3F2HA

Crystal structure of the mercury-bound form of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
208
structure length
204
Chain Sequence
MKLAPYILELLTSVNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCSHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 204
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f2hA00
5C0UA 5C17A 3FN8A 3F2GA 3F0OA 3F0PA 5DSFA 5C0TA 3F2FA 3F2HA
chains in the Genus database with same CATH superfamily
1NRPH 1XUFA 1P9SA 4TPIZ 1DPOA 1PFXC 1A61H 2RA3A 3GY8A 4MNXA 2YMSB 1V3XA 1D6WA 1EOJA 4I32A 1GJBB 2ZPQA 2PGQB 3BSQA 3SOSA 3M7QA 2F91A 3CNRA 1GMDF 1T8NA 2EA3A 3RC5A 3ZZ7A 3HGNA 1XUJA 3UQOA 2ZIQH 1ZRKA 2FESH 2BX4A 9ESTA 5DKMA 1FNIA 2O9QA 2FMJA 2A4OA 1GMDG 1K2I1 1O2NA 4Y8YA 4HZHA 1JBUH 1C2FA 3T62A 1J8AA 3M5MA 4IMQA 3ATWA 1FJSA 4JZFH 4WMFA 1EP6A 1LHDH 3RU4D 5A0CA 1FQ3A 1FONA 3M5OA 3UR9A 3GCOA 3A83A 3RXRA 1A0HB 3UUZA 5DSFA 3B9FH 3SBKA 2BQ6B 4KTCA 4E06H 3U69H 2ZP0H 5HIZA 2VIOA 1UTPA 5EJLA 1S6HA 3H5CB 3MNSA 3STJA 2VIDA 4TY6A 1O5CB 1WSSH 1GBFA 3ATMA 2PR3A 3P8NA 4X6MA 2ZHFH 2ZHEH 1HAZB 4LOYH 3KL6A 3MWIU 1MUEB 2A4QA 3SHAH 2G00A 1Z6JH 1TLDA 1FIWA 2VGCC 1GGDB 4DCDA 1O2QA 2A7CA 2V3OH 2CHAB 3VGCC 1IQJA 2PV9B 2BY9X 6CHAC 3A7YA 4ABAA 1EJNA 5EW2H 2OTVA 1YCPK 1VITH 5EG4A 2PKAB 5JBAS 1O2RA 1NTPA 1K1JA 1GVKB 3KGPA 1IHSH 1SHYA 5E2OA 4NIXA 5IDKA 1KXDA 4NIYA 1ANBA 1GJ9B 3RMNH 1VGCB 2HVYB 4IGDA 2FODA 3BTFE 1AHTH 3CS0A 3UR6A 2SGEE 4Q7YA 1QJ7B 2FO9A 2YNBA 3URDA 1P0SH 1O3MA 3TPIZ 3ZYEA 1G3CA 1D3TB 3K65B 2M2AA 3K9XB 1SLXB 1KSNA 3SNEA 2J98A 4UEHH 2VNTA 1FY3A 3UOPA 1CBWC 1IQIA 5C1YA 2SGQE 3UY9A 4I8LA 1ABIH 4CH2B 2PP6A 3A85A 3LDXH 2GT8A 5E8EH 2H9EH 2ZGCA 1G2LA 2JJ2D 3QTVH 2K1QA 1ELFA 4CRAA 2RCEA 2QN5T 4CR9A 3BTEE 1W13U 1C1VH 1ELGA 1GL0E 3RXCA 3M3VA 3CS7A 5F03A 1F5LA 4AC9A 1TGBA 2TGPZ 3SU6A 1EZUC 4B2CA 1NU7B 1GBHA 3RMOH 1THPB 2F43B 2ZTXA 1V2KT 3BEUA 4AFZA 1W0ZU 2BB4A 3ZVGA 1S83A 1XVMA 4UFFH 3QZQA 1OKXA 3A88A 1A0JA 3NUMA 2ZPSA 3BEIB 3UTUH 1PQ7A 1LMWB 4YLQH 2QC2A 1V2NT 5L30H 1XVOA 1RIWB 1UVOA 1EUFA 1NO9H 2BOKA 4BTTB 2KAIA 3S7KB 1C4V2 2AH4X 2VIPA 2GV7A 1O31A 5GIBA 3MQKC 3SJ9A 5LPRA 2D1JA 3MI4A 4TY7A 1EB1H 1HCGA 4MPVA 1YPGH 2QXGA 1H9IE 1BRBE 1HLTH 4NIVA 1C9PA 3M3TA 3RXDA 3ZZAA 1C2IA 4NIWA 1HNEE 3C27B 3AW0A 1O2WA 5DN6D 3U8RH 1ZHPA 2ZFSA 2XWBI 1KDQA 3F2GA 3O8RA 1UK4A 2PSXA 3KQCA 2AGIX 1Z8IB 1EJAA 1AY6H 1RRKA 1O2SA 2KR7A 1ZRBA 1LTOA 5JB9S 1AWFH 6ESTA 3DD2H 4FETA 1Y3UA 2ZQ2A 4WXIA 3OX7U 4IC5A 1NS3A 2HNTF 1GCDA 1UVTH 5JBTA 1O3JA 1B0EA 3A89A 1SPJA 1V2QT 3ESTA 4K3JA 3PV4A 3SV2H 2R2WU 2G81E 2GV6A 4INKA 3ZZBA 1DE7H 4X8VH 4DT4A 4GCHF 2WPJS 4ABFA 1HAVB 1Y5BT 4Y71A 5JBCS 3RXSA 3O8BA 3SUDA 1RD3B 4X2VA 2GMTC 5I25A 3MU8A 4Y11E 2HLCA 1COWD 3T5FH 1OWEA 3T26A 1PPZA 1BHXB 1ZJKA 2HOBA 2H5CA 1O33A 3P6ZB 3LGIA 5HMAA 1O30A 4DGJA 1GJ7B 1JXPA 3HATH 2BDHA 3TK5A 1THRH 4B6EA 3I29A 1MZAA 2F3CE 1G9IE 1TOCB 2PLXA 3A8BA 3UWJH 4FUHA 5FPYA 4JCNA 4CBNA 1YCPH 4F55A 4B71A 4FU9A 1AKSB 1P2OA 1BQYA 3ZZCA 1DLKB 3HKJB 4ZKNU 2ULLA 4DIHH 1XMNB 3N7DA 2BVXH 5E0GA 1FZZA 2XC5A 1H8IH 1QTFA 2VGCB 3LGVA 1A5IA 2BD2A 3VGCB 3SJIA 1FIZA 1AFEH 1QGFA 3S9AA 1L1GA 1KXCA 1J9CH 6CHAB 3IITA 3S7HB 1T8OA 1DX5M 3F9FA 3ZZ4A 1GBTA 1HRTH 3PYHA 1SSXA 2OC0A 1O2ZA 1TBRH 3RXJA 1C5LH 1EASA 3URCA 1O3NA 1GWAA 1UK2A 2ZCKP 3TK6A 3UREA 1AVGH 2OXSA 1DXWA 1TABE 2Z9KA 2A5KA 1ZTLA 1O2KA 1Y3YA 1A46H 1OWJA 2GCTC 1ZTJA 1INCA 4YOIA 1EXFA 3VPKA 1O2JA 1O2GH 1PJPA 2V35A 3M3SA 4I8JA 1RFNA 4RT0A 1AE5A 4Y10E 2PWXA 1U6QA 4MVNA 1SMFE 1JIRA 1KXEA 2OBOA 1NZQH 1TNKA 4ABGA 3SUEA 3LT3A 3GOVB 1A3BH 3UOUA 3F2HA 2H1UA 1F2SE 4YZUA 4B75A 1TA6A 1CBWB 1TRYA 2ZU2A 4YESB 2F9OA 5DO4H 4BAKB 4OS5A 1P12E 1H8ED 4ABEA 2QA9E 2GGVB 4MLFB 2ZGXH 3PM3A 1MCVA 1QIXB 5BRRE 3PWBA 4MQAA 4Z6AH 1AUJA 3TH3H 2FOFA 2GZ9A 1G30B 3HGPA 4TWYA 5GJ4B 4DT7B 2QF5A 5J4QA 1C2LA 1P2MA 1O3FA 1XXDA 5C17A 3SNDA 2DE9A 1AVXA 1BHXF 2AS9A 3ZZDA 5C1UA 4X1NU 1J17T 2Y7XA 1NRQH 2WV4A 3QK1A 4ZHMU 4AFQA 5EQSA 2CN0H 4XD7D 1BB0B 1L1JA 5DP6A 4OGYA 5EU8A 2QF3A 1ESAA 4MPWA 1SGTA 1V2WT 2Z9GA 3VXFH 1QL7A 3RM2H 2EI8A 3F68H 2TGTA 3A86A 3Q76A 3U1JB 4NG9H 3V0XA 4AOQA 1WV7H 3MU1A 4JYTA 5F8TA 3RXIA 2TRMA 3NPSA 1G3DA 5F8ZA 2FOAA 3GY2A 3A87A 1QB9A 1GBLA 1PPCE 3BG4C 2VVCA 1Q31A 2J34A 2FYQA 2F9UA 1SGNE 3PB1E 2XWAA 5DP5A 4NFFA 3UFAA 3PLBA 1EZXC 2BVRH 5H4IB 4RKJB 2L6OA 4ZKRU 2ZZUH 2ILNA 1Z71A 3SV7A 3HK6B 1RTFB 2EQNA 3PTBA 4GAWA 1FN6A 5F53A 1AWHB 3SJ8A 1LHGH 1O36A 2HWLB 1C1RA 4M9FA 4X6PA 1GMCG 1O3GA 2G51A 1C2DA 2O8LA 1V2OT 3PMHB 2PSYA 1C5OH 3RUOA 1ZR0A 4I86A 2GMTB 4FU8A 1WDIA 1BRCE 2W6ID 1OP8A 1W10U 2W5EA 1E34B 5C67A 5C0UA 3MO6A 4H42U 2WUCA 2ANWA 4HGCA 5PTPA 4K8BA 2TGAA 1PQ8A 1UK3A 6GCHF 2LP6A 3NK8A 2A31A 3U8TH 2AHME 3CP7A 2C8WB 2XC4A 2YMSD 2BY8X 1TBZH 1XUGA 1E37B 1T31A 4AX9H 6GCHG 4ABDA 2Z3CA 1WBGB 4A7IB 3ZV9A 5TCCA 2VINA 1DS2E 4B74A 1LVOA 2AMDA 1C5PA 3SU0A 4U30A 1TNIA 4X1PU 2AGGX 2KZ4A 4FUEA 4AN7A 1HDTH 5DJ7A 5HKKD 1JMOH 2J98B 2Y5FA 1NRNH 1V6DA 1E79D 4INHA 2C90B 1GJ8B 2B7DH 2A5IA 4WF8A 4AG2A 4AFSA 1QRZA 1GHXH 2GCTB 3OSYA 4XBBA 2G55A 2BDGA 2XNIA 1SG8B 2VIWA 2EEKA 1NU9A 2WPIS 1AI8H 1HPGA 4YOGA 5FXLA 1P2QA 1DITH 2JH5D 1TFXA 4KGAA 3OU0A 4U32A 1WXRA 2A7JA 2ZGJA 4UFEH 1MBMA 1O32A 3WW7A 1ZLRA 4X6OA 1HAGE 1BBRE 2L74A 1CHOG 2RG3A 1C5ZB 1W7GH 1BTYA 1ELBA 1FY5A 1L2EA 1RS0A 3OE7D 4A1VA 4TPYA 5IYTA 1BTPA 1XKBC 1KXBA 2BVSH 5E0HA 3F2FA 4BAQB 4BXWA 3G01A 4YT7H 3Q77A 1SQRA 2P93A 1CVWH 2F83A 3SNCA 3RXVA 3L6PA 4VGCC 3DSOA 2P94A 1AB9B 2QGRA 4GPGA 5AF9H 5C3NA 2H6MA 3LOXA 1P8VC 1K1OA 2ZG0H 1T8LA 1BMMH 2A5AA 4WH6A 4Y0YE 5FPSA 3FN8A 2ZF0H 2JH6D 1QY6A 4KTSA 2FEQH 1KDQB 1B0FA 2OBQA 3PRBA 4H6SB 5GPIB 1AVWA 3SNAA 4OS1A 4O3TA 4B73A 1BA8B 1KTSB 3ENSB 1SGQE 1HJ8A 3LC3A 3NZIA 1KIGH 1Z8GA 1BDAA 1SQAA 1KXAA 4FUBA 1TYNA 1GVZA 5JDUB 2DUCA 2GVFA 3MOCA 3BG4B 2O8MA 3RXBA 2C3SA 5AHGH 4A1TA 