SNCA 2GVFA 1Y3VA 3MNXA 3A88A 3NXPA 1UTMA 1DX5M 1B0FA 5L2ZH 4JZFH 3QZQA 1AB9C 1ELTA 1C1VH 3A8BA 3BTDE 2GCHG 1AB9B 1DE7H 2GZ7A 3KHVA 3QGJA 4Y76A 1O3IA 2UWLA 2GP9B 3GY3A 1O3LA 4GCHG 3TU7H 4X1QU 1DFPA 3PTNA 1AVXA 3GDUA 2BD2A 1EZUC 4MLFB 1YKTA 4WWYA 2ZKSA 5GJ4B 1O2PA 1K1OA 4E05H 2A45B 1Y3WA 2UUJB 4CRAA 1H8DH 1JRTA 1QL8A 2UUFB 1MAXA 1B5GH 1GBIA 4B73A 3GDSA 5IYTA 1C5VA 2ANYA 4BXSA 1ZTKA 3P8OA 1K1PA 1GJCB 4HI3A 2ZEBA 4BXWA 1EUFA 1V3XA 5FPTA 1P01A 2PTCE 3EAJA 3GY7A 1QURH 2QGRA 2PKAA 1QQUA 1LVMA 1BMAA 4K2YA 4BNRA 3RXGA 1SFQB 1VITH 2BVXH 3V13A 3ODDA 2BLWA 5GXPA 2R0LA 3QWCH 2G4UA 4DJZB 4LOYH 2RA3A 1C1OA 1GVZA 1BRUP 1RTFB 1S6HA 1T32A 1C5YB 2RA0A 4UE7H 3SGBE 2ZDVH 1ELGA 3MO3A 3UPEA 5DJ7A 5T3HA 4JMYA 1QB6A 1O3OA 2ULLA 2CF8H 7GCHG 2UWOA 1P2MA 4H6SB 1MKXK 1C5QA 4JYTA 1C2GA 2GDEH 2FOBA 3MH7A 1S84A 1SGIB 3SORA 4JK6A 4FUFA 2ESTE 1P9UA 1Z8RA 2A5IA 2BX4A 4J1YA 2VVCA 4CREA 4F4OC 1ZSJA 3BTWE 3EA8A 1GI2A 5LPFA 1QRWA 2SGDE 3U69H 1EXFA 2TGPZ 4Z0KA 1SHYA 1HYLA 1EZXC 2QF3A 1HPGA 5JDUB 4XDEA 2QC2A 2FS9A 3ZZ6A 1GBCA 3NCLA 5GCHG 1C5ZB 1V2RT 2PV9B 1VCWA 1QB1A 3JZ1B 3ATLA 1V2WT 7KMEH 4NA7A 3RMOH 3NK8A 4Y6DA 2ZHWH 2JH5D 4FUDA 4B71A 5AHGH 4D8NA 2CF9H 3GCNA 4BOHA 1GJBB 1Y3YA 3C27B 4FUJA 1S85A 2VIDA 1W14U 4WF8A 3RU4D 1CGJE 2HNTE 1NPMA 1P10A 1BTYA 1QL7A 2XRCA 3BN9A 1P8VC 2A0QB 1FAKH 1ZLRA 1BTZA 2ZHFH 4XBDA 1D3PB 1UCYK 3BTEE 1MH0A 2AGIX 3ZVDA 1HAXB 3VB7A 4ZXYH 2C8WB 2FODA 1HJ9A 1PYTD 3SU6A 4X8VH 2WV4A 3RXVA 2B7DH 1EX3A 1QA0A 1FIWA 4CRDA 1TRYA 1P12E 1SLWB 2ZI2H 1XMNB 5DO4H 2ZGJA 4X8TH 3RU4T 1ARBA 2BDIA 4Y0ZE 3ZYEA 3AVZA 1MKWH 3E0PB 3RMMH 3A83A 2FYRA 1P0SH 5DG6A 1BT7A 5DKMA 2H1UA 4FUCA 1FONA 1O5CB 1GHWH 1MQ6A 5C1UA 2VU8E 2XTTB 1YPKH 1O3NA 4KTUA 3K2UA 1DT2A 4A5TS 2A5KA 1O2YA 1TNLA 2ZTZA 3URDA 3SUDA 5TCCA 1G36A 1AFQC 4AG2A 1MZAA 2HNTC 3LOXA 1C9TA 2A5AA 3GYLB 1O31A 3O8DA 3ZZBA 1T8OA 4H42U 1AFQB 1GCTC 3F1SB 4Z6AH 1MU8B 1UTPA 4BTUB 2ZHQH 2SGEE 4TY7A 2ZPQA 4CR9A 2Q1JA 2ZECA 3OSYA 1QFKH 2HPPH 4YOIA 1D3DB 2OBOA 5DP9A 3FZZA 4CR5A 4NIXA 4HFPB 1O3KA 1UVSH 3BSQA 2QA9E 1CBWC 1AQ7A 1UK4A 1ETSH 3UFAA 1SGNE 2QYIA 2THFB 1FPCH 1O34A 4ISNA 1GJ5H 1XVOA 1C2DA 1CBWB 1QY6A 2VWLA 1NU7B 3MH4A 3MFJA 3AW0A 4TY6A 1O3HA 3PLBA 4NSVA 2H5CA 3A86A 1BBRH 5EXMA 4D9RA 1DSTA 3FFGA 2W5EA 3ESTA 4WH8A 4LZ1H 1AZ8A 1GMHF 3ZZAA 1TX6A 2XCFA 1TPAE 5F8XA 1PPFE 1FNIA 2XXLA 1KXEA 3SZNA 5T6GA 2VH0A 5EPYA 3SO3A 3NWUA 3N7OA 3TH4H 1BRCE 1GMCF 1ZPZA 2CJIA 2W3IA 4H6TA 1HAZB 1O5GH 4AGKA 2BD9A 4RN6A 1LVYA 1CA8B 6LPRA 1YC0A 2IOTA 4I8GA 4Y79A 5HM2A 1G9IE 2ZGXH 3TH2H 2ZDAH 2ZFTA 1LHCH 2HPQH 4DOQA 2VH6A 1MTUA 4X1PU 3TVJB 1D3QB 1P3EA 2FO9A 1OOKB 1WU1A 2W7UA 3RXUA 1TQ7B 4UONA 4B76A 1U6QA 1TNHA 1BRBE 3TIUA 2HALA 3VGCC 1TPPA 3EQ0H 5I46H 2BVSH 1CVWH 4NZQA 1LHEH 4YT7H 1AI8H 2HVXA 2R3UA 1CSOE 2HNTF 1H4WA 2JETB 4NIWA 3U1JB 3DD2H 1S0QA 1OP2A 1GHBG 2FTMA 9LPRA 4I31A 1JIMA 3E3TA 4DGJA 1T7CA 3BIVH 1O3FA 4ZH8A 1C5MD 2O8UA 5G4BA 4JK5A 4KTSA 2DUCA 1YM0A 3DUXH 3I78A 1UTLM 3RXQA 4XOJA 3RP2A 2Z94A 3MU5A 2AIQA 1MU6B 3P95A 3SU1A 1RXPA 3AASA 3D49H 1L2EA 3LT3A 2XWBI 2V0BA 1C5RA 1NFWA 1VCQA 1A3EH 2ALVA 1GJ7B 3T27A 2O9QA 1WYKA 2GGVB 2ZFQH 4MG3A 4OS6A 3RXIA 4JZDH 2ZA5A 3K65B 2B0FA 4OS4A 1YLDA 1FI8A 1RS0A 1ZJDA 3KL6A 5DK1A 2BVRH 4GUXA 2FEQH 1C1QA 1SGFG 2M5TA 2PHBA 1EZQA 2EC9H 2LNCA 2HWLB 1GHYH 4XBBA 3A82A 1AN1E 2BX3A 1C5XB 2OC1A 3A89A 5C1YA 3ELAH 2J34A 1CQQA 1TGTA 6CHAB 1LPZB 1L1JA 3P8NA 4X6PA 2TIOA 3RM2H 3ZZ8A 3ODFA 1IQIA 4FUGA 3R0FA 3EDXB 1LPGB 3RXFA 3BG8A 2Y7ZA 3BTTE 3LIWA 3P92A 3Q00A 3CS0A 2GDDA 3SU5A 2J9NA 1JWTA 2F9UA 1DOJA 1BTXA 1O32A 4AOQA 2FI4E 4FXGH 1HCGA 1ZMJA 1NT1A 2WUBA 1OX1A 3A81A 3OU0A 3MU8A 3RXTA 2BDYA 2GCHF 1BIOA 4CHAC 4MTBA 2YNAA 2GT8A 4X6NA 3VXEH 5DP6A 1ELDE 1GGDC 4KTCA 3F9EA 