4ABBA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abbA02
3URDA 4B75A 4NWKA 3EA9A 3BV9B 2SGAA 3SJKA 4MNYA 3SV7A 3S69A 1AFQC 5C5NA 3A7YA 1BT7A 1P04A 1O2KA 1C1RA 1T32A 1YPHC 1HAOH 2BM2A 1FAKH 5TCCA 2AIPA 1G9IE 4WH6A 4XDEA 2YOLA 2ZC9H 2BDYA 1S6FA 4X1PU 3ITIA 4OS4A 1DUAA 5GDSH 2BZAA 1CSOE 3GCTF 4RKJB 5L2YH 1M9UA 1P2OA 1GJ6A 2CF9H 1BMLA 5JBBS 2NWNA 5F6MA 1OOKB 2VH0A 1HIAB 2BY9X 1UO6A 3F9FA 5C20A 2BD7A 1NRQH 1YKTA 1CBWC 4FUIA 1D3PB 2EI8A 2H6MA 2FYRA 1F5KU 4GHQA 2G5VA 5HYOA 3IWMA 1QIXB 1HJAB 2XTTB 1SLUB 1NC6A 2F3CE 3UWJH 1QGFA 1TNJA 5EPYA 3FVFB 3FP7E 4YLUA 1AWHB 3LT3A 2Y5HA 3ZZ4A 4BAMB 3Q77A 2GD4B 1Y59T 2V0BA 1Y8TA 1AMHA 9ESTA 3UNSA 2VNTA 4Y76A 3F9HA 5FPSA 1BTPA 5A2MH 4UE7H 3S9BA 5H4IB 3T25A 2XBXA 3S9AA 3ZVCA 1D3DB 1QBOA 1O3GA 3P92A 1NFYA 1EPTC 1F5RA 2GMTB 3ZZ8A 1HYLA 2ZU1A 2ZFPH 2FOEA 1OWJA 4Y8ZA 1YCPK 1TMBH 2AH4X 1MKWK 2J9NA 3JZ2B 5JPMH 1V2TT 3PWBA 1V2UT 3RLWH 3KEEA 1YM0A 4X2VA 1QJ6B 2ZTYA 5ESBA 3SU0A 3RUOA 1L1JA 1A1RA 1P2MA 4A1XA 3FP8E 1Z6JH 1LQDB 3SHCH 1V2RT 1ZPCA 4ABIA 1HJAC 3LONA 1XVMA 4MPWA 1KXDA 3F68H 1O5FH 3SU1A 1TPSA 1C5QA 1DSTA 2OUAA 4J2YB 4HTCH 2D1JA 3EE0B 4XE4A 2BHGA 2Q6GA 4BAKB 2WPJS 3KQCA 2J2UA 1O2OA 1SQOA 4LZ4B 1BBRE 4CREA 3UY9A 2H2ZA 1GVZA 1C1QA 2WUCA 2C8WB 3A8AA 3UPEA 1IQLA 4K2YA 1BBRK 1J16A 5EODA 1O3DA 1IHTH 4IBLH 2PSXA 2Y6TA 4BAOB 1AE8H 4FVDA 1SB1H 3C1KA 2AMQA 2VVVA 5HGGA 3VEQB 2CGAA 1CE5A 2GZ9A 4FUCA 4AORA 1GI5A 4U01A 1EXFA 1SGQE 2A32A 4LK4A 5HM2A 5DK1A 1CHGA 1C2LA 1GBEA 5FAHA 1NU7B 1AKSA 1C9PA 3MNXA 5F8ZA 3UQOA 2A7JA 3A8CA 1ABJH 2C4FH 1E37B 2PWXA 4YOIA 3L6PA 1ZHRA 2W26A 3KF2A 2HLCA 4IC6A 3SNEA 1QCPA 5DPAA 1SPJA 2P3FH 1L1GA 2GT8A 2KAIB 2NU2E 4OS6A 5CHAB 2BX3A 4BANB 1D3QB 2BQ7B 3GDUA 1DFPA 2QA9E 1TNGA 1SFIA 2FDAA 2FPZA 4H42U 3RC4A 1GBFA 4F49A 1ZTJA 1O39A 2AGGX 3A82A 3GDVA 5DP6A 1BCUH 1MTWA 1PPCE 4ABAA 2Y7ZA 2QIQA 4JK6A 2OP9A 1FUJA 1O3CA 1ZTLA 4A1VA 1ZJKA 1AIXH 1YPEH 3M3TA 1V2VT 3RU4T 4RSPA 3GY4A 1A5HA 1TMTH 4U32A 1K1NA 2GX4A 3QX5H 4X2XA 1O3PB 2FMJA 2BOKA 