4ABBA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
molecule tags Hydrolase
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA02
3GCHC 1L4DA 4H4FA 3SO3A 1ACBE 2AGEX 3T62A 1O0DH 3L6PA 5IYTA 2W3KA 1L1JA 3MMGA 3S7KB 2VIWA 1BMAA 4CRCA 4CRBA 3UREA 2FWWA 3PO1B 3EYDA 3JZ1B 2OQUA 2QIQA 1MD7A 1MQ6A 4A92A 3T5FH 1HGTH 2F9OA 1QL9A 4KTSA 1F7ZA 2ZG0H 1IQEA 1YP9A 3MHWU 1J8AA 1ZHMA 2W7UA 1TIOA 3PM3A 2QN5T 2SGPE 4Z6AH 1GMHG 2FTLE 1BB0B 3Q77A 3EA7A 4OS6A 1B7XB 1Z6EA 3A88A 1OWIA 1TYNA 1KLJH 1DLKB 1Z71A 4OGYA 4KGAA 2AGIX 4FUGA 2BDGA 2A4RA 2FYQA 3RXVA 3T29A 1IQIA 1ZSLA 2QAAA 1GHVH 3F6UH 2Y7XA 4OGXA 2ZGCA 1RIWB 3Q3XA 2EI6A 2BDBA 2H2ZA 1GBTA 1ZOMA 1O34A 2ULLA 1UMAH 3BF6H 2OLGA 3C1KA 3WY8A 3O8CA 1WQVH 3GOVB 4Y7BA 1O3GA 2ZDAH 4KELA 5T6GA 3MH4A 4I32A 2UUKB 1HAVB 4GUXA 3O8DA 2ZCLP 4MPXA 4I33A 2QYIA 1P2OA 1W3CA 2NU3E 3CS0A 4O03A 3KIDU 1A0HB 1PQ8A 5C5OA 1QA7A 1Z1IA 2BQ7B 3NXPA 4M7GA 3Q3YA 3ATIA 1ZR0A 1C1NA 5E2OA 1WYKA 1EAUA 2VJ1A 1P8VC 5EW1H 1MMJN 1O5BB 2OC1A 4XSKU 2ANMH 2A5AA 4D7FA 1KXDA 1Z6JH 1V2QT 4JK6A 5E0GA 1SLWB 1FI8A 2F9NA 1UVPA 1BMMH 2IPHA 1T8OA 2QXIA 4AFZA 2Y6TA 1TWXB 2SNVA 5ABWA 5F8XA 2VVVA 5GWZA 1WTGH 2OBOA 4TY7A 1ZHRA 8ESTE 1FIZA 1HLTH 2Z9GA 4UD9H 3I77A 3M7UA 1D4PB 3UR9A 1LPKB 3R3GB 4X8TH 4IGDA 3ZZ8A 3TH3H 3AW1A 1NFUA 3BEFB 3G01A 3E0PB 3I29A 4Q7ZA 1KYNA 1NFYA 1XM1A 1C2FA 2VGCC 1TMUH 2R9PA 3NK8A 5E8EH 3QTVH 1O3BA 1H9IE 3VB3A 1O33A 1TRNA 2FM2A 3AVZA 1HNEE 4ISOA 1O2SA 2D26C 1V2RT 2BDIA 1Y3YA 4AN7A 3RC6A 1QJ7B 4ZKRU 3RXAA 1TAWA 2TGAA 2ZPRA 3ZVBA 2CXVA 3OY5U 4NSVA 4IS5A 3A7YA 1ZJKA 1GVKB 1K21H 4DT7B 2FOMB 1HJAC 3TH4H 2I6QA 1XKBC 2Z9IA 3M36A 3ZZ9A 5E0HA 1VCWA 1MCTA 4A5TS 3UWJH 3A83A 1P2JA 1A5IA 1YPJH 3S0NA 1QJ1B 5T3HA 4Y8ZA 1RIWC 3GCHB 1G3EA 2BD7A 2B8OH 1KXCA 1QB6A 1SGEE 1V2OT 2O8LA 4ZUHA 1ZPZA 3MU5A 5EPYA 1SL3A 5LPRA 9ESTA 1A61H 1S6HA 2FS9A 5GIBA 5EXLA 1V2LT 5DP4A 1J14A 2HOBA 4XOJA 2VH0A 2BDCA 4DW2U 2G52A 4NFFA 2BXTH 2C8WB 2XBYA 4B75A 2HNTE 4ZKSU 3GISB 2OC8A 1HJ9A 1IQFA 4TYDA 1FV9A 1XX9A 1SG8B 1TOMH 1K1LA 3RXFA 2K1QA 1GVZA 1HXFH 2Z6BD 3KQEA 1ELVA 2VIPA 4GPGA 5EU8A 1GJAB 1LHDH 3NZIA 7KMEH 1QY6A 2A4QA 4Y79A 3Q00A 2A7CA 3URCA 1KTTB 4ZAEA 1GJCB 2GTBA 1V2JT 3NCLA 2TGPZ 3QGNB 1KTSB 5EQRA 4AORA 4JYVH 1L1NA 1SFQB 3GDSA 1RTFB 4NA7A 4BAOB 1TGNA 5FHTA 4MLFB 4NWKA 3UTUH 3ZZ7A 1WSSH 2GMTB 1ZTLA 1LKAA 1GI9B 1C1QA 1UTOA 3A7VA 1G3DA 1P12E 3B23B 5DP7A 3D65E 4I8GA 1GHBF 4NZLA 1UVOA 3QX5H 3TNSA 7ESTE 2P59A 5GXPA 3S9CA 2Y81A 2ZC9H 2RCEA 2XYAA 1RD3B 4ZROA 1ANEA 3T2NA 1LPZB 1QQ4A 3BG4B 3RXQA 1DUAA 3TVJB 1GGDC 1EKBB 3M7QA 4HFPB 1EZUC 5BRRE 2XXLA 1PPGE 1WOFA 1NRRH 4CRAA 4LOYH 1ABIH 1T4UH 1BJVA 1QRXA 2OCVB 4FUFA 1K2I1 5LPFA 1P10A 5EG4A 1HV7A 5TCCA 4BAHB 3ZVEA 2TBSA 4JCNA 1Z8RA 4E7NA 1O3IA 3RMLH 2Q6DA 2CGAA 1GHAG 1DOJA 2XBXA 3ATLA 4AFSA 3UNRA 1P02A 2Z9KA 2FIRH 2PTNA 1HBTH 2OINA 5C1UA 1NT1A 1Z7KA 1EAXA 2J94A 1SMFE 2IJOB 2ZTZA 2NWNA 1DITH 4CR5A 1C4V2 3TPIZ 1GMHF 1WTHD 1UHBB 2ZTXA 1E0FD 1MBMA 1C5ZB 2P95A 3MNBA 1CGIE 3FANA 1GHBG 1DXPA 1X7AC 1BRAA 2GCTB 1PPFE 1ID5H 4LK4A 3STIA 3SJIA 3LU9B 3SQEE 2XNIA 4MDSA 1W11U 3M5MA 1KDQA 1GJ7B 3U98H 1TNGA 1CE5A 3TITA 1E37B 1KSNA 1TGSZ 1CA0C 1SQTA 1UJ1A 2PV9B 1AB9B 1GDNA 2J34A 1HIAB 1O30A 2AH4X 1RS0A 1MQ5A 2BOHB 2F9UA 1RXPA 3D23A 4TWYA 3SUFA 2Z3EA 1HJAB 1GVLA 1FXYA 1OWKA 1SGQE 4D7GA 2OC0A 2EI8A 4K69A 1QB1A 2XBVA 1SGCA 2ZWLH 1ETSH 1GI7B 2V3OH 1L4ZA 1Y3XA 1NRSH 3SNEA 1FNIA 3T28A 1RJXB 3QDZB 4F4OC 5C67A 1P09A 3AAVA 1CT2E 2WINI 1QL7A 1IQKA 1OP8A 1BMLA 1S83A 3RU4D 1A1RA 3QWCH 4AX9H 1VITF 1C4Y2 2WUCA 1ANDA 4GCHF 1C2GA 1H1BA 4K8BA 2WV4A 3D62A 4O97A 1DT2A 4Y10E 4A1XA 3LH1A 4BXWA 2CHAC 2YNAA 4X6MA 1YYY1 5CHAB 1IHSH 3ZZ6A 2O8TA 1T8MA 1HDTH 1ZYOA 3VXEH 1ARCA 2DUCA 1SOTA 2BY5X 1GMDF 1C1OA 1KLIH 2AGGX 3F9HA 5L30H 1TNLA 3MH5A 3OYPA 4BTUB 1GHXH 2VIDA 3BTKE 1UTJA 4Q7YA 3BSQA 3SJ9A 4IMZA 3M3VA 1XUJA 1TX8A 1HUTH 4FVBA 3OU0A 1YLDA 1CHGA 1GG6C 1Q31A 3P95A 1YLCA 2Y5HA 3ZZCA 3PMJA 2R3YA 8GCHG 1GBDA 3MYWA 1ABJH 4JMYA 5F6MA 1ELBA 2H9TH 3HK6B 1J15A 2R3UA 3LIWA 2Y7ZA 1Y5AT 1GHWH 1UCYE 3BIVH 2HLCA 3MFJA 1MTSA 2ZO3H 2ZPQA 1C5LH 4X1PU 4DCDA 1NU9A 1C2KA 2H9HA 5DP3A 2ZDMA 3A8CA 3LDXH 4WWYA 3FP7E 4DIHH 4NIXA 2BD9A 1UK3A 5L2YH 2BD4A 2BB4A 2SFAA 3S9BA 1FONA 2EC9H 1C9PA 1O2RA 1P0SH 2FI5E 5C3NA 3ZV9A 1N8OB 5A09A 1FPCH 2WPJS 4NIYA 1IQNA 1YC0A 4OS5A 1WBGB 3MWIU 3TJOA 1TGCA 2FDAA 1W13U 1AE5A 2XWAA 2G4TA 1C2JA 1NM6A 2ZA5A 5DP6A 4AG1A 2BXUH 1SQOA 3BEUA 3EGKH 1NROH 1O2MA 2XW9A 6GCHG 1XUFA 3W95A 1QA0A 4Z0KA 5FCRA 3EQ0H 2GP9B 1UVTH 2SGFE 2VWNA 3A82A 4WJG2 1QCPA 4J1YA 5EW2H 1GJ9B 1YM0A 1K1NA 1ZRKA 5F8ZA 1FDPA 1SI5H 1BRCE 2IN2A 2A32A 4D9RA 2GT8A 3A86A 4WMFA 3A87A 1DFPA 1SLXB 4FU7A 3DA9B 2C93B 3RXOA 2AMDA 1MKXH 2V0BA 5C1YA 1NFXA 2A4GA 4HI3A 1GBJA 1V2NT 2BY9X 6CHAC 1LHEH 1DUEA 4K8YA 4SGBE 1EXFA 1MUEB 4AGJA 2ZP0H 1ETRH 5EPNA 3F9GA 2ZCKP 1CSOE 1BJUA 1CA8B 1W12U 3LGYA 4K1EA 1SQAA 1SLVB 1RRKA 1T32A 2ZGHA 4FUHA 1GL0E 4VGCC 1WU1A 1IOEA 3IG6B 1OP2A 1VGCB 2YNBA 3PLKA 1PPCE 1YPEH 1GJBB 3ZVAA 4GLYA 2PW8H 1AIXH 2RDLA 2VIVA 3E90B 1BTUA 5FBIA 4KP0A 