1O3CA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA02
1CBWB 3PYHA 1VITG 1HIAA 4MPVA 3MHWU 1ZMNA 3P70B 1HAIH 3SGAE 2ZHDA 1ZGVA 2KAIA 4FXGH 3VPKA 1MTNB 4R0IA 2IPHA 4XOJA 5DP9A 2GGVB 2CMYA 1AZZA 1P06A 2OCVB 3FZDA 2HLCA 1A2CH 1YPKH 4YOGA 4HGCA 2PKSC 1EB2A 1C5WB 3LH1A 3SBKA 1P02A 2J94A 4X2YA 1PFXC 1DOJA 3KL6A 3DD2H 4NCYA 2P3FH 2TRMA 2A32A 1A3BH 1GMHG 4ESTE 2GCHF 2LPRA 4NA8A 1RJXB 2FLBH 3L3TA 1YPHC 3N7OA 1EATA 3SNAA 3UREA 2ZGHA 4B75A 1LQDB 3STJA 3A88A 3SV2H 1DWBH 1ZOMA 3ZVCA 4BAOB 5L30H 5JPMH 1BJVA 2H1UA 3LH3A 1LVMA 1MTUA 4O97A 3PLPA 1GJDB 5DPAA 1F0UA 1RRKA 1NS3A 2J38A 1BRAA 1AWFH 2ZDNA 4BNRA 2BQWB 2CGAA 2ZFFH 1CT4E 1XKBC 2BY9X 4I8HA 1THRH 1G3DA 4IS5A 1AIXH 3TGKE 1P12E 3TH2H 1P57B 2ZF0H 1HAPH 1MMJN 1D9IA 1SVPA 1QGFA 3MYWA 1HAZB 4A1XA 5I25A 1ZPCA 1H9HE 2WPLS 3HATH 3LC3A 2OLGA 1GBTA 1O3CA 3U1IB 2ODPA 1QJ1B 1TFXA 1BITA 3UNRA 1CT0E 1SGQE 3KHVA 1PQ5A 1NTPA 4MPUA 4FVDA 1HJ9A 1UK3A 4NFEA 1ETRH 1AI8H 5CHAC 1HJAB 3GDVA 1TONA 2Z9JA 2Y81A 1UVOA 1K1NA 1AUTC 1B5GH 3DT0H 4OS4A 1KLIH 1ZHPA 1ZGIA 2XXLA 4BTIB 5JBTA 1EQ9A 1GI3A 1C2GA 3K6ZA 2TBSA 4FU9A 5A09A 1MAYA 2P93A 2VINA 2C8YB 1NC6A 1GPZA 4ISIH 4B2AA 1GCTB 3TITA 1OSSA 5GXPA 1CVWH 1TRNA 2WUCA 3RXLA 1Y3VA 1CHOG 1DWDH 2A4GA 4IN2A 4XBBA 4ZHMU 1TALA 4K5ZA 2XBXA 1EPTB 1C1QA 4UFDH 4MLFB 1TBZH 3A7VA 5FCRA 3RXBA 4KTUA 2GMTC 5FAHA 3SN8A 4CRBA 4ABAA 2FMJA 3U8RH 4HZHA 1Q2WA 1TBQH 3RP2A 2XBYA 3ZVAA 1BRUP 1HNEE 1GG6B 1PPEE 2GTBA 4IMZA 4DVAU 1MBMA 4Y79A 2ZGXH 5JB9S 1O2QA 2BVRH 1GVKB 1CA0B 4FUCA 1QB9A 3P92A 3BN9A 3ZZ3A 1D4PB 1HXFH 4I8LA 1QB1A 4WMFA 5EU8A 4AYYB 4OGXA 1TBRH 4TY7A 2STAE 1BIOA 1IQMA 3F9EA 1UTKA 2WV5A 1GHAF 2Z6BD 1DLKB 1SG8B 1THPB 1P04A 1P03A 3PROA 1ANBA 2PGBB 3SGBE 1QRWA 1DANH 3MNSA 7LPRA 2M5TA 5EW1H 1H8IH 1W8BH 4I31A 5GDSH 3EDXB 2JKHA 5HM9A 1O2WA 4DG4A 1O3AA 4D9QA 1OS8A 1GJ8B 1NM6A 2BD5A 1MU6B 3GY2A 1MU8B 5DP5A 2ZNKH 3GY7A 1MAXA 2BDAA 1YCPH 1D3TB 1A1RA 1W2KH 1AVWA 4BAKB 1XXDA 2FOMB 2ZTZA 2HPQH 1DDJA 1LVBA 3M5NA 3UWIA 2NU2E 3F1SB 2BB4A 3UQOA 1NRQH 3UFAA 1ZJDA 1W0ZU 3MO9A 5DP6A 2PR3A 3MNBA 4RKOB 1VZQH 2BQ7B 2SGFE 4Q80A 4B2BA 2DE8A 1EAIA 4UONA 1BTXA 2THFB 3ATKA 4MTBA 3NK8A 4X8SH 1GBHA 1YP9A 3BSQA 2PTNA 1HAGE 3RM0H 3LGVA 1EZXC 2P8OC 3H7TA 2HGTH 2SGQE 1THSH 4AG2A 5K7RA 2AFQB 4IC5A 2VH6A 1RGQA 1KXFA 1UJ1A 1O5DH 5GWZA 3H7OA 3P8OA 4OGYA 2ODQA 1GJAB 3UNSA 3MO3A 8KME2 4IMQA 1TGSZ 1UMAH 2JH6D 4GCHG 4XDEA 1EOJA 1A5IA 1GMHF 3ZZ7A 5JBBS 5ABWA 3EA9A 3Q3YA 3A89A 2QN5T 3HKJB 4UDWH 2GZ8A 3VXEH 2WPHS 1FY5A 4ISOA 5LH8A 3I77A 2BD8A 1RTLA 3AASA 1O2JA 1OP0A 4FUJA 2XYAA 2VWNA 9ESTA 1GBAA 3TGJE 4X2XA 4I8GA 4I7YH 5GCHG 5A2MH 4CHAC 1CA8B 4GAWA 1VGCB 4A5TS 3GCOA 1TPAE 4MPWA 1CBWC 1Z6EA 2B9LA 1FUJA 1P2MA 1GJ5H 1CGIE 2B0FA 1T32A 3O8CA 4JZ1A 3RU4T 1ZHRA 1TGNA 2VIOA 2OC8A 2EEKA 2FI5E 1H9IE 3C1KA 1GMDG 1S85A 4D9RA 2F9PA 4WY3A 3T62A 3UWJH 4IC6A 1JRSA 1D6RA 3JZ2B 4YT6H 1YM0A 5DGJA 1XXFA 4X6NA 3SNBA 5EPYA 1DXWA 4WMEA 1VITH 1O2KA 3A87A 3D65E 1H8DH 3LU9B 3SNDA 1SLWB 1XMNB 1MD7A 4DIIH 2JETC 1XVOA 2B8OH 1HAHH 5EXMA 2WPKS 2VWMA 3SUEA 1OWHA 1Y3UA 2BVSH 5JBCS 2BY5X 4GUXA 3NKKA 2CF8H 3KGPA 1DPOA 2ZTYA 1IQKA 1O2MA 3KQCA 1G32B 3SJ8A 2WYGA 1KY9A 1EJNA 2PKAB 3VGCC 3Q77A 1C5VA 1FV9A 1S6HA 1C2HA 1SLVB 3TH4H 3VB5A 1TMTH 2QF0A 3K2UA 1PPBH 4ZXXH 3BTTE 1SB1H 3TU7H 3RXQA 2B5TB 3IITA 1UTPA 2A31A 2J34A 1XX9A 1O33A 3QX5H 1KXDA 4X6OA 1GJBB 3KEEA 1O3LA 1EAWA 3NWUA 5FBEA 2V0BA 1TE0A 1AFQC 1F0SA 1VITF 4K1EA 4JZFH 1S82A 4Y76A 1C1UH 3E8LA 3SZNA 5E8EH 1YPGH 1BTHH 1S0RA 4DJZB 4JYTA 1PPGE 5FPTA 2SNWA 5LGOA 1WUNH 4WMDA 1MH0A 3QN7A 3SJOA 2Q6FA 3GCTF 1HYLA 4YLUA 3MMGA 1ZHMA 3URDA 3SNCA 1SGIB 1G37A 4NG9H 1MQ6A 2FYQA 1YCPM 3A85A 1DE7H 2Y6TA 2Z94A 2UWPA 1WYKA 3SU1A 1HB0B 4AX9H 1VCPA 1GHYH 4UFEH 4K8BA 1Y3YA 3BIUH 1PPCE 2ZHWH 4ABJA 4K1SA 1LHEH 1L1GA 2HOBA 5C1YA 3UTUH 1Y5BT 1XUKA 3MI4A 1CGJE 1GI9B 3AAUA 1C5MD 1NRRH 4BAQB 1MCTA 2XCFA 1SGRE 2WPIS 5A0AE 1UCYE 3F9HA 1FDPA 1KSNA 3K6YA 3OY6U 3C27B 4LXBH 1BBRH 3LDXH 2QC2A 3M5MA 3BEIB 4GSOA 1BMNH 3ITIA 3RLWH 2GVFA 2ZHEH 1SFQB 2P3UB 3LPRA 3S69A 3JZ1B 1N8OB 1H1BA 2G8TA 1GJCB 5DO4H 1UVPA 4DCDA 1CA0C 5FPYA 3I78A 1OPHB 1DITH 1KDQB 2A5IA 4B2CA 2SGDE 2IOTA 3RXAA 1W3CA 4ZKOU 2D1JA 2XRCA 3ZZ9A 3ZVEA 1V2LT 2OUAA 2DUCA 5GCHF 3HK3B 1DXPA 4UEHH 1GMCF 2BMGB 3RUOA 2UWOA 2ZPSA 3UOPA 2ILNA 4DGJA 1GI2A 1A3EH 1NRNH 1KLTA 4I33A 1ZSJA 1ZRKA 2CF9H 3HK6B 1ACBE 1AWHB 1IQIA 4VGCB 4ZHLU 1SHYA 2OD3B 4B76A 2Z3EA 3BG4C 1K21H 2WINI 1V2JT 4UFFH 1TPPA 3QLPH 2BD2A 1CGHA 2TPIZ 1IQEA 1L1NA 1O2PA 5E0GA 3SW2B 2VVUA 7GCHG 2ZIQH 2AERH 4X6MA 5HXFA 1QL7A 1ZZZA 2VIDA 1TABE 5EPNA 1C1VH 3FP8E 4VGCC 1TQ0B 2Z3DA 1VCQA 4AORA 2UUJB 5A0CA 5A8XA 3ZZBA 1NRPH 3GY6A 3LGWA 2ANYA 1C2LA 1FMGA 1JXPA 4I8JA 2H9EH 1TX8A 2AMDA 2H9HA 3AW0A 3FP7E 1K28D 3M7UA 1AFQB 3NZIA 3UQVA 1F2SE 3GCNA 3V0XA 2HALA 4R8TB 4BXSA 1C2KA 1SGEE 2BLQA 1C9PA 1MD8A 5T6DA 2ZDLA 1NU9A 1A5HA 3SU0A 1ELGA 2XC0A 4O03A 3E1XB 3MH7A 2ZKSA 3MU5A 2AH4X 2GV7A 1ZLRA 4ABIA 4CBNA 1TOMH 1ZPZA 4CRAA 4FU8A 1BZXE 2EI6A 4Z0KA 1EOLA 5G4BA 4CR5A 1CHOF 2BTCE 2BDBA 2BXUH 5DP4A 1EZQA 