4X2XA 1S81A 2H5DA 2J4IA 3ITIA 1G2MA 1MBMA 2GCTC 2ZTXA 3DT0H 1SI5H 1MTNB 1TNKA 4UEHH 1C9PA 5K7RA 1S82A 1MZDA 1QIXB 1ESAA 1BOQA 2VWNA 1H8IH 2XC0A 3MU0A 1YPHE 3PTBA 4DURA 5EW1H 2QXGA 1P57B 1SGRE 3GICB 3OY5U 4WVPE 2AMQA 3HK6B 2FOEA 1MTWA 5FBEA 1BITA 1ZHPA 2G52A 3Q77A 5A0AE 1GBBA 3FANA 1KLJH 5F6MA 1K1IA 1XKBC 1DXPA 2FOGA 3FP6E 3L33A 4IN2A 1IQLA 5FX5A 3PYHA 1KXBA 2G5VA 1W7XH 1DS2E 2AMDA 1GI3A 1P3CA 1C2IA 5CMXH 3E8LA 1TIOA 3P17H 1S6FA 5JBCS 3KGPA 2P3TB 1C1NA 1TRMA 1TGCA 1JMOH 1ETTH 2PFEA 1E37B 1MTSA 4R8TB 4FU9A 4UD9H 4GHTA 2FX6A 1HB0B 1MD8A 1P11E 3FZDA 4ZROA 1ID5H 1O5AB 1IQKA 1LO6A 1WTHD 1P03A 1L4ZA 3F9HA 3M7QA 2XC5A 4WMFA 3ZZ9A 1OPHB 1OSSA 1SLUB 3CP7A 1MKWK 2O8LA 1C2LA 1NRPH 4IMQA 4K1TA 5FBIA 3S0NA 2VIPA 1GI5A 2WPHS 1PFXC 3A85A 1EZSC 1ZTLA 1UHBB 1YPHC 1RD3B 1SOZA 1ESBA 5FXLA 1TMUH 1AD8H 1SGTA 1XUFA 4Q2KA 3SOSA 2ZGBH 4X0WU 5ESTE 1Y8TA 1F7ZA 3DA9B 3O8CA 3TJUA 2ZCLP 1O2TA 2XBWA 1KXAA 5C3NA 4INLA 2OCVB 2A32A 1RGQA 5C67A 2SGFE 1SFIA 2BY6X 1NESE 3MU4A 4ISLA 3PO1B 2F9VA 1C2FA 1W13U 1O2JA 1G2LA 2PUXB 4YESB 2I6SA 2FWWA 4Q7XA 4AB9A 1EPTB 3LONA 1G3DA 5DGJA 1SR5C 4Y0YE 3SJ9A 1CT0E 2ZDKA 2NU3E 1GHXH 2A4QA 4U32A 4GSOA 3SU4A 4B74A 2P8OC 3RXLA 2D26C 1A4WH 1F0TA 4FUEA 1ZPCA 1JXPA 2BZ6H 4GLYA 1BUIA 2VGCC 1J9CH 2P8OB 4AGJA 1THRH 4OS1A 3T62A 1BBRK 3ZVAA 1C1TA 1JRSA 2VGCB 2QV1A 1GBTA 3EA9A 1F5LA 2CHAB 1HIAA 1AKSA 2DE9A 3SV8A 1JIRA
chains in the Genus database with same CATH superfamily
1AE8H 3PLKA 1S5SA 4Q7YA 2Y6TA 2BYAX 1EOLA 1XM1A 1FJSA 1QJ7B 2FYQA 2L74A 1TMBH 3M3TA 1K9OE 1Y5UT 3MO6A 2ZGCA 3MI4A 3PMBB 1C2KA 1A0JA 4FVDA 2OC8A 3QX5H 1NTPA 5LPEA 2ZTYA 1NFYA 3MMGA 1QRZA 1WOFA 1LPKB 1NM6A 1QGFA 3S9CA 1BJUA 3CS7A 1LKBA 2G5NA 3RMLH 4U2WA 2DE8A 3F0PA 4AFSA 1FN8A 2BDHA 4NFFA 3ZZ3A 5DPAA 1TAWA 1BMMH 2ZCKP 5GIBA 1W11U 5L6NH 4MPWA 1HAVB 2H9EH 1LCYA 1TALA 5BPEA 3SUEA 2YOLA 4D76A 5FAHA 1DICA 2RDEA 1TFXA 1TOMH 1XUIA 1E35B 1PQ7A 1BQYA 5HGGA 2BDCA 1SQAA 1BHXF 4AX9H 1IHTH 1G32B 2OXSA 1EASA 2PKAB 2Z3CA 3BF6H 1S6LA 3OYPA 3NUMA 3LH1A 2H2ZA 3SU0A 5B6LA 4ZHLU 1HAVA 3P8GA 5JBTA 1YP9A 4WXVA 4IN1A 3P8FA 1SMFE 4DVAU 3LH3A 1C5TA 4IC5A 3A8DA 4TSFD 3OAAD 1Y3UA 1AGJA 5GDSH 1ZR0A 5A8YA 3UQOA 2WPDD 2A2QH 1ZRBA 1N6XA 3PV4A 2XW9A 2A7CA 4X1NU 3GCHC 2SGAA 5E0HA 1DUAA 2VWOA 4I7YH 2WUCA 3LGTA 3MOCA 3GDVA 1AZZA 1K2I1 9ESTA 1O2QA 2AEIH 1DWDH 2V3OH 3GCHB 3MWIU 4HZHA 4B6EA 2ZHDA 4AZ2B 7LPRA 1FY3A 1PPBH 2W3KA 5H4IB 3VFEA 1QHRB 3H7TA 3SJIA 2FOHA 4U30A 4ABJA 1ANCA 2KCAA 2XNDD 1A5IA 1KLTA 1O2SA 2G51A 2FOCA 3ZVGA 1H9IE 1O3PB 1V2ST 1AWFH 3LJJA 4Q80A 1TNGA 3RMNH 3MH6A 4ABEA 3PV2A 1GMDF 2C8YB 1P09A 3UIRA 1F0UA 1QJ6B 1GVKB 1SGQE 4MPXA 4P02A 1GI7B 3RC6A 1TGNA 2P16A 3UUZA 3WY8A 1TGSZ 2BY5X 1AVGH 1O3GA 1C2JA 1FZZA 3HGNA 2BXTH 2JH0D 3BTHE 4IMZA 3SGQE 3ZZ4A 5FPYA 1Y5BT 3ATIA 3K6ZA 4GAWA 1J17T 1DANH 1W10U 2L6OA 3RXAA 4LXBH 4DIHH 4UFDH 5EIYA 2OD3B 5A2MH 4ZKSU 3M36A 4BTIB 2ALPA 1HUTH 3SHCH 3ZYDA 5KECA 2BQWB 4OGYA 1VITG 1QQ4A 1OXGA 3UWJH 4AYVB 4A7IB 5LGOA 1ZHRA 1XUGA 2PTNA 1P2OA 3RU4E 2A4RA 1C1PA 3VXFH 4THNH 1KXFA 2F83A 3N7DA 5HXFA 1O2ZA 1ZHMA 3UNRA 3NZIA 5JPMH 1RJXB 2EI7A 2ZDMA 1KSNA 5DP7A 3H7OA 1ZSLA 1E38B 4F48B 4ABBA 5JBAS 1MD7A 5DP8A 1RIWC 3HPTB 1EJMA 1FY8E 4X1SU 5C20A 1UCYE 1CO7E 1AMHA 1BMFD 3F68H 2F3CE 4BAMB 6ESTA 1J16A 1GBEA 3LGWA 1HXFH 1THSH 4MPVA 1XUHA 1ELBA 3MYWA 5IDKA 2JIZD 3TJOA 2QIQA 1MTVA 1V2UT 1KDQB 4K1SA 1MABB 1ZPBA 4O3TA 1YF4A 2PW8H 5FHTA 4K3JA 1HJAC 2QXIA 3IG6B 1ANEA 3UWIA 3MHWU 1B7XB 1C2EA 3N99A 1N8OC 3RXRA 1LHFH 1YPGH 3URCA 3UR6A 3B8JA 2A31A 1K1MA 1GBMA 1N8OB 1KDQA 1HAOH 3A7TA 1NC6A 1YBWA 3VPKA 4K60A 1AU8A 2UUKB 2ANMH 1GL0E 1O2NA 1MCVA 3O8BA 1F0RA 1D6WA 1N1LA 2EEKA 1C5PA 3BIUH 5EW2H 2ZU5A 2JKHA 1GJDB 2G00A 5A8XA 1NFXA 2AGGX 4HTCH 