1LVMA 4AB8A 3A81A 5K0HA 1O2GH 4MTBA 3ZVGA 2BVRH 3U1JB 3SU0A 5LGOA 4YO9A 1L2EA 1QJ6B 3K9XB 3SUDA 1IQHA 4X1NU 2FODA 3V12A 5A2MH 1G30B 1CA0B 1C2IA 2FEQH 3LGUA 2NU4E 2OC7A 1QBOA 1ZRBA 3JZ2B 2R2MB 1GBFA 1TBZH 2ZKSA 4UONA 1WQSA 1EATA 3EA9A 1AY6H 2ALVA 2NU0E 4TPYA 2SGAA 1JWTA 1AZZA 1DM4B 1BZXE 1FQ3A 3E6PH 1O2UA 4YOGA 5CE1A 1N8OC 1VITG 2JETB 2FLRH 1PPZA 3PTNA 4DGJA 3RXKA 1O3FA 1Y3WA 1DSTA 4HTCH 3IWMA 2CJIA 4FUBA 1TE0A 1TQ7B 1TX6A 5HMAA 1KXEA 4GHTA 3FZDA 5TJXA 1ELEE 3VFEA 1B5GH 2J92A 4R0IA 3M7TA 1SLUB 4NSYA 3SI4H 1S6FA 1RTKA 4I8JA 1LDTT 2XCFA 3QN7A 3GCNA 2FXRA 3L33A 3ZVDA 2CHAB 2NU1E 2Q6GA 2ZIQH 1EPTA 1HAXB 1FY1A 1XXFA 4IMQA 2ZF0H 3D49H 3K6YA 2C8ZB 3HATH 3K6ZA 1HCGA 4E7RG 3SU3A 1VR1H 3BN9A 4B71A 3QK1A 1GG6B 4R8TB 3BG8A 1O2LA 1C2DA 2B0FA 2P3UB 1GCTC 1DXWA 1V2PT 1P06A 3PO1C 1V2KT 4BANB 1P2MA 3BTQE 4MPUA 2ZHWH 3BIUH 4ZXYH 3M61U 1DICA 8KME2 2PWXA 1A46H 1ZHPA 3MOCA 1PPEE 1FY5A 2VGCB 1CVWH 4QT8C 4B1TA 1JXPA 1YPKH 1OWEA 3PROA 2ZPSA 2ZU4A 1D3TB 1QBVH 4CBOA 2VNTA 1AUTC 1O2NA 4TPIZ 2ZU5A 1WUNH 5L2ZH 4I31A 1N1LA 4RSPA 1V2VT 1ARBA 1D6RA 1BCUH 2UUJB 2Q1JA 4FUJA 1W7GH 2ZTYA 4CH2B 1V2UT 3TLOA 3ATWA 4X6OA 4NA9H 5I25A 1ZSKA 1Y5UT 1GBMA 2TRMA 3UOPA 3OSYA 1AGJA 1SB1H 2QA9E 3BTTE 3RXGA 2STAE 1AQ7A 4UDWH 2G55A 1F0UA 3HK3B 1LPGB 6GCHF 1SFIA 1O3CA 5AF9H 2ZU3A 1ELTA 1UTKA 4VGCB 1CHOF 1ZMLA 1GJ4H 4K60A 4OS4A 2XC5A 4JZEH 3ZVFA 4DJZB 1P05A 1EJNA 1BT7A 1OX1A 4BAMB 2G81E 4FUDA 4ZKNU 4WF8A 2SNWA 2Y5FA 4ISNA 1SGYE 1BTWA 2F3CE 2GKVE 1YKTA 1O5EH 3KEEA 1C2HA 8LPRA 3QGJA 4NIWA 7LPRA 5DP5A 4JK5A 1MBQA 1NO9H 1T8NA 3L3TA 1DY8A 2Z94A 1MTNB 1DWEH 1N6XA 2BX4A 4IN2A 1ZMJA 1AI8H 3U8TH 4AGKA 4E05H 5DP8A 4A1TA 1D6WA 1BRBE 1K22H 2W3IA 3U69H 2RA3A 4X6PA 2WPIS 2HPPH 1XUHA 3ITIA 1TPOA 3UY9A 3DHKH 2XBWA 3TH2H 1GBHA 1HAZB 3QUMP 5ESTE 1H4WA 3A7ZA 3RXRA 3SV7A 1ESAA 3ENSB 1UVSH 1AWHB 3RU4E 4Y0YE 1O5GH 3HGPA 1O5DH 1O2HA 1ANBA 5K7RA 1DPOA 3SOSA 1GBAA 4NWLA 2ZHFH 2OBQA 1J17T 3DFLA 1MKXK 4FVDA 2GDDA 5JBAS 4FXGH 4MPVA 3VB5A 4MG3A 2VWMA 3RXDA 2A0QB 2LPRA 1OWHA 1V2MT 3AAUA 1UK4A 1KLTA 2P94A 5GDSH 2HPQH 1O3OA 4SGAE 3VGCB 4KTUA 1C1UH 4XDEA 1WCZA 2FOAA 1THRH 1OSSA 5SGAE 3LGIA 5F8TA 3C27B 4NA8A 1H8DH 3UPEA 4RN6A 2WPLS 1DX5M 4YOJA 6CHAB 3ZZDA 1ELDE 4DURA 1MZDA 1PFXC 3SQHE 3E0NB 3QTOH 1BOQA 1RTLA 2G8TA 4AYVB 4TWWA 3T25A 3SHAH 1FY4A 4BAKB 1MTUA 1U6QA 3GY7A 1UTNA 3M3TA 1TRYA 3E16B 4INLA 2PTCE 3KNXA 4Q80A 3A8AA 3QZRA 2ZFRH 4ZHLU 1EAWA 1K1OA 3SU1A 5JBCS 5DKMA 2BM2A 4LZ4B 4LZ1H 1H9HE 3PYHA 1VCQA 4FUIA 3GDVA 2VIOA 3MI4A 4BTTB 3RLWH 4IC6A 4NG9H 2BY6X 1O2TA 1G9IE 4CRGA 2QY0B 5GCHG 1SGNE 1C5MD 1E35B 1BHXB 1Q2WA 4HGCA 1EZQA 3KCGH 2IOTA 1GDUA 2BD2A 1UTQA 1SGFA 1O3MA 2VU8E 2P8OB 2Y80A 1C5WB 3MU1A 2UUYA 4AB9A 1TFXA 4UFGH 1HB0B 4H42U 3O8BA 1IQLA 1GI2A 2BLQA 2ZFFH 4LXBH 2PGBB 1P57B 4ISHH 5JDUB 2CV3A 3S69A 1C5PA 1FPHH 4O3TA 3ZYDA 1PQAA 4INHA 1E38B 4A6LA 4AFQA 4X1QU 1GMDG 1S82A 2BLWA 2GCHF 3TIUA 1DLEA 2G5VA 2H1UA 1SBWA 4CH8B 2RG3A 1OS8A 2Z9LA 4ZHAA 1BMNH 2PSXA 2Z9JA 2C8YB 3P8NA 1O3DA 3KN2A 5LPEA 1NZQH 4B73A 1ELGA 1SPJA 2BVSH 2AS9A 3IITA 2VVUA 3SNDA 2WPKS 3VB4A 2FOBA 3ZZ4A 2VVCA 2GGVB 3F9EA 1XKAC 1DWDH 1FLEE 3SV6A 1DS2E 1XUGA 3RP2A 1KXBA 4OS2A 1N6YA 3SUEA 4Y76A 1E34B 1SVPA 1ZTKA 3F68H 1O2XA 3SW2B 4INKA 4NIVA 4X1SU 1NTPA 3M5NA 4ABIA 2W26A 2R2WU 1BDAA 5E0JA 1S0QA 3M5OA 5EXNA 1QIXB 1O3HA 1V6DA 1D3QB 3TJVA 3A8DA 3URDA 1V3XA 1AFEH 3ZZAA 1MKWK 2F9PA 1EJMA 1SGDE 2M5TA 2ZDVH 1F5LA 4X2WA 1D3DB 3RMMH 4I8KA 3V3MA 3UQVA 1L1GA 2V6NA 1ETTH 1DVAH 1XUIA 3PMAB 4ZMAH 4BOHA 1C5OH 1SGIB 2CF9H 5AHGH 2QXJA 3UR6A 4I8LA 1LQDB 2B7DH 1K1IA 2WYJA 4DIIH 3NWUA 3ODFA 4GSOA 1O3JA 1TPSA 1P03A 3UIRA 3KGPA 4E06H 3TGJE 4UFEH 1C4U2 1S81A 1SC8U 2G51A 1DWBH 3MNXA 3CS7A 3SNCA 2O8MA 1P2KA 5PTPA 1TX7A 3VEQB 1C1SA 1GCDA 1JBUH 4DOQA 5F03A 1C5YB 4OS1A 2FI3E 1DWCH 2XC0A 4F49A 4AG2A 3SHCH 2HNTC 2O8WA 2C90B 4ISIH 2BD5A 3I78A 4OS7A 2FYRA 1BTXA 4FUEA 1QR3E 2XWBI 3LONA 3OX7U 2GCHG 3BG4C 3SGAE 1UCYK 2PKAB 2ODPA 3SV2H 1O37A 1SHYA 1O2VA 2A4OA 3M5LA 4YM9A 2J2UA 1F92A 3ZZ5A 3FZZA 3PLPA 2WPHS 1S84A 1WV7H 1ESBA 1ZLRA 2XRCA 4MNWA 2ANYA 3RUOA 4ABHA 1BBRE 2C4FH 1FJSA 1XVOA 5BPEA 3W94A 4ABAA 2CMYA 1GI8B 2KAIB 1YPHE 1MKWH 4RKOB 1MCVA 1Z8GA 3TK9A 1OP0A 2ZECA 2H9EH 3VB6A 4XBCA 3LC5A 1SR5C 5B6OA 1P3CA 3N7OA 1P9UA 1GJ5H 1EP6A 1HYLA 1KIGH 5DGJA 3U1IB 1EJAA 5EGMA 3KQDA 1MH0A 5LH8A 1VZQH 1B0FA 1CBWB 4O9VA 3B9FH 2FOHA 3SV9A 1VJAU 1FY8E 1HAPH 5GCHF 4U30A 2QC2A 1IQGA 2FI4E 4K5ZA 3LH3A 1O2YA 3LGVA 2ZFPH 4H6SB 1CGHA 2FZZA 5C2ZA 1NRNH 1GL1A 3GDUA 4YOIA 1HAYB 1GBLA 1O3LA 1KXFA 2I6SA 2PKAA 1ZSJA 2WPMS 3EE0B 1FN8A 5JBTA 2HVXA 3DD2H 1O5FH 3LOXA 3PWCA 1HAGE 1C1RA 1JRTA 4D8NA 5FPYA 4ASHA 1OYQA 1AVXA 3E91A 3UNSA 3S7HB 1FIWA 2OQ5A 4U32A 1P9SA 2AERH 3RXCA 1QQUA 3Q76A 3NKKA 2THFB 4YT6H 3GYMA 3P8OA 3AW0A 1O5CB 1SGFG 3MNSA 2CN0H 2HRVA 1IAUA 3V0XA 2HGTH 1J16A 2H5DA 5AFYH 1HPGA 3O8RA 3TGKE 3E3TA 2DE9A 1QGFA 2QGRA 4ZH8A 1GI4A 3EDXB 1TB6H 3GICB 4A7IB 2ZHEH 3LKWA 3LT3A 3UUZA 1O3AA 5L6NH 1P3EA 4B74A 2PR3A 4RKJB 3RXSA 1SHHB 3SI3H 3FP8E 1AFQB 1BITA 2A7JA 1AKSB 4YT7H 1GI3A 