4ABBA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA02
2AFQB 1AGJA 3M7QA 1NT1A 3UY9A 3RXRA 1LKBA 2ZDLA 1HYLA 2C93B 2FOFA 2Y82A 3BF6H 4DIIH 1SG8B 2VB0A 3DT0H 4OS7A 3RMNH 2STAE 2ZFSA 1UVTH 3SNBA 1K28D 3ZVEA 1BRBE 2Z9KA 4HI3A 1Z6EA 2ZGBH 1PYTC 1MZAA 1O3PB 1IQNA 1LPZB 1HAXB 3D23A 1K1OA 1C1UH 1RIWB 1TMTH 1GMDG 5EPYA 1FQ3A 1D6RA 2TPIZ 3ZVBA 1QGFA 1PQAA 2OTVA 5DKMA 1AZ8A 4ZKSU 2FI5E 3Q76A 4JYVH 1GI2A 4OS2A 1C2GA 2BLOA 3ESTA 1Y3XA 5L2ZH 1FLEE 2C8XB 1NESE 2J38A 2OXSA 3LGVA 2Z9LA 3URDA 1GMHG 3VB5A 2P94A 4I31A 1J14A 1TBRH 2G5VA 3T29A 4OS1A 2OQUA 3MTYA 1SL3A 1CT0E 4BOHA 1ELDE 2PUQH 4O03A 3RM0H 1EKBB 1EATA 3E16B 4J2YB 2QXGA 3V12A 1L1GA 1EX3A 4A5TS 3UQVA 4HZHA 1Z6JH 4XOJA 6ESTA 1FY5A 3MH6A 2UUJB 1AUTC 2Z6BD 3SV9A 2XBWA 1DLEA 2SGDE 3NUMA 5T6GA 2JETC 1CA0C 2FESH 2JH6D 4XBCA 3MH7A 3M5LA 4OS5A 3SI3H 1ZGVA 1O31A 1UCYK 5B6OA 4Y10E 3VXEH 3PMJA 4AX9H 3QUMP 3RXIA 4FXGH 1EPTA 3Q00A 1SB1H 4ISHH 1L2EA 1T8NA 1V2WT 3E0NB 1H9IE 1V2KT 2FPZA 3NWUA 1MQ6A 1SR5C 3QZRA 5GPIB 3BTME 1QBOA 1YCPK 3NPSA 1ANDA 4BNRA 1GG6B 1A2CH 1QFKH 2Z9IA 1GGDB 2ZDMA 2FXRA 2H2ZA 1DLKB 5FPSA 4Z6AH 1O2UA 5SGAE 3BN9A 2ZC9H 3TGJE 1E35B 1ZSLA 3P8OA 3A80A 1BMLA 1V3XA 3KQBA 1PPHE 1ZLRA 2A7CA 3AW1A 1DPOA 3FAOA 5G4BA 1V2RT 4CBOA 4B76A 1TALA 1G3CA 2G51A 5F03A 1UTMA 3O8CA 3PMBB 1N6YA 3SGAE 3K9XB 3RXSA 3SU3A 1W7XH 2IOTA 2SGFE 3U1JB 2A4QA 3U8OH 1SGRE 2G55A 2UUYA 1FNIA 1LO6A 3KQDA 4ZMAH 1NRQH 1ZSKA 5CHAC 3M36A 1GJ6A 1OPHB 2OC7A 1AU8A 5C5OA 2D26C 1OWDA 3ZVGA 3SV6A 1THPB 4WH6A 4D9QA 1GPZA 1TABE 2OC0A 2VWOA 9LPRA 1SGEE 5EOKA 3AW0A 5FCKA 1V2LT 4NIXA 2HLCA 4OGXA 4ABFA 1LVYA 2EC9H 1EAXA 1OYTH 1G3DA 1O3NA 2AERH 1AKSA 4BTIB 2VIVA 4AB9A 1ELGA 1SOZA 1D3DB 1HNEE 1ZSJA 1AB9C 3QTOH 2EI7A 1DE7H 3GCTG 1GJ9B 3KF2A 2NU4E 3NK8A 1DX5M 3P95A 3SI4H 4IC5A 3DFLA 4UFFH 1CT2E 2XTTB 3K2UA 2GMTB 1GI1A 1C2KA 2Y6TA 1QRZA 2PGBB 2BOHB 4GPGA 3RXGA 2V6NA 1ETRH 4ISOA 1S6FA 4CREA 1N1LA 1ZPCA 1W8BH 4A1VA 1H8IH 4FUJA 1AWFH 2P8OC 2FYRA 3A7VA 3PROA 1JXPA 1VCQA 4UFEH 1Z7KA 4ISLA 1BMNH 1GI0A 2AMPA 4WXIA 3H7OA 4BAQB 2ZEBA 2LPRA 4JZIA 2NU2E 4LZ1H 3RU4D 1K1LA 1Y5UT 1B0FA 2WINI 4BAKB 2R9PA 4X6OA 1ID5H 1O33A 1BBRE 2W3IA 3M5OA 4NCYA 1GCTC 3N7OA 4NIYA 3B8JA 1THSH 1TGBA 3RXAA 1ZTJA 2GVFA 3TH2H 2O8UA 1EOJA 2FDAA 1BQYA 2A4GA 3I77A 1BB0B 5EGMA 1LHGH 1O30A 5FHTA 1O5DH 1SLVB 1RD3B 5L30H 2P3TB 1P02A 2Q6FA 2P3FH 1GBBA 2IJOB 4X2WA 5GWZA 5GXPA 3IITA 1AZZA 4AZ2B 4DG4A 3SORA 3S9AA 1O36A 3T62A 2BDYA 4Q7YA 4SGBE 3FFGA 3TGIE 4XDEA 1VITH 4KTSA 3RXPA 2IPHA 1GBDA 4INKA 1GL0E 5DP8A 5GCHF 4K1SA 1NTPA 2SNVA 3QWCH 3T5FH 4JZDH 5FX6A 2ZFTA 2ODYB 4RKOB 1THRH 1AVWA 1SGPE 4X8SH 4NSVA 3PV4A 1TAWA 2H5DA 4GHQA 1AE8H 1Y5BT 1F0RA 1Z8IB 1FPCH 4DURA 1PQ7A 2RDLA 1VJ9U 4R0IA 2G81E 5JB8S 3URCA 3JZ1B 2A5AA 1P10A 2TGDA 3OY5U 2ZCHP 2CXVA 2QC2A 4NSYA 5J4QA 1FDPA 1GVKB 2A2QH 2O8LA 1C5UA 1EZXC 1LCYA 4A6LA 3PO1B 1QCPA 5A8YA 4X6NA 3BTTE 1HJAB 6CHAB 1MAYA 2BX3A 2TRMA 4JZ1A 4YO9A 3R0FA 1MAXA 4XSKU 1KLIH 1O3OA 2OC8A 3UIRA 3MNCA 5EQSA 1KSNA 1UCYE 1G3BA 3PTNA 1LVOA 6GCHF 5HMAA 1ELAA 4OS4A 4FVDA 1L4ZA 1GHZA 3M7UA 2AIPA 2BD9A 1KYNA 4YESB 1BBRH 4FUIA 4BTTB 1NFYA 4Y7BA 2BD8A 1BJUA 2ZZUH 2Z9GA 4WMDA 2XBXA 5EW2H 1A0LA 1W10U 3ATKA 1CU1A 3KIDU 1P11E 1MD8A 1DSTA 2XC4A 1A5IA 1AO5A 4DIHH 1GHAF 1EB1H 3SGQE 1P2MA 2FIRH 3FP8E 3MNSA 1QJ1B 4BXWA 4AN7A 2Z3CA 4BTUB 4JYTA 1IQMA 4WWYA 2BB4A 1BHXF 1ACBE 1HFDA 3GY7A 1MUEB 1CBWB 4ABHA 1MZDA 1C2EA 4VGCB 1EAIA 2Z94A 2PW8H 5FAHA 1SVPA 1DS2E 3LIWA 4O3TA 5AVDA 1GHXH 1IQIA 5JBBS 4I8KA 3RC4A 5A8XA 1HJ9A 4TY6A 5T6DA 4WMEA 1O2WA 4ABIA 5I46H 1GMDF 3ATIA 1F92A 1MU8B 4DCDA 1LPGB 3BEFB 1C5LH 1S0QA 2XYAA 4Q7XA 3SJKA 2XBYA 1KXDA 3UNRA 2BMGB 1V2OT 2ZHQH 3SNAA 2XWBI 2GX4A 3QGNB 3QO6A 2FI4E 7ESTE 1DUEA 3M37A 1ELEE 3OYPA 1GJAB 1QB6A 3A87A 2TBSA 3EAJA 2ZDKA 2HNTE 1J16A 3T26A 1T8MA 1YM0A 1QRWA 2VGCB 1FY4A 2AMDA 1XUHA 3F68H 3ZYDA 3A8CA 2BY6X 3VGCC 4K60A 2UUFB 7GCHF 1ZGIA 2EI8A 5AHGH 1TQ7B 2Q1JA 1DICA 1TRNA 1V2VT 1O5AB 1XX9A 1UCYH 2BD3A 1OWJA 2ZF0H 4IGDA 4X1RU 1ETSH 2ZPQA 4A7IB 4FUFA 3UNQA 4CHAC 1DWEH 2TIOA 4IMQA 2BQWB 5JYIA 1ZTLA 4FU7A 4YT7H 1P2JA 2BDAA 1C5NH 1PJPA 4AFSA 1YCPH 4WVPE 3U1IB 1ZRKA 4YOIA 1MTNC 3QGJA 2ZHWH 1HPGA 1QR3E 3AAVA 1VGCC 1RTFB 1C5ZB 1IQJA 5BRRE 1TQ0B 1UVSH 1O3LA 2Y80A 4K1TA 5A8ZA 1FY1A 5DP9A 3A88A 1PQ8A 2C90B 1C2IA 2BDGA 1ANBA 1OWKA 4JK5A 3SJIA 3FVFB 1H1BA 1JOUB 4F4OC 2GCHF 1LHFH 3EGKH 4I8HA 3C27B 1O3BA 5DP4A 1BUIA 3Q3YA 3BTGE 2ZWLH 4ABBA 5LH8A 2JKHA 3E8LA 1O2IA 3SU0A 5GCHG 4TWWA 2ZHDA 1DWBH 3MU4A 1A61H 1GBAA 4B2BA 1KDQA 4B2AA 2GZ9A 4CRFA 2GT7A 2ZFRH 4LOYH 1V2ST 1QJ7B 2PWXA 4A92A 3TK6A 2BLWA 4ABEA 3SOSA 3VB6A 4Y71A 1ESAA 1YF4A 4IBLH 1KXFA 5E2PA 3RXCA 1SLXB 3KHVA 1Q3XA 3SV7A 4Q2KA 1P0SH 1EPTC 3HGNA 3SU6A 1TX6A 1P8VC 1L1NA 1QIXB 1HLTH 3HATH 2NU1E 2P95A 4ZUHA 3TH3H 1SI5H 3A81A 5HYOA 2OBOA 4I8LA 1YLDA 1F0UA 8ESTE 3PYHA 3LC3A 4GSOA 5F8TA 2AMQA 4OGYA 2A4RA 4CRAA 2BY5X 2AS9A 2VWLA 1EAWA 2HOBA 1C5RA 1SBWA 1Z8RA 1OOKB 5ESTE 3ZZ7A 1QBNA 6GCHG 1T8LA 1SQOA 3B9FH 3HPTB 3L3TA 5DP7A 1QY6A 4MG3A 2UUKB 1ARCA 3GCTF 4ZROA 5HM2A 