1O3CA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA02
3VPKA 4MVNA 3TJUA 4I8GA 3MU4A 4AOQA 3RP2A 2ZHFH 3GCTF 2H2ZA 4CR5A 1TMUH 3W95A 2PKAA 3ZVBA 3EA7A 1K21H 1AFEH 2CMYA 2B9LA 1FN6A 1C5XB 2GD4B 3ZV8A 1YC0A 3SUGA 5LPRA 2QYIA 3MTYA 2ESTE 3P95A 3A7YA 4YLUA 1UTMA 3LH3A 2D2DA 2TGTA 5TCAA 2WYGA 1GDQA 1QRWA 1MTVA 1LPZB 4B2AA 1A5IA 1MKWH 1P10A 2BLWA 5DP5A 1VITG 4KTUA 1O2LA 3H5CB 1ZPZA 3ODFA 3MI4A 1C1OA 4AB9A 3S69A 1Q3XA 2OC0A 1IQHA 5DO4H 1WSSH 1V2NT 3U1IB 2VJ1A 3VXFH 2GV7A 1V2LT 2EC9H 2VH0A 2Z9JA 2RG3A 5JBAS 3D49H 1OKXA 3I78A 1HNEE 1CA0C 1XVMA 5DP8A 3AAUA 3GCHC 2D26C 1GCDA 2P8OB 1F0RA 3DD2H 1HXEH 1ZTKA 2P3TB 1AGJA 2STAE 4M7GA 2XBYA 1ELBA 1HB0B 2G4TA 5JYIA 1RS0A 3Q3KA 3A81A 3GISB 3K9XB 4I7YH 1QR3E 5FPTA 1FIZA 2OTVA 4I33A 3K6ZA 1O30A 1LQEA 1E38B 4GSOA 1BRCE 5E0HA 1CSOE 3A8BA 3LT3A 5DG6A 3GCOA 3SJKA 3SUEA 3SW2B 1L4ZA 1TGBA 1P2OA 1C5ZB 1TA2A 2VIVA 4K69A 3SV2H 1P2QA 1BB0B 1P2NA 1PPHE 2VIQA 1AUTC 1C5YB 4Z0KA 1MZDA 1AVXA 1RTFB 3LKWA 4WXVA 1FJSA 1DLEA 2FZZA 4CRBA 2LPRA 2P93A 3VXEH 2R9PA 1OWIA 1GGDC 2XYAA 2F83A 1PPZA 1CHOG 1A46H 4WY3A 1IOEA 1TFXA 3A80A 1SFIA 4UFFH 1TGTA 4JK6A 1O3FA 1RFNA 1SGPE 2QXGA 1DPOA 3A8DA 5CHAC 1OWKA 1QBVH 1HAIH 3RXGA 3MFJA 3H7TA 1SLWB 1EAXA 1W8BH 2ZFQH 1TNGA 3P92A 3SU6A 1A61H 1XM1A 1O5FH 2BY5X 3MH4A 4HGCA 3H7OA 3ZVCA 4H4FA 3PMBB 1YYY1 2ZFFH 2ZU1A 2GZ8A 1THSH 2ZGHA 2Q6GA 1O2QA 1EPTA 4QT8C 1EKBB 1G3CA 3DT0H 1DT2A 3HKIB 1QL9A 2AMPA 4XBCA 4UDWH 3SHCH 1QJ7B 2ZU3A 1XUKA 1P9UA 2VH6A 1AO5A 2WPJS 4BTTB 5EGMA 1IQLA 1V2TT 1DWEH 3T62A 5A8ZA 1AVWA 1MQ6A 5E2OA 3EA8A 4ISIH 3KQEA 4I8LA 1GDNA 3IITA 1NS3A 1KIGH 1MCTA 2FTLE 2W3KA 1SGQE 2BD5A 4NIVA 3GY4A 4UFEH 6ESTA 4FVBA 1V2KT 1NPMA 2PTCE 1KTTB 3RM0H 2Y5FA 1BZXE 3ZZ5A 1BITA 3KQCA 4IS5A 2Z9KA 2QC2A 1CBWC 1A7SA 1A3BH 1CGJE 2IPHA 2QN5T 1S0QA 3MU0A 2PLXA 2A5AA 2BVSH 5C20A 1JRTA 2FI3E 3HKJB 1QJ6B 3T26A 1TB6H 3FP8E 4F49A 5EODA 2JH5D 1K1MA 4AFUA 1GBIA 3U9AH 1V6DA 3PYHA 1S0RA 2ZWLH 4ABHA 1TNLA 5JPMH 2Q6FA 3BTME 1LKBA 2F9NA 4IN1A 4WMFA 1Y59T 2ODPA 2XBXA 3QGJA 5HMAA 2BOKA 3EYDA 1C1PA 2CXVA 1P2MA 1O5GH 1Z8IB 3RXKA 3S7KB 1NRNH 3KNXA 2B0FA 1DSUA 3HK3B 4FU7A 4X1PU 1MTNC 1EJAA 1EPTC 1VJAU 1ZGIA 1XVOA 1E37B 1C5SA 4I8KA 1X7AC 5SGAE 2AEIH 1O3NA 2ZQ1A 1AKSB 3C1KA 5GDSH 4O03A 1YCPM 1Z6JH 1W11U 2VWOA 1O2HA 4Q7YA 3GY7A 1O38A 2PKSC 1ZRBA 1W0ZU 3BTEE 4A7IB 3RXBA 5BPEA 1TALA 2EEKA 2WINI 3RXVA 3T25A 3E1XB 3RXEA 3BTFE 1XUGA 3QZQA 1T8LA 1S83A 3LGWA 3Q3YA 3JZ2B 3QWCH 4Y8ZA 1TPSA 1EZSC 2O8UA 1SR5C 1HAOH 2FOFA 4XBDA 1NESE 2F9BH 2CJIA 4Y8XA 1Y8TA 1GBLA 1BMAA 2A32A 2GV6A 1MU6B 2Q1JA 2TGDA 4FU8A 4TWWA 4U30A 5F8TA 1NT1A 3M37A 3LONA 1E34B 1VZQH 1HAZB 2A4OA 3MWIU 1P9SA 2UUYA 1W7GH 2H5DA 4ABJA 1SGTA 2BX4A 1AKSA 4K8YA 1P02A 1QB9A 4B1TA 4DOQA 1SGFG 4TPIZ 4ZKSU 3O8DA 1TABE 4ZKOU 5B6OA 2AGGX 4WMDA 2ZGJA 1O2VA 4KTSA 1C1UH 1JXPA 2J4IA 2SGPE 1T32A 1O5CB 1SBWA 2ODYB 1ANDA 1G2MA 3BG4B 3NPSA 5IDKA 1C4U2 2YNAA 5AVDA 1AE5A 2OQUA 2ZCHP 1E36B 4XDEA 1SGDE 2BQ6B 1FY3A 1AFQB 1KXCA 1BMNH 3OY6U 3OY5U 1P8VC 2HVXA 1GJ4H 2GMTC 3ATLA 4B71A 4AFZA 4BANB 1GI7B 2H1UA 1W7XH 1SVPA 3T5FH 1MU8B 4ZAEA 1AD8H 4Y0ZE 1UVUH 1F0SA 2ZCKP 3RMNH 3VB3A 2HNTE 1A0LA 1O2WA 4OGYA 5IYTA 2BY9X 5JB9S 1INCA 1MQ5A 1C2EA 2ANKH 3BTDE 4I8HA 5C5OA 4FVDA 1ARBA 1FONA 2WPIS 5EQSA 5EPYA 3ZZ6A 2XBVA 4YESB 2XXLA 3VFEA 3GYLB 2XWAA 4HI3A 2FEQH 2Y81A 2C93B 3ATWA 2QGRA 4JZ1A 4O97A 3RXPA 3SQHE 5AF9H 1P57B 2BDBA 2UWPA 5DJ7A 1EUFA 1GJ5H 2ZEBA 1K2I1 4MNWA 1C9TA 4NGAH 2NU4E 3OU0A 2J92A 3UPEA 4CBNA 3U8TH 1DICA 2G00A 1SL3A 3PB1E 4SGAE 1TOCB 2XRCA 2BZ6H 3PLKA 2ZP0H 3A88A 1A0JA 1RRKA 1DE7H 2GDEH 2AYWA 4XE4A 1ELTA 5K0HA 4AG2A 2BDGA 4RKOB 1UJ1A 1GBTA 1O2MA 4X8UH 1O3LA 2HALA 4FUJA 4BAHB 1C2HA 1K1OA 1QB6A 5EQQA 1O2NA 3ENSB 6CHAC 1HUTH 1EJMA 1EOJA 1V2MT 2FLRH 1O2RA 1ORFA 2ZC9H 2EI8A 1YGCH 2J95A 4DGJA 2GX4A 4FUDA 4THNH 1DWDH 2GCTB 1L1NA 2A7JA 2PFEA 1GGDB 1MKWK 1W13U 2SGEE 2R3YA 3TK9A 3RXMA 4X6NA 3BTKE 5FPSA 4CRGA 2FTMA 4CHAB 2GP9B 5DKMA 1T7CA 2GCHG 4RN6A 3MNBA 3QK1A 2BD4A 1O2TA 4R0IA 1O2YA 2TIOA 1O36A 3TH3H 1XUJA 2ANWA 1V2ST 2BQWB 1O3CA 4X8SH 1IQIA 5BRRE 1P01A 3QZRA 1EJNA 1ZZZA 1AI8H 1XUFA 3PMHB 4O3TA 1B5GH 3TVJB 3UTUH 4BAMB 2FXRA 1AIXH 1C4Y2 1TBRH 1MMJN 1C5WB 3GCTG 1O3OA 1S84A 4Y8YA 2KAIB 1THRH 4GCHF 1ELDE 1DX5M 4KGAA 2A5KA 3BEIB 4H6SB 4WXIA 4Y6DA 4U01A 1KLTA 1CA0B 5CE1A 1F5KU 3RXCA 2R2MB 5EW1H 1TNHA 3MO6A 3SGAE 3SGQE 2C8YB 4NZQA 1BTXA 2CGAA 2F9UA 3I29A 2D8WA 1DS2E 1TGSZ 5F8ZA 4MNVA 5L2YH 1CT4E 4AGKA 2PGQB 5E0JA 3SJOA 2W7UA 1J8AA 3ELAH 1F92A 1G32B 1P06A 4D9RA 2YNBA 1GJCB 1C9PA 4ABAA 3GDSA 1HCGA 1QJ1B 3SZNA 1HRTH 3QUMP 2A1DB 4HFPB 3PWCA 4KTCA 1GBKA 4TY6A 3BF6H 2F91A 4XBBA 1SHHB 1ANCA 3Q00A 3SO3A 1AB9B 1A4WH 1AQ7A 4D76A 4GHQA 4GHTA 4B2BA 1VCQA 4Z6AH 3GY2A 1SGNE 1GG6B 2GZ9A 3PTNA 2BB4A 3EDXB 1QCPA 4FUHA 1YBWA 3UNQA 3RMOH 3RU4D 3P6ZB 1EAIA 3SU4A 7GCHG 4GCHG 1FY5A 4MNYA 5GPIB 1F5RA 2GT8A 1ANBA 1T31A 1YPEH 3TK6A 5T6GA 3S0NA 1UMAH 3AASA 2ULLA 1ZR0A 3JZ1B 2ZQ2A 3PMAB 2RA3A 4X2YA 1BTZA 2A5IA 4NA7A 5E2PA 1MUEB 4BTUB 1P09A 3A89A 5C2ZA 4J1YA 1FV9A 2HPPH 2G8TA 