2ZCHP 1G2MA 3MO3A 2TGDA 1IQMA 2RA0A 3DFJA 4CR9A 1ZMNA 2FOFA 4WVPE 1W14U 3SN8A 4IW4E 1M9UA 1T31A 1C1VH 4X8VH 5FX5A 1AB9C 2EI7A 1E36B 1MAYA 3RXUA 1TNHA 2AFQB 1CGJE 2GZ7A 1CQQA 1EAIA 2A2QH 2TGTA 4KTCA 3SJ8A 2HALA 3FFGA 1CU1A 3STJA 3AASA 1AVGH 1O38A 1GBBA 3ZYEA 1Z8IB 1C5QA 5AFZH 1A2CH 1LHCH 2PSYA 1FAKH 1FAXA 3A84A 2A31A 2PFEA 3K65B 2KAIA 1AE8H 2ZHQH 1LHFH 4BTIB 3K2UA 3GY4A 1LHGH 5G4BA 3F1SB 2H5CA 5DP9A 4B76A 3SORA 4UE7H 1O3KA 4AYYB 4ESTE 1AUJA 1A4WH 2P93A 1G3BA 4H6TA 1CHOG 1F0RA 3TNTA 1DSUA 2BZ6H 4ABFA 2H6MA 1EASA 3LJOA 7GCHG 1TA6A 1L0ZA 2Z7FE 5C1XA 2ZFQH 4WMEA 1DY9A 1C5VA 3RXJA 1ELCA 2C8XB 3RMOH 1Z1JA 3KF2A 2QXGA 2ZI2H 4I7YH 2QXHA 4MQAA 4XBDA 1S5SA 1YCPK 2QF0A 3A89A 2GV7A 1O5AB 3E1XB 3KQCA 3OY6U 5TCAA 3UWIA 3QLPH 3U8RH 1QNJA 1GWAA 3FP6E 1EP5A 2AYWA 2PKSB 2VB0A 1HXEH 5DPAA 2ZU1A 3SNBA 1W0YH 1LMWB 1C5UA 1LCYA 5JPMH 2J95A 4K3JA 2CF8H 2P3FH 1HIAA 1W7XH 4B2AA 1FY3A 1AU8A 4X8UH 1G32B 2Z3CA 1S0RA 1GPZA 1UTLM 1A0LA 1KXAA 1T4VH 3EAJA 4U2WA 2F9BH 2V35A 3MU4A 1XVMA 5HYOA 2WYGA 1Y59T 1O2JA 3M37A 3QZQA 3ZVCA 2ZDNA 1QRWA 1C5TA 1GCTB 2OXSA 4JZIA 5HM2A 1O39A 1TNIA 4JYUH 3GY3A 2FS8A 2VIQA 1YBWA 2P3TB 1V2TT 4TY6A 1P04A 3BTDE 4X2VA 2FESH 4Y7AA 4WMDA 1PJPA 3A85A 5FAHA 5H4IB 1O2WA 2BHGA 3TU7H 1QHRB 3TJUA 4KKDA 1HAOH 1GI1A 3ZZ3A 2QF3A 2GV6A 3VPKA 1NRQH 3MU8A 1FN6A 4BAQB 1PPBH 3B8JA 1DDJA 2VWOA 3RC5A 4B2BA 2D1JA 3RDZA 5T6DA 1OWJA 5DJ7A 2ZGJA 1C2MA 2BLVA 1GJDB 2R0LA 5EODA 3DT0H 3ODDA 5T6FA 3UOUA 1TBRH 1GHZA 3BTFE 4YESB 2HWLB 1C2EA 3RM2H 1G3CA 4BNRA 1THSH 1XXDA 1YGCH 1BTHH 3MU0A 1NS3A 1O31A 2EA3A 5FPTA 3M3SA 4ZKOU 3KQBA 1V2ST 4NZQA 2OUAA 2ZEBA 1PQ5A 3F9FA 3MNCA 1AFQC 2BMGB 4BXSA 1AN1E 1VCPA 3PWBA 1SGRE 5FXLA 3LGTA 2ESTE 5J4QA 1YPLH 1EOJA 3TK6A 2G5NA 3M35A 4WH6A 1CBWC 1F0TA 3QO6A 4XBBA 3P92A 1Y5BT 3GY5A 1UHBA 2BQWB 4ISLA 4J2YB 1BIOA 2ZQ1A 6LPRA 7GCHF 3KL6A 1BTYA 2AIQA 5JB9S 2F91A 1Z8JB 4CHAC 1CT0E 1MD8A 1PYTC 3PTBA 2ZNKH 1CT4E 3ATMA 1OWDA 1A3EH 1O3PB 3H5CB 2A45B 1GHYH 5AVDA 4Y0ZE 2JH6D 1JIRA 1OXGA 3RXBA 3U9AH 3DUXH 1NY22 1EZSC 1YF4A 3A7WA 3SU6A 4JZDH 1JOUB 2B9LA 1BRUP 3RMNH 1A0JA 2C3SA 2BOKA 1AO5A 2GDEH 1HRTH 3P70B 4FU9A 2BQ6B 4NFEA 1J9CH 4ABBA 5JB8S 1GMCG 1VJ9U 2G4UA 2ODYB 1NFWA 1GI5A 3HKIB 3MO6A 1O2PA 1HFDA 1SGTA 1VITH 1O3EA 2ZGBH 1EB1H 3GYLB 1LVYA 1VGCC 2VINA 1AHTH 1K1MA 4UEHH 1GBEA 2BDHA 1H8IH 2FOGA 4AFUA 1BUIA 1A7SA 1QB9A 2O8UA 1WAYB 1K9OE 1DANH 5ESBA 4Q2KA 2BD3A 3PB1E 4Y71A 1EB2A 1PYTD 2GD4B 3ESTA 4X8SH 1PQ7A 1HAHH 4IBLH 1QBNA 2A2XH 4B2CA 1QTFA 2AEIH 4ZXXH 2B5TB 4NCYA 3TK5A 4AOQA 1F5KU 3RXMA 2GMTC 2ZU2A 1MAXA 1ZPBA 1QFKH 3RXTA 1OKXA 4ABEA 4I8HA 1ZZZA 1P11E 1EPTB 4X2XA 2TIOA 1TOCB 1C5RA 2PGQB 3RXLA 3S9AA 3RLYH 4K2YA 4HZHA 1LTOA 1W10U 4MNYA 3H7OA 3GY6A 3LC3A 4YLQH 1RGQA 1GGDB 3NUMA 8GCHF 1O32A 2R0KA 2ZHDA 1TPAE 2UWLA 2STBE 1K1JA 3A80A 3RM0H 1Y8TA 3T27A 1SGPE 3R0FA 4Q7XA 5DK1A 1O2IA 2GCTC 5HXFA 4UFFH 1FUJA 3BTEE 3RU4T 2OP9A 1IHTH 3UFAA 2SGDE 3P17H 2FOCA 2FP7B 1JRSA 3GY2A 1LVBA 1QURH 1LVOA 1GBCA 2BDYA 2NU2E 4NGAH 1ZGIA 3TJNA 3SU5A 2BZAA 1UVUH 2ZDKA 3PV4A 1A5HA 1ZJDA 2FO9A 1SOZA 3SBKA 2ZDLA 3GCTF 2BYAX 1INCA 1BTPA 1EZXC 1XMNB 5DG6A 1BA8B 1TABE 2G00A 3GCTG 1ANCA 4CRDA 2FTMA 1Y3VA 1OYTH 2F83A 1NESE 2Y5GA 3P6ZB 1BTZA 2PHBA 2ASUB 4D9QA 2Q6FA 3SU2A 1GMCF 1O3NA 1H9LB 1BQYA 1TONA 1AMHA 2BY8X 4XE4A 3SGBE 1HJ8A 3CENA 1SSXA 5EQSA 2SGEE 4JZFH 1D9IA 2A7HA 1THPB 1TGBA 1GDQA 5FBEA 2LNCA 1ORFA 3VGCC 3FVFB 2BVXH 2JKHA 3T26A 2UUFB 1GHAF 2D2DA 5FX6A 3LPRA 2BX3A 1RFNA 2W5EA 4CBNA 2P16A 1AVWA 4A1VA 5A0AE 3TGIE 1C1MA 1TNKA 1F2SE 2O9QA 5EXMA 1KY9A 3UNQA 1YCPM 3SJOA 1K28D 1TMBH 1O2ZA 3BTGE 4WXIA 5GJ4B 3CP7A 1P01A 1TPPA 1A5GH 2ZQ2A 2Z3DA 1TGTA 2OTVA 1DE7H 1G2LA 1ZGVA 2EEKA 3RC4A 3MH7A 3SGQE 1O2KA 1EUFA 5JBBS 1EQ9A 3PMBB 1P2QA 1EX3A 2BY7X 3P8FA 2HNTF 3ATKA 1HAVA 5C5NA 1MU8B 2ODQA 1AD8H 1UO6A 3HKJB 1LO6A 4WH8A 1NRPH 4WXVA 4CHAB 4MNVA 1EOLA 3BEIB 4X0WU 2GT7A 2J4IA 1NC6A 3LGWA 5EQQA 3EA8A 2VWLA 3RXPA 3A7XA 1V2WT 2ZGXH 2V3HH 1BBRK 4Y6DA 1GI6A 5JYIA 2ILNA 4ABJA 4D76A 1MZAA 1TQ0B 4U01A 1UCYH 4CREA 3SU4A 5CHAC 4JYTA 2XTTB 1NN6A 1YPMH 3MTYA 5A8YA 2PUXB 1MTWA 2XCNA 1O36A 3UQOA 5A8XA 1AKSA 1MTVA 3PLBA 5A0CA 4GHQA 5E2PA 1G37A 3V13A 1QRZA 2A1DB 1BHXF 4ZHMU 2BDAA 3VB7A 4O3UA 2A5KA 4MNXA 2FX6A 3PMHB 1EPTC 2PKSC 1W0ZU 4THNH 3ZV8A 2PLXA 2J38A 2ANKH 3RXHA 5DO4H 1ELFA 5FPSA 1TMTH 4AZ2B 4XFQA 1CO7E 1YCPH 4FUCA 2AMPA 3A7TA 3A8BA 3SUGA 3V7TA 3H7TA 1C5SA 5IDKA 2ZZUH 1TNJA 4ABGA 3P8GA 4X2YA 1B0EA 1GJ6A 1O2OA 2UWPA 1YPGH 1MTNC 3SZNA 5A0BA 1IQJA 2FLBH 2JH0D 1UTMA 2ANWA 3BTHE 1TA2A 5J4SA 4YTAA 2W7SA 3BTME 2GZ8A 1AZ8A 3ELAH 1ESTA 5GPIB 2DE8A 1PPHE 2SGQE 3HPTB 4Y8YA 3NPSA 1UTPA 1JIMA 1Q3XA 2UWOA 1C9TA 1O2QA 1ZTJA 2FOEA 2QCYA 2FX4A 3SV8A 3GCOA 1A3BH 1GBKA 3LJJA 9LPRA 2GVFA 4YLUA 1LKBA 3SNAA 1P2IA 2ZFTA 1BBRH 2AMQA 5FCKA 3MH6A 2XC4A 3Q3KA 4MVNA 1C5XB 4PROA 5I46H 4X1RU 4GVUA 4K1TA 1KDQB 6ESTA 5HGGA 3MO9A 3RXEA 2PUQH 4JZ1A 2ALPA 1ELAA 5HM9A 1YPHC 4IC5A 1NPMA 1C1WH 1W2KH 5A8ZA 3SJKA 1JMOH 1T7CA 2P8OC 2GX4A 5C20A 2FMJA 1C1PA 1QL8A 3U8OH 1Y3UA 1W8BH 3KHVA 2AIPA 2YOLA 2ZFSA 1HAIH 2JH5D 2A5IA 1NU7B 3FAOA 1P2NA 2BD8A 1OOKB 3RXIA 1FZZA 2JETC 1ZPCA 4WY3A 1GJ8B 4YZUA 2WUBA 1XUKA 4GCHG 1TLDA 1F0SA 2OD3B 5EOKA 4Y8XA 3VXFH 1O35A 1AWFH 2VH6A 2BTCE 3OTJE 3BV9B 3HGNA 2D8WA 4CRFA 1C5NH 1G36A 1UK2A 2QV1A 3ZZBA 1T8LA 1S85A 4MPWA 2BLOA 1OPHB 1MU6B 4Y11E 1TBQH 1TRMA 2WV5A 1TALA 1LQEA 1C2LA 4DY7B 4ABDA 5ETXA 4X6NA 4FU8A 2J9NA 3GY8A 2TPIZ 1D3PB 2Y82A 1FMGA 1GBIA 3E8LA 4IN1A 4DG4A 1F5RA 1GI0A 2F9VA 4UFDH 1C1TA 4GAWA 4DVAU 5CMXH 3BTWE 1K1PA 4K1SA 2FPZA 2GZ9A
