1O3CA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3cA02
2STBE 1CT2E 1OP8A 4AGKA 2G5VA 3TJOA 1F2SE 1O2KA 2ZEBA 1MUEB 2ZGCA 1V2QT 1S6FA 5F8XA 1A46H 1DVAH 1O35A 2WINI 3MU0A 4CHAB 1W11U 2HRVA 5E0GA 1K1OA 1MH0A 3LGIA 1PPHE 1UVPA 2BY6X 1Y3YA 1YPKH 1W7GH 1P2QA 4AYYB 1AWHB 1N8OB 2H9EH 4HTCH 5EOKA 2A7JA 1EZUC 4CBNA 2P3UB 3RM0H 3GISB 2BLOA 2VIQA 4ISNA 1T8MA 1UK3A 1WYKA 1AE8H 1DFPA 1O3IA 3GOVB 1D4PB 1ZGIA 2SGQE 3RXVA 2F9UA 2CGAA 3EDXB 2HVXA 1W2KH 1C5YB 3RXCA 1TPAE 1RD3B 4I32A 4THNH 1T7CA 1NO9H 4DIIH 4Z6AH 1GJ6A 3U69H 1DWBH 1XX9A 2BDCA 3A7XA 4BAQB 1SLVB 2QA9E 1A7SA 3NK8A 1GJAB 2YOLA 4X1QU 3DFJA 2SGAA 1CE5A 1QHRB 4KP0A 2F9OA 1BBRK 1HAOH 2WPMS 1HAGE 1MCVA 3QGJA 3TJUA 4DURA 1KLTA 3TIUA 1C1VH 1LVBA 5GJ4B 3SHCH 3TJNA 1MKWH 1OWJA 5E2OA 1RIWB 3RP2A 1E0FD 1QJ6B 4BTIB 2UUFB 4GCHF 1BDAA 3RXJA 1GMHG 3MH4A 1N6YA 1OWDA 6GCHF 4NG9H 2WPJS 1O2GH 2Z9JA 3V3MA 1Y5BT 3HGPA 4ESTE 1CHGA 1IQHA 2ANKH 2B5TB 1BCUH 1YM0A 1RFNA 1K21H 1BTHH 4LZ1H 4Y76A 1Y59T 1QL8A 2GMTC 3PWCA 4B1TA 1O2ZA 4O97A 2TGPZ 1Z8RA 1O3DA 4K60A 3SI4H 1TWXB 3SNDA 2NU1E 1P3EA 3BF6H 1KYNA 3R3GB 2GCTB 2ZHDA 3P8FA 5DGJA 3QDZB 1IAUA 3LGUA 1RS0A 1NU7B 3SGAE 4ABEA 1HB0B 4TYDA 2K1QA 3SUFA 1QQUA 2WYGA 3K2UA 4ZKNU 3PROA 2HNTE 1VGCC 3GDUA 1GJCB 1EJNA 3SU3A 3E3TA 1DS2E 2XC5A 2ZHWH 1GI0A 1XKBC 4GHQA 3RU4E 8KME2 5HM2A 2H9TH 3SV2H 1J16A 4FU7A 1FY1A 2O8TA 1ZTJA 2AIPA 1KDQA 4JYTA 5C1UA 1BB0B 3SGQE 2I6QA 3NWUA 1V2MT 1EB2A 1O5AB 3IWMA 2NU0E 5TCCA 2ODYB 3SNCA 2Y6TA 1EP6A 1YCPM 1BIOA 2FZZA 4AG1A 5EW1H 1TQ7B 4MPWA 1W0YH 4IC6A 1O3BA 3L3TA 1GMCF 1K1MA 3F9FA 3NZIA 4CH8B 5FCKA 1Z1IA 1EXFA 4Y0ZE 1JMOH 3GCTF 1MAXA 2GCHF 1QIXB 2BDBA 1GBKA 4FUGA 4BAMB 4X0WU 1Y5AT 2FX6A 1A0LA 1GDNA 1TX7A 1ZYOA 1ANDA 1O3NA 2XW9A 1C5VA 1C5MD 1G2MA 4UFGH 1FQ3A 4MVNA 1Q31A 4ABAA 2WPKS 3LH3A 2BDYA 2GT8A 2GZ7A 1EZQA 1K1IA 1O2VA 4YZUA 3RC6A 2EI6A 4X2YA 4CR9A 2ZHFH 1QFKH 3RC4A 5A0CA 1L1GA 3P17H 2A4OA 5DPAA 4Y79A 3HGNA 3SU1A 5JBTA 3SUGA 2G55A 2ALVA 3OU0A 3FVFB 4Y8YA 1YPLH 2J95A 4Q7YA 3SU0A 1DDJA 1W13U 2Y5HA 3KQDA 2UUJB 3GDVA 3MFJA 1TNHA 3GDSA 4IGDA 1P09A 1G30B 3MH6A 1CHOF 2WUCA 1FY5A 1DSTA 3E1XB 1EAWA 4IN2A 1L4DA 4HGCA 4XFQA 3GY4A 1OP0A 1ZPBA 1ZTLA 5DP7A 5FPYA 5I25A 3EYDA 4GCHG 1SGEE 2ZHEH 3LGYA 3SJKA 1FIZA 2O8MA 1UHBB 1V2KT 4NWLA 4NA8A 2G5NA 4INKA 5FPTA 1SGPE 3IITA 3RXQA 4U2WA 3CS7A 1Y8TA 6GCHG 4DG4A 4DY7B 3BG8A 1C1QA 4MDSA 1P2MA 1F5RA 3OY5U 3ZZ5A 1GCTB 1GJ8B 5EPNA 4WXVA 2HALA 4X6NA 1UK4A 3U8TH 2ODQA 3SW2B 4X1RU 5A2MH 3H7TA 4J1YA 2F9BH 2JH5D 1GGDB 5AFYH 1MTNC 1FV9A 1IHSH 5AHGH 2BD3A 1QBVH 2ZFPH 1BOQA 1ETTH 2BD4A 1A5GH 1O2YA 2FOAA 1TNLA 3ZVDA 1TMBH 2W5EA 3K6ZA 2A4RA 3SNEA 3NCLA 1GI3A 5GWZA 1DSUA 4NIVA 4NZLA 2XTTB 3VB7A 4Z0KA 5J4QA 2F91A 5JDUB 2TBSA 1PQ5A 3TU7H 1O2SA 2A0QB 4DGJA 1EKBB 1YKTA 1QRZA 4UD9H 2GDDA 1O3LA 2ZHQH 2Y7XA 1Z8JB 2AERH 5EODA 1M9UA 3BTDE 1O30A 1UK2A 3QUMP 3ZYDA 1HV7A 4FU9A 1HAXB 1KTTB 1SI5H 3T5FH 1BTWA 3ENSB 1K1JA 1HAHH 2VINA 3ATMA 3TK9A 1NRSH 4LOYH 1UVUH 3VB6A 4NIYA 1WTHD 5EQRA 4ABHA 3AW1A 1KLJH 1J9CH 2CF9H 2FM2A 3PO1C 3GY2A 4CR5A 2ZI2H 1O3EA 4XE4A 5DKMA 1O39A 3SJIA 1HUTH 1BITA 3I29A 1CBWC 2FLRH 3TNTA 4RSPA 1P05A 1F0SA 1KXFA 1BJUA 3BTTE 1GMCG 3CP7A 1DX5M 1TGTA 3TITA 1AKSA 1ZTKA 3JZ1B 3SU6A 3VFEA 2A4GA 3SBKA 4Y8ZA 1W14U 4DOQA 3GCTG 1C5OH 2GCHG 3V12A 4ISOA 1IQIA 3RDZA 4UDWH 2FS9A 3RXDA 1BMNH 4H6TA 2LPRA 2PFEA 4XBBA 3S9CA 1P06A 4NFEA 1GI4A 1NRRH 1V2LT 1EQ9A 2Q6GA 1C2IA 1FXYA 1O2TA 2GCTC 2VVUA 1TQ0B 1EAXA 2O8UA 4CBOA 1WCZA 1VJAU 4JCNA 1GHXH 1FY8E 1W7XH 4X6OA 3TLOA 1HCGA 1DUEA 4Y0YE 2BTCE 2BVSH 3LJOA 5GIBA 3RMOH 1HAPH 1Y3WA 1V2ST 1EJAA 1MD8A 2ZGXH 1UCYE 1P2JA 1CHOG 2VIOA 5FX5A 1LVOA 1WUNH 2P95A 5F8TA 3SU2A 4NSVA 1HFDA 3ATIA 2THFB 4FUFA 5J4SA 2BOHB 3U8RH 3LGVA 3SU5A 1JBUH 2QC2A 1MTUA 1V2VT 3W95A 3ZZ3A 3B8JA 1XXFA 3BEIB 3QK1A 5DP6A 1LHFH 3PMBB 3SJ9A 3RXLA 1V2RT 1UVTH 2PSYA 3ZVGA 3TPIZ 1E37B 2GV7A 2TIOA 4GAWA 4WVPE 4F49A 5ABWA 4ISIH 2WYJA 4IN1A 4GUXA 3BTGE 1WQSA 2FX4A 1NRNH 3W94A 5T6FA 1AIXH 3A7TA 3VB4A 4BANB 5L30H 2ASUB 5DP8A 1ZHRA 4PROA 3ZZDA 3M35A 2FOBA 2FI3E 1HPGA 3ZV9A 4YOJA 4A6LA 1AB9B 3HPTB 1G32B 2Q1JA 3H5CB 1AZ8A 1O32A 2ZPQA 4K2YA 3OSYA 2D2DA 3BEFB 1CA8B 2A45B 1EPTB 4TY7A 3GCOA 1KDQB 3NPSA 3D49H 4FUDA 3SN8A 1TGSZ 1PPBH 4Q7XA 2EA3A 4NA7A 4ZHMU 1VGCB 3UUZA 2AGIX 5DK1A 1P9SA 1JWTA 2GX4A 1NS3A 2ZGHA 1QL9A 2BD9A 2GDEH 2O8WA 1C2LA 1ELFA 4KGAA 3TGKE 3M5OA 2LNCA 3A81A 1TPPA 8LPRA 2G52A 3F9GA 1P01A 1FUJA 1YPGH 4XDEA 2XXLA 3SZNA 1O31A 3OY6U 3PYHA 2BD7A 5EG4A 3JZ2B 1P12E 1LVYA 4JZ1A 3URCA 1S84A 1XM1A 1Q2WA 3BTKE 1O2XA 2DUCA 1D3QB 1DPOA 1KXDA 1C4U2 5E0HA 1LKBA 1NFUA 1GGDC 4MQAA 2R2MB 1GMDF 2H2ZA 4B75A 2Z9IA 1S83A 2HLCA 1V2PT 3E16B 3QLPH 5L6NH 1H9HE 2OXSA 1F5KU 2A4QA 4ZKSU 3A82A 1CVWH 3QO6A 1C5NH 1ZMLA 1GI9B 1GI6A 1T8NA 1Y3VA 3RXKA 1ZHMA 1GJDB 3MWIU 1IQEA 2ZDNA 1KXEA 1RXPA 3KGPA 3M5MA 4AFQA 3MU5A 4SGAE 1O5FH 1E36B 1ETSH 1YLCA 2QN5T 5C5OA 1KIGH 3EGKH 1O3CA 4K1SA 1G2LA 1G3DA 5TCAA 4TWWA 4U32A 1GHBF 2G8TA 3LKWA 5E0JA 3RUOA 1FONA 2BQWB 3D62A 3A8AA 1HYLA 1NTPA 4A92A 1GJ5H 1YP9A 2BY9X 1ARBA 