2PR3A 3VB6A 3SGBE 1B0EA 1ELVA 3UIRA 4GUXA 1CGIE 1PQAA 1TPPA 1K1LA 2FESH 3CP7A 2RA0A 2ASUB 5EXNA 3QTVH 1YM0A 1DSTA 1ARCA 5F03A 3KEEA 1P2IA 2DUCA 5FX5A 8ESTE 3ESTA 2GTBA 3F6UH 4YT7H 2F9OA 1V2JT 1H9LB 4Y7BA 4BNRA 1QFKH 2ANYA 1S85A 2Z6BD 3UNSA 3E16B 3A83A 1YPHE 1Y3UA 4AX9H 1OWEA 3V12A 4ZXYH 1CHGA 2XTTB 3ZVFA 1D6RA 3F9FA 1BTUA 4TYDA 1HV7A 1SC8U 4NIWA 2WPMS 3F68H 1QB1A 2SNWA 2ZF0H 1ZJDA 2ALPA 2NU3E 4JMYA 3FAOA 4MQAA 2VVVA 1EX3A 3ZVDA 1HAHH 1V2UT 1WCZA 3BTTE 1C5MD 1BT7A 4B75A 2O8TA 1C4V2 4CBOA 2BXTH 4CHAC 1KXAA 5C1UA 4HZHA 1KDQA 1G3DA 1BUIA 1L1JA 3UNRA 3BTHE 4IMZA 1RGQA 2ZPRA 4ZH8A 3A84A 2AH4X 1WOFA 3DUXH 1GI2A 1BMLA 3O8RA 2M5TA 1GVLA 4DG4A 4UD9H 5L6NH 1QGFA 2K1QA 3ATIA 4FUFA 2WUBA 2BD2A 1ZSLA 1ABIH 1LDTT 1RXPA 3PROA 3GY6A 3A85A 4IMQA 2FI4E 2OXSA 3A86A 3DFLA 2W26A 4Q80A 1K1PA 2C90B 3U98H 4MPVA 3W94A 1BDAA 1QURH 2C8XB 5T6FA 1HAPH 1SGFA 3LJOA 2CHAB 2BLVA 4OS6A 1V2WT 1V2RT 1GHZA 2PW8H 4K1SA 3ZZCA 2QXIA 3SN8A 1TBZH 1GDUA 3GCNA 4YT6H 2WPKS 1TWXB 1O3KA 2KAIA 2UUJB 2VIOA 1P2JA 3OX7U 1UCYH 2J38A 1W10U 1D3DB 1RIWB 1SGCA 3TH2H 1WU1A 2BQ7B 2H9EH 3UOUA 5JBCS 2AS9A 1UCYE 1XUHA 1C1SA 1YKTA 1OWHA 3ZVAA 3SU0A 3SNDA 1OOKB 2IJOB 1UTLM 1BMMH 2ZZUH 4X6PA 3M5MA 2R0LA 1DLKB 3MNSA 1L4DA 1RTLA 5EPNA 4E05H 1AB9C 3PO1B 2ZA5A 3S9BA 1V3XA 2H9TH 3PTBA 2ZGBH 2F3CE 2RCEA 2OINA 4RKJB 1C2LA 5J4QA 1T8NA 2JETC 4E06H 3FP7E 3KL6A 4X0WU 1Z7KA 1O37A 1KXDA 2ZIQH 1C5TA 2FPZA 4NG9H 2QF3A 1Z8RA 4ISNA 3ZZ9A 1KLIH 4JCNA 1DXPA 3RLWH 1XUIA 2A7HA 1L2EA 5GCHG 5T3HA 2GDDA 2GCHF 2FYQA 4DURA 1P05A 1TAWA 2TGAA 3BG4C 5H4IB 3NUMA 1BJUA 3M3TA 4BOHA 2SGFE 1QTFA 4H6TA 1QRZA 2FS8A 4AN7A 3BTGE 4LZ4B 2C8ZB 3NZIA 3RXQA 1BBRK 1C1WH 2BLQA 2ZHWH 3LGIA 1QA7A 2TRMA 1GJ7B 2Q6DA 3BEFB 1NZQH 3O8CA 1GI9B 2P3UB 2RDLA 4U2WA 1NU9A 3MH6A 1LVBA 3P70B 1TYNA 3DHKH 4MPXA 3ATKA 3MU8A 1IQFA 1C1TA 3A7VA 2HNTF 4NWKA 2FO9A 2OC1A 1TPAE 2HLCA 1LHCH 2FOMB 3ZVEA 1GBMA 1AHTH 2ZU4A 2VU8E 2EI6A 2JKHA 4NIYA 1BIOA 2GKVE 3RDZA 8GCHF 2V0BA 3SHAH 1IQGA 4FUGA 2UUFB 1K1NA 2HOBA 3C27B 4INLA 1YPJH 3AW1A 4AYYB 1WYKA 4AGJA 1NC6A 2UWLA 5I25A 3KQDA 1LHEH 1TONA 1O3GA 3RXTA 3QN7A 5C67A 1UTQA 3V13A 3I77A 3K6YA 1EZXC 2Z94A 3BTQE 5TCCA 4WH6A 2FP7B 4Y11E 2A31A 2AGEX 1AZ8A 1M9UA 4WF8A 2TGPZ 3U8OH 2OLGA 3SV8A 1ELCA 1NFWA 2Z9GA 1CO7E 4X8VH 1GG6C 2BX3A 1N8OB 4UFGH 1N6YA 3GDUA 1EAUA 1C2DA 2QY0B 4Y76A 1GJAB 2D1JA 1U6QA 1Y5AT 3E3TA 3UR6A 1H1BA 3V7TA 1TRNA 1KXEA 1TA6A 5EQRA 3IG6B 4DIIH 1RD3B 2G52A 2FDAA 4TY7A 1AWHB 3ZZ3A 2QA9E 4JZEH 3SUFA 4U32A 1LPGB 5T6DA 5JBTA 1MD7A 5F8XA 3L3TA 1CBWB 1UVSH 3HPTB 1EP6A 4B74A 8GCHG 1GVZA 2Z7FE 3PV4A 4F4OC 2AFQB 5AFYH 1SI5H 2WPLS 3M7UA 1YLDA 1ESTA 1C1RA 2ZTXA 1C2FA 2XBWA 2ZGXH 1YCPH 3P17H 4K2YA 3FP6E 1BRAA 1O2IA 5GXPA 3BSQA 5EXLA 4AFSA 1G9IE 1O2PA 1FDPA 1SQOA 3L6PA 2BY8X 1C2GA 1UTPA 1KLJH 3E8LA 2OD3B 1JIRA 3QDZB 3DA9B 2P3FH 1OYTH 2ANMH 3E0PB 7LPRA 5AFZH 1IHSH 4JZFH 1JIMA 1UK4A 2WV5A 3M3SA 5TJXA 1CU1A 3RMMH 1H8DH 1Y3YA 5FPYA 4BAQB 4CREA 1ZOMA 1HJ8A 3KN2A 3SJ8A 5JB8S 2PSYA 1O32A 1UTOA 1LCYA 2Z3DA 1OP0A 2B7DH 2ZDAH 3ZV9A 1FPHH 2VB0A 1AFQC 2PUXB 3UQVA 3SQEE 3K65B 1YPLH 4I31A 2O8MA 3MH7A 1UCYK 4UEHH 5F6MA 2Z3CA 1PQ8A 1PQ5A 2BVRH 2ZDLA 1O3HA 1C2MA 1MKXK 1HAVA 1GI8B 2J2UA 3SU3A 1TRMA 1K1JA 1EASA 3B8JA 3F9HA 4SGBE 3LGUA 1XKBC 3STJA 1GHWH 1FNIA 5EW2H 1C2JA 1O2KA 1BCUH 4NIXA 3NCLA 1O2UA 3D65E 3TNTA 1FAKH 2ODQA 4ABGA 1WUNH 1HDTH 1B7XB 1BHXF 4NCYA 2A4RA 4YTAA 1BRUP 2AGIX 5HM9A 1DFPA 1FXYA 1OSSA 4ISOA 1ELAA 2HNTC 1F2SE 3S7HB 2PV9B 2BDIA 4K1EA 3RU4T 3HK6B 1MTUA 1GWAA 3RC5A 2Y82A 1XXDA 4A6LA 5DP7A 2NU0E 1GHBG 4ZKRU 1ABJH 2BDAA 3U8RH 1J9CH 1HAGE 4X1NU 6GCHF 2P16A 2VVUA 1W2KH 1MBMA 4CH8B 1ZHPA 1GI0A 1ID5H 2BD3A 2P8OC 2BHGA 5GJ4B 1VCPA 3TU7H 2DE9A 1LO6A 1EPTB 1T8OA 1C5LH 3HGPA 2UUKB 3NKKA 1YPKH 1F5LA 1MZAA 3O8BA 1A3EH 4OS1A 1SHYA 1PQ7A 2XCNA 3M7QA 4WVPE 3SORA 2AIQA 5E8EH 2FX4A 2FOAA 3BG8A 3BEUA 1CHOF 1C5NH 1IHTH 1GHBF 1NTPA 1S81A 1EP5A 2BLOA 1FY8E 1GI4A 1PPCE 4CR9A 1UVTH 3ODDA 4Y10E 1Q2WA 1LVYA 3EQ0H 5ESTE 4UFDH 4OS7A 4Q7XA 4NFEA 4ABBA 4AZ2B 2BY7X 1OWJA 4YO9A 1EZUC 4ZKNU 2Z9IA 4YOGA 2AMDA 2XC5A 1PPFE 1YPHC 2LNCA 2C3SA 2BDYA 5HXFA 1H8IH 2G81E 3RXDA 1ZTJA 1GI3A 3V3MA 1P0SH 1WV7H 4JZDH 2EI7A 1DANH 3MO3A 3VB7A 3SNAA 1D3TB 5HM2A 4B76A 2P59A 4O9VA 1QQUA 1Z8JB 2ZU2A 1TE0A 3SJIA 1BBRH 4YM9A 4OGXA 1O5DH 4KELA 3URCA 1A0HB 1FIWA 2H5CA 3K2UA 1JBUH 2H6MA 1V2QT 5CMXH 3OSYA 3LGVA 1HAXB 1GI1A 5ESBA 1GMDG 2ZPQA 6LPRA 5LPFA 3TK5A 1IQKA 3RUOA 1ZTLA 2PHBA 3Q76A 7KMEH 1EB1H 1O2SA 4E7NA 1ACBE 3QX5H 1O3MA 1T4UH 4A92A 3T28A 3SU2A 1TX6A 1NFUA 2F9PA 4LXBH 3PLBA 1VITH 4UONA 1P3EA 1CT0E 3UR9A 1ETSH 1HIAA 2ZDMA 2BDHA 4IW4E 4NWLA 2UWOA 5A0BA 3UQOA 1N1LA 2W3IA 4CH2B 1SG8B 1GBAA 5FX6A 1D9IA 2BVXH 3GCHB 1MTNB 4RSPA 2ZDVH 1DWCH 3KQBA 3TNSA 4ISLA 1C1VH 2P94A 1FN8A 1W0YH 2HPQH 5DGJA 5DP4A 5DP3A 1VR1H 1Y3XA 1PFXC 1EATA 4E7RG 2OQ5A 5DP6A 1SQAA 2CV3A 4K5ZA 2DE8A 3RXAA 4DIHH 1C5UA 1WTHD 2ZU5A 2BY6X 3NWUA 1TPOA 5ETXA 3LU9B 2FOHA 3KIDU 1SFQB 4FU9A 1GJBB 1OXGA 1J14A 5A0AE 1LKAA 2Y5GA 2JH0D 1S6FA 4B73A 4B2CA 1WQSA 3SNBA 