2FS8A 1YLCA 2F83A 1XVMA 4ZHAA 1AHTH 4KGAA 2DE8A 3FZZA 1ZMLA 3VEQB 1ELVA 1MKWK 2O8TA 4D76A 4I32A 1XXFA 2PUXB 1HCGA 2FM2A 3SNEA 2H5CA 2WPKS 3U69H 1GHAG 1O3DA 1NFWA 1OP2A 3O8RA 2FLRH 2FLBH 1ESTA 1RIWC 4JYUH 1IQKA 3ZZ5A 1EOLA 1G30B 5EQRA 1GDQA 1INCA 1XUGA 3SU1A 3STJA 1O2HA 5LPRA 2BLVA 3BG8A 1SGFG 3LPRA 3BIUH 1LVMA 5EPNA 1O2JA 1AFQB 3A8DA 1O5CB 3SUDA 1EJMA 3BTEE 1TA2A 4FUBA 4D9RA 2R3YA 1IQHA 3LU9B 1NRPH 4H4FA 3RMLH 1ZHRA 3NKKA 1IQFA 1NU9A 3DFJA 4KTCA 2SFAA 2UWLA 2H6MA 1MMJN 3TITA 1F7ZA 3MNXA 1E34B 3F1SB 2VNTA 3MU0A 1ZR0A 2HVXA 2OD3B 4LXBH 3AVZA 2F9UA 2J2UA 4HFPB 1TX7A 2QY0B 5AFYH 1W7GH 3BG4B 5GJ4B 1HIAA 1C2DA 3SU2A 1GJBB 3MO6A 4Q7ZA 2OP9A 3GOVB 4U2WA 3UNSA 1FJSA 2AIQA 2CHAB 1D3QB 2W7UA 3UTUH 7GCHG 3M7TA 3OU0A 4AYYB 1NRRH 1ELCA 1D6WA 1EQ9A 1W0YH 3Q3XA 1JMOH 1BA8B 3E6PH 3A7XA 1Y5AT 1FAXA 3MHWU 1O3IA 1ETTH 3LT3A 1XMNB 2BXUH 2VH6A 2ILNA 3PB1E 3T27A 1IQEA 3P6ZB 4FUHA 3SJOA 3ZZ6A 2BTCE 1GI9B 3GYLB 5DP5A 2ZCKP 1SGDE 2R2MB 1MQ5A 3RXMA 1FI8A 1O2KA 2RA3A 4DOQA 2FOHA 4Y8YA 1WUNH 1QL9A 4UDWH 1A4WH 5FCRA 2GCHG 3RXTA 3ZZ4A 1V2MT 5I25A 3P17H 1BTYA 1IHTH 4WY3A 2ZPRA 4DW2U 3DA9B 3U98H 2R0LA 1MTVA 5EG4A 4A1XA 1RTLA 1CO7E 1YPGH 3K6ZA 5TCAA 4CRDA 3GY3A 3BTDE 3SJ8A 3TU7H 1BOQA 4MQAA 3GDUA 4Y11E 3H7TA 2Z7FE 1OP8A 4ABAA 4ZKNU 2GZ7A 2ZU2A 1GI5A 3ODDA 4BAOB 5T6FA 3V13A 4JZEH 3V3MA 2G00A 3UOUA 1YBWA 1MBMA 1PFXC 4BAMB 4DT7B 1GBMA 4X6PA 3STIA 2GV7A 4X2XA 1VR1H 1C4Y2 4Y79A 5L2YH 1O2GH 1W3CA 1TRYA 4YLUA 1H4WA 3GDSA 1FPHH 1A0JA 1O3KA 3P92A 2PV9B 2GCTB 1UHBB 2NU0E 1C9TA 1PPEE 3CS0A 3SUGA 1HV7A 3VPKA 4ABJA 1PQ5A 3RM2H 5FBIA 2PLXA 1AUJA 3U8RH 4PROA 3SUFA 1O5GH 3LJJA 2F9VA 2ZFPH 5DPAA 8KME2 2J4IA 3ZZAA 2AGIX 3T25A 1C2MA 1MKXK 1GDUA 2OCVB 2V35A 2QF3A 1BTHH 1C4V2 1TGTA 1GBHA 3MYWA 3SW2B 1K1NA 3OTJE 2XWAA 1MCTA 1T7CA 2F9BH 2W5EA 2BXTH 3RP2A 4K3JA 1O3MA 1SGYE 5FBEA 4CBNA 5HGGA 2ZTZA 2VJ1A 2BZAA 1XUKA 5DP3A 4NIWA 4HGCA 1OYQA 1WQVH 1TRMA 3U8TH 3BIVH 1DSUA 3JZ2B 1C2JA 2BOKA 3CENA 4Y8ZA 1SQAA 4D7FA 3P8FA 4YZUA 2H9TH 2GZ8A 1YPKH 2QCYA 4B73A 3RXKA 1FZZA 4ISNA 1AFEH 3A7YA 4NA9H 3PWCA 2ZPSA 2K1QA 5A0CA 1LHDH 4NA8A 1FY3A 3D49H 2BDCA 1FXYA 3RXLA 1GMCG 2SGEE 3TVJB 1AB9B 4X1SU 5L6NH 1MU6B 3SN8A 1GVLA 3UQOA 1GHBG 2BD4A 1YPLH 3F6UH 1FIWA 4IN1A 6LPRA 1DXWA 2ANYA 5C2ZA 3IWMA 1BRUP 2HGTH 2FX4A 2QIQA 2FX6A 1TPSA 3GICB 2D2DA 1T31A 4GLYA 1GJDB 1CGHA 1O3AA 1HAZB 2J34A 1O2OA 2V3OH 2JH5D 4I8GA 3E3TA 3RXEA 2O8WA 2QAAA 4MVNA 3LGUA 2P8OB 3LGYA 4Y8XA 4JMYA 1WAYB 3I29A 3SNDA 2BLQA 3V7TA 1TNHA 3RDZA 3RMMH 1K9OE 3S9BA 3RC5A 1SLWB 2WYGA 5IDKA 1TGSZ 2I6QA 3PO1C 1O2SA 3RXQA 1TNGA 3MWIU 1HJAC 4AGKA 4U01A 3UWJH 1GCTB 1K21H 3FZDA 2FWWA 2B0FA 2J94A 1GJ5H 1XUFA 3QZQA 5FXLA 1GI8B 1GBCA 1O35A 1IQLA 1XVOA 1S0RA 2BD5A 4Q80A 2GV6A 3UPEA 4I7YH 1C5OH 1WU1A 1SGCA 1Y3VA 5HM9A 2P59A 3MU5A 2WV5A 1TX8A 3E91A 3SZNA 1B0EA 4U30A 1HAGE 8LPRA 2EI6A 4H6SB 1G2MA 1SOTA 1HXFH 4CH2B 1LKAA 1FONA 1H9HE 3SBKA 3MH4A 1UMAH 3IG6B 1NN6A 1VCWA 3LDXH 1TNLA 1MKWH 2RG3A 3GISB 4CR5A 1HAVB 1ZJDA 3SGBE 2W7SA 7LPRA 3ENSB 2A7HA 3RXDA 1NZQH 4MNWA 1OWEA 3MI4A 2J95A 2KAIB 1C9PA 1DY9A 1CBWC 4BXSA 2VH0A 1A0HB 1C5MD 3LGTA 4CRGA 2ZU3A 1C1VH 1O2LA 2WPHS 2FOBA 1E0FD 4KELA 1YPJH 4IS5A 3P8NA 2FMJA 2PKSB 1P57B 1SGNE 1J15A 3A89A 1P2NA 1SFQB 3L6PA 1TYNA 3BTKE 2FOEA 4CH8B 1C1WH 1MBQA 3TIUA 3RXJA 1ZHPA 1DWCH 2FO9A 5C67A 5A0AE 1S84A 3CS7A 1O3GA 4E06H 4UEHH 1YPHE 1K1PA 2QXHA 1HAIH 2QXIA 4ISIH 1KLJH 1S6HA 1HJ8A 1T8OA 5A0BA 4YLQH 4K1EA 1TB6H 1E36B 3QDZB 2A1DB 1G9IE 1GHYH 1YKTA 1O3JA 2BY7X 3MO3A 3GY6A 2CF8H 3M3VA 3TPIZ 3NZIA 2C8WB 1XUJA 3RXHA 1QURH 3HGPA 3PMHB 2FEQH 3BSQA 3EA8A 1ZMJA 4XBDA 1EZQA 1Z8JB 2I6SA 1P9SA 5C1UA 3S7HB 1GI7B 2VIQA 1L4DA 1BMMH 2FTLE 1GBJA 1UTPA 1MCVA 3SV8A 1S85A 1K1IA 4H6TA 4B2CA 3LH1A 3AASA 1P2OA 3A7ZA 2PR3A 4DVAU 4MDSA 1KY9A 1MTUA 3W95A 1XKAC 2WUBA 2ULLA 1P3CA 3TGKE 1TNKA 1O39A 4MTBA 2F3CE 3NCLA 1QB9A 3WY8A 1PPGE 1UO6A 3BTWE 2ASUB 2PKAB 2BVRH 1HAPH 2YNAA 3ZZ8A 5JBTA 1N8OC 1NU7B 4MNVA 3S69A 3RXBA 1LQEA 1LPKB 2BY8X 1NFXA 1F5LA 3SQHE 4X1NU 2VVCA 1EJNA 3KCGH 1L1JA 3KN2A 1QRXA 3ZV9A 1D4PB 3GCOA 2GTBA 3ATWA 1HXEH 2ODQA 1M9UA 1O3EA 2ALPA 1JIMA 1KXEA 5GIBA 3MNBA 1O0DH 3NXPA 3QN7A 5DP6A 4AYVB 3K65B 3LGWA 2Y7ZA 1DDJA 2PSYA 3UREA 1MD7A 3TJUA 3DHKH 4NWLA 5K0HA 1G37A 4X8VH 1C5YB 1O2XA 1ZRBA 4MLFB 2HALA 1XUIA 1P01A 3A82A 4Y6DA 5C3NA 2TGAA 3VGCB 4GUXA 2J92A 4IC6A 2FTMA 1TOCB 1NFUA 1P2KA 2SGAA 3UWIA 2ZO3H 3HKJB 3A7WA 1DFPA 1BDAA 3L33A 4CHAB 3T2NA 1DXPA 3GCNA 3P70B 1UTKA 3GCHB 1D3PB 1NRSH 4CRCA 2AH4X 4E7NA 1QQUA 5AF9H 4TPYA 1SHYA 3VFEA 1BTZA 1V2NT 1F5KU 1MTNB 1ZTKA 1WTHD 1E37B 3KL6A 4TPIZ 3V0XA 1NY22 1VGCB 2HWLB 2ZP0H 3S9CA 1ESBA 3ZYEA 2Z9JA 1O34A 1A7SA 1TMBH 1PPBH 3B23B 4ZKRU 4JZFH 5A2MH 1AMHA 1DUAA 3ATLA 2A2XH 3F9EA 4CR9A 1MKXH 1GJ7B 3ATMA 2AYWA 2FZZA 2A45B 4AGJA 4KKDA 4X2VA 1UVOA 4HTCH 2VWMA 4Y76A 1IAUA 2ZHFH 3TNSA 1H8DH 1D3TB 4ZXXH 1P09A 2V3HH 2VIDA 1AFQC 1EJAA 3ODFA 2GDEH 4XE4A 1XM1A 2QGRA 4JK6A 1HAYB 4LZ4B 2OC1A 2RA0A 3LONA 3T28A 1O2PA 1EPTB 2OQ5A 4GAWA 5C1XA 1C5XB 1HAHH 1W11U 1C5TA 5E2OA 4WXVA 3D62A 