1BQYA 1GBLA 2ZG0H 1TNIA 1BTXA 1GJ4H 3GY5A 2R3UA 1YPJH 4MTBA 3BIVH 1OSSA 3AASA 4TY6A 3UNQA 2BXUH 3PB1E 2OP9A 3V7TA 2Y5GA 1SQAA 2R3YA 1UTNA 1Q3XA 1HJ9A 3CS0A 1O2IA 4MNYA 1O33A 2HNTC 4K5ZA 3ATKA 1NC6A 2VJ1A 5BRRE 2F83A 1FI8A 2FTLE 3D23A 2SGPE 3LU9B 2ZU4A 2ALPA 4OS5A 2VH6A 2FYRA 1MTNB 1CA0B 2QCYA 3F9HA 3EA8A 1HBTH 1FLEE 3PTNA 1O2PA 1XUFA 5F03A 2C3SA 3FANA 4OS6A 1QBNA 1YPEH 3ZZAA 2P93A 1SLXB 1HDTH 2FOEA 2PHBA 4UONA 1TE0A 4E05H 1O5BB 5LPRA 2QY0B 2AS9A 5JBBS 5CE1A 4B74A 1EOJA 1AMHA 1DWEH 1C1UH 3RXGA 3VPKA 3EQ0H 3ZZ9A 4J2YB 5EPYA 2W3KA 1S6HA 1G3EA 4I8GA 1AU8A 4JMYA 5EXNA 3RMMH 1YCPK 4F4OC 1QNJA 4JZDH 2FOGA 4K8YA 4AG2A 2W7UA 3GCNA 1C9PA 1PYTC 3O8BA 2V35A 1E38B 2Y82A 5L2YH 4ZAEA 2PV9B 4BAKB 5LGOA 3QN7A 2FPZA 3SORA 1HXFH 4QT8C 4JZEH 1AKSB 2XRCA 1P03A 3KQCA 4TWYA 1GCDA 3M37A 2P94A 1AFQC 2JETC 1AO5A 4Q80A 1THPB 3GCHC 3UWJH 3LONA 3PO1B 1SGFG 5IDKA 2NU2E 2Z6BD 1UCYK 2ZGBH 4GPGA 1TPSA 4NZQA 1CBWB 2HGTH 2VVCA 4OS1A 3U98H 1C2KA 3S9AA 1A61H 3RXIA 1YPMH 4R0IA 1T8LA 2IJOB 1T8OA 2RA3A 3UTUH 1ACBE 4Q7ZA 1AN1E 1GMDG 1GDUA 1HAYB 3BTWE 4A1VA 2BY5X 2XWBI 1DT2A 2PUXB 4ISLA 3E90B 2P59A 2FESH 1AB9C 2EI8A 1L1JA 1H8IH 1A1RA 5FBIA 1GBCA 1VCWA 4BTUB 1DY8A 2H9HA 1YF4A 2WV4A 1EP5A 2ANWA 1IQMA 2FIRH 1D6WA 4Y7AA 2A5IA 4CRGA 5C1YA 1TX8A 1EPTC 4B2BA 4BXSA 5JB9S 1GBBA 1GBIA 3B23B 1SGRE 3DFLA 2ZTYA 1AFEH 1TA6A 1BMLA 1KXBA 1LHGH 1CGHA 1V2OT 1ORFA 2TGTA 1VITF 2SGDE 4GLYA 1C2GA 5TJXA 1QBOA 3TK5A 1GHBG 2XWAA 1AQ7A 1C5RA 1TLDA 1WBGB 2VWMA 3KQEA 1IQFA 3RXFA 1IQKA 1EPTA 2HPPH 4MPXA 2V0BA 2STAE 3ZZBA 1C5QA 2CF8H 5EQSA 3RMLH 2R0LA 4X2WA 1Z6JH 2XBVA 2FWWA 3GY3A 3H7OA 3BSQA 2OINA 2A5AA 5K0HA 3UNRA 2IN2A 4ZH8A 4TPYA 2VIDA 1DXPA 1KXCA 9LPRA 4ISHH 1BRBE 1AVGH 2TGAA 3L33A 1MZAA 1JIRA 3C1KA 2AEIH 1O0DH 2QIQA 3BV9B 3NUMA 3P8OA 2UWLA 1H4WA 3KL6A 1H1BA 1EUFA 1MQ6A 3C27B 2W26A 2BZAA 4I8JA 2ZWLH 2FOMB 1ESBA 3WY8A 1ETRH 5DP9A 1UVOA 4AFSA 1C2JA 5L2ZH 4VGCB 5AVDA 1FPHH 2V3OH 4X1NU 2WPIS 2SGFE 2ZFTA 3M5LA 1DITH 1BTZA 1S0RA 2PGQB 5CHAC 4UFFH 4X2VA 4JZIA 2B8OH 5E8EH 3P8GA 5ETXA 2VIWA 4ABJA 1ZGVA 2AMQA 3UNSA 1BHXF 1CT4E 1QJ1B 1YCPH 3HKIB 3Q77A 1AE5A 1SLUB 2C8ZB 2QV1A 3ZVBA 1C5SA 1TYNA 2ZQ2A 1ELCA 2BX4A 2ZDLA 1EOLA 1HJAC 1K2I1 2WV5A 1WQVH 7GCHF 2BD5A 1JRSA 2H6MA 3GY6A 1SGTA 3NXPA 1NRQH 3GYLB 5AFZH 4BTTB 1ESAA 3BTME 2B7DH 3VB5A 1K1PA 3HATH 3P70B 1VCQA 2VB0A 4I33A 1ZHPA 3SQHE 1HXEH 1JIMA 1EJMA 1UCYH 3M3TA 3P95A 1KTSB 2C93B 1NFWA 4FVDA 1BRUP 1ANBA 1OXGA 2PSXA 1T32A 1B7XB 3TH2H 2FXRA 2ZKSA 2BLWA 1V2JT 2BLVA 1SC8U 1UTKA 5EGMA 1HRTH 1V2NT 1WTGH 1ANEA 2BYAX 4UEHH 2A7CA 2FLBH 1ELDE 2C90B 2BDIA 1HAIH 1OWIA 1MTSA 1MKXK 2P8OC 1AY6H 2QXHA 3LIWA 3GICB 1C1SA 1CA0C 4NIWA 5DP3A 3A8BA 1CO7E 1FDPA 3E91A 1MBQA 1LDTT 4B71A 1W8BH 4ZKRU 4YLQH 1SVPA 1GBJA 4FUEA 4HZHA 3M3SA 2FODA 1VZQH 1GI2A 4D7FA 1DLKB 3LDXH 1S5SA 3ODDA 4IBLH 1LPKB 1HIAA 3E0PB 2TGDA 1UO6A 3SU4A 1QL7A 1XKAC 2A31A 1YLDA 1PFXC 4X8UH 1LPZB 1O3OA 1VITG 4JYUH 4NA9H 2PKAA 3STIA 3PTBA 3PMHB 5G4BA 2QF0A 4IMQA 1BUIA 1LMWB 5A0AE 5C3NA 1PPFE 2A7HA 1O3GA 4MNWA 4X6MA 4Y6DA 1UTMA 2ZCLP 1ABJH 2EI7A 2CN0H 1C2MA 4WJG2 2VH0A 1AZZA 5FCRA 1J17T 4ZXYH 1N6XA 2GTBA 5K7RA 1K28D 1TGNA 1BTUA 1TNJA 2Z94A 2QGRA 4I8LA 4YO9A 6CHAC 1PJPA 4KKDA 2XBWA 4WXIA 3DA9B 1GHYH 1GL0E 4KTUA 1FY3A 3ATWA 3RXTA 3MO9A 4Y10E 3ZZ7A 1Y3XA 1XMNB 1QRWA 5JB8S 3FFGA 2AMDA 1W3CA 1GBTA 1FAKH 1F92A 5HMAA 1F7ZA 1ESTA 1AHTH 1V6DA 1U6QA 2R2WU 2UWPA 5C67A 1TGCA 3MU1A 1SHYA 3MOCA 1H8DH 4OS2A 1EZSC 1TNGA 2BB4A 1UTOA 3M3VA 5C1XA 3FAOA 1BMMH 3QZQA 1ELEE 3DHKH 3T62A 5I46H 2KAIA 3KEEA 5BPEA 1UTLM 2SGEE 1CT0E 2XBXA 3P6ZB 7LPRA 1SGCA 5LPEA 3M61U 1OP2A 4ABDA 4IS5A 3RXBA 2AIQA 1BBRE 2ZPSA 3K65B 7GCHG 5LH8A 2Y80A 4NFFA 3U8OH 4X1SU 1ANCA 1ABIH 4UFEH 4AORA 1UTQA 1GL1A 5HM9A 1A4WH 2Z3EA 1SGQE 1ZSJA 4ABIA 3RXMA 1RJXB 3MNXA 1JXPA 2ZU3A 1GVKB 1P2IA 4SGBE 1G3CA 2SNVA 2OBQA 2ZTZA 3T29A 2G00A 3O8CA 3P8NA 4CRFA 1FZZA 1AFQB 2JETB 2ODPA 3GCHB 1MU8B 1TAWA 4E06H 1MD7A 1TMTH 4NSYA 1FPCH 2ZFSA 3PLKA 3SHAH 2Z7FE 2ZC9H 2BY8X 1NESE 1GBMA 1OWHA 2FOFA 3TK6A 1QJ7B 5A0BA 1MKXH 3RLYH 1B5GH 3A89A 1EX3A 3ZVFA 1O37A 4XBCA 1XUIA 4INLA 2VGCB 1GI8B 1F0TA 2AGGX 2ZU1A 1OYQA 1HJ8A 2O8LA 4MNXA 1SPJA 1L1NA 1C2HA 1DANH 3HK6B 3PLPA 4AGJA 1GHVH 3A83A 4DW2U 1H9LB 3MHWU 1TABE 5GCHF 1ZRKA 4VGCC 2RG3A 1O2WA 5F8ZA 4GVUA 3MNSA 1O5CB 1O3FA 1NRPH 1GI1A 7ESTE 2HOBA 1SGDE 1C5XB 3MU4A 4BXWA 1SG8B 1MCTA 3A7YA 1V2TT 3LT3A 4IC5A 4XBDA 4XOJA 2C8XB 2ZP0H 3F68H 1MAYA 1SSXA 3VXFH 4YM9A 3M5NA 5SGAE 1S82A 2VIPA 1ELVA 2OTVA 1XUHA 4GHTA 2O9QA 4OGYA 1TONA 4X8TH 4X2XA 1EZXC 3KCGH 3GY8A 1P0SH 2DE9A 4WMDA 2ZFFH 1C4Y2 1JOUB 1NPMA 1C2DA 3KHVA 4IMZA 1ZSKA 3GY7A 4AFUA 4ZXXH 1NFXA 1SFQB 1O5DH 1O2QA 2H5CA 4JK6A 1LQEA 2H5DA 4BAOB 3TGJE 4ASHA 5JYIA 3BEUA 1Z8IB 4YTAA 4JYVH 2BM2A 1C5TA 2G51A 5DP4A 1CU1A 1SL3A 3S7KB 1SR5C 2G4TA 2W3IA 8ESTE 4WH8A 5F6MA 1O3AA 1P11E 1SBWA 1GJ9B 4KELA 2V3HH 2Z9LA 5C2ZA 4OS7A 1MU6B 2XCFA 1ZRBA 5ESTE 5EXMA 1MQ5A 1QURH 1O2UA 3SJ8A 4WH6A 4HI3A 4DIHH 3E6PH 2PR3A 3Q3KA 1GBDA 1TIOA 5ESBA 1S0QA 5CHAB 4DJZB 3UQVA 2F9VA 5FPSA 