1LHCH 3UR6A 1AQ7A 1P2OA 2J4IA 1YBWA 2H5CA 4GLYA 4Y8YA 3A8DA 1DICA 1HLTH 2EI8A 5HGGA 5HM2A 1BQYA 3LGYA 2F9NA 3A83A 3A81A 2CN0H 2PV9B 2W3IA 2VVVA 3PO1B 3VFEA 1U6QA 3VXFH 1G36A 1IAUA 4NA9H 3K65B 1TB6H 1RFNA 1UVTH 2XW9A 2PUXB 1O3JA 1MKXH 1V2KT 3O8BA 2YOLA 1HFDA 3B9FH 3W94A 3RXVA 5AF9H 1ZTLA 2XC5A 4M7GA 1LHDH 4DOQA 3F6UH 4Y0ZE 3RLYH 3DFLA 1EASA 3TJVA 1L2EA 5TCAA 1FZZA 1O34A 4H6TA 1PYTC 2CV3A 1Z8RA 2FS9A 1GMCG 1GWAA 1GL1A 1T31A 3SNEA 4B1TA 4A92A 2ZU3A 2C93B 2BM2A 4FUDA 1F5RA 1V2TT 5C3NA 2F9BH 4X1NU 3TIUA 3SI4H 4CRGA 2AS9A 1FXYA 3QUMP 2Q1JA 2FTLE 1QBVH 1GGDB 1T4VH 2ZZUH 3RXIA 1OXGA 1MZDA 1O3HA 3PV4A 1CQQA 3M7QA 2BY6X 3MH4A 5DG6A 1GBFA 2H6MA 2STBE 2HNTC 1C5QA 5GIBA 2NU4E 1ELBA 1O3OA 3KF2A 1F7ZA 1UVUH 1GVLA 5FHTA 3URCA 1O2GH 1ZSKA 2W3KA 1CE5A 3GISB 1Y5UT 1KXAA 4MNYA 4YO9A 1A61H 2FM2A 4YTAA 3AVZA 5JB8S 3UPEA 3D23A 2GDDA 1J9CH 3ESTA 4FUGA 5E2OA 1V2QT 1FONA 3BEUA 1XUFA 3OU0A 1ANDA 5EXLA 1DWEH 1MQ5A 1GL0E 4JYVH 3OYPA 2BZAA 1O2RA 3T28A 1O2LA 1SQAA 1O30A 4RN6A 4NA7A 1ETSH 1MCVA 1T8MA 1L1JA 3U98H 4WH8A 1P11E 1SR5C 2ODYB 2QXGA 4THNH 4AYVB 1NO9H 4JZIA 1VJAU 3UOUA 1C1RA 1QB6A 2ZQ2A 1NPMA 2ZU1A 5J4QA 2ZTXA 1BDAA 2FZZA 3ENSB 1PYTD 2AGGX 4AGKA 2BZ6H 1KDQA 1B7XB 1FIWA 1HGTH 2KAIB 2BDGA 4E06H 2BD3A 1A0JA 3T29A 1CT2E 2Z7FE 2PWXA 4XBDA 4ZKRU 3UY9A 5F03A 1IQGA 4NIXA 2QXIA 3E16B 1Z7KA 2VJ1A 4ZAEA 1LPGB 3RXCA 1ELTA 3RC5A 1UK4A 1GBIA 1GI4A 2A7JA 5PTPA 1C5ZB 5C1XA 4ISLA 2GZ9A 1ARCA 1IQHA 1SI5H 1O5EH 1IQJA 1YPHE 2WPJS 1GJ4H 1CO7E 1KXCA 1ZYOA 4AG1A 1QA0A 3LOXA 2FP7B 5H4IB 3ELAH 1BBRK 3PB1E 1QRZA 1IHTH 3QO6A 1AO5A 5FBIA 2TGDA 3IG6B 5EOKA 3Q76A 1AFEH 3RXDA 4CRFA 2P16A 1XUHA 4AFSA 1BUIA 1EX3A 1J14A 2ZCLP 1SGDE 1G3BA 5DP7A 2H2ZA 2OBQA 2Y5FA 3LONA 3RC6A 1EXFA 2PSXA 3FFGA 1D3DB 2PSYA 3MTYA 1HAXB 3S0NA 1A5GH 2FOHA 1P01A 3GCTG 3A8CA 1TNHA 3S7KB 4PROA 2AGEX 1E38B 2SFAA 3Q3KA 4U32A 2WPMS 2EA3A 2YNAA 3BTHE 3O8DA 4ZMAH 3PMJA 5AFZH 3TH3H 1QY6A 1FAKH 1D3PB 3RMOH 1TQ7B 5AVDA 2G5VA 1HAYB 1S5SA 2ZFPH 5HYOA 4NZQA 3PO1C 1GBEA 3M5OA 1EUFA 3VB6A 3ZYEA 4K2YA 1TGBA 1KTSB 2A2QH 2FEQH 1H9LB 3K9XB 1P0SH 1WOFA 5AHGH 3R0FA 3EGKH 2VNTA 2ZCKP 2ZG0H 2PUQH 1DX5M 5LPEA 1ABIH 2QIQA 4ZKNU 1C1OA 4IN1A 3ZYDA 1FI8A 1J8AA 5A0BA 1DM4B 1P9SA 1EP5A 1ZSLA 3CP7A 2A2XH 1CU1A 5L2ZH 3GYLB 1N1LA 1ZTJA 2R9PA 4DY7B 1S0QA 3MU1A 1YF4A 1TNKA 3NUMA 4YLQH 1C1NA 1GBLA 1O2VA 1UCYK 3MOCA 4A1TA 1TNIA 2NU3E 1TA6A 1YKTA 4DT7B 3T25A 4H6SB 1W14U 2AMQA 2BXTH 4H4FA 2ALVA 1ESTA 2XBVA 2LNCA 1C2IA 1C9TA 3RXOA 3A7YA 4Q7YA 1BT7A 1FNIA 2ZI2H 1L4DA 3AAVA 1O3NA 3RXSA 1T4UH 2FLRH 1JBUH 1SLUB 1SLXB 3RXGA 1FPHH 4ZXYH 3LJJA 4MQAA 2QY0B 4TPIZ 1O5AB 6GCHG 4AOQA 1V3XA 3SO3A 3BTKE 1V2VT 1Y3WA 3TK5A 6GCHF 1LTOA 2O9QA 2HVXA 1RD3B 5DJ7A 5BRRE 1AN1E 4BXWA 3P8NA 1ZPBA 3BTME 1QJ7B 4AFQA 4Q7XA 2ZGBH 1QRXA 1LPKB 2FOFA 4WH6A 4IGDA 8ESTE 2G81E 2WV4A 1FN6A 1G2MA 2CJIA 3VB3A 2FWWA 4NIYA 1HV7A 1UHBB 1O2UA 2V3OH 4X8TH 2ZFSA 4NIWA 5C5NA 1F5KU 3UR9A 3UNQA 4KELA 1UHBA 2R2WU 1KXEA 3A86A 1SGTA 1O3PB 1QURH 1Z71A 2VIPA 1NY22 4H42U 5F6MA 2WUBA 2Z9GA 4KTSA 1O37A 3RXTA 4LOYH 3G01A 1YPEH 2PKSB 4NWKA 4UD9H 2AIQA 5F8TA 1LDTT 6CHAB 3QGNB 1GJ9B 1M9UA 3MO6A 3A80A 4CRDA 1OWJA 2A5KA 1BMAA 3SU6A 3ZV9A 1T8LA 3U1JB 1Z8JB 3GDSA 2PKAA 3MNXA 5SGAE 4FVBA 2O8TA 4AZ2B 2CHAB 3OX7U 4SGBE 5A8ZA 2F9UA 3SGQE 2D26C 1G3CA 2BX3A 4JZEH 3KQEA 1D3QB 4BTUB 1L0ZA 1SPJA 4KGAA 3E91A 1ZMLA 3GOVB 4K8YA 3SJ9A 1BHXB 1Y5AT 1HJ8A 6CHAC 1GI7B 2BDCA 1P09A 1PJPA 3FVFB 5EG4A 1NT1A 3SQHE 4Y0YE 3D62A 3KQDA 1S81A 3RMNH 1SGYE 4TY6A 4CH2B 2OQUA 1O36A 2C3SA 2RA0A 1ELVA 1PPZA 4D76A 3PTBA 1LMWB 5CHAB 1FAXA 4NSVA 1SQOA 2A1DB 1JOUB 2HNTE 4J2YB 1SSXA 1G2LA 2BDHA 1WTHD 1SOZA 4TPYA 1WAYB 5L6NH 1H4WA 2P95A 4ZHAA 4LK4A 3LGIA 2R0KA 1AE8H 4LZ1H 2O8LA 1QL8A 1V2WT 5L2YH 1GCTC 5DKMA 2OC0A 3TLOA 4X1PU 2ZPQA 1FY8E 2BY8X 5IDKA 1QJ6B 1QNJA 4BAMB 2IN2A 2FTMA 2DE9A 1F5LA 3ATLA 2FS8A 1QFKH 4ABDA 2ZU4A 3Q00A 1K22H 1YC0A 2VGCB 2D2DA 3M5LA 1TRYA 3ODDA 3PWBA 4X0WU 4DURA 1IOEA 2W7UA 3BV9B 2P3TB 4O9VA 1TWXB 1ETTH 3T5FH 4GPGA 5HMAA 2VVCA 1ARBA 1O3IA 2ZDKA 5GJ4B 1HAVA 4OS1A 1HBTH 1TPSA 2ZHQH 1V2ST 1ZR0A 1C5TA 2QA9E 4ZKSU 2SGEE 3EQ0H 1EAXA 5B6OA 1FY4A 1ZTKA 1MTSA 1J15A 4K60A 2GX4A 5BPEA 1HUTH 4INLA 1O32A 1TOCB 4NIVA 4UE7H 2W7SA 3A8AA 1DUAA 1T7CA 1VCWA 1Q31A 5LPFA 3GY3A 3LIWA 3TJNA 3PMAB 2BLVA 1YPJH 2R2MB 4FUFA 1K1JA 2FOAA 4MG3A 1AKSA 1GBKA 4JK5A 3PLBA 2BD7A 1QCPA 2BQ6B 1GBDA 4MNXA 3E90B 5EGMA 3MU8A 1TLDA 1E37B 2Z9LA 4O3UA 2YNBA 3TJOA 1BHXF 3ZZAA 3E6PH 5C67A 1O2XA 5FXLA 2JH0D 4CHAB 4XFQA 1C5UA 1TNLA 5C20A 3VB4A 3P17H 3A84A 4A7IB 3BEFB 3GY5A 4WWYA 1LHGH 1EPTC 1O3MA 4MNVA 4INKA 2V35A 1EP6A 3TK6A 4JYUH 2QCYA 4OS5A 1QHRB 1LVYA 2BD4A 1K1MA 2XBWA 3GCHB 2HNTF 2XWBI 2R3UA 3RC4A 1A46H 1BOQA 1RTKA 1HPGA 3MNCA 4Z6AH 3RMLH 3TJUA 1V2PT 2CHAC 3A7TA 2ZFTA 1A0HB 1PQ7A 2GCTB 1AMHA 1BRBE 2GP9B 2HWLB 1E35B 1HAOH 3TVJB 5FCKA 1WTGH 3ZVDA 1EZUC 2ASUB 1ABJH 3DA9B 2R3YA 3RXFA 1PQ8A 2TGPZ 1TGCA 1W11U 1C5LH 1V2MT 4F49A 4FUEA 1BTWA 2ZQ1A 4B74A 1TNGA 3M37A 2TGAA 1QA7A 2P8OB 1D6WA 1MTVA 1C2MA 1XUJA 3ZZCA 1TYNA 