1CVWH 4KP0A 2GDDA 2B7DH 2XCNA 5DK1A 2XCFA 1CSOE 4NGAH 3KEEA 4LK4A 1O2MA 5DGJA 1BMAA 1BJVA 2B9LA 1DT2A 3EDXB 1RRKA 4YT6H 3H5CB 3GY8A 2ZCLP 4INHA 5C5NA 1Z1IA 1UTQA 1AY6H 1WSSH 4MPWA 1WOFA 2ANWA 1GBFA 2H9EH 2VVVA 1BZXE 2ZIQH 2EA3A 3ZZ9A 1GMCF 3VB7A 3M5NA 2Y81A 4AFZA 2ZTYA 3PMAB 1O2RA 1QA0A 3ELAH 2G4TA 1GHBF 2CHAC 5E8EH 1HAOH 1MH0A 4X2YA 2BX4A 1BHXB 2XXLA 1L0ZA 2BDIA 2XRCA 2VINA 4X8UH 3RU4E 1O2VA 1KTSB 4AG1A 4Y0YE 1CHOF 1RS0A 1CE5A 3O8BA 1TPAE 5ESBA 1GDNA 4X8TH 4I33A 4GCHF 4FU9A 3QX5H 2ZKSA 1KXCA 3KQEA 1UTLM 2VIWA 2ZDVH 1ZHMA 1A1RA 3UUZA 1ZYOA 3MFJA 3SNCA 4FUEA 3RXOA 1AVXA 1ZMNA 5FX5A 1O3CA 1FIZA 2BD7A 3ZZDA 1UTNA 3GY5A 4D7GA 4MNXA 2NWNA 2ODPA 1RXPA 1HGTH 1AKSB 3EQ0H 4B74A 1PPZA 1SGQE 1VITF 4THNH 1GG6C 2F9PA 1YPEH 3ZVAA 3PLBA 1AQ7A 2P3UB 4NIVA 4FUCA 1GGDC 1K22H 1LHCH 1A5HA 4R8TB 1Y59T 3F9FA 4WH8A 2F9OA 1WQSA 3P8GA 1TIOA 4WF8A 2PFEA 5CE1A 1MTWA 2BD2A 1BIOA 4X6MA 1EUFA 3E90B 5E0JA 4Y0ZE 1H9LB 1S83A 3OX7U 1SGIB 1WCZA 2GGVB 3ZZCA 2P16A 2ZG0H 4GVUA 1TMUH 4UFGH 3BV9B 2D1JA 1V6DA 3ZZBA 2CMYA 3GY4A 1DANH 3EA9A 4OS6A 1QB1A 2SNWA 1GCDA 2G5NA 4MPXA 1SQTA 2A7JA 2A4OA 3EYDA 4FUDA 4ZKOU 2OUAA 3C1KA 1K1JA 1KXBA 1VCPA 1SGTA 4YOGA 5EU8A 3R3GB 2ESTE 2ANMH 5K7RA 1G3EA 4SGAE 5F8XA 1TPPA 2CJIA 3FP6E 7KMEH 3M5MA 1WBGB 2HPPH 3TJOA 1P9UA 3HKIB 4AB8A 1FN8A 4ZH8A 1QNJA 2ZDNA 1LHEH 2GCTC 2ZFFH 3I78A 1ELTA 2JETB 1CA0B 1V2UT 2OBQA 3A7TA 3D65E 5IYTA 4CRBA 3HK3B 1GBIA 1UVUH 2VWNA 1AWHB 4FU8A 2ZGCA 1Z8GA 4ABGA 5F6MA 2ZNKH 4ASHA 3KNXA 2PTCE 1OP0A 1O2YA 3TK9A 5AFZH 1LMWB 1JRTA 1P2IA 4X1PU 3FP7E 1P04A 2AEIH 1ZZZA 4H42U 2G52A 2XNIA 1YYY1 1ZPZA 1SGFA 4F49A 1AD8H 3U9AH 1PYTD 1YP9A 1FAKH 3ZVDA 2GMTC 2LNCA 1BRCE 2NU3E 1PPFE 2ZGXH 3RXFA 5JBCS 4RN6A 4UE7H 1NC6A 1KTTB 3TLOA 3GYMA 2Z3EA 1Y3UA 1FY8E 2EEKA 2P93A 5JBAS 2H1UA 2FYQA 2CF9H 1U6QA 1O2QA 1WV7H 1XXDA 1IOEA 1O5BB 1EP6A 1RGQA 1TLDA 2RCEA 3F9HA 1C1NA 1HB0B 1LVBA 3SO3A 1J9CH 4JCNA 5EXLA 2FI3E 2STBE 1C1MA 3RLYH 1O2NA 1QQ4A 1PPCE 1W2KH 2Z3DA 1QJ6B 1C2LA 5JDUB 2ANKH 3RMOH 3LKWA 5CHAB 2C8YB 5E0GA 1OXGA 2QYIA 2CGAA 4NFFA 3Q3KA 3TJNA 1EAUA 3A83A 5ABWA 4TY7A 1BTWA 2FODA 4RSPA 1AN1E 1QHRB 2BZ6H 2BHGA 1WTGH 1BTPA 1YGCH 2BDHA 2UWPA 1CT4E 1SLUB 2THFB 5T3HA 3SU5A 4TWYA 3KQCA 1CGJE 2XBVA 1JIRA 1BITA 1ELBA 3OY6U 1BTUA 1CQQA 1OS8A 1ZOMA 5EW1H 2H9HA 1BCUH 3TH4H 1G32B 1GI6A 2Y5GA 3AAUA 2UWOA 2HRVA 1A46H 1EP5A 1CHOG 1GVZA 1O32A 1Y3WA 1O3FA 5DJ7A 1DM4B 1GJCB 2R3UA 1C5SA 1S82A 2QF0A 4GCHG 4K2YA 2ZHEH 1O38A 1O37A 1OWHA 1O2TA 1O2ZA 2VIOA 2BQ6B 4YM9A 3GDVA 2C4FH 5H4IB 1V2TT 1NS3A 4NA7A 1KIGH 2OLGA 4K69A 3VXFH 3BTQE 2BM2A 2BY9X 5GDSH 1ZPBA 3BEIB 4KTUA 5FPYA 4AFQA 4ZXYH 1TGNA 1JRSA 3TJVA 4K5ZA 4B1TA 2SGPE 6CHAC 1ELFA 1IQGA 1ORFA 1VITG 1W14U 3ITIA 1ANCA 1LTOA 4NWKA 1QTFA 3GY2A 1EB2A 1TFXA 1D9IA 1K2I1 1UK3A 4NZLA 1T32A 2WV4A 1UHBA 3RU4T 1Q2WA 1C4U2 4B75A 2IN2A 3RXVA 4Z0KA 1OSSA 1TOMH 2ZU1A 4M7GA 1NPMA 2ZECA 2GP9B 1UJ1A 1C1QA 1P3EA 3UOPA 2CN0H 3PLKA 2DE9A 3LC5A 1P03A 1GBKA 3EE0B 3ZZ3A 4MPVA 2WYJA 2B5TB 1TONA 5BPEA 5C20A 3EA7A 1EZUC 2BVSH 1GHVH 4MPUA 2BDBA 2PKSC 3MMGA 5EODA 3VB3A 1C2HA 3SUEA 2ZGJA 1SSXA 1P2QA 2ZDAH 2BYAX 5C1YA 4UONA 2HNTF 1IHSH 1DWDH 1YPMH 2GD4B 2R2WU 3M3SA 4WMFA 4J1YA 2ZI2H 2A5KA 1Y8TA 3SU4A 1RTKA 1T4UH 1KXAA 5EQQA 1C1SA 3HK6B 3UR6A 1O3HA 2PTNA 4ZAEA 2FOGA 2A5IA 3MO9A 2G4UA 3A8BA 4VGCC 4D8NA 2PGQB 3A85A 2Y7XA 2FOAA 1E38B 1T4VH 1YCPM 2YNBA 1MTSA 1AE5A 1QA7A 2FOMB 1OWIA 3MU8A 4AORA 1FUJA 1W12U 1P05A 3S7KB 8GCHF 1A3EH 1TBQH 1C5PA 2O8MA 1GBTA 3F9GA 1NO9H 3PTBA 3A84A 2ZQ2A 5LPEA 4RKJB 1O5EH 1J17T 1A3BH 3FANA 4INLA 3QTVH 4I8JA 1V2PT 1UTOA 1SMFE 1GBEA 1BTXA 1C1OA 1C5WB 2VU8E 4ZHMU 1X7AC 3KGPA 1KDQB 3ZV8A 1GL1A 2QV1A 4IMZA 3A86A 1C1RA 2VGCC 3TNTA 4E05H 2B8OH 4WJG2 1XKBC 1B7XB 2A0QB 2Y5FA 4X1QU 3LJOA 3MH5A 5LPFA 1Q31A 5JB9S 4K8BA 1ARBA 2SGQE 1TE0A 1F0TA 5LGOA 2ZQ1A 1JWTA 2DUCA 2F91A 1HBTH 2PHBA 4O9VA 4YTAA 3SJ9A 3SV2H 1TA6A 2G8TA 2D8WA 2WPJS 1GJ8B 1FV9A 3OSYA 2XW9A 1W0ZU 2ALVA 1GJ4H 3TK5A 1TGCA 4X0WU 5TJXA 4MNYA 3BEUA 3M35A 1RJXB 4B71A 5TCCA 1OX1A 4E7RG 1Z71A 3E0PB 4FUGA 1GBLA 3DUXH 4O3UA 4AG2A 1QBVH 2JH0D 1UK4A 3E1XB 4DY7B 1JBUH 1V2JT 4FVBA 1GMHF 5E0HA 1S5SA 1ZJKA 2A31A 3SHAH 1F0SA 1SC8U 3PM3A 1QL7A 2QXJA 3PWBA 3ZVCA 3VB4A 3O8DA 2BVXH 2V0BA 5CMXH 3BTHE 1SFIA 1Z1JA 1P06A 1DOJA 1QL8A 2Q6DA 4DGJA 3SQEE 3BTFE 4NZQA 2F9NA 1HAVA 1EZSC 1TBZH 1UK2A 4A1TA 3K6YA 1P12E 1YPHC 1GI3A 3GCHC 1GHWH 3RLWH 5FPTA 3G01A 1NM6A 2VVUA 2KAIA 1BRAA 1ABJH 4XFQA 2W3KA 4ZHLU 4IW4E 1W13U 1GI4A 3MU1A 2VIPA 1HRTH 1S81A 4QT8C 1ABIH 1YC0A 4NG9H 1RFNA 4XBBA 1HUTH 1N8OB 1EXFA 2HPQH 3QK1A 1C5QA 1G36A 1LQDB 2PSXA 3CP7A 2W26A 1TNIA 1WYKA 2Q6GA 2ZGHA 3LH3A 3Q77A 9ESTA 1ANEA 1FMGA 2HNTC 2QN5T 2FS9A 2Y5HA 1CA8B 2C8ZB 1EASA 1NRNH 1AVGH 1NROH 2WPIS 2ZA5A 2ZFQH 5PTPA 5DO4H 1HIAB 2C3SA 1TPOA 4ABDA 2ZU4A 5F8ZA 1Y3YA 1J8AA 3S0NA 2TGTA 4AFUA 1F2SE 2XC5A 4DJZB 1KLTA 2QA9E 1A5GH 1C5VA 1F5RA 1SHHB 4ESTE 2WUCA 3LGIA 5ETXA 1B5GH 3A8AA 3RXUA 1N6XA 3RC6A 1TWXB 1UTJA 4BAHB 2BQ7B 4U32A 4UD9H 3UFAA 1OKXA 1DY8A 2FOCA 2AGGX 1VJAU 2OINA 1AI8H 2R0KA 4Y7AA 1BT7A 2FP7B 2O9QA 2GKVE 4BANB 1CGIE 2A32A 4TYDA 1UVPA 1V2QT 2PKAA 4O97A 1CHGA 2J9NA 3MOCA 1C2FA 2WPLS 4YOJA 1HDTH 2YOLA 5EXMA 2ZTXA 3LOXA 4K8YA 4UFDH 2WPMS 3W94A 8GCHG 5JPMH 1O5FH 1C1PA 1SPJA 1DITH 1DVAH 2AGEX 3PLPA 4NFEA 1G2LA 1AIXH 1GWAA 4AOQA 1C1TA 5A09A 4IN2A 3UR9A 2CV3A 3SHCH 2ZU5A 2XC0A 3M3TA 3M61U 4GHTA 5HXFA 3ZVFA 1VZQH 1K1MA 1TNJA 2M5TA 3DD2H 1FN6A 2GT8A 1BBRK 2TGPZ 3BG4C 5J4SA 5EXNA 3RUOA 1LDTT 5DG6A 3QLPH