4X8UH 4ABJA 1GI0A 3MMGA 2JDID 4AYVB 1MQ5A 3KNXA 4JYUH 1LVMA 3NXPA 5CMXH 2GZ8A 3D23A 3A7XA 3L3TA 1W2KH 1Q3XA 1SGFA 1MMJN 1YPLH 2A2QH 1FPHH 2FX6A 2GZ7A 5FCKA 3SGAE 2ZDKA 4JK5A 4Y7BA 1TGSZ 2Z3EA 3E3TA 3MNBA 3F9HA 1UHBA 4KP0A 3RXUA 3GISB 3LJJA 3PLPA 1WTHD 2XW9A 2BD4A 1NFXA 1NPMA 1HAPH 3UAIC 5T1VA 1QHRB 1E38B 1O34A 3RXEA 2QF0A 1PQ5A 2Y6TA 1C4U2 1DFPA 3UIRA 3S9CA 1GBJA 3GY3A 1G3EA 1P3CA 2HNTE 2R2MB 2ZC9H 1C5XB 4U01A 3MO3A 1O3AA 3BF6H 4GSOA 2Q6GA 5A09A 1VKYA 1WQVH 3ODFA 5A0BA 3FAOA 1GG6B 1MTNC 4OGXA 4MNVA 3BN9A 3E0PB 1CA8B 1C1UH 3T27A 2FS9A 1P3EA 1V2TT 3LGYA 1E1QD 1C5SA 4Q7XA 1S0RA 1BMFD 2FOGA 2G52A 3A8AA 1P2JA 2Y80A 4E7RG 4D8NA 1SL3A 3B23B 1V2ST 3NWUA 3BTGE 3GCHB 3PRDA 1W12U 1C1SA 1L0ZA 1HIAA 3SV6A 3V3MA 5EIYA 5EJ1A 1BJUA 2P8OC 1XUHA 2Y5GA 3OAAD 4FUJA 5JYIA 1AO5A 4TWWA 4OS4A 3U1IB 1UVPA 2BTCE 1P01A 2ZFQH 1D6RA 1QJ1B 1J16A 3FVFB 2ZU5A 4Y79A 2V7QD 3E8LA 3SUGA 5A0AE 1AD8H 4CHAC 8KME2 4P00A 1OHHD 5TCAA 3U98H 4YM9A 2FOHA 2G5NA 1LO6A 1O2YA 4ZAEA 1AN1E 2BDAA 4K1TA 4A1XA 1BT7A 2I6SA 4B76A 1DICA 1HJAC 4ABHA 2SGPE 1F0TA 3STIA 3U9AH 1P57B 1MU8B 3S69A 5FX6A 1Z1JA 1BBRH 1E0FD 4VGCB 3BTDE 2RDLA 4KTUA 1OS8A 2UWPA 2BDCA 1F5RA 1SQOA 5FL7D 3RU4E 1AZZA 4UD9H 3DCLA 5KGOA 4ISNA 2Y7ZA 1ZGVA 2J5UA 4FOUC 1EB2A 3M5LA 2H9TH 4XRNA 3LH3A 1QQ4A 1WOFA 1EPTA 3ZV8A 5EPYA 2Q6DA 1V2UT 1MU6B 1Z1IA 3JZ1B 1FY4A 1UW7A 1MH0A 1TGCA 1FPCH 1O3LA 2FI5E 2OQUA 1ZHMA 1D3DB 1W3CA 4I8GA 4DVAU 2ZI2H 1ABJH 3MNXA 1FUJA 1DWCH 2PTNA 1BTUA 2KFWA 3MYWA 1GBMA 2PKSC 1ZPBA 1K1IA 1K1MA 3WWBA 1GI6A 4MDSA 2GT7A 2WZQA 5LPFA 3AK5A 4AORA 1V2JT 4ACBA 5FX5A 1PYTC 3SGBE 4I31A 5F6MA 1O2LA 1S82A 1OPHB 2UUYA 3TNSA 3ZZ9A 1Q2WA 1M9UA 3M35A 4JZDH 4NA9H 2LNCA 1DWEH 2BY7X 2XBYA 1CSOE 1P02A 2QCYA 3K6YA 1F92A 2HPQH 4IN1A 2VH0A 4A92A 1Y3XA 4ISIH 4O97A 1LHEH 1C5NH 5K7RA 1RTKA 1YM0A 2J4IA 3HPTB 5ESTE 1UTQA 1DOJA 3A82A 3TH4H 2Q6FA 4OM9A 2SGFE 2CJIA 4FU7A 4DY7B 2F9NA 1O5AB 2XXLA 1PQAA 4ZMAH 1W0KD 4JK6A 2W3IA 1K9OE 4Q80A 2CXVA 4ABIA 4X1QU 2Q1JA 4NSYA 3KQBA 5DK1A 1L4DA 1TPOA 4ISOA 2OC7A 2UUKB 1HFDA 1CO7E 4ZKSU 2C8YB 1BRAA 2FOCA 1ESBA 2C8XB 4MNWA 1O3PB 1GHWH 4X2XA 1BRUP 1VJ9U 2XYAA 3TJOA 2WPKS 1TQ0B 4BAOB 1SGPE 2B8OH 1LHCH 2OLGA 5EXNA 1ELAA 4H4FA 3TNTA 1O3DA 1MTNB 3WY8A 1JRTA 3ATLA 3ZVAA 1ZMJA 2ESTE 2THFB 2ALPA 1ANCA 4AZ2B 2ODPA 2ANKH 4NWLA 2O8TA 3QDZB 2BQ7B 5G4BA 4UFDH 3SNBA 5J4SA 1C5WB 5DPAA 4HI3A 4O9VA 5LGOA 2ZECA 5L2ZH 3A7WA 3GCTG 4D76A 9LPRA 1VCQA 2WPHS 1K1PA 3M7TA 2ZGHA 5EXLA 1O3OA 3SN8A 4ISHH 3RP2A 4ASUD 1F0SA 3UNQA 3UPEA 1H8HD 2P8OB 2J38A 3FANA 4CRBA 4Z0KA 1O2UA 3TU7H 4GHTA 3EA9A 1C2MA 2Z6BD 1GBKA 2Z7FE 3RM0H 2K0QA 1SR5C 3V13A 4B6FA 3BIVH 2AFQB 1ELVA 1TPAE 5K0HA 3E1XB 4NSVA 3TK9A 1CU1A 4DJZB 1DSUA 3OTJE 5L2YH 4CHAB 1MBQA 4R0IA 1S6FA 2OP9A 1O35A 5DGJA 1KTTB 3OEED 5CDFE 2XCFA 2K8IA 1FAKH 1HAYB 1HJAB 3Q00A 2PGBB 3DFLA 2W26A 1ELEE 1GL1A 4XSKU 4RI0A 4CRFA 5LH8A 4I7YH 2B9LA 3ZZ3A 3GS9A 2VWMA 3EDXB 2XBXA 1FI8A 1KYNA 1AIXH 2NU1E 2PUQH 2WV9A 2ZU1A 3QGNB 4YOJA 1GI4A 2ZU3A 3SO3A 2IJOB 4RN6A 2GP9B 3SJOA 1BJVA 1FMGA 1NM6A 1C1WH 3BV9B 1SLVB 1SOTA 1LCYA 5DP3A 4ZH8A 4HFPB 1QNJA 1N6YA 1TMTH 3MNCA 1LQEA 3QUMP 2BXTH 2Y82A 3TVJB 3BTHE 1A3EH 1THSH 3NCLA 2C8ZB 2LELA 1EAXA 2H2ZA 2J92A 2QYIA 1QA0A 1YY3A 2PKSB 5FPTA 1HAHH 4Y8XA 2J94A 1O5FH 1O3KA 1W7XH 1AB9C 4Y0ZE 7GCHG 1GI3A 1UHBB 3BTME 1QL9A 3V7TA 4BXSA 1OWKA 7ESTE 1SLWB 1P10A 3ZZ5A 2STBE 1SGIB 4X0WU 2ZFRH 4I8KA 1TMBH 2FOMB 2LPRA 1SKYE 1YBWA 1A5HA 2UUJB 1Z8RA 1VR1H 5CHAC 3FP6E 2FI4E 1KMHB 1S85A 4TT3D 1SGDE 2FOEA 1TONA 3JZ2B 4IBLH 2H9HA 1EX3A 1O38A 3A84A 4GVUA 1EATA 1P2NA 5GCHF 1DWBH 3N99A 3F9EA 1TWXB 1C5YB 3T28A 3RXKA 1NY22 1GVLA 1O3EA 5A2MH 2ZDLA 4UONA 2BLVA 1GMCF 2HGTH 3F1SB 1Y5UT 4BNRA 1JWTA 2AIQA 2H5DA 5GCHG 3SZEA 2JIZD 1TQ7B 4NZLA 1ELDE 3SZNA 2BXUH 4K2YA 2VWOA 1QL8A 4ZXYH 3T25A 2CGAA 5EW1H 2PUXB 3N7EA 8GCHF 1TOMH 1EZQA 1TRMA 5EODA 2FP7B 1YF4A 1QURH 4ISLA 4CH8B 2NU4E 2SNVA 1BITA 3Q3XA 2FOBA 5ETXA 2NWNA 1ZSLA 1P2IA 1Y8TA 4J1YA 2XC0A 3ATIA 1X7AC 8GCHG 1XM1A 2BZ6H 4BOHA 4LK4A 2AGEX 1BTZA 1CGIE 4D9RA 1CE5A 4M7GA 1GJ6A 2GJGA 1NN6A 1YPJH 1CQQA 2WSSD 4K8YA 1SC8U 1BTXA 1D9IA 1C2JA 1BIOA 3P17H 4NGAH 3SV8A 1GI1A 2WPDD 3P95A 4O3UA 1UVUH 3ZYDA 3PO1C 5ESBA 1ACBE 1AQ7A 2IPQX 3FZDA 4ZUHA 1DY8A 1GG6C 4HG6A 4B2AA 2HALA 1HGTH 2UUFB 5ABWA 1G2MA 1YPHE 3Q3KA 2Z3DA 1V2MT 4FUGA 1Y3WA 1FX0B 1B5GH 1TX8A 2D26C 3EA7A 4OS7A 1XX9A 2A0QB 1UTLM 1SB1H 2J97A 5CE1A 3ZIAD 3BIUH 4MNYA 3GICB 1K28D 1SGEE 1MKXK 4Q4LA 1OSSA 1TPPA 2R9PA 2XBWA 4FUFA 3GCHC 1EPTB 2EY4C 3TGKE 4FUIA 2QV1A 4IN2A 4WXVA 1UTMA 1EJMA 1O39A 3PMBB 4MTBA 1CHOF 4Y7AA 1WQSA 1A4WH 2BD7A 3Q3YA 2W3KA 1GBCA 2BD5A 4XFQA 2VVUA 4Y6DA 1HAVA 3F3BA 1OX1A 3RLYH 2BLQA 1NC6A 1ZSKA 2WPLS 4U2WA 4LXBH 1DUEA 3TJVA 1GDNA 3RXHA 1C5UA 3E91A 1H4WA 1UO6A 3RC4A 3M7UA 5B6LA 1KLTA 1SGRE 2ZFTA 1J15A 2ZDVH 2HRVA 1K1LA 1D3QB 1GJCB 2FTMA 4XBDA 4ZHAA 2OUAA 3ODDA 1C2HA 1L4ZA 2KAIB 2FTLE 1OYQA 3I78A 3EQ0H 1GJ5H 2HNTC 1TA2A 4ZROA 3ITIA 2XCNA 5HYOA 2SNWA 2XRCA 1ORFA 5DP7A 1XUIA 3O8CA 3SQHE 3QX5H 1N8OC 5T6FA 4ABBA 1HUTH 1T4VH 2C93B 1FLEE 3MHWU 3NRLA 2HPPH 4K69A 3SI3H 1C2GA 2IPHA 3GY5A 2ZNKH 2OD3B 3SV9A 2BZAA 1HXEH 1YLDA 2ZU4A 3NKKA 5CHAB 4B2BA 4A6LA 2AEIH 3DFJA 2Z94A 1IQFA 2YNAA 3P92A 3IG6B 1IQEA 1HYLA 1MQ6A 3P8OA 1CT0E 4D9QA 2M5TA 1G3BA 5E0JA 5C5OA 1UCYE 1O2XA 3GDUA 1OWDA 2SGDE 2A2XH 4THNH 1K1NA 3RXFA 1KXFA 3H7TA 3E6PH 2DE8A 3M61U 2TIOA 4H6TA 3RXOA 3EGKH 4GLYA 3S0NA 1N6XA 1O3CA 3MTYA 2OCVB 1ELTA 3PWCA 2J95A 2QXJA 3OY6U 3P8FA 3KYGA 2O8UA 1MTUA 4SGBE 1YWUA 1DUAA 2AERH 1N1LA 4JZEH 2TGDA 1ZMNA 1C1PA 5EGMA 3A8DA 2UWLA 3SW2B 5HXFA 1YC0A 1FN8A 2I6QA 3DUXH 2ZHQH 1GDUA 3O8DA 3RXMA 4BTUB 3K2UA 5C1XA 3SYJA 1C2EA 1T7CA 2GX4A 1O5EH 5C5NA 4YT6H 2G5VA 7KMEH 3LKWA 4ZKOU 4Z1MD 3MO9A 1TRNA 2BD9A 4CRGA 3B8JA 1VZQH 2ZDNA 1HJ9A 2ANMH 2EI6A 1L1NA 4F49A 1Y3VA 1YYY1 1UCYK 