4MDSA 4RKJB 2PWXA 3T29A 1PPGE 5EODA 3RXEA 4AYYB 1EQ9A 3D65E 1DLKB 3LPRA 2XBXA 1PYTC 2OQ5A 5EPNA 4CRGA 2V7QD 1AUJA 1GCTB 3CENA 1O2UA 4KP0A 1NFUA 2W6JD 3BG4C 3WW7A 3ZV8A 1T31A 1H1BA 2BY7X 2KAIB 4MQAA 4MVNA 5EGMA 3G01A 3RM0H 4ABAA 4IW4E 1GJ4H 3C1KA 3RLWH 3E0NB 4RT1A 3ZZ5A 3RXBA 2QF0A 1LQDB 2RCEA 1F0SA 1TE0A 2Y80A 2ZO3H 1V2JT 3QTVH 1GDQA 3SGAE 3SV9A 2FI5E 2KAIA 1DVAH 2AERH 2ZHEH 3RXKA 4B6FA 2CV3A 2ZFRH 1G30B 2VBCA 1IQNA 1YCPH 4BAHB 1W2KH 2C3SA 2BOHB 4ZHMU 1SB1H 2ANWA 1QRXA 3B23B 4NWKA 2IPQX 4JYUH 1O2HA 1T4UH 1O38A 1C5SA 1JOUB 4MNXA 3FAOA 4AFZA 1DWEH 2UWPA 6GCHG 2PP6A 1F5KU 1O2IA 1QBOA 4HGCA 5LH8A 1ZMLA 3RC4A 1AWHB 1SC8U 1BRAA 1Z8IB 2BMGB 2CN0H 3OEHD 3ATKA 2OUAA 2ODYB 1FXYA 1V2VT 4GPGA 1K0HA 2ZU2A 4NCYA 5JB8S 4D9QA 5AF9H 1DLEA 1WV7H 1EAIA 3Q3XA 3ZVFA 2Y5GA 2QAAA 2B8OH 1G3CA 2OTVA 4ZKOU 2C90B 3AK5A 4LZ4B 3SU3A 4J2YB 2A2XH 2J98B 3LC3A 4Y71A 1E36B 2NWNA 2FS8A 2HRVA 3U9AH 1P2IA 4YT6H 2F4LA 2GJGA 1L1GA 1TABE 3FP7E 3VGCB 4I8LA 5EG4A 3HK3B 1A0LA 2VVUA 1MBQA 2Z3DA 4I8HA 3KF2A 1IQFA 1NBME 1UK3A 2R9PA 1PQ8A 3MH5A 4E06H 3K6YA 1C4Y2 3SU2A 3UY9A 2BD7A 1PPEE 1ZJKA 2GD4B 4NA9H 2ZG0H 1O2WA 1V2LT 4TWYA 1TBRH 3V0XA 1NO9H 5J4SA 2WZQA 3M3SA 1Y3XA 4JZEH 1NU9A 4ZKRU 3RXCA 1DSUA 1AO5A 4DT7B 1GI1A 1W12U 3SNEA 3GCTF 1YWUA 2FDAA 2F9NA 3A80A 4XD7D 3M61U 2KCOA 1KXDA 3PMHB 1D3TB 2J2UA 1HAYB 4OS5A 3SJ8A 4UFGH 4WMDA 5PTPA 1NRNH 1OWDA 2KR7A 4FVBA 4JZIA 4Y8XA 3BTME 1DY9A 4ZKNU 1CGIE 4RI0A 1O2KA 2XYAA 1GWAA 4ZXXH 3BTQE 2A1DB 1VCPA 1GBLA 1QTFA 4K8BA 4YZUA 2VIWA 3AAUA 2WYGA 1O5DH 2J94A 3UTUH 8GCHF 1O2OA 2STBE 1LVBA 1TA6A 1C5OH 1TPOA 3M5NA 4GVUA 2F9BH 1YPJH 1XUKA 1YPEH 3TJVA 1PPZA 4OGXA 4ABDA 3A7WA 4JZ1A 4BAKB 1T8NA 2GTBA 1DPOA 1TBQH 5CHBA 1LDTT 3EYDA 2ZU4A 1OWEA 4RKOB 1AHTH 1H9LB 1ELFA 1TNIA 1CU1A 2AMPA 2D1JA 5EOKA 3SV2H 1FQ3A 1KTSB 3FOAA 1C1MA 3GCOA 4XSKU 1TWXB 3SV7A 2QXJA 2Z6BD 4TYDA 2A4GA 2BXUH 1LHDH 1ETRH 2Y82A 3T25A 2R0KA 3LDXH 4D7FA 1EB1H 2EI8A 3QTOH 1CE5A 1O36A 4BAQB 1E1RD 5L2YH 2Z9KA 4ZAEA 1UTNA 1VJAU 2Q6FA 2BLVA 5SGAE 1EAWA 2FX4A 1QBNA 1FLEE 2BDBA 1ELCA 1DXWA 4CH2B 4GCHF 1SGDE 1P04A 2K1QA 4CHAB 4OS2A 1HGTH 2D2DA 2J38A 1SLXB 4VGCC 1GGDB 1ELAA 1L0ZA 1B0EA 2GCTB 1GJAB 3TPIZ 4B2BA 4PROA 3F9GA 4O3UA 3BV9B 4O03A 2YMSD 4FU7A 5DP3A 4NIYA 5A0BA 2Z9LA 1TQ0B 1F92A 4BTTB 2VINA 5E0GA 2CMYA 1GHAG 4I8JA 5TJXA 2BY8X 3ATMA 1C1SA 2A7HA 2HGTH 2XC4A 2WINI 5LPRA 1Q2WA 2IJOB 1K21H 1TMTH 2FIRH 1V2KT 1GL1A 3S69A 4X2WA 4ZMAH 1GMHG 3KNXA 2FZZA 3QO6A 3GOVB 4UFFH 1O5EH 2XWAA 3SI4H 2OC0A 1GDUA 3RXOA 2WV5A 1YPMH 3SN8A 1GI6A 1GMCG 1XUJA 1X7AC 2QXHA 2FESH 1P02A 3L3TA 3SBKA 1XKAC 3W95A 3S9AA 1T8LA 2OP9A 3RUOA 1O3BA 5A09A 1HNEE 3TK5A 5EJZA 1H8HD 1XX9A 1EJAA 3TGIE 7GCHF 2V35A 3BTKE 3UOUA 3T26A 3KQ5A 4WH6A 5ESBA 3TGKE 1O3DA 3ZVBA 2P3FH 1DWCH 3CNRA 2YNBA 1C1RA 4NG9H 1O5FH 2QY0B 3U8OH 4AFQA 4CRFA 3PWCA 4UDWH 3K9XB 1IOEA 3OX7U 1O2VA 1ELEE 4FUHA 1TLDA 4ISIH 5B6OA 2Y5FA 1BHXB 1QNJA 2BD3A 2NU0E 1MAYA 3E6PH 5GWZA 3HATH 3QN7A 3NRLA 3PWBA 3PB1E 2WPJS 2C8XB 2R2MB 3F6UH 2OBQA 4K5ZA 1LHGH 5T6DA 4INHA 5GCHF 2RG3A 5DSFA 2JJ2D 4WMEA 2GKVE 2ZQ1A 3A7ZA 3S7HB 1UVOA 3E16B 3Q76A 2Q6GA 1BTUA 1VITF 3SUFA 1V2MT 2ODPA 1BDAA 1GJ9B 2OINA 2WPMS 3UAIC 2A4OA 1O2RA 3N7EA 3PMJA 1UO6A 1HIAB 2KCYA 3KQBA 1ZTJA 2O8WA 1AKSB 1QL9A 1WTGH 1AUTC 3NKKA 2OQUA 1SKYE 2TBSA 1ANBA 1INCA 3LGIA 2BQ7B 4JYVH 4NA8A 5JB9S 1QJ1B 2BB4A 5FPSA 2V3HH 3DSGA 1YCPK 2FXRA 2BDAA 2W26A 5AFZH 1HV7A 2CXVA 2FMJA 3KQCA 2WPIS 2FM2A 2BQ6B 3RXPA 3MQKC 1LVOA 1K1NA 5ABWA 3V12A 2K8IA 1EJNA 1GG6C 1O30A 2AIPA 2ZC9H 3VEQB 4ABIA 1HAHH 1GHVH 1D6RA 1FV9A 1Q31A 2HOBA 1T4VH 2RDLA 3RXHA 1HLTH 1V6DA 4OS7A 4ABGA 1J8AA 1O5BB 3Q3KA 1WQSA 1BA8B 1G37A 3U8RH 1GBAA 2LPRA 1YYY1 1D9IA 2FLRH 5DN6D 2WPLS 1GCDA 1FDPA 1O2MA 