2FO9A

Structure of porcine pancreatic elastase in 95% acetone
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fo9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fo9A01
1KDQA 2OC1A 2ANWA 2FOMB 2HPQH 4HI3A 1FAKH 1AQ7A 2CF9H 3ATIA 2Q6DA 5ETXA 3AAUA 2OCVB 3ZVEA 3F9FA 2VIPA 2ZU4A 1LHFH 1IQEA 2VH0A 1EOJA 4ABFA 2BD8A 1P0SH 3LT3A 1C1SA 1TMTH 1TBZH 4NG9H 8GCHF 3EQ0H 1LHCH 4ABDA 1DDJA 3LOXA 1NC6A 1EUFA 3MMGA 1UCYH 1NY22 3QGJA 1VITH 3SOSA 3PV4A 4Y6DA 4X2YA 1O2ZA 2CMYA 2RA3A 1GG6B 1O3BA 3L3TA 1SB1H 3A88A 4CRCA 1OP8A 4RKOB 2Z3DA 2ZQ2A 1Y3UA 1CHGA 1AKSA 1DLKB 3VFEA 3ITIA 1HAVA 2FPZA 3HKJB 3TK9A 1HAPH 3SQEE 3RLWH 2PTCE 1TMBH 1IOEA 2BY7X 3MH4A 3AAVA 1CHOG 3RXDA 1V2UT 2ZFRH 1E36B 4AGKA 4YOJA 1HBTH 1NTPA 2JETB 1ZRBA 3O8BA 2ZZUH 3P92A 4AFZA 1PJPA 4AG1A 5T6GA 5A09A 1AVWA 1YCPM 3K6YA 2VU8E 5L6NH 4M7GA 4UFDH 3M5OA 3GCNA 2FI3E 5GCHF 2R0KA 4WH8A 1BBRK 2A7HA 3V3MA 3S7KB 2BX4A 1A1RA 3Q3XA 1C1MA 4IC5A 4X2WA 5EXLA 3ZZ5A 2EC9H 1D6RA 1N1LA 1G3EA 2A2XH 4FUGA 3LC5A 2GT7A 3MU0A 1L2EA 1O3GA 2PSXA 4B71A 2ZFPH 4AFSA 2BDGA 5E0JA 2B8OH 3S0NA 4WMDA 3SUEA 4ZKOU 4IMQA 3RC5A 1GHZA 2ZGXH 1P2IA 2FP7B 3NUMA 3LGTA 1XX9A 1NESE 3KNXA 2FOEA 2GP9B 3FP6E 1O5DH 4OGYA 4ABHA 3UFAA 2PKAA 1EJAA 1LVMA 1O31A 1CO7E 1W0YH 4O3TA 5DGJA 3BN9A 3E91A 1SOTA 3PM3A 1DX5M 4MTBA 2BD5A 1HAIH 3HK3B 5HM9A 2Z94A 1TNKA 1W3CA 3QK1A 3RXSA 2ZPRA 2ZP0H 1HJ8A 4I8HA 2BDBA 3S69A 3BTDE 4Y76A 1HDTH 1WOFA 5HMAA 1F0RA 1NRQH 1O5EH 1B5GH 4MNVA 1YCPH 4YM9A 1G37A 2VWNA 2R9PA 4X1PU 3F9HA 1V2LT 4JYUH 2WV5A 1UTQA 1FV9A 4O97A 1CGIE 1C5RA 3NK8A 1C5MD 5GCHG 3TNTA 1E35B 4PROA 1BMLA 2JH5D 3OY6U 3BTQE 4LZ4B 1AZ8A 1O32A 1XUJA 2FLRH 3I77A 2GMTC 2BD3A 2O8MA 4FUCA 1MBMA 2ZHDA 3TH4H 5DKMA 1YPMH 1A61H 1ZTJA 5C1YA 2F9BH 3MU4A 2F9OA 4Y8XA 2M5TA 3PTBA 2FMJA 4TY7A 4WJG2 1NFWA 3PLKA 4YOGA 1KLIH 4BAMB 1BTUA 1DY9A 2ZDMA 1ANBA 1Y5AT 5LPRA 2A7JA 1C2MA 4B76A 1CBWC 4LXBH 3EDXB 3FFGA 3LGUA 4BTUB 1NROH 3L33A 1O36A 3PMHB 2SGQE 2CJIA 1QFKH 1LHEH 1OP0A 2C90B 2G52A 1SGCA 4AB9A 1AUTC 1L1JA 1V2VT 1ZYOA 4FU8A 4JYTA 7GCHF 2NU4E 4IN1A 2P16A 4MPXA 2WPMS 2ZKSA 3CS7A 1O3EA 4HZHA 5FAHA 2AMDA 3QN7A 3LIWA 3M3TA 5AFYH 4X1RU 3ZV9A 1L1GA 1A0LA 3Q76A 3S9CA 3BIUH 2ANMH 3ODDA 1L4ZA 2Q6FA 7ESTE 3IWMA 1VITG 1YKTA 4XE4A 2BLQA 1KYNA 3ZZBA 5IYTA 1C5NH 2ALVA 1TNIA 4XBBA 1IHTH 1PQ7A 3STIA 3OU0A 2FESH 2IN2A 2F9PA 4GHQA 2ZEBA 4TPYA 3A7XA 2BTCE 4E06H 2W3KA 3MO6A 4X8UH 3TU7H 1TPOA 5ESBA 1C5WB 5C1UA 1EASA 1O2XA 1HAXB 2GD4B 3GYMA 4ZHAA 4Y10E 2ESTE 1DUAA 3MH6A 3LGWA 1GHBF 4KTCA 1MQ5A 1DT2A 2ILNA 4A1TA 5JB9S 3A89A 1BZXE 1S83A 1ZTKA 2QGRA 3PLBA 1P57B 4MQAA 2IJOB 1GI7B 2VWOA 4FU9A 3KQBA 1SGIB 2PLXA 4H6SB 5B6OA 1E0FD 1BHXF 2VH6A 1T31A 2J34A 2HPPH 2BY8X 5DP7A 2BZAA 1E37B 1GI2A 2QF0A 3U8OH 2ZTXA 1QBNA 3SNCA 1SHYA 3SGQE 5ABWA 4Y71A 1P2JA 5JBCS 3UTUH 4K8YA 1NT1A 5FX5A 7GCHG 4AFUA 4FVBA 3AASA 3PYHA 2P3UB 1EP6A 2B7DH 2OUAA 4ZKRU 1ANEA 1A0HB 1VGCB 1TNGA 1N8OC 1QHRB 4CRGA 1H9HE 1K28D 4MPWA 2GTBA 2W7SA 3OTJE 1W11U 3U1JB 1BTHH 2G00A 1FN6A 1AE5A 2G55A 5DP4A 2GV6A 1Y3YA 1V6DA 1D3QB 1KXCA 2PR3A 2ZIQH 2DE9A 2D1JA 4X6PA 2GV7A 4U01A 1UVTH 1KTSB 1LDTT 4O9VA 3RXLA 1QB9A 1FPHH 1PQ8A 4RN6A 2BDYA 3QO6A 1O3MA 1BQYA 1ELGA 3V12A 1MKXH 1KXDA 2ZGBH 2AMQA 1EAXA 4DIHH 1TGNA 4AG2A 3A7ZA 1UTKA 4FUDA 3ZZ6A 1GVZA 3RMOH 1GHBG 4YO9A 3PMAB 1JRSA 4NIWA 2P8OC 3GCOA 1HNEE 1KXBA 1IQHA 1YCPK 1C5UA 1JWTA 1H9LB 3SHCH 1BHXB 2BVRH 2PGBB 1JMOH 1DVAH 3K2UA 3ZVCA 3BEFB 3M35A 2Y7ZA 1QRXA 4JMYA 5E0HA 1RIWC 2GDDA 1K21H 3ATKA 1SGFG 1C5OH 2J95A 2FXRA 5GWZA 4JK5A 4ZHMU 3N7OA 3V13A 2G81E 8KME2 5L2ZH 1ETRH 2VWMA 5HYOA 4ISNA 4XOJA 2PKSB 1IQKA 4K8BA 2C8ZB 2XBVA 3TPIZ 3BTEE 1QCPA 2JH6D 1QJ1B 1SMFE 1UO6A 4NZLA 1GBIA 4D76A 2ASUB 2ZFSA 4XSKU 3TK6A 2Y82A 1C4Y2 4OGXA 1MAYA 1Y59T 4K1SA 1O5FH 3DHKH 1RTFB 1TGTA 3HK6B 4BAKB 5HGGA 1FONA 1N8OB 2UWPA 3PWBA 2VIVA 3SZNA 1A46H 2PW8H 2BY6X 3TH2H 1O3PB 4ABAA 1P10A 5EXMA 3ZVFA 3BSQA 6LPRA 1BBRH 1VJ9U 2QC2A 3SV7A 2EA3A 1DXPA 2LNCA 4I31A 2H5DA 5F8TA 2WYJA 5EG4A 1TRYA 3SJKA 3SU0A 3BTWE 1BTXA 2BOHB 5EQQA 1QY6A 2YOLA 2D2DA 2EI6A 4Z0KA 1ELVA 1QGFA 3C27B 3ZVAA 1GCTC 4JZFH 1C2JA 4JZ1A 4Q7XA 2O9QA 2ZHQH 4X0WU 4ZKSU 1BB0B 1ELFA 1Y3XA 2FOFA 4FUIA 1J14A 1DWBH 1GBDA 2TBSA 2WUCA 1Z7KA 4ZH8A 2FOBA 2Z6BD 1V2OT 1P2OA 2J92A 2P3TB 5EOKA 3RXKA 1O33A 1TE0A 3RM2H 3A84A 4ABBA 4NWKA 1ZMJA 1MUEB 1A5IA 1GI1A 2A0QB 1W13U 4X6OA 3TJNA 4AFQA 1AO5A 1AN1E 3KGPA 2SGEE 4X2XA 2FOGA 4WMEA 4Y8ZA 1E34B 1MU6B 2QY0B 5FCKA 1RIWB 2QA9E 1ETTH 4A6LA 4D9RA 1HJAC 4NSYA 3T27A 5G4BA 3RMNH 1ABIH 1IQNA 3NXPA 4F4OC 1CE5A 5EQSA 1D6WA 3VGCC 3KHVA 3GISB 3P95A 1S0RA 3LC3A 1MD7A 3HPTB 1JRTA 2W7UA 3QZQA 2HOBA 1DXWA 4XFQA 1QBOA 2ZFQH 1UMAH 2YNAA 1FY3A 3RU4E 3SUDA 2CGAA 1SGYE 2FIRH 4DY7B 1GL1A 2OD3B 2ZHFH 4U30A 4IW4E 2VVUA 1UHBA 1SSXA 3P8GA 1YYY1 5T6DA 2W26A 1CT2E 1O5AB 3M36A 1O3KA 4WY3A 4YESB 1AZZA 2HRVA 4GUXA 4X6NA 1W10U 1YPGH 4CH2B 2C8XB 3URCA 2JETC 1T8OA 1WV7H 3RMLH 4MG3A 4YT6H 1CA8B 1SGEE 1BTYA 2AIPA 3A8BA 3BTFE 1YPEH 3RXAA 1V2PT 2WPIS 4ZHLU 5C1XA 3A8AA 1IQIA 1GCTB 2ZQ1A 2GDEH 5C2ZA 3C1KA 1TRMA 2VVCA 1EZSC 5SGAE 