2VB0A 5GXPA 3QTOH 3KQDA 2ZCHP 5EXMA 1D4PB 1SVPA 3EA8A 1A5GH 5B6OA 2KCAA 2GDEH 1W14U 3PV2A 1ELCA 3VG8A 1MKXH 2CF9H 3PO1B 4NCYA 1SOZA 2BM2A 1T8MA 1IQHA 2QXHA 3A80A 3TJNA 4AYYB 1OYTH 5FAHA 4HTCH 2JKHA 4P02A 2BD8A 1TGTA 2V6NA 1WCZA 4X2YA 3F0PA 1EOLA 3AAVA 1ZOMA 2PTCE 3ZVDA 3QO6A 3VB4A 1SLUB 5IK2D 1CHGA 2P16A 2B5TB 2FS8A 3ZVCA 4Q7ZA 2WHXA 2FLBH 1UTNA 1EQ9A 1S6LA 3GYMA 5T6GA 5FCRA 1SFIA 2JETC 2XOKD 2KCPA 2J2UA 1Z7KA 2NU2E 1P06A 3FOAA 3LPRA 1YLNA 1MKWK 5HGGA 1GDQA 2ZO3H 1S0QA 3P70B 2WINI 3RC6A 1O2HA 3UWIA 1HAOH 3ELAH 1AFQC 3VFEA 4X8SH 2PFEA 4D7FA 1ZJDA 4XE4A 3QGJA 1WAYB 1O2VA 1GBAA 4IMZA 1VITF 1GMHF 1DANH 2NU0E 5KECA 2FLRH 1E35B 3BTKE 3GY7A 4DG4A 1NT1A 4MPUA 5EOKA 1RJXB 5C2ZA 1QQUA 2AMQA 1AE8H 5FBIA 3VB5A 2GCHF 1GHYH 1AMHA 1ZMLA 5DG6A 1QRWA 4NA8A 4IS5A 1QBNA 5JPMH 1DDJA 1VITG 5SGAE 1GMHG 3FP7E 1IHTH 1SGYE 1C1NA 2G4UA 5I46H 3TH2H 2GCHG 2ZPRA 1LVBA 4IC6A 2BX3A 2ZGBH 1HV7A 4O03A 5HM2A 2CMYA 3EYDA 3BTQE 3D65E 4AB9A 1N8OB 1DVAH 1MABB 2STAE 2F4LA 3MH7A 1BMAA 2ZDAH 2P95A 1NFWA 1RGQA 1KLJH 2R0KA 2ASUB 3OFND 2WV5A 1GHZA 2IN2A 1XKAC 1K22H 1SHHB 1O37A 1EAUA 1UTKA 1V2PT 1GBIA 3PLKA 5T3HA 8LPRA 1NFUA 2BOHB 1GJDB 5TJXA 1BUIA 1OXGA 1T32A 3UQVA 3BEFB 2EI7A 4Q2KA 3SU1A 2P3TB 4FUCA 4JZIA 1V2VT 2A4RA 4K1EA 2A4GA 3SU4A 1C5TA 3KHVA 3VB7A 5AFYH 2FWWA 1OWHA 3AW1A 3DT0H 4KKDA 3FFGA 3LGUA 8ESTE 1GCTC 3GCNA 4X1SU 1CGJE 1A2CH 2VIVA 4YTAA 1P9UA 2W6JD 1BTWA 2BDYA 1UCYH 5A8YA 3VB3A 2P3FH 1JOUB 2KX4A 1H1BA 3SQEE 3RDZA 3MU5A 1SBWA 4TYDA 1W11U 1BZXE 1HAIH 2BDIA 3LGWA 4OS2A 3W95A 1GI7B 3R3GB 2HLDD 6LPRA 3SGQE 1C1TA 1PYTD 2WPMS 3RXLA 3TJUA 4GUXA 2VIQA 1UTJA 1F5KU 2NU3E 1TX7A 2OINA 1QZ8A 1ETRH 1O0DH 3E0NB 2J9NA 3ATKA 3ZVFA 1LPKB 1MAYA 3A7ZA 1DXPA 3V12A 5GWZA 3GY4A 1GJAB 2JH0D 2TBSA 3VEQB 1GBDA 4CREA 5HM9A 1FAXA 1C2KA 1LKBA 2QAAA 4ZXXH 3A8CA 3BG8A 1PPHE 1CA0C 1YPMH 1ANDA 1ZGIA 1MTWA 2ODQA 1YP9A 2BHGA 4XBCA 3CENA 2AMPA 3RMMH 2R3YA 4CRDA 4UDWH 4NZQA 1IAUA 3GCTF 4DW2U 1MKWH 4J2YB 4WY3A 1NFYA 4CBOA 3LU9B 1TNJA 2BY6X 2ZDMA 2B0FA 3S9BA 3ZVBA 2QE7D 2TPIZ 1C1OA 7LPRA 3QN7A 1GI5A 3KEEA 1F0RA 4WMDA 1C1QA 2FM2A 1E1RD 2ZTZA 2F9BH 1QB6A 1F7ZA 2JETB 1A1RA 1OP0A 1SQTA 5GDSH 1GJ4H 3T29A 1WUNH 4IW4E 3SHCH 4BAMB 4ESTE 3AAUA 1W0YH 4GCHG 3RXGA 2VBCA 5AVDA 3P8GA 1BCUH 2Z9IA 1WYKA 3TITA 2VWLA 1AFQB 3A81A 4I33A 4LZ1H 4F4OC 1ZHRA 4INLA 5DP9A 4DURA 3MH5A 3PV5A 4E05H 1QFKH 1TX6A 1A7SA 1SI5H 1XUKA 4B1TA 1YGCH 3FO8D 3SUFA 1G36A 3H09A 1EPTC 4YO9A 4AGKA 3C1KA 3SORA 1V2RT 1O5DH 1Y59T 3KF2A 1C5VA 3OYPA 4QT8C 4K60A 1O5GH 2BDBA 3EE7A 4UFGH 1LQDB 1MZDA 3AASA 1W0JD 4NA7A 2SGAA 1PPFE 5GNDA 3FP8E 1HBTH 4K5ZA 4DIIH 1EP5A 1Y5AT 1IQKA 2ALVA 2KCOA 5JBBS 3F6UH 1UVSH 4BANB 1GHVH 2GKVE 5EQRA 3PTNA 4ZHLU 2FXRA 5DP4A 1TNLA 3TGIE 1EAWA 2P3UB 2ODYB 4Q63A 1BMLA 4FXGH 1DSTA 3A7VA 1OOKB 1P2KA 7GCHF 1MTVA 3I77A 3RXQA 3UNRA 1QBVH 1F0UA 1GHAF 2G4TA 2QF4A 2ZHDA 1NRRH 1O3HA 4NWKA 5KEDA 3SU2A 2D2DA 2G8TA 2BYAX 4KELA 4XDEA 1K21H 2R3UA 2OK5A 2R0LA 1LPGB 1AZ8A 2ZHWH 3ZZ6A 1GHAG 1KY9A 3PMJA 1PPBH 4X8TH 1ZZZA 1VCWA 3FZZA 2ZKSA 1GCTB 2VH6A 3DSPA 1OWIA 1E36B 1YPHC 3LJOA 2VVVA 2A7HA 3T2NA 4ASHA 3RXPA 2WYJA 3GDVA 2PKAA 2FYRA 1PPEE 4TSFD 4ACAA 2QY0B 2ZCLP 4AG1A 3IWMA 1C4Y2 2FZZA 4RSPA 1GPZA 2V3HH 1S5SA 1DT2A 5L6NH 2A1DB 1TNGA 3R0FA 3TIUA 2EC9H 1ID5H 3MU4A 1HXFH 5F8XA 1MCTA 1QR3E 1O5BB 2RDEA 5A8ZA 4FVBA 3KIDU 4R8TB 2QIQA 1B7XB 3OEHD 3M36A 4AB8A 2PW8H 1DY9A 1ZPCA 3U28C 3LC5A 5BPEA 3W1EA 5C20A 1TB6H 3GDSA 2ZTYA 4E7NA 2Z9JA 2A32A 4WJG2 2F9VA 3TGJE 1ARBA 2FX4A 3VB6A 1YLCA 4Y76A 1FV9A 5C0TA 2CF8H 1QBOA 1VCPA 2Z9LA 1CA0B 1YKTA 4MG3A 2RFKC 1LPZB 1IOEA 3FKSD 2UWOA 1EFRD 2XBVA 1HIAB 3KQEA 3LIWA 1EAIA 4X1RU 2Y5HA 2SFAA 4UE7H 2FI3E 1QRXA 3DA9B 3GYLB 1XXFA 1YPEH 5FHTA 3SU3A 1BTHH 1TPSA 4WWYA 1O3IA 3VXEH 4BTIB 1TBQH 2PHBA 2BQWB 1NROH 2WYGA 2V3MA 2YMSC 1ETSH 4OS6A 4AGJA 5C94A 2BY5X 3MH6A 4F48B 1J14A 4PROA 3D49H 1O2MA 1W8BH 1WU1A 1T4UH 4RKOB 1NBMD 2W7SA 1PPGE 4XOJA 1MAXA 1DM4B 1O2OA 1OP2A 2VU8E 1FY8E 3KYFA 2OQ5A 4CRCA 1RTLA 5EJZA 4JYVH 3EE0B 2KCYA 5JB8S 2XTTB 1CGHA 1P11E 1UTOA 4D7GA 2ZA5A 2XNDD 3H7OA 1O2TA 1C1MA 1VJAU 4MPXA 1GI9B 2BMGB 3DSGA 3QLPH 1SFQB 4JMYA 3M37A 4CR5A 4GHQA 4A5TS 3HKIB 1SGFG 3K6ZA 4X6NA 2WUBA 2VWNA 1TNHA 1IQMA 3SU5A 2GD4B 2F9PA 1O2PA 4YXWD 1RXPA 1ZPZA 2FDAA 1G37A 1JRSA 2P59A 3PMAB 1BMNH 3WWFA 3MH4A 3UNSA 1P04A 2BLWA 3BTTE 2A45B 5EPNA 5AFZH 1ARCA 1CT2E 1ZYOA 4FVDA 4NFEA 1GBBA 3OY5U 2IOTA 2IJD1 1O3BA 2OC8A 3BTWE 3LONA 3MFJA 2BD3A 1GI8B 1H9LB 1GI2A 3L33A 1TE0A 3MU0A 2D8WA 1UJ1A 2ZQ1A 3KQ5A 3SJKA 1S81A 4BAHB 2ZFFH 1FY1A 5T6DA 3LH1A 5LPEA 1NRSH 1FXYA 3ZZ8A 1EZSC 3LGTA 3DHKH 1GGDC 1QA7A 1LVYA 2CHAC 5A8XA 1IQNA 1GBEA 3OTPA 2YOLA 2KM0A 4X2WA 1DLEA 2JJ1D 1WTGH 1ZSJA 2GTBA 2V0BA 1Z8JB 1C9TA 2C4FH 1P09A 3AVZA 5HIYA 2FPZA 2OC1A 3RLWH 5EQQA 3ZVEA 2CV3A 1AKSA 3N7OA 3TLOA 1A0LA 1NBME 1VGCC 1G32B 1GHBF 3KCGH 3KN2A 1JIMA 1MD8A 1AU8A 4JZ1A 1ANEA 3E16B 4RT1A 3RXAA 1P05A 3SI4H 1UMAH 4WH8A 4ZCNA 3U8OH 3A7TA 2BLOA 3QZRA 1LDTT 1LKAA 1ETTH 1GHBG 2Y81A 1MD7A 1V2LT 1CT4E 2AIPA 2AYWA 1BOQA 1TMUH 1ESTA 2O8WA 2FIRH 5FBEA 1MTSA 2CK3D 4AFUA 4SGAE 1DWDH 1C5QA 3GY6A 3D62A 1D3PB 1YCPM 2RA0A 2QXIA 1S84A 4YLUA 1KLIH 4FUDA 1TIOA 1TALA 2ZEBA 4K1SA 4Y8ZA 2HVXA 5E2PA 1NESE 1C5RA 5CHBA 1IQGA 1BBRK 4WVPE 3PROA 1AUTC 1Z6EA 1SGCA 2W7UA 1C5MD 4I8HA 3EAJA 1K0HA 2ANYA 3RU4T 3F9GA 1O2IA 1H9HE 2ZFPH 3RXTA 3HK3B 1EKBB 2GDDA 1TGNA 1H8DH 4WMEA 1HAXB 3F0OA 1LHFH 1FDPA 4LZ4B 1P03A 4DOQA 1AGJA 3UB0A 3RMLH 1ZTKA 1TAWA 2ZWLH 1QCPA 5DP8A 1IQLA 1RIWC 3QWCH 1HB0B 3E90B 3W94A 3M5NA 1QJ6B 2VJ1A 1QB1A 1YPKH
chains in the Genus database with same CATH topology