2G8TA 2ZCHP 3PM3A 4A1XA 1CT2E 1O3CA 4M7GA 2G4TA 2QE7D 1C2HA 1EATA 2ZZUH 5I25A 4CBOA 1FY1A 1YCPM 5T6FA 1V2QT 4MNVA 1VGCC 2R2WU 4E7NA 3P70B 1IQGA 2G81E 3VB5A 3HKIB 4O97A 2ZQ2A 4KKDA 2BDGA 1TYNA 3KQEA 1VGCB 4ABFA 2TGDA 3FVFB 2WSSD 5F8TA 3ZZCA 2ZIQH 2BD5A 3OY6U 3M5MA 2Q6DA 4WY3A 1O2XA 1BTHH 1TX8A 2QN5T 4AG1A 3I77A 1EP6A 1P2KA 2RFKC 1C5NH 1SBWA 2WPKS 3MNBA 2BHGA 1E34B 1FX0B 1THPB 1UTKA 1CT4E 2F9OA 1HBTH 1P05A 1OS8A 1Q3XA 1W8BH 2PGQB 1SHHB 3PRDA 3UREA 1TONA 1YGCH 1TA2A 3W1EA 3RDZA 3F9FA 4Y8ZA 1C5LH 3KN2A 1ABIH 1UK2A 2ZWLH 1CHGA 4RT0A 2ZU3A 4YTAA 5FCKA 4AC9A 2XBVA 6GCHF 1CA0C 1VZQH 3E91A 2STAE 2Y5HA 5ETXA 1BJVA 1L4DA 4INKA 3W94A 2GMTC 2BLQA 2ZP0H 4TWWA 1S83A 1CA0B 1BCUH 3GY2A 4X1RU 4ISHH 1O3EA 2ODQA 2GMTB 2Y81A 4SGAE 1G3EA 4HG6A 1XVMA 2B5TB 2H9HA 4CH8B 3MNCA 4YLUA 4WXIA 1Z8JB 5C1XA 1SGFA 1ZGVA 4Q7ZA 3T2NA 1V2OT 2GV6A 1WSSH 3F3BA 4X2VA 2PKSC 5HMAA 4DY7B 1W0ZU 2SNVA 1FY4A 1OWKA 4NIVA 1C2MA 1Z71A 1NZQH 2TPIZ 4X8UH 2KX4A 1LKAA 3SQHE 4MPUA 3T5FH 3FKSD 2PKSB 3B9FH 1O0DH 4K1EA 1O2LA 3KEEA 1C1UH 4ZUHA 1FAXA 1CHOG 4DG4A 5E8EH 1GHBF 2GZ9A 2J95A 1VR1H 1BTWA 3L6PA 2VJ1A 2PSYA 3MNSA 2XNIA 2HVYB 5AFYH 1W0KD 3T28A 1XXDA 2J92A 3A8AA 1RFNA 4I8KA 1QR3E 3UOPA 2GT7A 2P93A 1WUNH 1RIWB 1WAYB 2ZDLA 2VIQA 4F49A 1ESTA 3RXDA 3ZVCA 1SSXA 1Y5AT 2PR3A 5EQSA 2O8TA 3QDZB 1ZSKA 5CE1A 1YPLH 1K22H 1SVPA 1HJAB 1GBDA 3HKJB 1QB9A 1HAPH 3VB6A 4Y7AA 2EA3A 1BZXE 3BEUA 2ANKH 3TNSA 2GZ8A 5HYOA 1O2GH 2AFQB 5DP5A 1M9UA 1HFDA 1EKBB 1FY5A 1SGEE 1O35A 4BAOB 3D23A 2ZFSA 3V3MA 1ARCA 3KQDA 3A87A 3O8RA 4B2AA 3GYMA 4WJG2 3BEFB 2H9TH 3A84A 3P6ZB 1A5HA 1ZMNA 4XFQA 1C4U2 1E79D 4SGBE 2TGAA 5EQQA 1Z1IA 1COWD 5FCRA 1PQAA 3QLPH 4P00A 1TNJA 1OYTH 1P2NA 1F2SE 1NN6A 3GY6A 3H5CB 3GY5A 1HXEH 1K28D 1GHZA 3WWFA 3M37A 1O37A 1BMNH 4I33A 5BRRE 5AVDA 2Y7XA 1IQEA 3BG4B 3VB4A 5C5NA 1Z6EA 4TPYA 4B1TA 1GI0A 1PQ5A 3LGYA 2UUYA 3UNSA 1GBFA 4NGAH 3UR9A 1Y59T 2R3YA 2Z7FE 1S0RA 2H6MA 1KXCA 4R0IA 4A6LA 5C17A 1JBUH 1WXRA 1A5GH 1ZGIA 1OP0A 2PSXA 1GI9B 3DFJA 2KCPA 1EB2A 3V7TA 4X6MA 1OWIA 1OP8A 3TJNA 4U01A 4ESTE 1E1QD 3TK6A 2PGBB 2SNWA 1YLNA 1AVWA 5GPIB 1GBKA 2NU4E 3TNTA 1Z7KA 1GHAF 3U1IB 1K1JA 1EAUA 1HAGE 2TGTA 3SNAA 3VB3A 4X6OA 2ZU1A 2HLCA 5L30H 5F03A 1EFRD 4Y11E 3FP8E 3JZ2B 2ZNKH 1NY22 1SG8B 5JYIA 4AFUA 1GI8B 2ZGHA 3DSPA 1PPHE 1GDNA 2FLBH 3A7YA 3QZRA 1D4PB 2O8MA 2ILNA 2P95A 8ESTE 1W0JD 3DHKH 1LMWB 1LTOA 1DDJA 4MNWA 4CRCA 3A7XA 1GMDG 1V2NT 1Z1JA 1GPZA 1A7SA 4GHQA 3QUMP 2F91A 1PPCE 1GBJA 3GS9A 1ABJH 5C2ZA 2PLXA 4E7RG 1UMAH 2CGAA 4BANB 4X8SH 4FUIA 1G3BA 1O3JA 4LK4A 5KEDA 1NROH 2C4FH 7ESTE 3STIA 5FX6A 1FUJA 3TK9A 1OWJA 4ABHA 1UVTH 4X2YA 1SQOA 2G55A 2BD8A 3E90B 2ZPRA 2GX4A 5HM9A 2Z9GA 3RXSA 1H9HE 2JETC 3TLOA 1HRTH 1SQTA 1FN6A 4KELA 5EXNA 4NZLA 1XXFA 1ZRKA 4Y7BA 3SV6A 2V6NA 2BM2A 3LKWA 1N6YA 1ZYOA 4M9FA 3ATWA 2ZPSA 1QCPA 5A0CA 1QA7A 3M35A 2C8ZB 2A7JA 2ZFPH 1VKYA 1HJ8A 4I32A 4FUBA 1MQ5A 1IQMA 1DWBH 1NRRH 2J97A 2ZF0H 1UTOA 1AY6H 1SOTA 3LJOA 4FETA 3SNBA 8KME2 1BMLA 2M2AA 3EGKH 1CGHA 1SL3A 3LGVA 1IQHA 3GY4A 2BZAA 2SGQE 3D62A 3ZZDA 4UFEH 3RC5A 1WCZA 2IPHA 2TRMA 1A1RA 1V2TT 3STJA 2P59A 4A1TA 3NPSA 1IHSH 2KFWA 3AW1A 2JH6D 5HIZA 1GJ6A 1SLVB 5E2PA 5C0UA 1SPJA 3S9BA 4ACBA 1FPHH 1MKXH 1C4V2 4Y10E 2F9PA 3SHAH 4ACAA 1HAIH 1W7GH 2OC7A 3PV5A 1K1LA 1W0YH 4O9VA 2IN2A 3HGPA 2GV7A 3PMAB 3UNQA 4FU8A 3SUGA 1FIZA 6CHAC 2AS9A 2SFAA 2W6ID 4IGDA 4B75A 1OKXA 5K0HA 1DITH 1O3AA 1P2JA 2BD4A 4YLQH 1VJ9U 2Z9IA 1OYQA 1UTQA 1TPSA 2I6QA 2SGPE 4TPIZ 5J4QA 5F8ZA 1DUEA 1KY9A 1OWHA 1TB6H 3SI3H 5TCAA 3AAVA 1Z8GA 4D7GA 3M7TA 2QF4A 2AYWA 1SQRA 1GVLA 2P94A 3SJOA 2Z3EA 3OFND 3BEIB 1UVUH 3VG8A 1KLIH 4K69A 5A8ZA 4VGCB 3LC5A 1RTLA 3QK1A 1J15A 1MTNC 1UW7A 2VNTA 2Z9JA 4MNYA 4IS5A 3S7KB 1AFEH 1EOJA 3ZZ7A 1RRKA 