1O3BA 2ZTYA 4TWYA 2G55A 5FAHA 3SI4H 1FMGA 1J15A 4ZUHA 2FWWA 1YCPK 2CF8H 4H42U 3SV7A 1C1NA 1S6HA 4MNXA 1CVWH 3SI3H 3P8OA 4OS5A 2J9NA 4NSVA 2PTNA 4WH8A 1TMBH 1PYTD 3UREA 1LHGH 2XC0A 4AB8A 1O35A 1UTKA 4ZHMU 3TJVA 5A0CA 5K7RA 5GIBA 1Z1IA 1JWTA 3GDVA 1P12E 2B5TB 1P04A 1GBBA 1SOTA 3CS7A 1C1MA 1D3PB 1DWBH 2SNVA 1QHRB 1HAYB 1DDJA 1OP2A 1SMFE 5EU8A 4DVAU 1IAUA 1OS8A 1TBQH 5GCHF 1O2OA 1GI5A 3D62A 1BBRE 1O0DH 3BIUH 2Y7ZA 5A09A 5E0GA 1ZYOA 1GHXH 1BTPA 1SGIB 4OS4A 1TGNA 1QY6A 1GMDF 1BTYA 1EAWA 3MU5A 3B23B 2EA3A 2ZECA 3MNXA 1N8OC 5CHAB 2Z9LA 3ZVGA 1MTSA 3FVFB 4GVUA 4ABFA 5A8XA 1UK3A 5A8YA 1KXFA 5HGGA 1YF4A 1YP9A 3KCGH 4INKA 3UY9A 1Z8GA 1YLCA 3VGCB 1CE5A 2FYRA 1A2CH 4JZIA 3E91A 2NU1E 2PKAB 1O3EA 1LHDH 2R2WU 1ZGVA 1O3PB 3LPRA 3R0FA 3QGNB 5FBIA 2A2QH 2R3UA 1O2ZA 2A2XH 4CRFA 3IWMA 1PJPA 1VJ9U 1GJ8B 1TNIA 2G5VA 2XW9A 2QCYA 3GY3A 3TJOA 2PUQH 3SV6A 4J2YB 1MCVA 3MNCA 2A4GA 1GJDB 1IQMA 3UOPA 2FI5E 1QL8A 3PLPA 1C2KA 2VIWA 1GI6A 1MH0A 2OCVB 1QBNA 1BJVA 4X1SU 5DP9A 2OBOA 2O9QA 3URDA 1EZQA 3A8CA 1FY4A 1GBJA 1G3BA 3PM3A 2OC7A 2G51A 1O2XA 1BHXB 1TNJA 1SPJA 1OPHB 1LHFH 2FODA 1VITF 1K28D 5EOKA 2QXJA 1F0UA 1OX1A 1T4VH 5FHTA 4DT7B 1TX8A 3RXSA 4X1QU 2NWNA 1AVGH 3A7ZA 3U1JB 4BAOB 1DUAA 3EAJA 3AAVA 2A0QB 1MKXH 8KME2 1GMCF 3SNCA 5L30H 4ABIA 2R0KA 1TOMH 1YPGH 1MTWA 2ZCLP 3BIVH 2JETB 3T27A 3UWJH 2ILNA 1UHBB 4KKDA 4XSKU 3B9FH 1SLUB 4CRDA 4ZXXH 3VB5A 3PO1C 1IQJA 4AFQA 1F0TA 3PMJA 3F1SB 4NA8A 1A5GH 1HLTH 2FOGA 1WQVH 3E6PH 1VGCC 2A7CA 3NXPA 2FLBH 5G4BA 1V2OT 1ANEA 1BTWA 2P95A 3TGKE 3P8FA 1HPGA 1NO9H 1XMNB 2OP9A 1C5RA 3F9GA 2BDCA 3PWBA 3RXUA 3UFAA 1H9IE 1ZMNA 3KGPA 3TGIE 1C5QA 2ZFRH 3ZZ4A 3RC4A 1PPGE 2QF0A 1O31A 1KTSB 3GY8A 1UK2A 6GCHG 2ZI2H 1QNJA 3RXRA 3MMGA 1Q31A 4KP0A 1G2LA 3SV9A 3ZZ7A 1DY8A 2VGCC 4Q2KA 4BXWA 2H9HA 2VVCA 3BN9A 1W12U 4GLYA 4X2VA 3HGNA 4ZHLU 4MLFB 3SOSA 4ASHA 1J16A 2PWXA 3BV9B 2QAAA 1O2GH 1J17T 2ZG0H 2FOCA 3EA9A 3FANA 1MD8A 2G5NA 1O3IA 1XKAC 2IOTA 3LJJA 3T2NA 5FCKA 5FXLA 2YOLA 3SNEA 4YOJA 2AIPA 3TGJE 2ZDNA 1ZHMA 1LMWB 1HFDA 1THPB 2V3OH 3ZZDA 3QTOH 5JBBS 1HAVB 1SGEE 2HWLB 3LC5A 1HGTH 1TIOA 4FXGH 3MHWU 3GY5A 4A1TA 1XX9A 3E0NB 1KSNA 3M36A 3V0XA 2A4QA 2ZO3H 2G4UA 2PSXA 4NFFA 1KYNA 2OC8A 2SGAA 4NA9H 4DW2U 3ATMA 1GBDA 3WY8A 4LZ1H 1LVOA 2FOBA 4DY7B 1DY9A 3E90B 2W7SA 1SLXB 1TQ7B 4GPGA 4A1VA 1E35B 3GYMA 1AY6H 3LC3A 5EXMA 4GAWA 4IC5A 1O3JA 1UTJA 2BD7A 2BZAA 1IQEA 3L33A 3M35A 1F7ZA 4ABDA 4JK5A 1RJXB 4ISHH 1CGHA 4IN2A 3BTWE 4DCDA 1RTKA 1UVOA 4ZHAA 1C2IA 1G3EA 4YOIA 3TJNA 4K1TA 2FOEA 1K9OE 3SJ9A 2GCTC 4Y79A 1O33A 1NROH 2XC4A 4FUEA 1L0ZA 2HGTH 1OYQA 2F9VA 3TLOA 1FI8A 2WYJA 1QIXB 1HJAC 1YPMH 2V3HH 1DM4B 1D6WA 4ZMAH 1GCTC 1NN6A 4WWYA 3ZZBA 3LGYA 3EGKH 1GBHA 1L1GA 4JYVH 1G37A 1ZMJA 1D3QB 1TRYA 2VGCB 1VCWA 2THFB 1DVAH 1ZPBA 2PGBB 1K22H 1ZPCA 5FCRA 2VWNA 1H9HE 3RXFA 2BD8A 3VB4A 2FM2A 2GT7A 2NU2E 4YLQH 1IQNA 1ZSKA 5GWZA 4X2WA 4JYUH 9ESTA 1BQYA 1SLVB 4WMEA 2FMJA 1MAYA 1NM6A 1GMCG 2FIRH 1KXBA 4D7GA 3RLYH 1S5SA 2FX6A 4VGCB 3LGTA 2OUAA 5LGOA 4D8NA 1H4WA 1Y5BT 2HRVA 3QLPH 1SQTA 3RXJA 4HTCH 1KY9A 3NK8A 2WUCA 3D23A 1VGCB 4Y0YE 1S82A 1GHAG 4FUCA 2SGDE 1DUEA 1FQ3A 3F9EA 1PYTC 3M5NA 5FBEA 5A2MH 1BRBE 1FZZA 3T29A 4X8TH 1AU8A 1DITH 4YZUA 2GZ7A 5C5NA 4X6OA 1GL0E 2C4FH 2ZTZA 3HATH 3RXLA 2ZKSA 2J34A 3ZYEA 1LTOA 1GMHF 3FFGA 1GJ9B 1GCTB 3M5LA 3FZDA 1WBGB 1XXFA 5LH8A 4IBLH 5EG4A 1NY22 1HJAB 2CF9H 2GMTB 3QO6A 1LQDB 4Y71A 1GVKB 1GPZA 1JMOH 3AVZA 1OP8A 2BM2A 1CQQA 2BXUH 3M3VA 4IC6A 2VNTA 2ZHDA 2QXHA 1NRPH 3SUDA 2BD9A 3A82A 1P03A 1GL1A 1TLDA 1ESBA 1HIAB 1GHYH 3MU1A 3G01A 5C3NA 3CENA 3MH5A 1ZHRA 2BYAX 3Q77A 2V6NA 1AZZA 3TH4H 2TPIZ 3MO9A 1ZSJA 1NFYA 3TIUA 1SGYE 1TGCA 1O2JA 1UTNA 4ZROA 1EXFA 2QIQA 1WAYB 2Y80A 1LPKB 7ESTE 4MG3A 2O8LA 4X1RU 2ZFSA 2VIPA 2B8OH 2ZFTA 3MYWA 1PPEE 3A7TA 1Y3VA 3LIWA 2I6QA 3LOXA 1EB2A 1Y3WA 3Q3XA 2I6SA 3LH1A 1FUJA 1O3DA 1ELGA 1SGRE 3GOVB 1QBOA 2ZNKH 4ESTE 1C5PA 1BTHH 1PPBH 7GCHF 1CT2E 1CA8B 1HBTH 2ZPSA 2ZGCA 3KHVA 2VIDA 1G36A 1C5OH 4MTBA 1BOQA 3ZZ8A 1WTGH 2STBE 5HYOA 1O3AA 1GMHG 1ZMLA 4D9QA 4LOYH 1ZRKA 3U69H 1JOUB 1Z71A 3CS0A 4K3JA 2JH6D 4NSYA 1MBQA 2XWBI 2ZHQH 3KF2A 4MDSA 1C5VA 4I8JA 4VGCC 1Z1JA 1QL7A 2V35A 1RIWC 1TNKA 4CRAA 1GBCA 2Y5HA 4DJZB 6CHAB 1NU7B 2W5EA 1NFXA 2VINA 4OS2A 1GJ6A 4LK4A 2VWLA 8LPRA 1FLEE 1AN1E 1B0FA 1TQ0B 1V2VT 3OTJE 3RM2H 4MPUA 1W14U 1P2KA 2Y6TA 3ZYDA 2GGVB 4WJG2 2Y7XA 3RXIA 4IGDA 2CHAC 1A1RA 4XFQA 5L2ZH 3A8AA 1GHAF 1BA8B 1HJ9A 1ZLRA 4NZLA 1TX7A 3MOCA 4XOJA 9LPRA 1EQ9A 2WPHS 1QQ4A 1ETTH 2WV4A 5I46H 1ZJKA 4AYVB 3SBKA 1T8MA 3N7OA 2A45B 2O8WA 1MAXA 3OYPA 1NRRH 1QRXA 3R3GB 3DFJA 4A1XA 3ITIA 1HYLA 5PTPA 1UHBA 1ETRH 3M61U 4BXSA 5JDUB 3GICB 1GBFA 1OWDA 4D7FA 1UO6A 4X2XA 3STIA 3A87A 3S9AA 5AHGH 4Y7AA 1DOJA 2CN0H 2TBSA 5J4SA 4CRCA 1P11E 4K8BA 4R8TB 3TITA 4FUIA 4I32A 4BTIB 1O34A 3UUZA 2AERH 3RXOA 1V2PT 1AE8H 2ZHEH 1AUJA 1LVMA 3RU4E 3M5OA 2QV1A 2ZDKA 3SU5A 4ABEA 1ELFA 1NRQH 3RMLH 3A7XA 1HXFH 1GBEA 2ZFPH 3FZZA 3SU1A 4UE7H 4X6MA 3S9CA 5C1YA 4PROA 1K1IA 1W3CA 2C8WB 2GVFA 3LDXH 1UVPA 1O5AB 5C1XA 2XCFA 2IN2A 4AG1A 3P8GA 1Y5UT 1AWFH 2BTCE 3P8NA 4A5TS 4TPYA 1C1QA 2XNIA 4Q7ZA 3M7TA 1NRSH 1ELEE 2FS9A 2SGQE 1O39A 3EE0B 2BMGB 1GHVH 1KDQB 3AW0A 1EOLA 5DK1A 1TMTH 5DPAA 3RC6A 3VEQB 1AMHA 2J94A 4K60A 1JRSA 1SSXA 2Z3EA 1O5BB 4O3UA 4AORA 1D4PB 1N6XA 1Z6EA 5LPEA 1DXWA 1O5EH 1FPCH 1SB1H 3ZZAA 3TPIZ 3A7WA 5ABWA 1G30B 2ALVA 2SFAA 1FY1A 4INHA 1ESAA 2OBQA 2BOHB 1P3CA 4BAKB 3VGCC 1FAXA 3UWIA 4FUBA 1E0FD 1SOZA 4JYTA 2PKSB 4MPWA 2VWMA 3RXHA 1A5HA 1QA0A 2AMQA