3GS9A 3OAAD 2A4RA 3SU4A 2A4GA 4R8TB 5ETXA 3F0PA 4DT4A 1W0KD 3OEHD 2XCNA 3U1IB 2GVFA 5HKKD 2WV9A 1DY9A 3O8BA 4B74A 3SUDA 5IK2D 2O8MA 3PV5A 3W1EA 2YMSB 5GJ4B 3O8CA 2QF5A 2OC7A 2M2AA 1COWD 3FO8D 4I32A 2IJOB 2WHXA 3SUFA 4A1TA 3NRLA 2F9VA 5C17A 3OTPA 1S6LA 2YOLA 2W6JD 2KM0A 3SU0A 3H09A 5C0TA 2JJ1D 2KZ4A 2WSSD 2V7QD 2JDID 3SV9A 1JXPA 2XOKD 3SUGA 5EQSA 3RC5A 4XD7D 2KCPA 3KNXA 3SV8A 4TYDA 2WPDD 4B6EA 1OHHD 3FKSD 3KF2A 1E79D 3OYPA 2OC1A 3FOAA 3O8RA 1EFRD 5FPYA 2HLDD 5EQQA 5ESBA 3P8OA 4WF8A 4A1XA 4F55A 4B71A 4A92A 1BT7A 1NBME 4B76A 1DY8A 1W0JD 2LELA 2XNIA 2JJ2D 3KN2A 5GNDA 3RC6A 2K1QA 5FPTA 3U1JB 2KCOA 3SU3A 3N7DA 2OINA 3M5MA 4WH8A 1FX0B 4ZCNA 1DXPA 5EQRA 5T1VA 3SU6A 5FL7D 4NWLA 2YMSC 1WXRA 3DCLA 2F43B 2F9UA 2J5UA 3M5OA 3ZIAD 4Q63A 3M5LA 3WW7A 1N1LA 2FOMB 4Q4LA 5H4IB 1SKYE 2L6OA 2OC0A 5EPYA 1NBMD 5DSFA 2QF4A 3OE7D 3SV7A 4A1VA 1RTLA 1KMHB 2CK3D 4KTCA 4NWKA 4U01A 3SU2A 2KCYA 3O8DA 2QV1A 4TT3D 1DXWA 3SYJA 1W3CA 4ASUD 3F2FA 5F53A 2OK5A 2XNDD 1H8HD 4M9FA 3LKWA 4Z1MD 2KFWA 4JMYA 3P8NA 3EYDA 5CHBA 3N99A 3WWBA 3L6PA 2A4QA 2QE7D 2WZQA 2OBOA 3AK5A 2K0QA 3SU5A 4B6FA 3DSOA 3F3BA 3DSPA 3KEEA 3SUEA 1MABB 2W6ID 4YXWD 3LOXA 2P59A 2FM2A 1CU1A 2F4LA 4I31A 1E1RD 3F2HA 5DN6D 3WWFA 5C0UA 4WH6A 5FPSA 3FN8A 4B75A 3F0OA 3F2GA 5EPNA 1E1QD 2JIZD 1RGQA 4TSFD 1A1RA 2KCAA 3SZEA 1BMFD 3OFND 4K8BA 2OBQA 3PRBA 5GPIB 3RC4A 3PV2A 2KR7A 3VG8A 5B6LA 3OEED 5CDFE 2XCFA 2K8IA 2IJD1 2OC8A 2VBCA 3LONA 1H8ED 4FETA 2AHME 3PRDA 3UB0A 2GGVB 4B73A 5IDKA 3N7EA 3SV6A 1NS3A 2YMSD 3E90B 3M5NA 2FP7B 4OM9A 4RI0A 3SU1A 4I33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0U A;  5C17 A;  3FN8 A;  3F2G A;  3F0O A;  3F0P A;  5DSF A;  5C0T A;  3F2F A;  3F2H A; 
#chains in the Genus database with same CATH topology
 1NRP H;  1XUF A;  1P9S A;  4TPI Z;  1DPO A;  1PFX C;  1A61 H;  2RA3 A;  3GY8 A;  4MNX A;  2YMS B;  1V3X A;  1D6W A;  1EOJ A;  4I32 A;  1GJB B;  2ZPQ A;  2PGQ B;  3BSQ A;  3SOS A;  3M7Q A;  2F91 A;  3CNR A;  1GMD F;  1T8N A;  2EA3 A;  3RC5 A;  3ZZ7 A;  3HGN A;  1XUJ A;  3UQO A;  2ZIQ H;  1ZRK A;  2FES H;  2BX4 A;  9EST A;  5DKM A;  1FNI A;  2O9Q A;  2FMJ A;  2A4O A;  1GMD G;  1K2I 1;  1O2N A;  4Y8Y A;  4HZH A;  1JBU H;  1C2F A;  3T62 A;  1J8A A;  3M5M A;  4IMQ A;  3ATW A;  1FJS A;  4JZF H;  4WMF A;  1EP6 A;  1LHD H;  3RU4 D;  5A0C A;  1FQ3 A;  1FON A;  3M5O A;  3UR9 A;  3GCO A;  3A83 A;  3RXR A;  1A0H B;  3UUZ A;  5DSF A;  3B9F H;  3SBK A;  2BQ6 B;  4KTC A;  4E06 H;  3U69 H;  2ZP0 H;  5HIZ A;  2VIO A;  1UTP A;  5EJL A;  1S6H A;  3H5C B;  3MNS A;  3STJ A;  2VID A;  4TY6 A;  1O5C B;  1WSS H;  1GBF A;  3ATM A;  2PR3 A;  3P8N A;  4X6M A;  2ZHF H;  2ZHE H;  1HAZ B;  4LOY H;  3KL6 A;  3MWI U;  1MUE B;  2A4Q A;  3SHA H;  2G00 A;  1Z6J H;  1TLD A;  1FIW A;  2VGC C;  1GGD B;  4DCD A;  1O2Q A;  2A7C A;  2V3O H;  2CHA B;  3VGC C;  1IQJ A;  2PV9 B;  2BY9 X;  6CHA C;  3A7Y A;  4ABA A;  1EJN A;  5EW2 H;  2OTV A;  1YCP K;  1VIT H;  5EG4 A;  2PKA B;  5JBA S;  1O2R A;  1NTP A;  1K1J A;  1GVK B;  3KGP A;  1IHS H;  1SHY A;  5E2O A;  4NIX A;  5IDK A;  1KXD A;  4NIY A;  1ANB A;  1GJ9 B;  3RMN H;  1VGC B;  2HVY B;  4IGD A;  2FOD A;  3BTF E;  1AHT H;  3CS0 A;  3UR6 A;  2SGE E;  4Q7Y A;  1QJ7 B;  2FO9 A;  2YNB A;  3URD A;  1P0S H;  1O3M A;  3TPI Z;  3ZYE A;  1G3C A;  1D3T B;  3K65 B;  2M2A A;  3K9X B;  1SLX B;  1KSN A;  3SNE A;  2J98 A;  4UEH H;  2VNT A;  1FY3 A;  3UOP A;  1CBW C;  1IQI A;  5C1Y A;  2SGQ E;  3UY9 A;  4I8L A;  1ABI H;  4CH2 B;  2PP6 A;  3A85 A;  3LDX H;  2GT8 A;  5E8E H;  2H9E H;  2ZGC A;  1G2L A;  2JJ2 D;  3QTV H;  2K1Q A;  1ELF A;  4CRA A;  2RCE A;  2QN5 T;  4CR9 A;  3BTE E;  1W13 U;  1C1V H;  1ELG A;  1GL0 E;  3RXC A;  3M3V A;  3CS7 A;  5F03 A;  1F5L A;  4AC9 A;  1TGB A;  2TGP Z;  3SU6 A;  1EZU C;  4B2C A;  1NU7 B;  1GBH A;  3RMO H;  1THP B;  2F43 B;  2ZTX A;  1V2K T;  3BEU A;  4AFZ A;  1W0Z U;  2BB4 A;  3ZVG A;  1S83 A;  1XVM A;  4UFF H;  3QZQ A;  1OKX A;  3A88 A;  1A0J A;  3NUM A;  2ZPS A;  3BEI B;  3UTU H;  1PQ7 A;  1LMW B;  4YLQ H;  2QC2 A;  1V2N T;  5L30 H;  1XVO A;  1RIW B;  1UVO A;  1EUF A;  1NO9 H;  2BOK A;  4BTT B;  2KAI A;  3S7K B;  1C4V 2;  2AH4 X;  2VIP A;  2GV7 A;  1O31 A;  5GIB A;  3MQK C;  3SJ9 A;  5LPR A;  2D1J A;  3MI4 A;  4TY7 A;  1EB1 H;  1HCG A;  4MPV A;  1YPG H;  2QXG A;  1H9I E;  1BRB E;  1HLT H;  4NIV A;  1C9P A;  3M3T A;  3RXD A;  3ZZA A;  1C2I A;  4NIW A;  1HNE E;  3C27 B;  3AW0 A;  1O2W A;  5DN6 D;  3U8R H;  1ZHP A;  2ZFS A;  2XWB I;  1KDQ A;  3F2G A;  3O8R A;  1UK4 A;  2PSX A;  3KQC A;  2AGI X;  1Z8I B;  1EJA A;  1AY6 H;  1RRK A;  1O2S A;  2KR7 A;  1ZRB A;  1LTO A;  5JB9 S;  1AWF H;  6EST A;  3DD2 H;  4FET A;  1Y3U A;  2ZQ2 A;  4WXI A;  3OX7 U;  4IC5 A;  1NS3 A;  2HNT F;  1GCD A;  1UVT H;  5JBT A;  1O3J A;  1B0E A;  3A89 A;  1SPJ A;  1V2Q T;  3EST A;  4K3J A;  3PV4 A;  3SV2 H;  2R2W U;  2G81 E;  2GV6 A;  4INK A;  3ZZB A;  1DE7 H;  4X8V H;  4DT4 A;  4GCH F;  2WPJ S;  4ABF A;  1HAV B;  1Y5B T;  4Y71 A;  5JBC S;  3RXS A;  3O8B A;  3SUD A;  1RD3 B;  4X2V A;  2GMT C;  5I25 A;  3MU8 A;  4Y11 E;  2HLC A;  1COW D;  3T5F H;  1OWE A;  3T26 A;  1PPZ A;  1BHX B;  1ZJK A;  2HOB A;  2H5C A;  1O33 A;  3P6Z B;  3LGI A;  5HMA A;  1O30 A;  4DGJ A;  1GJ7 B;  1JXP A;  3HAT H;  2BDH A;  3TK5 A;  1THR H;  4B6E A;  3I29 A;  1MZA A;  2F3C E;  1G9I E;  1TOC B;  2PLX A;  3A8B A;  3UWJ H;  4FUH A;  5FPY A;  4JCN A;  4CBN A;  1YCP H;  4F55 A;  4B71 A;  4FU9 A;  1AKS B;  1P2O A;  1BQY A;  3ZZC A;  1DLK B;  3HKJ B;  4ZKN U;  2ULL A;  4DIH H;  1XMN B;  3N7D A;  2BVX H;  5E0G A;  1FZZ A;  2XC5 A;  1H8I H;  1QTF A;  2VGC B;  3LGV A;  1A5I A;  2BD2 A;  3VGC B;  3SJI A;  1FIZ A;  1AFE H;  1QGF A;  3S9A A;  1L1G A;  1KXC A;  1J9C H;  6CHA B;  3IIT A;  3S7H B;  1T8O A;  1DX5 M;  3F9F A;  3ZZ4 A;  1GBT A;  1HRT H;  3PYH A;  1SSX A;  2OC0 A;  1O2Z A;  1TBR H;  3RXJ A;  1C5L H;  1EAS A;  3URC A;  1O3N A;  1GWA A;  1UK2 A;  2ZCK P;  3TK6 A;  3URE A;  1AVG H;  2OXS