1IQJA 4ZHAA 1TGBA 3E1XB 3Q3YA 4NFEA 1ANDA 4JCNA 3MO9A 1KYNA 4K8YA 1UCYH 2AH4X 1EAXA 1GI4A 3DFLA 4A1VA 5E0JA 5E2OA 1W3CA 5CHAC 3RXJA 3U8TH 4H4FA 2VWMA 1Z6JH 3PRBA 4NWLA 3BTGE 3LU9B 2F43B 3EA7A 5CHAB 2JJ1D 1NRSH 2AGEX 3TGJE 2ASUB 1C5WB 3ZV9A 4DW2U 2QCYA 1A46H 4XRNA 2FTLE 1BB0B 2LELA 3EE0B 2BTCE 1ELVA 4XBCA 3IITA 2VIVA 5EQRA 3PLPA 1PJPA 3MTYA 2FPZA 4YM9A 1TBZH 1A0HB 3IWMA 1QBVH 2WYJA 3OTJE 2XCNA 1A3BH 1O39A 2OLGA 5KGOA 3FO8D 3M7UA 3SJKA 2ZDNA 1T8MA 1NRQH 3GISB 2D8WA 4XE4A 1NS3A 2EQNA 2EI6A 1GBHA 3R3GB 4QT8C 3WWBA 4RSPA 3A7VA 3ENSB 1UTJA 2FI3E 5DP4A 3SQEE 5T1VA 1E0FD 2VB0A 3I29A 3TITA 4DCDA 1P2QA 5EXLA 1WBGB 4Y8YA 1C1WH 2VVVA 2FOMB 8LPRA 3A8CA 3U98H 2B9LA 2VIOA 1WQVH 4Q4LA 3M3VA 1O33A 4IBLH 1HDTH 1MMJN 1C5UA 4IC6A 2K0QA 4ISOA 3UB0A 4AN7A 4DT4A 2PUQH 1IAUA 4AORA 1ZOMA 4YO9A 5C5OA 4B2CA 1YLCA 3PO1C 3SW2B 1SGCA 4ASHA 2FP7B 1TRNA 1UHBA 3UQVA 1MCTA 4NSYA 1CHOF 1O3MA 3LGUA 1MUEB 3GCTG 3KCGH 4DIIH 3SZEA 3TH3H 3MU1A 1EPTC 1V2PT 1RTKA 3M5LA 2FOAA 4ASUD 1AE5A 1P06A 1P9SA 2BLOA 3GY8A 4A92A 1SGYE 2BOKA 4ZCNA 1A61H 1F5RA 1BBRE 4KGAA 1L1NA 5JBBS 3RXMA 2P3UB 4AB8A 1TOCB 2WHXA 3KIDU 3M5OA 1FMGA 1KTTB 2C93B 2W7SA 1A2CH 8GCHG 5EJ1A 1DM4B 2ZFFH 1ORFA 4CRBA 1DY8A 1ACBE 1EPTA 1LQEA 1UJ1A 1EP5A 4YOGA 4YOJA 2CHAC 3RLYH 3BTFE 1KIGH 3ZVEA 1SGPE 3SNDA 1J14A 2NU1E 1UVPA 5EU8A 4CBNA 1GG6B 2XBYA 1GJ8B 1ZZZA 3QGNB 1AIXH 2FOFA 2BY9X 2NU2E 3PROA 1BTPA 1TX7A 3SNCA 2GVFA 1Y3VA 3MNXA 3A88A 3NXPA 1UTMA 1DX5M 1B0FA 5L2ZH 4JZFH 3QZQA 1AB9C 2HLDD 1ELTA 1C1VH 3A8BA 3BTDE 2GCHG 1AB9B 1DE7H 2GZ7A 3F0OA 3KHVA 3QGJA 4Y76A 1O3IA 2UWLA 2GP9B 3GY3A 1O3LA 4GCHG 3TU7H 4X1QU 1DFPA 3PTNA 1AVXA 3GDUA 2BD2A 1EZUC 4MLFB 3DCLA 1YKTA 4WWYA 2ZKSA 5GJ4B 1O2PA 1K1OA 4Z1MD 4E05H 2A45B 1Y3WA 2UUJB 4CRAA 1H8DH 1JRTA 1QL8A 2UUFB 1MAXA 1B5GH 1GBIA 4B73A 3GDSA 5IYTA 1C5VA 2ANYA 4BXSA 1ZTKA 3P8OA 1K1PA 1GJCB 4HI3A 2ZEBA 4BXWA 1EUFA 1V3XA 5FPTA 1P01A 2PTCE 3EAJA 3GY7A 1QURH 2QGRA 2PKAA 1QQUA 1LVMA 1BMAA 4K2YA 4BNRA 3RXGA 1SFQB 1VITH 2BVXH 3V13A 3ODDA 2BLWA 5GXPA 2R0LA 3QWCH 2G4UA 5EJLA 4DJZB 4LOYH 2RA3A 1C1OA 1GVZA 1BRUP 3F2FA 1RTFB 1S6HA 1T32A 1C5YB 2RA0A 3F2HA 4UE7H 3SGBE 2ZDVH 1ELGA 3MO3A 3UPEA 5DJ7A 5T3HA 4JMYA 1QB6A 1O3OA 2ULLA 2CF8H 7GCHG 2UWOA 1P2MA 4H6SB 1MKXK 1C5QA 4JYTA 1C2GA 2GDEH 2FOBA 3MH7A 1S84A 1SGIB 3SORA 4JK6A 4FUFA 2ESTE 1P9UA 5HIYA 1Z8RA 2A5IA 2BX4A 4J1YA 2VVCA 4CREA 4F4OC 1ZSJA 3BTWE 3EA8A 1GI2A 5LPFA 5C0TA 1QRWA 2SGDE 4I86A 3U69H 1EXFA 2TGPZ 4Z0KA 1SHYA 1HYLA 1EZXC 2QF3A 1HPGA 5JDUB 4XDEA 2QC2A 2FS9A 3ZZ6A 1GBCA 3NCLA 5GCHG 1C5ZB 1V2RT 2PV9B 1VCWA 1QB1A 1KMHB 3ATLA 3JZ1B 1V2WT 7KMEH 4NA7A 3RMOH 3OE7D 3NK8A 4Y6DA 2ZHWH 2JH5D 4FUDA 4B71A 5AHGH 4D8NA 2CF9H 1YY3A 3GCNA 1GJBB 4BOHA 2QF5A 1Y3YA 3C27B 4FUJA 1S85A 2VIDA 1W14U 4WF8A 3RU4D 2J5UA 1CGJE 2HNTE 1NPMA 1P10A 1BTYA 1QL7A 2XRCA 3BN9A 1P8VC 2A0QB 1FAKH 1ZLRA 1BTZA 2ZHFH 4XBDA 1D3PB 1UCYK 3BTEE 1MH0A 2AGIX 3ZVDA 1HAXB 5CDFE 3VB7A 4ZXYH 2C8WB 2FODA 1HJ9A 1PYTD 3SU6A 4X8VH 2WV4A 3RXVA 2B7DH 1EX3A 1QA0A 1FIWA 4CRDA 1TRYA 1P12E 1SLWB 2ZI2H 1XMNB 5DO4H 2ZGJA 4X8TH 3RU4T 1ARBA 2BDIA 4Y0ZE 3ZYEA 3AVZA 1MKWH 3E0PB 3RMMH 3A83A 2FYRA 1P0SH 5DG6A 1BT7A 5DKMA 2H1UA 4FUCA 1FONA 1O5CB 1QZ8A 1GHWH 1MQ6A 5C1UA 2VU8E 2XTTB 1YPKH 1O3NA 4KTUA 3K2UA 1DT2A 4A5TS 2A5KA 1O2YA 1TNLA 2ZTZA 3URDA 3SUDA 5TCCA 1G36A 1AFQC 4AG2A 1MZAA 2HNTC 3LOXA 1C9TA 2A5AA 3GYLB 1O31A 3O8DA 3ZZBA 1T8OA 4H42U 1AFQB 1GCTC 3F1SB 4Z6AH 1MU8B 1UTPA 4TT3D 4BTUB 2ZHQH 2SGEE 4TY7A 2ZPQA 4CR9A 2Q1JA 1H8ED 2ZECA 3OSYA 1QFKH 2HPPH 4YOIA 5IK2D 1D3DB 2OBOA 5DP9A 3FZZA 4CR5A 4NIXA 4HFPB 1O3KA 1UVSH 3BSQA 2QA9E 1CBWC 1AQ7A 1UK4A 1ETSH 3UFAA 1SGNE 2QYIA 2THFB 3FN8A 1FPCH 1O34A 4ISNA 1GJ5H 1XVOA 1C2DA 1CBWB 1QY6A 2VWLA 1NU7B 