1ELTA 3SV7A 3BG4C 1IOEA 6LPRA 4WF8A 4UFDH 5EQQA 1GHAG 1O5GH 1HJAB 3K9XB 2XCNA 3RXOA 2FDAA 2HPQH 1TOCB 3D65E 2QXIA 2P3FH 1LCYA 1PPCE 2Z9KA 1QB9A 1SGFA 3PM3A 1P2KA 1P02A 3HK3B 4AB9A 1NZQH 3EAJA 1C1NA 1C5WB 1P10A 3CENA 1GBAA 1A0JA 5IYTA 5A8YA 2IOTA 1DE7H 3MU8A 2QXGA 3Q00A 2ZECA 2WPHS 4B76A 1LVMA 4K3JA 1C5UA 1VJ9U 2B9LA 3L6PA 2OC1A 1O3MA 2PKSC 3K6YA 4YOIA 3F9EA 2VWLA 3BN9A 3Q3XA 3P92A 1DLEA 3E8LA 3G01A 1RTLA 1F5LA 1NT1A 1GPZA 1IQGA 4LXBH 2PTCE 1T31A 2P8OB 2BY7X 4FVBA 1HIAB 4U01A 2NWNA 1P8VC 1SGYE 1YBWA 3RXUA 5GCHG 1K1NA 5FHTA 3PMAB 1QQ4A 2NU4E 1A3BH 2PKAB 1EB1H 3ZVAA 1P2OA 3A8DA 3I78A 4XSKU 3LPRA 1OKXA 3NKKA 2A1DB 2AFQB 4I8KA 1AGJA 2ZQ1A 2OQ5A 1F0UA 3BTQE 4OS4A 5DP5A 2OCVB 1LKAA 1GJBB 3A7ZA 1CGJE 3EA7A 3N7OA 1ZMJA 1AVWA 3PLBA 3LJJA 3IG6B 1NM6A 1JRTA 4Y71A 1PPZA 1J14A 3VXEH 2YNBA 1BZXE 2ZDVH 3RMNH 1X7AC 2J34A 1TRNA 1ELAA 2ZU5A 1Z6EA 2Z9GA 1AVXA 2RCEA 1FNIA 4FXGH 4Y8XA 4B2CA 3ZZ8A 1GI7B 3FP8E 6CHAB 5HYOA 2ZDKA 1W12U 3RLWH 2GP9B 2ZGJA 3A7WA 1TFXA 5JBCS 2TRMA 3RXHA 4IW4E 3UWIA 3ZV8A 4AB8A 5C5NA 1LPGB 1KSNA 2KAIB 4HFPB 4I8HA 2XYAA 3SUEA 3UQOA 4DVAU 5GXPA 2ULLA 2FYQA 1V3XA 2VGCC 5EW2H 4NIXA 4K1TA 5A8ZA 1O3HA 1AD8H 3KNXA 1LHDH 2BDHA 3SQEE 1NROH 4DT7B 4YT7H 1WSSH 2J94A 1C1WH 1XVOA 1SLWB 2F9PA 1BTYA 3UOPA 2P3TB 2CMYA 1TPOA 3SV6A 2OBOA 3Q76A 2M5TA 2GZ9A 4NGAH 1SHHB 1C1MA 1QY6A 1EAIA 4ZKOU 2V6NA 4MLFB 3A8CA 1KLIH 3UY9A 3OTJE 1ID5H 1YYY1 1UTJA 4YOGA 2GT7A 1SGNE 3EE0B 2VNTA 5GPIB 2EC9H 1EASA 2F9NA 4DCDA 2QF3A 1L0ZA 4A1XA 4D9QA 2BQ7B 4CRBA 3DD2H 1GJ7B 3S0NA 1TX6A 5DO4H 4X8VH 1P57B 2ZFRH 3O8DA 1VITH 2A32A 4AYVB 2IPHA 3RU4D 2XC4A 1S81A 4Q2KA 1B0FA 1OX1A 2ZFQH 1GVZA 3S69A 1AUJA 1ZLRA 2A2XH 4ZMAH 1O38A 3RXSA 1RRKA 2AGEX 1FY4A 3U1JB 1GWAA 1EATA 2H1UA 1DOJA 1UJ1A 2CJIA 1O34A 1OPHB 3QWCH 1GG6C 3U1IB 1HAVB 1SQOA 1MTVA 2BOKA 1C5PA 4BOHA 4FU8A 4AFZA 2JKHA 1QB1A 1MMJN 1ELGA 3A7VA 3EA9A 4LZ4B 1VR1H 4A1TA 2D1JA 1ZPZA 4WMFA 1BJVA 4B73A 2FP7B 3URDA 1GBFA 1PYTD 2B0FA 2R9PA 1DXWA 3ODFA 3FZDA 1DY9A 1ARCA 5HXFA 4D7GA 2GVFA 4B2AA 1Y3UA 2CXVA 2GGVB 3A80A 1NN6A 2PWXA 3BTHE 2G81E 2RA0A 2ZCHP 1C4V2 2JH6D 1LHCH 1P3CA 1T4VH 2XNIA 8GCHF 1A5HA 4O03A 3A84A 3LH1A 1RGQA 3SI3H 2OLGA 3SGBE 1BBRH 1IQLA 4MPVA 4YLUA 7KMEH 4FUBA 3U9AH 2AMPA 5FX6A 3SJOA 2PGBB 2CHAC 1D3PB 5T3HA 2PTNA 4Y7BA 3M36A 2ANMH 1ELBA 1HAZB 3VEQB 3M7UA 1C1PA 4K1EA 4BNRA 1QRXA 2Y81A 1L4ZA 4O3TA 2GV6A 3VGCB 1D3DB 4H4FA 3LOXA 4JK5A 4JZFH 3ELAH 1O2JA 4AN7A 5JPMH 1YGCH 2C8WB 4ABBA 3KQBA 1PQ8A 2Z3CA 1PQAA 1BMAA 3S9BA 4CRAA 1HGTH 1O2RA 2CV3A 1OS8A 5DG6A 3E0NB 4CRCA 2J38A 1TOMH 3MMGA 1QA0A 1Y5UT 3ESTA 4CHAC 2OD3B 1ZPCA 1A2CH 4MPUA 3TGIE 2D26C 1RTKA 5JBAS 1GHWH 1WAYB 1Z8GA 3R0FA 2GD4B 1XVMA 1LHEH 3KIDU 5FBEA 5T6DA 1N8OC 5EU8A 4X1PU 3SO3A 1NY22 1ZOMA 1G36A 4ZHLU 1LO6A 1SOTA 2ZZUH 3TVJB 2SNWA 1SQTA 3T25A 1QCPA 1YPHC 3BG4B 1DICA 1PQ7A 1L2EA 4GSOA 2SFAA 3A87A 4YT6H 4E7RG 3S7HB 1Z1JA 2FO9A 1DWCH 3V13A 5H4IB 2NU3E 2F3CE 5HGGA 1GI5A 1C2FA 1E34B 3ZZ4A 4UE7H 1MBMA 1XUJA 3MH5A 1O2LA 1TBRH 2AYWA 2QXJA 5T6GA 4U30A 1K1LA 2G4UA 2Q6FA 1A3EH 4A7IB 2QYIA 1FN8A 1K9OE 2PKSB 3O8RA 4R8TB 1O2OA 1HLTH 1XUGA 3MNBA 2YNAA 1AI8H 3MYWA 3GYMA 1GVLA 2ZU2A 2R0KA 3VB3A 1TALA 1O2NA 3QTOH 3T27A 1SMFE 1SFIA 3DUXH 1G3BA 2OQUA 1RIWC 3Q3YA 1FMGA 9ESTA 1TMUH 1S85A 1O2HA 4O9VA 1IHTH 3ZZ6A 2XC0A 3UFAA 1INCA 3M7QA 1J15A 2ESTE 1FN6A 1BRCE 2ANYA 2BQ6B 3SV8A 2D8WA 2FOCA 1TRMA 4RN6A 1DM4B 2Q6DA 3AAVA 3RXPA 5B6OA 3LC5A 2BVRH 1ZZZA 1F0RA 1NFYA 1GDQA 1TBZH 5LPFA 3BTEE 3BIUH 2TPIZ 2Z3DA 4CRDA 3UPEA 4MG3A 2J4IA 2UUYA 4BAHB 4WY3A 1P2NA 1ZJKA 2W7SA 1OWKA 3KF2A 5FAHA 2DE8A 3T26A 3ZVCA 1VCPA 1O3PB 2FOHA 3RXEA 1WU1A 2WPLS 1GBHA 4E7NA 2OC8A 2ZDAH 3ZZCA 2ZA5A 5EXLA 3A85A 5C20A 4TPIZ 1GHAF 4MNVA 8GCHG 1CGIE 1TGBA 1J8AA 4ZUHA 3UR9A 2GKVE 4K69A 2RDLA 3SUDA 3SV9A 1OOKB 5E2PA 5CMXH 3QZRA 1TNKA 2XBYA 1K22H 2BVXH 1W10U 2UUKB 2BHGA 1V2UT 2OC7A 3MH7A 1ZMNA 3ATLA 5AF9H 4INHA 1KXAA 1C2EA 3PWBA 1SOZA 4Y11E 3I77A 1CQQA 3ZVEA 5A09A 3DT0H 1ZJDA 2A5KA 1YPHE 1QGFA 1ZSLA 1H9IE 2BXTH 1UVSH 3TJVA 2BX3A 1ZR0A 1IQJA 4AOQA 4H6SB 3AAUA 1O36A 1BA8B 1N1LA 4CREA 3RU4T 1TB6H 1O3JA 1SGIB 2BMGB 2BLQA 4OGXA 1D9IA 1P04A 3V0XA 2ZIQH 2A2QH 1Z7KA 3T28A 1QR3E 1EAUA 1D3TB 3ZYEA 5DJ7A 3F1SB 1LQDB 1XUKA 4RKOB 1G37A 3UREA 1HAVA 2ZF0H 4O3UA 4RKJB 1FJSA 1UMAH 1OWEA 4X8SH 3QX5H 1CSOE 4D8NA 1WV7H 2VWNA 2FEQH 3BTFE 3STJA 1BRAA 3UOUA 2BZ6H 2BDAA 2GMTB 3AW0A 2AH4X 1FAXA 2PW8H 4K8BA 1UTPA 1W0ZU 3MO3A 1A0HB 4KTCA 1O2MA 1T4UH 1V2WT 2FS8A 4NWKA 3A88A 3MI4A 2OC0A 3RXRA 2C8YB 1C9TA 1P9UA 2ILNA 1G9IE 1O5EH 1YC0A 2FMJA 3HKJB 3TH4H 1BT7A 2VVVA 1THRH 4KTSA 2FI4E 1OYTH 3F6UH 2FTMA 2ZDMA 4FUHA 1A5IA 1C1OA 2JH0D 2ZCKP 3A86A 4H42U 3VGCC 3RC5A 4I7YH 4AX9H 1C5LH 1DWDH 5A8XA 2PLXA 2FI5E 4M7GA 4AZ2B 3LC3A 2OUAA 1HNEE 1SB1H 1FIWA 2HWLB 4ABGA 3SOSA 3LGWA 1E35B 2P16A 1C5ZB 3B9FH 2BD2A 1GG6B 2VIVA 1NU9A 2BD8A 2Y5FA 4ZHAA 1PPEE 4ABFA 1MKWK 2QAAA 3TNSA 1LTOA 3SNBA 1GMHF 2ZTXA 1QTFA 2I6SA 3OYPA 3RXAA 1GBEA 1MTWA 1GCTC 5PTPA 1C1RA 1AUTC 3MTYA 2PUQH 4FUJA 3UIRA 1QB6A 1UHBA 3AVZA 4A5TS 2VU8E 3ITIA 3FZZA 1TBQH 3MNCA 5GDSH 3T2NA 3M7TA 4FUCA 1AWFH 5FXLA 3MO6A 3PV4A 4WMEA 2WUBA 1KY9A 1XXDA 1MZDA 4ZROA 1BTPA 1O3KA 1RTFB 3LGTA 2C4FH 2ZPRA 3TH3H 1THSH 1D6RA 3FP7E 3OX7U 3RM2H 3UR6A 3PMJA 6ESTA 1DUAA 4YESB 1TRYA 2VWOA 1C1TA 2BDGA 2UWOA 3FP6E 3QGNB 3SNAA 2J2UA 1WOFA 1TA2A 1IQNA 4D9RA 4LK4A 4NCYA 2CHAB 4CH2B 3KN2A 2J9NA 1PPGE 4I31A 2HNTF 2J92A 1B0EA 1QA7A 1Z71A 2EEKA 1GHZA 2GZ8A 2ZO3H 4WWYA 4D76A 1BHXB 4X6PA 2Y7ZA 4FUIA 2ZNKH 3QTVH