2R2MB 3LGIA 1ETRH 1AWFH 3PLBA 4I32A 1MQ6A 2ZA5A 1NRSH 1QA0A 5GWZA 4MVNA 1IQJA 3CS0A 2FI4E 1CGHA 1GBDA 2ZCLP 4Y10E 4AFZA 1KXFA 3BF6H 4TWWA 4Q2KA 3SJOA 2GTBA 5CHAC 3PO1C 2CJIA 4MQAA 2OXSA 1LDTT 2Y80A 2F9BH 1TGNA 1KIGH 4IW4E 1XKBC 3SUGA 3P8FA 1FIZA 4Q7ZA 1ZPBA 1EQ9A 1TLDA 3AW0A 2B9LA 1C5UA 2VWNA 1C5YB 4UFDH 3PTBA 2V35A 3BTFE 3HPTB 1AU8A 1SGFG 2BY5X 1OYTH 1GMDF 1HNEE 2FZZA 2F83A 3UWIA 3ZZAA 4ABDA 2OC7A 2VVCA 3RXKA 3ZV8A 7ESTE 3TK6A 2XC4A 2Z9LA 5HXFA 1LCYA 1ANCA 4I8JA 1HAVB 4AYYB 1XUJA 2FOAA 3R3GB 1TRNA 3L3TA 1C5WB 1ZZZA 3NWUA 5EOKA 5DKMA 3NUMA 2WPMS 4FUHA 1DWEH 4AX9H 1UVUH 3SU4A 1RXPA 1G3EA 2ZHQH 3KCGH 1GI2A 1TE0A 1VJAU 4U30A 3DD2H 3S0NA 2J38A 3U8TH 5AFZH 3K65B 4NIYA 2ODYB 1TGSZ 4AB8A 1WV7H 2P93A 4FUFA 4Y8YA 3RU4D 2STAE 2C8ZB 1BITA 2V3OH 1C2MA 3VFEA 4DW2U 1O2YA 1G36A 4A92A 1DX5M 1P2JA 3PLKA 2VJ1A 3GCNA 3A7VA 3E1XB 1AB9B 4B2AA 3K2UA 1DM4B 1C2DA 1V3XA 5HMAA 2OC8A 1FY4A 2Z9IA 1PQ5A 1GJ7B 1W10U 3BEUA 4K5ZA 1F2SE 4XBCA 5DGJA 1P57B 1Y3UA 1UK4A 1LTOA 4D76A 3T2NA 5J4QA 4X1SU 4AGKA 1A0HB 4YOGA 1C4U2 3TGIE 3W95A 2JETC 1ELGA 3DHKH 4X6PA 3SNBA 1F0RA 3AASA 8GCHG 4B73A 1TRYA 4ESTE 4CRAA 1O3AA 1HBTH 2Y7XA 2J34A 3OSYA 2AS9A 2FI5E 3T28A 4NZQA 1UVSH 3QTVH 1ACBE 1THSH 1HXEH 2Y82A 1QRWA 3QN7A 4J1YA 2OBOA 2A2XH 1C2GA 4OS2A 3OY5U 1AB9C 1G32B 1AVGH 1ARBA 1QB6A 1PPZA 1P12E 3KQEA 5DJ7A 1EKBB 4ABFA 3TJUA 1ELFA 2ZGHA 4X2YA 3ZVBA 1LHEH 1ESTA 1YCPM 1UTLM 1BJVA 1EPTA 2FOCA 4DT7B 4YM9A 3BTDE 4DURA 2A45B 2BD3A 3TGJE 1P9SA 1BRAA 3M61U 5JB8S 1D6RA 1GBJA 2XW9A 1YPLH 1BUIA 1QL7A 2F9UA 2ILNA 2Z3CA 5K7RA 1TYNA 2LNCA 3GCHB 1C5MD 1CGIE 3SGAE 3P17H 1E36B 1K2I1 1S5SA 1ZHMA 2G55A 5A8ZA 2BDGA 3PMAB 1JIMA 2G51A 8KME2 4M7GA 1NT1A 3BIUH 3PTNA 2ANWA 3SU5A 1Y3YA 2RDLA 3BIVH 3H7TA 1QRXA 3K6YA 3QLPH 1LPKB 1O3NA 2BVRH 2PLXA 3LGTA 1F0SA 1FIWA 1Y3VA 1WOFA 1DLEA 2Z94A 2QC2A 3UOUA 1TQ7B 1A4WH 4OS7A 1OWEA 4HZHA 4WXVA 3MNCA 1PQ8A 2Z3DA 5CMXH 2BTCE 1UVTH 3BTQE 3FP6E 1O30A 4Z0KA 1BRUP 4DOQA 1KLTA 1GBMA 2ODQA 2HRVA 1UTOA 2JH6D 3RXMA 