chains in the Genus database with same CATH superfamily
2AFQB 1AGJA 3M7QA 1NT1A 3UY9A 3RXRA 1LKBA 2ZDLA 1HYLA 2C93B 2FOFA 2Y82A 3BF6H 4DIIH 1SG8B 2VB0A 3DT0H 4OS7A 3RMNH 2STAE 2ZFSA 1UVTH 3SNBA 1K28D 3ZVEA 1BRBE 2Z9KA 4HI3A 1Z6EA 2ZGBH 1PYTC 1MZAA 1O3PB 1IQNA 1LPZB 1HAXB 3D23A 1K1OA 1W0JD 1C1UH 1RIWB 1TMTH 1GMDG 5EPYA 1FQ3A 1D6RA 2TPIZ 3ZVBA 1QGFA 1PQAA 2OTVA 5DKMA 1AZ8A 4ZKSU 2FI5E 3Q76A 4JYVH 2V3MA 1GI2A 4OS2A 1C2GA 2BLOA 3ESTA 1Y3XA 5L2ZH 1FLEE 2C8XB 1NESE 2J38A 5T1VA 2OXSA 2KX4A 3LGVA 2Z9LA 3URDA 1GMHG 3VB5A 2KZ4A 1E1QD 2P94A 4I31A 1J14A 1TBRH 2G5VA 3T29A 4OS1A 2OQUA 3MTYA 1SL3A 1CT0E 4BOHA 1ELDE 2PUQH 5KGOA 4O03A 3RM0H 1EKBB 1EATA 3E16B 4J2YB 2QXGA 3V12A 1L1GA 1EX3A 2J97A 4A5TS 3UQVA 4HZHA 1Z6JH 4XOJA 6ESTA 1FY5A 3MH6A 2UUJB 1AUTC 2Z6BD 3SV9A 2XBWA 1DLEA 2SGDE 2PP6A 3NUMA 5T6GA 2JETC 1CA0C 1COWD 2FESH 2JH6D 4XBCA 3MH7A 3M5LA 4OS5A 3SI3H 1ZGVA 1O31A 3KYFA 1UCYK 5B6OA 4Y10E 3VXEH 3PMJA 4AX9H 3QUMP 3RXIA 4FXGH 1EPTA 3Q00A 1SB1H 4ISHH 1L2EA 1T8NA 1V2WT 3E0NB 1H9IE 1V2KT 2FPZA 3NWUA 1MQ6A 1SR5C 3QZRA 5GPIB 2WZQA 3BTME 1QBOA 1YCPK 3NPSA 1ANDA 4BNRA 1GG6B 1A2CH 1QFKH 2Z9IA 4P02A 1GGDB 2ZDMA 2FXRA 2H2ZA 1DLKB 5FPSA 4Z6AH 1O2UA 5SGAE 3BN9A 2ZC9H 3TGJE 1E35B 1ZSLA 3P8OA 3A80A 1BMLA 1V3XA 3KQBA 1PPHE 3ZIAD 3N7DA 1ZLRA 2A7CA 3AW1A 1DPOA 3FAOA 5G4BA 1V2RT 4CBOA 4B76A 1TALA 1G3CA 2G51A 5F03A 1UTMA 3O8CA 3PMBB 1N6YA 2JIZD 3SGAE 3K9XB 3RXSA 3SU3A 1W7XH 2IOTA 2SGFE 3U1JB 2A4QA 3U8OH 1SGRE 2G55A 2UUYA 1FNIA 1LO6A 3KQDA 4ZMAH 1NRQH 1ZSKA 5CHAC 3M36A 1GJ6A 1OPHB 2OC7A 1AU8A 5C5OA 2D26C 1OWDA 1S6LA 3ZVGA 3SV6A 1THPB 4WH6A 4D9QA 1GPZA 1TABE 2OC0A 2VWOA 3DSGA 9LPRA 1SGEE 5EOKA 3AW0A 5FCKA 1V2LT 4NIXA 2HLCA 4OGXA 4ABFA 1LVYA 2EC9H 1EAXA 2XOKD 1OYTH 1G3DA 1O3NA 2AERH 1AKSA 4BTIB 2VIVA 4AB9A 1ELGA 1SOZA 1D3DB 1HNEE 1ZSJA 1AB9C 2YMSC 3QTOH 2EI7A 2OK5A 1DE7H 3GCTG 1GJ9B 3KF2A 2NU4E 3NK8A 1DX5M 3P95A 3SI4H 4IC5A 3DFLA 4UFFH 1CT2E 2XTTB 3K2UA 2GMTB 1GI1A 1C2KA 2Y6TA 1QRZA 2PGBB 2BOHB 4GPGA 3RXGA 2V6NA 1ETRH 4ISOA 1S6FA 4CREA 2JJ2D 1N1LA 1SKYE 1ZPCA 1W8BH 4A1VA 1H8IH 4FUJA 1AWFH 2P8OC 2FYRA 3A7VA 3PROA 1JXPA 1VCQA 4FOUC 4UFEH 1Z7KA 4ISLA 1BMNH 1GI0A 2AMPA 4WXIA 3H7OA 4BAQB 2ZEBA 2LPRA 4JZIA 2NU2E 4LZ1H 3RU4D 1K1LA 1Y5UT 1B0FA 2WINI 4BAKB 2R9PA 4X6OA 1ID5H 1O33A 1BBRE 2W3IA 3M5OA 4NCYA 1GCTC 3N7OA 4NIYA 3B8JA 1THSH 1TGBA 3RXAA 1ZTJA 4AC9A 2GVFA 3TH2H 2O8UA 1EOJA 2FDAA 1BQYA 2A4GA 3I77A 1BB0B 5EGMA 1LHGH 1O30A 5FHTA 1O5DH 1SLVB 3WW7A 1RD3B 5L30H 2P3TB 1P02A 2Q6FA 2P3FH 1GBBA 2IJOB 4X2WA 5EJ1A 5GXPA 5GWZA 2L6OA 3IITA 1AZZA 4AZ2B 2F4LA 3CNRA 4DG4A 3SORA 3S9AA 1O36A 3T62A 2BDYA 4Q7YA 4SGBE 3FFGA 3TGIE 4XDEA 1VITH 4KTSA 3RXPA 2IPHA 1GBDA 4INKA 1GL0E 5DP8A 5GCHF 4K1SA 1NTPA 2SNVA 3QWCH 3T5FH 4JZDH 5FX6A 2ZFTA 2ODYB 4RKOB 3OEHD 1THRH 1AVWA 1SGPE 5CHBA 4X8SH 4NSVA 3PV4A 1TAWA 2H5DA 4GHQA 1AE8H 1Y5BT 1F0RA 1Z8IB 1FPCH 4DURA 1PQ7A 2RDLA 1VJ9U 4R0IA 2G81E 5JB8S 3EE7A 3URCA 3JZ1B 3F3BA 2A5AA 1P10A 2TGDA 3OY5U 2ZCHP 2CXVA 2QC2A 4NSYA 5J4QA 1FDPA 1GVKB 2A2QH 2O8LA 1C5UA 1EZXC 1LCYA 4A6LA 3PO1B 1QCPA 5A8YA 4X6NA 3BTTE 1HJAB 6CHAB 1MAYA 2BX3A 2TRMA 4JZ1A 4YO9A 3R0FA 1MAXA 4XSKU 1SQRA 1KLIH 1O3OA 2OC8A 3UIRA 3MNCA 5EQSA 1KSNA 1UCYE 1G3BA 3PTNA 1LVOA 4I86A 6GCHF 5HMAA 1ELAA 4OS4A 4FVDA 1E79D 1L4ZA 1GHZA 3M7UA 2AIPA 2BD9A 1KYNA 2W6JD 1BBRH 4FUIA 4YESB 4BTTB 1NFYA 4Y7BA 2BD8A 1BJUA 2ZZUH 2Z9GA 4WMDA 2XBXA 5EW2H 1A0LA 1W10U 3ATKA 1CU1A 3KIDU 1P11E 1MD8A 2KFWA 1DSTA 2XC4A 1A5IA 1BMFD 1AO5A 4DIHH 1GHAF 1EB1H 5C94A 3SGQE 1P2MA 2FIRH 4ZCNA 3FP8E 3MNSA 1QJ1B 4BXWA 4AN7A 2XNDD 2Z3CA 4BTUB 4JYTA 5KEDA 1IQMA 4WWYA 2BB4A 1BHXF 1ACBE 1HFDA 3GY7A 1MUEB 3KYGA 1CBWB 4ABHA 1MZDA 1C2EA 4VGCB 1EAIA 2Z94A 2PW8H 5FAHA 1SVPA 1DS2E 3LIWA 4O3TA 2WPDD 5AVDA 1GHXH 1IQIA 5JBBS 4I8KA 3RC4A 5A8XA 1HJ9A 4TY6A 5T6DA 4WMEA 1O2WA 4ABIA 5I46H 1GMDF 3ATIA 1F92A 1MU8B 4DCDA 1LPGB 3BEFB 1C5LH 1S0QA 2XYAA 4Q7XA 3SJKA 2XBYA 1KXDA 3UNRA 2BMGB 1V2OT 2ZHQH 3SNAA 2XWBI 2GX4A 3QGNB 3QO6A 2FI4E 7ESTE 2K0QA 1DUEA 3M37A 1ELEE 3OYPA 1GJAB 3OE7D 1QB6A 3A87A 2TBSA 3EAJA 2ZDKA 2HNTE 1J16A 3T26A 1T8MA 1YM0A 1QRWA 5EIYA 2VGCB 1FY4A 2AMDA 1XUHA 3F68H 3ZYDA 3A8CA 2BY6X 3VGCC 4K60A 2UUFB 7GCHF 1ZGIA 2EI8A 5AHGH 1TQ7B 2Q1JA 1DICA 1TRNA 1V2VT 1O5AB 1XX9A 1UCYH 2BD3A 1OWJA 2ZF0H 4IGDA 4X1RU 1ETSH 2ZPQA 4A7IB 4FUFA 3UNQA 4CHAC 1DWEH 2TIOA 4IMQA 2BQWB 5JYIA 1ZTLA 4FU7A 4YT7H 1P2JA 2BDAA 1C5NH 1PJPA 4AFSA 1YCPH 4WVPE 3U1IB 1ZRKA 4YOIA 1MTNC 3QGJA 2ZHWH 1YLNA 1HPGA 1QR3E 3AAVA 2KCOA 1VGCC 1RTFB 1C5ZB 1IQJA 5BRRE 1TQ0B 1UVSH 1O3LA 2Y80A 4K1TA 5A8ZA 1FY1A 5DP9A 