4UD9H 1XMNB 1SI5H 5DK1A 3OX7U 4X1SU 3ZZAA 3UQOA 2AFQB 1LKBA 1EATA 1ZTLA 4OS1A 5E8EH 1RJXB 1ACBE 4YOIA 1P9UA 3NKKA 2OBQA 3T26A 1AI8H 1C1OA 1MKXK 1V2JT 1C1UH 1O5GH 2P3FH 1Z6JH 1V2KT 1WAYB 5EPNA 2FI5E 1THRH 4ISIH 3ENSB 4MNYA 2QXIA 1O2NA 2SNWA 3HGPA 1HJAB 2XWAA 4WXVA 1QJ6B 1NS3A 1T8MA 1EZUC 1O2GH 4MPVA 2OC8A 3GYLB 1W2KH 3MYWA 2WYGA 2V35A 3HATH 2GZ8A 3VGCB 2ZCHP 6GCHF 2ZA5A 2TGDA 2QXHA 3RC4A 2VJ1A 2PGQB 3RMMH 3MU5A 4AYYB 3MWIU 3QZRA 1WQVH 5FX6A 3UNSA 3LH1A 2JKHA 1SGFA 1GDQA 5A8XA 1HV7A 1GJ4H 3E0NB 4TY6A 3SN8A 3SJ8A 1KSNA 1C5VA 1O2RA 5HXFA 1YPHC 1EB1H 3TJOA 1O3AA 2XTTB 1Y8TA 4KP0A 1MU8B 5K7RA 3DA9B 2NWNA 1Q31A 4WVPE 3GDSA 1TBQH 2EEKA 3UWJH 5I46H 1PPCE 7LPRA 1NZQH 3MNCA 2Z9GA 3LGVA 2BD2A 1ELDE 5EPYA 3UY9A 1TNHA 4B1TA 4X1QU 2A4OA 2FS9A 4FU7A 3LPRA 1QR3E 3BTHE 5L2YH 1DE7H 2FX6A 3F9GA 1PPFE 1P03A 4INHA 1O30A 3AVZA 4Q7ZA 1GBFA 1TX6A 2ZTZA 2BLOA 1HIAB 2V3HH 4Y79A 4FUHA 4BXSA 1ZPZA 2Z3CA 1IQGA 2ANKH 3SHAH 3GCHC 3RXVA 3PMJA 1HAGE 3GOVB 3RU4T 1GMDF 3RXGA 1AFEH 2QV1A 1O2WA 1P04A 1QRWA 4K1EA 4CR9A 1V2TT 1UK3A 1BRUP 1ARCA 8GCHG 1TFXA 1NFXA 1C2LA 4AX9H 1GBJA 2FO9A 3EA7A 1FY1A 1G2LA 1UVPA 5T3HA 4DG4A 3VB5A 3O8DA 1CT4E 1C5XB 3SUFA 1PFXC 1V2QT 2AERH 1A4WH 1ELBA 1FXYA 4FXGH 1JIMA 2Y5GA 5F8XA 1A7SA 3TLOA 2BYAX 2PUQH 2BHGA 3F6UH 1O3DA 2ZU5A 3UNQA 2Z9LA 4K2YA 2VNTA 2G8TA 1OWHA 5EQRA 3RXOA 1PQ5A 5FPTA 2FODA 4CRDA 3STJA 3T5FH 1IQFA 4D7FA 3VPKA 3UPEA 4D8NA 2A4GA 4K60A 3M7QA 5BRRE 4SGAE 4AN7A 1BT7A 1TOMH 1BJVA 5GIBA 4NA9H 2GCTC 1PPHE 2BLVA 1V2ST 3ZZCA 2XC5A 1SQTA 3BTGE 1GI5A 5FPSA 4CRFA 2O8WA 3A82A 1ELCA 2ZDNA 1BMNH 1QL8A 2FDAA 1LCYA 4GSOA 1YPKH 3KQCA 3P8OA 1QURH 1AE8H 2UUFB 1AD8H 3U9AH 1MMJN 2CV3A 2ZHWH 1O5CB 1GDNA 1ID5H 4Y11E 1C4U2 2TGAA 2WPJS 1T8LA 1INCA 3TNSA 1ELEE 1BMMH 1DLEA 2ZCKP 2AGIX 1PPZA 3GCHB 2O8TA 3PO1B 4ISOA 3VB7A 3OSYA 4IS5A 3A83A 1SPJA 4NFFA 3QTOH 1EX3A 2C3SA 2A4RA 1VZQH 1ZMLA 3NZIA 1OS8A 1J9CH 1TA2A 4IGDA 2XNIA 4Y7AA 4BOHA 1P3EA 4JZIA 1K1IA 3RXHA 2XCNA 1VGCC 1ELAA 1O2PA 1UJ1A 5CE1A 2ODYB 2BQ6B 1SFQB 1EZQA 1UVOA 3BTTE 2FTLE 1WBGB 1DWDH 1RXPA 2F3CE 1VCQA 2PTNA 2STAE 1MTVA 3T28A 4WH6A 1OX1A 3UNRA 1HAYB 2Q1JA 1FY8E 1C2KA 1P8VC 2BZ6H 1RS0A 1G9IE 2R2WU 1G3CA 1O2MA 4I8KA 4TPIZ 7KMEH 1TWXB 1BA8B 3QDZB 3GY2A 2A31A 2B0FA 1ZHPA 2J4IA 1CA0B 2NU1E 1GI3A 1N6YA 1PYTC 1K1LA 3LGIA 5JBAS 1HUTH 2GCTB 3LH3A 1EJMA 3E3TA 3RM0H 2ZHEH 4Q2KA 5EODA 1O2KA 3GCTF 4YZUA 3ZVBA 1HJ9A 1J17T 3SU4A 1JXPA 2ZDKA 4SGBE 1O38A 1TPSA 3RXJA 1VR1H 1GPZA 3A7WA 3KQEA 5GXPA 3UUZA 1C2EA 1P2QA 1DOJA 4DCDA 1SLUB 4XDEA 2XXLA 4NIVA 1O5BB 3TGIE 4AOQA 2FX4A 1BBRE 1MZAA 1SGRE 2XWBI 2H6MA 5JPMH 1BTZA 2BOKA 1DFPA 3KF2A 5A0CA 2PKSC 1WU1A 4HTCH 3I78A 4BNRA 1WTHD 2V6NA 3FZDA 1SOZA 1GVLA 1P12E 3SU2A 1OXGA 3QLPH 4WF8A 3MH7A 4MDSA 1Z8RA 3SW2B 3TK5A 1AGJA 1XXDA 1BDAA 1C1TA 2J94A 3NWUA 3PLPA 3UQVA 2ZDVH 3EYDA 1C2HA 3VB4A 1GWAA 1QTFA 2FLBH 1C1VH 3LDXH 6ESTA 1KXAA 1BCUH 1DICA 1EAUA 1FZZA 1P2MA 3U69H 3ZZ3A 2KAIB 1DITH 3ATMA 4BAOB 4KTSA 1O2YA 4WWYA 1EPTB 1K1OA 1UTLM 2C8WB 1J15A 1K22H 1QA0A 1QJ7B 1UTMA 3UOUA 1C2DA 1M9UA 1O3OA 1YLDA 4CRAA 3O8CA 1TGSZ 5TCAA 1F5KU 1KIGH 1AUJA 3VXFH 3UR6A 1BUIA 1UK2A 2VINA 3BEUA 1P11E 3EA8A 3ESTA 2OC7A 3DD2H 3ELAH 4MPUA 2BM2A 3KN2A 2FEQH 1XKAC 1YPHE 1J8AA 3PB1E 4X2VA 1F7ZA 6CHAC 3KL6A 3P17H 1ESAA 1DS2E 1F5RA 1G3DA 1HAOH 1P9SA 1KLTA 1LHGH 1O39A 1XKBC 2AIQA 1F2SE 1GBTA 4NFEA 1NU9A 1O2IA 1YPLH 2YNBA 3FP7E 4J2YB 4GHTA 1GJ7B 2SGAA 4LK4A 4OS6A 1TALA 3A8DA 4H6TA 1OWIA 3U1IB 4E05H 3ZYEA 2GVFA 2GCHF 1UVSH 2A2QH 3FP8E 2UWLA 1EAWA 3GY4A 3D65E 2AMPA 2GZ7A 1D3DB 5DP9A 4X8TH 1G30B 1OYQA 3JZ2B 4DIIH 3SI4H 4ISHH 1P3CA 1GJ5H 1A3EH 1BJUA 4OS7A 2QF3A 2Z3EA 4Y0ZE 3SJOA 1LPKB 1YGCH 4NGAH 3RDZA 1QBVH 4ZUHA 4ABIA 1W7GH 1FAXA 2AH4X 1NRSH 1ESBA 4CBOA 1Z1JA 3F1SB 2VIOA 2Y5HA 2QAAA 3M7UA 3T2NA 1ANDA 1OSSA 2DUCA 4NSVA 1HXFH 1NRNH 1Z8IB 1NPMA 1TNJA 1B0FA 4H42U 3ZYDA 1GVKB 1LQDB 3JZ1B 1SVPA 1D4PB 1ZSKA 1O3CA 2P93A 5AVDA 1Y3WA 2PV9B 1HLTH 3GY5A 4B74A 3IITA 1ARBA 4GAWA 1BMAA 1DY8A 3V0XA 4MVNA 2XBYA 4BANB 3WY8A 1P01A 2AGEX 3A7VA 2BLWA 2PHBA 3TIUA 4AORA 2FTMA 3TVJB 1O2UA 2WPLS 3D23A 5GJ4B 1K1JA 5F03A 2F9UA 1FIZA 3SV2H 2F9NA 1H1BA 3P70B 5FBEA 1DWEH 4NIXA 4GPGA 2C93B 5K0HA 5AFZH 2ZC9H 1SGPE 2ODQA 4OS4A 1EXFA 1LVOA 2Y81A 1HAZB 6CHAB 1ZMNA 3U8TH 5PTPA 1O37A 2I6SA 1QL9A 2FYQA 5DP8A 3E1XB 2OP9A 3RXFA 3ZZ7A 2IOTA 3VEQB 1UK4A 3M3SA 3ODFA 2ZO3H 4K69A 2GCHG 4O03A 1P05A 2QIQA 5EW2H 1TGBA 1B0EA 1XUIA 2FZZA 2BXUH 2QXJA 2ZNKH 2ZDAH 1PPGE 3M37A 1KY9A 5J4QA 1XUHA 1ZPBA 4AZ2B 1S6FA 2R3UA 1GJAB 1ZLRA 2WUBA 4B2CA 3RU4D 1O3JA 3H7OA 1SGNE 3EAJA 4MNWA 5CMXH 1TPPA 2SGPE 3BIVH 4J1YA 1JBUH 2BVSH 1SQAA 1FQ3A 2FOCA 3SV9A 1BRAA 2AS9A 5LPFA 1ZJKA 1G2MA 4ESTE 2ZG0H 3Q00A 5FBIA 1C9TA 2BDHA 1O3HA 3CENA 4Z6AH 1ZGVA 2H2ZA 1A5GH 1Z8GA 1S81A 3IG6B 2RDLA 4NWLA 1NFYA 1L4DA 2STBE 4HFPB 2OQ5A 4FUEA 1C1NA 1AFQC 2EI7A 5GPIB 1GMCF 1IQJA 2ZECA 1Q3XA 3MO9A 5CHAB 4AYVB 1V2NT 1ZPCA 3SV6A 1EJNA 1NRPH 1YPJH 4UONA 1HAHH 1B7XB 3MHWU 1TA6A 1IHSH 1C5QA 3EA9A 1TX8A 2SGFE 2Z7FE 5E0GA 2BDIA 2D26C 2ZU3A 3P8NA 3SQHE 3QUMP 1AB9C 