A;  1DXW A;  1TAB E;  2Z9K A;  2A5K A;  1ZTL A;  1O2K A;  1Y3Y A;  1A46 H;  1OWJ A;  2GCT C;  1ZTJ A;  1INC A;  4YOI A;  1EXF A;  3VPK A;  1O2J A;  1O2G H;  1PJP A;  2V35 A;  3M3S A;  4I8J A;  1RFN A;  4RT0 A;  1AE5 A;  4Y10 E;  2PWX A;  1U6Q A;  4MVN A;  1SMF E;  1JIR A;  1KXE A;  2OBO A;  1NZQ H;  1TNK A;  4ABG A;  3SUE A;  3LT3 A;  3GOV B;  1A3B H;  3UOU A;  3F2H A;  2H1U A;  1F2S E;  4YZU A;  4B75 A;  1TA6 A;  1CBW B;  1TRY A;  2ZU2 A;  4YES B;  2F9O A;  5DO4 H;  4BAK B;  4OS5 A;  1P12 E;  1H8E D;  4ABE A;  2QA9 E;  2GGV B;  4MLF B;  2ZGX H;  3PM3 A;  1MCV A;  1QIX B;  5BRR E;  3PWB A;  4MQA A;  4Z6A H;  1AUJ A;  3TH3 H;  2FOF A;  2GZ9 A;  1G30 B;  3HGP A;  4TWY A;  5GJ4 B;  4DT7 B;  2QF5 A;  5J4Q A;  1C2L A;  1P2M A;  1O3F A;  1XXD A;  5C17 A;  3SND A;  2DE9 A;  1AVX A;  1BHX F;  2AS9 A;  3ZZD A;  5C1U A;  4X1N U;  1J17 T;  2Y7X A;  1NRQ H;  2WV4 A;  3QK1 A;  4ZHM U;  4AFQ A;  5EQS A;  2CN0 H;  4XD7 D;  1BB0 B;  1L1J A;  5DP6 A;  4OGY A;  5EU8 A;  2QF3 A;  1ESA A;  4MPW A;  1SGT A;  1V2W T;  2Z9G A;  3VXF H;  1QL7 A;  3RM2 H;  2EI8 A;  3F68 H;  2TGT A;  3A86 A;  3Q76 A;  3U1J B;  4NG9 H;  3V0X A;  4AOQ A;  1WV7 H;  3MU1 A;  4JYT A;  5F8T A;  3RXI A;  2TRM A;  3NPS A;  1G3D A;  5F8Z A;  2FOA A;  3GY2 A;  3A87 A;  1QB9 A;  1GBL A;  1PPC E;  3BG4 C;  2VVC A;  1Q31 A;  2J34 A;  2FYQ A;  2F9U A;  1SGN E;  3PB1 E;  2XWA A;  5DP5 A;  4NFF A;  3UFA A;  3PLB A;  1EZX C;  2BVR H;  5H4I B;  4RKJ B;  2L6O A;  4ZKR U;  2ZZU H;  2ILN A;  1Z71 A;  3SV7 A;  3HK6 B;  1RTF B;  2EQN A;  3PTB A;  4GAW A;  1FN6 A;  5F53 A;  1AWH B;  3SJ8 A;  1LHG H;  1O36 A;  2HWL B;  1C1R A;  4M9F A;  4X6P A;  1GMC G;  1O3G A;  2G51 A;  1C2D A;  2O8L A;  1V2O T;  3PMH B;  2PSY A;  1C5O H;  3RUO A;  1ZR0 A;  4I86 A;  2GMT B;  4FU8 A;  1WDI A;  1BRC E;  2W6I D;  1OP8 A;  1W10 U;  2W5E A;  1E34 B;  5C67 A;  5C0U A;  3MO6 A;  4H42 U;  2WUC A;  2ANW A;  4HGC A;  5PTP A;  4K8B A;  2TGA A;  1PQ8 A;  1UK3 A;  6GCH F;  2LP6 A;  3NK8 A;  2A31 A;  3U8T H;  2AHM E;  3CP7 A;  2C8W B;  2XC4 A;  2YMS D;  2BY8 X;  1TBZ H;  1XUG A;  1E37 B;  1T31 A;  4AX9 H;  6GCH G;  4ABD A;  2Z3C A;  1WBG B;  4A7I B;  3ZV9 A;  5TCC A;  2VIN A;  1DS2 E;  4B74 A;  1LVO A;  2AMD A;  1C5P A;  3SU0 A;  4U30 A;  1TNI A;  4X1P U;  2AGG X;  2KZ4 A;  4FUE A;  4AN7 A;  1HDT H;  5DJ7 A;  5HKK D;  1JMO H;  2J98 B;  2Y5F A;  1NRN H;  1V6D A;  1E79 D;  4INH A;  2C90 B;  1GJ8 B;  2B7D H;  2A5I A;  4WF8 A;  4AG2 A;  4AFS A;  1QRZ A;  1GHX H;  2GCT B;  3OSY A;  4XBB A;  2G55 A;  2BDG A;  2XNI A;  1SG8 B;  2VIW A;  2EEK A;  1NU9 A;  2WPI S;  1AI8 H;  1HPG A;  4YOG A;  5FXL A;  1P2Q A;  1DIT H;  2JH5 D;  1TFX A;  4KGA A;  3OU0 A;  4U32 A;  1WXR A;  2A7J A;  2ZGJ A;  4UFE H;  1MBM A;  1O32 A;  3WW7 A;  1ZLR A;  4X6O A;  1HAG E;  1BBR E;  2L74 A;  1CHO G;  2RG3 A;  1C5Z B;  1W7G H;  1BTY A;  1ELB A;  1FY5 A;  1L2E A;  1RS0 A;  3OE7 D;  4A1V A;  4TPY A;  5IYT A;  1BTP A;  1XKB C;  1KXB A;  2BVS H;  5E0H A;  3F2F A;  4BAQ B;  4BXW A;  3G01 A;  4YT7 H;  3Q77 A;  1SQR A;  2P93 A;  1CVW H;  2F83 A;  3SNC A;  3RXV A;  3L6P A;  4VGC C;  3DSO A;  2P94 A;  1AB9 B;  2QGR A;  4GPG A;  5AF9 H;  5C3N A;  2H6M A;  3LOX A;  1P8V C;  1K1O A;  2ZG0 H;  1T8L A;  1BMM H;  2A5A A;  4WH6 A;  4Y0Y E;  5FPS A;  3FN8 A;  2ZF0 H;  2JH6 D;  1QY6 A;  4KTS A;  2FEQ H;  1KDQ B;  1B0F A;  2OBQ A;  3PRB A;  4H6S B;  5GPI B;  1AVW A;  3SNA A;  4OS1 A;  4O3T A;  4B73 A;  1BA8 B;  1KTS B;  3ENS B;  1SGQ E;  1HJ8 A;  3LC3 A;  3NZI A;  1KIG H;  1Z8G A;  1BDA A;  1SQA A;  1KXA A;  4FUB A;  1TYN A;  1GVZ A;  5JDU B;  2DUC A;  2GVF A;  3MOC A;  3BG4 B;  2O8M A;  3RXB A;  2C3S A;  5AHG H;  4A1T A;  4X8U H;  4ABJ A;  1GI0 A;  3MMG A;  2JDI D;  4AYV B;  1MQ5 A;  3KNX A;  4JYU H;  1LVM A;  3NXP A;  5CMX H;  2GZ8 A;  3D23 A;  3A7X A;  3L3T A;  1W2K H;  1Q3X A;  1SGF A;  1MMJ N;  1YPL H;  2A2Q H;  1FPH H;  2FX6 A;  2GZ7 A;  5FCK A;  3SGA E;  2ZDK A;  4JK5 A;  4Y7B A;  1TGS Z;  2Z3E A;  3E3T A;  3MNB A;  3F9H A;  1UHB A;  4KP0 A;  3RXU A;  3GIS B;  3LJJ A;  3PLP A;  1WTH D;  2XW9 A;  2BD4 A;  1NFX A;  1NPM A;  1HAP H;  3UAI C;  5T1V A;  1QHR B;  1E38 B;  1O34 A;  3RXE A;  2QF0 A;  1PQ5 A;  2Y6T A;  1C4U 2;  1DFP A;  3UIR A;  3S9C A;  1GBJ A;  3GY3 A;  1G3E A;  1P3C A;  2HNT E;  2R2M B;  2ZC9 H;  1C5X B;  4U01 A;  3MO3 A;  1O3A A;  3BF6 H;  4GSO A;  2Q6G A;  5A09 A;  1VKY A;  1WQV H;  3ODF A;  5A0B A;  3FAO A;  1GG6 B;  1MTN C;  4OGX A;  4MNV A;  3BN9 A;  3E0P B;  1CA8 B;  1C1U H;  3T27 A;  2FS9 A;  1P3E A;  1V2T T;  3LGY A;  1E1Q D;  1C5S A;  4Q7X A;  1S0R A;  1BMF D;  2FOG A;  2G52 A;  3A8A A;  1P2J A;  2Y80 A;  4E7R G;  4D8N A;  1SL3 A;  3B23 B;  1V2S T;  3NWU A;  3BTG E;  3GCH B;  3PRD A;  1W12 U;  1C1S A;  1L0Z A;  1HIA A;  3SV6 A;  3V3M A;  5EIY A;  5EJ1 A;  1BJU A;  2P8O C;  1XUH A;  2Y5G A;  3OAA D;  4FUJ A;  5JYI A;  1AO5 A;  4TWW A;  4OS4 A;  3U1I B;  1UVP A;  2BTC E;  1P01 A;  2ZFQ H;  1D6R A;  1QJ1 B;  1J16 A;  3FVF B;  2ZU5 A;  4Y79 A;  2V7Q D;  3E8L A;  3SUG A;  5A0A E;  1AD8 H;  4CHA C;  8KME 2;  4P00 A;  1OHH D;  5TCA A;  3U98 H;  4YM9 A;  2FOH A;  2G5N A;  1LO6 A;  1O2Y A;  4ZAE A;  1AN1 E;  2BDA A;  4K1T A;  4A1X A;  1BT7 A;  2I6S A;  4B76 A;  1DIC A;  1HJA C;  4ABH A;  2SGP E;  1F0T A;  3STI A;  3U9A H;  1P57 B;  1MU8 B;  3S69 A;  5FX6 A;  1Z1J A;  1BBR H;  1E0F D;  4VGC B;  3BTD E;  2RDL A;  4KTU A;  1OS8 A;  2UWP A;  2BDC A;  1F5R A;  1SQO A;  5FL7 D;  3RU4 E;  1AZZ A;  4UD9 H;  3DCL A;  5KGO A;  4ISN A;  2Y7Z A;  1ZGV A;  2J5U A;  4FOU C;  1EB2 A;  3M5L A;  2H9T H;  4XRN A;  3LH3 A;  1QQ4 A;  1WOF A;  1EPT A;  3ZV8 A;  5EPY A;  2Q6D A;  1V2U T;  1MU6 B;  1Z1I A;  3JZ1 B;  1FY4 A;  1UW7 A;  1MH0 A;  