chains in the Genus database with same CATH superfamily
3GCHC 1L4DA 4H4FA 3SO3A 1ACBE 2AGEX 3T62A 1O0DH 3L6PA 5IYTA 2W3KA 1L1JA 3MMGA 3S7KB 2VIWA 1BMAA 2CK3D 4CRCA 4CRBA 3UREA 2FWWA 3PO1B 3EYDA 3JZ1B 2OQUA 2QIQA 1MD7A 1MQ6A 4A92A 3T5FH 1HGTH 1SKYE 2F9OA 1QL9A 4KTSA 1F7ZA 2ZG0H 1IQEA 1YP9A 3MHWU 1J8AA 1ZHMA 2W7UA 1TIOA 3PM3A 2QN5T 2SGPE 4Z6AH 1GMHG 2FTLE 1BB0B 3Q77A 3EA7A 4OS6A 1B7XB 1Z6EA 3A88A 1OWIA 1TYNA 1KLJH 1DLKB 1Z71A 4OGYA 3KYGA 2AGIX 4KGAA 4FUGA 2BDGA 2A4RA 2FYQA 3RXVA 3T29A 1IQIA 1ZSLA 2QAAA 1GHVH 3F6UH 2Y7XA 4OGXA 2ZGCA 1RIWB 3Q3XA 2EI6A 2BDBA 2H2ZA 1GBTA 1ZOMA 1O34A 2ULLA 1UMAH 3BF6H 2OLGA 3C1KA 3WY8A 3O8CA 1WQVH 3GOVB 4Y7BA 1O3GA 2ZDAH 4KELA 5T6GA 3MH4A 4I32A 2UUKB 1HAVB 4GUXA 3O8DA 2ZCLP 4MPXA 4I33A 2QYIA 1P2OA 1W3CA 2NU3E 3CS0A 4O03A 3KIDU 1A0HB 1PQ8A 5C5OA 1QA7A 1YWUA 1Z1IA 2BQ7B 3NXPA 4M7GA 3Q3YA 3ATIA 1ZR0A 1C1NA 5E2OA 1WYKA 1EAUA 2VJ1A 1P8VC 3DCLA 5EW1H 1MMJN 4XRNA 1O5BB 2OC1A 4XSKU 2ANMH 2F43B 2A5AA 4D7FA 1KXDA 1Z6JH 1V2QT 4JK6A 5E0GA 1SLWB 4Q4LA 1FI8A 2F9NA 1UVPA 1BMMH 2IPHA 1T8OA 2QXIA 4AFZA 2Y6TA 1TWXB 2SNVA 5ABWA 5F8XA 2VVVA 5GWZA 1WTGH 2OBOA 4TY7A 1ZHRA 8ESTE 1FIZA 1HLTH 2Z9GA 4UD9H 3I77A 3M7UA 1D4PB 3UR9A 1LPKB 3R3GB 4X8TH 4IGDA 3ZZ8A 3TH3H 3AW1A 1NFUA 2KFWA 3SZEA 3BEFB 3G01A 3E0PB 3I29A 4Q7ZA 1KYNA 1NFYA 1XM1A 3OTPA 1C2FA 2VGCC 1TMUH 2R9PA 3NK8A 5E8EH 3QTVH 1S6LA 1O3BA 1H9IE 3VB3A 1O33A 1TRNA 2FM2A 3AVZA 1HNEE 4ISOA 1O2SA 2D26C 1V2RT 2BDIA 1Y3YA 4AN7A 3RC6A 1QJ7B 4ZKRU 3RXAA 1TAWA 2TGAA 2ZPRA 3ZVBA 2CXVA 2KCYA 3OY5U 4NSVA 4IS5A 3A7YA 1ZJKA 1GVKB 1K21H 4DT7B 2FOMB 1HJAC 3TH4H 2I6QA 1XKBC 2Z9IA 3M36A 3ZZ9A 5E0HA 1NBME 1VCWA 1MCTA 4A5TS 3UWJH 3A83A 1P2JA 1A5IA 1YPJH 3S0NA 1QJ1B 1H8HD 5T3HA 4Y8ZA 1RIWC 3GCHB 1G3EA 2BD7A 2GJGA 2B8OH 1KXCA 1QB6A 1SGEE 1V2OT 2O8LA 4ZUHA 1ZPZA 3MU5A 5EPYA 1SL3A 5LPRA 9ESTA 1A61H 1S6HA 2FS9A 5GIBA 5EXLA 1V2LT 5DP4A 1J14A 2HOBA 5B6LA 4XOJA 2VH0A 2BDCA 4DW2U 2G52A 5FL7D 4NFFA 2BXTH 2C8WB 2XBYA 4TSFD 4B75A 2HNTE 4ZKSU 3GISB 2OC8A 4TT3D 1HJ9A 1IQFA 4TYDA 1FV9A 1XX9A 1SG8B 1TOMH 1K1LA 3RXFA 2K1QA 1GVZA 1HXFH 2Z6BD 3KQEA 1ELVA 2VIPA 4GPGA 5EU8A 1GJAB 1LHDH 3NZIA 7KMEH 1QY6A 2A4QA 4Y79A 3Q00A 2KZ4A 2A7CA 3URCA 1KTTB 4ZAEA 1GJCB 2GTBA 1V2JT 3NCLA 2TGPZ 3QGNB 1KTSB 5EQRA 4AORA 4JYVH 1L1NA 1SFQB 3GDSA 1RTFB 4NA7A 4BAOB 1TGNA 5FHTA 4MLFB 4NWKA 3UTUH 3ZZ7A 1WSSH 2GMTB 1ZTLA 1LKAA 4FOUC 1GI9B 1C1QA 1UTOA 3A7VA 3N99A 1G3DA 1P12E 3B23B 5DP7A 3D65E 4I8GA 1GHBF 4NZLA 1UVOA 3QX5H 4AC9A 3TNSA 7ESTE 2P59A 5GXPA 3S9CA 2Y81A 2ZC9H 2RCEA 3UB0A 2XYAA 1RD3B 4ZROA 1ANEA 3DSGA 3T2NA 1LPZB 1QQ4A 3BG4B 1OHHD 3RXQA 1DUAA 3TVJB 1GGDC 1EKBB 3M7QA 4HFPB 1EZUC 5BRRE 2XXLA 1PPGE 1WOFA 1NRRH 4CRAA 5EJLA 4LOYH 1ABIH 1T4UH 1BJVA 1QRXA 2OCVB 4FUFA 1K2I1 5LPFA 1P10A 5EG4A 1HV7A 5TCCA 4BAHB 3ZVEA 2TBSA 4JCNA 1Z8RA 4E7NA 1O3IA 3RMLH 2Q6DA 2CGAA 1GHAG 1DOJA 2XBXA 3FOAA 3ATLA 4AFSA 3UNRA 5C17A 1P02A 2Z9KA 3DSOA 2FIRH 2PTNA 1HBTH 2OINA 5C1UA 1NT1A 1Z7KA 1EAXA 2J94A 5HKKD 1SMFE 2IJOB 2ZTZA 2NWNA 1DITH 4CR5A 1C4V2 4B6FA 3TPIZ 1GMHF 1WTHD 1UHBB 2ZTXA 1E0FD 1MBMA 1C5ZB 2OK5A 2P95A 3MNBA 1CGIE 3FANA 1GHBG 1DXPA 1X7AC 1BRAA 2GCTB 1PPFE 1ID5H 4LK4A 3STIA 3SJIA 3LU9B 3SQEE 2XNIA 4MDSA 1W11U 3M5MA 1KDQA 1GJ7B 3U98H 1TNGA 1CE5A 3TITA 1E37B 1KSNA 1TGSZ 1CA0C 1SQTA 1UJ1A 2PV9B 1AB9B 1GDNA 2J34A 1HIAB 1O30A 2AH4X 1RS0A 1MQ5A 2BOHB 2F9UA 1RXPA 3D23A 4TWYA 3SUFA 2Z3EA 1HJAB 1GVLA 1FXYA 2WPDD 1OWKA 1SGQE 4D7GA 2OC0A 2EI8A 4K69A 1QB1A 2XBVA 1SGCA 2ZWLH 1ETSH 1GI7B 2V3OH 1L4ZA 1Y3XA 1NRSH 3SNEA 1FNIA 3T28A 1RJXB 3QDZB 4F4OC 5C67A 1P09A 3AAVA 2JJ1D 1CT2E 2WINI 1QL7A 1IQKA 2J98B 1OP8A 1BMLA 1S83A 3RU4D 1A1RA 3QWCH 4AX9H 3PRBA 1VITF 1C4Y2 2WUCA 1ANDA 2LP6A 4GCHF 1C2GA 1H1BA 4K8BA 2WV4A 3D62A 4O97A 1DT2A 4Y10E 4A1XA 3LH1A 4BXWA 2XNDD 2CHAC 2YNAA 4X6MA 1YYY1 5CHAB 1IHSH 3ZZ6A 2O8TA 5KEDA 1T8MA 1HDTH 1ZYOA 3VXEH 1ARCA 2DUCA 1SOTA 2BY5X 1GMDF 1C1OA 1KLIH 2AGGX 3F9HA 5L30H 3N7DA 1TNLA 3MH5A 3OYPA 4BTUB 1GHXH 2VIDA 3BTKE 5C0UA 1UTJA 4Q7YA 2L74A 2W6ID 3BSQA 3SJ9A 4IMZA 3M3VA 1XUJA 1TX8A 1HUTH 4FVBA 3OU0A 1YLDA 1CHGA 1GG6C 1Q31A 3PV2A 3P95A 1YLCA 2Y5HA 3DSPA 3ZZCA 3PMJA 2R3YA 8GCHG 1GBDA 3MYWA 1ABJH 3UAIC 4JMYA 2AHME 5F6MA 1ELBA 2H9TH 3HK6B 1J15A 2R3UA 3LIWA 2Y7ZA 1Y5AT 1GHWH 3KQ5A 1UCYE 3BIVH 2HLCA 3MFJA 1MTSA 2ZO3H 2ZPQA 1C5LH 4X1PU 4DCDA 1NU9A 1EFRD 1C2KA 2H9HA 5DP3A 4F48B 2ZDMA 3A8CA 3LDXH 4WWYA 3FP7E 4ACAA 4DIHH 4NIXA 2BD9A 1UK3A 4XD7D 5L2YH 2BD4A 2BB4A 2SFAA 3S9BA 1FONA 2EC9H 1C9PA 1O2RA 1P0SH 2FI5E 5C3NA 3ZV9A 1N8OB 5A09A 1YY3A 