3UUZA 5EQQA 1OP8A 3LC5A 3QTOH 2BX4A 2Y80A 2VIQA 2ZDAH 4WVPE 2ZC9H 4K3JA 3RMMH 2ZFRH 2WYJA 1INCA 5JBAS 1MBQA 3HPTB 1TPOA 1BTZA 7KMEH 4YZUA 4F4OC 1YLDA 1C5SA 1JIMA 1ZMJA 3A8BA 5C5OA 1BTYA 1P2IA 1GI1A 4X2VA 1O2SA 3KCGH 4J1YA 2HRVA 3HKIB 4GVUA 1PPFE 1PQAA 2XTTB 1BTUA 2AYWA 2BOHB 2K1QA 4OS6A 3O8RA 2Y5GA 3PLKA 1E36B 1MKWK 4XSKU 2Y82A 1GHWH 3EAJA 3VEQB 2OC1A 4WJG2 1FIZA 3SUFA 1SQTA 3SU3A 5FPSA 1KXBA 1NFYA 1ELDE 5E0HA 3MU4A 2TGTA 1YLCA 2PHBA 5EXNA 2AMPA 1VGCC 3D49H 2GDEH 1LCYA 2VIWA 4A6LA 1EZSC 4X8VH 1SMFE 4X1SU 6ESTA 4HFPB 2G55A 4ABHA 9LPRA 1XVMA 1WQSA 4HTCH 4ISHH 4X1QU 2J92A 5GPIB 4CBOA 4DW2U 3RXUA 2NWNA 3T26A 3VGCB 1QTFA 4TWYA 1AVXA 1V6DA 3MFJA 1BRCE 8GCHG 2A0QB 3PTNA 2TIOA 3M36A 2BDIA 1AB9C 4E7NA 2FO9A 2VH0A 4CR9A 1OKXA 2FI3E 2BVXH 2J2UA 1HIAB 2C8ZB 4X6PA 2Q6GA 4B73A 1TIOA 1AU8A 1GG6C 4NZLA 1GMDF 3RXPA 1SBWA 2VGCC 1TMBH 2J95A 4U01A 1EPTA 1RIWB 3BF6H 1W13U 4ABBA 4ABGA 4D8NA 3A7XA 4MNWA 7ESTE 2ZDVH 3IWMA 3UIRA 1OWDA 1P05A 4BAHB 3V13A 3RXKA 5CE1A 1DSTA 3QGJA 1SGFA 1P2KA 3LJOA 4GHQA 1HDTH 5FX6A 3SJIA 1UTNA 2I6QA 2GKVE 1AGJA 1XUGA 1Y59T 2Y5HA 5LPRA 1XKAC 2A4OA 3RXRA 2NU1E 4JZDH 2FODA 4AN7A 1AHTH 2ZDMA 1BBRE 4KP0A 4WF8A 4JMYA 2QAAA 4SGAE 1BTPA 3E0NB 1V2NT 2OBOA 1MKXK 1TX7A 1Z8IB 1UCYH 1SHHB 1FQ3A 4JCNA 2EC9H 3U8TH 3A7WA 4AB8A 4OS7A 1QQ4A 3HGNA 1C2DA 4ISNA 2W26A 3TNTA 3RXHA 2O8UA 1P2JA 4IW4E 3SV9A 2FOGA 3M61U 2O8WA 4NGAH 1O3KA 1NRSH 3H5CB 1XUIA 3MH6A 3EYDA 3E3TA 3GDUA 3RU4E 3NXPA 1P10A 3EE0B 3OSYA 4RSPA 2PLXA 1G9IE 2ZP0H 3BTDE 3QDZB 3SV8A 1TAWA 4AGJA 1CHGA 1Z1JA 1GJ7B 2BDYA 1OP2A 1IQLA 1QR3E 2F3CE 4BANB 2QYIA 3SHCH 3SJKA 3SU2A 4Y6DA 2FXRA 3ZZ8A 1G3EA 3U9AH 6LPRA 1E34B 1FPCH 1GGDC 3RDZA 3PMHB 1OWEA 2F91A 2F83A 1Y8TA 1T8NA 4KKDA 2AEIH 3RXJA 1HXEH 1W7XH 2VU8E 3L6PA 1C5RA 3RXMA 2NU0E 1C1SA 3BTWE 1O2ZA 1QIXB 5DK1A 3RU4D 1EJMA 1P2QA 3W95A 3E0PB 3SU5A 1A4WH 4K69A 1YPMH 4Y71A 1L4ZA 3ATMA 1HRTH 3L33A 3M3TA 1GBJA 1K1PA 4ASHA 1HJAC 4Y10E 3ZZ6A 1W7GH 3M3SA 1FLEE 2PFEA 3A7ZA 1FN8A 2OQ5A 3R3GB 4ZH8A 4RKJB 4QT8C 1K1OA 3S7HB 1GHBF 3M7TA 5JDUB 1DSUA 1IQNA 2QXHA 1TMUH 2ULLA 5T6GA 8LPRA 2A5AA 2ZECA 3QTVH 2SNVA 3M3VA 2OC7A 1DS2E 1O5GH 3SU4A 1GI6A 2BLOA 2UUFB 4NWLA 1ELFA 4MVNA 2HPPH 2ZFQH 4YESB 1O2OA 2A7HA 4BTTB 3TK9A 1UTJA 2FOBA 1HCGA 2Q6DA 2XWAA 3DHKH 5FX5A 2A4QA 1O35A 4U2WA 4BOHA 2P94A 1G30B 3ODFA 3VB7A 1ELAA 3STIA 1K1IA 2B7DH 2G4UA 3LGTA 3LGUA 1BMMH 1FY3A 1NU7B 5EW2H 2O8MA 3MU0A 1P8VC 2GCTC 1UTMA 2A4RA 3ZZDA 1N8OC 1GHXH 3SV6A 3GCHC 2RCEA 3EA7A 3NPSA 1C1MA 1NFXA 5AFYH 1MUEB 1O2YA 1AE5A 2W5EA 2UWLA 3ZVGA 1B0FA 1LO6A 2QXJA 2GCHG 1QBOA 2AIPA 1Z1IA 2H5DA 3SHAH 3CS7A 4FU7A 2FIRH 1DFPA 1GDUA 1OYQA 2AGIX 3KIDU 1P9UA 3BG4B 4Y11E 4Y7AA 3MH5A 1RTFB 1MTNC 3BG8A 4ZROA 3SV7A 1ANCA 1GJ6A 1GDNA 4FUHA 2ANKH 1KIGH 1C2FA 2BOKA 3SUDA 2ANWA 3BIVH 4WXIA 5CMXH 1QQUA 1O0DH 2XNIA 2QGRA 3BTQE 3Q3XA 5ESBA 3TGIE 1ESAA 1DLEA 2FOCA 1P2NA 3A82A 3P8GA 4D7FA 5F8ZA 4GCHF 5F8XA 5IYTA 3RXEA 1SFIA 4XE4A 1GBCA 1C1PA 1C1WH 4NSYA 1T8OA 2OP9A 3FAOA 4X8UH 5JYIA 4TYDA 2Z3CA 1K2I1 4YM9A 2G00A 1YGCH 2JH5D 7GCHF 1C5XB 4I8KA 1NFWA 1J17T 1O31A 2UUYA 5J4SA 5DP3A 3M35A 2BHGA 1O3FA 2J9NA 3OTJE 1O2TA 3ZVBA 3GY4A 1MZAA 1TGTA 2G5NA 4K1TA 2ALPA 1TA2A 1Z6JH 2BYAX 1SGPE 1P3CA 2BY7X 1KTTB 5C1UA 1GI5A 2PTCE 1P3EA 4E7RG 2ZPRA 1O39A 3BTEE 1DVAH 1W12U 3F9GA 3LKWA 3ZZ5A 1C4Y2 1IHSH 2ANMH 4ABEA 1XM1A 4E05H 4YOIA 1ZRBA 4INHA 3BTFE 2PGQB 2BD9A 2A45B 1LKAA 3QZRA 4AB9A 1WU1A 1SC8U 4D7GA 1EAUA 5K0HA 1NROH 4X2WA 2FX6A 1WBGB 2FI4E 3B23B 4WXVA 2ESTE 1OWIA 4FUBA 3P8FA 2CXVA 1K1LA 3ATWA 5EQRA 1DY8A 4Q2KA 1LQEA 2SGPE 2I6SA 1S6FA 5I46H 4YOJA 1N6XA 5A8YA 1O2IA 1AZ8A 2RG3A 4Y8ZA 1C5OH 3F9FA 1NESE 2GZ7A 1GI8B 1GBBA 4U30A 4ABFA 1TX6A 1RXPA 2FOEA 2FX4A 2ZU5A 1AB9B 3P95A 4TWWA 1VJ9U 2QV1A 1GHVH 1ID5H 2FDAA 3I29A 4IBLH 1O38A 1O5BB 2RA3A 3SQEE 3ATIA 1HAVB 8GCHF 3T27A 1BMLA 2GMTB 1O2NA 2ZO3H 2ZA5A 1BB0B 1JMOH 1BA8B 4FUIA 3T2NA 1FJSA 1O5CB 1DY9A 1SL3A 2C90B 4CH8B 2V6NA 1NN6A 4KTCA 1WQVH 1UTLM 1FY1A 3DFJA 2GT7A 1GCDA 1C2JA 1W10U 3FZZA 4O3TA 2QF3A 3S9BA 2ZGJA 3V7TA 3QK1A 3TPIZ 1C5PA 2OTVA 3F68H 5EQSA 3GICB 1BCUH 2ZU2A 1O2HA 2FPZA 2Z9IA 4A1VA 1YPLH 2VIVA 3HGPA 4Q7ZA 4AFZA 1SGCA 1SGFG 3B8JA 1SGNE 3MWIU 1YCPK 1EB1H 1UTOA 1UVSH 3BTGE 1OYTH 4JK6A 2ZCHP 2ZHFH 1LPZB 5ESTE 1C2EA 2PW8H 1AKSB 2G52A 5E0JA 4MPXA 1C5NH 1WCZA 2GT8A 3PM3A 3DUXH 1DUEA 1RIWC 3S9CA 3ZV8A 5T3HA 3FANA 3WY8A 1F92A 2ZWLH 2Y7ZA 2XCNA 3QZQA 3FP6E 2BLWA 2P59A 1Z8GA 1BJUA 3AW1A 1SOTA 2IJOB 1O3BA 2V3HH 1CSOE 1C4V2 2GD4B 3KN2A 2H9TH 2XC4A 1GVZA 4LZ4B 1TRMA 2EI7A 1O3GA 3GYMA 3SORA 1JWTA 4MDSA 2F9OA 2R0LA 2UUKB 1KYNA 4Y8XA 1LHFH 1AUJA 1TNJA 2C4FH 1QBNA 1S84A 3PWCA 3SUGA 1UO6A 1C4U2 1EKBB 2FYRA 4AFUA 2OINA 5TCCA 1PPHE 5TJXA 3NCLA 1GHBG 1IQFA 3KNXA 1W0YH 3V12A 2SGAA 1V2OT 1DT2A 4XBCA 1Q3XA 3SI3H 4GHTA 1QL9A 5C2ZA 1GDQA 3OY5U 4Y7BA 1O3DA 1OWKA 2F9VA 1NZQH 1Y3XA 2OXSA 5EODA 2Y7XA 1ELEE 2ZEBA 3EA8A 5DP8A 2VB0A 4HI3A 2ZGCA 3RM2H 1GHAG 1C5YB 1MKWH 5ETXA 1C1TA 4I32A 1S83A 1OX1A 1E0FD 1EJAA 1LKBA 2C8WB 4CRCA 4NFFA 1AY6H 1V2RT 2D8WA 1F0RA 1ESBA 3V3MA 1KLJH 2GV6A 3KQBA 1AD8H 3SOSA 1O5FH 4X1RU 5T6FA 2A7CA 3P6ZB 1A0LA 3PMBB 4DIHH 3LT3A 3U8OH 3ZVFA 2VWOA 1VR1H 1B0EA 1O3EA 1YYY1 1RS0A 4YT7H 1WSSH 1DWCH 4B71A 2Z9KA 3GY8A 4ZUHA 1LVOA 1GBMA 1N6YA 2VWLA 1J16A 3TNSA 1WV7H 1K9OE 3QWCH 1MTWA 1JIRA 2C8XB 1OOKB 1F0TA 1X7AC 1A7SA 1ZJKA 3CENA 2G4TA 2FESH 5E2PA 1ORFA 4UFGH 1GHZA 1JRTA 1V2UT 2G51A 3S9AA 3CS0A 1UK2A 1ELCA 1NFUA 1UTQA 1GI0A 4CREA 4OS2A 2JETB 1ANEA 3U69H 2RDLA 1AVGH 3ZZ4A