1PQAA 2TGTA 1T7CA 2PSYA 1NU7B 5E2PA 1EB2A 1OKXA 2KAIA 2H9EH 1JIRA 3CP7A 1UTOA 3W95A 1QRZA 3U98H 4DJZB 2CHAB 4B75A 2HWLB 1KXEA 1N6XA 3BG4C 1PYTD 1GCDA 3DFJA 1F0TA 2XRCA 5C5OA 3D49H 4VGCC 3A80A 4JZEH 3ZZDA 1FNIA 3AW1A 3EGKH 4E7NA 3E0PB 2RA0A 1GBCA 1OOKB 1Z8JB 4CRBA 5TCCA 2GZ9A 2AEIH 2VGCC 4QT8C 1VCPA 5DPAA 3Q77A 4ZAEA 1AVGH 2J38A 3E16B 1O2VA 5DJ7A 4Q80A 5EU8A 3M3VA 4CHAC 1ZOMA 1XUKA 4UFGH 1H4WA 1OWKA 1S84A 3M7TA 3M61U 3URDA 1TOCB 1W7XH 1C5YB 1SGTA 4NA7A 2FS8A 4OS2A 4CR5A 1WTGH 3MU8A 1K1NA 4UE7H 1EP5A 3SGBE 1FI8A 3A81A 1ESTA 1C1RA 2PWXA 1NO9H 3F68H 4DURA 3B23B 1GMCG 4D9QA 3G01A 2Q6GA 1G32B 1ZSJA 2BDCA 4F49A 4UEHH 1AFQB 1TPAE 2H9HA 2A4QA 1QIXB 1SLVB 4LZ1H 1HYLA 3P8FA 1AWHB 3BTKE 2ZFTA 1C1WH 2GKVE 4ASHA 1L0ZA 3SNBA 4I8JA 2OXSA 4B2AA 1O2QA 3SJ9A 1MTWA 3MH5A 3SNAA 2G5NA 2ZF0H 1FPCH 1OP2A 2J9NA 1DWCH 1NFUA 3LONA 2J2UA 1O0DH 1MKWH 1EAIA 1GHYH 1AB9B 2HVXA 1P09A 3SU1A 3F9EA 4K3JA 3MI4A 1RTLA 1BOQA 3LKWA 4R0IA 3V7TA 5A8ZA 1C5LH 4UDWH 5FHTA 3GY7A 3BG4B 4A1VA 2H5CA 3PO1C 4XBCA 2ZPSA 2VIWA 1SGQE 5JDUB 3ZV8A 3SU5A 2R3YA 2G5VA 4YLQH 1HPGA 5DO4H 2GX4A 4VGCB 1EZXC 4ABEA 3S9AA 3B8JA 2Z9KA 9LPRA 2GGVB 2B5TB 5LH8A 1ZZZA 3M5LA 1A2CH 4U32A 1GHAF 2FM2A 2VGCB 1VJAU 2ZGJA 3RXCA 4I33A 1TB6H 6GCHG 2ZTYA 3OYPA 3GY6A 1V2RT 1A0JA 1S85A 1TYNA 2XC0A 2P95A 4NCYA 2PFEA 4UFEH 4CHAB 2P94A 3BF6H 3DT0H 4X8VH 1ZHMA 2Y7XA 2F9VA 1ZSLA 1OYTH 1CT0E 2IPHA 4YTAA 4D7GA 5I25A 1CGHA 2OINA 3E90B 1THPB 2ZCLP 1HB0B 3K65B 3SU6A 1SQOA 2TIOA 5A2MH 2NU3E 1FJSA 1RRKA 3SGAE 4X6MA 5L30H 3S9BA 1UTPA 1LVYA 5EXNA 2O8LA 1FLEE 4BXWA 4BAQB 1S82A 1CA0C 3FAOA 3P6ZB 2K1QA 1AY6H 3TGKE 4GCHF 4A5TS 1ZHRA 2FI4E 4WMFA 1Y5UT 2OBOA 2ZU2A 1UVUH 4E7RG 1LO6A 2H1UA 3T62A 4ABGA 2H9TH 1W8BH 1LVBA 3PTNA 1GBHA 1O2LA 1VITF 1YM0A 5EGMA 3ZZ9A 1O3NA 4RSPA 2WINI 1AVXA 1AIXH 4JK6A 1DUEA 1BTWA 4OS5A 2WPKS 3E8LA 4Y7BA 1BRCE 5C3NA 1CVWH 2BVXH 1C4V2 2WV4A 1O2OA 2ZWLH 1GGDC 3A85A 1FY4A 2ZGHA 1GMDG 3QWCH 2A5KA 2BXTH 4JZDH 3CS0A 4FVDA 3NCLA 1VCWA 1WCZA 1PPBH 2BQWB 1W14U 1GBKA 1EQ9A 1GHAG 1FMGA 1MCVA 5JBBS 1V3XA 2BD4A 1C2GA 1DM4B 1ETSH 1NRRH 2Y5FA 4K1TA 3RXTA 1P2NA 3ZZ8A 4INKA 1TAWA 3KIDU 3SU3A 1GHXH 2BY5X 1W12U 3FZZA 3I29A 4YT7H 4Y0YE 1GBLA 2XBXA 3LJJA 3BG8A 2BX3A 1ORFA 2ZI2H 2QYIA 1Y5BT 1SL3A 2QXGA 3RXPA 1GBEA 2Y80A 5JB8S 1GJCB 1L1NA 3E6PH 3UIRA 1QB1A 2NU2E 1MTNC 3M5NA 1LTOA 3Q3YA 4MNXA 5TJXA 1HXEH 5JYIA 5LPEA 4BAHB 1EPTC 1SBWA 1O2JA 2GT8A 4WXIA 3Q3KA 5IDKA 2LPRA 1SC8U 4BTTB 1D3PB 5DG6A 3RC6A 1C5ZB 2HNTC 4LOYH 1TQ7B 4IBLH 1UTNA 3VXEH 3DFLA 4GCHG 3R0FA 5C5NA 5LGOA 2XC4A 4I8LA 5DP6A 2XYAA 3BV9B 5BPEA 2AGGX 1ZR0A 2ZGCA 2HNTF 4I8GA 2BD9A 2VIQA 2CN0H 1X7AC 9ESTA 2FOHA 1BTPA 2CXVA 1SFIA 2TRMA 1QB6A 1Z71A 4B2BA 1TLDA 1UCYK 1GI4A 2ZPQA 2O8UA 3RXMA 4CH8B 1LMWB 3RXUA 1LHDH 1GI8B 4KELA 1SLXB 2OTVA 2ZU1A 4ZXXH 1MZDA 1GI9B 3T29A 3K9XB 1GL0E 1LQEA 4UFFH 8ESTE 2HALA 2P59A 4I32A 5AF9H 1O3FA 5FCRA 1O2HA 1OWDA 1T8NA 1RGQA 3RXIA 1FIWA 1BIOA 5A0BA 1GGDB 4AGJA 1U6QA 1DANH 2B9LA 1O3IA 4NZQA 3SNDA 1ELTA 2Z9IA 2FWWA 1FDPA 1YC0A 4AB8A 1MKWK 3RXBA 1TX7A 2BMGB 2GMTB 4GVUA 5C67A 1HIAA 4FUFA 1MD8A 3PROA 1RFNA 3TGJE 4CREA 1NM6A 1WUNH 4YLUA 1UHBB 2ZDLA 3LU9B 1YLCA 4NIYA 3A7TA 3MU1A 1AU8A 1CBWB 1P02A 1GHWH 1F5LA 1F0UA 3SUGA 4FUBA 5E2OA 1IQMA 1DSUA 1LPZB 3GY3A 1OWJA 2RG3A 2Z9JA 3L6PA 4MLFB 1SG8B 1SR5C 1MTNB 1MTUA 3SJIA 1HGTH 2QCYA 2Y6TA 3BTME 4KKDA 3RXQA 4A92A 1OPHB 3BEIB 1F92A 1F0SA 1TIOA 3FVFB 1GHVH 1S6HA 3RLYH 1KXFA 1YBWA 2TPIZ 1MCTA 2V3OH 1O3LA 3K6ZA 3VB3A 2XBWA 4KTUA 2BY9X 3SNEA 2G51A 1ZJDA 1Z1IA 1DPOA 3HGNA 1SHHB 1TNLA 3GCTG 4INLA 2A7CA 4U2WA 4Q7YA 4DT7B 3SO3A 1GJ8B 2C8YB 1ABJH 3M5MA 3SORA 1YP9A 2FYRA 1C5PA 4BTIB 2BQ7B 3ATLA 5T6FA 1KDQB 3ATWA 4FUJA 4HGCA 2G4TA 4IN2A 2SNVA 1WSSH 4TWWA 1LPGB 3LJOA 1QA7A 1C2FA 2PUXB 2F83A 4ZMAH 4ZROA 1O34A 2ZFFH 1EOLA 1H9IE 1TMUH 2EI8A 1C9PA 2DE8A 1HFDA 1XM1A 1D3TB 3EE0B 1Q2WA 5DP5A 5F8ZA 1A3BH 3MNXA 3ZVDA 1RD3B 1GBAA 1WYKA 1JOUB 1MAXA 2SGDE 1K1PA 2VVVA 2UUYA 1HRTH 3VB6A 1TQ0B 2SFAA 3A8CA 1MH0A 3MNBA 1Z6EA 3FANA 1GI0A 4Y8YA 2WPHS 8LPRA 4TYDA 3UR9A 1AKSB 2UUJB 2VIDA 4DOQA 3RUOA 1HAVB 2D8WA 3GY8A 1V2WT 1AHTH 2FOAA 1C1PA 1GI6A 3UREA 3GICB 1P2KA 3A86A 3QGNB 4THNH 1T4UH 2HGTH 1CU1A 2TGPZ 3HKIB 3LGYA 1SGDE 5CHAC 5H4IB 1GJDB 4JYVH 2OC0A 2QN5T 1FN8A 2XW9A 3UWIA 2F91A 4B73A 3MOCA 3GDUA 2JH0D 1MQ6A 5ESTE 1TRNA 1UTJA 4IMZA 4I7YH 1QL7A 2A32A 3TITA 1ANCA 3MNSA 1TONA 3QTVH 1FUJA 1EKBB 4RKJB 1GJ6A 3A87A 2CHAC 1XXFA 1KTTB 4X1NU 3TH3H 1GJBB 3AW0A 4TWYA 1PPEE 4NA8A 1O2SA 5J4SA 2R0LA 3H7TA 1V2MT 1TBRH 3SV8A 1CQQA 1IAUA 1AWFH 1UCYE 1BITA 3PWCA 4CBNA 1WQSA 1DSTA 2PKAB 3MTYA 1LKAA 4A7IB 5FPYA 1TABE 3UOPA 5JBTA 3D62A 1G3BA 2P8OB 4JCNA 1BRBE 1GMHF 2CF8H 2R2MB 5DP3A 3SBKA 4R8TB 1QQ4A 5A0AE 1Y3VA 1NN6A 4XBDA 3RP2A 1TGCA 1D9IA 3H5CB 1HCGA 1XVOA 1XUGA 3MFJA 3KEEA 1C2IA 2A45B 2V0BA 4X8SH 1K1MA 1ZGIA 1G36A 1H8IH 1THSH 1CSOE 3SI3H 1C5TA 3TJVA 4GLYA 2BD7A 4IC6A 3PMBB 2BB4A 3QX5H 1GJ9B 5FXLA 2W3IA 5C20A 2NU0E 3TJUA 1S5SA 2A5AA 3DUXH 2OLGA 3T25A 3MO3A 5GDSH 1CGJE 2VWLA 3R3GB 2BDAA 1XUFA 1J16A 4DGJA 1QNJA 1GG6C 1W0ZU 2UWOA 2RCEA 1IQLA 4A1XA 3RXRA 2UUKB 1O2TA 2OQUA 2G4UA 2ANYA 4KGAA 1S0QA 4DVAU 1K9OE 3B9FH 3KCGH 1GBBA 3ZZ4A 1XVMA 1RTKA 3W94A 5F6MA 4ABJA 2THFB 1YF4A 3ZVGA 4ISLA 4ZKNU 3A7YA 1ZRKA 1O35A 2ODPA 1T4VH 1GDUA 4H4FA 3U8RH 1E38B 1K2I1 1C5SA 4K5ZA 4ZXYH 2A1DB 1MBQA 1QQUA 1CHOF 3O8RA 2ALPA 1EPTA 3OY5U 1A5HA 4DW2U 1MTSA 1GBMA 2HNTE 1T32A 5HM2A 1H8DH 3GDVA 1P06A 3KQDA 2VB0A 2I6QA 3RXEA 2C4FH 1KLJH 2AYWA 2ULLA 1OWEA 1FY5A 2HLCA 3S7HB 3NPSA 5AHGH 1C1QA 1GMHG 1SLWB 1AMHA 2A5IA 2XCFA 5EW1H 2W5EA 4O3UA 5A8YA