3MH4A 3MFJA 3AW0A 4TY6A 1O3HA 3PLBA 4NSVA 4YXWD 2H5CA 3A86A 1BBRH 5EXMA 3SYJA 5FL7D 4D9RA 1DSTA 3FFGA 2W5EA 3ESTA 4WH8A 4LZ1H 1AZ8A 1GMHF 3ZZAA 1TX6A 1WDIA 2XCFA 1TPAE 5F8XA 1PPFE 1FNIA 2XXLA 1KXEA 3SZNA 5T6GA 2VH0A 5EPYA 3SO3A 3NWUA 3N7OA 3TH4H 1BRCE 1GMCF 1ZPZA 2CJIA 2W3IA 4H6TA 1HAZB 1O5GH 4AGKA 2BD9A 4RN6A 5C94A 1LVYA 1CA8B 6LPRA 1YC0A 2IOTA 4I8GA 4Y79A 5HM2A 1G9IE 5GNDA 2ZGXH 3TH2H 2ZDAH 2ZFTA 1LHCH 2HPQH 4DOQA 2VH6A 3EE7A 1MTUA 4X1PU 3TVJB 1D3QB 1P3EA 2FO9A 1OOKB 1WU1A 2W7UA 3RXUA 1TQ7B 4UONA 4B76A 1U6QA 1TNHA 1BRBE 3TIUA 2HALA 3VGCC 1TPPA 3EQ0H 5I46H 2BVSH 1CVWH 4NZQA 1LHEH 4YT7H 1AI8H 2HVXA 2R3UA 1CSOE 2HNTF 1H4WA 2JETB 4NIWA 3U1JB 3DD2H 1S0QA 1OP2A 3U28C 1GHBG 2FTMA 9LPRA 2J98A 4I31A 1JIMA 3E3TA 4DGJA 1T7CA 3BIVH 1O3FA 4ZH8A 1C5MD 2O8UA 5G4BA 1NBMD 4JK5A 4KTSA 2DUCA 1YM0A 3DUXH 3I78A 1UTLM 3RXQA 4XOJA 3RP2A 2Z94A 3DSOA 3MU5A 2AIQA 1MU6B 3P95A 3SU1A 1RXPA 3AASA 3D49H 1L2EA 3LT3A 2XWBI 2V0BA 1C5RA 1NFWA 1VCQA 2EY4C 1A3EH 2ALVA 1GJ7B 2OK5A 3T27A 2O9QA 1WYKA 2GGVB 2ZFQH 4MG3A 4OS6A 3RXIA 4JZDH 2ZA5A 3K65B 2B0FA 4OS4A 1YLDA 1FI8A 1RS0A 1ZJDA 3KL6A 5DK1A 2BVRH 4GUXA 2AHME 1C1QA 2FEQH 1SGFG 2M5TA 2PHBA 1EZQA 2EC9H 2LNCA 2HWLB 1GHYH 2WV9A 4XBBA 3A82A 1AN1E 2BX3A 1C5XB 2OC1A 3A89A 5C1YA 5HKKD 3ELAH 2J34A 1CQQA 1TGTA 6CHAB 1LPZB 1L1JA 3P8NA 4X6PA 2TIOA 3RM2H 3ZZ8A 3ODFA 1IQIA 4FUGA 3R0FA 3EDXB 1LPGB 3RXFA 5F53A 3BG8A 2Y7ZA 3BTTE 3LIWA 3P92A 4F55A 3Q00A 3CS0A 2GDDA 3SU5A 2J9NA 1JWTA 2F9UA 1DOJA 1BTXA 1O32A 4AOQA 2FI4E 4FXGH 1HCGA 1ZMJA 1NT1A 2WUBA 1OX1A 3A81A 3OU0A 3MU8A 3RXTA 2BDYA 2GCHF 1BIOA 4CHAC 4MTBA 2KZ4A 2YNAA 2GT8A 4X6NA 3VXEH 5DP6A 1ELDE 1GGDC 4KTCA 3F9EA 4X2XA 1S81A 2H5DA 2J4IA 3ITIA 1G2MA 1MBMA 2GCTC 2ZTXA 3DT0H 1SI5H 1MTNB 1TNKA 4UEHH 1C9PA 5K7RA 1S82A 1MZDA 1QIXB 1ESAA 3KYFA 1BOQA 2VWNA 1H8IH 2XC0A 3MU0A 1YPHE 3PTBA 4DURA 5EW1H 2QXGA 1P57B 1SGRE 3GICB 3OY5U 4WVPE 2AMQA 3HK6B 2FOEA 1MTWA 5FBEA 1BITA 1ZHPA 2G52A 2V3MA 3Q77A 5A0AE 3F2GA 1GBBA 3FANA 1KLJH 2IJD1 5F6MA 1K1IA 1XKBC 1DXPA 2FOGA 3FP6E 3L33A 2LP6A 4IN2A 1IQLA 5FX5A 3PYHA 1KXBA 2G5VA 1W7XH 1DS2E 2AMDA 2YMSC 1GI3A 1P3CA 1C2IA 5CMXH 3E8LA 1TIOA 3P17H 1S6FA 5JBCS 2JDID 2P3TB 1C1NA 3KGPA 1TRMA 1TGCA 1JMOH 1ETTH 2PFEA 2YMSB 1E37B 1MTSA 4R8TB 4FU9A 4UD9H 4GHTA 2FX6A 1HB0B 1MD8A 2KM0A 1P11E 3FZDA 4ZROA 1ID5H 1O5AB 1IQKA 1LO6A 1WTHD 1P03A 1L4ZA 3F9HA 3M7QA 2XC5A 4WMFA 3ZZ9A 1OPHB 1OSSA 1SLUB 3CP7A 1MKWK 2O8LA 1C2LA 1NRPH 4IMQA 4K1TA 5FBIA 3S0NA 2VIPA 1GI5A 2WPHS 1PFXC 3A85A 1EZSC 1ZTLA 1UHBB 1YPHC 1OHHD 1RD3B 1SOZA 1ESBA 5FXLA 1TMUH 1AD8H 1SGTA 1XUFA 4Q2KA 3SOSA 2ZGBH 4X0WU 5ESTE 1Y8TA 1F7ZA 3DA9B 4FOUC 3O8CA 3TJUA 2ZCLP 3KYGA 1O2TA 2XBWA 1KXAA 5C3NA 4INLA 2OCVB 2A32A 1RGQA 5C67A 2SGFE 1SFIA 2BY6X 1NESE 3MU4A 4ISLA 3PO1B 2F9VA 1C2FA 1W13U 3OTPA 3ZIAD 1O2JA 1G2LA 2PUXB 4YESB 2I6SA 2FWWA 4Q7XA 4AB9A 1EPTB 3LONA 1G3DA 5DGJA 1SR5C 4Y0YE 3SJ9A 1CT0E 2ZDKA 2NU3E 1GHXH 2A4QA 4U32A 4GSOA 3SU4A 4B74A 2P8OC 3RXLA 2D26C 1A4WH 1F0TA 4FUEA 1ZPCA 1JXPA 2BZ6H 3OEED 4GLYA 4OM9A 1BUIA 2VGCC 1J9CH 2P8OB 4AGJA 1THRH 2XOKD 4OS1A 3T62A 1BBRK 3ZVAA 1C1TA 1JRSA 2VGCB 2QV1A 4Q63A 1GBTA 3EA9A 1F5LA 2CHAB 1HIAA 3H09A 1AKSA 2CK3D 2DE9A 3SV8A 1JIRA
chains in the Genus database with same CATH topology