chains in the Genus database with same CATH superfamily
1CBWB 3PYHA 2J97A 1VITG 1HIAA 4MPVA 3N99A 3MHWU 1ZMNA 1H8HD 3P70B 1HAIH 4P02A 3SGAE 2ZHDA 1ZGVA 2KAIA 4FXGH 3VPKA 1MTNB 4R0IA 3FN8A 2IPHA 4XOJA 5DP9A 2GGVB 2CMYA 1AZZA 1P06A 2F4LA 2OCVB 3FZDA 2HLCA 1A2CH 1YPKH 4YOGA 4FETA 4HGCA 2PKSC 1EB2A 1C5WB 3LH1A 3SBKA 2KR7A 1P02A 2J94A 4X2YA 1PFXC 1DOJA 3KL6A 3DD2H 4NCYA 2P3FH 2TRMA 3F0PA 2A32A 1A3BH 1GMHG 4ESTE 2GCHF 2LPRA 4NA8A 1RJXB 2FLBH 3L3TA 1YPHC 3N7OA 1EATA 3SNAA 3UREA 2ZGHA 4B75A 1LQDB 3STJA 3A88A 3SV2H 1DWBH 1ZOMA 3ZVCA 4BAOB 5L30H 3PRDA 5JPMH 1BJVA 2H1UA 3LH3A 1LVMA 1MTUA 4O97A 3PLPA 1GJDB 5DPAA 1F0UA 1RRKA 1NS3A 2J38A 1BRAA 1AWFH 2ZDNA 4BNRA 2BQWB 2CGAA 2ZFFH 1CT4E 1XKBC 2BY9X 4I8HA 1THRH 1G3DA 4IS5A 1AIXH 2YMSB 3TGKE 1P12E 3TH2H 1P57B 2ZF0H 1SKYE 1HAPH 1MMJN 1D9IA 1SVPA 1QGFA 3MYWA 1HAZB 4A1XA 5I25A 1ZPCA 1H9HE 5HKKD 2WPLS 3HATH 3LC3A 2OLGA 1GBTA 1O3CA 3U1IB 2ODPA 1QJ1B 1TFXA 1BITA 3UNRA 1CT0E 1SGQE 3KHVA 1PQ5A 1NTPA 4MPUA 4FVDA 1HJ9A 1UK3A 4NFEA 4F55A 1ETRH 1AI8H 5CHAC 1HJAB 3GDVA 1TONA 2Z9JA 2YMSD 2Y81A 1UVOA 1K1NA 1AUTC 1B5GH 3DT0H 4OS4A 1KLIH 1ZHPA 1ZGIA 2XXLA 4BTIB 5JBTA 1EQ9A 1GI3A 1C2GA 3K6ZA 2TBSA 4FU9A 5A09A 1MAYA 2P93A 2VINA 2C8YB 1NC6A 1GPZA 4ISIH 4B2AA 1GCTB 3TITA 1OSSA 5GXPA 1CVWH 1E1QD 1TRNA 2WUCA 3RXLA 1Y3VA 1CHOG 1DWDH 2A4GA 4IN2A 4XBBA 4ZHMU 1TALA 4K5ZA 2XBXA 1EPTB 1C1QA 4UFDH 4MLFB 1TBZH 3A7VA 5FCRA 3RXBA 4KTUA 4F48B 2GMTC 5FAHA 3SN8A 3AK5A 4CRBA 4ABAA 2FMJA 3U8RH 4HZHA 1Q2WA 1TBQH 3RP2A 2XBYA 3ZVAA 1BRUP 1HNEE 1GG6B 1PPEE 2GTBA 4IMZA 4DVAU 1MBMA 4Y79A 2ZGXH 5JB9S 1O2QA 2BVRH 1GVKB 1CA0B 4FUCA 1QB9A 3P92A 3BN9A 3ZZ3A 1D4PB 1HXFH 4I8LA 1QB1A 4WMFA 5EU8A 4AYYB 4OGXA 1TBRH 4TY7A 4Z1MD 2STAE 5C0UA 1BIOA 1IQMA 3F9EA 1UTKA 4HG6A 2WV5A 1GHAF 2Z6BD 2JJ1D 1DLKB 1SG8B 1THPB 3CNRA 1P04A 1P03A 3PROA 1ANBA 2PGBB 3SGBE 1QRWA 1DANH 3MNSA 7LPRA 2M5TA 5EW1H 1H8IH 1W8BH 3PRBA 2JDID 4I31A 5GDSH 3EDXB 2JKHA 5HM9A 1O2WA 4DG4A 4OM9A 1O3AA 3WWFA 4D9QA 1OS8A 1GJ8B 1NM6A 2BD5A 1MU6B 3GY2A 1MU8B 5DP5A 2ZNKH 3GY7A 1MAXA 2EY4C 2BDAA 1YCPH 1D3TB 1A1RA 1W2KH 1AVWA 4BAKB 1XXDA 2FOMB 2ZTZA 2HPQH 1DDJA 1LVBA 3M5NA 3UWIA 2NU2E 3F1SB 2BB4A 3UQOA 4ZCNA 1NRQH 3UFAA 1ZJDA 1W0ZU 3MO9A 5DP6A 2PR3A 3MNBA 4RKOB 1VZQH 2BQ7B 2SGFE 4Q80A 4B2BA 2DE8A 1EAIA 3F2HA 4UONA 1BTXA 2THFB 3ATKA 4MTBA 3NK8A 4X8SH 1GBHA 1YP9A 3BSQA 2PTNA 1HAGE 3RM0H 3LGVA 1EZXC 2P8OC 3H7TA 2HGTH 2SGQE 1THSH 4AG2A 5K7RA 2AFQB 4IC5A 2VH6A 1RGQA 1KXFA 1UJ1A 1O5DH 5GWZA 3H7OA 3P8OA 4OGYA 2ODQA 1GJAB 3UNSA 3MO3A 8KME2 4IMQA 1TGSZ 1UMAH 2JH6D 4GCHG 4XDEA 1EOJA 1A5IA 1GMHF 3ZZ7A 5JBBS 5ABWA 3EA9A 3Q3YA 3A89A 2QN5T 3HKJB 4UDWH 2GZ8A 3VXEH 2WPHS 1FY5A 4ISOA 5LH8A 3I77A 2BD8A 1RTLA 3AASA 1O2JA 1OP0A 4FUJA 2XYAA 2VWNA 9ESTA 1GBAA 3TGJE 4X2XA 4I8GA 4I7YH 5GCHG 5A2MH 4CHAC 1CA8B 4GAWA 1VGCB 4A5TS 3GCOA 1TPAE 4MPWA 1CBWC 1Z6EA 2B9LA 1FUJA 1P2MA 1GJ5H 1CGIE 2B0FA 1T32A 3O8CA 4JZ1A 3RU4T 1ZHRA 1TGNA 2VIOA 2OC8A 2RDEA 2EEKA 2FI5E 1H9IE 3C1KA 1GMDG 1S85A 4D9RA 2F9PA 4WY3A 3T62A 3UWJH 4IC6A 1JRSA 1D6RA 3JZ2B 4YT6H 1YM0A 5DGJA 1XXFA 4X6NA 3SNBA 5EPYA 1DXWA 4WMEA 1VITH 1O2KA 3A87A 3D65E 1H8DH 3LU9B 3SNDA 1SLWB 1XMNB 1MD7A 4DIIH 2JETC 1XVOA 2B8OH 1HAHH 5EXMA 2WPKS 2VWMA 3SUEA 1OWHA 1Y3UA 2HLDD 2BVSH 5JBCS 2BY5X 4GUXA 3NKKA 2CF8H 2EQNA 3KGPA 1DPOA 2ZTYA 1IQKA 1O2MA 3KQCA 1G32B 1OHHD 3SJ8A 2WYGA 1WXRA 1KY9A 1EJNA 5F53A 2PKAB 3VGCC 3Q77A 1C5VA 1FV9A 1S6HA 1C2HA 1SLVB 3TH4H 3VB5A 1TMTH 2QF0A 3K2UA 1PPBH 4ZXXH 3BTTE 1SB1H 3TU7H 3RXQA 2B5TB 3IITA 1UTPA 2A31A 4AC9A 2J34A 1XX9A 1O33A 3QX5H 1KXDA 4X6OA 1GJBB 3KEEA 1O3LA 1EAWA 3NWUA 5FBEA 2V0BA 1TE0A 1AFQC 5IK2D 1F0SA 1VITF 4K1EA 4JZFH 1S82A 4Y76A 1C1UH 3E8LA 3SZNA 5E8EH 5HIZA 1YPGH 1BTHH 1S0RA 4DJZB 4JYTA 1PPGE 5FPTA 2SNWA 5LGOA 1WUNH 4WMDA 1MH0A 3QN7A 3UAIC 3SJOA 3W1EA 2Q6FA 3GCTF 1HYLA 4YLUA 3MMGA 1ZHMA 3URDA 3SNCA 3OE7D 1SGIB 1G37A 4NG9H 1MQ6A 2FYQA 1YCPM 3A85A 1DE7H 2Y6TA 2Z94A 2UWPA 2J98A 1WYKA 3SU1A 1HB0B 4AX9H 1VCPA 1GHYH 4UFEH 4K8BA 1Y3YA 3BIUH 1PPCE 2ZHWH 2VBCA 4ABJA 4K1SA 1LHEH 1L1GA 2HOBA 5C1YA 3UTUH 1Y5BT 1XUKA 3MI4A 1CGJE 1GI9B 3AAUA 1C5MD 1NRRH 4BAQB 1MCTA 2XCFA 1SGRE 2WPIS 5A0AE 1UCYE 3F9HA 1FDPA 1KSNA 3K6YA 3OY6U 3C27B 4LXBH 1BBRH 3LDXH 2QC2A 3M5MA 3BEIB 4GSOA 1BMNH 3ITIA 3RLWH 2GVFA 2ZHEH 1SFQB 5T1VA 2P3UB 3LPRA 1YLNA 3PV5A 3S69A 3JZ1B 1N8OB 1H1BA 2G8TA 1GJCB 5DO4H 1UVPA 4DCDA 1CA0C 5FPYA 3I78A 1OPHB 1DITH 1KDQB 2A5IA 4B2CA 2SGDE 2IOTA 3RXAA 1W3CA 4ZKOU 2D1JA 2XRCA 3ZZ9A 3ZVEA 1V2LT 2OUAA 2DUCA 5GCHF 3HK3B 1DXPA 4UEHH 1GMCF 2BMGB 3RUOA 2UWOA 2ZPSA 3UOPA 2ILNA 4DGJA 