1TGC A;  1FPC H;  1O3L A;  2FI5 E;  2OQU A;  1ZHM A;  1D3D B;  1W3C A;  4I8G A;  4DVA U;  2ZI2 H;  1ABJ H;  3MNX A;  1FUJ A;  1DWC H;  2PTN A;  1BTU A;  2KFW A;  3MYW A;  1GBM A;  2PKS C;  1ZPB A;  1K1I A;  1K1M A;  3WWB A;  1GI6 A;  4MDS A;  2GT7 A;  2WZQ A;  5LPF A;  3AK5 A;  4AOR A;  1V2J T;  4ACB A;  5FX5 A;  1PYT C;  3SGB E;  4I31 A;  5F6M A;  1O2L A;  1S82 A;  1OPH B;  2UUY A;  3TNS A;  3ZZ9 A;  1Q2W A;  1M9U A;  3M35 A;  4JZD H;  4NA9 H;  2LNC A;  1DWE H;  2BY7 X;  2XBY A;  1CSO E;  1P02 A;  2QCY A;  3K6Y A;  1F92 A;  2HPQ H;  4IN1 A;  2VH0 A;  4A92 A;  1Y3X A;  4ISI H;  4O97 A;  1LHE H;  1C5N H;  5K7R A;  1RTK A;  1YM0 A;  2J4I A;  3HPT B;  5EST E;  1UTQ A;  1DOJ A;  3A82 A;  3TH4 H;  2Q6F A;  4OM9 A;  2SGF E;  2CJI A;  4FU7 A;  4DY7 B;  2F9N A;  1O5A B;  2XXL A;  1PQA A;  4ZMA H;  1W0K D;  4JK6 A;  2W3I A;  1K9O E;  4Q80 A;  2CXV A;  4ABI A;  4X1Q U;  2Q1J A;  4NSY A;  3KQB A;  5DK1 A;  1L4D A;  1TPO A;  4ISO A;  2OC7 A;  2UUK B;  1HFD A;  1CO7 E;  4ZKS U;  2C8Y B;  1BRA A;  2FOC A;  1ESB A;  2C8X B;  4MNW A;  1O3P B;  1GHW H;  4X2X A;  1BRU P;  1VJ9 U;  2XYA A;  3TJO A;  2WPK S;  1TQ0 B;  4BAO B;  1SGP E;  2B8O H;  1LHC H;  2OLG A;  5EXN A;  1ELA A;  4H4F A;  3TNT A;  1O3D A;  1MTN B;  3WY8 A;  1JRT A;  3ATL A;  3ZVA A;  1ZMJ A;  2EST E;  2THF B;  2ALP A;  1ANC A;  4AZ2 B;  2ODP A;  2ANK H;  4NWL A;  2O8T A;  3QDZ B;  2BQ7 B;  5G4B A;  4UFD H;  3SNB A;  5J4S A;  1C5W B;  5DPA A;  4HI3 A;  4O9V A;  5LGO A;  2ZEC A;  5L2Z H;  3A7W A;  3GCT G;  4D76 A;  9LPR A;  1VCQ A;  2WPH S;  1K1P A;  3M7T A;  2ZGH A;  5EXL A;  1O3O A;  3SN8 A;  4ISH H;  3RP2 A;  4ASU D;  1F0S A;  3UNQ A;  3UPE A;  1H8H D;  2P8O B;  2J38 A;  3FAN A;  4CRB A;  4Z0K A;  1O2U A;  3TU7 H;  4GHT A;  3EA9 A;  1C2M A;  2Z6B D;  1GBK A;  2Z7F E;  3RM0 H;  2K0Q A;  1SR5 C;  3V13 A;  4B6F A;  3BIV H;  2AFQ B;  1ELV A;  1TPA E;  5K0H A;  3E1X B;  4NSV A;  3TK9 A;  1CU1 A;  4DJZ B;  1DSU A;  3OTJ E;  5L2Y H;  4CHA B;  1MBQ A;  4R0I A;  1S6F A;  2OP9 A;  1O35 A;  5DGJ A;  1KTT B;  3OEE D;  5CDF E;  2XCF A;  2K8I A;  1FAK H;  1HAY B;  1HJA B;  3Q00 A;  2PGB B;  3DFL A;  2W26 A;  1ELE E;  1GL1 A;  4XSK U;  4RI0 A;  4CRF A;  5LH8 A;  4I7Y H;  2B9L A;  3ZZ3 A;  3GS9 A;  2VWM A;  3EDX B;  2XBX A;  1FI8 A;  1KYN A;  1AIX H;  2NU1 E;  2PUQ H;  2WV9 A;  2ZU1 A;  3QGN B;  4YOJ A;  1GI4 A;  2ZU3 A;  3SO3 A;  2IJO B;  4RN6 A;  2GP9 B;  3SJO A;  1BJV A;  1FMG A;  1NM6 A;  1C1W H;  3BV9 B;  1SLV B;  1SOT A;  1LCY A;  5DP3 A;  4ZH8 A;  4HFP B;  1QNJ A;  1N6Y A;  1TMT H;  3MNC A;  1LQE A;  3QUM P;  2BXT H;  2Y82 A;  3TVJ B;  3BTH E;  1A3E H;  1THS H;  3NCL A;  2C8Z B;  2LEL A;  1EAX A;  2H2Z A;  2J92 A;  2QYI A;  1QA0 A;  1YY3 A;  2PKS B;  5FPT A;  1HAH H;  4Y8X A;  2J94 A;  1O5F H;  1O3K A;  1W7X H;  1AB9 C;  4Y0Z E;  7GCH G;  1GI3 A;  1UHB B;  3BTM E;  1QL9 A;  3V7T A;  4BXS A;  1OWK A;  7EST E;  1SLW B;  1P10 A;  3ZZ5 A;  2STB E;  1SGI B;  4X0W U;  2ZFR H;  4I8K A;  1TMB H;  2FOM B;  2LPR A;  1SKY E;  1YBW A;  1A5H A;  2UUJ B;  1Z8R A;  1VR1 H;  5CHA C;  3FP6 E;  2FI4 E;  1KMH B;  1S85 A;  4TT3 D;  1SGD E;  2FOE A;  1TON A;  3JZ2 B;  4IBL H;  2H9H A;  1EX3 A;  1O38 A;  3A84 A;  4GVU A;  1EAT A;  1P2N A;  5GCH F;  1DWB H;  3N99 A;  3F9E A;  1TWX B;  1C5Y B;  3T28 A;  3RXK A;  1NY2 2;  1GVL A;  1O3E A;  5A2M H;  2ZDL A;  4UON A;  2BLV A;  1GMC F;  2HGT H;  3F1S B;  1Y5U T;  4BNR A;  1JWT A;  2AIQ A;  2H5D A;  5GCH G;  3SZE A;  2JIZ D;  1TQ7 B;  4NZL A;  1ELD E;  3SZN A;  2BXU H;  4K2Y A;  2VWO A;  1QL8 A;  4ZXY H;  3T25 A;  2CGA A;  5EW1 H;  2PUX B;  3N7E A;  8GCH F;  1TOM H;  1EZQ A;  1TRM A;  5EOD A;  2FP7 B;  1YF4 A;  1QUR H;  4ISL A;  4CH8 B;  2NU4 E;  2SNV A;  1BIT A;  3Q3X A;  2FOB A;  5ETX A;  2NWN A;  1ZSL A;  1P2I A;  1Y8T A;  4J1Y A;  2XC0 A;  3ATI A;  1X7A C;  8GCH G;  1XM1 A;  2BZ6 H;  4BOH A;  4LK4 A;  2AGE X;  1BTZ A;  1CGI E;  4D9R A;  1CE5 A;  4M7G A;  1GJ6 A;  2GJG A;  1NN6 A;  1YPJ H;  1CQQ A;  2WSS D;  4K8Y A;  1SC8 U;  1BTX A;  1D9I A;  1C2J A;  1BIO A;  3P17 H;  4NGA H;  3SV8 A;  1GI1 A;  2WPD D;  3P95 A;  4O3U A;  1UVU H;  3ZYD A;  3PO1 C;  5ESB A;  1ACB E;  1AQ7 A;  2IPQ X;  3FZD A;  4ZUH A;  1DY8 A;  1GG6 C;  4HG6 A;  4B2A A;  2HAL A;  1HGT H;  2UUF B;  5ABW A;  1G2M A;  1YPH E;  3Q3K A;  2Z3D A;  1V2M T;  4FUG A;  1Y3W A;  1FX0 B;  1B5G H;  1TX8 A;  2D26 C;  3EA7 A;  4OS7 A;  1XX9 A;  2A0Q B;  1UTL M;  1SB1 H;  2J97 A;  5CE1 A;  3ZIA D;  3BIU H;  4MNY A;  3GIC B;  1K28 D;  1SGE E;  1MKX K;  4Q4L A;  1OSS A;  1TPP A;  2R9P A;  2XBW A;  4FUF A;  3GCH C;  1EPT B;  2EY4 C;  3TGK E;  4FUI A;  2QV1 A;  4IN2 A;  4WXV A;  1UTM A;  1EJM A;  1O39 A;  3PMB B;  4MTB A;  1CHO F;  4Y7A A;  1WQS A;  1A4W H;  2BD7 A;  3Q3Y A;  2W3K A;  1GBC A;  2BD5 A;  4XFQ A;  2VVU A;  4Y6D A;  1HAV A;  3F3B A;  1OX1 A;  3RLY H;  2BLQ A;  1NC6 A;  1ZSK A;  2WPL S;  4U2W A;  4LXB H;  1DUE A;  3TJV A;  1GDN A;  3RXH A;  1C5U A;  3E91 A;  1H4W A;  1UO6 A;  3RC4 A;  3M7U A;  5B6L A;  1KLT A;  1SGR E;  2ZFT A;  1J15 A;  2ZDV H;  2HRV A;  1K1L A;  1D3Q B;  1GJC B;  2FTM A;  4XBD A;  4ZHA A;  2OUA A;  3ODD A;  1C2H A;  1L4Z A;  2KAI B;  2FTL E;  1OYQ A;  3I78 A;  3EQ0 H;  1GJ5 H;  2HNT C;  1TA2 A;  4ZRO A;  3ITI A;  2XCN A;  5HYO A;  2SNW A;  2XRC A;  1ORF A;  5DP7 A;  1XUI A;  3O8C A;  3SQH E;  3QX5 H;  1N8O C;  5T6F A;  4ABB A;  1HUT H;  1T4V H;  2C93 B;  1FLE E;  3MHW U;  3NRL A;  2HPP H;  4K69 A;  3SI3 H;  1C2G A;  2IPH A;  3GY5 A;  2ZNK H;  2OD3 B;  3SV9 A;  2BZA A;  1HXE H;  1YLD A;  2ZU4 A;  3NKK A;  5CHA B;  4B2B A;  4A6L A;  2AEI H;  3DFJ A;  2Z94 A;  1IQF A;  2YNA A;  3P92 A;  3IG6 B;  1IQE A;  1HYL A;  1MQ6 A;  3P8O A;  1CT0 E;  4D9Q A;  2M5T