chains in the Genus database with same CATH superfamily
3VPKA 4MVNA 3TJUA 4I8GA 3MU4A 4AOQA 3RP2A 2ZHFH 3GCTF 2H2ZA 4CR5A 1TMUH 3W95A 2PKAA 3ZVBA 3EA7A 1K21H 1AFEH 2CMYA 2B9LA 1FN6A 1C5XB 2GD4B 3ZV8A 1YC0A 3SUGA 5LPRA 1FX0B 2QYIA 3MTYA 2ESTE 3P95A 3A7YA 4YLUA 1UTMA 3LH3A 1EFRD 2D2DA 2TGTA 5TCAA 2WYGA 1GDQA 1QRWA 1MTVA 1LPZB 4B2AA 1A5IA 1MKWH 1P10A 1W0JD 2BLWA 5DP5A 1VITG 4KTUA 1O2LA 3H5CB 1ZPZA 3ODFA 3MI4A 1C1OA 4AB9A 3S69A 1Q3XA 2OC0A 1IQHA 5DO4H 1WSSH 1V2NT 3F0OA 2VJ1A 3U1IB 3VXFH 2GV7A 4ZCNA 1V2LT 2EC9H 2VH0A 2Z9JA 2RG3A 5JBAS 3D49H 1OKXA 3I78A 1HNEE 1CA0C 1E1RD 1XVMA 5DP8A 4YXWD 3AAUA 3GCHC 2D26C 1GCDA 2P8OB 1F0RA 3DD2H 1HXEH 1ZTKA 2P3TB 1AGJA 2STAE 4M7GA 2XBYA 1ELBA 1HB0B 2G4TA 5JYIA 1RS0A 3Q3KA 3A81A 3GISB 3K9XB 4I7YH 1QR3E 5FPTA 1FIZA 2OTVA 4I33A 3K6ZA 1O30A 1LQEA 1E38B 4GSOA 1BRCE 5E0HA 1CSOE 3A8BA 3LT3A 5DG6A 3GCOA 3SJKA 3SUEA 3SW2B 1L4ZA 1TGBA 1P2OA 1C5ZB 1TA2A 2VIVA 4K69A 3SV2H 1P2QA 1BB0B 1P2NA 1PPHE 2VIQA 1AUTC 1C5YB 4Z0KA 1MZDA 1AVXA 1RTFB 3LKWA 5GNDA 4WXVA 1FJSA 1DLEA 2FZZA 4CRBA 2LPRA 2P93A 3VXEH 2R9PA 1OWIA 1GGDC 2XYAA 2F83A 3GS9A 1PPZA 1CHOG 4RT1A 1A46H 4WY3A 1IOEA 1TFXA 3A80A 1SFIA 4UFFH 1TGTA 4JK6A 1O3FA 1RFNA 1SGPE 2QXGA 1DPOA 3A8DA 2WV9A 5CHAC 1OWKA 1QBVH 1HAIH 3RXGA 3MFJA 3H7TA 1SLWB 1EAXA 1W8BH 2ZFQH 3PV5A 1TNGA 3P92A 3SU6A 1A61H 1XM1A 1O5FH 2BY5X 3MH4A 4HGCA 3H7OA 3ZVCA 4H4FA 3PMBB 1YYY1 2ZFFH 3OFND 2ZU1A 2GZ8A 1THSH 2ZGHA 2Q6GA 1O2QA 1EPTA 4QT8C 1EKBB 1G3CA 3DT0H 1DT2A 3HKIB 1QL9A 2AMPA 4TSFD 2KCAA 4XBCA 4UDWH 3SHCH 1QJ7B 2ZU3A 1XUKA 1P9UA 2VH6A 1AO5A 2WPJS 4BTTB 5EGMA 1IQLA 1V2TT 1DWEH 3T62A 5A8ZA 1AVWA 1MQ6A 5E2OA 3EA8A 4ISIH 3KQEA 4I8LA 1GDNA 3IITA 1NS3A 5C0UA 1KIGH 1MCTA 2FTLE 2W3KA 1SGQE 2BD5A 4FETA 4NIVA 3GY4A 4UFEH 6ESTA 4FVBA 1V2KT 1NPMA 2PTCE 1KTTB 3RM0H 2Y5FA 1BZXE 3ZZ5A 1BITA 2CK3D 3KQCA 4IS5A 2Z9KA 2QC2A 1CBWC 1A7SA 1A3BH 1CGJE 2IPHA 2QN5T 1S0QA 3MU0A 2PLXA 2A5AA 2BVSH 5C20A 1JRTA 2FI3E 3HKJB 1QJ6B 3T26A 1TB6H 3FP8E 4F49A 5EODA 2JH5D 1K1MA 4AFUA 1GBIA 3U9AH 1V6DA 3PYHA 5CHBA 1S0RA 2ZWLH 4ABHA 1TNLA 5JPMH 2Q6FA 3BTME 1LKBA 2F9NA 4IN1A 4WMFA 1Y59T 2ODPA 2XBXA 3QGJA 5HMAA 2BOKA 3EYDA 1C1PA 2CXVA 3OEHD 1P2MA 1O5GH 1Z8IB 3RXKA 3S7KB 1NRNH 3KNXA 2B0FA 1DSUA 3HK3B 4FU7A 4X1PU 1MTNC 1EJAA 1EPTC 1VJAU 1ZGIA 2GJGA 1XVOA 1E37B 1C5SA 4I8KA 1X7AC 5SGAE 2AEIH 1O3NA 2ZQ1A 1AKSB 3C1KA 5GDSH 4O03A 1YCPM 1Z6JH 1W11U 2VWOA 1O2HA 4Q7YA 1NBME 3GY7A 1O38A 2PKSC 1ZRBA 1W0ZU 3BTEE 4A7IB 3RXBA 5BPEA 1TALA 2EEKA 2WINI 3RXVA 3T25A 3E1XB 3RXEA 3BTFE 1XUGA 3QZQA 1T8LA 1S83A 3LGWA 3Q3YA 3JZ2B 3QWCH 4Y8ZA 1TPSA 1EZSC 2O8UA 1SR5C 1HAOH 2FOFA 4XBDA 1NESE 2F9BH 2CJIA 4Y8XA 1Y8TA 1GBLA 1BMAA 2A32A 2GV6A 1MU6B 2Q1JA 2TGDA 4FU8A 4TWWA 2L6OA 4U30A 5F8TA 1NT1A 3M37A 3LONA 5C0TA 1E34B 1VZQH 1HAZB 2A4OA 3MWIU 1P9SA 2UUYA 1W7GH 2H5DA 4B6FA 4ABJA 2YMSD 4RT0A 1SGTA 2BX4A 1AKSA 4K8YA 1P02A 1QB9A 4B1TA 4DOQA 1SGFG 4TPIZ 4ZKSU 3O8DA 5HIYA 1TABE 4ZKOU 5B6OA 2AGGX 4WMDA 2ZGJA 1O2VA 4KTSA 1C1UH 1JXPA 2J4IA 2SGPE 1T32A 1O5CB 1SBWA 2ODYB 1ANDA 1G2MA 3BG4B 3NPSA 5IDKA 1C4U2 2YNAA 5AVDA 1AE5A 2OQUA 2ZCHP 1E36B 4XDEA 1SGDE 2BQ6B 1FY3A 1AFQB 1KXCA 1BMNH 3OY6U 3OY5U 1P8VC 2HVXA 2KFWA 1GJ4H 2GMTC 3ATLA 4B71A 4AFZA 4BANB 1GI7B 2H1UA 1W7XH 1SVPA 3T5FH 1MU8B 4ZAEA 1AD8H 4Y0ZE 1UVUH 1F0SA 2ZCKP 3RMNH 3VB3A 2HNTE 1A0LA 1O2WA 4OGYA 5IYTA 2BY9X 5JB9S 1INCA 1MQ5A 1C2EA 5KECA 1NBMD 2ANKH 3BTDE 4I8HA 5C5OA 4FVDA 1ARBA 1FONA 2WPIS 5EQSA 5EPYA 3ZZ6A 2XBVA 2KM0A 4YESB 3CNRA 1YWUA 2XXLA 3VFEA 3GYLB 2XWAA 4HI3A 2FEQH 2Y81A 2C93B 3ATWA 2QGRA 4JZ1A 4O97A 3RXPA 3SQHE 2LP6A 5AF9H 1P57B 2BDBA 2UWPA 5DJ7A 1EUFA 1GJ5H 2ZEBA 1K2I1 4MNWA 1C9TA 4NGAH 4Q4LA 2NU4E 3OU0A 2J92A 3UPEA 4CBNA 4M9FA 3U8TH 1DICA 2G00A 1SL3A 3PB1E 4SGAE 1TOCB 2XRCA 2BZ6H 3PLKA 2ZP0H 3A88A 1A0JA 1RRKA 1DE7H 2GDEH 2AYWA 4XE4A 1ELTA 5K0HA 4AG2A 2BDGA 4RKOB 1UJ1A 1GBTA 1O2MA 4X8UH 1O3LA 2HALA 4FUJA 4BAHB 1C2HA 1K1OA 1QB6A 5EQQA 1O2NA 3ENSB 6CHAC 1HUTH 1EJMA 1EOJA 2FLRH 1V2MT 3DSGA 4RI0A 1O2RA 1ORFA 2ZC9H 2EI8A 1SQRA 1YGCH 2J95A 5DN6D 4OM9A 4DGJA 2GX4A 4FUDA 4THNH 1DWDH 2GCTB 1L1NA 2A7JA 2WZQA 3FOAA 2PFEA 1GGDB 1MKWK 1W13U 2SGEE 2R3YA 3TK9A 3RXMA 3WWBA 4X6NA 3EE7A 3BTKE 5FPSA 4CRGA 2FTMA 4CHAB 2GP9B 5DKMA 1T7CA 2GCHG 4P00A 4RN6A 3MNBA 3QK1A 2BD4A 1O2TA 4R0IA 1O2YA 2TIOA 1O36A 3TH3H 1XUJA 2RFKC 2ANWA 1V2ST 2BQWB 1O3CA 4X8SH 1IQIA 5BRRE 1P01A 3QZRA 1EJNA 1ZZZA 1AI8H 1XUFA 3PMHB 4O3TA 1B5GH 3TVJB 3UTUH 4BAMB 2FXRA 1AIXH 1C4Y2 1TBRH 1MMJN 1C5WB 3GCTG 1O3OA 1S84A 4Y8YA 2KAIB 1THRH 4GCHF 1ELDE 1DX5M 2J5UA 4KGAA 2A5KA 3BEIB 4H6SB 4WXIA 