chains in the Genus database with same CATH superfamily
1KDQA 2OC1A 2ANWA 2FOMB 2HPQH 4HI3A 1FAKH 1AQ7A 1KMHB 2CF9H 3ATIA 2Q6DA 5ETXA 3AAUA 2OCVB 3ZVEA 3F9FA 2VIPA 2ZU4A 4DT4A 1LHFH 1IQEA 2VH0A 1EOJA 4ABFA 2BD8A 1P0SH 3LT3A 1C1SA 1TMTH 1TBZH 4NG9H 8GCHF 3EQ0H 1LHCH 4M9FA 4ABDA 1DDJA 3LOXA 1NC6A 1EUFA 3MMGA 1UCYH 1NY22 3QGJA 1VITH 3SOSA 3PV4A 4Y6DA 4X2YA 1O2ZA 2CMYA 2RA3A 1GG6B 1O3BA 3L3TA 1SB1H 3A88A 4CRCA 1OP8A 4RKOB 2Z3DA 2ZQ2A 1Y3UA 1CHGA 1AKSA 3AK5A 1DLKB 2OK5A 3VFEA 3ITIA 1HAVA 2FPZA 3HKJB 3TK9A 1HAPH 3SQEE 3RLWH 2PTCE 1H8ED 1TMBH 1IOEA 2BY7X 3MH4A 3AAVA 1CHOG 3RXDA 1V2UT 2ZFRH 1E36B 4AGKA 4YOJA 1HBTH 1NTPA 2JETB 1ZRBA 3O8BA 2ZZUH 3P92A 4AFZA 1PJPA 4AG1A 5T6GA 5A09A 1AVWA 1YCPM 3K6YA 3FKSD 1E1RD 2VU8E 5L6NH 4M7GA 4UFDH 3M5OA 3GCNA 1SKYE 2FI3E 5GCHF 2R0KA 4WH8A 1BBRK 2A7HA 3V3MA 3S7KB 2BX4A 1A1RA 3Q3XA 1C1MA 2V7QD 4IC5A 4X2WA 5EXLA 3ZZ5A 2EC9H 1D6RA 1N1LA 1G3EA 2A2XH 4FUGA 3LC5A 3ZIAD 2GT7A 3MU0A 1L2EA 1O3GA 2PSXA 4B71A 2ZFPH 4AFSA 2BDGA 5E0JA 2B8OH 3S0NA 4WMDA 3SUEA 4ZKOU 4IMQA 3RC5A 1GHZA 3SZEA 2ZGXH 1P2IA 2FP7B 3NUMA 3LGTA 1XX9A 1NESE 3KNXA 2WV9A 2FOEA 2GP9B 3FP6E 1O5DH 4OGYA 4ABHA 3UFAA 2PKAA 1EJAA 1LVMA 1O31A 1CO7E 1W0YH 4O3TA 5DGJA 3BN9A 3E91A 1SOTA 5CHBA 3PM3A 1DX5M 4MTBA 2BD5A 1HAIH 3HK3B 5HM9A 2Z94A 1TNKA 1W3CA 3QK1A 3RXSA 2ZPRA 2ZP0H 1HJ8A 1H8HD 4I8HA 2BDBA 3S69A 3BTDE 4Y76A 1HDTH 1WOFA 5CDFE 5HMAA 1F0RA 1NRQH 1O5EH 2KFWA 1B5GH 4MNVA 1YCPH 4YM9A 1G37A 1QZ8A 2JIZD 2VWNA 2R9PA 4X1PU 3F9HA 1V2LT 4JYUH 2WV5A 1UTQA 1E79D 1FV9A 4O97A 1CGIE 1C5RA 3NK8A 1C5MD 5GCHG 3TNTA 1E35B 4PROA 4P00A 1BMLA 2JH5D 4YXWD 3OY6U 3BTQE 4LZ4B 1AZ8A 1O32A 1XUJA 2FLRH 3I77A 2GMTC 2BD3A 2O8MA 4FUCA 1MBMA 2ZHDA 3TH4H 5DKMA 1YPMH 1A61H 1ZTJA 5C1YA 2F9BH 3MU4A 2F9OA 4Y8XA 2M5TA 3PTBA 2FMJA 4TY7A 4WJG2 1NFWA 3PLKA 4YOGA 1KLIH 4BAMB 1BTUA 1DY9A 2ZDMA 1ANBA 1Y5AT 5LPRA 2A7JA 1C2MA 4B76A 1CBWC 4LXBH 3EDXB 3FFGA 3LGUA 4BTUB 2HLDD 1NROH 3L33A 1O36A 3PMHB 3DSOA 2SGQE 2CJIA 1QFKH 1LHEH 1OP0A 2C90B 5A8YA 2G52A 1SGCA 4AB9A 1AUTC 1L1JA 1V2VT 1ZYOA 4FU8A 4JYTA 7GCHF 2NU4E 4IN1A 2P16A 2KCYA 4MPXA 2WPMS 2ZKSA 3CS7A 1O3EA 4HZHA 5FAHA 2AMDA 3QN7A 3LIWA 3M3TA 5AFYH 4X1RU 3ZV9A 1L1GA 1A0LA 3Q76A 3S9CA 3BIUH 2ANMH 3ODDA 1L4ZA 2Q6FA 7ESTE 3IWMA 1VITG 1YKTA 2WHXA 4XE4A 2BLQA 1KYNA 3ZZBA 5IYTA 1C5NH 2ALVA 1TNIA 3N99A 4XBBA 1IHTH 1PQ7A 3STIA 3OU0A 2FESH 2IN2A 2F9PA 4GHQA 2ZEBA 4TPYA 3A7XA 2BTCE 4E06H 2W3KA 3MO6A 4X8UH 3TU7H 1TPOA 5ESBA 1C5WB 5C1UA 1EASA 1O2XA 1HAXB 2GD4B 3GYMA 4ZHAA 4Y10E 2ESTE 1DUAA 3MH6A 3LGWA 1GHBF 4KTCA 1MQ5A 1DT2A 2ILNA 4OM9A 4A1TA 5JB9S 3A89A 1BZXE 1S83A 1ZTKA 2QGRA 3PLBA 1P57B 4MQAA 2IJOB 4Q4LA 1GI7B 2VWOA 4FU9A 3KQBA 1SGIB 2PLXA 4H6SB 5B6OA 1E0FD 1BHXF 2VH6A 1T31A 2J34A 2HPPH 2BY8X 5DP7A 2BZAA 1E37B 1GI2A 2QF0A 3U8OH 2ZTXA 1QBNA 3SNCA 1SHYA 3SYJA 4ACBA 3SGQE 5ABWA 4Y71A 1P2JA 5JBCS 3UTUH 4K8YA 1NT1A 5FX5A 7GCHG 4AFUA 4FVBA 3AASA 3PYHA 2P3UB 1EP6A 2B7DH 2OUAA 4ZKRU 1ANEA 1A0HB 1VGCB 1TNGA 1N8OC 1QHRB 4CRGA 1H9HE 1K28D 4MPWA 2GTBA 2W7SA 3OTJE 1W11U 3U1JB 1BTHH 2G00A 1FN6A 1AE5A 2G55A 5DP4A 2GV6A 1Y3YA 1V6DA 1D3QB 1VKYA 1KXCA 2PR3A 2ZIQH 2DE9A 2D1JA 4X6PA 2GV7A 4U01A 1UVTH 5C94A 5F53A 1KTSB 1LDTT 1WXRA 2AHME 2KX4A 4O9VA 3RXLA 1QB9A 1FPHH 1PQ8A 4RN6A 2BDYA 3QO6A 1O3MA 1BQYA 1ELGA 3V12A 1MKXH 1KXDA 2ZGBH 2AMQA 1EAXA 4DIHH 1TGNA 4AG2A 3A7ZA 1UTKA 4FUDA 3ZZ6A 1GVZA 3RMOH 2WZQA 1GHBG 4YO9A 3PMAB 1JRSA 4NIWA 2P8OC 3GCOA 1HNEE 1KXBA 1IQHA 1YCPK 1C5UA 1JWTA 1H9LB 3SHCH 4B6FA 1BHXB 2BVRH 2PGBB 1JMOH 1DVAH 3K2UA 3ZVCA 3BEFB 3M35A 5DSFA 2Y7ZA 1QRXA 4JMYA 5E0HA 1RIWC 2GDDA 1K21H 3ATKA 1SGFG 1C5OH 2J95A 2FXRA 5GWZA 4JK5A 4ZHMU 3N7OA 3V13A 2G81E 8KME2 5L2ZH 1ETRH 2VWMA 5HYOA 4ISNA 4XOJA 2PKSB 1IQKA 4K8BA 2C8ZB 2XBVA 3TPIZ 3BTEE 1QCPA 2JH6D 1QJ1B 1SMFE 1UO6A 4NZLA 1GBIA 4D76A 2ASUB 2ZFSA 4XSKU 3TK6A 2Y82A 1C4Y2 4OGXA 1MAYA 1Y59T 4K1SA 1O5FH 3DHKH 1RTFB 1TGTA 3HK6B 4BAKB 5HGGA 1FONA 1N8OB 2UWPA 3PWBA 2VIVA 3SZNA 1A46H 2PW8H 2BY6X 3TH2H 1O3PB 4ABAA 2L6OA 1P10A 5EXMA 3ZVFA 3BSQA 6LPRA 1BBRH 1VJ9U 2QC2A 3SV7A 2EA3A 1DXPA 2LNCA 4I31A 2PP6A 2H5DA 5F8TA 2WYJA 5EG4A 1TRYA 3SJKA 3SU0A 3BTWE 1BTXA 2BOHB 5EQQA 1QY6A 2YOLA 2D2DA 2EI6A 4Z0KA 1ELVA 1QGFA 3C27B 3ZVAA 1GCTC 4JZFH 1C2JA 4JZ1A 4Q7XA 2O9QA 2ZHQH 4X0WU 4ZKSU 1BB0B 1ELFA 3FN8A 1Y3XA 2FOFA 3OAAD 4FUIA 1J14A 1DWBH 1GBDA 2TBSA 2WUCA 1Z7KA 4ZH8A 2FOBA 2Z6BD 1V2OT 1P2OA 2J92A 2CK3D 2P3TB 5EOKA 1O33A 3RXKA 1TE0A 3RM2H 3A84A 4ABBA 4NWKA 1ZMJA 1MUEB 1A5IA 1GI1A 2A0QB 1W13U 4X6OA 3TJNA 4AFQA 