1GI2A 1A3EH 1NRNH 1KLTA 1SQRA 4I33A 1ZSJA 1ZRKA 2CF9H 3HK6B 1ACBE 1AWHB 1IQIA 4VGCB 4ZHLU 1SHYA 2OD3B 4B76A 2Z3EA 3BG4C 1K21H 2WINI 1V2JT 4UFFH 1TPPA 3QLPH 2BD2A 1MABB 1CGHA 2TPIZ 1IQEA 1L1NA 1O2PA 5E0GA 3SW2B 2VVUA 7GCHG 3WWBA 2ZIQH 2AERH 1W0JD 4X6MA 5HXFA 1QL7A 1ZZZA 2VIDA 1TABE 5EPNA 1C1VH 3FP8E 4VGCC 1TQ0B 2Z3DA 1VCQA 4AORA 2UUJB 5A0CA 5A8XA 3ZZBA 1NRPH 3GY6A 3LGWA 2ANYA 1C2LA 1FMGA 1JXPA 4I8JA 2H9EH 1TX8A 2AMDA 2H9HA 3AW0A 3FP7E 1K28D 3M7UA 1AFQB 3NZIA 3UQVA 1F2SE 3GCNA 3V0XA 2HALA 4R8TB 4BXSA 1C2KA 1SGEE 2BLQA 1C9PA 1MD8A 5T6DA 2ZDLA 1NU9A 1A5HA 3SU0A 1ELGA 2XC0A 4O03A 3E1XB 3MH7A 2V3MA 2ZKSA 3MU5A 2AH4X 3OEED 2GV7A 1ZLRA 4ABIA 4CBNA 1TOMH 1ZPZA 4CRAA 4FU8A 1BZXE 2EI6A 4Z0KA 1EOLA 5G4BA 4CR5A 1CHOF 2BTCE 2BDBA 2BXUH 5DP4A 1EZQA 1LHCH 3UR6A 5C0TA 1AQ7A 1P2OA 2J4IA 1YBWA 2H5CA 4GLYA 4Y8YA 3A8DA 1DICA 1HLTH 2EI8A 3N7EA 3NRLA 5HGGA 5HM2A 2F43B 1BQYA 3LGYA 2F9NA 3A83A 3A81A 2CN0H 2PV9B 2W3IA 2VVVA 4B6FA 5CHBA 3PO1B 4DT4A 3VFEA 1U6QA 3VXFH 1G36A 1IAUA 4NA9H 3K65B 1TB6H 1RFNA 1UVTH 2XW9A 2PUXB 1O3JA 1MKXH 1V2KT 3O8BA 2W6ID 1HFDA 2YOLA 3B9FH 3W94A 3RXVA 5AF9H 1ZTLA 2XC5A 4M7GA 1LHDH 4DOQA 3F6UH 4Y0ZE 3RLYH 3DFLA 3OEHD 1EASA 3TJVA 1L2EA 5TCAA 1YY3A 5C17A 1FZZA 1O34A 4H6TA 1PYTC 2CV3A 1Z8RA 2FS9A 1GMCG 1GWAA 1GL1A 1T31A 3SNEA 4B1TA 4FOUC 2ZU3A 2C93B 4RT0A 4A92A 2BM2A 4FUDA 1F5RA 1V2TT 5C3NA 2F9BH 4X1NU 3TIUA 3SI4H 4CRGA 2AS9A 1FXYA 3QUMP 2Q1JA 3F0OA 2FTLE 1QBVH 1GGDB 1T4VH 2ZZUH 3RXIA 1OXGA 1MZDA 1O3HA 3PV4A 1CQQA 3M7QA 2BY6X 3MH4A 5DG6A 1GBFA 2H6MA 2STBE 2HNTC 1C5QA 5GIBA 2NU4E 1ELBA 1O3OA 3KF2A 1F7ZA 1UVUH 1GVLA 5FHTA 3URCA 1O2GH 1ZSKA 2W3KA 1CE5A 3GISB 1Y5UT 1KXAA 4MNYA 4YO9A 1A61H 2FM2A 4YTAA 3AVZA 3ZIAD 5JB8S 2WPDD 3UPEA 3D23A 2GDDA 1J9CH 3ESTA 4FUGA 5E2OA 1V2QT 1FONA 3BEUA 1XUFA 3OU0A 1ANDA 5EXLA 4B6EA 1DWEH 1MQ5A 1GL0E 4JYVH 3OYPA 2BZAA 1O2RA 5B6LA 3T28A 1O2LA 1SQAA 1O30A 4RN6A 4NA7A 1ETSH 1MCVA 1T8MA 1L1JA 3U98H 4WH8A 1P11E 1SR5C 2ODYB 2QXGA 4THNH 4AYVB 1NO9H 4JZIA 1VJAU 3UOUA 1C1RA 1QB6A 2ZQ2A 1NPMA 2ZU1A 2WSSD 5J4QA 2ZTXA 1BDAA 2FZZA 3ENSB 1PYTD 2AGGX 4M9FA 3VG8A 4AGKA 2BZ6H 1KDQA 1B7XB 1FIWA 1HGTH 2KAIB 2BDGA 4E06H 2BD3A 1A0JA 3T29A 1CT2E 2Z7FE 2PWXA 4XBDA 1YWUA 4ZKRU 3UY9A 5F03A 1IQGA 4NIXA 2QXIA 3E16B 1Z7KA 2VJ1A 4ZAEA 1LPGB 3RXCA 1ELTA 3RC5A 1UK4A 4YXWD 1GBIA 1GI4A 2A7JA 5PTPA 1C5ZB 5C1XA 4ISLA 2GZ9A 1ARCA 1IQHA 1SI5H 1O5EH 1IQJA 1YPHE 2WPJS 1GJ4H 1CO7E 1KXCA 1ZYOA 4AG1A 1QA0A 3LOXA 2FP7B 5H4IB 3ELAH 1BBRK 3PB1E 1QRZA 1IHTH 3QO6A 5C94A 3DCLA 1AO5A 5FBIA 2TGDA 3IG6B 5EOKA 3Q76A 1AFEH 3RXDA 4CRFA 2P16A 1XUHA 4AFSA 1BUIA 1EX3A 3OFND 3OTPA 3MQKC 1J14A 2ZCLP 1SGDE 1G3BA 5DP7A 2H2ZA 2OBQA 2Y5FA 3LONA 3RC6A 1EXFA 2PSXA 3FFGA 1D3DB 2PSYA 3MTYA 1HAXB 3S0NA 1A5GH 2FOHA 1P01A 3GCTG 3A8CA 1TNHA 3S7KB 4PROA 2AGEX 1E38B 2SFAA 3Q3KA 4U32A 2WPMS 2EA3A 2YNAA 3BTHE 3O8DA 4ZMAH 3PMJA 5AFZH 3TH3H 1QY6A 1FAKH 1D3PB 3RMOH 1TQ7B 5AVDA 2G5VA 1HAYB 1S5SA 2WZQA 5CDFE 2ZFPH 5HYOA 4NZQA 3PO1C 1GBEA 3M5OA 1EUFA 3VB6A 3ZYEA 4K2YA 1TGBA 1KTSB 2A2QH 2FEQH 1H9LB 3K9XB 1P0SH 1WOFA 5AHGH 3R0FA 3EGKH 2VNTA 2ZCKP 2ZG0H 1EFRD 5KEDA 2PUQH 1DX5M 5LPEA 1ABIH 2QIQA 4ZKNU 1C1OA 2OK5A 4IN1A 5FL7D 3ZYDA 1FI8A 1J8AA 5A0BA 1DM4B 1P9SA 1EP5A 1ZSLA 3CP7A 2A2XH 1CU1A 5L2ZH 3GYLB 1N1LA 1ZTJA 2R9PA 4DY7B 1S0QA 3MU1A 1YF4A 1TNKA 3NUMA 4YLQH 1C1NA 1GBLA 1O2VA 1UCYK 3MOCA 4A1TA 1TNIA 2NU3E 1TA6A 1YKTA 4DT7B 3T25A 4H6SB 1W14U 2AMQA 2BXTH 4H4FA 2ALVA 1ESTA 2XBVA 2LNCA 1C2IA 1C9TA 3RXOA 3A7YA 4Q7YA 1BT7A 1FNIA 2ZI2H 1L4DA 3AAVA 1O3NA 3RXSA 1T4UH 2FLRH 1JBUH 1SLUB 1SLXB 3RXGA 1FPHH 4ZXYH 3LJJA 4MQAA 2QY0B 4TPIZ 1O5AB 6GCHG 2KX4A 4AOQA 1V3XA 3SO3A 3BTKE 1V2VT 1Y3WA 3TK5A 2KCAA 6GCHF 1LTOA 2O9QA 1K0HA 2HVXA 1RD3B 5DJ7A 5BRRE 1AN1E 4BXWA 5EIYA 3P8NA 1ZPBA 3BTME 1QJ7B 4AFQA 4Q7XA 2ZGBH 1QRXA 1LPKB 2FOFA 4WH6A 4IGDA 8ESTE 2G81E 2WV4A 1FN6A 1G2MA 2CJIA 3VB3A 2FWWA 4XD7D 4NIYA 1HV7A 1UHBB 1NBME 1O2UA 2V3OH 4X8TH 2ZFSA 4NIWA 5C5NA 1F5KU 3UR9A 3UNQA 4KELA 1UHBA 2R2WU 1KXEA 3A86A 1SGTA 2HVYB 1O3PB 1QURH 1Z71A 2VIPA 1NY22 4H42U 5F6MA 2WUBA 2Z9GA 4KTSA 1O37A 3RXTA 1VKYA 4LOYH 3G01A 1YPEH 2PKSB 4NWKA 4UD9H 2AIQA 5F8TA 1LDTT 6CHAB 3QGNB 1GJ9B 1M9UA 3MO6A 3A80A 4CRDA 1OWJA 2A5KA 1BMAA 3SU6A 3ZV9A 1T8LA 3U1JB 1Z8JB 3GDSA 2PKAA 3MNXA 5SGAE 4FVBA 2O8TA 4AZ2B 2CHAB 3OX7U 4SGBE 5A8ZA 2F9UA 3SGQE 2D26C 1G3CA 2BX3A 4JZEH 3KQEA 1D3QB 4BTUB 1L0ZA 1SPJA 4KGAA 3E91A 1ZMLA 3GOVB 4K8YA 3SJ9A 1BHXB 1Y5AT 1HJ8A 6CHAC 1GI7B 2BDCA 1P09A 1PJPA 3FVFB 5EG4A 1NT1A 3SQHE 4Y0YE 3D62A 1WDIA 3KQDA 1S81A 3RMNH 1SGYE 4TY6A 4CH2B 2OQUA 1O36A 2C3SA 2RA0A 1ELVA 1PPZA 4D76A 3PTBA 1LMWB 5CHAB 1FAXA 4NSVA 1SQOA 1E1RD 2A1DB 1JOUB 2HNTE 2L6OA 4J2YB 2LP6A 1SSXA 1G2LA 2BDHA 1WTHD 1SOZA 4TPYA 1WAYB 5L6NH 1H4WA 2P95A 4ZHAA 4LK4A 3DSPA 3LGIA 2R0KA 1AE8H 4LZ1H 2O8LA 1QL8A 1V2WT 5L2YH 1GCTC 5DKMA 2OC0A 3TLOA 4X1PU 2ZPQA 1FY8E 2BY8X 5IDKA 4XRNA 1QJ6B 1QNJA 4BAMB 2IN2A 2FTMA 2DE9A 1F5LA 2YMSC 3ATLA 2FS8A 1QFKH 4ABDA 2ZU4A 2WHXA 3Q00A 1K22H 1YC0A 2VGCB 2D2DA 3M5LA 1TRYA 3ODDA 3PWBA 