3A88A 1PQ8A 2C90B 1C2IA 2BDGA 1ANBA 1OWKA 4JK5A 3SJIA 3FVFB 1H1BA 1JOUB 4F4OC 2GCHF 1LHFH 3EGKH 4Q4LA 4I8HA 3C27B 1O3BA 5DP4A 1BUIA 3Q3YA 3BTGE 2ZWLH 4ABBA 5FL7D 5LH8A 2JKHA 3E8LA 1O2IA 3SU0A 5GCHG 4TWWA 2ZHDA 1WDIA 1DWBH 3MU4A 1A61H 1GBAA 4B2BA 1KDQA 4B2AA 2GZ9A 4CRFA 2GT7A 2ZFRH 4LOYH 1V2ST 1QJ7B 2PWXA 4A92A 3TK6A 2BLWA 4ABEA 3SOSA 1E1RD 3VB6A 4Y71A 1ESAA 1YF4A 4IBLH 1KXFA 5E2PA 3RXCA 1SLXB 3KHVA 1Q3XA 3SV7A 4Q2KA 1P0SH 1EPTC 3HGNA 3SU6A 2IPQX 1TX6A 1P8VC 1L1NA 1QIXB 1HLTH 3HATH 2NU1E 2P95A 4ZUHA 3TH3H 1SI5H 3A81A 5HYOA 2OBOA 4I8LA 1YLDA 1F0UA 8ESTE 3PYHA 3LC3A 4GSOA 5F8TA 2AMQA 4OGYA 2A4RA 4CRAA 2BY5X 2AS9A 2VWLA 1EAWA 5C17A 2HOBA 1C5RA 1SBWA 1Z8RA 1OOKB 5ESTE 3ZZ7A 1QBNA 6GCHG 1T8LA 1SQOA 3B9FH 3HPTB 3L3TA 8GCHF 5DP7A 1QY6A 4MG3A 2UUKB 3NRLA 2HLDD 1ARCA 3GCTF 4ZROA 5HM2A 2FS8A 1YLCA 2F83A 1XVMA 4ZHAA 1AHTH 4KGAA 2DE8A 3FZZA 1ZMLA 3VEQB 1ELVA 1MKWK 2O8TA 4D76A 4I32A 1XXFA 2PUXB 1HCGA 2FM2A 3SNEA 2H5CA 2WPKS 3U69H 1GHAG 1O3DA 1NFWA 1OP2A 1WXRA 3O8RA 2FLRH 4FETA 2FLBH 1ESTA 1RIWC 4JYUH 1IQKA 3ZZ5A 1EOLA 1G30B 5EQRA 1GDQA 1INCA 1XUGA 3SU1A 3STJA 1O2HA 5LPRA 2BLVA 3BG8A 1SGFG 3LPRA 3BIUH 1LVMA 5EPNA 1O2JA 1AFQB 3A8DA 1O5CB 3SUDA 1EJMA 3BTEE 1TA2A 4FUBA 4D9RA 2R3YA 1IQHA 3LU9B 1NRPH 4H4FA 2EY4C 3RMLH 1ZHRA 3NKKA 1IQFA 1NU9A 3DFJA 4KTCA 2SFAA 2UWLA 2H6MA 1MMJN 3TITA 1F7ZA 3MNXA 1E34B 3PRDA 3F1SB 2KR7A 2VNTA 3MU0A 1ZR0A 2HVXA 2OD3B 4LXBH 3AVZA 2F9UA 2J2UA 4HFPB 1TX7A 2QY0B 5AFYH 4DT4A 1W7GH 3BG4B 5GJ4B 1HIAA 1C2DA 3SU2A 1GJBB 3MO6A 4Q7ZA 2OP9A 3GOVB 4U2WA 3UNSA 1FJSA 2AIQA 2CHAB 1D3QB 2VBCA 2W7UA 3UTUH 7GCHG 3M7TA 3OU0A 4AYYB 1NRRH 1ELCA 1D6WA 1EQ9A 1W0YH 3Q3XA 1JMOH 1BA8B 3E6PH 3A7XA 3N7EA 1Y5AT 1FAXA 3MHWU 1O3IA 1ETTH 3LT3A 1XMNB 2BXUH 2VH6A 2ILNA 3PB1E 3T27A 1IQEA 3P6ZB 4FUHA 3UAIC 3SJOA 3ZZ6A 2BTCE 1GI9B 3GYLB 5DP5A 2ZCKP 1SGDE 2R2MB 1MQ5A 3RXMA 1FI8A 1O2KA 2RA3A 4DOQA 2FOHA 1NBME 4Y8YA 1WUNH 1QL9A 4UDWH 4HG6A 1A4WH 5FCRA 2GCHG 3RXTA 3ZZ4A 3FKSD 1V2MT 5F53A 5I25A 2KCYA 3P17H 1BTYA 1IHTH 2QF5A 4WY3A 2ZPRA 4DW2U 3DA9B 3U98H 2R0LA 1MTVA 5EG4A 4A1XA 1RTLA 1CO7E 1YPGH 3K6ZA 5TCAA 4CRDA 3GY3A 3BTDE 3F2FA 3SJ8A 3TU7H 1BOQA 4MQAA 3GDUA 4Y11E 3H7TA 2Z7FE 1OP8A 4ABAA 4ZKNU 2GZ7A 2ZU2A 3N99A 1GI5A 3ODDA 4BAOB 5T6FA 3V13A 4JZEH 3V3MA 2G00A 3UOUA 1YBWA 1MBMA 1PFXC 4BAMB 4DT7B 1GBMA 4X6PA 3STIA 2GV7A 4X2XA 1VR1H 1C4Y2 4Y79A 5L2YH 1O2GH 1W3CA 1TRYA 4YLUA 1H4WA 3GDSA 3GS9A 1FPHH 1A0JA 1O3KA 3P92A 2PV9B 2GCTB 1UHBB 2NU0E 1C9TA 1PPEE 3CS0A 3SUGA 1HV7A 3VPKA 4ABJA 1PQ5A 3RM2H 5FBIA 2PLXA 1AUJA 3U8RH 4PROA 3SUFA 1O5GH 3LJJA 2F9VA 2ZFPH 5DPAA 8KME2 2J4IA 3ZZAA 2AGIX 3T25A 1C2MA 1MKXK 1GDUA 2OCVB 2V35A 2QF3A 1BTHH 1C4V2 1TGTA 1GBHA 3MYWA 3SW2B 1K1NA 3OTJE 2XWAA 1MCTA 1T7CA 2F9BH 2W5EA 2BXTH 3RP2A 4K3JA 1O3MA 1SGYE 5FBEA 4CBNA 5HGGA 2ZTZA 2VJ1A 2BZAA 1XUKA 5DP3A 4NIWA 4HGCA 1OYQA 1WQVH 1TRMA 3U8TH 3BIVH 2GJGA 1DSUA 3JZ2B 1C2JA 2BOKA 3CENA 4Y8ZA 1SQAA 4D7FA 5IK2D 3P8FA 4YZUA 2H9TH 2GZ8A 1YPKH 2QCYA 4B73A 3RXKA 1FZZA 4ISNA 1AFEH 3A7YA 4NA9H 3PWCA 2ZPSA 2AHME 2K1QA 5A0CA 1LHDH 4NA8A 1FY3A 3D49H 2BDCA 1FXYA 2QF4A 3RXLA 1GMCG 2SGEE 3TVJB 1AB9B 2YMSB 4X1SU 5L6NH 1MU6B 3SN8A 1GVLA 3UQOA 1GHBG 2BD4A 1YPLH 3F6UH 1FIWA 4IN1A 6LPRA 1DXWA 2ANYA 5C2ZA 3IWMA 1BRUP 2HGTH 2FX4A 4OM9A 2QIQA 2FX6A 1TPSA 3GICB 2LELA 2D2DA 1T31A 4GLYA 1GJDB 1CGHA 1O3AA 1HAZB 2J34A 1O2OA 2V3OH 2JH5D 4I8GA 3E3TA 3RXEA 2O8WA 2QAAA 4MVNA 3LGUA 2P8OB 3LGYA 4Y8XA 4JMYA 1WAYB 3I29A 3SNDA 2BLQA 3V7TA 1TNHA 3RDZA 3RMMH 1K9OE 3S9BA 3RC5A 1SLWB 2WYGA 5IDKA 1TGSZ 2I6QA 3PO1C 1O2SA 3RXQA 1TNGA 3MWIU 1HJAC 4AGKA 4U01A 3UWJH 1GCTB 1K21H 3FZDA 2FWWA 2B0FA 2J94A 1GJ5H 1XUFA 3QZQA 5FXLA 1GI8B 1GBCA 1O35A 5B6LA 1IQLA 1XVOA 1S0RA 2BD5A 4Q80A 2GV6A 3UPEA 4I7YH 1C5OH 1WU1A 1SGCA 1Y3VA 5HM9A 3SYJA 2P59A 3MU5A 2WV5A 1TX8A 3E91A 3SZNA 1B0EA 4U30A 2IJD1 1HAGE 8LPRA 2EI6A 4H6SB 1G2MA 1SOTA 1HXFH 4CH2B 1LKAA 1FONA 1H9HE 3SBKA 3MH4A 1UMAH 3IG6B 1KMHB 1NN6A 1VCWA 3LDXH 1TNLA 1MKWH 2RG3A 3GISB 4CR5A 1HAVB 1ZJDA 3SGBE 2W7SA 4RI0A 7LPRA 1EFRD 3ENSB 2A7HA 3RXDA 1NZQH 4YXWD 4MNWA 1OWEA 3MI4A 2J95A 2KAIB 1C9PA 1DY9A 1CBWC 4BXSA 2VH0A 1A0HB 1C5MD 3LGTA 4CRGA 2ZU3A 1C1VH 1O2LA 2WPHS 2FOBA 1E0FD 4KELA 1YPJH 4IS5A 3P8NA 2FMJA 2PKSB 1P57B 1SGNE 1J15A 3A89A 1P2NA 1SFQB 3L6PA 1TYNA 2KCPA 3BTKE 2FOEA 4CH8B 1C1WH 1MBQA 3TIUA 3RXJA 1ZHPA 1DWCH 2FO9A 5C67A 5A0AE 1S84A 3CS7A 2JDID 1O3GA 2WHXA 4E06H 4UEHH 1YPHE 1K1PA 2QXHA 4TT3D 1HAIH 2QXIA 4ISIH 1KLJH 1S6HA 1HJ8A 1T8OA 5A0BA 4YLQH 4K1EA 2J98B 2M2AA 1TB6H 1E36B 3QDZB 2A1DB 1G9IE 1GHYH 1YKTA 1O3JA 2BY7X 3MO3A 3GY6A 2CF8H 3M3VA 3TPIZ 3NZIA 2C8WB 1XUJA 3RXHA 1QURH 3DSOA 3HGPA 3PMHB 2FEQH 3BSQA 2HVYB 3EA8A 1ZMJA 4XBDA 1EZQA 1Z8JB 2I6SA 1P9SA 5C1UA 3S7HB 1GI7B 2VIQA 1L4DA 1BMMH 2FTLE 1GBJA 1UTPA 1MCVA 3SV8A 1S85A 1K1IA 4H6TA 4B2CA 3LH1A 3AASA 1P2OA 3A7ZA 2PR3A 4DVAU 4MDSA 1KY9A 1MTUA 3W95A 1XKAC 2WUBA 2KCAA 2ULLA 1P3CA 3TGKE 1TNKA 1O39A 4MTBA 2F3CE 3NCLA 1QB9A 3WY8A 1PPGE 3UB0A 1UO6A 2QE7D 3BTWE 2ASUB 2PKAB 2BVRH 1HAPH 2YNAA 3ZZ8A 5JBTA 