4AC9A 4Y6DA 4U01A 1KLTA 1CA0B 5CE1A 1F5KU 3RXCA 2R2MB 5EW1H 1TNHA 3MO6A 3SGAE 3SGQE 2C8YB 4NZQA 1BTXA 4Z1MD 2CGAA 2F9UA 3I29A 1UW7A 2YMSC 2D8WA 1DS2E 1TGSZ 5F8ZA 4MNVA 5L2YH 1CT4E 4AGKA 2PGQB 5E0JA 3SJOA 2W7UA 1J8AA 3ELAH 1E79D 1F92A 2K8IA 1G32B 1P06A 4D9RA 2YNBA 1GJCB 1C9PA 4ABAA 3GDSA 1HCGA 1QJ1B 3SZNA 1HRTH 3QUMP 2A1DB 4HFPB 3PWCA 4KTCA 1GBKA 4TY6A 3BF6H 2F91A 4XBBA 1SHHB 1ANCA 3Q00A 3SO3A 1AB9B 1A4WH 1AQ7A 4D76A 4GHQA 4GHTA 4B2BA 1VCQA 4Z6AH 3GY2A 1SGNE 1GG6B 2GZ9A 3PTNA 2BB4A 3EDXB 1QCPA 4FUHA 1YBWA 3UNQA 3RMOH 3RU4D 3P6ZB 1EAIA 3SU4A 7GCHG 4GCHG 1FY5A 4MNYA 5GPIB 1F5RA 2GT8A 1ANBA 1T31A 1YPEH 3TK6A 5T6GA 3S0NA 1UMAH 3AASA 2ULLA 1ZR0A 3JZ1B 2ZQ2A 3PMAB 2RA3A 4X2YA 5EJLA 1BTZA 2A5IA 4NA7A 5E2PA 5FL7D 1MUEB 4BTUB 1P09A 3A89A 5C2ZA 4J1YA 1FV9A 2HPPH 3NRLA 2G8TA 2PR3A 3VB6A 3SGBE 3DSPA 2V7QD 1B0EA 1ELVA 2JJ1D 3UIRA 4GUXA 1CGIE 1PQAA 1TPPA 1K1LA 2FESH 3CP7A 2RA0A 2ASUB 5EXNA 3QTVH 1YM0A 1DSTA 1ARCA 5F03A 3KEEA 1P2IA 2DUCA 5FX5A 8ESTE 3ESTA 2GTBA 3F6UH 4YT7H 3F3BA 2F9OA 1V2JT 1H9LB 4Y7BA 4BNRA 1QFKH 2ANYA 1S85A 2Z6BD 3UNSA 3E16B 3A83A 1YPHE 1Y3UA 4AX9H 1OWEA 3V12A 4ZXYH 1CHGA 2XTTB 3ZVFA 1D6RA 3F9FA 1BTUA 4TYDA 1HV7A 1SC8U 4NIWA 2WPMS 3F68H 1QB1A 2SNWA 2ZF0H 1ZJDA 2ALPA 2NU3E 4JMYA 3FAOA 4TT3D 4MQAA 2VVVA 1EX3A 3ZVDA 1HAHH 1V2UT 1WCZA 3BTTE 1C5MD 1VKYA 1BT7A 4B75A 2O8TA 1C4V2 4CBOA 2BXTH 1WXRA 4CHAC 1KXAA 5C1UA 4HZHA 1KDQA 1G3DA 1BUIA 1L1JA 3UNRA 3BTHE 4IMZA 1RGQA 2ZPRA 4ZH8A 3A84A 2AH4X 1WOFA 3DUXH 1GI2A 1BMLA 3O8RA 2M5TA 1GVLA 4DG4A 4UD9H 5L6NH 1QGFA 2KCPA 2K1QA 3ATIA 4FUFA 2WUBA 2BD2A 1ZSLA 1ABIH 1LDTT 1RXPA 3PROA 3GY6A 3A85A 3OEED 4IMQA 2EY4C 2FI4E 2OXSA 3A86A 3DFLA 2W26A 4Q80A 1K1PA 2C90B 3U98H 4MPVA 3W94A 1BDAA 1QURH 2F4LA 2C8XB 5T6FA 1HAPH 1SGFA 3LJOA 2CHAB 2BLVA 4OS6A 1V2WT 1V2RT 1GHZA 2PW8H 4K1SA 3ZZCA 2QXIA 3SN8A 1TBZH 1GDUA 3GCNA 4YT6H 2WPKS 3F2FA 1TWXB 1O3KA 2KAIA 2UUJB 2VIOA 1P2JA 3OX7U 1UCYH 2J38A 1W10U 1D3DB 1RIWB 1SGCA 3TH2H 1WU1A 2BQ7B 2H9EH 3UOUA 5JBCS 2AS9A 1UCYE 5HKKD 1XUHA 1C1SA 5CDFE 1YKTA 1OWHA 3ZVAA 3SU0A 3SNDA 1OOKB 2IJOB 2WHXA 1UTLM 1BMMH 2ZZUH 4X6PA 3M5MA 2R0LA 1DLKB 3MNSA 1L4DA 1RTLA 5EPNA 4E05H 1AB9C 3PO1B 2ZA5A 3S9BA 1V3XA 2H9TH 3PTBA 2ZGBH 2F3CE 2RCEA 2OINA 4RKJB 1C2LA 1YLNA 4ACBA 5J4QA 1T8NA 2JETC 4E06H 3FP7E 3KL6A 4X0WU 1Z7KA 1O37A 1KXDA 2ZIQH 1C5TA 2FPZA 4NG9H 2QF3A 1Z8RA 4ISNA 3ZZ9A 1KLIH 4JCNA 1DXPA 3RLWH 1XUIA 3ZIAD 2A7HA 1L2EA 3KYFA 5GCHG 5T3HA 2GDDA 2GCHF 2FYQA 4DURA 1P05A 1TAWA 2TGAA 3BG4C 3F2HA 5H4IB 3NUMA 1BJUA 3M3TA 4BOHA 2SGFE 1QTFA 4H6TA 1QRZA 2FS8A 2QF5A 4AN7A 3BTGE 4LZ4B 2C8ZB 3NZIA 3RXQA 1BBRK 1C1WH 2BLQA 2ZHWH 3LGIA 1QA7A 2TRMA 3KYGA 1GJ7B 2Q6DA 3BEFB 1NZQH 3O8CA 1GI9B 2P3UB 2RDLA 4U2WA 1NU9A 2JJ2D 3MH6A 1LVBA 3P70B 1TYNA 3DHKH 3FN8A 4MPXA 3ATKA 3MU8A 1IQFA 1C1TA 3A7VA 2HNTF 4NWKA 2FO9A 2IJD1 5IK2D 2OC1A 1TPAE 2HLCA 1LHCH 2FOMB 3OTPA 3ZVEA 1GBMA 1AHTH 2ZU4A 2VU8E 2EI6A 2JKHA 4NIYA 1BIOA 2GKVE 3RDZA 8GCHF 2V0BA 3SHAH 1IQGA 4FUGA 2UUFB 1K1NA 2HOBA 3C27B 4INLA 1YPJH 3AW1A 4AYYB 1WYKA 4AGJA 1NC6A 2UWLA 5I25A 3KQDA 1LHEH 1TONA 1O3GA 3RXTA 3QN7A 5C67A 1UTQA 3V13A 3I77A 3K6YA 1EZXC 2Z94A 3BTQE 5TCCA 4WH6A 2FP7B 4Y11E 2A31A 2AGEX 1AZ8A 1M9UA 4WF8A 2TGPZ 3U8OH 2LELA 2OLGA 3SV8A 1ELCA 1NFWA 2Z9GA 1CO7E 4X8VH 1GG6C 2BX3A 1N8OB 4UFGH 1N6YA 3GDUA 1EAUA 1C2DA 2QY0B 4Y76A 1GJAB 2D1JA 3VG8A 1U6QA 1Y5AT 3E3TA 3UR6A 1H1BA 3V7TA 1TRNA 1QZ8A 1KXEA 1TA6A 5EQRA 3IG6B 4DIIH 1RD3B 2G52A 2FDAA 4TY7A 1AWHB 3ZZ3A 2QA9E 1S6LA 4JZEH 3SUFA 4U32A 1LPGB 3FO8D 5T6DA 5JBTA 3DCLA 1MD7A 5F8XA 3L3TA 1CBWB 1UVSH 2AHME 3HPTB 1EP6A 4B74A 8GCHG 1GVZA 2Z7FE 3PV4A 4F4OC 2WSSD 2YMSB 4Q63A 2AFQB 5AFYH 4F55A 1SI5H 2WPLS 3M7UA 1YLDA 1ESTA 1C1RA 2ZTXA 1C2FA 2XBWA 2ZGXH 1YCPH 3P17H 4K2YA 3FP6E 1BRAA 1O2IA 5GXPA 3UAIC 3BSQA 5EXLA 4AFSA 1YY3A 1G9IE 1O2PA 1FDPA 1SQOA 3L6PA 2BY8X 1C2GA 1UTPA 1KLJH 3E8LA 2OD3B 1JIRA 3QDZB 3DA9B 2P3FH 1OYTH 2ANMH 3E0PB 2M2AA 7LPRA 5AFZH 1IHSH 4JZFH 1JIMA 1UK4A 2WV5A 3M3SA 2V3MA 5TJXA 1CU1A 3RMMH 1H8DH 1Y3YA 5FPYA 4BAQB 4CREA 1ZOMA 1HJ8A 3KN2A 3SJ8A 5JB8S 2PSYA 1O32A 1UTOA 1LCYA 2Z3DA 1OP0A 2B7DH 2ZDAH 3ZV9A 1FPHH 2VB0A 1AFQC 2PUXB 3UQVA 3SQEE 3K65B 1YPLH 4I31A 2O8MA 3MH7A 1UCYK 4UEHH 1OHHD 5F6MA 2Z3CA 1PQ8A 1PQ5A 2BVRH 2ZDLA 1O3HA 1C2MA 1MKXK 1HAVA 1GI8B 2J2UA 3SU3A 1TRMA 1K1JA 2KZ4A 1EASA 3B8JA 3F9HA 4SGBE 3LGUA 1XKBC 3STJA 1GHWH 1FNIA 5EW2H 1C2JA 1O2KA 1BCUH 1MABB 4NIXA 3NCLA 3OE7D 1O2UA 3D65E 3TNTA 2HLDD 1FAKH 2ODQA 4ABGA 1WUNH 1HDTH 1B7XB 1BHXF 4NCYA 2A4RA 4YTAA 1BRUP 2AGIX 5HM9A 1DFPA 1FXYA 1OSSA 4ISOA 1ELAA 2HNTC 3UB0A 1F2SE 3S7HB 2PV9B 2BDIA 4K1EA 3RU4T 3HK6B 1MTUA 1GWAA 3RC5A 2Y82A 1XXDA 4A6LA 5DP7A 2VBCA 2NU0E 1GHBG 4ZKRU 1ABJH 2BDAA 3U8RH 3SYJA 1J9CH 1HAGE 4X1NU 6GCHF 2P16A 2VVUA 1W2KH 1MBMA 4CH8B 1ZHPA 1GI0A 2W6JD 1ID5H 2BD3A 2P8OC 2BHGA 5GJ4B 1VCPA 3TU7H 2DE9A 1LO6A 1EPTB 1T8OA 1C5LH 3HGPA 5KEDA 2UUKB 3NKKA 1YPKH 1F5LA 1MZAA 3O8BA 1A3EH 4OS1A 2KCOA 1SHYA 1PQ7A 2XCNA 3M7QA 4WVPE 3SORA 2AIQA 5EIYA 5E8EH 2KCYA 2FX4A 2FOAA 3BG8A 3BEUA 1CHOF 