chains in the Genus database with same CATH superfamily
2STBE 1CT2E 1OP8A 4AGKA 2G5VA 3TJOA 1F2SE 1O2KA 2ZEBA 1MUEB 2ZGCA 3WWBA 1V2QT 1S6FA 5F8XA 1A46H 1DVAH 4Z1MD 1O35A 2WINI 3MU0A 4CHAB 1W11U 2HRVA 5E0GA 1K1OA 1MH0A 3LGIA 1PPHE 1UVPA 2BY6X 1Y3YA 1YPKH 1W7GH 1P2QA 2YMSD 4AYYB 1AWHB 1N8OB 2H9EH 4HTCH 5EOKA 2A7JA 1EZUC 4CBNA 2P3UB 3RM0H 3GISB 2BLOA 2VIQA 4ISNA 1T8MA 1UK3A 1WYKA 1AE8H 1DFPA 1O3IA 3GOVB 1D4PB 1ZGIA 2SGQE 3RXVA 2F9UA 2CGAA 3EDXB 2HVXA 1W2KH 1C5YB 3RXCA 1TPAE 1RD3B 4I32A 4THNH 1T7CA 1NO9H 4DIIH 4Z6AH 1GJ6A 3U69H 2BDCA 1DWBH 1XX9A 3A7XA 4BAQB 1SLVB 2QA9E 1A7SA 3NK8A 1GJAB 2YOLA 4X1QU 3DFJA 2SGAA 1CE5A 1QHRB 4KP0A 2F9OA 1BBRK 1HAOH 2WPMS 1HAGE 1MCVA 3QGJA 3TJUA 4DURA 1KLTA 3TIUA 1C1VH 2JDID 3H09A 1LVBA 5GJ4B 3SHCH 3TJNA 1MKWH 1OWJA 5E2OA 1RIWB 3RP2A 5GNDA 1E0FD 1QJ6B 4BTIB 2UUFB 4GCHF 1BDAA 1NBMD 3RXJA 2QF5A 1GMHG 3MH4A 1N6YA 1H8ED 1OWDA 6GCHF 4NG9H 2WPJS 1O2GH 2Z9JA 5KECA 3V3MA 1Y5BT 3HGPA 4ESTE 3KQ5A 1CHGA 1IQHA 2ANKH 2B5TB 1BCUH 1YM0A 1RFNA 1K21H 1BTHH 4LZ1H 3PRBA 4Y76A 1Y59T 1SKYE 1QL8A 2GMTC 3PWCA 4B1TA 1O2ZA 4O97A 2TGPZ 1Z8RA 1O3DA 4K60A 3SI4H 1TWXB 3SNDA 2NU1E 1P3EA 3BF6H 1KYNA 3R3GB 2GCTB 2ZHDA 3P8FA 5DGJA 3QDZB 1IAUA 3LGUA 1RS0A 2L74A 3KYFA 1NU7B 4P02A 3SGAE 4ABEA 1HB0B 2JJ1D 4TYDA 2K1QA 3SUFA 1QQUA 2WYGA 3K2UA 2JJ2D 4ZKNU 3PROA 2HNTE 1VGCC 3GDUA 1GJCB 1EJNA 3SU3A 2M2AA 3E3TA 1DS2E 2XC5A 2ZHWH 1GI0A 1XKBC 4GHQA 3RU4E 8KME2 5HM2A 2H9TH 3SV2H 4Q4LA 1J16A 4FU7A 1FY1A 2O8TA 1ZTJA 2AIPA 1KDQA 4JYTA 5C1UA 1BB0B 3SGQE 2I6QA 3NWUA 1V2MT 1EB2A 1O5AB 3IWMA 2NU0E 5TCCA 2ODYB 3SNCA 2Y6TA 1EP6A 2LELA 1YCPM 1BIOA 2FZZA 4AG1A 5EW1H 1TQ7B 3KYGA 4MPWA 1W0YH 4IC6A 1O3BA 3L3TA 1GMCF 1K1MA 2J98B 3F9FA 3NZIA 4CH8B 5FCKA 1Z1IA 1EXFA 4Y0ZE 1JMOH 3GCTF 1MAXA 2GCHF 1QIXB 2BDBA 1GBKA 4FUGA 4BAMB 4X0WU 1Y5AT 2FX6A 1A0LA 1GDNA 1TX7A 1ZYOA 1ANDA 1O3NA 2XW9A 1C5VA 1C5MD 1G2MA 4UFGH 1FQ3A 5FL7D 4MVNA 1Q31A 4ABAA 2WPKS 3LH3A 2BDYA 2GT8A 2GZ7A 1EZQA 1K1IA 1O2VA 4YZUA 3RC6A 2EI6A 4X2YA 4CR9A 2ZHFH 1QFKH 3RC4A 5A0CA 1L1GA 3P17H 2A4OA 5DPAA 4Y79A 3HGNA 3SU1A 5JBTA 3SUGA 2G55A 2ALVA 3OU0A 3FVFB 3N7EA 4Y8YA 1YPLH 2J95A 4Q7YA 3SU0A 1DDJA 1W13U 2Y5HA 3KQDA 2UUJB 3GDVA 3MFJA 1TNHA 3GDSA 4IGDA 1P09A 1G30B 3MH6A 1CHOF 2WUCA 1FY5A 1DSTA 3E1XB 1EAWA 4IN2A 1L4DA 4HGCA 4XFQA 3GY4A 1OP0A 1ZPBA 1ZTLA 5DP7A 5FPYA 5I25A 3EYDA 4GCHG 1SGEE 2ZHEH 3LGYA 3SJKA 1FIZA 2O8MA 1UHBB 1V2KT 4NWLA 4NA8A 2G5NA 4INKA 5FPTA 1SGPE 3IITA 3RXQA 4U2WA 3CS7A 1Y8TA 6GCHG 4DG4A 4DY7B 3BG8A 1C1QA 4MDSA 1P2MA 1F5RA 3OY5U 3ZZ5A 4ACBA 1GCTB 1GJ8B 5EPNA 2PP6A 4WXVA 2HALA 4X6NA 1UK4A 3U8TH 2ODQA 3SW2B 4X1RU 5A2MH 3H7TA 4J1YA 2F9BH 2JH5D 1GGDB 5AFYH 1MTNC 1FV9A 1IHSH 5AHGH 2BD3A 1QBVH 2ZFPH 1BOQA 1ETTH 2BD4A 1YY3A 2IPQX 1A5GH 1O2YA 2FOAA 1TNLA 3ZVDA 1TMBH 2W5EA 3K6ZA 2A4RA 3SNEA 3NCLA 4F55A 1GI3A 5GWZA 4HG6A 1DSUA 4NIVA 4NZLA 2XTTB 3VB7A 4Z0KA 5J4QA 2F91A 5JDUB 4Q63A 2TBSA 1PQ5A 3TU7H 1O2SA 2A0QB 4DGJA 1EKBB 1YKTA 1QRZA 4UD9H 2GDDA 1O3LA 2ZHQH 2Y7XA 1Z8JB 2AERH 5EODA 1M9UA 3BTDE 1O30A 1UK2A 3QUMP 3ZYDA 1HV7A 4FU9A 1HAXB 1KTTB 1SI5H 3T5FH 1BTWA 3ENSB 1K1JA 1HAHH 5C0UA 2VINA 3ATMA 3TK9A 1NRSH 4LOYH 1UVUH 3VB6A 4NIYA 1WTHD 5EQRA 4ABHA 3AW1A 1KLJH 1J9CH 2CF9H 2FM2A 3PO1C 3GY2A 4CR5A 2ZI2H 1O3EA 4XE4A 5DKMA 1O39A 3SJIA 1QZ8A 1HUTH 1BITA 3I29A 1CBWC 2FLRH 3TNTA 4RSPA 1P05A 1F0SA 1KXFA 1BJUA 3BTTE 1GMCG 3CP7A 1DX5M 1TGTA 3TITA 1AKSA 1ZTKA 3JZ1B 3SU6A 3VFEA 2A4GA 3SBKA 4Y8ZA 1W14U 2KCOA 4DOQA 3GCTG 1WXRA 1C5OH 2GCHG 3V12A 4ISOA 1IQIA 3RDZA 4UDWH 2KCYA 2FS9A 3RXDA 1BMNH 4H6TA 2LPRA 2PFEA 4XBBA 3S9CA 1P06A 4NFEA 1GI4A 1NRRH 1V2LT 1EQ9A 2KFWA 2Q6GA 1C2IA 1YLNA 1FXYA 1O2TA 2GCTC 2VVUA 1TQ0B 1EAXA 2O8UA 4CBOA 1WCZA 1VJAU 4JCNA 1GHXH 1FY8E 1W7XH 4X6OA 3TLOA 1HCGA 1DUEA 4Y0YE 2BTCE 2BVSH 3LJOA 5GIBA 3RMOH 1HAPH 1Y3WA 1V2ST 1EJAA 1MD8A 2ZGXH 1UCYE 1P2JA 1CHOG 2VIOA 5FX5A 1LVOA 1WUNH 2P95A 1K0HA 5F8TA 3SU2A 4NSVA 1HFDA 3ATIA 2THFB 4FUFA 5J4SA 2BOHB 3U8RH 3LGVA 3SU5A 1JBUH 2QC2A 2F4LA 3FN8A 3FO8D 1MTUA 1V2VT 3W95A 3ZZ3A 3B8JA 1XXFA 3BEIB 3QK1A 5DP6A 1LHFH 3PMBB 3SJ9A 3RXLA 1V2RT 1UVTH 2PSYA 3ZVGA 3TPIZ 1E37B 2GV7A 2TIOA 4GAWA 4WVPE 4F49A 5ABWA 4ISIH 2WYJA 4IN1A 4GUXA 3BTGE 1WQSA 2FX4A 1NRNH 5DN6D 3W94A 3GS9A 5T6FA 1AIXH 3A7TA 3VB4A 4BANB 5L30H 2ASUB 5DP8A 1ZHRA 4PROA 3ZZDA 3M35A 2FOBA 2FI3E 1HPGA 3ZV9A 4YOJA 4A6LA 1AB9B 3HPTB 1G32B 2Q1JA 2KR7A 3H5CB 1AZ8A 1O32A 2ZPQA 4K2YA 3OSYA 2D2DA 3BEFB 1CA8B 2A45B 1EPTB 4TY7A 3GCOA 5C17A 1KDQB 3NPSA 3D49H 4FUDA 3SN8A 1TGSZ 1PPBH 4Q7XA 2EA3A 2YMSC 4NA7A 4ZHMU 1VGCB 3UUZA 2AGIX 5DK1A 1P9SA 1JWTA 