1N8OC 1NU7B 4MNVA 3S69A 3RXBA 1LQEA 1LPKB 5GNDA 2BY8X 1NFXA 1F5LA 3SQHE 4X1NU 2VVCA 1EJNA 3KCGH 1L1JA 3KN2A 1QRXA 3ZV9A 1D4PB 3GCOA 2GTBA 3ATWA 1HXEH 2ODQA 1M9UA 1O3EA 2ALPA 1JIMA 1KXEA 5GIBA 3MNBA 1O0DH 3NXPA 3QN7A 5DP6A 5CDFE 4AYVB 3K65B 3LGWA 2Y7ZA 1H8ED 1DDJA 2PSYA 3UREA 1MD7A 1W0KD 4XD7D 3TJUA 3FO8D 3DHKH 4NWLA 5K0HA 1G37A 4X8VH 2WV9A 1C5YB 1O2XA 1ZRBA 4MLFB 4F55A 2HALA 1XUIA 1P01A 3A82A 4Y6DA 5C3NA 2TGAA 3VGCB 4GUXA 2J92A 4IC6A 2FTMA 1TOCB 1NFUA 1P2KA 2SGAA 3UWIA 2ZO3H 3HKJB 3A7WA 1DFPA 3SZEA 1BDAA 2K8IA 3L33A 4CHAB 3T2NA 2JJ1D 1DXPA 2F43B 3GCNA 3P70B 1UTKA 3GCHB 1D3PB 3FN8A 1NRSH 4CRCA 3DSPA 2AH4X 4E7NA 1QQUA 5AF9H 4TPYA 1SHYA 3VFEA 1BTZA 1V2NT 1F5KU 1MTNB 1ZTKA 1WTHD 1E37B 3KL6A 4TPIZ 3V0XA 1NY22 1VGCB 2HWLB 2ZP0H 3S9CA 1ESBA 3ZYEA 2Z9JA 1O34A 1A7SA 1TMBH 1PPBH 3B23B 4ZKRU 4JZFH 5A2MH 1AMHA 1DUAA 3ATLA 2A2XH 3F9EA 4CR9A 1MKXH 2WSSD 1GJ7B 3ATMA 2AYWA 2FZZA 2A45B 4AGJA 4KKDA 4X2VA 1UVOA 4HTCH 2VWMA 4Y76A 1IAUA 2ZHFH 3TNSA 1H8DH 1D3TB 4ZXXH 1P09A 2V3HH 2VIDA 1AFQC 1EJAA 3ODFA 2GDEH 4XE4A 1XM1A 2QGRA 4JK6A 1HAYB 4LZ4B 2OC1A 2RA0A 3LONA 3T28A 1O2PA 1EPTB 2OQ5A 4GAWA 5C1XA 1C5XB 1HAHH 1W11U 1C5TA 5E2OA 4WXVA 1YWUA 3D62A 1CVWH 4KP0A 2GDDA 2B7DH 2XCNA 5DK1A 2XCFA 1CSOE 2W6ID 4NGAH 3KEEA 4LK4A 1O2MA 5DGJA 1BMAA 1BJVA 2B9LA 1DT2A 3EDXB 1RRKA 4YT6H 3H5CB 3GY8A 2ZCLP 4INHA 5C5NA 1Z1IA 1UTQA 1AY6H 1WSSH 4MPWA 1WOFA 2ANWA 1GBFA 2H9EH 2VVVA 1BZXE 2ZIQH 2EA3A 3ZZ9A 1GMCF 5HIZA 3VB7A 3M5NA 2Y81A 4ACBA 4AFZA 2ZTYA 3PMAB 1O2RA 1QA0A 3ELAH 2G4TA 1GHBF 2CHAC 5E8EH 1HAOH 1MH0A 4X2YA 2BX4A 1BHXB 2XXLA 1L0ZA 2BDIA 2XRCA 2VINA 4X8UH 3RU4E 1O2VA 1KTSB 4AG1A 3MQKC 4Y0YE 1CHOF 1RS0A 1CE5A 3F0OA 3O8BA 1TPAE 5ESBA 1GDNA 4X8TH 4I33A 4GCHF 5DN6D 4FU9A 3QX5H 2ZKSA 1KXCA 3KQEA 1UTLM 2VIWA 2ZDVH 1ZHMA 1A1RA 3UUZA 1ZYOA 3MFJA 3SNCA 4FUEA 3RXOA 1AVXA 1ZMNA 5FX5A 1O3CA 1FIZA 2BD7A 3ZZDA 1UTNA 3GY5A 4D7GA 4MNXA 2NWNA 2ODPA 1RXPA 1HGTH 1AKSB 3EQ0H 4B74A 1PPZA 1SGQE 1VITF 4THNH 1GG6C 2F9PA 1YPEH 3ZVAA 3PLBA 1AQ7A 2P3UB 4NIVA 4FUCA 4Z1MD 1GGDC 1K22H 1LHCH 1A5HA 4Q63A 4R8TB 1Y59T 3F9FA 4WH8A 2F9OA 5C0UA 1WQSA 3P8GA 1TIOA 4WF8A 2PFEA 5CE1A 1MTWA 2BD2A 1BIOA 4X6MA 1EUFA 3E90B 5E0JA 4Y0ZE 1H9LB 1S83A 3OX7U 1SGIB 5EJLA 1WCZA 2GGVB 3ZZCA 2P16A 2ZG0H 4GVUA 1TMUH 4UFGH 3BV9B 2D1JA 1V6DA 3ZZBA 2CMYA 3GY4A 4B6FA 1DANH 3EA9A 4OS6A 1QB1A 2SNWA 1GCDA 3OAAD 2G5NA 4MPXA 1SQTA 2A7JA 2A4OA 3EYDA 4FUDA 4ZKOU 2OUAA 3C1KA 1K1JA 1KXBA 1VCPA 1SGTA 4YOGA 5EU8A 3R3GB 2ESTE 3F2GA 2ANMH 5K7RA 1G3EA 4SGAE 5F8XA 1TPPA 2CJIA 3FP6E 7KMEH 3M5MA 1WBGB 2HPPH 3TJOA 1P9UA 3HKIB 4AB8A 1FN8A 4ZH8A 1QNJA 2ZDNA 1LHEH 2GCTC 2ZFFH 5KECA 3I78A 1ELTA 2JETB 1CA0B 1V2UT 2OBQA 3A7TA 3D65E 5IYTA 4CRBA 3HK3B 1GBIA 1UVUH 1MABB 2VWNA 1AWHB 4FU8A 2ZGCA 1Z8GA 4ABGA 3PRBA 5F6MA 2ZNKH 4ASHA 3KNXA 2PTCE 1OP0A 1O2YA 4ACAA 3TK9A 5AFZH 1LMWB 1JRTA 1P2IA 4X1PU 3FP7E 1P04A 2AEIH 1ZZZA 4H42U 2G52A 2XNIA 3VG8A 1YYY1 1ZPZA 1SGFA 4F49A 1AD8H 4M9FA 3U9AH 1PYTD 1YP9A 1FAKH 3ZVDA 2GMTC 2LNCA 4P00A 1BRCE 2NU3E 2KM0A 1PPFE 2ZGXH 3RXFA 5JBCS 4RN6A 4UE7H 1NC6A 1KTTB 3TLOA 3GYMA 2Z3EA 1Y3UA 1FY8E 2EEKA 2P93A 5JBAS 2H1UA 2FYQA 2CF9H 1U6QA 1O2QA 1WV7H 1XXDA 1IOEA 1O5BB 1EP6A 1RGQA 1TLDA 2RCEA 3F9HA 1C1NA 1HB0B 1LVBA 3SO3A 1J9CH 4JCNA 5EXLA 4RT0A 2FI3E 2STBE 1C1MA 3RLYH 1O2NA 1QQ4A 4B6EA 1PPCE 1W2KH 2V7QD 1QJ6B 2Z3DA 1C2LA 5JDUB 2ANKH 3RMOH 3LKWA 5CHAB 2C8YB 5E0GA 1OXGA 2QYIA 2CGAA 4NFFA 3Q3KA 3TJNA 1EAUA 3A83A 5ABWA 4TY7A 2J5UA 1BTWA 2FODA 4RSPA 1AN1E 1QHRB 3PV5A 2BZ6H 2BHGA 2CK3D 1WTGH 1BTPA 1YGCH 2BDHA 2UWPA 1CT4E 1SLUB 2THFB 5T3HA 3SU5A 4TWYA 3KQCA 1CGJE 2XBVA 1JIRA 1BITA 1ELBA 3OY6U 1BTUA 3WWBA 1YY3A 1CQQA 1OS8A 1ZOMA 5EW1H 2H9HA 3WWFA 1BCUH 3TH4H 1G32B 1GI6A 2Y5GA 1QZ8A 3AAUA 2UWOA 2HRVA 1A46H 1EP5A 1CHOG 1GVZA 1O32A 1Y3WA 1O3FA 5DJ7A 1DM4B 1GJCB 2R3UA 1C5SA 1S82A 2QF0A 4GCHG 4K2YA 2ZHEH 1O38A 1O37A 1OWHA 1O2TA 1O2ZA 2VIOA 2BQ6B 4YM9A 3GDVA 2C4FH 5H4IB 1V2TT 1NS3A 4NA7A 1KIGH 2OLGA 4K69A 3VXFH 3BTQE 2BM2A 1FX0B 2BY9X 5GDSH 1ZPBA 3BEIB 4KTUA 5FPYA 4AFQA 4ZXYH 1TGNA 1JRSA 3F0PA 3TJVA 4K5ZA 4B1TA 2SGPE 6CHAC 1ELFA 1IQGA 1ORFA 1VITG 1W14U 3ITIA 1ANCA 1LTOA 4NWKA 1QTFA 3GY2A 1EB2A 1TFXA 1D9IA 1K2I1 1UK3A 4NZLA 1T32A 2WV4A 1UHBA 3RU4T 1Q2WA 1C4U2 4B75A 2IN2A 3RXVA 4Z0KA 1OSSA 1TOMH 2ZU1A 2LP6A 4M7GA 1NPMA 2ZECA 2GP9B 1UJ1A 1C1QA 1P3EA 3UOPA 2CN0H 1NBMD 3PLKA 2DE9A 3LC5A 1P03A 1GBKA 3EE0B 3ZZ3A 4MPVA 2WYJA 2B5TB 1TONA 5BPEA 5C20A 2YMSD 3EA7A 1EZUC 2BVSH 1GHVH 4MPUA 2BDBA 2PKSC 3MMGA 5EODA 3VB3A 1C2HA 3SUEA 2ZGJA 1SSXA 1P2QA 2ZDAH 2BYAX 3OFND 5C1YA 4UONA 2HNTF 1IHSH 1DWDH 1YPMH 2GD4B 2R2WU 3M3SA 4WMFA 4J1YA 2ZI2H 2A5KA 1Y8TA 3SU4A 1RTKA 1T4UH 1KXAA 5EQQA 1C1SA 3HK6B 3UR6A 1O3HA 2PTNA 4ZAEA 2FOGA 2A5IA 3MO9A 2G4UA 3A8BA 4VGCC 4D8NA 2PGQB 3A85A 2Y7XA 1UW7A 2FOAA 1E38B 1T4VH 1YCPM 2YNBA 1MTSA 1AE5A 4RT1A 1QA7A 2FOMB 1OWIA 3MU8A 4AORA 1FUJA 1W12U 1P05A 3PV2A 3S7KB 1A3EH 1TBQH 1C5PA 2O8MA 1GBTA 3F9GA 1NO9H 3PTBA 3A84A 2ZQ2A 5LPEA 4RKJB 2RFKC 1O5EH 1J17T 1A3BH 3FANA 4INLA 3QTVH 4I8JA 1V2PT 