1AE8H 3PLKA 1S5SA 4Q7YA 2Y6TA 2BYAX 1EOLA 1XM1A 1FJSA 1QJ7B 2FYQA 1TMBH 3M3TA 1K9OE 1Y5UT 3MO6A 2ZGCA 3MI4A 3PMBB 1C2KA 1A0JA 4FVDA 2OC8A 3QX5H 1NTPA 5LPEA 2ZTYA 1NFYA 3MMGA 1QRZA 1WOFA 1LPKB 1NM6A 1QGFA 3S9CA 1BJUA 3CS7A 1LKBA 2G5NA 3RMLH 4U2WA 2DE8A 4AFSA 1FN8A 2BDHA 4NFFA 3ZZ3A 5DPAA 1TAWA 1BMMH 2ZCKP 5GIBA 1W11U 5L6NH 4MPWA 1HAVB 2H9EH 1LCYA 1TALA 5BPEA 3SUEA 2YOLA 4D76A 5FAHA 1DICA 1TFXA 1TOMH 1XUIA 1E35B 1PQ7A 1BQYA 5HGGA 2BDCA 1SQAA 1BHXF 4AX9H 1IHTH 1G32B 2OXSA 1EASA 2PKAB 2Z3CA 3BF6H 3OYPA 3NUMA 3LH1A 2H2ZA 3SU0A 4ZHLU 1HAVA 3P8GA 5JBTA 1YP9A 4WXVA 4IN1A 3P8FA 1SMFE 4DVAU 3LH3A 1C5TA 4IC5A 3A8DA 1Y3UA 1AGJA 5GDSH 1ZR0A 5A8YA 3UQOA 2A2QH 1ZRBA 1N6XA 3PV4A 2XW9A 2A7CA 4X1NU 3GCHC 2SGAA 5E0HA 1DUAA 2VWOA 4I7YH 2WUCA 3LGTA 3MOCA 3GDVA 1AZZA 1K2I1 9ESTA 1O2QA 2AEIH 1DWDH 2V3OH 3GCHB 3MWIU 4HZHA 2ZHDA 4AZ2B 7LPRA 1FY3A 1PPBH 2W3KA 5H4IB 3VFEA 1QHRB 3H7TA 3SJIA 2FOHA 4U30A 4ABJA 1ANCA 1A5IA 1KLTA 1O2SA 2G51A 2FOCA 3ZVGA 1H9IE 1O3PB 1V2ST 1AWFH 3LJJA 4Q80A 1TNGA 3RMNH 3MH6A 4ABEA 1GMDF 2C8YB 1P09A 3UIRA 1F0UA 1QJ6B 1GVKB 1SGQE 4MPXA 1GI7B 3RC6A 1TGNA 2P16A 3UUZA 3WY8A 1TGSZ 2BY5X 1AVGH 1O3GA 1C2JA 1FZZA 3HGNA 2BXTH 2JH0D 3BTHE 4IMZA 3SGQE 3ZZ4A 5FPYA 1Y5BT 3ATIA 3K6ZA 4GAWA 1J17T 1DANH 1W10U 3RXAA 4LXBH 4DIHH 4UFDH 2OD3B 5A2MH 4ZKSU 3M36A 4BTIB 2ALPA 1HUTH 3SHCH 3ZYDA 2BQWB 4OGYA 1VITG 1QQ4A 1OXGA 3UWJH 4AYVB 4A7IB 5LGOA 1ZHRA 1XUGA 2PTNA 1P2OA 3RU4E 2A4RA 1C1PA 3VXFH 4THNH 1KXFA 2F83A 5HXFA 1O2ZA 1ZHMA 3UNRA 3NZIA 5JPMH 1RJXB 2EI7A 2ZDMA 1KSNA 5DP7A 3H7OA 1ZSLA 1E38B 4ABBA 5JBAS 1MD7A 5DP8A 1RIWC 3HPTB 1EJMA 1FY8E 4X1SU 5C20A 1UCYE 1CO7E 1AMHA 6ESTA 3F68H 2F3CE 4BAMB 1J16A 1GBEA 3LGWA 1HXFH 1THSH 4MPVA 1XUHA 1ELBA 3MYWA 5IDKA 3TJOA 2QIQA 1MTVA 1V2UT 1KDQB 4K1SA 1ZPBA 4O3TA 1YF4A 2PW8H 5FHTA 4K3JA 1HJAC 2QXIA 3IG6B 1ANEA 3UWIA 3MHWU 1B7XB 1C2EA 1N8OC 3RXRA 1LHFH 1YPGH 3URCA 3UR6A 3B8JA 2A31A 1K1MA 1GBMA 1N8OB 1KDQA 1HAOH 3A7TA 1NC6A 1YBWA 3VPKA 4K60A 1AU8A 2UUKB 2ANMH 1GL0E 1O2NA 1MCVA 3O8BA 1F0RA 1D6WA 1N1LA 2EEKA 1C5PA 3BIUH 5EW2H 2ZU5A 2JKHA 1GJDB 2G00A 5A8XA 1NFXA 2AGGX 4HTCH 4MDSA 4RKJB 2PWXA 3T29A 1PPGE 5EODA 3RXEA 4AYYB 1EQ9A 3D65E 1DLKB 3LPRA 2XBXA 1PYTC 2OQ5A 5EPNA 4CRGA 1AUJA 1GCTB 3CENA 1O2UA 4KP0A 1NFUA 3ZV8A 3BG4C 1T31A 1H1BA 2BY7X 2KAIB 4MQAA 4MVNA 5EGMA 3G01A 3RM0H 4ABAA 4IW4E 1GJ4H 3C1KA 3RLWH 3E0NB 3ZZ5A 3RXBA 2QF0A 1LQDB 2RCEA 1F0SA 1TE0A 2Y80A 2ZO3H 1V2JT 3QTVH 1GDQA 3SGAE 3SV9A 2FI5E 2KAIA 1DVAH 2AERH 2ZHEH 3RXKA 2CV3A 2ZFRH 1G30B 1IQNA 1YCPH 4BAHB 1W2KH 2C3SA 2BOHB 4ZHMU 1SB1H 2ANWA 1QRXA 3B23B 4NWKA 4JYUH 1O2HA 1T4UH 1O38A 1C5SA 1JOUB 4MNXA 3FAOA 4AFZA 1DWEH 2UWPA 6GCHG 1F5KU 1O2IA 1QBOA 4HGCA 5LH8A 1ZMLA 3RC4A 1AWHB 1SC8U 1BRAA 1Z8IB 2BMGB 2CN0H 3ATKA 2OUAA 2ODYB 1FXYA 1V2VT 4GPGA 2ZU2A 4NCYA 5JB8S 4D9QA 5AF9H 1DLEA 1WV7H 1EAIA 3Q3XA 3ZVFA 2Y5GA 2QAAA 2B8OH 1G3CA 2OTVA 4ZKOU 2C90B 4LZ4B 3SU3A 4J2YB 2A2XH 3LC3A 4Y71A 1E36B 2NWNA 2FS8A 2HRVA 3U9AH 1P2IA 4YT6H 1L1GA 1TABE 3FP7E 3VGCB 4I8LA 5EG4A 3HK3B 1A0LA 2VVUA 1MBQA 2Z3DA 4I8HA 3KF2A 1IQFA 1UK3A 2R9PA 1PQ8A 3MH5A 4E06H 3K6YA 1C4Y2 3SU2A 3UY9A 2BD7A 1PPEE 1ZJKA 2GD4B 4NA9H 2ZG0H 1O2WA 1V2LT 4TWYA 1TBRH 3V0XA 1NO9H 5J4SA 3M3SA 1Y3XA 4JZEH 1NU9A 4ZKRU 3RXCA 1DSUA 1AO5A 4DT7B 1GI1A 1W12U 3SNEA 3GCTF 2FDAA 2F9NA 3A80A 3M61U 1KXDA 3PMHB 1D3TB 2J2UA 1HAYB 4OS5A 3SJ8A 4UFGH 4WMDA 5PTPA 1NRNH 1OWDA 4FVBA 4JZIA 4Y8XA 3BTME 1DY9A 4ZKNU 1CGIE 1O2KA 2XYAA 1GWAA 4ZXXH 3BTQE 2A1DB 1VCPA 1GBLA 1QTFA 4K8BA 4YZUA 2VIWA 3AAUA 2WYGA 1O5DH 2J94A 3UTUH 8GCHF 1O2OA 2STBE 1LVBA 1TA6A 1C5OH 1TPOA 3M5NA 4GVUA 2F9BH 1YPJH 1XUKA 1YPEH 3TJVA 1PPZA 4OGXA 4ABDA 3A7WA 4JZ1A 4BAKB 1T8NA 2GTBA 1DPOA 1TBQH 1LDTT 3EYDA 2ZU4A 1OWEA 4RKOB 1AHTH 1H9LB 1ELFA 1TNIA 1CU1A 2AMPA 2D1JA 5EOKA 3SV2H 1FQ3A 1KTSB 1C1MA 3GCOA 4XSKU 1TWXB 3SV7A 2QXJA 2Z6BD 4TYDA 2A4GA 2BXUH 1LHDH 1ETRH 2Y82A 3T25A 2R0KA 3LDXH 4D7FA 1EB1H 2EI8A 3QTOH 1CE5A 1O36A 4BAQB 5L2YH 2Z9KA 4ZAEA 1UTNA 1VJAU 2Q6FA 2BLVA 5SGAE 1EAWA 2FX4A 1QBNA 1FLEE 2BDBA 1ELCA 1DXWA 4CH2B 4GCHF 1SGDE 1P04A 2K1QA 4CHAB 4OS2A 1HGTH 2D2DA 2J38A 1SLXB 4VGCC 1GGDB 1ELAA 1L0ZA 1B0EA 2GCTB 1GJAB 3TPIZ 4B2BA 4PROA 3F9GA 4O3UA 