4X0WU 4DURA 1IOEA 2W7UA 4I86A 3BV9B 2P3TB 4O9VA 1TWXB 1ETTH 3T5FH 4GPGA 5HMAA 2VVCA 1ARBA 1O3IA 4ASUD 2ZDKA 5GJ4B 1KMHB 1HAVA 4OS1A 1HBTH 1TPSA 2ZHQH 1V2ST 1ZR0A 1C5TA 2QA9E 2IPQX 2SGEE 3EQ0H 1EAXA 4ZKSU 5B6OA 1FY4A 1ZTKA 2XNDD 1MTSA 1J15A 4K60A 2GX4A 5BPEA 1HUTH 4INLA 2QE7D 1O32A 1TOCB 4NIVA 4UE7H 2W7SA 3A8AA 1DUAA 1T7CA 1VCWA 1Q31A 5LPFA 3GY3A 4TT3D 3LIWA 3TJNA 3PMAB 2BLVA 1YPJH 2R2MB 4FUFA 1K1JA 2FOAA 4MG3A 3EE7A 1AKSA 1GBKA 4JK5A 3PLBA 2BD7A 1QCPA 2BQ6B 3FO8D 1GBDA 4MNXA 3E90B 5EGMA 3MU8A 1TLDA 1E37B 2Z9LA 4O3UA 2YNBA 3TJOA 1BHXF 3ZZAA 3E6PH 5C67A 1O2XA 5FXLA 2JH0D 4CHAB 4XFQA 1C5UA 1TNLA 5C20A 3VB4A 3P17H 3A84A 4A7IB 3BEFB 3GY5A 4WWYA 1LHGH 1EPTC 1O3MA 4MNVA 4INKA 2V35A 1EP6A 3TK6A 4JYUH 2QCYA 4OS5A 1QHRB 1LVYA 2BD4A 1K1MA 2XBWA 3GCHB 2HNTF 2XWBI 2R3UA 3RC4A 1A46H 1BOQA 3WW7A 1RTKA 1HPGA 3MNCA 4Z6AH 3RMLH 3TJUA 1V2PT 2CHAC 3A7TA 2ZFTA 1A0HB 1PQ7A 2GCTB 1AMHA 1BRBE 2GP9B 2HWLB 4Q4LA 1E35B 1HAOH 3TVJB 5FCKA 2J5UA 1WTGH 3ZVDA 1EZUC 2ASUB 1ABJH 3DA9B 2R3YA 3RXFA 1PQ8A 2TGPZ 1TGCA 1W11U 1C5LH 1V2MT 4F49A 4FUEA 1BTWA 2ZQ1A 4B74A 1TNGA 3M37A 2TGAA 1QA7A 2L74A 2P8OB 1D6WA 1MTVA 3F2FA 1C2MA 1XUJA 3ZZCA 1TYNA 3UUZA 5EQQA 1OP8A 3LC5A 3QTOH 2BX4A 2Y80A 2VIQA 2ZDAH 4WVPE 2ZC9H 1W0KD 4K3JA 3RMMH 2ZFRH 2WYJA 1INCA 5JBAS 1MBQA 3HPTB 1TPOA 1QZ8A 1BTZA 7KMEH 4YZUA 4F4OC 1YLDA 1C5SA 1JIMA 1ZMJA 3A8BA 5C5OA 1BTYA 1P2IA 1GI1A 4X2VA 3GS9A 1O2SA 3KCGH 4J1YA 2HRVA 3HKIB 4GVUA 1PPFE 1PQAA 2XTTB 1BTUA 2AYWA 2BOHB 2K1QA 3UB0A 4OS6A 3O8RA 2Y5GA 3PLKA 1E36B 1MKWK 4XSKU 2Y82A 1GHWH 3EAJA 3VEQB 2OC1A 4WJG2 1FIZA 3SUFA 1SQTA 3SU3A 5FPSA 1KXBA 1NFYA 1ELDE 5E0HA 3MU4A 2TGTA 1YLCA 2PHBA 5EXNA 2LELA 2PP6A 2AMPA 1VGCC 3D49H 2GDEH 1LCYA 2VIWA 4A6LA 1EZSC 4X8VH 1SMFE 4X1SU 6ESTA 4HFPB 2G55A 4ABHA 9LPRA 1XVMA 1NBMD 1WQSA 4HTCH 4ISHH 4X1QU 2J92A 5GPIB 4CBOA 4DW2U 3RXUA 2NWNA 3T26A 3VGCB 1QTFA 4TWYA 1AVXA 1V6DA 1COWD 3MFJA 1BRCE 8GCHG 2JIZD 2A0QB 3PTNA 2TIOA 3M36A 2BDIA 1AB9C 4E7NA 2FO9A 2VH0A 4CR9A 1OKXA 2FI3E 2BVXH 2J2UA 2IJD1 1BMFD 1HIAB 2C8ZB 4X6PA 2Q6GA 4B73A 1TIOA 1AU8A 1GG6C 4NZLA 1GMDF 3RXPA 1SBWA 2VGCC 4TSFD 1TMBH 4ACBA 2J95A 4U01A 1EPTA 1RIWB 3BF6H 1W13U 4ABBA 4ABGA 4D8NA 3A7XA 5KGOA 4MNWA 7ESTE 2ZDVH 3IWMA 3UIRA 1OWDA 1P05A 4BAHB 3V13A 3RXKA 5CE1A 1DSTA 3QGJA 1SGFA 2WV9A 1P2KA 3LJOA 4GHQA 1HDTH 5FX6A 3SJIA 1UTNA 2I6QA 2GKVE 1AGJA 1XUGA 1Y59T 2Y5HA 5LPRA 1XKAC 2A4OA 3RXRA 2CK3D 2NU1E 4JZDH 2FODA 4AN7A 1AHTH 2ZDMA 1BBRE 4KP0A 4WF8A 4JMYA 2QAAA 4SGAE 1BTPA 3E0NB 1V2NT 2OBOA 1MKXK 1TX7A 1Z8IB 1UCYH 1SHHB 1FQ3A 4JCNA 2EC9H 3U8TH 3A7WA 4AB8A 4OS7A 1QQ4A 3HGNA 1C2DA 4ISNA 2W26A 3TNTA 3RXHA 2O8UA 1P2JA 4IW4E 3SV9A 2FOGA 3M61U 2O8WA 3FKSD 4NGAH 1O3KA 1NRSH 3H5CB 1XUIA 3SYJA 3MH6A 1E79D 3EYDA 3E3TA 2M2AA 3GDUA 5EJLA 3RU4E 3DSGA 3NXPA 1P10A 3EE0B 3OSYA 4RSPA 2PLXA 1G9IE 2ZP0H 3BTDE 3QDZB 3SV8A 1TAWA 4AGJA 2KCPA 1CHGA 1Z1JA 1GJ7B 2BDYA 2W6JD 1FX0B 1OP2A 1IQLA 1QR3E 2F3CE 4BANB 2KCOA 2QYIA 3SHCH 3SJKA 3SU2A 4Y6DA 2FXRA 3ZZ8A 1G3EA 1H8ED 3U9AH 6LPRA 1E34B 1FPCH 1GGDC 3RDZA 3PMHB 1OWEA 2F91A 2F83A 1Y8TA 1T8NA 4KKDA 2AEIH 3RXJA 1HXEH 1W7XH 2VU8E 3L6PA 1C5RA 3RXMA 2NU0E 1C1SA 3BTWE 1O2ZA 1QIXB 5DK1A 3RU4D 1EJMA 1P2QA 3W95A 3E0PB 3SU5A 1A4WH 4K69A 1YPMH 2KM0A 4Y71A 1L4ZA 3ATMA 1HRTH 3L33A 3M3TA 1GBJA 1K1PA 4ASHA 1HJAC 4Y10E 3ZZ6A 1W7GH 3M3SA 1FLEE 2PFEA 3A7ZA 1FN8A 2OQ5A 3R3GB 4ZH8A 4RKJB 4QT8C 1K1OA 3S7HB 1GHBF 3M7TA 5JDUB 1DSUA 1IQNA 2JJ2D 2QXHA 1TMUH 2ULLA 5T6GA 8LPRA 2XOKD 2A5AA 2ZECA 3QTVH 2SNVA 3M3VA 2OC7A 1DS2E 1O5GH 3SU4A 1GI6A 2BLOA 2UUFB 4NWLA 1ELFA 2AHME 4MVNA 2HPPH 2ZFQH 4YESB 1O2OA 2A7HA 4BTTB 3TK9A 1UTJA 2FOBA 1HCGA 2Q6DA 2XWAA 3DHKH 5FX5A 2A4QA 1O35A 4U2WA 4BOHA 2P94A 5HIYA 1G30B 3ODFA 3VB7A 1ELAA 3STIA 1K1IA 2B7DH 2G4UA 3LGTA 3LGUA 3DSOA 1BMMH 1FY3A 1NU7B 5EW2H 2O8MA 3MU0A 1P8VC 2GCTC 1UTMA 2A4RA 3ZZDA 1N8OC 1GHXH 3SV6A 3GCHC 2RCEA 3EA7A 3N7DA 3NPSA 1C1MA 1NFXA 5AFYH 1MUEB 1O2YA 1AE5A 2W5EA 2UWLA 3ZVGA 1B0FA 1LO6A 2QXJA 2GCHG 1QBOA 2AIPA 1Z1IA 2H5DA 3SHAH 3H09A 3CS7A 4RT1A 4FU7A 2FIRH 1DFPA 1GDUA 1OYQA 2AGIX 3KIDU 1P9UA 3BG4B 4Y11E 4Y7AA 3MH5A 1RTFB 1MTNC 3BG8A 4ZROA 3SV7A 1ANCA 1GJ6A 1GDNA 4FUHA 2ANKH 1KIGH 1C2FA 2BOKA 3SUDA 2ANWA 4Q63A 3BIVH 4WXIA 5CMXH 1QQUA 1O0DH 2XNIA 2QGRA 3BTQE 3Q3XA 5ESBA 3TGIE 1ESAA 1DLEA 2FOCA 1P2NA 3A82A 3P8GA 4D7FA 5F8ZA 4GCHF 5F8XA 5IYTA 3RXEA 1SFIA 4XE4A 1GBCA 1C1PA 1C1WH 4NSYA 1T8OA 3F3BA 2OP9A 3FAOA 4X8UH 5JYIA 4TYDA 2Z3CA 1K2I1 4YM9A 5DN6D 2G00A 1YGCH 4RI0A 2JH5D 7GCHF 1C5XB 4I8KA 1NFWA 1J17T 1O31A 2UUYA 5J4SA 5DP3A 3M35A 2BHGA 1O3FA 2J9NA 3OTJE 1O2TA 3ZVBA 3GY4A 1MZAA 5KECA 1TGTA 2G5NA 4K1TA 2ALPA 1TA2A 3F2GA 1Z6JH 5GNDA 2BYAX 2J98B 1SGPE 1P3CA 2BY7X 1KTTB 5C1UA 1GI5A 2PTCE 1P3EA 4E7RG 2ZPRA 1O39A 3BTEE 1DVAH 1W12U 3F9GA 3LKWA 3ZZ5A 1C4Y2 1IHSH 2ANMH 4ABEA 1XM1A 4E05H 4YOIA 1ZRBA 4INHA 3BTFE 2PGQB 2BD9A 2A45B 1LKAA 3QZRA 4AB9A 1WU1A 1SC8U 4D7GA 1EAUA 5K0HA 1NROH 4X2WA 2FX6A 1WBGB 2FI4E 3B23B 4WXVA 2ESTE 1OWIA 4FUBA 2V7QD 3P8FA 2CXVA 1K1LA 2KZ4A 3ATWA 5EQRA 1DY8A 4Q2KA 