A;  1G3B A;  5E0J A;  5C5O A;  1UCY E;  1O2X A;  3GDU A;  1OWD A;  2SGD E;  2A2X H;  4THN H;  1K1N A;  3RXF A;  1KXF A;  3H7T A;  3E6P H;  2DE8 A;  3M61 U;  2TIO A;  4H6T A;  3RXO A;  3EGK H;  4GLY A;  3S0N A;  1N6X A;  1O3C A;  3MTY A;  2OCV B;  1ELT A;  3PWC A;  2J95 A;  2QXJ A;  3OY6 U;  3P8F A;  3KYG A;  2O8U A;  1MTU A;  4SGB E;  1YWU A;  1DUA A;  2AER H;  1N1L A;  4JZE H;  2TGD A;  1ZMN A;  1C1P A;  5EGM A;  3A8D A;  2UWL A;  3SW2 B;  5HXF A;  1YC0 A;  1FN8 A;  2I6Q A;  3DUX H;  2ZHQ H;  1GDU A;  3O8D A;  3RXM A;  4BTU B;  3K2U A;  5C1X A;  3SYJ A;  1C2E A;  1T7C A;  2GX4 A;  1O5E H;  5C5N A;  4YT6 H;  2G5V A;  7KME H;  3LKW A;  4ZKO U;  4Z1M D;  3MO9 A;  1TRN A;  2BD9 A;  4CRG A;  3B8J A;  1VZQ H;  2ZDN A;  1HJ9 A;  2ANM H;  2EI6 A;  1L1N A;  4F49 A;  1Y3V A;  1YYY 1;  1UCY K;  2VB0 A;  5GXP A;  3QTO H;  3KQD A;  2ZCH P;  5EXM A;  1D4P B;  1SVP A;  3EA8 A;  1A5G H;  5B6O A;  2KCA A;  2GDE H;  1W14 U;  3PV2 A;  1ELC A;  3VG8 A;  1MKX H;  2CF9 H;  3PO1 B;  4NCY A;  1SOZ A;  2BM2 A;  1T8M A;  1IQH A;  2QXH A;  3A80 A;  3TJN A;  4AYY B;  1OYT H;  5FAH A;  4HTC H;  2JKH A;  4P02 A;  2BD8 A;  1TGT A;  2V6N A;  1WCZ A;  4X2Y A;  3F0P A;  1EOL A;  3AAV A;  1ZOM A;  2PTC E;  3ZVD A;  3QO6 A;  3VB4 A;  1SLU B;  5IK2 D;  1CHG A;  2P16 A;  2B5T B;  2FS8 A;  3ZVC A;  4Q7Z A;  2WHX A;  2FLB H;  1UTN A;  1EQ9 A;  1S6L A;  3GYM A;  5T6G A;  5FCR A;  1SFI A;  2JET C;  2XOK D;  2KCP A;  2J2U A;  1Z7K A;  2NU2 E;  1P06 A;  3FOA A;  3LPR A;  1YLN A;  1MKW K;  5HGG A;  1GDQ A;  2ZO3 H;  1S0Q A;  3P70 B;  2WIN I;  3RC6 A;  1O2H A;  3UWI A;  1HAO H;  3ELA H;  1AFQ C;  3VFE A;  4X8S H;  2PFE A;  4D7F A;  1ZJD A;  4XE4 A;  3QGJ A;  1WAY B;  1O2V A;  1GBA A;  4IMZ A;  1VIT F;  1GMH F;  1DAN H;  2NU0 E;  5KEC A;  2FLR H;  1E35 B;  3BTK E;  3GY7 A;  4DG4 A;  1NT1 A;  4MPU A;  5EOK A;  1RJX B;  5C2Z A;  1QQU A;  2AMQ A;  1AE8 H;  5FBI A;  3VB5 A;  2GCH F;  1GHY H;  1AMH A;  1ZML A;  5DG6 A;  1QRW A;  4NA8 A;  4IS5 A;  1QBN A;  5JPM H;  1DDJ A;  1VIT G;  5SGA E;  1GMH G;  3FP7 E;  1IHT H;  1SGY E;  1C1N A;  2G4U A;  5I46 H;  3TH2 H;  2GCH G;  2ZPR A;  1LVB A;  4IC6 A;  2BX3 A;  2ZGB H;  1HV7 A;  4O03 A;  5HM2 A;  2CMY A;  3EYD A;  3BTQ E;  3D65 E;  4AB9 A;  1N8O B;  1DVA H;  1MAB B;  2STA E;  2F4L A;  3MH7 A;  1BMA A;  2ZDA H;  2P95 A;  1NFW A;  1RGQ A;  1KLJ H;  2R0K A;  2ASU B;  3OFN D;  2WV5 A;  1GHZ A;  2IN2 A;  1XKA C;  1K22 H;  1SHH B;  1O37 A;  1EAU A;  1UTK A;  1V2P T;  1GBI A;  3PLK A;  5T3H A;  8LPR A;  1NFU A;  2BOH B;  1GJD B;  5TJX A;  1BUI A;  1OXG A;  1T32 A;  3UQV A;  3BEF B;  2EI7 A;  4Q2K A;  3SU1 A;  2P3T B;  4FUC A;  4JZI A;  1V2V T;  2A4R A;  4K1E A;  2A4G A;  3SU4 A;  1C5T A;  3KHV A;  3VB7 A;  5AFY H;  2FWW A;  1OWH A;  3AW1 A;  3DT0 H;  4KKD A;  3FFG A;  3LGU A;  8EST E;  1GCT C;  3GCN A;  4X1S U;  1CGJ E;  1A2C H;  2VIV A;  4YTA A;  1P9U A;  2W6J D;  1BTW A;  2BDY A;  1UCY H;  5A8Y A;  3VB3 A;  2P3F H;  1JOU B;  2KX4 A;  1H1B A;  3SQE E;  3RDZ A;  3MU5 A;  1SBW A;  4TYD A;  1W11 U;  1BZX E;  1HAI H;  2BDI A;  3LGW A;  4OS2 A;  3W95 A;  1GI7 B;  3R3G B;  2HLD D;  6LPR A;  3SGQ E;  1C1T A;  1PYT D;  2WPM S;  3RXL A;  3TJU A;  4GUX A;  2VIQ A;  1UTJ A;  1F5K U;  2NU3 E;  1TX7 A;  2OIN A;  1QZ8 A;  1ETR H;  1O0D H;  3E0N B;  2J9N A;  3ATK A;  3ZVF A;  1LPK B;  1MAY A;  3A7Z A;  1DXP A;  3V12 A;  5GWZ A;  3GY4 A;  1GJA B;  2JH0 D;  2TBS A;  3VEQ B;  1GBD A;  4CRE A;  5HM9 A;  1FAX A;  1C2K A;  1LKB A;  2QAA A;  4ZXX H;  3A8C A;  3BG8 A;  1PPH E;  1CA0 C;  1YPM H;  1AND A;  1ZGI A;  1MTW A;  2ODQ A;  1YP9 A;  2BHG A;  4XBC A;  3CEN A;  2AMP A;  3RMM H;  2R3Y A;  4CRD A;  4UDW H;  4NZQ A;  1IAU A;  3GCT F;  4DW2 U;  1MKW H;  4J2Y B;  4WY3 A;  1NFY A;  4CBO A;  3LU9 B;  1TNJ A;  2BY6 X;  2ZDM A;  2B0F A;  3S9B A;  3ZVB A;  2QE7 D;  2TPI Z;  1C1O A;  7LPR A;  3QN7 A;  1GI5 A;  3KEE A;  1F0R A;  4WMD A;  1C1Q A;  2FM2 A;  1E1R D;  2ZTZ A;  2F9B H;  1QB6 A;  1F7Z A;  2JET B;  1A1R A;  1OP0 A;  1SQT A;  5GDS H;  1GJ4 H;  3T29 A;  1WUN H;  4IW4 E;  3SHC H;  4BAM B;  4EST E;  3AAU A;  1W0Y H;  4GCH G;  3RXG A;  2VBC A;  5AVD A;  3P8G A;  1BCU H;  2Z9I A;  1WYK A;  3TIT A;  2VWL A;  1AFQ B;  3A81 A;  4I33 A;  4LZ1 H;  4F4O C;  1ZHR A;  4INL A;  5DP9 A;  4DUR A;  3MH5 A;  3PV5 A;  4E05 H;  1QFK H;  1TX6 A;  1A7S A;  1SI5 H;  1XUK A;  4B1T A;  1YGC H;  3FO8 D;  3SUF A;  1G36 A;  3H09 A;  1EPT C;  4YO9 A;  4AGK A;  3C1K A;  3SOR A;  1V2R T;  1O5D H;  1Y59 T;  3KF2 A;  1C5V A;  3OYP A;  4QT8 C;  4K60 A;  1O5G H;  2BDB A;  3EE7 A;  4UFG H;  1LQD B;  1MZD A;  3AAS A;  1W0J D;  4NA7 A;  2SGA A;  1PPF E;  5GND A;  3FP8 E;  1HBT H;  4K5Z A;  4DII H;  1EP5 A;  1Y5A T;  1IQK A;  2ALV A;  2KCO A;  5JBB S;  3F6U H;  1UVS H;  4BAN B;  1GHV H;  2GKV E;  5EQR A;  3PTN A;  4ZHL U;  2FXR A;  5DP4 A;  1TNL A;  3TGI E;  1EAW A;  2P3U B;  2ODY B;  4Q63 A;  1BML A;  4FXG H;  1DST A;  3A7V A;  1OOK B;  1P2K A;  7GCH F;  1MTV A;  3I77 A;  3RXQ A;  3UNR A;  1QBV H;  1F0U A;  1GHA F;  2G4T A;  2QF4 A;  2ZHD A;  1NRR H;  1O3H A;  4NWK A;  5KED A;  3SU2 A;  2D2D A;  2G8T A;  2BYA X;  4KEL A;  4XDE A;  1K21 H;  2R3U A;  2OK5 A;  2R0L A;  1LPG B;  1AZ8 A;  2ZHW H;  3ZZ6 A;  1GHA G;  1KY9 A;  3PMJ A;  1PPB H;  4X8T H;  1ZZZ A;  1VCW A;  3FZZ A;  2ZKS A;  1GCT B;  2VH6 A;  3DSP A;  1OWI A;  1E36 B;  1YPH C;  3LJO A;  2VVV A;  2A7H A;  3T2N A;  4ASH A;  3RXP A;  2WYJ A;  3GDV A;  2PKA A;  2FYR A;  1PPE E;  4TSF D;  4ACA A;  2QY0 B;  2ZCL P;  4AG1 A;  3IWM A;  1C4Y 2;  2FZZ A;  4RSP A;  1GPZ A;  2V3H H;  1S5S A;  1DT2 A;  5L6N H;  2A1D B;  1TNG A;  3R0F A;  3TIU A;  2EC9 H;  1ID5 H;  3MU4 A;  1HXF H;  5F8X A;  1MCT A;  1QR3 E;  1O5B B;  