1FPCH 2WPJS 4NIYA 1IQNA 1YC0A 4OS5A 1WBGB 3MWIU 3TJOA 1TGCA 2FDAA 2RDEA 1W13U 1AE5A 2XWAA 2G4TA 1C2JA 1NM6A 2ZA5A 5DP6A 4AG1A 2BXUH 1SQOA 3BEUA 3EGKH 1NROH 1O2MA 2KR7A 2XW9A 6GCHG 1XUFA 3W95A 1QA0A 4Z0KA 5FCRA 3EQ0H 2GP9B 1UVTH 2SGFE 2VWNA 3A82A 1MABB 4WJG2 1QCPA 4J1YA 5EW2H 1GJ9B 1YM0A 1K1NA 1ZRKA 5F8ZA 1FDPA 1SI5H 1BRCE 2IN2A 2A32A 4D9RA 3OAAD 2GT8A 3A86A 4WMFA 3A87A 1DFPA 1SLXB 4FU7A 3DA9B 2C93B 3RXOA 2AMDA 1MKXH 2V0BA 5C1YA 1NFXA 2A4GA 4HI3A 1GBJA 1V2NT 2BY9X 6CHAC 1LHEH 2KCPA 1DUEA 4K8YA 4SGBE 4FETA 1EXFA 1MUEB 4AGJA 2ZP0H 1ETRH 5EPNA 3F9GA 2ZCKP 1CSOE 1BJUA 1CA8B 1W12U 5F53A 2K8IA 2QF5A 3LGYA 1SQAA 4K1EA 1SLVB 1RRKA 1T32A 2ZGHA 4FUHA 1GL0E 4VGCC 1WU1A 1IOEA 3IG6B 1OP2A 3F2FA 1VGCB 2YNBA 3PLKA 1PPCE 1YPEH 1GJBB 3ZVAA 4GLYA 2PW8H 1AIXH 2RDLA 2VIVA 3E90B 3W1EA 1BTUA 5FBIA 4KP0A 1LVMA 4AB8A 3A81A 5K0HA 1O2GH 4MTBA 3ZVGA 2BVRH 3U1JB 3SU0A 5LGOA 4YO9A 1L2EA 1QJ6B 3K9XB 3SUDA 1IQHA 4X1NU 2FODA 3V12A 5A2MH 1G30B 1CA0B 1C2IA 2FEQH 3LGUA 2NU4E 2OC7A 1QBOA 1ZRBA 3JZ2B 2R2MB 1GBFA 1TBZH 2ZKSA 4UONA 1WQSA 1EATA 3EA9A 1AY6H 2ALVA 2NU0E 4TPYA 2HLDD 2SGAA 1JWTA 1AZZA 1DM4B 1BZXE 1FQ3A 3E6PH 1O2UA 4YOGA 5CE1A 1N8OC 1VITG 2JETB 2FLRH 1PPZA 3PTNA 4DGJA 3RXKA 1O3FA 1Y3WA 1DSTA 4HTCH 3IWMA 2CJIA 4FUBA 1TE0A 1TQ7B 1TX6A 5HMAA 1KXEA 4DT4A 4GHTA 3FZDA 5TJXA 1ELEE 3VFEA 1YLNA 1B5GH 2J92A 4R0IA 3M7TA 1SLUB 4NSYA 3SI4H 1S6FA 1RTKA 4I8JA 1LDTT 3FKSD 2XCFA 3QN7A 3GCNA 2FXRA 3L33A 3ZVDA 2CHAB 2NU1E 2Q6GA 2ZIQH 1EPTA 1HAXB 1FY1A 1XXFA 4IMQA 2ZF0H 3D49H 3K6YA 2C8ZB 3HATH 3H09A 3K6ZA 1HCGA 4E7RG 3SU3A 1VR1H 3BN9A 4B71A 3QK1A 1GG6B 4R8TB 3BG8A 1O2LA 1C2DA 2B0FA 2P3UB 1GCTC 1DXWA 1V2PT 1P06A 3PO1C 1V2KT 4BANB 2YMSD 1P2MA 3BTQE 4MPUA 2ZHWH 3BIUH 4ZXYH 4YXWD 3M61U 1DICA 8KME2 2PWXA 1A46H 1ZHPA 3MOCA 1PPEE 1FY5A 3OE7D 2VGCB 1CVWH 4QT8C 4B1TA 1JXPA 1YPKH 1OWEA 3PROA 2ZPSA 2ZU4A 1D3TB 1QBVH 4CBOA 2VNTA 1AUTC 1O2NA 4TPIZ 2ZU5A 1WUNH 5L2ZH 4I31A 4B6EA 1N1LA 4RSPA 1V2VT 1ARBA 1D6RA 1BCUH 2UUJB 2Q1JA 4FUJA 2WZQA 1W7GH 2ZTYA 4CH2B 1V2UT 3TLOA 3ATWA 4X6OA 4NA9H 5I25A 1ZSKA 1Y5UT 1GBMA 4P02A 5EJ1A 2TRMA 3UOPA 3OSYA 1AGJA 1SB1H 2QA9E 3BTTE 3RXGA 2STAE 1AQ7A 4UDWH 2G55A 1F0UA 3HK3B 1LPGB 6GCHF 1SFIA 1O3CA 5AF9H 2ZU3A 1ELTA 1UTKA 4VGCB 1CHOF 1ZMLA 1GJ4H 4K60A 4OS4A 2XC5A 4JZEH 3ZVFA 4DJZB 1P05A 1EJNA 1BT7A 1OX1A 4BAMB 2G81E 4FUDA 4ZKNU 4WF8A 2SNWA 2Y5FA 4ISNA 1SGYE 1BTWA 2F3CE 2GKVE 1YKTA 1O5EH 3AK5A 3KEEA 1C2HA 8LPRA 3SYJA 3QGJA 4NIWA 7LPRA 5DP5A 4JK5A 1MBQA 1NO9H 1T8NA 3L3TA 1DY8A 2Z94A 1MTNB 2YMSB 1DWEH 1N6XA 2BX4A 4IN2A 1ZMJA 1AI8H 3U8TH 4AGKA 4E05H 5DP8A 4A1TA 1D6WA 1BRBE 1K22H 2W3IA 3U69H 2RA3A 4X6PA 2WPIS 2HPPH 1XUHA 3ITIA 1TPOA 3UY9A 3DHKH 2XBWA 3TH2H 1GBHA 1HAZB 3QUMP 5ESTE 1H4WA 3A7ZA 3RXRA 3SV7A 1ESAA 3ENSB 1UVSH 1AWHB 3RU4E 4Y0YE 1O5GH 3HGPA 1O5DH 1NBMD 1O2HA 1ANBA 5K7RA 1DPOA 3SOSA 1GBAA 4NWLA 2ZHFH 2OBQA 1J17T 3FN8A 3DFLA 3F0OA 1MKXK 4FVDA 2GDDA 5JBAS 4FXGH 4MPVA 3VB5A 4MG3A 2VWMA 3RXDA 2A0QB 2LPRA 1OWHA 1V2MT 3AAUA 1UK4A 1KLTA 2P94A 5GDSH 2HPQH 1O3OA 4SGAE 3VGCB 4KTUA 1C1UH 4XDEA 1WCZA 2FOAA 1THRH 1OSSA 5SGAE 3LGIA 5F8TA 3C27B 4NA8A 1H8DH 3UPEA 4RN6A 2WPLS 1DX5M 4YOJA 6CHAB 3ZZDA 1ELDE 4DURA 1MZDA 1PFXC 3SQHE 3E0NB 3QTOH 1BOQA 1RTLA 3FO8D 2G8TA 2IJD1 4AYVB 4TWWA 3T25A 3SHAH 1FY4A 4BAKB 1MTUA 1U6QA 3GY7A 1UTNA 3M3TA 1TRYA 3E16B 4INLA 2PTCE 3KNXA 4Q80A 3A8AA 3QZRA 2ZFRH 4ZHLU 1EAWA 1K1OA 3SU1A 5JBCS 5DKMA 2BM2A 4LZ4B 4LZ1H 1H9HE 3PYHA 1VCQA 4FUIA 3GDVA 2VIOA 3MI4A 4BTTB 3RLWH 4M9FA 4IC6A 4NG9H 2BY6X 1O2TA 1G9IE 4CRGA 2QY0B 3KYFA 5GCHG 1SGNE 1C5MD 1E35B 1BHXB 1Q2WA 2PP6A 4HGCA 1EZQA 3KCGH 2IOTA 1GDUA 2BD2A 1UTQA 1SGFA 1O3MA 2VU8E 2P8OB 2Y80A 1C5WB 4P00A 3MU1A 2UUYA 4AB9A 1TFXA 4UFGH 1HB0B 4H42U 3O8BA 1IQLA 1GI2A 2BLQA 2ZFFH 4LXBH 2PGBB 1P57B 4ISHH 5JDUB 2CV3A 3S69A 1C5PA 1FPHH 1KMHB 4O3TA 3ZYDA 1PQAA 4INHA 1E38B 4A6LA 4AFQA 4X1QU 1GMDG 1S82A 2BLWA 2JIZD 2GCHF 3TIUA 1DLEA 2G5VA 2H1UA 1SBWA 4CH8B 2RG3A 1OS8A 2Z9LA 4ZHAA 1BMNH 2PSXA 2Z9JA 2C8YB 3P8NA 1O3DA 3KN2A 5LPEA 1NZQH 4B73A 1ELGA 1FX0B 1SPJA 2BVSH 2AS9A 4Z1MD 3IITA 2VVUA 3SNDA 2WPKS 3VB4A 2FOBA 3ZZ4A 2VVCA 2GGVB 3F9EA 1XKAC 1DWDH 1FLEE 3SV6A 1DS2E 1XUGA 3RP2A 1KXBA 4OS2A 1N6YA 3SUEA 4Y76A 1E34B 4ZCNA 1SVPA 1ZTKA 3F68H 1O2XA 3SW2B 4INKA 4NIVA 4X1SU 1NTPA 2IPQX 3M5NA 4ABIA 2V7QD 2R2WU 1BDAA 2W26A 1S0QA 5E0JA 3M5OA 5EXNA 1QIXB 1O3HA 1V6DA 1D3QB 3TJVA 3A8DA 3U28C 3URDA 1V3XA 1AFEH 3ZZAA 1MKWK 2F9PA 4HG6A 2EY4C 1EJMA 3OEHD 1SGDE 2M5TA 2ZDVH 1F5LA 4X2WA 1D3DB 3RMMH 4I8KA 3V3MA 3UQVA 1L1GA 2V6NA 1ETTH 1DVAH 1XUIA 3PMAB 4ZMAH 4BOHA 1C5OH 1SGIB 2CF9H 5AHGH 2QXJA 3UR6A 4I8LA 1LQDB 2B7DH 1K1IA 2WYJA 4DIIH 1COWD 3NWUA 3ODFA 4GSOA 1O3JA 1TPSA 1P03A 3UIRA 3KGPA 4E06H 3TGJE 4UFEH 1C4U2 1S81A 1SC8U 2G51A 1DWBH 3MNXA 3CS7A 3SNCA 2O8MA 1P2KA 4RT1A 5PTPA 1TX7A 3VEQB 1H8ED 4I86A 1C1SA 1GCDA 1JBUH 4DOQA 5F03A 1C5YB 4OS1A 2FI3E 1DWCH 2XC0A 4F49A 4AG2A 3SHCH 2HNTC 2O8WA 2C90B 4ISIH 2BD5A 4RT0A 3I78A 4OS7A 2FYRA 1BTXA 4FUEA 1QR3E 2XWBI 3LONA 3OX7U 2GCHG 3BG4C 3SGAE 1UCYK 2PKAB 2ODPA 3SV2H 