3BV9B 4O03A 5DP3A 4FU7A 4NIYA 5A0BA 2Z9LA 1TQ0B 1F92A 4BTTB 2VINA 5E0GA 2CMYA 1GHAG 4I8JA 5TJXA 2BY8X 3ATMA 1C1SA 2A7HA 2HGTH 2XC4A 2WINI 5LPRA 1Q2WA 2IJOB 1K21H 1TMTH 2FIRH 1V2KT 1GL1A 3S69A 4X2WA 4ZMAH 1GMHG 3KNXA 2FZZA 3QO6A 3GOVB 4UFFH 1O5EH 2XWAA 3SI4H 2OC0A 1GDUA 3RXOA 2WV5A 1YPMH 3SN8A 1GI6A 1GMCG 1XUJA 1X7AC 2QXHA 2FESH 1P02A 3L3TA 3SBKA 1XKAC 3W95A 3S9AA 1T8LA 2OP9A 3RUOA 1O3BA 5A09A 1HNEE 3TK5A 1XX9A 1EJAA 3TGIE 7GCHF 2V35A 3BTKE 3UOUA 3T26A 4WH6A 5ESBA 3TGKE 1O3DA 3ZVBA 2P3FH 1DWCH 2YNBA 1C1RA 4NG9H 1O5FH 2QY0B 3U8OH 4AFQA 4CRFA 3PWCA 4UDWH 3K9XB 1IOEA 3OX7U 1O2VA 1ELEE 4FUHA 1TLDA 4ISIH 5B6OA 2Y5FA 1BHXB 1QNJA 2BD3A 2NU0E 1MAYA 3E6PH 5GWZA 3HATH 3QN7A 3PWBA 3PB1E 2WPJS 2C8XB 2R2MB 3F6UH 2OBQA 4K5ZA 1LHGH 5T6DA 4INHA 5GCHF 2RG3A 4WMEA 2GKVE 2ZQ1A 3A7ZA 3S7HB 1UVOA 3E16B 3Q76A 2Q6GA 1BTUA 1VITF 3SUFA 1V2MT 2ODPA 1BDAA 1GJ9B 2OINA 2WPMS 2A4OA 1O2RA 3PMJA 1UO6A 1HIAB 3KQBA 1ZTJA 2O8WA 1AKSB 1QL9A 1WTGH 1AUTC 3NKKA 2OQUA 2TBSA 1ANBA 1INCA 3LGIA 2BQ7B 4JYVH 4NA8A 5JB9S 1QJ1B 2BB4A 5FPSA 2V3HH 1YCPK 2FXRA 2BDAA 2W26A 5AFZH 1HV7A 2CXVA 2FMJA 3KQCA 2WPIS 2FM2A 2BQ6B 3RXPA 1LVOA 1K1NA 5ABWA 3V12A 1EJNA 1GG6C 1O30A 2AIPA 2ZC9H 3VEQB 4ABIA 1HAHH 1GHVH 1D6RA 1FV9A 1Q31A 2HOBA 1T4VH 2RDLA 3RXHA 1HLTH 1V6DA 4OS7A 4ABGA 1J8AA 1O5BB 3Q3KA 1WQSA 1BA8B 1G37A 3U8RH 1GBAA 2LPRA 1YYY1 1D9IA 2FLRH 2WPLS 1GCDA 1FDPA 1O2MA 2G8TA 2ZCHP 3PM3A 4A1XA 1CT2E 1O3CA 4M7GA 2G4TA 1C2HA 1EATA 2ZZUH 5I25A 4CBOA 1FY1A 1YCPM 5T6FA 1V2QT 4MNVA 1VGCC 2R2WU 4E7NA 3P70B 1IQGA 2G81E 3VB5A 3HKIB 4O97A 2ZQ2A 4KKDA 2BDGA 1TYNA 3KQEA 1VGCB 4ABFA 2TGDA 3FVFB 5F8TA 3ZZCA 2ZIQH 2BD5A 3OY6U 3M5MA 2Q6DA 4WY3A 1O2XA 1BTHH 1TX8A 2QN5T 4AG1A 3I77A 1EP6A 1P2KA 1C5NH 1SBWA 2WPKS 3MNBA 2BHGA 1E34B 1THPB 1UTKA 1CT4E 2F9OA 1HBTH 1P05A 1OS8A 1Q3XA 1W8BH 2PGQB 1SHHB 3UREA 1TONA 1YGCH 1TA2A 3RDZA 3F9FA 4Y8ZA 1C5LH 3KN2A 1ABIH 1UK2A 2ZWLH 1CHGA 2ZU3A 4YTAA 5FCKA 2XBVA 6GCHF 1CA0C 1VZQH 3E91A 2STAE 2Y5HA 5ETXA 1BJVA 1L4DA 4INKA 3W94A 2GMTC 2BLQA 2ZP0H 4TWWA 1S83A 1CA0B 1BCUH 3GY2A 4X1RU 4ISHH 1O3EA 2ODQA 2GMTB 2Y81A 4SGAE 1G3EA 1XVMA 2B5TB 2H9HA 4CH8B 3MNCA 4YLUA 4WXIA 1Z8JB 5C1XA 1SGFA 1ZGVA 4Q7ZA 3T2NA 1V2OT 2GV6A 1WSSH 4X2VA 2PKSC 5HMAA 4DY7B 1W0ZU 2SNVA 1FY4A 1OWKA 4NIVA 1C2MA 1Z71A 1NZQH 2TPIZ 4X8UH 3SQHE 1LKAA 3T5FH 4MPUA 2PKSB 3B9FH 1O0DH 4K1EA 1O2LA 3KEEA 1C1UH 4ZUHA 1FAXA 1CHOG 4DG4A 5E8EH 1GHBF 2GZ9A 2J95A 1VR1H 1BTWA 3L6PA 2VJ1A 2PSYA 3MNSA 2XNIA 5AFYH 3T28A 1XXDA 2J92A 3A8AA 1RFNA 4I8KA 1QR3E 3UOPA 2GT7A 2P93A 1WUNH 1RIWB 1WAYB 2ZDLA 2VIQA 4F49A 1ESTA 3RXDA 3ZVCA 1SSXA 1Y5AT 2PR3A 5EQSA 2O8TA 3QDZB 1ZSKA 5CE1A 1YPLH 1K22H 1SVPA 1HJAB 1GBDA 3HKJB 1QB9A 1HAPH 3VB6A 4Y7AA 2EA3A 1BZXE 3BEUA 2ANKH 3TNSA 2GZ8A 5HYOA 1O2GH 2AFQB 5DP5A 1M9UA 1HFDA 1EKBB 1FY5A 1SGEE 1O35A 4BAOB 3D23A 2ZFSA 3V3MA 1ARCA 3KQDA 3A87A 3O8RA 4B2AA 3GYMA 4WJG2 3BEFB 2H9TH 3A84A 3P6ZB 1A5HA 1ZMNA 4XFQA 1C4U2 4SGBE 2TGAA 5EQQA 1Z1IA 5FCRA 1PQAA 3QLPH 1TNJA 1OYTH 1P2NA 1F2SE 1NN6A 3GY6A 3H5CB 3GY5A 1HXEH 1K28D 1GHZA 3M37A 1O37A 1BMNH 4I33A 5BRRE 5AVDA 2Y7XA 1IQEA 3BG4B 3VB4A 5C5NA 1Z6EA 4TPYA 4B1TA 1GI0A 1PQ5A 3LGYA 2UUYA 3UNSA 1GBFA 4NGAH 3UR9A 1Y59T 2R3YA 2Z7FE 1S0RA 2H6MA 1KXCA 4R0IA 4A6LA 1JBUH 1A5GH 1ZGIA 1OP0A 2PSXA 1GI9B 3DFJA 1EB2A 3V7TA 4X6MA 1OWIA 1OP8A 3TJNA 4U01A 4ESTE 3TK6A 2PGBB 2SNWA 1AVWA 5GPIB 1GBKA 2NU4E 3TNTA 1Z7KA 1GHAF 3U1IB 1K1JA 1EAUA 1HAGE 2TGTA 3SNAA 3VB3A 4X6OA 2ZU1A 2HLCA 5L30H 5F03A 4Y11E 3FP8E 3JZ2B 2ZNKH 1NY22 1SG8B 5JYIA 4AFUA 1GI8B 2ZGHA 1PPHE 1GDNA 2FLBH 3A7YA 3QZRA 2O8MA 1D4PB 2ILNA 2P95A 8ESTE 3DHKH 1LMWB 1LTOA 1DDJA 4MNWA 4CRCA 3A7XA 1GMDG 1V2NT 1Z1JA 1GPZA 1A7SA 4GHQA 3QUMP 2F91A 1PPCE 1GBJA 1ABJH 5C2ZA 2PLXA