2GX4A 1NS3A 2ZGHA 1E79D 1KMHB 1E1RD 1QL9A 2BD9A 2GDEH 2O8WA 1C2LA 1ELFA 4KGAA 1YWUA 3NRLA 3TGKE 3M5OA 2LNCA 3A81A 1TPPA 8LPRA 5KEDA 2G52A 3F9GA 1P01A 1FUJA 1YPGH 2W6ID 4XDEA 2XXLA 3SZNA 2HVYB 1O31A 3OY6U 3PYHA 2BD7A 5EG4A 3JZ2B 1P12E 1LVYA 4JZ1A 3URCA 1S84A 1XM1A 1Q2WA 2GJGA 2W6JD 3BTKE 1O2XA 2DUCA 1D3QB 1DPOA 1KXDA 1C4U2 5E0HA 1LKBA 1NFUA 1GGDC 4MQAA 2R2MB 1GMDF 2H2ZA 4B75A 2Z9IA 1S83A 2HLCA 1V2PT 3E16B 3QLPH 5L6NH 1H9HE 2OXSA 1F5KU 2A4QA 4ZKSU 3A82A 1CVWH 3QO6A 1C5NH 1ZMLA 1GI9B 1GI6A 1T8NA 1Y3VA 3RXKA 1ZHMA 1GJDB 3MWIU 1IQEA 2ZDNA 1KXEA 1RXPA 3KGPA 3M5MA 4AFQA 3MU5A 4SGAE 1O5FH 1E36B 1ETSH 1YLCA 2QN5T 5C5OA 1KIGH 3EGKH 1O3CA 4K1SA 1G2LA 1G3DA 5TCAA 4TWWA 4U32A 4YT6H 1GHBF 2G8TA 3LKWA 5E0JA 3RUOA 1FONA 4TT3D 2BQWB 3D62A 3A8AA 1HYLA 1NTPA 4A92A 1GJ5H 1YP9A 2BY9X 1ARBA 1BQYA 1GBLA 2ZG0H 1TNIA 1BTXA 1GJ4H 3GY5A 2R3UA 1YPJH 4MTBA 3BIVH 1OSSA 3AASA 4TY6A 3UNQA 2BXUH 3PB1E 2OP9A 3V7TA 2Y5GA 1SQAA 2R3YA 1UTNA 1Q3XA 1HJ9A 3AK5A 3CS0A 1O2IA 4MNYA 1O33A 2HNTC 4K5ZA 3ATKA 1NC6A 2VJ1A 5BRRE 2F83A 1FI8A 4RT0A 2FTLE 3D23A 2SGPE 3LU9B 2ZU4A 2ALPA 4OS5A 2VH6A 2FYRA 1MTNB 1CA0B 2QCYA 3F9HA 3EA8A 1HBTH 1FLEE 3PTNA 1O2PA 1XUFA 5F03A 2QE7D 2C3SA 3FANA 4OS6A 1QBNA 1YPEH 3ZZAA 2P93A 1SLXB 1HDTH 2FOEA 2PHBA 4UONA 1TE0A 4E05H 1O5BB 3DSGA 3UB0A 5LPRA 2QY0B 2AS9A 5JBBS 5CE1A 4B74A 1EOJA 1AMHA 1DWEH 1C1UH 3RXGA 3VPKA 3EQ0H 3ZZ9A 4J2YB 5EPYA 2W3KA 1S6HA 1G3EA 4I8GA 1AU8A 3EE7A 4JMYA 5EXNA 3RMMH 1YCPK 4F4OC 1QNJA 4JZDH 2FOGA 2KX4A 4K8YA 4AG2A 2W7UA 3GCNA 1C9PA 1PYTC 2QF4A 3O8BA 2V35A 1E38B 2Y82A 5L2YH 4ZAEA 2PV9B 4BAKB 5LGOA 3QN7A 2FPZA 3SORA 1HXFH 4QT8C 4JZEH 1AKSB 2XRCA 1P03A 3KQCA 4TWYA 1GCDA 3M37A 2P94A 1AFQC 2JETC 1AO5A 3OTPA 1THPB 3GCHC 4Q80A 3UWJH 3LONA 3PO1B 1SGFG 4ZCNA 5IDKA 1NBME 2NU2E 2Z6BD 1UCYK 2ZGBH 4GPGA 1TPSA 4NZQA 1CBWB 2HGTH 2VVCA 4OS1A 3U98H 1C2KA 3VG8A 3S9AA 1A61H 3RXIA 1YPMH 4R0IA 1T8LA 2IJOB 1T8OA 2RA3A 3UTUH 1ACBE 4Q7ZA 1AN1E 1GMDG 1GDUA 1HAYB 3F0OA 3BTWE 4A1VA 2BY5X 2XWBI 1DT2A 2PUXB 4ISLA 3E90B 2P59A 2FESH 1AB9C 2EI8A 1L1JA 1H8IH 1A1RA 5FBIA 3ZIAD 1GBCA 1VCWA 4BTUB 1DY8A 2H9HA 1YF4A 2WV4A 1EP5A 2ANWA 1IQMA 2FIRH 1D6WA 4Y7AA 2A5IA 4CRGA 5C1YA 1TX8A 1EPTC 4B2BA 4BXSA 5JB9S 1GBBA 1GBIA 3B23B 1SGRE 3DFLA 2ZTYA 1AFEH 1TA6A 1BMLA 1KXBA 1LHGH 1CGHA 1V2OT 1ORFA 2TGTA 1VITF 2SGDE 4GLYA 1C2GA 5TJXA 1QBOA 3TK5A 1GHBG 2XWAA 1AQ7A 1C5RA 1TLDA 1WBGB 3W1EA 2VWMA 3KQEA 1IQFA 3RXFA 5HIYA 1IQKA 1EPTA 2HPPH 4MPXA 2V0BA 2STAE 3F0PA 3ZZBA 1C5QA 2CF8H 5EQSA 3RMLH 2R0LA 4X2WA 1Z6JH 2XBVA 2FWWA 3GY3A 3H7OA 3BSQA 2OINA 2A5AA 4AC9A 5K0HA 3UNRA 2IN2A 2KZ4A 4TPYA 4ZH8A 2VIDA 2K8IA 1DXPA 1KXCA 3DCLA 9LPRA 4ISHH 1BRBE 1AVGH 2TGAA 3L33A 1MZAA 1JIRA 3C1KA 2AEIH 1O0DH 2QIQA 3BV9B 3NUMA 3P8OA 2UWLA 1H4WA 3KL6A 1H1BA 1EUFA 1MQ6A 3C27B 2W26A 2BZAA 4TSFD 4I8JA 2ZWLH 2FOMB 1ESBA 3WY8A 1ETRH 5DP9A 1UVOA 4AFSA 1C2JA 5L2ZH 4VGCB 5AVDA 1FPHH 2V3OH 4X1NU 2WPIS 2SGFE 2ZFTA 3M5LA 1DITH 1BTZA 1S0RA 2PGQB 5CHAC 4UFFH 4X2VA 5CHBA 4JZIA 2B8OH 5E8EH 3P8GA 5ETXA 2VIWA 4ABJA 1ZGVA 2AMQA 3UNSA 1BHXF 1CT4E 1QJ1B 1YCPH 3HKIB 3Q77A 1AE5A 1SLUB 2C8ZB 2QV1A 3ZVBA 1C5SA 1TYNA 2ZQ2A 1ELCA 2BX4A 2ZDLA 1EOLA 1HJAC 1K2I1 2WV5A 1WQVH 7GCHF 2YMSB 2BD5A 1JRSA 2H6MA 3GY6A 1SGTA 3NXPA 1NRQH 3GYLB 5AFZH 4BTTB 1ESAA 3BTME 2B7DH 3VB5A 1K1PA 3HATH 3P70B 1VCQA 2VB0A 4I33A 1ZHPA 3SQHE 1HXEH 1JIMA 1EJMA 1UCYH 3M3TA 3P95A 1KTSB 2C93B 1NFWA 4FVDA 1BRUP 1ANBA 1OXGA 2PSXA 1T32A 1B7XB 3TH2H 2FXRA 2ZKSA 2BLWA 1V2JT 2BLVA 1SC8U 1UTKA 5EGMA 1HRTH 3OFND 1V2NT 1WTGH 1ANEA 2BYAX 4UEHH 2A7CA 3WW7A 2FLBH 1ELDE 2C90B 2BDIA 1HAIH 1OWIA 1MTSA 1MKXK 2P8OC 1AY6H 2QXHA 3LIWA 1SQRA 1C1SA 3GICB 1CA0C 4NIWA 5DP3A 3A8BA 1CO7E 1FDPA 3E91A 1MBQA 1LDTT 4B71A 1W8BH 4ZKRU 4YLQH 1WDIA 1SVPA 1GBJA 4FUEA 4HZHA 3M3SA 2FODA 1VZQH 1GI2A 4D7FA 1DLKB 3LDXH 1S5SA 3ODDA 4IBLH 4P00A 2XNDD 1LPKB 1HIAA 3E0PB 2TGDA 1UO6A 3SU4A 1QL7A 1XKAC 2A31A 1YLDA 1PFXC 4X8UH 1LPZB 1O3OA 1VITG 4JYUH 4NA9H 2PKAA 3STIA 3PTBA 3PMHB 5G4BA 2QF0A 4IMQA 1BUIA 1LMWB 5A0AE 5C3NA 1PPFE 2A7HA 2L6OA 1O3GA 4MNWA 4X6MA 4Y6DA 1UTMA 2ZCLP 1ABJH 2EI7A 2CN0H 1C2MA 4WJG2 2VH0A 1AZZA 5FCRA 1J17T 4ZXYH 1N6XA 2GTBA 5K7RA 1K28D 1TGNA 1BTUA 1TNJA 2Z94A 2QGRA 3OEHD 4I8LA 4YO9A 6CHAC 1PJPA 4KKDA 2XBWA 5HIZA 4WXIA 1W0JD 1GHYH 3DA9B 1GL0E 4KTUA 4YXWD 1FY3A 3ATWA 3RXTA 3MO9A 4Y10E 3ZZ7A 1Y3XA 1XMNB 1QRWA 5JB8S 3FFGA 2AMDA 1W3CA 1GBTA 1FAKH 1F92A 5HMAA 1F7ZA 1ESTA 1AHTH 1V6DA 1U6QA 2R2WU 2UWPA 5C67A 1TGCA 3MU1A 1SHYA 3MOCA 1H8DH 4OS2A 1EZSC 1TNGA 2BB4A 1UTOA 3PV5A 2KM0A 3FOAA 2LP6A 4M9FA 3M3VA 5C1XA 3FAOA 1BMMH 3QZQA 1ELEE 3DHKH 3T62A 5I46H 2KAIA 4B6EA 3KEEA 5BPEA 3OE7D 1UTLM 2SGEE 1CT0E 2WV9A 2XBXA 3P6ZB 7LPRA 1SGCA 5LPEA 3M61U 2EY4C 1OP2A 4ABDA 4IS5A 3RXBA 2AIQA 2KCPA 1BBRE 2ZPSA 3K65B 7GCHG 5LH8A 2Y80A 5F53A 4NFFA 3U8OH 4X1SU 1ANCA 1ABIH 4UFEH 4AORA 2RDEA 1UTQA 1GL1A 3WWFA 1A4WH 2Z3EA 5HM9A 1SGQE 1ZSJA 4ABIA 4FETA 3RXMA 1RJXB 3MNXA 1JXPA 2ZU3A 1GVKB 1P2IA 4SGBE 1G3CA 2SNVA 2OBQA 2V3MA 2ZTZA 3T29A 2G00A 3O8CA 3P8NA 3UAIC 1S6LA 1E1QD 