1AO5A 1AN1E 3KGPA 2SGEE 4X2XA 2FOGA 4WMEA 4Y8ZA 1E34B 1MU6B 2QY0B 5FCKA 1RIWB 2QA9E 1ETTH 4A6LA 4D9RA 1HJAC 4NSYA 3T27A 5G4BA 3RMNH 1ABIH 1YY3A 1IQNA 3NXPA 4F4OC 1CE5A 5EQSA 1D6WA 3VGCC 3KHVA 3GISB 3P95A 1S0RA 3F0OA 3LC3A 1MD7A 3HPTB 1JRTA 2W7UA 3QZQA 2HOBA 1DXWA 1W0KD 4XFQA 1QBOA 2ZFQH 1UMAH 2YNAA 1FY3A 3RU4E 3SUDA 2CGAA 1SGYE 2FIRH 4DY7B 1GL1A 2OD3B 2ZHFH 4U30A 4IW4E 2VVUA 1UHBA 1SSXA 3P8GA 1YYY1 5T6DA 2W26A 1CT2E 1O5AB 3M36A 1O3KA 4WY3A 4YESB 1AZZA 2HRVA 4GUXA 4X6NA 1W10U 1YPGH 4CH2B 2C8XB 3URCA 2JETC 1T8OA 1WV7H 3RMLH 4MG3A 4YT6H 1CA8B 1SGEE 1BTYA 2AIPA 3A8BA 3BTFE 1YPEH 3RXAA 1V2PT 2WPIS 4ZHLU 4ASUD 5C1XA 3A8AA 1IQIA 1GCTB 2ZQ1A 2GDEH 5C2ZA 3C1KA 1TRMA 2VVCA 1EZSC 3PV2A 4UD9H 5SGAE 1XMNB 4Z1MD 1SI5H 5DK1A 3OX7U 2QE7D 3N7EA 4X1SU 3ZZAA 3UQOA 2AFQB 1LKBA 1EATA 1ZTLA 5KEDA 4OS1A 5E8EH 1RJXB 1ACBE 4YOIA 1P9UA 3NKKA 4B6EA 2OBQA 3T26A 1AI8H 1C1OA 1MKXK 1V2JT 1C1UH 1O5GH 2P3FH 1Z6JH 1V2KT 1WAYB 5EPNA 2FI5E 1THRH 4ISIH 3ENSB 4MNYA 2QXIA 1O2NA 2SNWA 3HGPA 1HJAB 2XWAA 4WXVA 1QJ6B 1NS3A 1T8MA 1EZUC 1O2GH 4MPVA 2OC8A 3GYLB 1W2KH 3MYWA 2WYGA 2V35A 3HATH 2GZ8A 3VGCB 2ZCHP 6GCHF 2ZA5A 2TGDA 2QXHA 3RC4A 2VJ1A 2PGQB 3RMMH 3MU5A 4AYYB 3MWIU 3QZRA 1WQVH 5FX6A 3UNSA 3LH1A 2JKHA 1SGFA 1GDQA 5A8XA 1HV7A 1GJ4H 3E0NB 4TY6A 3SN8A 3SJ8A 1KSNA 1C5VA 1O2RA 5HXFA 1YPHC 1EB1H 3TJOA 1O3AA 2XTTB 1Y8TA 4FETA 4KP0A 1MU8B 5K7RA 3DA9B 2NWNA 1Q31A 4WVPE 1MABB 3GDSA 1TBQH 2LELA 2EEKA 3UWJH 5I46H 1PPCE 7LPRA 1NZQH 3MNCA 2Z9GA 3LGVA 2BD2A 1ELDE 5EPYA 3UY9A 1TNHA 4B1TA 4X1QU 2A4OA 2FS9A 4FU7A 3LPRA 1QR3E 2L74A 3BTHE 5L2YH 1DE7H 2FX6A 3F9GA 1PPFE 1P03A 4INHA 1O30A 3AVZA 4Q7ZA 1GBFA 1TX6A 2ZTZA 2BLOA 1HIAB 2V3HH 4Y79A 4FUHA 4BXSA 1ZPZA 2Z3CA 3H09A 1IQGA 2ANKH 3SHAH 3GCHC 3OTPA 3N7DA 3RXVA 4Q63A 3PMJA 1HAGE 3GOVB 3RU4T 1GMDF 3RXGA 1AFEH 2QV1A 1O2WA 1P04A 1QRWA 4K1EA 4CR9A 1V2TT 1UK3A 1BRUP 1ARCA 2KZ4A 8GCHG 1TFXA 1NFXA 1C2LA 4AX9H 1GBJA 2FO9A 3EA7A 1FY1A 1G2LA 1UVPA 5T3HA 4DG4A 3VB5A 3O8DA 1CT4E 1C5XB 3SUFA 1PFXC 3F2FA 1V2QT 2AERH 1A4WH 1ELBA 1FXYA 4FXGH 1JIMA 2Y5GA 5F8XA 1A7SA 3TLOA 2BYAX 2PUQH 2BHGA 3F6UH 1O3DA 2ZU5A 3UNQA 2Z9LA 4K2YA 2VNTA 2G8TA 1OWHA 5EQRA 3RXOA 1PQ5A 5FPTA 2FODA 4CRDA 3STJA 3T5FH 1IQFA 4D7FA 5C17A 3VPKA 3UPEA 4D8NA 2A4GA 4K60A 3M7QA 5BRRE 4SGAE 4AN7A 1BT7A 1TOMH 1BJVA 1YLNA 5GIBA 4NA9H 2GCTC 1PPHE 2BLVA 1V2ST 3ZZCA 2XC5A 1SQTA 3BTGE 1GI5A 5FPSA 4CRFA 2O8WA 3A82A 1ELCA 2ZDNA 1BMNH 1QL8A 2FDAA 1LCYA 4GSOA 1YPKH 3KQCA 3P8OA 4TSFD 1QURH 3CNRA 1AE8H 2UUFB 1AD8H 3U9AH 1MMJN 2CV3A 2ZHWH 1O5CB 1GDNA 1ID5H 4Y11E 1C4U2 2TGAA 2WPJS 1T8LA 5HIZA 1INCA 3TNSA 1ELEE 1BMMH 1DLEA 2ZCKP 2AGIX 1PPZA 3GCHB 2O8TA 3PO1B 4ISOA 3GS9A 3VB7A 3OSYA 4IS5A 3A83A 2KR7A 2W6JD 1SPJA 4NFFA 3QTOH 2W6ID 1EX3A 2C3SA 2A4RA 1VZQH 1ZMLA 3NZIA 1OS8A 1J9CH 1TA2A 4IGDA 2XNIA 4Y7AA 4BOHA 1P3EA 4JZIA 1K1IA 3RXHA 2XCNA 1VGCC 1ELAA 1O2PA 1UJ1A 5CE1A 2ODYB 2BQ6B 1SFQB 1EZQA 1UVOA 3BTTE 2FTLE 1WBGB 1DWDH 1RXPA 2F3CE 1VCQA 2PTNA 2STAE 1MTVA 3T28A 4WH6A 1OX1A 3UNRA 1HAYB 2J97A 2LP6A 2Q1JA 1FY8E 1C2KA 1P8VC 2BZ6H 5DN6D 1RS0A 1G9IE 2R2WU 1G3CA 1O2MA 4I8KA 4TPIZ 7KMEH 1TWXB 1BA8B 3QDZB 3GY2A 2A31A 2B0FA 1ZHPA 2J4IA 1CA0B 2NU1E 1GI3A 1N6YA 1PYTC 1K1LA 3LGIA 5JBAS 1HUTH 2GCTB 3LH3A 1EJMA 3E3TA 3RM0H 2ZHEH 4Q2KA 5EODA 1O2KA 3GCTF 4YZUA 3ZVBA 1HJ9A 1J17T 3SU4A 1JXPA 2ZDKA 4SGBE 1O38A 1TPSA 2KCAA 3RXJA 1VR1H 1GPZA 3A7WA 3KQEA 3PV5A 5GXPA 3UUZA 1C2EA 1P2QA 4XRNA 1DOJA 4DCDA 1SLUB 4XDEA 2XXLA 4NIVA 1O5BB 3TGIE 4AOQA 2FX4A 1BBRE 1MZAA 1SGRE 2XWBI 2H6MA 5JPMH 1BTZA 2BOKA 4AC9A 1DFPA 3KF2A 5A0CA 1WU1A 2EQNA 2PKSC 4HTCH 3I78A 4BNRA 1WTHD 2V6NA 3FZDA 1SOZA 1GVLA 1P12E 3SU2A 5B6LA 1OXGA 3QLPH 4WF8A 3MH7A 4MDSA 1Z8RA 3SW2B 3TK5A 1AGJA 1XXDA 1BDAA 1C1TA 2J94A 3NWUA 3PLPA 3UQVA 2ZDVH 3EYDA 1C2HA 3VB4A 1GWAA 1QTFA 2FLBH 1C1VH 3LDXH 2F4LA 3U28C 6ESTA 2JJ2D 1KXAA 1BCUH 1DICA 1EAUA 1FZZA 1P2MA 3U69H 3ZZ3A 2KAIB 1DITH 3ATMA 4BAOB 4KTSA 1O2YA 4WWYA 1EPTB 1K1OA 1UTLM 2C8WB 1J15A 1K22H 1QA0A 1QJ7B 1UTMA 3UOUA 1C2DA 1M9UA 1O3OA 1YLDA 4CRAA 3O8CA 1TGSZ 5TCAA 1F5KU 1KIGH 3MQKC 1AUJA 3OFND 2RDEA 3VXFH 3UR6A 1BUIA 1UK2A 2VINA 3BEUA 1P11E 3EA8A 3ESTA 3WWBA 2OC7A 3DD2H 3ELAH 4MPUA 2BM2A 3KN2A 2FEQH 1XKAC 1YPHE 2J5UA 1J8AA 3PB1E 4X2VA 1F7ZA 6CHAC 3KL6A 3P17H 1ESAA 1DS2E 1F5RA 1G3DA 1HAOH 1P9SA 1KLTA 1LHGH 1O39A 1XKBC 2AIQA 1F2SE 1GBTA 4NFEA 1NU9A 1O2IA 1YPLH 2YNBA 3FP7E 4J2YB 4GHTA 1GJ7B 2SGAA 4LK4A 4OS6A 1TALA 3DCLA 4ZCNA 3A8DA 4H6TA 1OWIA 3U1IB 4E05H 3ZYEA 2GVFA 2GCHF 1UVSH 2A2QH 5FL7D 3FP8E 2UWLA 1EAWA 3GY4A 4XD7D 3D65E 2AMPA 2GZ7A 1D3DB 5DP9A 4X8TH 1G30B 1OYQA 3JZ2B 4DIIH 3SI4H 4ISHH 1P3CA 1GJ5H 1A3EH 1BJUA 2K8IA 2QF3A 2Z3EA 4OS7A 4Y0ZE 3SJOA 1LPKB 1YGCH 4NGAH 3RDZA 1QBVH 4ZUHA 4ABIA 1W7GH 1FAXA 2AH4X 1NRSH 3KYGA 1ESBA 4CBOA 1Z1JA 3F1SB 2WSSD 2VIOA 2Y5HA 2QAAA 3M7UA 3T2NA 1ANDA 1OSSA 2DUCA 4NSVA 1HXFH 1NRNH 1Z8IB 1NPMA 1TNJA 1B0FA 2J98B 4H42U 3ZYDA 1GVKB 1LQDB 3JZ1B 1SVPA 1D4PB 1ZSKA 1O3CA 2P93A 5AVDA 1Y3WA 2PV9B 1HLTH 3GY5A 4B74A 3IITA 1ARBA 4GAWA 1BMAA 1DY8A 3V0XA 4MVNA 4RI0A 2XBYA 4F55A 