1UTOA 1SMFE 1GBEA 1BTXA 3KQ5A 1C1OA 1C5WB 2VU8E 3H09A 4ZHMU 1X7AC 3KGPA 1KDQB 3ZV8A 1GL1A 2QV1A 4IMZA 1H8HD 3A86A 1C1RA 2VGCC 3TNTA 4E05H 2B8OH 4WJG2 1XKBC 1B7XB 2A0QB 2Y5FA 5C0TA 4X1QU 3LJOA 3MH5A 5LPFA 1Q31A 5JB9S 4K8BA 1ARBA 2SGQE 1TE0A 1F0TA 2RDEA 5LGOA 2ZQ1A 1JWTA 2DUCA 2F91A 4TSFD 1HBTH 2PHBA 4O9VA 4YTAA 3SJ9A 3SV2H 1TA6A 2G8TA 2D8WA 2WPJS 1GJ8B 3F2HA 1FV9A 2L74A 3OSYA 2XW9A 1W0ZU 2ALVA 1GJ4H 3TK5A 1TGCA 4X0WU 5TJXA 4MNYA 3BEUA 3M35A 1RJXB 4B71A 5TCCA 1OX1A 4E7RG 3AK5A 1Z71A 3E0PB 4FUGA 1GBLA 3DUXH 4O3UA 4AG2A 1QBVH 2JH0D 1UK4A 3E1XB 4DY7B 1JBUH 1V2JT 4FVBA 1GMHF 5E0HA 1S5SA 1ZJKA 2A31A 3SHAH 1F0SA 1SC8U 3PM3A 1QL7A 2QXJA 3PWBA 3ZVCA 3VB4A 3O8DA 2BVXH 2V0BA 5CMXH 3BTHE 1SFIA 1Z1JA 1P06A 1DOJA 1QL8A 2Q6DA 3W1EA 4DGJA 3SQEE 3BTFE 4NZQA 1K0HA 2F9NA 1HAVA 1EZSC 1TBZH 1UK2A 4A1TA 3K6YA 1P12E 3DCLA 1YPHC 1GI3A 3GCHC 1GHWH 3RLWH 5FPTA 3G01A 1NM6A 2VVUA 2KAIA 1BRAA 1ABJH 2EQNA 4XFQA 2W3KA 3FOAA 4ZHLU 4IW4E 1W13U 1GI4A 3MU1A 2VIPA 1HRTH 1S81A 4QT8C 1ABIH 1YC0A 4NG9H 1RFNA 4XBBA 1HUTH 1N8OB 1EXFA 2HPQH 3QK1A 1C5QA 1G36A 1LQDB 2PSXA 3CP7A 2W26A 1TNIA 1WYKA 5HIYA 2Q6GA 2ZGHA 3LH3A 3Q77A 9ESTA 1ANEA 1FMGA 5EJZA 2HNTC 2QN5T 2FS9A 2Y5HA 2J98A 4XRNA 1CA8B 2C8ZB 1EASA 1NRNH 1AVGH 1NROH 2WPIS 2ZA5A 2ZFQH 5PTPA 5DO4H 1HIAB 2C3SA 1TPOA 4ABDA 2ZU4A 5F8ZA 1Y3YA 1J8AA 3S0NA 2TGTA 4AFUA 1F2SE 2XC5A 4DJZB 1KLTA 2QA9E 1A5GH 3U28C 1C5VA 1F5RA 1SHHB 4ESTE 2WUCA 3LGIA 3OEED 5ETXA 1B5GH 3A8AA 3RXUA 1N6XA 3RC6A 4ASUD 1TWXB 1UTJA 4BAHB 2BQ7B 4U32A 4UD9H 3UFAA 1OKXA 1DY8A 2FOCA 2AGGX 1VJAU 2OINA 1AI8H 2R0KA 4Y7AA 1BT7A 2FP7B 2O9QA 2GKVE 4BANB 1CGIE 2A32A 4TYDA 1UVPA 1V2QT 2PKAA 4O97A 1CHGA 2J9NA 3MOCA 1OHHD 1C2FA 2WPLS 4YOJA 1HDTH 2YOLA 5EXMA 2ZTXA 3LOXA 4K8YA 4UFDH 2WPMS 3W94A 8GCHG 5JPMH 1O5FH 1C1PA 1SPJA 1DITH 1DVAH 2AGEX 3PLPA 4NFEA 1G2LA 1AIXH 1GWAA 4AOQA 1C1TA 5A09A 4IN2A 4F48B 3UR9A 2CV3A 3SHCH 2ZU5A 2XC0A 3M3TA 3M61U 4GHTA 5HKKD 5HXFA 3ZVFA 1VZQH 1K1MA 1TNJA 2M5TA 3DD2H 3OTPA 1FN6A 2GT8A 1BBRK 2TGPZ 3BG4C 1VKYA 5J4SA 5EXNA 3RUOA 1LDTT 5DSFA 5DG6A 3QLPH
chains in the Genus database with same CATH topology
2AFQB 1AGJA 3M7QA 1NT1A 3UY9A 3RXRA 1LKBA 2ZDLA 1HYLA 2C93B 2FOFA 2Y82A 3BF6H 4DIIH 1SG8B 2VB0A 3DT0H 4OS7A 3RMNH 2STAE 2ZFSA 1UVTH 3SNBA 1K28D 3ZVEA 1BRBE 2Z9KA 4HI3A 1Z6EA 2ZGBH 1PYTC 1MZAA 1O3PB 1IQNA 1LPZB 1HAXB 3D23A 1K1OA 1C1UH 1RIWB 1TMTH 1GMDG 5EPYA 1FQ3A 1D6RA 2TPIZ 3ZVBA 1QGFA 1PQAA 2OTVA 5DKMA 1AZ8A 4ZKSU 2FI5E 3Q76A 4JYVH 1GI2A 4OS2A 1C2GA 2BLOA 3ESTA 1Y3XA 5L2ZH 1FLEE 2C8XB 1NESE 2J38A 2OXSA 3LGVA 2Z9LA 3URDA 1GMHG 3VB5A 2P94A 4I31A 1J14A 1TBRH 2G5VA 3T29A 4OS1A 2OQUA 3MTYA 1SL3A 1CT0E 4BOHA 1ELDE 2PUQH 4O03A 3RM0H 1EKBB 1EATA 3E16B 4J2YB 2QXGA 3V12A 1L1GA 1EX3A 4A5TS 3UQVA 4HZHA 1Z6JH 4XOJA 6ESTA 1FY5A 3MH6A 2UUJB 1AUTC 2Z6BD 3SV9A 2XBWA 1DLEA 2SGDE 3NUMA 5T6GA 2JETC 1CA0C 2FESH 2JH6D 4XBCA 3MH7A 3M5LA 4OS5A 3SI3H 1ZGVA 1O31A 1UCYK 5B6OA 4Y10E 3VXEH 3PMJA 4AX9H 3QUMP 3RXIA 4FXGH 1EPTA 3Q00A 1SB1H 4ISHH 1L2EA 1T8NA 1V2WT 3E0NB 1H9IE 1V2KT 2FPZA 3NWUA 1MQ6A 1SR5C 3QZRA 5GPIB 3BTME 1QBOA 1YCPK 3NPSA 1ANDA 4BNRA 1GG6B 1A2CH 1QFKH 2Z9IA 1GGDB 2ZDMA 2FXRA 2H2ZA 1DLKB 5FPSA 4Z6AH 1O2UA 5SGAE 3BN9A 2ZC9H 3TGJE 1E35B 1ZSLA 3P8OA 3A80A 1BMLA 1V3XA 3KQBA 1PPHE 1ZLRA 2A7CA 3AW1A 1DPOA 3FAOA 5G4BA 1V2RT 4CBOA 4B76A 1TALA 1G3CA 2G51A 5F03A 1UTMA 3O8CA 3PMBB 1N6YA 3SGAE 3K9XB 3RXSA 3SU3A 1W7XH 2IOTA 2SGFE 3U1JB 2A4QA 3U8OH 1SGRE 2G55A 2UUYA 1FNIA 1LO6A 3KQDA 4ZMAH 1NRQH 1ZSKA 5CHAC 3M36A 1GJ6A 1OPHB 2OC7A 1AU8A 5C5OA 2D26C 1OWDA 3ZVGA 3SV6A 1THPB 4WH6A 4D9QA 1GPZA 1TABE 2OC0A 2VWOA 9LPRA 1SGEE 5EOKA 3AW0A 5FCKA 1V2LT 4NIXA 2HLCA 4OGXA 4ABFA 1LVYA 2EC9H 1EAXA 1OYTH 1G3DA 1O3NA 2AERH 1AKSA 4BTIB 2VIVA 4AB9A 1ELGA 1SOZA 1D3DB 1HNEE 1ZSJA 1AB9C 3QTOH 2EI7A 1DE7H 3GCTG 1GJ9B 3KF2A 2NU4E 3NK8A 1DX5M 3P95A 3SI4H 4IC5A 3DFLA 4UFFH 1CT2E 2XTTB 3K2UA 2GMTB 1GI1A 1C2KA 2Y6TA 1QRZA 2PGBB 2BOHB 4GPGA 3RXGA 2V6NA 1ETRH 4ISOA 1S6FA 4CREA 1N1LA 1ZPCA 1W8BH 4A1VA 1H8IH 4FUJA 1AWFH 2P8OC 2FYRA 3A7VA 3PROA 1JXPA 1VCQA 4UFEH 1Z7KA 4ISLA 1BMNH 1GI0A 2AMPA 4WXIA 3H7OA 4BAQB 2ZEBA 2LPRA 4JZIA 2NU2E 4LZ1H 3RU4D 1K1LA 1Y5UT 1B0FA 2WINI 4BAKB 2R9PA 4X6OA 1ID5H 1O33A 1BBRE 2W3IA 3M5OA 4NCYA 1GCTC 3N7OA 4NIYA 3B8JA 1THSH 1TGBA 3RXAA 1ZTJA 2GVFA 3TH2H 2O8UA 1EOJA 2FDAA 1BQYA 2A4GA 3I77A 1BB0B 5EGMA 1LHGH 1O30A 5FHTA 1O5DH 1SLVB 1RD3B 5L30H 2P3TB 1P02A 2Q6FA 2P3FH 1GBBA 2IJOB 4X2WA 5GWZA 5GXPA 3IITA 1AZZA 4AZ2B 4DG4A 3SORA 3S9AA 1O36A 3T62A 2BDYA 4Q7YA 4SGBE 3FFGA 3TGIE 4XDEA 1VITH 4KTSA 3RXPA 2IPHA 1GBDA 4INKA 1GL0E 5DP8A 5GCHF 4K1SA 1NTPA 2SNVA 3QWCH 3T5FH 4JZDH 5FX6A 2ZFTA 2ODYB 4RKOB 1THRH 1AVWA 1SGPE 4X8SH 4NSVA 3PV4A 1TAWA 2H5DA 4GHQA 1AE8H 1Y5BT 1F0RA 1Z8IB 1FPCH 4DURA 1PQ7A 2RDLA 1VJ9U 4R0IA 2G81E 5JB8S 3URCA 3JZ1B 2A5AA 1P10A 2TGDA 3OY5U 2ZCHP 2CXVA 2QC2A 4NSYA 5J4QA 1FDPA 1GVKB 2A2QH 2O8LA 1C5UA 1EZXC 1LCYA 4A6LA 3PO1B 1QCPA 5A8YA 4X6NA 3BTTE 1HJAB 6CHAB 1MAYA 2BX3A 2TRMA 4JZ1A 4YO9A 3R0FA 1MAXA 4XSKU 1KLIH 1O3OA 