4CRFA 1FZZA 1AFQB 2JETB 2ODPA 3GCHB 1MU8B 1TAWA 4E06H 1MD7A 1TMTH 4NSYA 1FPCH 2ZFSA 3PLKA 3SHAH 2Z7FE 2ZC9H 1UW7A 2BY8X 1NESE 1GBMA 1OWHA 2FOFA 3TK6A 3OAAD 1QJ7B 5A0BA 1H8HD 1MKXH 3RLYH 1B5GH 3A89A 1EX3A 3ZVFA 1O37A 4XBCA 1XUIA 4INLA 2VGCB 1GI8B 1F0TA 2AGGX 2ZU1A 1OYQA 1HJ8A 2O8LA 4MNXA 1SPJA 1L1NA 1C2HA 1DANH 3HK6B 3PLPA 4AGJA 1GHVH 1VKYA 3A83A 4DW2U 1H9LB 3MHWU 1TABE 5GCHF 1ZRKA 4VGCC 2RG3A 1O2WA 5F8ZA 4GVUA 3MNSA 1O5CB 1O3FA 1NRPH 1GI1A 3U28C 7ESTE 2HOBA 1SGDE 1C5XB 3MU4A 4BXWA 1SG8B 1MCTA 3A7YA 1V2TT 3LT3A 4IC5A 4XBDA 4XOJA 2C8XB 2ZP0H 3F68H 1MAYA 1SSXA 3VXFH 4YM9A 3M5NA 5SGAE 1S82A 2VIPA 1ELVA 2OTVA 1XUHA 4GHTA 2O9QA 3F3BA 4OGYA 1TONA 4X8TH 4X2XA 1EZXC 3KCGH 3GY8A 1P0SH 2DE9A 4WMDA 2ZFFH 1C4Y2 1JOUB 1NPMA 1C2DA 3KHVA 4IMZA 1ZSKA 3GY7A 4AFUA 4ZXXH 1NFXA 1SFQB 1O5DH 1O2QA 2H5CA 4JK6A 1LQEA 2H5DA 4BAOB 3TGJE 4ASHA 5HKKD 5JYIA 3BEUA 1Z8IB 4YTAA 4JYVH 2BM2A 1C5TA 2G51A 5DP4A 2F43B 1CU1A 1SL3A 3S7KB 1SR5C 2G4TA 2W3IA 8ESTE 4WH8A 5F6MA 1O3AA 1P11E 1SBWA 1GJ9B 4KELA 2V3HH 2Z9LA 5C2ZA 4RI0A 4OS7A 1MU6B 2XCFA 1ZRBA 5ESTE 5EXMA 1OHHD 1MQ5A 1QURH 1O2UA 3SJ8A 4WH6A 4HI3A 4DIHH 3E6PH 2PR3A 3Q3KA 1GBDA 1TIOA 5ESBA 1S0QA 5CHAB 4DJZB 3UQVA 2F9VA 5FPSA 1ELTA 3SV7A 3BG4C 1IOEA 3F2GA 6LPRA 4WF8A 4UFDH 5EQQA 1GHAG 1O5GH 1HJAB 3K9XB 2XCNA 3RXOA 2FDAA 2HPQH 1TOCB 3D65E 2QXIA 2P3FH 1LCYA 1PPCE 2Z9KA 1QB9A 1SGFA 3PM3A 1P2KA 1P02A 3DSPA 3HK3B 5B6LA 4AB9A 1NZQH 3EAJA 5KGOA 1C1NA 1C5WB 1P10A 3CENA 1GBAA 1A0JA 5IYTA 5A8YA 2IOTA 1DE7H 3MU8A 2QXGA 3Q00A 2ZECA 2WPHS 4B76A 1LVMA 4K3JA 1C5UA 1VJ9U 2B9LA 3L6PA 2OC1A 1O3MA 2PKSC 3K6YA 4YOIA 3F9EA 2VWLA 3BN9A 3Q3XA 3P92A 1DLEA 3E8LA 3G01A 1RTLA 1F5LA 1NT1A 1GPZA 2XOKD 1IQGA 2EQNA 4LXBH 2PTCE 1T31A 2P8OB 2BY7X 4FVBA 1HIAB 4U01A 2NWNA 1P8VC 1SGYE 1YBWA 3RXUA 5GCHG 1K1NA 5FHTA 3PMAB 1QQ4A 2NU4E 1A3BH 2PKAB 1EB1H 3ZVAA 1P2OA 3A8DA 3I78A 4XSKU 3LPRA 1OKXA 3NKKA 2A1DB 2AFQB 4I8KA 1AGJA 2ZQ1A 2OQ5A 1F0UA 3BTQE 4OS4A 5DP5A 2OCVB 1LKAA 3F2FA 1GJBB 3A7ZA 2AHME 1CGJE 3EA7A 3N7OA 1ZMJA 1AVWA 3PLBA 3LJJA 3IG6B 5EJ1A 1NM6A 1JRTA 4Y71A 1PPZA 1J14A 3VXEH 2YNBA 1BZXE 2ZDVH 3RMNH 1X7AC 2J34A 1TRNA 1ELAA 2ZU5A 1Z6EA 2Z9GA 1AVXA 2RCEA 1FNIA 4FXGH 4Y8XA 4B2CA 3ZZ8A 1GI7B 3FP8E 6CHAB 5HYOA 2ZDKA 1W12U 3RLWH 2GP9B 2ZGJA 3A7WA 1TFXA 5JBCS 2TRMA 3RXHA 4IW4E 3UWIA 3ZV8A 4AB8A 5C5NA 1LPGB 1KSNA 2KAIB 4HFPB 4I8HA 2XYAA 3SUEA 3UQOA 4DVAU 5GXPA 2ULLA 2FYQA 1V3XA 2VGCC 5EW2H 4NIXA 4K1TA 5A8ZA 2VBCA 1O3HA 1AD8H 3KNXA 3SYJA 1LHDH 2BDHA 3SQEE 1NROH 4DT7B 4ACAA 4YT7H 1WSSH 4XD7D 2J94A 1C1WH 1XVOA 1SLWB 2F9PA 1BTYA 3UOPA 2P3TB 2CMYA 1TPOA 2K0QA 3SV6A 2OBOA 3Q76A 2M5TA 2GZ9A 4NGAH 1SHHB 1C1MA 1QY6A 1EAIA 4ZKOU 2V6NA 4MLFB 3A8CA 1KLIH 3UY9A 3OTJE 1ID5H 1YYY1 1UTJA 4YOGA 2GT7A 1SGNE 3EE0B 2VNTA 5GPIB 2EC9H 1EASA 2F9NA 4DCDA 2QF3A 1L0ZA 4A1XA 4D9QA 2BQ7B 4CRBA 3DD2H 1GJ7B 3S0NA 1W0KD 1TX6A 5DO4H 4X8VH 1P57B 2ZFRH 3O8DA 1VITH 2A32A 4AYVB 2IPHA 3RU4D 5IK2D 2XC4A 1S81A 4Q2KA 1B0FA 1OX1A 2ZFQH 1GVZA 3S69A 1AUJA 2IJD1 1ZLRA 2A2XH 4ZMAH 1O38A 3RXSA 1RRKA 2AGEX 1FY4A 3U1JB 1GWAA 1EATA 2H1UA 1DOJA 1UJ1A 2CJIA 1O34A 1OPHB 3QWCH 1GG6C 3U1IB 1HAVB 4ASUD 1SQOA 1MTVA 2BOKA 1C5PA 4BOHA 4FU8A 4AFZA 2JKHA 1QB1A 1MMJN 1ELGA 3A7VA 3EA9A 4LZ4B 1VR1H 4A1TA 2D1JA 1ZPZA 4WMFA 1BMFD 1BJVA 4B73A 2FP7B 3URDA 1GBFA 1PYTD 2B0FA 2R9PA 1DXWA 3ODFA 3FZDA 1DY9A 1ARCA 5HXFA 4D7GA 2GVFA 4B2AA 1Y3UA 2CXVA 2GGVB 3A80A 1NN6A 2PWXA 3BTHE 2G81E 2RA0A 2ZCHP 1C4V2 2JH6D 1LHCH 1P3CA 1T4VH 2XNIA 8GCHF 1A5HA 4O03A 3A84A 3LH1A 1RGQA 3SI3H 2OLGA 3SGBE 1BBRH 1IQLA 4MPVA 4YLUA 7KMEH 4FUBA 3U9AH 5EJLA 3N99A 2AMPA 5FX6A 3DSOA 3SJOA 2PGBB 2CHAC 1D3PB 5T3HA 2PTNA 4Y7BA 3M36A 2ANMH 1ELBA 1HAZB 3VEQB 3M7UA 1C1PA 4K1EA 4BNRA 2V7QD 1QRXA 2Y81A 1L4ZA 4O3TA 2GV6A 3VGCB 1D3DB 4H4FA 3LOXA 4JK5A 4JZFH 3ELAH 1O2JA 4AN7A 5JPMH 1YGCH 2C8WB 4ABBA 3KQBA 5T1VA 1PQ8A 2Z3CA 1PQAA 1BMAA 3S9BA 4CRAA 1HGTH 1O2RA 2CV3A 1OS8A 5DG6A 3E0NB 4CRCA 2J38A 1TOMH 3MMGA 1QA0A 1EFRD 1Y5UT 3ESTA 2OD3B 4CHAC 1ZPCA 1A2CH 4MPUA 3TGIE 2D26C 1RTKA 5JBAS 1GHWH 1WAYB 1Z8GA 3R0FA 2GD4B 1XVMA 1LHEH 3KIDU 5FBEA 5T6DA 1N8OC 5EU8A 4X1PU 3SO3A 1NY22 1ZOMA 1G36A 4ZHLU 1LO6A 1SOTA 2ZZUH 3TVJB 2SNWA 1SQTA 3T25A 1QCPA 1YPHC 3BG4B 1DICA 1PQ7A 1L2EA 2WZQA 2SFAA 3A87A 4FOUC 4GSOA 4E7RG 2OK5A 3S7HB 1Z1JA 2FO9A 1DWCH 3V13A 5H4IB 2NU3E 2F3CE 5HGGA 1GI5A 1C2FA 1E34B 2RFKC 3ZZ4A 4UE7H 1MBMA 1XUJA 3MH5A 1O2LA 2J97A 1TBRH 2AYWA 2QXJA 5T6GA 4U30A 2HLDD 1K1LA 2G4UA 2Q6FA 1A3EH 4A7IB 2QYIA 1FN8A 1K9OE 2PKSB 3O8RA 4R8TB 1O2OA 1HLTH 1XUGA 3MNBA 2YNAA 1AI8H 3MYWA 3GYMA 1GVLA 2ZU2A 2R0KA 3VB3A 1TALA 1O2NA 3QTOH 3T27A 1SMFE 1SFIA 3DUXH 1G3BA 2OQUA 1RIWC 1MABB 3Q3YA 1FMGA 9ESTA 1TMUH 1S85A 1O2HA 4O9VA 1IHTH 4RT1A 3ZZ6A 2XC0A 3UFAA 1INCA 3M7QA 1J15A 2ESTE 1FN6A 1BRCE 2ANYA 2BQ6B 3SV8A 2D8WA 2FOCA 1TRMA 4RN6A 1DM4B 2Q6DA 3AAVA 1COWD 1FX0B 3RXPA 5B6OA 3LC5A 3SZEA 2BVRH 1ZZZA 1F0RA 1NFYA 1GDQA 1TBZH 5LPFA 3BTEE 3BIUH 2TPIZ 2Z3DA 4CRDA 3UPEA 4MG3A 2J4IA 2UUYA 4BAHB 4WY3A 1P2NA 1ZJKA 2W7SA 1OWKA 3KF2A 5FAHA 2DE8A 3T26A 