1LQEA 2SGPE 2I6SA 1S6FA 5I46H 4YOJA 1N6XA 5A8YA 1O2IA 1AZ8A 2KFWA 2RG3A 1C5OH 4Y8ZA 3KYFA 3F9FA 1NESE 2GZ7A 1GI8B 1GBBA 4U30A 4ABFA 1TX6A 1RXPA 2FOEA 2FX4A 2ZU5A 1AB9B 3P95A 4TWWA 1VJ9U 2QV1A 1GHVH 1ID5H 2FDAA 3I29A 4IBLH 1O38A 1O5BB 2RA3A 3SQEE 3ATIA 1HAVB 8GCHF 3T27A 1BMLA 2GMTB 1O2NA 2ZO3H 2ZA5A 1BB0B 1JMOH 3KQ5A 1BA8B 4FUIA 3T2NA 1FJSA 5EJ1A 1O5CB 1DY9A 1SL3A 2C90B 4CH8B 2V6NA 1NN6A 4KTCA 1WQVH 1UTLM 4ACAA 1FY1A 3DFJA 2GT7A 1GCDA 1C2JA 1W10U 3FZZA 2GJGA 4O3TA 2QF3A 3S9BA 2ZGJA 3V7TA 3QK1A 3TPIZ 1C5PA 2OTVA 3F68H 3FOAA 5EQSA 3GICB 1BCUH 2ZU2A 1O2HA 2QF4A 2FPZA 2Z9IA 4A1VA 1YPLH 2VIVA 3HGPA 2KCYA 4Q7ZA 3KYGA 4AFZA 1SGCA 1SGFG 3B8JA 1SGNE 3MWIU 1YCPK 1EB1H 1UTOA 1UVSH 3BTGE 1OYTH 4JK6A 2ZCHP 2ZHFH 1LPZB 5ESTE 2K8IA 1C2EA 2PW8H 1AKSB 2G52A 5E0JA 4MPXA 1C5NH 1WCZA 2GT8A 3PM3A 3DUXH 1DUEA 1RIWC 3S9CA 3ZV8A 5T3HA 3FANA 3WY8A 1F92A 2ZWLH 2Y7ZA 2XCNA 3QZQA 3FP6E 2BLWA 2P59A 1Z8GA 1BJUA 3AW1A 1SOTA 2IJOB 2RFKC 1O3BA 2V3HH 4P00A 1CSOE 1C4V2 2GD4B 3KN2A 2H9TH 2XC4A 1GVZA 4LZ4B 1TRMA 2EI7A 1O3GA 3GYMA 3SORA 1JWTA 4MDSA 2F9OA 2R0LA 2UUKB 1KYNA 4Y8XA 1LHFH 1AUJA 1TNJA 2K0QA 2C4FH 1QBNA 1S84A 3PWCA 3SUGA 1UO6A 1C4U2 1EKBB 3SZEA 2FYRA 4AFUA 2OINA 5TCCA 1PPHE 5TJXA 3NCLA 1GHBG 1IQFA 3KNXA 1W0YH 3V12A 2SGAA 1V2OT 1DT2A 4XBCA 1Q3XA 3PV2A 1S6LA 3SI3H 4GHTA 1QL9A 5C2ZA 1GDQA 3OY5U 4Y7BA 1O3DA 1OWKA 2F9VA 1NZQH 1Y3XA 2OXSA 5EODA 2Y7XA 1ELEE 2ZEBA 3EA8A 5DP8A 2VB0A 4HI3A 2ZGCA 3RM2H 1GHAG 1C5YB 1MKWH 5ETXA 1C1TA 4I32A 3OAAD 1S83A 1OX1A 1E0FD 1EJAA 1LKBA 2C8WB 4CRCA 4NFFA 1AY6H 1V2RT 2D8WA 5DSFA 1F0RA 1ESBA 3V3MA 1KLJH 2GV6A 3KQBA 1AD8H 3SOSA 1O5FH 4X1RU 5T6FA 3U28C 2A7CA 3P6ZB 1A0LA 3PMBB 4DIHH 3LT3A 3U8OH 3ZVFA 1VR1H 2VWOA 1B0EA 2QF5A 1O3EA 1YYY1 1RS0A 4YT7H 1WSSH 1DWCH 4B71A 2Z9KA 3GY8A 5EJZA 4ZUHA 1LVOA 1GBMA 1N6YA 2VWLA 1J16A 1UW7A 3TNSA 1WV7H 1K9OE 3QWCH 1MTWA 1JIRA 2C8XB 1OOKB 1F0TA 1X7AC 1A7SA 1ZJKA 3CENA 2G4TA 2FESH 5E2PA 1ORFA 4UFGH 1GHZA 1JRTA 1V2UT 2G51A 3S9AA 3CS0A 1UK2A 1ELCA 1NFUA 1UTQA 1GI0A 4CREA 4OS2A 2JETB 1ANEA 3U69H 2RDLA 1AVGH 3ZZ4A
chains in the Genus database with same CATH topology
1CBWB 3PYHA 1VITG 1HIAA 4MPVA 3MHWU 1ZMNA 3P70B 1HAIH 3SGAE 2ZHDA 1ZGVA 2KAIA 4FXGH 3VPKA 1MTNB 4R0IA 2IPHA 4XOJA 5DP9A 2GGVB 2CMYA 1AZZA 1P06A 2OCVB 3FZDA 2HLCA 1A2CH 1YPKH 4YOGA 4HGCA 2PKSC 1EB2A 1C5WB 3LH1A 3SBKA 1P02A 2J94A 4X2YA 1PFXC 1DOJA 3KL6A 3DD2H 4NCYA 2P3FH 2TRMA 2A32A 1A3BH 1GMHG 4ESTE 2GCHF 2LPRA 4NA8A 1RJXB 2FLBH 3L3TA 1YPHC 3N7OA 1EATA 3SNAA 3UREA 2ZGHA 4B75A 1LQDB 3STJA 3A88A 3SV2H 1DWBH 1ZOMA 3ZVCA 4BAOB 5L30H 5JPMH 1BJVA 2H1UA 3LH3A 1LVMA 1MTUA 4O97A 3PLPA 1GJDB 5DPAA 1F0UA 1RRKA 1NS3A 2J38A 1BRAA 1AWFH 2ZDNA 4BNRA 2BQWB 2CGAA 2ZFFH 1CT4E 1XKBC 2BY9X 4I8HA 1THRH 1G3DA 4IS5A 1AIXH 3TGKE 1P12E 3TH2H 1P57B 2ZF0H 1HAPH 1MMJN 1D9IA 1SVPA 1QGFA 3MYWA 1HAZB 4A1XA 5I25A 1ZPCA 1H9HE 2WPLS 3HATH 3LC3A 2OLGA 1GBTA 1O3CA 3U1IB 2ODPA 1QJ1B 1TFXA 1BITA 3UNRA 1CT0E 1SGQE 3KHVA 1PQ5A 1NTPA 4MPUA 4FVDA 1HJ9A 1UK3A 4NFEA 1ETRH 1AI8H 5CHAC 1HJAB 3GDVA 1TONA 2Z9JA 2Y81A 1UVOA 1K1NA 1AUTC 1B5GH 3DT0H 4OS4A 1KLIH 1ZHPA 1ZGIA 2XXLA 4BTIB 5JBTA 1EQ9A 1GI3A 1C2GA 3K6ZA 2TBSA 4FU9A 5A09A 1MAYA 2P93A 2VINA 2C8YB 1NC6A 1GPZA 4ISIH 4B2AA 1GCTB 3TITA 1OSSA 5GXPA 1CVWH 1TRNA 2WUCA 3RXLA 1Y3VA 1CHOG 1DWDH 2A4GA 4IN2A 4XBBA 4ZHMU 1TALA 4K5ZA 2XBXA 1EPTB 1C1QA 4UFDH 4MLFB 1TBZH 3A7VA 5FCRA 3RXBA 4KTUA 2GMTC 5FAHA 3SN8A 4CRBA 4ABAA 2FMJA 3U8RH 4HZHA 1Q2WA 1TBQH 3RP2A 2XBYA 3ZVAA 1BRUP 1HNEE 1GG6B 1PPEE 2GTBA 4IMZA 4DVAU 1MBMA 4Y79A 2ZGXH 5JB9S 1O2QA 2BVRH 1GVKB 1CA0B 4FUCA 1QB9A 3P92A 3BN9A 3ZZ3A 1D4PB 1HXFH 4I8LA 1QB1A 4WMFA 5EU8A 4AYYB 4OGXA 1TBRH 4TY7A 2STAE 1BIOA 1IQMA 3F9EA 1UTKA 2WV5A 1GHAF 2Z6BD 1DLKB 1SG8B 1THPB 1P04A 1P03A 3PROA 1ANBA 2PGBB 3SGBE 1QRWA 1DANH 3MNSA 7LPRA 2M5TA 5EW1H 1H8IH 1W8BH 4I31A 5GDSH 3EDXB 2JKHA 5HM9A 1O2WA 4DG4A 1O3AA 4D9QA 1OS8A 1GJ8B 1NM6A 2BD5A 1MU6B 3GY2A 1MU8B 5DP5A 2ZNKH 3GY7A 1MAXA 2BDAA 1YCPH 1D3TB 1A1RA 1W2KH 1AVWA 4BAKB 1XXDA 2FOMB 2ZTZA 2HPQH 1DDJA 1LVBA 3M5NA 3UWIA 2NU2E 3F1SB 2BB4A 3UQOA 1NRQH 3UFAA 1ZJDA 1W0ZU 3MO9A 5DP6A 2PR3A 3MNBA 4RKOB 1VZQH 2BQ7B 2SGFE 4Q80A 4B2BA 2DE8A 1EAIA 4UONA 1BTXA 2THFB 3ATKA 4MTBA 3NK8A 4X8SH 1GBHA 1YP9A 3BSQA 2PTNA 1HAGE 3RM0H 3LGVA 1EZXC 2P8OC 3H7TA 2HGTH 2SGQE 1THSH 4AG2A 5K7RA 2AFQB 4IC5A 2VH6A 1RGQA 1KXFA 1UJ1A 1O5DH 5GWZA 3H7OA 3P8OA 4OGYA 2ODQA 1GJAB 3UNSA 3MO3A 8KME2 4IMQA 1TGSZ 1UMAH 2JH6D 4GCHG 4XDEA 1EOJA 1A5IA 1GMHF 3ZZ7A 5JBBS 5ABWA 3EA9A 3Q3YA 3A89A 2QN5T 3HKJB 4UDWH 2GZ8A 3VXEH 2WPHS 1FY5A 4ISOA 5LH8A 3I77A 2BD8A 1RTLA 3AASA 1O2JA 1OP0A 4FUJA 2XYAA 2VWNA 9ESTA 1GBAA 3TGJE 4X2XA 4I8GA 4I7YH 5GCHG 5A2MH 4CHAC 1CA8B 4GAWA 1VGCB 4A5TS 3GCOA 1TPAE 4MPWA 1CBWC 1Z6EA 2B9LA 1FUJA 1P2MA 1GJ5H 1CGIE 2B0FA 1T32A 3O8CA 4JZ1A 3RU4T 1ZHRA 1TGNA 2VIOA 2OC8A 2EEKA 2FI5E 1H9IE 3C1KA 1GMDG 1S85A 4D9RA 2F9PA 4WY3A 3T62A 3UWJH 4IC6A 1JRSA 1D6RA 3JZ2B 4YT6H 1YM0A 5DGJA 1XXFA 4X6NA 3SNBA 5EPYA 1DXWA 4WMEA 1VITH 1O2KA 3A87A 3D65E 1H8DH 3LU9B 