1C5NH 1IHTH 1GHBF 1NTPA 1S81A 1EP5A 2BLOA 1FY8E 1GI4A 1PPCE 4CR9A 1UVTH 3ODDA 4Y10E 1Q2WA 1LVYA 3EQ0H 5ESTE 4UFDH 4OS7A 4Q7XA 4NFEA 4ABBA 4AZ2B 2BY7X 1OWJA 4YO9A 1EZUC 4ZKNU 2Z9IA 4YOGA 2AMDA 2XC5A 1PPFE 1YPHC 2LNCA 2C3SA 2BDYA 5HXFA 1H8IH 2G81E 3RXDA 1ZTJA 1GI3A 3V3MA 1P0SH 1WV7H 4JZDH 2EI7A 1DANH 3MO3A 3VB7A 3SNAA 1D3TB 5HM2A 4B76A 2P59A 4O9VA 1QQUA 1Z8JB 2ZU2A 1TE0A 3SJIA 1BBRH 4YM9A 4OGXA 5C17A 1O5DH 4KELA 3URCA 1A0HB 1FIWA 2H5CA 3K2UA 1JBUH 2H6MA 1V2QT 1H8HD 5CMXH 3OSYA 3LGVA 1HAXB 1GI1A 5ESBA 1GMDG 2ZPQA 6LPRA 5LPFA 3TK5A 1IQKA 1W0KD 3RUOA 1ZTLA 2PHBA 3Q76A 7KMEH 1EB1H 1O2SA 4E7NA 2IPQX 1ACBE 3QX5H 1O3MA 1T4UH 4A92A 3T28A 3SU2A 1TX6A 1NFUA 2F9PA 4LXBH 3PLBA 1VITH 4UONA 1P3EA 1CT0E 3UR9A 1ETSH 1HIAA 2ZDMA 2BDHA 4IW4E 4NWLA 3F2GA 2UWOA 5A0BA 3UQOA 1N1LA 2W3IA 4CH2B 1SG8B 1GBAA 5FX6A 1D9IA 2BVXH 3GCHB 1MTNB 4RSPA 2K0QA 2ZDVH 1DWCH 3KQBA 3TNSA 4ISLA 1C1VH 2P94A 1FN8A 1W0YH 2HPQH 5DGJA 5DP4A 5DP3A 1VR1H 1Y3XA 1PFXC 5F53A 1EATA 4E7RG 2OQ5A 5DP6A 1SQAA 2CV3A 4K5ZA 3AK5A 2DE8A 3RXAA 4DIHH 1C5UA 1WTHD 2ZU5A 2BY6X 3NWUA 1TPOA 5ETXA 3LU9B 2FOHA 3KIDU 1SFQB 4FU9A 1GJBB 1OXGA 1J14A 5A0AE 3PV2A 1LKAA 2Y5GA 2JH0D 1S6FA 4B73A 4B2CA 1WQSA 3SNBA 1O3BA 2ZTYA 4TWYA 2G55A 5FAHA 3SI4H 1FMGA 1J15A 4ZUHA 2FWWA 2WPDD 1YCPK 2CF8H 4H42U 3SV7A 1C1NA 1S6HA 4MNXA 1CVWH 3SI3H 3P8OA 4OS5A 2J9NA 4NSVA 2PTNA 2XOKD 4WH8A 1TMBH 1PYTD 3UREA 1LHGH 2XC0A 4AB8A 1O35A 1UTKA 4ZHMU 3TJVA 5A0CA 5K7RA 5GIBA 1Z1IA 1JWTA 3GDVA 3N7EA 1P12E 2B5TB 1P04A 1GBBA 1SOTA 3CS7A 1C1MA 1D3PB 1DWBH 2SNVA 5B6LA 1QHRB 1HAYB 1DDJA 1OP2A 1SMFE 5EU8A 4DVAU 1IAUA 1OS8A 1TBQH 5GCHF 1O2OA 1GI5A 3D62A 1BBRE 1O0DH 3BIUH 2Y7ZA 5A09A 5E0GA 1ZYOA 1GHXH 1BTPA 1SGIB 4OS4A 1TGNA 1QY6A 1GMDF 1BTYA 1EAWA 3MU5A 3B23B 2EA3A 2ZECA 3MNXA 1N8OC 5CHAB 2Z9LA 3ZVGA 1MTSA 3FVFB 4GVUA 4ABFA 5A8XA 1UK3A 5A8YA 1KXFA 5HGGA 1YF4A 1YP9A 3KCGH 4INKA 3UY9A 1Z8GA 1YLCA 3VGCB 1CE5A 2FYRA 1A2CH 4JZIA 3E91A 2NU1E 2PKAB 1O3EA 1LHDH 2R2WU 1ZGVA 1O3PB 3LPRA 3R0FA 3QGNB 5FBIA 2A2QH 2R3UA 1O2ZA 2A2XH 4CRFA 3IWMA 1PJPA 1VJ9U 1GJ8B 1TNIA 2G5VA 2XW9A 2QCYA 3GY3A 3TJOA 2PUQH 3SV6A 4J2YB 2QF4A 1MCVA 3MNCA 2A4GA 1GJDB 1IQMA 3SZEA 3UOPA 2FI5E 1QL8A 3PLPA 1C2KA 2VIWA 1GI6A 1MH0A 2OCVB 1QBNA 1BJVA 4X1SU 5DP9A 2OBOA 2O9QA 2EQNA 2XNDD 3FKSD 3URDA 1EZQA 3WW7A 3A8CA 1FY4A 1GBJA 1G3BA 3PM3A 2OC7A 2J97A 2G51A 1O2XA 1BHXB 1TNJA 1SPJA 1OPHB 1LHFH 2FODA 1VITF 1K28D 5EOKA 2QXJA 1F0UA 1OX1A 1T4VH 5FHTA 4DT7B 1TX8A 3RXSA 4X1QU 2NWNA 1AVGH 3A7ZA 3U1JB 4BAOB 1DUAA 3EAJA 3AAVA 2A0QB 1MKXH 8KME2 1GMCF 3SNCA 5L30H 3DSOA 4ABIA 2R0KA 1TOMH 1YPGH 1MTWA 2KX4A 2ZCLP 3BIVH 2JETB 3T27A 3UWJH 2ILNA 1UHBB 4KKDA 4XSKU 3B9FH 1SLUB 4CRDA 4ACAA 4ZXXH 3VB5A 3PO1C 1IQJA 4AFQA 1F0TA 3PMJA 3F1SB 5EJZA 4NA8A 1A5GH 1HLTH 2FOGA 1WQVH 3E6PH 1VGCC 2A7CA 3NXPA 2FLBH 5G4BA 1V2OT 1ANEA 1BTWA 2P95A 2PP6A 2KR7A 3TGKE 4B6EA 3P8FA 1HPGA 1NO9H 1XMNB 2OP9A 1C5RA 3F9GA 2BDCA 3PWBA 3RXUA 3UFAA 1H9IE 1ZMNA 3KGPA 3TGIE 1C5QA 2ZFRH 3ZZ4A 3RC4A 5C94A 1PPGE 2QF0A 1O31A 1KTSB 3GY8A 1UK2A 6GCHG 2ZI2H 1QNJA 3RXRA 3MMGA 1Q31A 4KP0A 5T1VA 1G2LA 3SV9A 2RDEA 3ZZ7A 1DY8A 2VGCC 4Q2KA 4BXWA 2H9HA 2VVCA 3BN9A 1W12U 4GLYA 4X2VA 4F48B 3HGNA 4ZHLU 4MLFB 3SOSA 4ASHA 1J16A 2PWXA 3BV9B 3OAAD 2QAAA 2OK5A 1O2GH 1J17T 2ZG0H 2FOCA 3EA9A 3FANA 1MD8A 2G5NA 1O3IA 1XKAC 2IOTA 3N7DA 3LJJA 3N99A 4ASUD 3T2NA 5FCKA 5FXLA 2YOLA 3SNEA 4YOJA 2AIPA 3TGJE 2ZDNA 1ZHMA 1LMWB 1HFDA 1THPB 2V3OH 3ZZDA 3QTOH 5JBBS 1HAVB 1SGEE 2HWLB 3LC5A 1HGTH 1TIOA 4FXGH 3MHWU 3GY5A 4A1TA 1XX9A 1COWD 3E0NB 1KSNA 3M36A 3V0XA 2A4QA 2ZO3H 3PRBA 2G4UA 2PSXA 4NFFA 1KYNA 2OC8A 2SGAA 4NA9H 4DW2U 3ATMA 1GBDA 3WY8A 4LZ1H 1LVOA 2FOBA 4DY7B 1DY9A 3E90B 3F0PA 2W7SA 4XRNA 1SLXB 1TQ7B 4GPGA 4A1VA 1E35B 3GYMA 1AY6H 3LC3A 5EXMA 4GAWA 4IC5A 1O3JA 1UTJA 2BD7A 2BZAA 1IQEA 3L33A 3M35A 1F7ZA 5HIZA 4ABDA 4JK5A 1RJXB 4ISHH 1CGHA 4IN2A 3BTWE 4DCDA 1RTKA 1UVOA 4ZHAA 2F43B 1C2IA 1G3EA 4YOIA 3TJNA 4K1TA 2FOEA 4FOUC 1K9OE 3SJ9A 2GCTC 1KMHB 4Y79A 1O33A 2QE7D 1NROH 2XC4A 4FUEA 1L0ZA 2HGTH 1OYQA 2F9VA 3TLOA 1FI8A 4XD7D 2WYJA 1QIXB 1HJAC 4DT4A 1YPMH 1DM4B 2V3HH 1D6WA 4ZMAH 1GCTC 1NN6A 4WWYA 3ZZBA 3LGYA 3EGKH 5KGOA 1GBHA 1L1GA 4JYVH 1G37A 1ZMJA 1D3QB 1TRYA 2VGCB 1VCWA 2THFB 1DVAH 1ZPBA 2PGBB 1H8ED 1K22H 1ZPCA 5FCRA 2VWNA 1H9HE 3RXFA 2BD8A 3VB4A 2FM2A 2GT7A 2NU2E 4YLQH 1IQNA 1ZSKA 5GWZA 4X2WA 4JYUH 9ESTA 1BQYA 1SLVB 4WMEA 2FMJA 1MAYA 1NM6A 1GMCG 2FIRH 2W6ID 1KXBA 4D7GA 3RLYH 1S5SA 2FX6A 4VGCB 3LGTA 2OUAA 5LGOA 4D8NA 1H4WA 1Y5BT 2HRVA 3QLPH 1SQTA 3RXJA 4HTCH 1KY9A 3NK8A 2WUCA 3D23A 1VGCB 2JDID 4Y0YE 1S82A 1GHAG 4FUCA 2SGDE 3MQKC 1DUEA 1FQ3A 3F9EA 1PYTC 3M5NA 5FBEA 5A2MH 1BRBE 1FZZA 3T29A 4X8TH 1AU8A 1DITH 4YZUA 2GZ7A 5C5NA 4X6OA 1GL0E 2C4FH 1BMFD 2ZTZA 3HATH 3RXLA 2ZKSA 2J34A 3ZYEA 1LTOA 1GMHF 3FFGA 1GJ9B 1GCTB 3M5LA 3FZDA 1WBGB 1XXFA 5LH8A 4IBLH 5EG4A 1NY22 1HJAB 2CF9H 2GMTB 3QO6A 1LQDB 4Y71A 1GVKB 1GPZA 1JMOH 3AVZA 1OP8A 2BM2A 1CQQA 2BXUH 3M3VA 4IC6A 2VNTA 2ZHDA 2QXHA 1NRPH 3SUDA 2BD9A 3A82A 1P03A 1GL1A 1TLDA 1ESBA 1HIAB 