3ZVCA 1VCPA 1O3PB 2FOHA 3RXEA 1WU1A 2WPLS 1GBHA 4E7NA 2OC8A 2ZDAH 3ZZCA 2ZA5A 5EXLA 3A85A 3PV2A 5C20A 4TPIZ 1GHAF 4MNVA 8GCHG 1CGIE 1TGBA 1J8AA 4ZUHA 3UR9A 2GKVE 4K69A 2RDLA 3SUDA 3SV9A 1OOKB 5E2PA 5CMXH 3QZRA 1TNKA 2XBYA 1K22H 2BVXH 1W10U 2UUKB 2BHGA 1V2UT 2OC7A 3MH7A 1ZMNA 3ATLA 5AF9H 4INHA 1KXAA 5DSFA 1C2EA 3PWBA 1SOZA 2WHXA 4Y11E 3I77A 1CQQA 3ZVEA 5A09A 3DT0H 1ZJDA 2A5KA 3F2HA 1YPHE 1QGFA 1ZSLA 1H9IE 2BXTH 1UVSH 3TJVA 2BX3A 1ZR0A 1IQJA 4AOQA 4H6SB 2CK3D 3AAUA 4OM9A 1O36A 1BA8B 4B6FA 1N1LA 4CREA 3RU4T 1TB6H 1O3JA 1SGIB 2BMGB 2BLQA 4OGXA 1D9IA 1P04A 3V0XA 2ZIQH 2A2QH 1Z7KA 3T28A 1QR3E 1EAUA 1D3TB 3ZYEA 5DJ7A 5C0TA 3F1SB 1LQDB 1XUKA 4XRNA 4RKOB 1G37A 3UREA 1HAVA 2ZF0H 4O3UA 4RKJB 1FJSA 1UMAH 1OWEA 4X8SH 3QX5H 1CSOE 4D8NA 1WV7H 2VWNA 2FEQH 3BTFE 3STJA 1BRAA 2KCAA 2BZ6H 2WSSD 2BDAA 2GMTB 3UOUA 5EJZA 3N7DA 3AW0A 2AH4X 1FAXA 2PW8H 4K8BA 2J5UA 1UTPA 1W0ZU 3MO3A 1A0HB 4KTCA 1O2MA 1T4UH 1V2WT 2FS8A 2J98A 4NWKA 3A88A 3MI4A 2OC0A 3RXRA 2C8YB 1C9TA 1P9UA 2ILNA 1G9IE 1O5EH 3FKSD 1YC0A 2FMJA 3HKJB 3TH4H 1BT7A 2VVVA 1THRH 4KTSA 2FI4E 1OYTH 3F6UH 3OEED 2FTMA 2ZDMA 4FUHA 1A5IA 1C1OA 2JH0D 2ZCKP 3A86A 4H42U 3VGCC 3RC5A 4I7YH 4AX9H 1C5LH 1DWDH 4I86A 5A8XA 2PLXA 2FI5E 4M7GA 4AZ2B 3LC3A 2OUAA 1HNEE 4DT4A 1SB1H 1FIWA 2HWLB 4ABGA 3SOSA 3LGWA 1E35B 2P16A 1C5ZB 3B9FH 2BD2A 1GG6B 5CDFE 2VIVA 1NU9A 2BD8A 2Y5FA 4ZHAA 1PPEE 4ABFA 1MKWK 2QAAA 3TNSA 3MQKC 4F48B 1LTOA 3SNBA 1GMHF 2ZTXA 1QTFA 2I6SA 3OYPA 3RXAA 1GBEA 1MTWA 1GCTC 5PTPA 1C1RA 1AUTC 3MTYA 2PUQH 4FUJA 3UIRA 1QB6A 1UHBA 3AVZA 4A5TS 2JIZD 2VU8E 3ITIA 3FZZA 1TBQH 3MNCA 5GDSH 3T2NA 3M7TA 4FUCA 1AWFH 5FXLA 3MO6A 3PV4A 4WMEA 2WUBA 1KY9A 1XXDA 3PRDA 1MZDA 2WPDD 4ZROA 1BTPA 1O3KA 1RTFB 3LGTA 2C4FH 2ZPRA 3TH3H 1THSH 1D6RA 3FP7E 3OX7U 3RM2H 5C94A 3UR6A 3PMJA 6ESTA 1DUAA 4YESB 1TRYA 2VWOA 1C1TA 2BDGA 2UWOA 3FP6E 3QGNB 3SNAA 2J2UA 1WOFA 1TA2A 1IQNA 4D9RA 4LK4A 4NCYA 2CHAB 4CH2B 3KN2A 2J9NA 1PPGE 4I31A 2HNTF 5EIYA 2J92A 1B0EA 1QA7A 1Z71A 2GZ8A 1GHZA 2EEKA 2ZO3H 4WWYA 4D76A 1BHXB 3CNRA 4X6PA 2Y7ZA 4FUIA 2ZNKH 3QTVH
chains in the Genus database with same CATH topology
2STBE 1CT2E 1OP8A 4AGKA 2G5VA 3TJOA 1F2SE 1O2KA 2ZEBA 1MUEB 2ZGCA 1V2QT 1S6FA 5F8XA 1A46H 1DVAH 1O35A 2WINI 3MU0A 4CHAB 1W11U 2HRVA 5E0GA 1K1OA 1MH0A 3LGIA 1PPHE 1UVPA 2BY6X 1Y3YA 1YPKH 1W7GH 1P2QA 4AYYB 1AWHB 1N8OB 2H9EH 4HTCH 5EOKA 2A7JA 1EZUC 4CBNA 2P3UB 3RM0H 3GISB 2BLOA 2VIQA 4ISNA 1T8MA 1UK3A 1WYKA 1AE8H 1DFPA 1O3IA 3GOVB 1D4PB 1ZGIA 2SGQE 3RXVA 2F9UA 2CGAA 3EDXB 2HVXA 1W2KH 1C5YB 3RXCA 1TPAE 1RD3B 4I32A 4THNH 1T7CA 1NO9H 4DIIH 4Z6AH 1GJ6A 3U69H 1DWBH 1XX9A 2BDCA 3A7XA 4BAQB 1SLVB 2QA9E 1A7SA 3NK8A 1GJAB 2YOLA 4X1QU 3DFJA 2SGAA 1CE5A 1QHRB 4KP0A 2F9OA 1BBRK 1HAOH 2WPMS 1HAGE 1MCVA 3QGJA 3TJUA 4DURA 1KLTA 3TIUA 1C1VH 1LVBA 5GJ4B 3SHCH 3TJNA 1MKWH 1OWJA 5E2OA 1RIWB 3RP2A 1E0FD 1QJ6B 4BTIB 2UUFB 4GCHF 1BDAA 3RXJA 1GMHG 3MH4A 1N6YA 1OWDA 6GCHF 4NG9H 2WPJS 1O2GH 2Z9JA 3V3MA 1Y5BT 3HGPA 4ESTE 1CHGA 1IQHA 2ANKH 2B5TB 1BCUH 1YM0A 1RFNA 1K21H 1BTHH 4LZ1H 4Y76A 1Y59T 1QL8A 2GMTC 3PWCA 4B1TA 1O2ZA 4O97A 2TGPZ 1Z8RA 1O3DA 4K60A 3SI4H 1TWXB 3SNDA 2NU1E 1P3EA 3BF6H 1KYNA 3R3GB 2GCTB 2ZHDA 3P8FA 5DGJA 3QDZB 1IAUA 3LGUA 1RS0A 1NU7B 3SGAE 4ABEA 1HB0B 4TYDA 2K1QA 3SUFA 1QQUA 2WYGA 3K2UA 4ZKNU 3PROA 2HNTE 1VGCC 3GDUA 1GJCB 1EJNA 3SU3A 3E3TA 1DS2E 2XC5A 2ZHWH 1GI0A 1XKBC 4GHQA 3RU4E 8KME2 5HM2A 2H9TH 3SV2H 1J16A 4FU7A 1FY1A 2O8TA 1ZTJA 2AIPA 1KDQA 4JYTA 5C1UA 1BB0B 3SGQE 2I6QA 3NWUA 1V2MT 1EB2A 1O5AB 3IWMA 2NU0E 5TCCA 2ODYB 3SNCA 2Y6TA 1EP6A 1YCPM 1BIOA 2FZZA 4AG1A 5EW1H 1TQ7B 4MPWA 1W0YH 4IC6A 1O3BA 3L3TA 1GMCF 1K1MA 3F9FA 3NZIA 4CH8B 5FCKA 1Z1IA 1EXFA 4Y0ZE 1JMOH 3GCTF 1MAXA 2GCHF 1QIXB 2BDBA 1GBKA 4FUGA 4BAMB 4X0WU 1Y5AT 2FX6A 1A0LA 1GDNA 1TX7A 1ZYOA 1ANDA 1O3NA 2XW9A 1C5VA 1C5MD 1G2MA 4UFGH 1FQ3A 4MVNA 1Q31A 4ABAA 2WPKS 3LH3A 2BDYA 2GT8A 2GZ7A 1EZQA 1K1IA 1O2VA 4YZUA 3RC6A 2EI6A 4X2YA 4CR9A 2ZHFH 1QFKH 3RC4A 5A0CA 1L1GA 3P17H 2A4OA 5DPAA 4Y79A 3HGNA 3SU1A 5JBTA 3SUGA 2G55A 2ALVA 3OU0A 3FVFB 4Y8YA 1YPLH 2J95A 4Q7YA 3SU0A 1DDJA 1W13U 2Y5HA 3KQDA 2UUJB 3GDVA 3MFJA 1TNHA 3GDSA 4IGDA 1P09A 1G30B 3MH6A 1CHOF 2WUCA 1FY5A 1DSTA 3E1XB 1EAWA 4IN2A 1L4DA 4HGCA 4XFQA 3GY4A 1OP0A 1ZPBA 1ZTLA 5DP7A 5FPYA 5I25A 3EYDA 4GCHG 1SGEE 2ZHEH 3LGYA 3SJKA 1FIZA 2O8MA 1UHBB 1V2KT 4NWLA 4NA8A 2G5NA 4INKA 5FPTA 1SGPE 3IITA 3RXQA 4U2WA 3CS7A 1Y8TA 6GCHG 4DG4A 4DY7B 3BG8A 1C1QA 4MDSA 1P2MA 1F5RA 3OY5U 3ZZ5A 1GCTB 1GJ8B 5EPNA 4WXVA 2HALA 4X6NA 1UK4A 3U8TH 2ODQA 3SW2B 4X1RU 5A2MH 3H7TA 4J1YA 2F9BH 2JH5D 1GGDB 5AFYH 1MTNC 1FV9A 1IHSH 5AHGH 2BD3A 1QBVH 2ZFPH 1BOQA 1ETTH 2BD4A 1A5GH 1O2YA 2FOAA 1TNLA 3ZVDA 1TMBH 2W5EA 3K6ZA 2A4RA 3SNEA 3NCLA 1GI3A 5GWZA 1DSUA 4NIVA 4NZLA 2XTTB 3VB7A 4Z0KA 5J4QA 2F91A 5JDUB 2TBSA 1PQ5A 3TU7H 1O2SA 2A0QB 4DGJA 1EKBB 1YKTA 1QRZA 4UD9H 2GDDA 1O3LA 2ZHQH 2Y7XA 1Z8JB 2AERH 5EODA 1M9UA 3BTDE 1O30A 1UK2A 3QUMP 3ZYDA 1HV7A 4FU9A 1HAXB 1KTTB 1SI5H 3T5FH 1BTWA 3ENSB 1K1JA 1HAHH 2VINA 3ATMA 3TK9A 1NRSH 4LOYH 1UVUH 