1O37A 1SHYA 1O2VA 2A4OA 3M5LA 4YM9A 2J2UA 1F92A 3ZZ5A 3FZZA 3PLPA 1S84A 2WPHS 1WV7H 1ESBA 1ZLRA 2XRCA 4MNWA 2ANYA 3RUOA 1WDIA 1BBRE 2C4FH 1FJSA 4ABHA 1XVOA 5BPEA 3W94A 4ABAA 2CMYA 1GI8B 3OFND 2KAIB 1YPHE 1MKWH 4RKOB 1MCVA 1Z8GA 3TK9A 1OP0A 2ZECA 2H9EH 3VB6A 4XBCA 3LC5A 1SR5C 5B6OA 1P3CA 3N7OA 1P9UA 1GJ5H 1EP6A 1HYLA 1KIGH 5DGJA 3U1IB 1EJAA 2WV9A 5EGMA 3KQDA 1MH0A 5LH8A 1VZQH 1SQRA 1B0FA 1CBWB 4O9VA 5EJZA 3B9FH 2FOHA 3SV9A 1VJAU 1FY8E 1HAPH 3OEED 5GCHF 4U30A 2QC2A 1IQGA 2FI4E 4K5ZA 3LH3A 1O2YA 3LGVA 2ZFPH 4H6SB 1CGHA 2FZZA 5C2ZA 1NRNH 1GL1A 3GDUA 4YOIA 1HAYB 1GBLA 1O3LA 2M2AA 3EE7A 1KXFA 2I6SA 1K0HA 2PKAA 1ZSJA 2WPMS 3EE0B 1FN8A 5JBTA 2HVXA 3DD2H 1O5FH 3LOXA 3PWCA 1HAGE 1C1RA 1JRTA 3MQKC 4D8NA 5FPYA 4ASHA 1OYQA 1AVXA 3E91A 3UNSA 3S7HB 1FIWA 2OQ5A 4U32A 1P9SA 2AERH 3RXCA 1QQUA 3Q76A 2JDID 3NKKA 2THFB 4YT6H 2KCOA 3GYMA 3P8OA 3AW0A 1O5CB 1SGFG 3MNSA 2CN0H 2HRVA 1IAUA 3V0XA 2HGTH 1J16A 5KECA 2H5DA 5AFYH 1HPGA 3O8RA 3TGKE 3E3TA 2DE9A 1QGFA 2QGRA 4ZH8A 1GI4A 3EDXB 1TB6H 3GICB 4Q63A 4A7IB 2ZHEH 3LKWA 3LT3A 3UUZA 1O3AA 5L6NH 1P3EA 4B74A 2PR3A 4RKJB 3RXSA 2WSSD 1SHHB 3SI3H 3FP8E 1AFQB 1BITA 2A7JA 1AKSB 4YT7H 2W6JD 1GI3A 2ZCHP 1G2MA 3MO3A 2TGDA 1IQMA 2RA0A 3DFJA 5EIYA 4CR9A 1ZMNA 2FOFA 3NRLA 1W14U 4WVPE 3SN8A 4IW4E 1M9UA 1T31A 1C1VH 4X8VH 3PRDA 5FX5A 1AB9C 2EI7A 1E36B 1MAYA 3RXUA 3WWFA 1TNHA 2AFQB 1CGJE 2GZ7A 2K0QA 1CQQA 1EAIA 2A2QH 2TGTA 4KTCA 3SJ8A 2HALA 3FFGA 1CU1A 3STJA 3AASA 1AVGH 1O38A 1GBBA 3ZYEA 1Z8IB 1C5QA 5AFZH 1A2CH 1LHCH 2PSYA 1FAKH 1FAXA 3A84A 2A31A 2KCAA 2PFEA 3K65B 2KAIA 1AE8H 2ZHQH 1LHFH 4BTIB 3K2UA 3F2HA 3GY4A 1LHGH 5G4BA 3F1SB 2H5CA 5DP9A 4B76A 3SORA 4UE7H 1O3KA 4AYYB 4ESTE 1AUJA 1A4WH 2P93A 1G3BA 4H6TA 3WWBA 1CHOG 1F0RA 3TNTA 1DSUA 2BZ6H 4ABFA 2H6MA 1EASA 3LJOA 1WXRA 7GCHG 1TA6A 1L0ZA 2Z7FE 5C1XA 2ZFQH 4WMEA 1DY9A 1C5VA 3RXJA 1ELCA 2C8XB 3RMOH 1Z1JA 3KF2A 2QXGA 2ZI2H 3CNRA 4I7YH 2QXHA 4MQAA 4XBDA 1S5SA 1YCPK 2QF0A 3A89A 2GV7A 1O5AB 3E1XB 1W0KD 3KQCA 3OY6U 5TCAA 3UWIA 3QLPH 3U8RH 1QNJA 1GWAA 3FP6E 1EP5A 2AYWA 2PKSB 2VB0A 1HXEH 5DPAA 2ZU1A 3SNBA 1W0YH 1LMWB 1C5UA 1LCYA 5JPMH 2J95A 4K3JA 2CF8H 2P3FH 1HIAA 1W7XH 4B2AA 1FY3A 1AU8A 4X8UH 1G32B 2Z3CA 1S0RA 1GPZA 1UTLM 1A0LA 1KXAA 1T4VH 3EAJA 4U2WA 2F9BH 2V35A 3MU4A 5CHBA 1XVMA 5HYOA 1Y59T 2WYGA 2EQNA 1O2JA 3M37A 3QZQA 3ZVCA 2ZDNA 1QRWA 1C5TA 1GCTB 2OXSA 4JZIA 5HM2A 1O39A 1TNIA 4JYUH 3GY3A 2FS8A 2VIQA 1YBWA 2P3TB 2J98A 1V2TT 4TY6A 1P04A 3BTDE 4X2VA 1E1QD 2FESH 4Y7AA 4WMDA 1PJPA 3A85A 5FAHA 5H4IB 1O2WA 2BHGA 3TU7H 1QHRB 3TJUA 4KKDA 1HAOH 1GI1A 3ZZ3A 2QF3A 2GV6A 3VPKA 1NRQH 2XOKD 3MU8A 1FN6A 3N7EA 4BAQB 1PPBH 3B8JA 2KM0A 1DDJA 2VWOA 3RC5A 4B2BA 2D1JA 3RDZA 5T6DA 1OWJA 5DJ7A 2ZGJA 1C2MA 2BLVA 1GJDB 2R0LA 1E1RD 5EODA 3DT0H 3ODDA 5T6FA 3UOUA 1TBRH 1GHZA 3BTFE 4YESB 2HWLB 1C2EA 5HIYA 3RM2H 1G3CA 4BNRA 1THSH 1XXDA 1YGCH 1BTHH 3MU0A 1NS3A 1O31A 2EA3A 5FPTA 3M3SA 4ZKOU 3KQBA 1V2ST 4NZQA 2OUAA 2ZEBA 1PQ5A 3F9FA 3MNCA 1AFQC 2BMGB 4BXSA 1AN1E 1VCPA 3PWBA 1SGRE 5FXLA 3LGTA 2ESTE 5J4QA 1YPLH 1EOJA 3TK6A 2G5NA 3M35A 4WH6A 1CBWC 1F0TA 3QO6A 4XBBA 3P92A 1Y5BT 3GY5A 1BMFD 1UHBA 2BQWB 4ISLA 4J2YB 1BIOA 2ZQ1A 6LPRA 7GCHF 3KL6A 1BTYA 2WHXA 2AIQA 5JB9S 2F91A 1Z8JB 4CHAC 1CT0E 1MD8A 1PYTC 3PTBA 2ZNKH 1CT4E 3ATMA 1OWDA 3F3BA 1A3EH 1O3PB 3H5CB 2A45B 1GHYH 5AVDA 2LELA 4Y0ZE 2JH6D 1JIRA 1OXGA 3RXBA 3U9AH 3DUXH 1NY22 1EZSC 1YF4A 3A7WA 3SU6A 4JZDH 1JOUB 2B9LA 1BRUP 3RMNH 1A0JA 2C3SA 2BOKA 1AO5A 2GDEH 1HRTH 3P70B 4FU9A 5IK2D 2BQ6B 4NFEA 1J9CH 4ABBA 5JB8S 1GMCG 1VJ9U 2G4UA 2ODYB 1NFWA 2JJ2D 1GI5A 3HKIB 3MO6A 1O2PA 1HFDA 1SGTA 1VITH 1O3EA 2ZGBH 1EB1H 3GYLB 1LVYA 1VGCC 2VINA 1AHTH 1K1MA 4UEHH 1GBEA 2BDHA 1H8IH 2FOGA 4AFUA 1BUIA 1A7SA 1QB9A 2O8UA 1W0JD 1WAYB 1K9OE 1DANH 5ESBA 1E79D 4Q2KA 2L6OA 2BD3A 3PB1E 4Y71A 1EB2A 1PYTD 2GD4B 3ESTA 4X8SH 1PQ7A 1HAHH 4IBLH 1QBNA 2A2XH 4B2CA 1QTFA 2AEIH 4ZXXH 2B5TB 4NCYA 3TK5A 4AOQA 1F5KU 3RXMA 2GMTC 2ZU2A 1MAXA 1ZPBA 1QFKH 3RXTA 1OKXA 4ABEA 4I8HA 1ZZZA 1P11E 1EPTB 4X2XA 2TIOA 1TOCB 1C5RA 2PGQB 3RXLA 3S9AA 3RLYH 4K2YA 4HZHA 1LTOA 1W10U 4MNYA 3H7OA 3GY6A 3LC3A 4YLQH 1RGQA 1GGDB 3NUMA 8GCHF 1O32A 2R0KA 2ZHDA 1TPAE 2UWLA 2STBE 1K1JA 3A80A 3RM0H 1Y8TA 3T27A 1SGPE 3WW7A 3R0FA 4Q7XA 5DK1A 5HIZA 1O2IA 2GCTC 5HXFA 4UFFH 1FUJA 3BTEE 3RU4T 2OP9A 1IHTH 3UFAA 2SGDE 3P17H 2FOCA 2FP7B 1JRSA 3GY2A 1LVBA 1QURH 1LVOA 1GBCA 2BDYA 2NU2E 4NGAH 1ZGIA 3TJNA 3SU5A 2BZAA 1UVUH 2ZDKA 3PV4A 1A5HA 1ZJDA 2FO9A 1SOZA 3SBKA 2ZDLA 3GCTF 2BYAX 1INCA 5C94A 1BTPA 1EZXC 1XMNB 5DG6A 1BA8B 2KX4A 1TABE 2G00A 3GCTG 1ANCA 4CRDA 2FTMA 1Y3VA 1OYTH 2F83A 1NESE 2Y5GA 3P6ZB 1BTZA 2PHBA 2ASUB 4D9QA 2Q6FA 3SU2A 1GMCF 1O3NA 1H9LB 1BQYA 1TONA 1AMHA 2BY8X 4XE4A 4F55A 3SGBE 5DN6D 1HJ8A 3CENA 1SSXA 5EQSA 2SGEE 4JZFH 1D9IA 2A7HA 1THPB 2QE7D 1TGBA 1GDQA 5FBEA 4ASUD 2LNCA 1ORFA 3VGCC 3FVFB 2BVXH 2JKHA 3ZIAD 3T26A 2UUFB 1GHAF 2D2DA 5FX6A 3LPRA 2BX3A 1RFNA 2W5EA 4CBNA 2P16A 1AVWA 4A1VA 2RFKC 5A0AE 3TGIE 1C1MA 1TNKA 1F2SE 2O9QA 5EXMA 1KY9A 3UNQA 1YCPM 3SJOA 1K28D 1TMBH 1O2ZA 3BTGE 4WXIA 5GJ4B 