2OC8A 3UIRA 3MNCA 5EQSA 1KSNA 1UCYE 1G3BA 3PTNA 1LVOA 6GCHF 5HMAA 1ELAA 4OS4A 4FVDA 1L4ZA 1GHZA 3M7UA 2AIPA 2BD9A 1KYNA 4YESB 1BBRH 4FUIA 4BTTB 1NFYA 4Y7BA 2BD8A 1BJUA 2ZZUH 2Z9GA 4WMDA 2XBXA 5EW2H 1A0LA 1W10U 3ATKA 1CU1A 3KIDU 1P11E 1MD8A 1DSTA 2XC4A 1A5IA 1AO5A 4DIHH 1GHAF 1EB1H 3SGQE 1P2MA 2FIRH 3FP8E 3MNSA 1QJ1B 4BXWA 4AN7A 2Z3CA 4BTUB 4JYTA 1IQMA 4WWYA 2BB4A 1BHXF 1ACBE 1HFDA 3GY7A 1MUEB 1CBWB 4ABHA 1MZDA 1C2EA 4VGCB 1EAIA 2Z94A 2PW8H 5FAHA 1SVPA 1DS2E 3LIWA 4O3TA 5AVDA 1GHXH 1IQIA 5JBBS 4I8KA 3RC4A 5A8XA 1HJ9A 4TY6A 5T6DA 4WMEA 1O2WA 4ABIA 5I46H 1GMDF 3ATIA 1F92A 1MU8B 4DCDA 1LPGB 3BEFB 1C5LH 1S0QA 2XYAA 4Q7XA 3SJKA 2XBYA 1KXDA 3UNRA 2BMGB 1V2OT 2ZHQH 3SNAA 2XWBI 2GX4A 3QGNB 3QO6A 2FI4E 7ESTE 1DUEA 3M37A 1ELEE 3OYPA 1GJAB 1QB6A 3A87A 2TBSA 3EAJA 2ZDKA 2HNTE 1J16A 3T26A 1T8MA 1YM0A 1QRWA 2VGCB 1FY4A 2AMDA 1XUHA 3F68H 3ZYDA 3A8CA 2BY6X 3VGCC 4K60A 2UUFB 7GCHF 1ZGIA 2EI8A 5AHGH 1TQ7B 2Q1JA 1DICA 1TRNA 1V2VT 1O5AB 1XX9A 1UCYH 2BD3A 1OWJA 2ZF0H 4IGDA 4X1RU 1ETSH 2ZPQA 4A7IB 4FUFA 3UNQA 4CHAC 1DWEH 2TIOA 4IMQA 2BQWB 5JYIA 1ZTLA 4FU7A 4YT7H 1P2JA 2BDAA 1C5NH 1PJPA 4AFSA 1YCPH 4WVPE 3U1IB 1ZRKA 4YOIA 1MTNC 3QGJA 2ZHWH 1HPGA 1QR3E 3AAVA 1VGCC 1RTFB 1C5ZB 1IQJA 5BRRE 1TQ0B 1UVSH 1O3LA 2Y80A 4K1TA 5A8ZA 1FY1A 5DP9A 3A88A 1PQ8A 2C90B 1C2IA 2BDGA 1ANBA 1OWKA 4JK5A 3SJIA 3FVFB 1H1BA 1JOUB 4F4OC 2GCHF 1LHFH 3EGKH 4I8HA 3C27B 1O3BA 5DP4A 1BUIA 3Q3YA 3BTGE 2ZWLH 4ABBA 5LH8A 2JKHA 3E8LA 1O2IA 3SU0A 5GCHG 4TWWA 2ZHDA 1DWBH 3MU4A 1A61H 1GBAA 4B2BA 1KDQA 4B2AA 2GZ9A 4CRFA 2GT7A 2ZFRH 4LOYH 1V2ST 1QJ7B 2PWXA 4A92A 3TK6A 2BLWA 4ABEA 3SOSA 3VB6A 4Y71A 1ESAA 1YF4A 4IBLH 1KXFA 5E2PA 3RXCA 1SLXB 3KHVA 1Q3XA 3SV7A 4Q2KA 1P0SH 1EPTC 3HGNA 3SU6A 1TX6A 1P8VC 1L1NA 1QIXB 1HLTH 3HATH 2NU1E 2P95A 4ZUHA 3TH3H 1SI5H 3A81A 5HYOA 2OBOA 4I8LA 1YLDA 1F0UA 8ESTE 3PYHA 3LC3A 4GSOA 5F8TA 2AMQA 4OGYA 2A4RA 4CRAA 2BY5X 2AS9A 2VWLA 1EAWA 2HOBA 1C5RA 1SBWA 1Z8RA 1OOKB 5ESTE 3ZZ7A 1QBNA 6GCHG 1T8LA 1SQOA 3B9FH 3HPTB 3L3TA 5DP7A 1QY6A 4MG3A 2UUKB 1ARCA 3GCTF 4ZROA 5HM2A 2FS8A 1YLCA 2F83A 1XVMA 4ZHAA 1AHTH 4KGAA 2DE8A 3FZZA 1ZMLA 3VEQB 1ELVA 1MKWK 2O8TA 4D76A 4I32A 1XXFA 2PUXB 1HCGA 2FM2A 3SNEA 2H5CA 2WPKS 3U69H 1GHAG 1O3DA 1NFWA 1OP2A 3O8RA 2FLRH 2FLBH 1ESTA 1RIWC 4JYUH 1IQKA 3ZZ5A 1EOLA 1G30B 5EQRA 1GDQA 1INCA 1XUGA 3SU1A 3STJA 1O2HA 5LPRA 2BLVA 3BG8A 1SGFG 3LPRA 3BIUH 1LVMA 5EPNA 1O2JA 1AFQB 3A8DA 1O5CB 3SUDA 1EJMA 3BTEE 1TA2A 4FUBA 4D9RA 2R3YA 1IQHA 3LU9B 1NRPH 4H4FA 3RMLH 1ZHRA 3NKKA 1IQFA 1NU9A 3DFJA 4KTCA 2SFAA 2UWLA 2H6MA 1MMJN 3TITA 1F7ZA 3MNXA 1E34B 3F1SB 2VNTA 3MU0A 1ZR0A 2HVXA 2OD3B 4LXBH 3AVZA 2F9UA 2J2UA 4HFPB 1TX7A 2QY0B 5AFYH 1W7GH 3BG4B 5GJ4B 1HIAA 1C2DA 3SU2A 1GJBB 3MO6A 4Q7ZA 2OP9A 3GOVB 4U2WA 3UNSA 1FJSA 2AIQA 2CHAB 1D3QB 2W7UA 3UTUH 7GCHG 3M7TA 3OU0A 4AYYB 1NRRH 1ELCA 1D6WA 1EQ9A 1W0YH 3Q3XA 1JMOH 1BA8B 3E6PH 3A7XA 1Y5AT 1FAXA 3MHWU 1O3IA 1ETTH 3LT3A 1XMNB 2BXUH 2VH6A 2ILNA 3PB1E 3T27A 1IQEA 3P6ZB 4FUHA 3SJOA 3ZZ6A 2BTCE 1GI9B 3GYLB 5DP5A 2ZCKP 1SGDE 2R2MB 1MQ5A 3RXMA 1FI8A 1O2KA 2RA3A 4DOQA 2FOHA 4Y8YA 1WUNH 1QL9A 4UDWH 1A4WH 5FCRA 2GCHG 3RXTA 3ZZ4A 1V2MT 5I25A 3P17H 1BTYA 1IHTH 4WY3A 2ZPRA 4DW2U 3DA9B 3U98H 2R0LA 1MTVA 5EG4A 4A1XA 1RTLA 1CO7E 1YPGH 3K6ZA 5TCAA 4CRDA 3GY3A 3BTDE 3SJ8A 3TU7H 1BOQA 4MQAA 3GDUA 4Y11E 3H7TA 2Z7FE 1OP8A 4ABAA 4ZKNU 2GZ7A 2ZU2A 1GI5A 3ODDA 4BAOB 5T6FA 3V13A 4JZEH 3V3MA 2G00A 3UOUA 1YBWA 1MBMA 1PFXC 4BAMB 4DT7B 1GBMA 4X6PA 3STIA 2GV7A 4X2XA 1VR1H 1C4Y2 4Y79A 5L2YH 1O2GH 1W3CA 1TRYA 4YLUA 1H4WA 3GDSA 1FPHH 1A0JA 1O3KA 3P92A 2PV9B 2GCTB 1UHBB 2NU0E 1C9TA 1PPEE 3CS0A 3SUGA 1HV7A 3VPKA 4ABJA 1PQ5A 3RM2H 5FBIA 2PLXA 1AUJA 3U8RH 4PROA 3SUFA 1O5GH 3LJJA 2F9VA 2ZFPH 5DPAA 8KME2 2J4IA 3ZZAA 2AGIX 3T25A 1C2MA 1MKXK 1GDUA 2OCVB 2V35A 2QF3A 1BTHH 1C4V2 1TGTA 1GBHA 3MYWA 3SW2B 1K1NA 3OTJE 2XWAA 1MCTA 1T7CA 2F9BH 2W5EA 2BXTH 3RP2A 4K3JA 1O3MA 1SGYE 5FBEA 4CBNA 5HGGA 2ZTZA 2VJ1A 2BZAA 1XUKA 5DP3A 4NIWA 4HGCA 1OYQA 1WQVH 1TRMA 3U8TH 3BIVH 1DSUA 3JZ2B 1C2JA 2BOKA 3CENA 4Y8ZA 1SQAA 4D7FA 3P8FA 4YZUA 2H9TH 2GZ8A 1YPKH 2QCYA 4B73A 3RXKA 1FZZA 4ISNA 1AFEH 3A7YA 4NA9H 3PWCA 2ZPSA 2K1QA 5A0CA 1LHDH 4NA8A 1FY3A 3D49H 2BDCA 1FXYA 3RXLA 1GMCG 2SGEE 3TVJB 1AB9B 4X1SU 5L6NH 1MU6B 3SN8A 1GVLA 3UQOA 1GHBG 2BD4A 1YPLH 3F6UH 1FIWA 4IN1A 6LPRA 1DXWA 2ANYA 5C2ZA 3IWMA 1BRUP 2HGTH 2FX4A 2QIQA 2FX6A 1TPSA 3GICB 2D2DA 1T31A 4GLYA 1GJDB 1CGHA 1O3AA 1HAZB 2J34A 1O2OA 2V3OH 2JH5D 4I8GA 3E3TA 3RXEA 2O8WA 2QAAA 4MVNA 3LGUA 2P8OB 3LGYA 4Y8XA 4JMYA 1WAYB 3I29A 3SNDA 2BLQA 3V7TA 1TNHA 3RDZA 3RMMH 1K9OE 3S9BA 3RC5A 1SLWB 2WYGA 5IDKA 1TGSZ 2I6QA 3PO1C 1O2SA 3RXQA 1TNGA 3MWIU 1HJAC 4AGKA 4U01A 3UWJH 1GCTB 1K21H 3FZDA 2FWWA 2B0FA 2J94A 1GJ5H 1XUFA 3QZQA 5FXLA 1GI8B 1GBCA 1O35A 1IQLA 1XVOA 1S0RA 2BD5A 4Q80A 2GV6A 3UPEA 4I7YH 1C5OH 1WU1A 1SGCA 1Y3VA 5HM9A 2P59A 3MU5A 2WV5A 1TX8A 3E91A 3SZNA 1B0EA 4U30A 1HAGE 8LPRA 2EI6A 4H6SB 1G2MA 1SOTA 1HXFH 4CH2B 1LKAA 1FONA 1H9HE 3SBKA 3MH4A 1UMAH 3IG6B 1NN6A 1VCWA 3LDXH 1TNLA 1MKWH <