2RDE A;  5A8Z A;  4FVB A;  3KID U;  4R8T B;  2QIQ A;  1B7X B;  3OEH D;  3M36 A;  4AB8 A;  2PW8 H;  1DY9 A;  1ZPC A;  3U28 C;  3LC5 A;  5BPE A;  3W1E A;  5C20 A;  1TB6 H;  3GDS A;  2ZTY A;  4E7N A;  2Z9J A;  2A32 A;  4WJG 2;  2F9V A;  3TGJ E;  1ARB A;  2FX4 A;  3VB6 A;  1YLC A;  4Y76 A;  1FV9 A;  5C0T A;  2CF8 H;  1QBO A;  1VCP A;  2Z9L A;  1CA0 B;  1YKT A;  4MG3 A;  2RFK C;  1LPZ B;  1IOE A;  3FKS D;  2UWO A;  1EFR D;  2XBV A;  1HIA B;  3KQE A;  3LIW A;  1EAI A;  4X1R U;  2Y5H A;  2SFA A;  4UE7 H;  2FI3 E;  1QRX A;  3DA9 B;  3GYL B;  1XXF A;  1YPE H;  5FHT A;  3SU3 A;  1BTH H;  1TPS A;  4WWY A;  1O3I A;  3VXE H;  4BTI B;  1TBQ H;  2PHB A;  2BQW B;  1NRO H;  2WYG A;  2V3M A;  2YMS C;  1ETS H;  4OS6 A;  4AGJ A;  5C94 A;  2BY5 X;  3MH6 A;  4F48 B;  1J14 A;  4PRO A;  3D49 H;  1O2M A;  1W8B H;  1WU1 A;  1T4U H;  4RKO B;  1NBM D;  2W7S A;  1PPG E;  4XOJ A;  1MAX A;  1DM4 B;  1O2O A;  1OP2 A;  2VU8 E;  1FY8 E;  3KYF A;  2OQ5 A;  4CRC A;  1RTL A;  5EJZ A;  4JYV H;  3EE0 B;  2KCY A;  5JB8 S;  2XTT B;  1CGH A;  1P11 E;  1UTO A;  4D7G A;  2ZA5 A;  2XND D;  3H7O A;  1O2T A;  1C1M A;  1VJA U;  4MPX A;  1GI9 B;  2BMG B;  3DSG A;  3QLP H;  1SFQ B;  4JMY A;  3M37 A;  4CR5 A;  4GHQ A;  4A5T S;  3HKI B;  1SGF G;  3K6Z A;  4X6N A;  2WUB A;  2VWN A;  1TNH A;  1IQM A;  3SU5 A;  2GD4 B;  2F9P A;  1O2P A;  4YXW D;  1RXP A;  1ZPZ A;  2FDA A;  1G37 A;  1JRS A;  2P59 A;  3PMA B;  1BMN H;  3WWF A;  3MH4 A;  3UNS A;  1P04 A;  2BLW A;  3BTT E;  2A45 B;  5EPN A;  5AFZ H;  1ARC A;  1CT2 E;  1ZYO A;  4FVD A;  4NFE A;  1GBB A;  3OY5 U;  2IOT A;  2IJD 1;  1O3B A;  2OC8 A;  3BTW E;  3LON A;  3MFJ A;  2BD3 A;  1GI8 B;  1H9L B;  1GI2 A;  3L33 A;  1TE0 A;  3MU0 A;  2D8W A;  1UJ1 A;  2ZQ1 A;  3KQ5 A;  3SJK A;  1S81 A;  4BAH B;  2ZFF H;  1FY1 A;  5T6D A;  3LH1 A;  5LPE A;  1NRS H;  1FXY A;  3ZZ8 A;  1EZS C;  3LGT A;  3DHK H;  1GGD C;  1QA7 A;  1LVY A;  2CHA C;  5A8X A;  1IQN A;  1GBE A;  3OTP A;  2YOL A;  2KM0 A;  4X2W A;  1DLE A;  2JJ1 D;  1WTG H;  1ZSJ A;  2GTB A;  2V0B A;  1Z8J B;  1C9T A;  2C4F H;  1P09 A;  3AVZ A;  5HIY A;  2FPZ A;  2OC1 A;  3RLW H;  5EQQ A;  3ZVE A;  2CV3 A;  1AKS A;  3N7O A;  3TLO A;  1A0L A;  1NBM E;  1VGC C;  1G32 B;  1GHB F;  3KCG H;  3KN2 A;  1JIM A;  1MD8 A;  1AU8 A;  4JZ1 A;  1ANE A;  3E16 B;  4RT1 A;  3RXA A;  1P05 A;  3SI4 H;  1UMA H;  4WH8 A;  4ZCN A;  3U8O H;  3A7T A;  2BLO A;  3QZR A;  1LDT T;  1LKA A;  1ETT H;  1GHB G;  2Y81 A;  1MD7 A;  1V2L T;  1CT4 E;  2AIP A;  2AYW A;  1BOQ A;  1TMU H;  1EST A;  2O8W A;  2FIR H;  5FBE A;  1MTS A;  2CK3 D;  4AFU A;  4SGA E;  1DWD H;  1C5Q A;  3GY6 A;  3D62 A;  1D3P B;  1YCP M;  2RA0 A;  2QXI A;  1S84 A;  4YLU A;  1KLI H;  4FUD A;  1TIO A;  1TAL A;  2ZEB A;  4K1S A;  4Y8Z A;  2HVX A;  5E2P A;  1NES E;  1C5R A;  5CHB A;  1IQG A;  1BBR K;  4WVP E;  3PRO A;  1AUT C;  1Z6E A;  1SGC A;  2W7U A;  1C5M D;  4I8H A;  3EAJ A;  1K0H A;  2ANY A;  3RU4 T;  3F9G A;  1O2I A;  1H9H E;  2ZFP H;  3RXT A;  3HK3 B;  1EKB B;  2GDD A;  1TGN A;  1H8D H;  4WME A;  1HAX B;  3F0O A;  1LHF H;  1FDP A;  4LZ4 B;  1P03 A;  4DOQ A;  1AGJ A;  3UB0 A;  3RML H;  1ZTK A;  1TAW A;  2ZWL H;  1QCP A;  5DP8 A;  1IQL A;  1RIW C;  3QWC H;  1HB0 B;  3E90 B;  3W94 A;  3M5N A;  1QJ6 B;  2VJ1 A;  1QB1 A;  1YPK H; 
#chains in the Genus database with same CATH homology
 3GS9 A;  3OAA D;  2A4R A;  3SU4 A;  2A4G A;  4R8T B;  5ETX A;  3F0P A;  4DT4 A;  1W0K D;  3OEH D;  2XCN A;  3U1I B;  2GVF A;  5HKK D;  2WV9 A;  1DY9 A;  3O8B A;  4B74 A;  3SUD A;  5IK2 D;  2O8M A;  3PV5 A;  3W1E A;  2YMS B;  5GJ4 B;  3O8C A;  2QF5 A;  2OC7 A;  2M2A A;  1COW D;  3FO8 D;  4I32 A;  2IJO B;  2WHX A;  3SUF A;  4A1T A;  3NRL A;  2F9V A;  5C17 A;  3OTP A;  1S6L A;  2YOL A;  2W6J D;  2KM0 A;  3SU0 A;  3H09 A;  5C0T A;  2JJ1 D;  2KZ4 A;  2WSS D;  2V7Q D;  2JDI D;  3SV9 A;  1JXP A;  2XOK D;  3SUG A;  5EQS A;  3RC5 A;  4XD7 D;  2KCP A;  3KNX A;  3SV8 A;  4TYD A;  2WPD D;  4B6E A;  1OHH D;  3FKS D;  3KF2 A;  1E79 D;  3OYP A;  2OC1 A;  3FOA A;  3O8R A;  1EFR D;  5FPY A;  2HLD D;  5EQQ A;  5ESB A;  3P8O A;  4WF8 A;  4A1X A;  4F55 A;  4B71 A;  4A92 A;  1BT7 A;  1NBM E;  4B76 A;  1DY8 A;  1W0J D;  2LEL A;  2XNI A;  2JJ2 D;  3KN2 A;  5GND A;  3RC6 A;  2K1Q A;  5FPT A;  3U1J B;  2KCO A;  3SU3 A;  3N7D A;  2OIN A;  3M5M A;  4WH8 A;  1FX0 B;  4ZCN A;  1DXP A;  5EQR A;  5T1V A;  3SU6 A;  5FL7 D;  4NWL A;  2YMS C;  1WXR A;  3DCL A;  2F43 B;  2F9U A;  2J5U A;  3M5O A;  3ZIA D;  4Q63 A;  3M5L A;  3WW7 A;  1N1L A;  2FOM B;  4Q4L A;  5H4I B;  1SKY E;  2L6O A;  2OC0 A;  5EPY A;  1NBM D;  5DSF A;  2QF4 A;  3OE7 D;  3SV7 A;  4A1V A;  1RTL A;  1KMH B;  2CK3 D;  4KTC A;  4NWK A;  4U01 A;  3SU2 A;  2KCY A;  3O8D A;  2QV1 A;  4TT3 D;  1DXW A;  3SYJ A;  1W3C A;  4ASU D;  3F2F A;  5F53 A;  2OK5 A;  2XND D;  1H8H D;  4M9F A;  3LKW A;  4Z1M D;  2KFW A;  4JMY A;  3P8N A;  3EYD A;  5CHB A;  3N99 A;  3WWB A;  3L6P A;  2A4Q A;  2QE7 D;  2WZQ A;  2OBO A;  3AK5 A;  2K0Q A;  3SU5 A;  4B6F A;  3DSO A;  3F3B A;  3DSP A;  3KEE A;  3SUE A;  1MAB B;  2W6I D;  4YXW D;  3LOX A;  2P59 A;  2FM2 A;  1CU1 A;  2F4L A;  4I31 A;  1E1R D;  3F2H A;  5DN6 D;  3WWF A;  5C0U A;  4WH6 A;  5FPS A;  3FN8 A;  4B75 A;  3F0O A;  3F2G A;  5EPN A;  1E1Q D;  2JIZ D;  1RGQ A;  4TSF D;  1A1R A;  2KCA A;  3SZE A;  1BMF D;  3OFN D;  4K8B A;  2OBQ A;  3PRB A;  5GPI B;  3RC4 A;  3PV2 A;  2KR7 A;  3VG8 A;  5B6L A;  3OEE D;  5CDF E;  2XCF A;  2K8I A;  2IJD 1;  2OC8 A;  2VBC A;  3LON A;  1H8E D;  4FET A;  2AHM E;  3PRD A;  3UB0 A;  2GGV B;  4B73 A;  5IDK A;  3N7E A;  3SV6 A;  1NS3 A;  2YMS D;  3E90 B;  3M5N A;  2FP7 B;  4OM9 A;  4RI0 A;  3SU1 A;  4I33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...