3VB6A 4NIYA 1WTHD 5EQRA 4ABHA 3AW1A 1KLJH 1J9CH 2CF9H 2FM2A 3PO1C 3GY2A 4CR5A 2ZI2H 1O3EA 4XE4A 5DKMA 1O39A 3SJIA 1HUTH 1BITA 3I29A 1CBWC 2FLRH 3TNTA 4RSPA 1P05A 1F0SA 1KXFA 1BJUA 3BTTE 1GMCG 3CP7A 1DX5M 1TGTA 3TITA 1AKSA 1ZTKA 3JZ1B 3SU6A 3VFEA 2A4GA 3SBKA 4Y8ZA 1W14U 4DOQA 3GCTG 1C5OH 2GCHG 3V12A 4ISOA 1IQIA 3RDZA 4UDWH 2FS9A 3RXDA 1BMNH 4H6TA 2LPRA 2PFEA 4XBBA 3S9CA 1P06A 4NFEA 1GI4A 1NRRH 1V2LT 1EQ9A 2Q6GA 1C2IA 1FXYA 1O2TA 2GCTC 2VVUA 1TQ0B 1EAXA 2O8UA 4CBOA 1WCZA 1VJAU 4JCNA 1GHXH 1FY8E 1W7XH 4X6OA 3TLOA 1HCGA 1DUEA 4Y0YE 2BTCE 2BVSH 3LJOA 5GIBA 3RMOH 1HAPH 1Y3WA 1V2ST 1EJAA 1MD8A 2ZGXH 1UCYE 1P2JA 1CHOG 2VIOA 5FX5A 1LVOA 1WUNH 2P95A 5F8TA 3SU2A 4NSVA 1HFDA 3ATIA 2THFB 4FUFA 5J4SA 2BOHB 3U8RH 3LGVA 3SU5A 1JBUH 2QC2A 1MTUA 1V2VT 3W95A 3ZZ3A 3B8JA 1XXFA 3BEIB 3QK1A 5DP6A 1LHFH 3PMBB 3SJ9A 3RXLA 1V2RT 1UVTH 2PSYA 3ZVGA 3TPIZ 1E37B 2GV7A 2TIOA 4GAWA 4WVPE 4F49A 5ABWA 4ISIH 2WYJA 4IN1A 4GUXA 3BTGE 1WQSA 2FX4A 1NRNH 3W94A 5T6FA 1AIXH 3A7TA 3VB4A 4BANB 5L30H 2ASUB 5DP8A 1ZHRA 4PROA 3ZZDA 3M35A 2FOBA 2FI3E 1HPGA 3ZV9A 4YOJA 4A6LA 1AB9B 3HPTB 1G32B 2Q1JA 3H5CB 1AZ8A 1O32A 2ZPQA 4K2YA 3OSYA 2D2DA 3BEFB 1CA8B 2A45B 1EPTB 4TY7A 3GCOA 1KDQB 3NPSA 3D49H 4FUDA 3SN8A 1TGSZ 1PPBH 4Q7XA 2EA3A 4NA7A 4ZHMU 1VGCB 3UUZA 2AGIX 5DK1A 1P9SA 1JWTA 2GX4A 1NS3A 2ZGHA 1QL9A 2BD9A 2GDEH 2O8WA 1C2LA 1ELFA 4KGAA 3TGKE 3M5OA 2LNCA 3A81A 1TPPA 8LPRA 2G52A 3F9GA 1P01A 1FUJA 1YPGH 4XDEA 2XXLA 3SZNA 1O31A 3OY6U 3PYHA 2BD7A 5EG4A 3JZ2B 1P12E 1LVYA 4JZ1A 3URCA 1S84A 1XM1A 1Q2WA 3BTKE 1O2XA 2DUCA 1D3QB 1DPOA 1KXDA 1C4U2 5E0HA 1LKBA 1NFUA 1GGDC 4MQAA 2R2MB 1GMDF 2H2ZA 4B75A 2Z9IA 1S83A 2HLCA 1V2PT 3E16B 3QLPH 5L6NH 1H9HE 2OXSA 1F5KU 2A4QA 4ZKSU 3A82A 1CVWH 3QO6A 1C5NH 1ZMLA 1GI9B 1GI6A 1T8NA 1Y3VA 3RXKA 1ZHMA 1GJDB 3MWIU 1IQEA 2ZDNA 1KXEA 1RXPA 3KGPA 3M5MA 4AFQA 3MU5A 4SGAE 1O5FH 1E36B 1ETSH 1YLCA 2QN5T 5C5OA 1KIGH 3EGKH 1O3CA 4K1SA 1G2LA 1G3DA 5TCAA 4TWWA 4U32A 1GHBF 2G8TA 3LKWA 5E0JA 3RUOA 1FONA 2BQWB 3D62A 3A8AA 1HYLA 1NTPA 4A92A 1GJ5H 1YP9A 2BY9X 1ARBA 1BQYA 1GBLA 2ZG0H 1TNIA 1BTXA 1GJ4H 3GY5A 2R3UA 1YPJH 4MTBA 3BIVH 1OSSA 3AASA 4TY6A 3UNQA 2BXUH 3PB1E 2OP9A 3V7TA 2Y5GA 1SQAA 2R3YA 1UTNA 1Q3XA 1HJ9A 3CS0A 1O2IA 4MNYA 1O33A 2HNTC 4K5ZA 3ATKA 1NC6A 2VJ1A 5BRRE 2F83A 1FI8A 2FTLE 3D23A 2SGPE 3LU9B 2ZU4A 2ALPA 4OS5A 2VH6A 2FYRA 1MTNB 1CA0B 2QCYA 3F9HA 3EA8A 1HBTH 1FLEE 3PTNA 1O2PA 1XUFA 5F03A 2C3SA 3FANA 4OS6A 1QBNA 1YPEH 3ZZAA 2P93A 1SLXB 1HDTH 2FOEA 2PHBA 4UONA 1TE0A 4E05H 1O5BB 5LPRA 2QY0B 2AS9A 5JBBS 5CE1A 4B74A 1EOJA 1AMHA 1DWEH 1C1UH 3RXGA 3VPKA 3EQ0H 3ZZ9A 4J2YB 5EPYA 2W3KA 1S6HA 1G3EA 4I8GA 1AU8A 4JMYA 5EXNA 3RMMH 1YCPK 4F4OC 1QNJA 4JZDH 2FOGA 4K8YA 4AG2A 2W7UA 3GCNA 1C9PA 1PYTC 3O8BA 2V35A 1E38B 2Y82A 5L2YH 4ZAEA 2PV9B 4BAKB 5LGOA 3QN7A 2FPZA 3SORA 1HXFH 4QT8C 4JZEH 1AKSB 2XRCA 1P03A 3KQCA 4TWYA 1GCDA 3M37A 2P94A 1AFQC 2JETC 1AO5A 4Q80A 1THPB 3GCHC 3UWJH 3LONA 3PO1B 1SGFG 5IDKA 2NU2E 2Z6BD 1UCYK 2ZGBH 4GPGA 1TPSA 4NZQA 1CBWB 2HGTH 2VVCA 4OS1A 3U98H 1C2KA 3S9AA 1A61H 3RXIA 1YPMH 4R0IA 1T8LA 2IJOB 1T8OA 2RA3A 3UTUH 1ACBE 4Q7ZA 1AN1E 1GMDG 1GDUA 1HAYB 3BTWE 4A1VA 2BY5X 2XWBI 1DT2A 2PUXB 4ISLA 3E90B 2P59A 2FESH 1AB9C 2EI8A 1L1JA 1H8IH 1A1RA 5FBIA 1GBCA 1VCWA 4BTUB 1DY8A 2H9HA 1YF4A 2WV4A 1EP5A 2ANWA 1IQMA 2FIRH 1D6WA 4Y7AA 2A5IA 4CRGA 5C1YA 1TX8A 1EPTC 4B2BA 4BXSA 5JB9S 1GBBA 1GBIA 3B23B 1SGRE 3DFLA 2ZTYA 1AFEH 1TA6A 1BMLA 1KXBA 1LHGH 1CGHA 1V2OT 1ORFA 2TGTA 1VITF 2SGDE 4GLYA 1C2GA 5TJXA 1QBOA 3TK5A 1GHBG 2XWAA 1AQ7A 1C5RA 1TLDA 1WBGB 2VWMA 3KQEA 1IQFA 3RXFA 1IQKA 1EPTA 2HPPH 4MPXA 2V0BA 2STAE 3ZZBA 1C5QA 2CF8H 5EQSA 3RMLH 2R0LA 4X2WA 1Z6JH 2XBVA 2FWWA 3GY3A 3H7OA 3BSQA 2OINA 2A5AA 5K0HA 3UNRA 2IN2A 4ZH8A 4TPYA 2VIDA 1DXPA 1KXCA 9LPRA 4ISHH 1BRBE 1AVGH 2TGAA 3L33A 1MZAA 1JIRA 3C1KA 2AEIH 1O0DH 2QIQA 3BV9B 3NUMA 3P8OA 2UWLA 1H4WA 3KL6A 1H1BA 1EUFA 1MQ6A 3C27B 2W26A 2BZAA 4I8JA 2ZWLH 2FOMB 1ESBA 3WY8A 1ETRH 5DP9A 1UVOA 4AFSA 1C2JA 5L2ZH 4VGCB 5AVDA 1FPHH 2V3OH 4X1NU 2WPIS 2SGFE 2ZFTA 3M5LA 1DITH 1BTZA 1S0RA 2PGQB 5CHAC 4UFFH 4X2VA 4JZIA 2B8OH 5E8EH 3P8GA 5ETXA 2VIWA 4ABJA 1ZGVA 2AMQA 3UNSA 1BHXF 1CT4E 1QJ1B 1YCPH 3HKIB 3Q77A 1AE5A 1SLUB 2C8ZB 2QV1A 3ZVBA 1C5SA 1TYNA 2ZQ2A 1ELCA 2BX4A 2ZDLA 1EOLA 1HJAC 1K2I1 2WV5A 1WQVH 7GCHF 2BD5A 1JRSA 2H6MA 3GY6A 1SGTA 3NXPA 1NRQH 3GYLB 5AFZH 4BTTB 1ESAA 3BTME 2B7DH 3VB5A 1K1PA 3HATH 3P70B 1VCQA 2VB0A 4I33A 1ZHPA 3SQHE 1HXEH 1JIMA 1EJMA 1UCYH 3M3TA 3P95A 1KTSB 2C93B 1NFWA 4FVDA 1BRUP 1ANBA 1OXGA 2PSXA 1T32A 1B7XB 3TH2H 2FXRA 2ZKSA 2BLWA 1V2JT 2BLVA 1SC8U 1UTKA 5EGMA 1HRTH 1V2NT 1WTGH 1ANEA 2BYAX 4UEHH 2A7CA 2FLBH 1ELDE 2C90B 2BDIA 1HAIH 1OWIA 1MTSA 1MKXK 2P8OC 1AY6H 2QXHA 3LIWA 3GICB 1C1SA 1CA0C 4NIWA 5DP3A 3A8BA 1CO7E 1FDPA 3E91A 1MBQA 1LDTT 4B71A 1W8BH 4ZKRU 4YLQH 1SVPA 1GBJA 4FUEA 4HZHA 3M3SA 2FODA 1VZQH 1GI2A 4D7FA 1DLKB 3LDXH 1S5SA 3ODDA 4IBLH 1LPKB 1HIAA 3E0PB 2TGDA 1UO6A 3SU4A 1QL7A 1XKAC 2A31A 1YLDA 1PFXC 4X8UH 1LPZB 1O3OA 1VITG 4JYUH 4NA9H 2PKAA 3STIA 3PTBA 3PMHB