1GHYH 3MU1A 3G01A 5C3NA 3CENA 3MH5A 1ZHRA 2BYAX 3Q77A 2V6NA 1AZZA 3TH4H 4HG6A 2TPIZ 3MO9A 1ZSJA 1NFYA 3TIUA 2L74A 1SGYE 3KQ5A 1TGCA 1O2JA 1UTNA 4ZROA 1EXFA 2QIQA 1WAYB 2Y80A 3H09A 1LPKB 7ESTE 4MG3A 2O8LA 4X1RU 2ZFSA 2B8OH 2VIPA 2ZFTA 3MYWA 1PPEE 3A7TA 1E1QD 1Y3VA 3LIWA 2I6QA 3LOXA 1EB2A 1Y3WA 3Q3XA 2I6SA 3LH1A 1FUJA 1O3DA 1ELGA 1SGRE 3GOVB 1QBOA 2ZNKH 4ESTE 1C5PA 1BTHH 1PPBH 4P02A 7GCHF 1CT2E 1CA8B 1HBTH 2ZPSA 2ZGCA 3U28C 3KHVA 2VIDA 1G36A 1C5OH 4MTBA 1BOQA 3ZZ8A 1WTGH 2STBE 5HYOA 1O3AA 1GMHG 1ZMLA 4D9QA 4LOYH 1ZRKA 3U69H 1JOUB 1Z71A 3CS0A 4K3JA 2JH6D 4NSYA 1MBQA 2XWBI 2ZHQH 3KF2A 4MDSA 1C5VA 4I8JA 4VGCC 1Z1JA 3W1EA 1QL7A 2V35A 1RIWC 1TNKA 4CRAA 1GBCA 2Y5HA 4DJZB 6CHAB 1NU7B 2W5EA 1NFXA 2VINA 4OS2A 1GJ6A 4LK4A 2VWLA 8LPRA 1FLEE 1AN1E 1B0FA 1TQ0B 1V2VT 3OTJE 3RM2H 4MPUA 1W14U 1P2KA 2Y6TA 3ZYDA 2GGVB 5DSFA 4WJG2 2Y7XA 3RXIA 4IGDA 2CHAC 1A1RA 4XFQA 5L2ZH 3A8AA 1GHAF 1BA8B 1HJ9A 1ZLRA 4NZLA 1TX7A 3MOCA 4XOJA 9LPRA 1EQ9A 2J98A 2WPHS 1QQ4A 1ETTH 2WV4A 5I46H 1ZJKA 4AYVB 2HVYB 3SBKA 1T8MA 3N7OA 2A45B 2O8WA 1MAXA 3OYPA 1NRRH 1QRXA 2JIZD 3R3GB 3DFJA 4A1XA 3ITIA 1HYLA 5PTPA 1UHBA 1ETRH 3M61U 4BXSA 5JDUB 3GICB 1GBFA 1OWDA 4D7FA 1UO6A 4X2XA 3STIA 1SKYE 3A87A 3S9AA 5AHGH 4Y7AA 1DOJA 2CN0H 2TBSA 5J4SA 4CRCA 1P11E 4K8BA 4R8TB 3WWFA 3TITA 4FUIA 4I32A 4BTIB 1O34A 3UUZA 2AERH 3RXOA 1K0HA 1V2PT 1AE8H 2ZHEH 1AUJA 1LVMA 3RU4E 3M5OA 2QV1A 5EJ1A 2ZDKA 3SU5A 2J98B 1ELFA 1NRQH 4ABEA 3RMLH 3A7XA 1HXFH 1GBEA 2ZFPH 3FZZA 3SU1A 4UE7H 4X6MA 3S9CA 5C1YA 4PROA 1K1IA 1W3CA 2C8WB 2GVFA 3LDXH 1UVPA 1O5AB 5C1XA 2XCFA 2IN2A 4AG1A 3P8GA 1Y5UT 1AWFH 2BTCE 3P8NA 4A5TS 4TPYA 1C1QA 2XNIA 4Q7ZA 3M7TA 1NRSH 1ELEE 2FS9A 2SGQE 1O39A 1WDIA 3EE0B 2BMGB 1GHVH 1KDQB 3AW0A 1EOLA 5DK1A 1TMTH 5DPAA 3RC6A 3PRDA 3VEQB 1AMHA 2J94A 4K60A 1JRSA 1SSXA 2Z3EA 1O5BB 4O3UA 4AORA 1D4PB 1N6XA 1Z6EA 5LPEA 1DXWA 1O5EH 1FPCH 1SB1H 3ZZAA 3TPIZ 3A7WA 5ABWA 1G30B 2ALVA 2SFAA 1FY1A 4INHA 1ESAA 2OBQA 2BOHB 1P3CA 4BAKB 3VGCC 1FAXA 3UWIA 4FUBA 1E0FD 1SOZA 4JYTA 2PKSB 4MPWA 4I86A 2VWMA 3RXHA 1A5HA 1QA0A 2AMQA
chains in the Genus database with same CATH topology
3VPKA 4MVNA 3TJUA 4I8GA 3MU4A 4AOQA 3RP2A 2ZHFH 3GCTF 2H2ZA 4CR5A 1TMUH 3W95A 2PKAA 3ZVBA 3EA7A 1K21H 1AFEH 2CMYA 2B9LA 1FN6A 1C5XB 2GD4B 3ZV8A 1YC0A 3SUGA 5LPRA 2QYIA 3MTYA 2ESTE 3P95A 3A7YA 4YLUA 1UTMA 3LH3A 2D2DA 2TGTA 5TCAA 2WYGA 1GDQA 1QRWA 1MTVA 1LPZB 4B2AA 1A5IA 1MKWH 1P10A 2BLWA 5DP5A 1VITG 4KTUA 1O2LA 3H5CB 1ZPZA 3ODFA 3MI4A 1C1OA 4AB9A 3S69A 1Q3XA 2OC0A 1IQHA 5DO4H 1WSSH 1V2NT 3U1IB 2VJ1A 3VXFH 2GV7A 1V2LT 2EC9H 2VH0A 2Z9JA 2RG3A 5JBAS 3D49H 1OKXA 3I78A 1HNEE 1CA0C 1XVMA 5DP8A 3AAUA 3GCHC 2D26C 1GCDA 2P8OB 1F0RA 3DD2H 1HXEH 1ZTKA 2P3TB 1AGJA 2STAE 4M7GA 2XBYA 1ELBA 1HB0B 2G4TA 5JYIA 1RS0A 3Q3KA 3A81A 3GISB 3K9XB 4I7YH 1QR3E 5FPTA 1FIZA 2OTVA 4I33A 3K6ZA 1O30A 1LQEA 1E38B 4GSOA 1BRCE 5E0HA 1CSOE 3A8BA 3LT3A 5DG6A 3GCOA 3SJKA 3SUEA 3SW2B 1L4ZA 1TGBA 1P2OA 1C5ZB 1TA2A 2VIVA 4K69A 3SV2H 1P2QA 1BB0B 1P2NA 1PPHE 2VIQA 1AUTC 1C5YB 4Z0KA 1MZDA 1AVXA 1RTFB 3LKWA 4WXVA 1FJSA 1DLEA 2FZZA 4CRBA 2LPRA 2P93A 3VXEH 2R9PA 1OWIA 1GGDC 2XYAA 2F83A 1PPZA 1CHOG 1A46H 4WY3A 1IOEA 1TFXA 3A80A 1SFIA 4UFFH 1TGTA 4JK6A 1O3FA 1RFNA 1SGPE 2QXGA 1DPOA 3A8DA 5CHAC 1OWKA 1QBVH 1HAIH 3RXGA 3MFJA 3H7TA 1SLWB 1EAXA 1W8BH 2ZFQH 1TNGA 3P92A 3SU6A 1A61H 1XM1A 1O5FH 2BY5X 3MH4A 4HGCA 3H7OA 3ZVCA 4H4FA 3PMBB 1YYY1 2ZFFH 2ZU1A 2GZ8A 1THSH 2ZGHA 2Q6GA 1O2QA 1EPTA 4QT8C 1EKBB 1G3CA 3DT0H 1DT2A 3HKIB 1QL9A 2AMPA 4XBCA 4UDWH 3SHCH 1QJ7B 2ZU3A 1XUKA 1P9UA 2VH6A 1AO5A 2WPJS 4BTTB 5EGMA 1IQLA 1V2TT 1DWEH 3T62A 5A8ZA 1AVWA 1MQ6A 5E2OA 3EA8A 4ISIH 3KQEA 4I8LA 1GDNA 3IITA 1NS3A 1KIGH 1MCTA 2FTLE 2W3KA 1SGQE 2BD5A 4NIVA 3GY4A 4UFEH 6ESTA 4FVBA 1V2KT 1NPMA 2PTCE 1KTTB 3RM0H 2Y5FA 1BZXE 3ZZ5A 1BITA 3KQCA 4IS5A 2Z9KA 2QC2A 1CBWC 1A7SA 1A3BH 1CGJE 2IPHA 2QN5T 1S0QA 3MU0A 2PLXA 2A5AA 2BVSH 5C20A 1JRTA 2FI3E 3HKJB 1QJ6B 3T26A 1TB6H 3FP8E 4F49A 5EODA 2JH5D 1K1MA 4AFUA 1GBIA 3U9AH 1V6DA 3PYHA 1S0RA 2ZWLH 4ABHA 1TNLA 5JPMH 2Q6FA 3BTME 1LKBA 2F9NA 4IN1A 4WMFA 1Y59T 2ODPA 2XBXA 3QGJA 5HMAA 2BOKA 3EYDA 1C1PA 2CXVA 1P2MA 1O5GH 1Z8IB 3RXKA 3S7KB 1NRNH 3KNXA 2B0FA 1DSUA 3HK3B 4FU7A 4X1PU 1MTNC 1EJAA 1EPTC 1VJAU 1ZGIA 1XVOA 1E37B 1C5SA 4I8KA 1X7AC 5SGAE 2AEIH 1O3NA 2ZQ1A 1AKSB 3C1KA 5GDSH 4O03A 1YCPM 1Z6JH 1W11U 2VWOA 1O2HA 4Q7YA 3GY7A 1O38A 2PKSC 1ZRBA 1W0ZU 3BTEE 4A7IB 3RXBA 5BPEA 1TALA 2EEKA 2WINI 3RXVA 3T25A 3E1XB 3RXEA 3BTFE 1XUGA 3QZQA 1T8LA 1S83A 3LGWA 3Q3YA 3JZ2B 3QWCH 4Y8ZA 1TPSA 1EZSC 2O8UA 1SR5C 1HAOH 2FOFA 4XBDA 1NESE 2F9BH 2CJIA 4Y8XA 1Y8TA 1GBLA 1BMAA 2A32A 2GV6A 1MU6B 2Q1JA 2TGDA 4FU8A 4TWWA 4U30A 5F8TA 1NT1A 3M37A 3LONA 1E34B 1VZQH 1HAZB 2A4OA 3MWIU 1P9SA 2UUYA 1W7GH 2H5DA 4ABJA 1SGTA 2BX4A 1AKSA 4K8YA 1P02A 1QB9A 4B1TA 4DOQA 1SGFG 4TPIZ 4ZKSU 3O8DA 1TABE 4ZKOU 5B6OA 2AGGX 4WMDA 2ZGJA 1O2VA 4KTSA 1C1UH 1JXPA 2J4IA 2SGPE 1T32A 1O5CB 1SBWA 2ODYB 1ANDA 1G2MA 3BG4B 3NPSA 5IDKA 1C4U2 2YNAA 5AVDA 1AE5A 2OQUA 2ZCHP 1E36B 4XDEA 1SGDE 2BQ6B 