4BANB 3WY8A 1P01A 2AGEX 3A7VA 2BLWA 2PHBA 3TIUA 4AORA 2FTMA 3TVJB 5EJLA 1O2UA 2WPLS 3D23A 5GJ4B 1K1JA 5F03A 2F9UA 1FIZA 3SV2H 2F9NA 1H1BA 2QF4A 3P70B 5FBEA 1DWEH 4NIXA 4GPGA 2C93B 5K0HA 5AFZH 2ZC9H 1SGPE 3OEED 2ODQA 4OS4A 1EXFA 1LVOA 2Y81A 1HAZB 6CHAB 1ZMNA 3U8TH 5PTPA 1O37A 2I6SA 1QL9A 2FYQA 5DP8A 3E1XB 2OP9A 3RXFA 3ZZ7A 2IOTA 3VEQB 4I86A 3F3BA 1UK4A 3M3SA 3ODFA 2ZO3H 4K69A 2EY4C 2GCHG 4O03A 1P05A 2QIQA 5EW2H 2QF5A 1TGBA 1B0EA 1XUIA 2FZZA 2BXUH 2QXJA 2ZNKH 2ZDAH 1PPGE 3M37A 3UB0A 1KY9A 5J4QA 1XUHA 1ZPBA 4AZ2B 1S6FA 2R3UA 1GJAB 1ZLRA 2WUBA 4B2CA 3RU4D 1O3JA 3H7OA 1SGNE 3EAJA 4MNWA 5CMXH 1TPPA 2SGPE 3BIVH 4J1YA 1JBUH 2BVSH 1SQAA 1FQ3A 2FOCA 3SV9A 1BRAA 2AS9A 5LPFA 5EIYA 1ZJKA 1G2MA 4ESTE 2ZG0H 3Q00A 5FBIA 1C9TA 2BDHA 1O3HA 3CENA 4Z6AH 1ZGVA 2H2ZA 1A5GH 1Z8GA 1S81A 3KQ5A 3IG6B 2RDLA 4NWLA 1NFYA 1L4DA 2STBE 4HFPB 2OQ5A 4FUEA 1OHHD 1C1NA 1AFQC 2EI7A 2WPDD 5GPIB 1GMCF 1IQJA 2ZECA 1Q3XA 5KECA 3MO9A 5CHAB 4AYVB 1V2NT 1ZPCA 3SV6A 1EJNA 5IK2D 1NRPH 1YPJH 4UONA 1HAHH 1B7XB 4P02A 3MHWU 1TA6A 3KYFA 1IHSH 1C5QA 3EA9A 1TX8A 2SGFE 2Z7FE 5E0GA 2BDIA 2D26C 2ZU3A 3P8NA 3SQHE 3QUMP 1AB9C 1PQAA 2TGTA 1T7CA 2PSYA 1NU7B 5E2PA 1EB2A 1OKXA 2KAIA 2H9EH 1JIRA 3CP7A 1UTOA 3W95A 1QRZA 3U98H 4DJZB 2CHAB 4B75A 2HWLB 1KXEA 1N6XA 3BG4C 1PYTD 1GCDA 3DFJA 1F0TA 2XRCA 5C5OA 3D49H 4VGCC 3A80A 4JZEH 2YMSC 3ZZDA 1FNIA 3AW1A 3EGKH 4E7NA 3E0PB 2RA0A 2KCOA 1GBCA 1OOKB 1Z8JB 4CRBA 5TCCA 2GZ9A 2AEIH 4TT3D 2VGCC 4QT8C 1VCPA 5DPAA 3Q77A 4ZAEA 1AVGH 2J38A 3VG8A 3E16B 1O2VA 5DJ7A 4Q80A 5EU8A 1NBME 3M3VA 1ZOMA 4CHAC 1XUKA 4UFGH 1H4WA 1OWKA 1S84A 3M7TA 3M61U 3URDA 1TOCB 1W7XH 1C5YB 2K0QA 1SGTA 4NA7A 2FS8A 4OS2A 4CR5A 1WTGH 3MU8A 1K1NA 4UE7H 1S6LA 1EP5A 3SGBE 1FI8A 3A81A 1ESTA 1C1RA 2PWXA 1NO9H 3PRDA 3F68H 4DURA 3B23B 1GMCG 4D9QA 3G01A 2Q6GA 1G32B 1ZSJA 2BDCA 4F49A 4UEHH 1AFQB 1TPAE 2H9HA 3W1EA 2A4QA 1QIXB 1SLVB 4LZ1H 1HYLA 3P8FA 1AWHB 3BTKE 2V3MA 2ZFTA 1C1WH 2GKVE 4ASHA 1L0ZA 3SNBA 3WW7A 4I8JA 2OXSA 4B2AA 1O2QA 3SJ9A 1MTWA 3MH5A 3SNAA 2G5NA 2ZF0H 1FPCH 1OP2A 2J98A 2J9NA 1DWCH 1NFUA 3LONA 2J2UA 2GJGA 1O0DH 1MKWH 1EAIA 1GHYH 1AB9B 2HVXA 1P09A 3SU1A 3F9EA 4K3JA 3MI4A 1RTLA 1BOQA 4F48B 3LKWA 4R0IA 3V7TA 5A8ZA 1C5LH 4UDWH 5FHTA 3GY7A 3BG4B 4A1VA 2H5CA 3PO1C 4XBCA 2ZPSA 2VIWA 1SGQE 5JDUB 3ZV8A 3SU5A 2R3YA 2G5VA 4YLQH 1HPGA 5DO4H 2GX4A 4VGCB 1EZXC 1COWD 4ABEA 2YMSB 3S9AA 3B8JA 2Z9KA 9LPRA 2GGVB 2B5TB 3PRBA 5LH8A 1ZZZA 3M5LA 1A2CH 4U32A 1GHAF 2FM2A 2VGCB 1VJAU 2ZGJA 3EE7A 4I33A 3RXCA 1TB6H 6GCHG 2ZTYA 3OYPA 3GY6A 1V2RT 1A0JA 1S85A 1TYNA 2XC0A 2P95A 4NCYA 2PFEA 4UFEH 4CHAB 2P94A 3BF6H 3DT0H 4X8VH 1ZHMA 2Y7XA 2F9VA 1ZSLA 1OYTH 1CT0E 2IPHA 4YTAA 4D7GA 5I25A 1CGHA 2OINA 3E90B 1THPB 2ZCLP 1HB0B 2KM0A 3K65B 3SU6A 1SQOA 2TIOA 5A2MH 2NU3E 1FJSA 1RRKA 3SGAE 4X6MA 5L30H 3S9BA 1UTPA 1LVYA 5EXNA 2JJ1D 2O8LA 1FLEE 4BXWA 4BAQB 1S82A 1CA0C 3F2GA 3FAOA 3P6ZB 2K1QA 1AY6H 3TGKE 4GCHF 4A5TS 1ZHRA 2FI4E 4WMFA 1Y5UT 2OBOA 2ZU2A 1UVUH 4E7RG 1LO6A 2H1UA 3T62A 4ABGA 2H9TH 1W8BH 1LVBA 2IJD1 3PTNA 1GBHA 1O2LA 1VITF 1YM0A 5EGMA 3ZZ9A 1O3NA 4RSPA 2WINI 1AVXA 1AIXH 4JK6A 1DUEA 1BTWA 4OS5A 2WPKS 4ACAA 3E8LA 4Y7BA 1BRCE 5C3NA 1CVWH 2BVXH 1C4V2 1WDIA 2WV4A 1O2OA 2ZWLH 1GGDC 3A85A 1FY4A 2ZGHA 1GMDG 3QWCH 2A5KA 2BXTH 4JZDH 3CS0A 4FVDA 3NCLA 1VCWA 1WCZA 1PPBH 2BQWB 1W14U 1GBKA 1EQ9A 1GHAG 1FMGA 1MCVA 3UAIC 5JBBS 1V3XA 2BD4A 1C2GA 1DM4B 1ETSH 1NRRH 2Y5FA 4K1TA 3RXTA 1P2NA 3ZZ8A 4INKA 1TAWA 3KIDU 3SU3A 1GHXH 2BY5X 1W12U 3FZZA 3I29A 4YT7H 4Y0YE 1GBLA 2XBXA 3LJJA 3BG8A 2BX3A 1ORFA 2ZI2H 2QYIA 1Y5BT 1SL3A 2QXGA 3RXPA 1GBEA 2Y80A 5JB8S 1GJCB 1L1NA 3E6PH 3UIRA 1QB1A 2NU2E 1MTNC 3M5NA 1LTOA 3Q3YA 4MNXA 5TJXA 1HXEH 5JYIA 5LPEA 4BAHB 1EPTC 1SBWA 1O2JA 2GT8A 4WXIA 3Q3KA 5IDKA 2LPRA 1SC8U 4BTTB 1D3PB 5DG6A 3RC6A 1C5ZB 2HNTC 4LOYH 1TQ7B 3F0PA 4IBLH 1UTNA 3VXEH 3DFLA 4GCHG 3R0FA 5T1VA 5C5NA 5LGOA 2XC4A 4I8LA 5DP6A 2XYAA 3BV9B 5GNDA 2AGGX 1ZR0A 5BPEA 2ZGCA 2HNTF 4I8GA 2BD9A 2VIQA 2CN0H 1X7AC 9ESTA 2FOHA 1BTPA 2CXVA 1SFIA 2XOKD 2TRMA 1QB6A 1Z71A 4B2BA 1TLDA 1UCYK 1GI4A 2ZPQA 2O8UA 3RXMA 4CH8B 1LMWB 5KGOA 3RXUA 1LHDH 1GI8B 4KELA 1SLXB 2OTVA 2ZU1A 4ZXXH 1K0HA 1MZDA 1GI9B 3T29A 3K9XB 1GL0E 1LQEA 4UFFH 8ESTE 2HALA 2P59A 4I32A 5AF9H 1O3FA 5FCRA 1O2HA 5HKKD 1OWDA 1T8NA 1RGQA 3RXIA 1FIWA 1BIOA 5A0BA 1GGDB 4AGJA 1U6QA 1DANH 2B9LA 1FX0B 1O3IA 4NZQA 3SNDA 2M2AA 1ELTA 2Z9IA 2FWWA 1FDPA 1YC0A 4AB8A 1MKWK 3RXBA 1TX7A 2BMGB 2GMTB 4GVUA 5C67A 1HIAA 4FUFA 1MD8A 3PROA 2IPQX 1RFNA 3TGJE 4CREA 2YMSD 1NM6A 1WUNH 5C0TA 4YLUA 1UHBB 2ZDLA 3LU9B 1YLCA 4NIYA 2RFKC 3A7TA 3MU1A 1AU8A 1CBWB 1P02A 1GHWH 1E1QD 1F5LA 1F0UA 1UW7A 3SUGA 4FUBA 5E2OA 1IQMA 1DSUA 1LPZB 3GY3A 1OWJA 2RG3A 2Z9JA 3L6PA 4MLFB 1SG8B 1SR5C 1MTNB 1MTUA 3SJIA 1HGTH 2QCYA 2Y6TA 3BTME 4KKDA 3RXQA 4A92A 1OPHB 3BEIB 5C0UA 1F92A 1F0SA 1TIOA 3FVFB 1GHVH 1S6HA 3RLYH 1KXFA 1YBWA 2TPIZ 1MCTA 2V3OH 1O3LA 3K6ZA 3VB3A 2XBWA 4KTUA 2BY9X 3SNEA 2G51A 1ZJDA 1Z1IA 1DPOA 3HGNA 1SHHB 1TNLA 3GCTG 4INLA 2A7CA 4U2WA 4Q7YA 4DT7B 3SO3A 1GJ8B 2C8YB 1ABJH 3M5MA 3SORA 1YP9A 2FYRA 