3CP7A 1P01A 1TPPA 1A5GH 2ZQ2A 2Z3DA 5C0TA 1TGTA 2OTVA 1DE7H 1G2LA 1ZGVA 2EEKA 3RC4A 3MH7A 3SGQE 1O2KA 1EUFA 5JBBS 1EQ9A 5CDFE 3PMBB 1P2QA 1EX3A 2BY7X 3P8FA 2HNTF 3ATKA 1HAVA 5C5NA 1MU8B 2ODQA 1AD8H 1UO6A 3HKJB 1LO6A 4WH8A 1NRPH 4WXVA 4CHAB 4MNVA 1EOLA 2YMSC 3BEIB 4X0WU 2GT7A 2J4IA 1NC6A 3LGWA 3PV5A 3EA8A 5EQQA 2VWLA 3RXPA 3A7XA 1V2WT 2VBCA 2ZGXH 2V3HH 1BBRK 4Y6DA 1GI6A 5JYIA 2J97A 1QZ8A 2ILNA 4ABJA 4D76A 1MZAA 1TQ0B 4U01A 1UCYH 4CREA 3SU4A 5CHAC 4JYTA 1NN6A 2XTTB 1YPMH 3MTYA 5A8YA 2PUXB 1MTWA 2XCNA 1O36A 3UQOA 5A8XA 1AKSA 1MTVA 3PLBA 5A0CA 4GHQA 5E2PA 1G37A 3F2GA 2V3MA 3V13A 1QRZA 2A1DB 1BHXF 4ZHMU 2BDAA 3VB7A 4O3UA 2A5KA 4MNXA 2FX6A 3PMHB 1EPTC 2PKSC 1W0ZU 4THNH 3ZV8A 2PLXA 2J38A 2ANKH 3RXHA 5DO4H 1ELFA 5FPSA 1TMTH 4AZ2B 4XFQA 4OM9A 1CO7E 1YCPH 4FUCA 2AMPA 3A7TA 3A8BA 3SUGA 3V7TA 5GNDA 3H7TA 1C5SA 5IDKA 2ZZUH 3VG8A 1TNJA 4ABGA 3P8GA 4X2YA 1B0EA 1GJ6A 1O2OA 2UWPA 1YPGH 1MTNC 3SZNA 5A0BA 1IQJA 2FLBH 2JH0D 5DSFA 1UTMA 2ANWA 3BTHE 1TA2A 5J4SA 4YTAA 2W7SA 3BTME 2GZ8A 1AZ8A 3ELAH 1ESTA 5GPIB 2DE8A 1PPHE 2SGQE 3HPTB 4Y8YA 4RI0A 3NPSA 1UTPA 1JIMA 1Q3XA 2UWOA 1C9TA 1O2QA 1ZTJA 2FOEA 2QCYA 2FX4A 3SV8A 3GCOA 1A3BH 1GBKA 2QF4A 3LJJA 9LPRA 2GVFA 2J5UA 3GS9A 4YLUA 1LKBA 3SNAA 5T1VA 1P2IA 2ZFTA 1BBRH 2AMQA 5FCKA 3MH6A 3F0PA 2XC4A 3Q3KA 4MVNA 1C5XB 4PROA 5I46H 4X1RU 4GVUA 4K1TA 1KDQB 6ESTA 5HGGA 3MO9A 3RXEA 2PUQH 4JZ1A 2ALPA 1ELAA 5HM9A 1YPHC 4IC5A 4ACBA 1NPMA 1C1WH 1W2KH 1UW7A 5A8ZA 3SJKA 1JMOH 1T7CA 2P8OC 2GX4A 5C20A 2FMJA 1C1PA 1QL8A 3U8OH 1Y3UA 1W8BH 3KHVA 2AIPA 2YOLA 2ZFSA 1HAIH 2JH5D 2A5IA 1NU7B 3FAOA 1VKYA 1P2NA 2BD8A 1OOKB 3RXIA 1FZZA 2JETC 1ZPCA 4WY3A 1GJ8B 4YZUA 2WUBA 1XUKA 4GCHG 1TLDA 1F0SA 2OD3B 5EOKA 4Y8XA 5KGOA 2F4LA 3VXFH 1O35A 1AWFH 2VH6A 2BTCE 3OTJE 3BV9B 3HGNA 2D8WA 4CRFA 1C5NH 1G36A 1UK2A 2QV1A 3ZZBA 1T8LA 1S85A 4MPWA 2BLOA 1OPHB 1MU6B 4Y11E 1TBQH 1TRMA 2WV5A 1TALA 1LQEA 1C2LA 4DY7B 2HVYB 4ABDA 5ETXA 4X6NA 4FU8A 2J9NA 3GY8A 2TPIZ 1D3PB 2Y82A 1FMGA 1GBIA 3E8LA 4IN1A 4DG4A 1F5RA 1GI0A 2F9VA 4UFDH 1C1TA 4GAWA 4DVAU 5CMXH 3BTWE 1K1PA 4K1SA 2FPZA 2GZ9A
chains in the Genus database with same CATH topology
3GCHC 1L4DA 4H4FA 3SO3A 1ACBE 2AGEX 3T62A 1O0DH 3L6PA 5IYTA 2W3KA 1L1JA 3MMGA 3S7KB 2VIWA 1BMAA 4CRCA 4CRBA 3UREA 2FWWA 3PO1B 3EYDA 3JZ1B 2OQUA 2QIQA 1MD7A 1MQ6A 4A92A 3T5FH 1HGTH 2F9OA 1QL9A 4KTSA 1F7ZA 2ZG0H 1IQEA 1YP9A 3MHWU 1J8AA 1ZHMA 2W7UA 1TIOA 3PM3A 2QN5T 2SGPE 4Z6AH 1GMHG 2FTLE 1BB0B 3Q77A 3EA7A 4OS6A 1B7XB 1Z6EA 3A88A 1OWIA 1TYNA 1KLJH 1DLKB 1Z71A 4OGYA 4KGAA 2AGIX 4FUGA 2BDGA 2A4RA 2FYQA 3RXVA 3T29A 1IQIA 1ZSLA 2QAAA 1GHVH 3F6UH 2Y7XA 4OGXA 2ZGCA 1RIWB 3Q3XA 2EI6A 2BDBA 2H2ZA 1GBTA 1ZOMA 1O34A 2ULLA 1UMAH 3BF6H 2OLGA 3C1KA 3WY8A 3O8CA 1WQVH 3GOVB 4Y7BA 1O3GA 2ZDAH 4KELA 5T6GA 3MH4A 4I32A 2UUKB 1HAVB 4GUXA 3O8DA 2ZCLP 4MPXA 4I33A 2QYIA 1P2OA 1W3CA 2NU3E 3CS0A 4O03A 3KIDU 1A0HB 1PQ8A 5C5OA 1QA7A 1Z1IA 2BQ7B 3NXPA 4M7GA 3Q3YA 3ATIA 1ZR0A 1C1NA 5E2OA 1WYKA 1EAUA 2VJ1A 1P8VC 5EW1H 1MMJN 1O5BB 2OC1A 4XSKU 2ANMH 2A5AA 4D7FA 1KXDA 1Z6JH 1V2QT 4JK6A 5E0GA 1SLWB 1FI8A 2F9NA 1UVPA 1BMMH 2IPHA 1T8OA 2QXIA 4AFZA 2Y6TA 1TWXB 2SNVA 5ABWA 5F8XA 2VVVA 5GWZA 1WTGH 2OBOA 4TY7A 1ZHRA 8ESTE 1FIZA 1HLTH 2Z9GA 4UD9H 3I77A 3M7UA 1D4PB 3UR9A 1LPKB 3R3GB 4X8TH 4IGDA 3ZZ8A 3TH3H 3AW1A 1NFUA 3BEFB 3G01A 3E0PB 3I29A 4Q7ZA 1KYNA 1NFYA 1XM1A 1C2FA 2VGCC 1TMUH 2R9PA 3NK8A 5E8EH 3QTVH 1O3BA 1H9IE 3VB3A 1O33A 1TRNA 2FM2A 3AVZA 1HNEE 4ISOA 1O2SA 2D26C 1V2RT 2BDIA 1Y3YA 4AN7A 3RC6A 1QJ7B 4ZKRU 3RXAA 1TAWA 2TGAA 2ZPRA 3ZVBA 2CXVA 3OY5U 4NSVA 4IS5A 3A7YA 1ZJKA 1GVKB 1K21H 4DT7B 2FOMB 1HJAC 3TH4H 2I6QA 1XKBC 2Z9IA 3M36A 3ZZ9A 5E0HA 1VCWA 1MCTA 4A5TS 3UWJH 3A83A 1P2JA 1A5IA 1YPJH 3S0NA 1QJ1B 5T3HA 4Y8ZA 1RIWC 3GCHB 1G3EA 2BD7A 2B8OH 1KXCA 1QB6A 1SGEE 1V2OT 2O8LA 4ZUHA 1ZPZA 3MU5A 5EPYA 1SL3A 5LPRA 9ESTA 1A61H 1S6HA 2FS9A 5GIBA 5EXLA 1V2LT 5DP4A 1J14A 2HOBA 4XOJA 2VH0A 2BDCA 4DW2U 2G52A 4NFFA 2BXTH 2C8WB 2XBYA 4B75A 2HNTE 4ZKSU 3GISB 2OC8A 1HJ9A 1IQFA 4TYDA 1FV9A 1XX9A 1SG8B 1TOMH 1K1LA 3RXFA 2K1QA 1GVZA 1HXFH 2Z6BD 3KQEA 1ELVA 2VIPA 4GPGA 5EU8A 1GJAB 1LHDH 3NZIA 7KMEH 1QY6A 2A4QA 4Y79A 3Q00A 2A7CA 3URCA 1KTTB 4ZAEA 1GJCB 2GTBA 1V2JT 3NCLA 2TGPZ 3QGNB 1KTSB 5EQRA 4AORA 4JYVH 1L1NA 1SFQB 3GDSA 1RTFB 4NA7A 4BAOB 1TGNA 5FHTA 4MLFB 4NWKA 3UTUH 3ZZ7A 1WSSH 2GMTB 1ZTLA 1LKAA 1GI9B 1C1QA 1UTOA 3A7VA 1G3DA 1P12E 3B23B 5DP7A 3D65E 4I8GA 1GHBF 4NZLA 1UVOA 3QX5H 3TNSA 7ESTE 2P59A 5GXPA 3S9CA 2Y81A 2ZC9H 2RCEA 2XYAA 1RD3B 4ZROA 1ANEA 3T2NA 1LPZB 1QQ4A 3BG4B 3RXQA 1DUAA 3TVJB 1GGDC 1EKBB 3M7QA 4HFPB 1EZUC 5BRRE 2XXLA 1PPGE 1WOFA 1NRRH 4CRAA 4LOYH 1ABIH 1T4UH 1BJVA 1QRXA 2OCVB 4FUFA 1K2I1 5LPFA 1P10A 5EG4A 1HV7A 5TCCA 4BAHB 3ZVEA 2TBSA 4JCNA 1Z8RA 4E7NA 1O3IA 3RMLH 2Q6DA 2CGAA 1GHAG 1DOJA 2XBXA 3ATLA 4AFSA 3UNRA 1P02A 2Z9KA 2FIRH 2PTNA 1HBTH 2OINA 5C1UA 1NT1A 1Z7KA 1EAXA 2J94A 1SMFE 2IJOB 2ZTZA 2NWNA 1DITH 4CR5A 1C4V2 3TPIZ 1GMHF 1WTHD 1UHBB 2ZTXA 1E0FD 1MBMA 1C5ZB 2P95A 3MNBA 1CGIE 3FANA 1GHBG 1DXPA 1X7AC 1BRAA 2GCTB 1PPFE 