1FY3A 1AFQB 1KXCA 1BMNH 3OY6U 3OY5U 1P8VC 2HVXA 1GJ4H 2GMTC 3ATLA 4B71A 4AFZA 4BANB 1GI7B 2H1UA 1W7XH 1SVPA 3T5FH 1MU8B 4ZAEA 1AD8H 4Y0ZE 1UVUH 1F0SA 2ZCKP 3RMNH 3VB3A 2HNTE 1A0LA 1O2WA 4OGYA 5IYTA 2BY9X 5JB9S 1INCA 1MQ5A 1C2EA 2ANKH 3BTDE 4I8HA 5C5OA 4FVDA 1ARBA 1FONA 2WPIS 5EQSA 5EPYA 3ZZ6A 2XBVA 4YESB 2XXLA 3VFEA 3GYLB 2XWAA 4HI3A 2FEQH 2Y81A 2C93B 3ATWA 2QGRA 4JZ1A 4O97A 3RXPA 3SQHE 5AF9H 1P57B 2BDBA 2UWPA 5DJ7A 1EUFA 1GJ5H 2ZEBA 1K2I1 4MNWA 1C9TA 4NGAH 2NU4E 3OU0A 2J92A 3UPEA 4CBNA 3U8TH 1DICA 2G00A 1SL3A 3PB1E 4SGAE 1TOCB 2XRCA 2BZ6H 3PLKA 2ZP0H 3A88A 1A0JA 1RRKA 1DE7H 2GDEH 2AYWA 4XE4A 1ELTA 5K0HA 4AG2A 2BDGA 4RKOB 1UJ1A 1GBTA 1O2MA 4X8UH 1O3LA 2HALA 4FUJA 4BAHB 1C2HA 1K1OA 1QB6A 5EQQA 1O2NA 3ENSB 6CHAC 1HUTH 1EJMA 1EOJA 1V2MT 2FLRH 1O2RA 1ORFA 2ZC9H 2EI8A 1YGCH 2J95A 4DGJA 2GX4A 4FUDA 4THNH 1DWDH 2GCTB 1L1NA 2A7JA 2PFEA 1GGDB 1MKWK 1W13U 2SGEE 2R3YA 3TK9A 3RXMA 4X6NA 3BTKE 5FPSA 4CRGA 2FTMA 4CHAB 2GP9B 5DKMA 1T7CA 2GCHG 4RN6A 3MNBA 3QK1A 2BD4A 1O2TA 4R0IA 1O2YA 2TIOA 1O36A 3TH3H 1XUJA 2ANWA 1V2ST 2BQWB 1O3CA 4X8SH 1IQIA 5BRRE 1P01A 3QZRA 1EJNA 1ZZZA 1AI8H 1XUFA 3PMHB 4O3TA 1B5GH 3TVJB 3UTUH 4BAMB 2FXRA 1AIXH 1C4Y2 1TBRH 1MMJN 1C5WB 3GCTG 1O3OA 1S84A 4Y8YA 2KAIB 1THRH 4GCHF 1ELDE 1DX5M 4KGAA 2A5KA 3BEIB 4H6SB 4WXIA 4Y6DA 4U01A 1KLTA 1CA0B 5CE1A 1F5KU 3RXCA 2R2MB 5EW1H 1TNHA 3MO6A 3SGAE 3SGQE 2C8YB 4NZQA 1BTXA 2CGAA 2F9UA 3I29A 2D8WA 1DS2E 1TGSZ 5F8ZA 4MNVA 5L2YH 1CT4E 4AGKA 2PGQB 5E0JA 3SJOA 2W7UA 1J8AA 3ELAH 1F92A 1G32B 1P06A 4D9RA 2YNBA 1GJCB 1C9PA 4ABAA 3GDSA 1HCGA 1QJ1B 3SZNA 1HRTH 3QUMP 2A1DB 4HFPB 3PWCA 4KTCA 1GBKA 4TY6A 3BF6H 2F91A 4XBBA 1SHHB 1ANCA 3Q00A 3SO3A 1AB9B 1A4WH 1AQ7A 4D76A 4GHQA 4GHTA 4B2BA 1VCQA 4Z6AH 3GY2A 1SGNE 1GG6B 2GZ9A 3PTNA 2BB4A 3EDXB 1QCPA 4FUHA 1YBWA 3UNQA 3RMOH 3RU4D 3P6ZB 1EAIA 3SU4A 7GCHG 4GCHG 1FY5A 4MNYA 5GPIB 1F5RA 2GT8A 1ANBA 1T31A 1YPEH 3TK6A 5T6GA 3S0NA 1UMAH 3AASA 2ULLA 1ZR0A 3JZ1B 2ZQ2A 3PMAB 2RA3A 4X2YA 1BTZA 2A5IA 4NA7A 5E2PA 1MUEB 4BTUB 1P09A 3A89A 5C2ZA 4J1YA 1FV9A 2HPPH 2G8TA 2PR3A 3VB6A 3SGBE 1B0EA 1ELVA 3UIRA 4GUXA 1CGIE 1PQAA 1TPPA 1K1LA 2FESH 3CP7A 2RA0A 2ASUB 5EXNA 3QTVH 1YM0A 1DSTA 1ARCA 5F03A 3KEEA 1P2IA 2DUCA 5FX5A 8ESTE 3ESTA 2GTBA 3F6UH 4YT7H 2F9OA 1V2JT 1H9LB 4Y7BA 4BNRA 1QFKH 2ANYA 1S85A 2Z6BD 3UNSA 3E16B 3A83A 1YPHE 1Y3UA 4AX9H 1OWEA 3V12A 4ZXYH 1CHGA 2XTTB 3ZVFA 1D6RA 3F9FA 1BTUA 4TYDA 1HV7A 1SC8U 4NIWA 2WPMS 3F68H 1QB1A 2SNWA 2ZF0H 1ZJDA 2ALPA 2NU3E 4JMYA 3FAOA 4MQAA 2VVVA 1EX3A 3ZVDA 1HAHH 1V2UT 1WCZA 3BTTE 1C5MD 1BT7A 4B75A 2O8TA 1C4V2 4CBOA 2BXTH 4CHAC 1KXAA 5C1UA 4HZHA 1KDQA 1G3DA 1BUIA 1L1JA 3UNRA 3BTHE 4IMZA 1RGQA 2ZPRA 4ZH8A 3A84A 2AH4X 1WOFA 3DUXH 1GI2A 1BMLA 3O8RA 2M5TA 1GVLA 4DG4A 4UD9H 5L6NH 1QGFA 2K1QA 3ATIA 4FUFA 2WUBA 2BD2A 1ZSLA 1ABIH 1LDTT 1RXPA 3PROA 3GY6A 3A85A 4IMQA 2FI4E 2OXSA 3A86A 3DFLA 2W26A 4Q80A 1K1PA 2C90B 3U98H 4MPVA 3W94A 1BDAA 1QURH 2C8XB 5T6FA 1HAPH 1SGFA 3LJOA 2CHAB 2BLVA 4OS6A 1V2WT 1V2RT 1GHZA 2PW8H 4K1SA 3ZZCA 2QXIA 3SN8A 1TBZH 1GDUA 3GCNA 4YT6H 2WPKS 1TWXB 1O3KA 2KAIA 2UUJB 2VIOA 1P2JA 3OX7U 1UCYH 2J38A 1W10U 1D3DB 1RIWB 1SGCA 3TH2H 1WU1A 2BQ7B 2H9EH 3UOUA 5JBCS 2AS9A 1UCYE 1XUHA 1C1SA 1YKTA 1OWHA 3ZVAA 3SU0A 3SNDA 1OOKB 2IJOB 1UTLM 1BMMH 2ZZUH 4X6PA 3M5MA 2R0LA 1DLKB 3MNSA 1L4DA 1RTLA 5EPNA 4E05H 1AB9C 3PO1B 2ZA5A 3S9BA 1V3XA 2H9TH 3PTBA 2ZGBH 2F3CE 2RCEA 2OINA 4RKJB 1C2LA 5J4QA 1T8NA 2JETC 4E06H 3FP7E 3KL6A 4X0WU 1Z7KA 1O37A 1KXDA 2ZIQH 1C5TA 2FPZA 4NG9H 2QF3A 1Z8RA 4ISNA 3ZZ9A 1KLIH 4JCNA 1DXPA 3RLWH 1XUIA 2A7HA 1L2EA 5GCHG 5T3HA 2GDDA 2GCHF 2FYQA 4DURA 1P05A 1TAWA 2TGAA 3BG4C 5H4IB 3NUMA 1BJUA 3M3TA 4BOHA 2SGFE 1QTFA 4H6TA 1QRZA 2FS8A 4AN7A 3BTGE 4LZ4B 2C8ZB 3NZIA 3RXQA 1BBRK 1C1WH 2BLQA 2ZHWH 3LGIA 1QA7A 2TRMA 1GJ7B 2Q6DA 3BEFB 1NZQH 3O8CA 1GI9B 2P3UB 2RDLA 4U2WA 1NU9A 3MH6A 1LVBA 3P70B 1TYNA 3DHKH 4MPXA 3ATKA 3MU8A 1IQFA 1C1TA 3A7VA 2HNTF 4NWKA 2FO9A 2OC1A 1TPAE 2HLCA 1LHCH 2FOMB 3ZVEA 1GBMA 1AHTH 2ZU4A 2VU8E 2EI6A 2JKHA 4NIYA 1BIOA 2GKVE 3RDZA 8GCHF 2V0BA 3SHAH 1IQGA 4FUGA 2UUFB 1K1NA 2HOBA 3C27B 4INLA 1YPJH 3AW1A 4AYYB 1WYKA 4AGJA 1NC6A 2UWLA 5I25A 3KQDA 1LHEH 1TONA 1O3GA 3RXTA 3QN7A 5C67A 1UTQA 3V13A 3I77A 3K6YA 1EZXC 2Z94A 3BTQE 5TCCA 4WH6A 2FP7B 4Y11E 2A31A 2AGEX 1AZ8A 1M9UA 4WF8A 2TGPZ 3U8OH 2OLGA 3SV8A 1ELCA 1NFWA 2Z9GA 1CO7E 4X8VH 1GG6C 2BX3A 1N8OB 4UFGH 1N6YA 3GDUA 1EAUA 1C2DA 2QY0B 4Y76A 1GJAB 2D1JA 1U6QA 1Y5AT 3E3TA 3UR6A 1H1BA 3V7TA 1TRNA 1KXEA 1TA6A 5EQRA 3IG6B 4DIIH 1RD3B 2G52A 2FDAA 4TY7A 1AWHB 3ZZ3A 2QA9E 4JZEH 3SUFA 4U32A 1LPGB 5T6DA 5JBTA 1MD7A 5F8XA 3L3TA 1CBWB 1UVSH 3HPTB 1EP6A 4B74A 8GCHG 1GVZA 2Z7FE 3PV4A 4F4OC 2AFQB 5AFYH 1SI5H 2WPLS 3M7UA 1YLDA 1ESTA 1C1RA 2ZTXA 1C2FA 2XBWA 2ZGXH 1YCPH 3P17H 4K2YA 3FP6E 1BRAA 1O2IA 5GXPA 3BSQA 5EXLA 4AFSA 1G9IE 1O2PA 1FDPA 1SQOA 3L6PA 2BY8X 1C2GA 1UTPA 1KLJH 3E8LA 2OD3B 1JIRA 3QDZB 3DA9B 2P3FH 1OYTH 2ANMH 3E0PB 7LPRA 5AFZH 1IHSH 4JZFH 1JIMA 1UK4A 2WV5A 3M3SA 5TJXA 1CU1A 3RMMH 1H8DH 1Y3YA 5FPYA 4BAQB 4CREA 1ZOMA