1C5PA 4BTIB 2BQ7B 3ATLA 5T6FA 1KDQB 3ATWA 4FUJA 4HGCA 2G4TA 4IN2A 2SNVA 1WSSH 4TWWA 1YWUA 1LPGB 3LJOA 1QA7A 1C2FA 2PUXB 2F83A 4ZMAH 3DSPA 4ZROA 1BMFD 1O34A 2ZFFH 1EOLA 1H9IE 1TMUH 2EI8A 1C9PA 2DE8A 1HFDA 1XM1A 1D3TB 4FOUC 3EE0B 1Q2WA 5DP5A 5F8ZA 1A3BH 3MNXA 3ZVDA 1RD3B 1GBAA 1WYKA 1JOUB 1MAXA 2SGDE 1K1PA 2VVVA 2UUYA 1HRTH 3VB6A 1TQ0B 2SFAA 3A8CA 1MH0A 3WWFA 3MNBA 1Z6EA 3FANA 1GI0A 4Y8YA 2WPHS 8LPRA 4TYDA 3UR9A 1AKSB 2UUJB 2VIDA 4DOQA 3RUOA 1HAVB 2D8WA 3GY8A 1V2WT 1AHTH 3F2HA 3DSGA 2FOAA 1C1PA 1GI6A 2JDID 3UREA 3GICB 1P2KA 3A86A 3QGNB 5EJZA 4THNH 1T4UH 2HGTH 4RT0A 2F43B 1CU1A 2TGPZ 3HKIB 3LGYA 1SGDE 3FOAA 5CHAC 5H4IB 1GJDB 4JYVH 2OC0A 2QN5T 1FN8A 2XW9A 3UWIA 2F91A 4B73A 3MOCA 3GDUA 2JH0D 1MQ6A 5ESTE 1TRNA 1UTJA 4IMZA 4I7YH 1QL7A 2A32A 3TITA 1ANCA 3MNSA 1TONA 3QTVH 1FUJA 1EKBB 4RKJB 1GJ6A 3A87A 2CHAC 1XXFA 1KTTB 4X1NU 3TH3H 4HG6A 1GJBB 3AW0A 4TWYA 1EFRD 1PPEE 4NA8A 1O2SA 5J4SA 2R0LA 3H7TA 1V2MT 1TBRH 3SV8A 1CQQA 1SQRA 1IAUA 1AWFH 1UCYE 1BITA 3PWCA 4CBNA 1WQSA 1DSTA 2PKAB 3MTYA 1LKAA 4A7IB 5FPYA 1TABE 3UOPA 5JBTA 3D62A 1G3BA 2P8OB 4JCNA 1BRBE 1GMHF 2CF8H 2R2MB 5DP3A 3SBKA 4R8TB 1QQ4A 5A0AE 1Y3VA 1NN6A 4XBDA 3RP2A 1TGCA 1D9IA 3H5CB 1HCGA 1XVOA 1XUGA 3MFJA 3KEEA 1C2IA 2A45B 2V0BA 4X8SH 1K1MA 1ZGIA 1G36A 1H8IH 1THSH 1CSOE 3SI3H 3FO8D 1C5TA 3TJVA 4GLYA 2BD7A 4IC6A 3NRLA 3PMBB 2BB4A 3QX5H 1GJ9B 5FXLA 2W3IA 5C20A 2NU0E 3TJUA 1S5SA 2A5AA 3DUXH 2OLGA 3T25A 3MO3A 5GDSH 1CGJE 2VWLA 5EJ1A 3R3GB 2BDAA 3OE7D 1XUFA 1J16A 4DGJA 1QNJA 1GG6C 1W0ZU 2UWOA 2RCEA 1IQLA 4A1XA 3RXRA 2UUKB 1O2TA 2OQUA 2G4UA 2ANYA 4KGAA 1S0QA 4DVAU 1K9OE 3B9FH 3KCGH 1GBBA 3ZZ4A 2XNDD 1XVMA 1RTKA 2HVYB 3W94A 5F6MA 4ABJA 2THFB 1YF4A 2VBCA 3ZVGA 4ISLA 4ZKNU 3A7YA 1ZRKA 1O35A 2ODPA 1T4VH 1GDUA 4H4FA 3U8RH 5HIYA 1E38B 1K2I1 1C5SA 4K5ZA 4ZXYH 2A1DB 1MBQA 1QQUA 1CHOF 3O8RA 2ALPA 1EPTA 3OY5U 1A5HA 4DW2U 2KCPA 1MTSA 1GBMA 2HNTE 1T32A 5HM2A 1H8DH 3GDVA 1P06A 3KQDA 2VB0A 2I6QA 3RXEA 2C4FH 1KLJH 2AYWA 2ULLA 1OWEA 1FY5A 2HLCA 3S7HB 1NBMD 3NPSA 5AHGH 4RT1A 1C1QA 1GMHG 1SLWB 1AMHA 2A5IA 2XCFA 5EW1H 2W5EA 4O3UA 1W0JD 3OEHD
chains in the Genus database with same CATH topology
1KDQA 2OC1A 2ANWA 2FOMB 2HPQH 4HI3A 1FAKH 1AQ7A 2CF9H 3ATIA 2Q6DA 5ETXA 3AAUA 2OCVB 3ZVEA 3F9FA 2VIPA 2ZU4A 1LHFH 1IQEA 2VH0A 1EOJA 4ABFA 2BD8A 1P0SH 3LT3A 1C1SA 1TMTH 1TBZH 4NG9H 8GCHF 3EQ0H 1LHCH 4ABDA 1DDJA 3LOXA 1NC6A 1EUFA 3MMGA 1UCYH 1NY22 3QGJA 1VITH 3SOSA 3PV4A 4Y6DA 4X2YA 1O2ZA 2CMYA 2RA3A 1GG6B 1O3BA 3L3TA 1SB1H 3A88A 4CRCA 1OP8A 4RKOB 2Z3DA 2ZQ2A 1Y3UA 1CHGA 1AKSA 1DLKB 3VFEA 3ITIA 1HAVA 2FPZA 3HKJB 3TK9A 1HAPH 3SQEE 3RLWH 2PTCE 1TMBH 1IOEA 2BY7X 3MH4A 3AAVA 1CHOG 3RXDA 1V2UT 2ZFRH 1E36B 4AGKA 4YOJA 1HBTH 1NTPA 2JETB 1ZRBA 3O8BA 2ZZUH 3P92A 4AFZA 1PJPA 4AG1A 5T6GA 5A09A 1AVWA 1YCPM 3K6YA 2VU8E 5L6NH 4M7GA 4UFDH 3M5OA 3GCNA 2FI3E 5GCHF 2R0KA 4WH8A 1BBRK 2A7HA 3V3MA 3S7KB 2BX4A 1A1RA 3Q3XA 1C1MA 4IC5A 4X2WA 5EXLA 3ZZ5A 2EC9H 1D6RA 1N1LA 1G3EA 2A2XH 4FUGA 3LC5A 2GT7A 3MU0A 1L2EA 1O3GA 2PSXA 4B71A 2ZFPH 4AFSA 2BDGA 5E0JA 2B8OH 3S0NA 4WMDA 3SUEA 4ZKOU 4IMQA 3RC5A 1GHZA 2ZGXH 1P2IA 2FP7B 3NUMA 3LGTA 1XX9A 1NESE 3KNXA 2FOEA 2GP9B 3FP6E 1O5DH 4OGYA 4ABHA 3UFAA 2PKAA 1EJAA 1LVMA 1O31A 1CO7E 1W0YH 4O3TA 5DGJA 3BN9A 3E91A 1SOTA 3PM3A 1DX5M 4MTBA 2BD5A 1HAIH 3HK3B 5HM9A 2Z94A 1TNKA 1W3CA 3QK1A 3RXSA 2ZPRA 2ZP0H 1HJ8A 4I8HA 2BDBA 3S69A 3BTDE 4Y76A 1HDTH 1WOFA 5HMAA 1F0RA 1NRQH 1O5EH 1B5GH 4MNVA 1YCPH 4YM9A 1G37A 2VWNA 2R9PA 4X1PU 3F9HA 1V2LT 4JYUH 2WV5A 1UTQA 1FV9A 4O97A 1CGIE 1C5RA 3NK8A 1C5MD 5GCHG 3TNTA 1E35B 4PROA 1BMLA 2JH5D 3OY6U 3BTQE 4LZ4B 1AZ8A 1O32A 1XUJA 2FLRH 3I77A 2GMTC 2BD3A 2O8MA 4FUCA 1MBMA 2ZHDA 3TH4H 5DKMA 1YPMH 1A61H 1ZTJA 5C1YA 2F9BH 3MU4A 2F9OA 4Y8XA 2M5TA 3PTBA 2FMJA 4TY7A 4WJG2 1NFWA 3PLKA 4YOGA 1KLIH 4BAMB 1BTUA 1DY9A 2ZDMA 1ANBA 1Y5AT 5LPRA 2A7JA 1C2MA 4B76A 1CBWC 4LXBH 3EDXB 3FFGA 3LGUA 4BTUB 1NROH 3L33A 1O36A 3PMHB 2SGQE 2CJIA 1QFKH 1LHEH 1OP0A 2C90B 2G52A 1SGCA 4AB9A 1AUTC 1L1JA 1V2VT 1ZYOA 4FU8A 4JYTA 7GCHF 2NU4E 4IN1A 2P16A 4MPXA 2WPMS 2ZKSA 3CS7A 1O3EA 4HZHA 5FAHA 2AMDA 3QN7A 3LIWA 3M3TA 5AFYH 4X1RU 3ZV9A 1L1GA 1A0LA 3Q76A 3S9CA 3BIUH 2ANMH 3ODDA 1L4ZA 2Q6FA 7ESTE 3IWMA 1VITG 1YKTA 4XE4A 2BLQA 1KYNA 3ZZBA 5IYTA 1C5NH 2ALVA 1TNIA 4XBBA 1IHTH 1PQ7A 3STIA 3OU0A 2FESH 2IN2A 2F9PA 4GHQA 2ZEBA 4TPYA 3A7XA 2BTCE 4E06H 2W3KA 3MO6A 4X8UH 3TU7H 1TPOA 5ESBA 1C5WB 5C1UA 1EASA 1O2XA 1HAXB 2GD4B 3GYMA 4ZHAA 4Y10E 2ESTE 1DUAA 3MH6A 3LGWA 1GHBF 4KTCA 1MQ5A 1DT2A 2ILNA 4A1TA 5JB9S 3A89A 1BZXE 1S83A 1ZTKA 2QGRA 3PLBA 1P57B 4MQAA 2IJOB 1GI7B 2VWOA 4FU9A 3KQBA 1SGIB 2PLXA 4H6SB 5B6OA 1E0FD 1BHXF 2VH6A 1T31A 2J34A 2HPPH 2BY8X 5DP7A 2BZAA 1E37B 1GI2A 2QF0A 3U8OH 2ZTXA 1QBNA 3SNCA 1SHYA 3SGQE 5ABWA 4Y71A 1P2JA 5JBCS 3UTUH 4K8YA 1NT1A 5FX5A 7GCHG 4AFUA 4FVBA 3AASA 3PYHA 2P3UB 1EP6A 2B7DH 2OUAA 4ZKRU 1ANEA 1A0HB 1VGCB 1TNGA 1N8OC 1QHRB 4CRGA 1H9HE 1K28D 4MPWA 2GTBA 2W7SA 3OTJE 1W11U 3U1JB 1BTHH 2G00A 1FN6A 1AE5A 2G55A 5DP4A 2GV6A 1Y3YA 1V6DA 1D3QB 1KXCA 2PR3A 2ZIQH 2DE9A 