3SNDA 1SLWB 1XMNB 1MD7A 4DIIH 2JETC 1XVOA 2B8OH 1HAHH 5EXMA 2WPKS 2VWMA 3SUEA 1OWHA 1Y3UA 2BVSH 5JBCS 2BY5X 4GUXA 3NKKA 2CF8H 3KGPA 1DPOA 2ZTYA 1IQKA 1O2MA 3KQCA 1G32B 3SJ8A 2WYGA 1KY9A 1EJNA 2PKAB 3VGCC 3Q77A 1C5VA 1FV9A 1S6HA 1C2HA 1SLVB 3TH4H 3VB5A 1TMTH 2QF0A 3K2UA 1PPBH 4ZXXH 3BTTE 1SB1H 3TU7H 3RXQA 2B5TB 3IITA 1UTPA 2A31A 2J34A 1XX9A 1O33A 3QX5H 1KXDA 4X6OA 1GJBB 3KEEA 1O3LA 1EAWA 3NWUA 5FBEA 2V0BA 1TE0A 1AFQC 1F0SA 1VITF 4K1EA 4JZFH 1S82A 4Y76A 1C1UH 3E8LA 3SZNA 5E8EH 1YPGH 1BTHH 1S0RA 4DJZB 4JYTA 1PPGE 5FPTA 2SNWA 5LGOA 1WUNH 4WMDA 1MH0A 3QN7A 3SJOA 2Q6FA 3GCTF 1HYLA 4YLUA 3MMGA 1ZHMA 3URDA 3SNCA 1SGIB 1G37A 4NG9H 1MQ6A 2FYQA 1YCPM 3A85A 1DE7H 2Y6TA 2Z94A 2UWPA 1WYKA 3SU1A 1HB0B 4AX9H 1VCPA 1GHYH 4UFEH 4K8BA 1Y3YA 3BIUH 1PPCE 2ZHWH 4ABJA 4K1SA 1LHEH 1L1GA 2HOBA 5C1YA 3UTUH 1Y5BT 1XUKA 3MI4A 1CGJE 1GI9B 3AAUA 1C5MD 1NRRH 4BAQB 1MCTA 2XCFA 1SGRE 2WPIS 5A0AE 1UCYE 3F9HA 1FDPA 1KSNA 3K6YA 3OY6U 3C27B 4LXBH 1BBRH 3LDXH 2QC2A 3M5MA 3BEIB 4GSOA 1BMNH 3ITIA 3RLWH 2GVFA 2ZHEH 1SFQB 2P3UB 3LPRA 3S69A 3JZ1B 1N8OB 1H1BA 2G8TA 1GJCB 5DO4H 1UVPA 4DCDA 1CA0C 5FPYA 3I78A 1OPHB 1DITH 1KDQB 2A5IA 4B2CA 2SGDE 2IOTA 3RXAA 1W3CA 4ZKOU 2D1JA 2XRCA 3ZZ9A 3ZVEA 1V2LT 2OUAA 2DUCA 5GCHF 3HK3B 1DXPA 4UEHH 1GMCF 2BMGB 3RUOA 2UWOA 2ZPSA 3UOPA 2ILNA 4DGJA 1GI2A 1A3EH 1NRNH 1KLTA 4I33A 1ZSJA 1ZRKA 2CF9H 3HK6B 1ACBE 1AWHB 1IQIA 4VGCB 4ZHLU 1SHYA 2OD3B 4B76A 2Z3EA 3BG4C 1K21H 2WINI 1V2JT 4UFFH 1TPPA 3QLPH 2BD2A 1CGHA 2TPIZ 1IQEA 1L1NA 1O2PA 5E0GA 3SW2B 2VVUA 7GCHG 2ZIQH 2AERH 4X6MA 5HXFA 1QL7A 1ZZZA 2VIDA 1TABE 5EPNA 1C1VH 3FP8E 4VGCC 1TQ0B 2Z3DA 1VCQA 4AORA 2UUJB 5A0CA 5A8XA 3ZZBA 1NRPH 3GY6A 3LGWA 2ANYA 1C2LA 1FMGA 1JXPA 4I8JA 2H9EH 1TX8A 2AMDA 2H9HA 3AW0A 3FP7E 1K28D 3M7UA 1AFQB 3NZIA 3UQVA 1F2SE 3GCNA 3V0XA 2HALA 4R8TB 4BXSA 1C2KA 1SGEE 2BLQA 1C9PA 1MD8A 5T6DA 2ZDLA 1NU9A 1A5HA 3SU0A 1ELGA 2XC0A 4O03A 3E1XB 3MH7A 2ZKSA 3MU5A 2AH4X 2GV7A 1ZLRA 4ABIA 4CBNA 1TOMH 1ZPZA 4CRAA 4FU8A 1BZXE 2EI6A 4Z0KA 1EOLA 5G4BA 4CR5A 1CHOF 2BTCE 2BDBA 2BXUH 5DP4A 1EZQA 1LHCH 3UR6A 1AQ7A 1P2OA 2J4IA 1YBWA 2H5CA 4GLYA 4Y8YA 3A8DA 1DICA 1HLTH 2EI8A 5HGGA 5HM2A 1BQYA 3LGYA 2F9NA 3A83A 3A81A 2CN0H 2PV9B 2W3IA 2VVVA 3PO1B 3VFEA 1U6QA 3VXFH 1G36A 1IAUA 4NA9H 3K65B 1TB6H 1RFNA 1UVTH 2XW9A 2PUXB 1O3JA 1MKXH 1V2KT 3O8BA 2YOLA 1HFDA 3B9FH 3W94A 3RXVA 5AF9H 1ZTLA 2XC5A 4M7GA 1LHDH 4DOQA 3F6UH 4Y0ZE 3RLYH 3DFLA 1EASA 3TJVA 1L2EA 5TCAA 1FZZA 1O34A 4H6TA 1PYTC 2CV3A 1Z8RA 2FS9A 1GMCG 1GWAA 1GL1A 1T31A 3SNEA 4B1TA 4A92A 2ZU3A 2C93B 2BM2A 4FUDA 1F5RA 1V2TT 5C3NA 2F9BH 4X1NU 3TIUA 3SI4H 4CRGA 2AS9A 1FXYA 3QUMP 2Q1JA 2FTLE 1QBVH 1GGDB 1T4VH 2ZZUH 3RXIA 1OXGA 1MZDA 1O3HA 3PV4A 1CQQA 3M7QA 2BY6X 3MH4A 5DG6A 1GBFA 2H6MA 2STBE 2HNTC 1C5QA 5GIBA 2NU4E 1ELBA 1O3OA 3KF2A 1F7ZA 1UVUH 1GVLA 5FHTA 3URCA 1O2GH 1ZSKA 2W3KA 1CE5A 3GISB 1Y5UT 1KXAA 4MNYA 4YO9A 1A61H 2FM2A 4YTAA 3AVZA 5JB8S 3UPEA 3D23A 2GDDA 1J9CH 3ESTA 4FUGA 5E2OA 1V2QT 1FONA 3BEUA 1XUFA 3OU0A 1ANDA 5EXLA 1DWEH 1MQ5A 1GL0E 4JYVH 3OYPA 2BZAA 1O2RA 3T28A 1O2LA 1SQAA 1O30A 4RN6A 4NA7A 1ETSH 1MCVA 1T8MA 1L1JA 3U98H 4WH8A 1P11E 1SR5C 2ODYB 2QXGA 4THNH 4AYVB 1NO9H 4JZIA 1VJAU 3UOUA 1C1RA 1QB6A 2ZQ2A 1NPMA 2ZU1A 5J4QA 2ZTXA 1BDAA 2FZZA 3ENSB 1PYTD 2AGGX 4AGKA 2BZ6H 1KDQA 1B7XB 1FIWA 1HGTH 2KAIB 2BDGA 4E06H 2BD3A 1A0JA 3T29A 1CT2E 2Z7FE 2PWXA 4XBDA 4ZKRU 3UY9A 5F03A 1IQGA 4NIXA 2QXIA 3E16B 1Z7KA 2VJ1A 4ZAEA 1LPGB 3RXCA 1ELTA 3RC5A 1UK4A 1GBIA 1GI4A 2A7JA 5PTPA 1C5ZB 5C1XA 4ISLA 2GZ9A 1ARCA 1IQHA 1SI5H 1O5EH 1IQJA 1YPHE 2WPJS 1GJ4H 1CO7E 1KXCA 1ZYOA 4AG1A 1QA0A 3LOXA 2FP7B 5H4IB 3ELAH 1BBRK 3PB1E 1QRZA 1IHTH 3QO6A 1AO5A 5FBIA 2TGDA 3IG6B 5EOKA 3Q76A 1AFEH 3RXDA 4CRFA 2P16A 1XUHA 4AFSA 1BUIA 1EX3A 1J14A 2ZCLP 1SGDE 1G3BA 5DP7A 2H2ZA 2OBQA 2Y5FA 3LONA 3RC6A 1EXFA 2PSXA 3FFGA 1D3DB 2PSYA 3MTYA 1HAXB 3S0NA 1A5GH 2FOHA 1P01A 3GCTG 3A8CA 1TNHA 3S7KB 4PROA 2AGEX 1E38B 2SFAA 3Q3KA 4U32A 2WPMS 2EA3A 2YNAA 3BTHE 3O8DA 4ZMAH 3PMJA 5AFZH 3TH3H 1QY6A 1FAKH 1D3PB 3RMOH 1TQ7B 5AVDA 2G5VA 1HAYB 1S5SA 2ZFPH 5HYOA 4NZQA 3PO1C 1GBEA 3M5OA 1EUFA 3VB6A 3ZYEA 4K2YA 1TGBA 1KTSB 2A2QH 2FEQH 1H9LB 3K9XB 1P0SH 1WOFA 5AHGH 3R0FA 3EGKH 2VNTA 2ZCKP 2ZG0H 2PUQH 1DX5M 5LPEA 1ABIH 2QIQA 4ZKNU 1C1OA 4IN1A 3ZYDA 1FI8A 1J8AA 5A0BA 1DM4B 1P9SA 1EP5A 1ZSLA 3CP7A 2A2XH 1CU1A 5L2ZH 3GYLB 1N1LA 1ZTJA 2R9PA 4DY7B 1S0QA 3MU1A 1YF4A 1TNKA 3NUMA 4YLQH 1C1NA 1GBLA 1O2VA 1UCYK 3MOCA 4A1TA 1TNIA 2NU3E 1TA6A 1YKTA 4DT7B 3T25A 4H6SB 1W14U 2AMQA 2BXTH 4H4FA 2ALVA 1ESTA 2XBVA 2LNCA 1C2IA 1C9TA 3RXOA 3A7YA 4Q7YA 1BT7A 1FNIA 2ZI2H 1L4DA 3AAVA 1O3NA 3RXSA 1T4UH 2FLRH 1JBUH 1SLUB 1SLXB 3RXGA 1FPHH 4ZXYH 3LJJA 4MQAA 2QY0B 4TPIZ 1O5AB 6GCHG 4AOQA 1V3XA 3SO3A 3BTKE 1V2VT 1Y3WA 3TK5A 6GCHF 1LTOA 2O9QA 2HVXA 1RD3B 5DJ7A 5BRRE 1AN1E 4BXWA 3P8NA 1ZPBA 3BTME 1QJ7B 4AFQA 4Q7XA 2ZGBH 1QRXA 1LPKB 2FOFA 4WH6A 4IGDA 8ESTE 2G81E 2WV4A 1FN6A 1G2MA 2CJIA 3VB3A 2FWWA 4NIYA 1HV7A 1UHBB 1O2UA 2V3OH 4X8TH 2ZFSA 4NIWA 5C5NA 1F5KU 3UR9A 3UNQA 4KELA 1UHBA 2R2WU 1KXEA