1ID5H 4LK4A 3STIA 3SJIA 3LU9B 3SQEE 2XNIA 4MDSA 1W11U 3M5MA 1KDQA 1GJ7B 3U98H 1TNGA 1CE5A 3TITA 1E37B 1KSNA 1TGSZ 1CA0C 1SQTA 1UJ1A 2PV9B 1AB9B 1GDNA 2J34A 1HIAB 1O30A 2AH4X 1RS0A 1MQ5A 2BOHB 2F9UA 1RXPA 3D23A 4TWYA 3SUFA 2Z3EA 1HJAB 1GVLA 1FXYA 1OWKA 1SGQE 4D7GA 2OC0A 2EI8A 4K69A 1QB1A 2XBVA 1SGCA 2ZWLH 1ETSH 1GI7B 2V3OH 1L4ZA 1Y3XA 1NRSH 3SNEA 1FNIA 3T28A 1RJXB 3QDZB 4F4OC 5C67A 1P09A 3AAVA 1CT2E 2WINI 1QL7A 1IQKA 1OP8A 1BMLA 1S83A 3RU4D 1A1RA 3QWCH 4AX9H 1VITF 1C4Y2 2WUCA 1ANDA 4GCHF 1C2GA 1H1BA 4K8BA 2WV4A 3D62A 4O97A 1DT2A 4Y10E 4A1XA 3LH1A 4BXWA 2CHAC 2YNAA 4X6MA 1YYY1 5CHAB 1IHSH 3ZZ6A 2O8TA 1T8MA 1HDTH 1ZYOA 3VXEH 1ARCA 2DUCA 1SOTA 2BY5X 1GMDF 1C1OA 1KLIH 2AGGX 3F9HA 5L30H 1TNLA 3MH5A 3OYPA 4BTUB 1GHXH 2VIDA 3BTKE 1UTJA 4Q7YA 3BSQA 3SJ9A 4IMZA 3M3VA 1XUJA 1TX8A 1HUTH 4FVBA 3OU0A 1YLDA 1CHGA 1GG6C 1Q31A 3P95A 1YLCA 2Y5HA 3ZZCA 3PMJA 2R3YA 8GCHG 1GBDA 3MYWA 1ABJH 4JMYA 5F6MA 1ELBA 2H9TH 3HK6B 1J15A 2R3UA 3LIWA 2Y7ZA 1Y5AT 1GHWH 1UCYE 3BIVH 2HLCA 3MFJA 1MTSA 2ZO3H 2ZPQA 1C5LH 4X1PU 4DCDA 1NU9A 1C2KA 2H9HA 5DP3A 2ZDMA 3A8CA 3LDXH 4WWYA 3FP7E 4DIHH 4NIXA 2BD9A 1UK3A 5L2YH 2BD4A 2BB4A 2SFAA 3S9BA 1FONA 2EC9H 1C9PA 1O2RA 1P0SH 2FI5E 5C3NA 3ZV9A 1N8OB 5A09A 1FPCH 2WPJS 4NIYA 1IQNA 1YC0A 4OS5A 1WBGB 3MWIU 3TJOA 1TGCA 2FDAA 1W13U 1AE5A 2XWAA 2G4TA 1C2JA 1NM6A 2ZA5A 5DP6A 4AG1A 2BXUH 1SQOA 3BEUA 3EGKH 1NROH 1O2MA 2XW9A 6GCHG 1XUFA 3W95A 1QA0A 4Z0KA 5FCRA 3EQ0H 2GP9B 1UVTH 2SGFE 2VWNA 3A82A 4WJG2 1QCPA 4J1YA 5EW2H 1GJ9B 1YM0A 1K1NA 1ZRKA 5F8ZA 1FDPA 1SI5H 1BRCE 2IN2A 2A32A 4D9RA 2GT8A 3A86A 4WMFA 3A87A 1DFPA 1SLXB 4FU7A 3DA9B 2C93B 3RXOA 2AMDA 1MKXH 2V0BA 5C1YA 1NFXA 2A4GA 4HI3A 1GBJA 1V2NT 2BY9X 6CHAC 1LHEH 1DUEA 4K8YA 4SGBE 1EXFA 1MUEB 4AGJA 2ZP0H 1ETRH 5EPNA 3F9GA 2ZCKP 1CSOE 1BJUA 1CA8B 1W12U 3LGYA 4K1EA 1SQAA 1SLVB 1RRKA 1T32A 2ZGHA 4FUHA 1GL0E 4VGCC 1WU1A 1IOEA 3IG6B 1OP2A 1VGCB 2YNBA 3PLKA 1PPCE 1YPEH 1GJBB 3ZVAA 4GLYA 2PW8H 1AIXH 2RDLA 2VIVA 3E90B 1BTUA 5FBIA 4KP0A 1LVMA 4AB8A 3A81A 5K0HA 1O2GH 4MTBA 3ZVGA 2BVRH 3U1JB 3SU0A 5LGOA 4YO9A 1L2EA 1QJ6B 3K9XB 3SUDA 1IQHA 4X1NU 2FODA 3V12A 5A2MH 1G30B 1CA0B 1C2IA 2FEQH 3LGUA 2NU4E 2OC7A 1QBOA 1ZRBA 3JZ2B 2R2MB 1GBFA 1TBZH 2ZKSA 4UONA 1WQSA 1EATA 3EA9A 1AY6H 2ALVA 2NU0E 4TPYA 2SGAA 1JWTA 1AZZA 1DM4B 1BZXE 1FQ3A 3E6PH 1O2UA 4YOGA 5CE1A 1N8OC 1VITG 2JETB 2FLRH 1PPZA 3PTNA 4DGJA 3RXKA 1O3FA 1Y3WA 1DSTA 4HTCH 3IWMA 2CJIA 4FUBA 1TE0A 1TQ7B 1TX6A 5HMAA 1KXEA 4GHTA 3FZDA 5TJXA 1ELEE 3VFEA 1B5GH 2J92A 4R0IA 3M7TA 1SLUB 4NSYA 3SI4H 1S6FA 1RTKA 4I8JA 1LDTT 2XCFA 3QN7A 3GCNA 2FXRA 3L33A 3ZVDA 2CHAB 2NU1E 2Q6GA 2ZIQH 1EPTA 1HAXB 1FY1A 1XXFA 4IMQA 2ZF0H 3D49H 3K6YA 2C8ZB 3HATH 3K6ZA 1HCGA 4E7RG 3SU3A 1VR1H 3BN9A 4B71A 3QK1A 1GG6B 4R8TB 3BG8A 1O2LA 1C2DA 2B0FA 2P3UB 1GCTC 1DXWA 1V2PT 1P06A 3PO1C 1V2KT 4BANB 1P2MA 3BTQE 4MPUA 2ZHWH 3BIUH 4ZXYH 3M61U 1DICA 8KME2 2PWXA 1A46H 1ZHPA 3MOCA 1PPEE 1FY5A 2VGCB 1CVWH 4QT8C 4B1TA 1JXPA 1YPKH 1OWEA 3PROA 2ZPSA 2ZU4A 1D3TB 1QBVH 4CBOA 2VNTA 1AUTC 1O2NA 4TPIZ 2ZU5A 1WUNH 5L2ZH 4I31A 1N1LA 4RSPA 1V2VT 1ARBA 1D6RA 1BCUH 2UUJB 2Q1JA 4FUJA 1W7GH 2ZTYA 4CH2B 1V2UT 3TLOA 3ATWA 4X6OA 4NA9H 5I25A 1ZSKA 1Y5UT 1GBMA 2TRMA 3UOPA 3OSYA 1AGJA 1SB1H 2QA9E 3BTTE 3RXGA 2STAE 1AQ7A 4UDWH 2G55A 1F0UA 3HK3B 1LPGB 6GCHF 1SFIA 1O3CA 5AF9H 2ZU3A 1ELTA 1UTKA 4VGCB 1CHOF 1ZMLA 1GJ4H 4K60A 4OS4A 2XC5A 4JZEH 3ZVFA 4DJZB 1P05A 1EJNA 1BT7A 1OX1A 4BAMB 2G81E 4FUDA 4ZKNU 4WF8A 2SNWA 2Y5FA 4ISNA 1SGYE 1BTWA 2F3CE 2GKVE 1YKTA 1O5EH 3KEEA 1C2HA 8LPRA 3QGJA 4NIWA 7LPRA 5DP5A 4JK5A 1MBQA 1NO9H 1T8NA 3L3TA 1DY8A 2Z94A 1MTNB 1DWEH 1N6XA 2BX4A 4IN2A 1ZMJA 1AI8H 3U8TH 4AGKA 4E05H 5DP8A 4A1TA 1D6WA 1BRBE 1K22H 2W3IA 3U69H 2RA3A 4X6PA 2WPIS 2HPPH 1XUHA 3ITIA 1TPOA 3UY9A 3DHKH 2XBWA 3TH2H 1GBHA 1HAZB 3QUMP 5ESTE 1H4WA 3A7ZA 3RXRA 3SV7A 1ESAA 3ENSB 1UVSH 1AWHB 3RU4E 4Y0YE 1O5GH 3HGPA 1O5DH 1O2HA 1ANBA 5K7RA 1DPOA 3SOSA 1GBAA 4NWLA 2ZHFH 2OBQA 1J17T 3DFLA 1MKXK 4FVDA 2GDDA 5JBAS 4FXGH 4MPVA 3VB5A 4MG3A 2VWMA 3RXDA 2A0QB 2LPRA 1OWHA 1V2MT 3AAUA 1UK4A 1KLTA 2P94A 5GDSH 2HPQH 1O3OA 4SGAE 3VGCB 4KTUA 1C1UH 4XDEA 1WCZA 2FOAA 1THRH 1OSSA 5SGAE 3LGIA 5F8TA 3C27B 4NA8A 1H8DH 3UPEA 4RN6A 2WPLS 1DX5M 4YOJA 6CHAB 3ZZDA 1ELDE 4DURA 1MZDA 1PFXC 3SQHE 3E0NB 3QTOH 1BOQA 1RTLA 2G8TA 4AYVB 4TWWA 3T25A 3SHAH 1FY4A 4BAKB 1MTUA 1U6QA 3GY7A 1UTNA 3M3TA 1TRYA 3E16B 4INLA 2PTCE 3KNXA 4Q80A 3A8AA 3QZRA 2ZFRH 4ZHLU 1EAWA 1K1OA 3SU1A 5JBCS 5DKMA 2BM2A 4LZ4B 4LZ1H 1H9HE 3PYHA 1VCQA 4FUIA 3GDVA 2VIOA 3MI4A 4BTTB 3RLWH 4IC6A 4NG9H 2BY6X 1O2TA 1G9IE 4CRGA 2QY0B 5GCHG 1SGNE 1C5MD 1E35B 1BHXB 1Q2WA 4HGCA 1EZQA 3KCGH 2IOTA 1GDUA 2BD2A 1UTQA 1SGFA 1O3MA 2VU8E 2P8OB 2Y80A 1C5WB 3MU1A 2UUYA 4AB9A 1TFXA 4UFGH 1HB0B 4H42U 3O8BA 1IQLA 1GI2A 2BLQA 2ZFFH 4LXBH 2PGBB 1P57B 4ISHH 5JDUB 2CV3A 3S69A 1C5PA 1FPHH 4O3TA 3ZYDA 1PQAA 4INHA 1E38B 4A6LA 4AFQA 4X1QU 1GMDG 1S82A 2BLWA 2GCHF 3TIUA 1DLEA 2G5VA 2H1UA 1SBWA 4CH8B 2RG3A 1OS8A 2Z9LA 4ZHAA 1BMNH 2PSXA 2Z9JA 2C8YB 3P8NA 1O3DA 3KN2A 5LPEA 1NZQH 4B73A 1ELGA