2D1JA 4X6PA 2GV7A 4U01A 1UVTH 1KTSB 1LDTT 4O9VA 3RXLA 1QB9A 1FPHH 1PQ8A 4RN6A 2BDYA 3QO6A 1O3MA 1BQYA 1ELGA 3V12A 1MKXH 1KXDA 2ZGBH 2AMQA 1EAXA 4DIHH 1TGNA 4AG2A 3A7ZA 1UTKA 4FUDA 3ZZ6A 1GVZA 3RMOH 1GHBG 4YO9A 3PMAB 1JRSA 4NIWA 2P8OC 3GCOA 1HNEE 1KXBA 1IQHA 1YCPK 1C5UA 1JWTA 1H9LB 3SHCH 1BHXB 2BVRH 2PGBB 1JMOH 1DVAH 3K2UA 3ZVCA 3BEFB 3M35A 2Y7ZA 1QRXA 4JMYA 5E0HA 1RIWC 2GDDA 1K21H 3ATKA 1SGFG 1C5OH 2J95A 2FXRA 5GWZA 4JK5A 4ZHMU 3N7OA 3V13A 2G81E 8KME2 5L2ZH 1ETRH 2VWMA 5HYOA 4ISNA 4XOJA 2PKSB 1IQKA 4K8BA 2C8ZB 2XBVA 3TPIZ 3BTEE 1QCPA 2JH6D 1QJ1B 1SMFE 1UO6A 4NZLA 1GBIA 4D76A 2ASUB 2ZFSA 4XSKU 3TK6A 2Y82A 1C4Y2 4OGXA 1MAYA 1Y59T 4K1SA 1O5FH 3DHKH 1RTFB 1TGTA 3HK6B 4BAKB 5HGGA 1FONA 1N8OB 2UWPA 3PWBA 2VIVA 3SZNA 1A46H 2PW8H 2BY6X 3TH2H 1O3PB 4ABAA 1P10A 5EXMA 3ZVFA 3BSQA 6LPRA 1BBRH 1VJ9U 2QC2A 3SV7A 2EA3A 1DXPA 2LNCA 4I31A 2H5DA 5F8TA 2WYJA 5EG4A 1TRYA 3SJKA 3SU0A 3BTWE 1BTXA 2BOHB 5EQQA 1QY6A 2YOLA 2D2DA 2EI6A 4Z0KA 1ELVA 1QGFA 3C27B 3ZVAA 1GCTC 4JZFH 1C2JA 4JZ1A 4Q7XA 2O9QA 2ZHQH 4X0WU 4ZKSU 1BB0B 1ELFA 1Y3XA 2FOFA 4FUIA 1J14A 1DWBH 1GBDA 2TBSA 2WUCA 1Z7KA 4ZH8A 2FOBA 2Z6BD 1V2OT 1P2OA 2J92A 2P3TB 5EOKA 3RXKA 1O33A 1TE0A 3RM2H 3A84A 4ABBA 4NWKA 1ZMJA 1MUEB 1A5IA 1GI1A 2A0QB 1W13U 4X6OA 3TJNA 4AFQA 1AO5A 1AN1E 3KGPA 2SGEE 4X2XA 2FOGA 4WMEA 4Y8ZA 1E34B 1MU6B 2QY0B 5FCKA 1RIWB 2QA9E 1ETTH 4A6LA 4D9RA 1HJAC 4NSYA 3T27A 5G4BA 3RMNH 1ABIH 1IQNA 3NXPA 4F4OC 1CE5A 5EQSA 1D6WA 3VGCC 3KHVA 3GISB 3P95A 1S0RA 3LC3A 1MD7A 3HPTB 1JRTA 2W7UA 3QZQA 2HOBA 1DXWA 4XFQA 1QBOA 2ZFQH 1UMAH 2YNAA 1FY3A 3RU4E 3SUDA 2CGAA 1SGYE 2FIRH 4DY7B 1GL1A 2OD3B 2ZHFH 4U30A 4IW4E 2VVUA 1UHBA 1SSXA 3P8GA 1YYY1 5T6DA 2W26A 1CT2E 1O5AB 3M36A 1O3KA 4WY3A 4YESB 1AZZA 2HRVA 4GUXA 4X6NA 1W10U 1YPGH 4CH2B 2C8XB 3URCA 2JETC 1T8OA 1WV7H 3RMLH 4MG3A 4YT6H 1CA8B 1SGEE 1BTYA 2AIPA 3A8BA 3BTFE 1YPEH 3RXAA 1V2PT 2WPIS 4ZHLU 5C1XA 3A8AA 1IQIA 1GCTB 2ZQ1A 2GDEH 5C2ZA 3C1KA 1TRMA 2VVCA 1EZSC 5SGAE 4UD9H 1XMNB 1SI5H 5DK1A 3OX7U 4X1SU 3ZZAA 3UQOA 2AFQB 1LKBA 1EATA 1ZTLA 4OS1A 5E8EH 1RJXB 1ACBE 4YOIA 1P9UA 3NKKA 2OBQA 3T26A 1AI8H 1C1OA 1MKXK 1V2JT 1C1UH 1O5GH 2P3FH 1Z6JH 1V2KT 1WAYB 5EPNA 2FI5E 1THRH 4ISIH 3ENSB 4MNYA 2QXIA 1O2NA 2SNWA 3HGPA 1HJAB 2XWAA 4WXVA 1QJ6B 1NS3A 1T8MA 1EZUC 1O2GH 4MPVA 2OC8A 3GYLB 1W2KH 3MYWA 2WYGA 2V35A 3HATH 2GZ8A 3VGCB 2ZCHP 6GCHF 2ZA5A 2TGDA 2QXHA 3RC4A 2VJ1A 2PGQB 3RMMH 3MU5A 4AYYB 3MWIU 3QZRA 1WQVH 5FX6A 3UNSA 3LH1A 2JKHA 1SGFA 1GDQA 5A8XA 1HV7A 1GJ4H 3E0NB 4TY6A 3SN8A 3SJ8A 1KSNA 1C5VA 1O2RA 5HXFA 1YPHC 1EB1H 3TJOA 1O3AA 2XTTB 1Y8TA 4KP0A 1MU8B 5K7RA 3DA9B 2NWNA 1Q31A 4WVPE 3GDSA 1TBQH 2EEKA 3UWJH 5I46H 1PPCE 7LPRA 1NZQH 3MNCA 2Z9GA 3LGVA 2BD2A 1ELDE 5EPYA 3UY9A 1TNHA 4B1TA 4X1QU 2A4OA 2FS9A 4FU7A 3LPRA 1QR3E 3BTHE 5L2YH 1DE7H 2FX6A 3F9GA 1PPFE 1P03A 4INHA 1O30A 3AVZA 4Q7ZA 1GBFA 1TX6A 2ZTZA 2BLOA 1HIAB 2V3HH 4Y79A 4FUHA 4BXSA 1ZPZA 2Z3CA 1IQGA 2ANKH 3SHAH 3GCHC 3RXVA 3PMJA 1HAGE 3GOVB 3RU4T 1GMDF 3RXGA 1AFEH 2QV1A 1O2WA 1P04A 1QRWA 4K1EA 4CR9A 1V2TT 1UK3A 1BRUP 1ARCA 8GCHG 1TFXA 1NFXA 1C2LA 4AX9H 1GBJA 2FO9A 3EA7A 1FY1A 1G2LA 1UVPA 5T3HA 4DG4A 3VB5A 3O8DA 1CT4E 1C5XB 3SUFA 1PFXC 1V2QT 2AERH 1A4WH 1ELBA 1FXYA 4FXGH 1JIMA 2Y5GA 5F8XA 1A7SA 3TLOA 2BYAX 2PUQH 2BHGA 3F6UH 1O3DA 2ZU5A 3UNQA 2Z9LA 4K2YA 2VNTA 2G8TA 1OWHA 5EQRA 3RXOA 1PQ5A 5FPTA 2FODA 4CRDA 3STJA 3T5FH 1IQFA 4D7FA 3VPKA 3UPEA 4D8NA 2A4GA 4K60A 3M7QA 5BRRE 4SGAE 4AN7A 1BT7A 1TOMH 1BJVA 5GIBA 4NA9H 2GCTC 1PPHE 2BLVA 1V2ST 3ZZCA 2XC5A 1SQTA 3BTGE 1GI5A 5FPSA 4CRFA 2O8WA 3A82A 1ELCA 2ZDNA 1BMNH 1QL8A 2FDAA 1LCYA 4GSOA 1YPKH 3KQCA 3P8OA 1QURH 1AE8H 2UUFB 1AD8H 3U9AH 1MMJN 2CV3A 2ZHWH 1O5CB 1GDNA 1ID5H 4Y11E 1C4U2 2TGAA 2WPJS 1T8LA 1INCA 3TNSA 1ELEE 1BMMH 1DLEA 2ZCKP 2AGIX 1PPZA 3GCHB 2O8TA 3PO1B 4ISOA 3VB7A 3OSYA 4IS5A 3A83A 1SPJA 4NFFA 3QTOH 1EX3A 2C3SA 2A4RA 1VZQH 1ZMLA 3NZIA 1OS8A 1J9CH 1TA2A 4IGDA 2XNIA 4Y7AA 4BOHA 1P3EA 4JZIA 1K1IA 3RXHA 2XCNA 1VGCC 1ELAA 1O2PA 1UJ1A 5CE1A 2ODYB 2BQ6B 1SFQB 1EZQA 1UVOA 3BTTE 2FTLE 1WBGB 1DWDH 1RXPA 2F3CE 1VCQA 2PTNA 2STAE 1MTVA 3T28A 4WH6A 1OX1A 3UNRA 1HAYB 2Q1JA 1FY8E 1C2KA 1P8VC 2BZ6H 1RS0A 1G9IE 2R2WU 1G3CA 1O2MA 4I8KA 4TPIZ 7KMEH 1TWXB 1BA8B 3QDZB 3GY2A 2A31A 2B0FA 1ZHPA 2J4IA 1CA0B 2NU1E 1GI3A 1N6YA 1PYTC 1K1LA 3LGIA 5JBAS 1HUTH 2GCTB 3LH3A 1EJMA 3E3TA 3RM0H 2ZHEH 4Q2KA 5EODA 1O2KA 3GCTF 4YZUA 3ZVBA 1HJ9A 1J17T 3SU4A 1JXPA 2ZDKA 4SGBE 1O38A 1TPSA 3RXJA 1VR1H 1GPZA 3A7WA 3KQEA 5GXPA 3UUZA 1C2EA 1P2QA 1DOJA 4DCDA 1SLUB 4XDEA 2XXLA 4NIVA 1O5BB 3TGIE 4AOQA 2FX4A 1BBRE 1MZAA 1SGRE 2XWBI 2H6MA 5JPMH 1BTZA 2BOKA 1DFPA 3KF2A 5A0CA 2PKSC 1WU1A 4HTCH 3I78A 4BNRA 1WTHD 2V6NA 3FZDA 1SOZA 1GVLA 1P12E 3SU2A 1OXGA 3QLPH 4WF8A 3MH7A 4MDSA 1Z8RA 3SW2B 3TK5A 1AGJA 1XXDA 1BDAA 1C1TA 2J94A 3NWUA 3PLPA 3UQVA 2ZDVH 3EYDA 1C2HA 3VB4A 1GWAA 1QTFA 2FLBH 1C1VH 3LDXH 6ESTA 1KXAA 1BCUH 1DICA 1EAUA 1FZZA 1P2MA 3U69H 3ZZ3A 2KAIB 1DITH 3ATMA 4BAOB 4KTSA 1O2YA 4WWYA 1EPTB 1K1OA 1UTLM 2C8WB 1J15A 1K22H 1QA0A 1QJ7B 1UTMA 3UOUA 1C2DA 1M9UA 1O3OA 1YLDA