5LH8A 1O3HA 1Q3XA 1RD3B 1P0SH 3TJNA 1AHTH 3VB6A 1O2IA 1P2NA 2AGIX 3AAUA 3MFJA 1O3IA 2VGCB 1BTWA 2OTVA 1H9HE 3GY3A 1IOEA 1S6HA 4CR9A 5B6OA 2P94A 2Z7FE 1O2ZA 4MDSA 3PWCA 3KQDA 3E90B 4TWYA 1CU1A 5AHGH 1ABIH 1VITH 3UQVA 2XWAA 5T3HA 1O37A 1P01A 1H4WA 3GY7A 1AI8H 1YCPH 1XX9A 3GISB 4F4OC 1MKWH 1TALA 1OP8A 2CHAB 2NU1E 4ZHMU 8LPRA 3HGPA 1IQIA 5GXPA 1G3BA 1MU6B 1WYKA 2GCHF 2XRCA 3LH1A 1YPGH 1O2SA 1LVMA 4WH8A 3WY8A 1BTHH 3SN8A 4KTSA 1BTZA 2UUYA 1QR3E 3ATLA 3LPRA 2VGCC 1MD8A 2H1UA 3GY5A 1P9UA 2ZU4A 1EJMA 3UTUH 5AVDA 1Q2WA 5EPNA 1SOZA 2FODA 3Q76A 1P09A 3E6PH 1LMWB 1KXCA 3SI3H 4FU8A 1EASA 3PYHA 3RXHA 1LPGB 4E06H 4JYUH 1GHWH 5DO4H 4CHAC 3TITA 2BMGB 1MCVA 3TH4H 2QY0B 1GG6C 1GBLA 2CHAC 2H9TH 4H6SB 3EQ0H 2BDBA 2D8WA 1LVOA 1HCGA 1O2GH 2BB4A 2PR3A 1C1WH 2ZEBA 5E0JA 2TGTA 1QQUA 1G37A 3RXLA 1NFXA 1XUGA 1NFUA 1O3MA 2VIDA 3DUXH 3RXUA 1RIWC 1EP5A 1C5RA 5DP7A 1GCTB 1QBVH 1BHXB 5FX5A 1PYTC 3SW2B 2SGQE 3M3VA 2A7CA 3M37A 3OX7U 5AF9H 5SGAE 3D65E 4MNXA 2G8TA 1W11U 1HDTH 1GI0A 4B2BA 3ZYEA 1EB1H 5FHTA 4DGJA 1KLJH 1O2XA 2GDDA 2EI6A 2BQ6B 3GY8A 2ZFFH 4ZKRU 1GVLA 5DP5A 5C1UA 1HAVA 4CRFA 1SL3A 3E16B 4O03A 2UWPA 3M7UA 1DPOA 3SUDA 1P02A 3B23B 4JYVH 4IMQA 1T8NA 1FAXA 3HATH 1O2MA 1VCPA 5C3NA 1DXPA 1EATA 1VITF 1SR5C 1UMAH 1H9IE 1YPKH 1N1LA 1P2IA 1PJPA 1OPHB 2HVXA 4ZH8A 4I33A 1O2UA 3I77A 3KQBA 1YGCH 3MH4A 3M7TA 1GGDB 2H9HA 1N8OB 4I8HA 4BTUB 4YESB 2R2WU 2THFB 3FAOA 3I78A 1KYNA 2F9NA 3ZZ3A 3E0NB 1QA7A 1ELEE 3A81A 3VPKA 4LXBH 1QQ4A 2H9EH 5LPEA 2WPLS 7GCHF 1O2QA 3VB3A 4FUGA 2M5TA 5FCKA 1DY9A 1ETTH 2GZ8A 4ZHAA 4FVBA 3BN9A 1CHOF 1S0QA 1DUEA 5GCHG 2P8OB 1KLIH 1TPPA 1QJ7B 5ETXA 1W0ZU 4YO9A 1SGIB 1HB0B 3TIUA 1HAXB 2OC1A 1H8IH 2F9OA 1ESBA 1LQEA 1S85A 4JCNA 2P3TB 3C27B 3N7OA 3TK9A 2BY7X 2GKVE 3AW1A 2BX4A 4WF8A 1TNIA 3CS7A 3TJVA 1GGDC 1DLKB 3RXBA 2DE9A 3A84A 3U8OH 1QB1A 1V2MT 1SSXA 1EUFA 1C5XB 1IHSH 1OXGA 3MH6A 1S82A 1TWXB 2QXJA 5CE1A 1GHAF 4WJG2 1JWTA 2A5KA 3QTOH 4IGDA 4BTIB 4Y71A 3TJOA 4U2WA 1HAPH 4R8TB 1GJ8B 1ZRKA 1TABE 1RGQA 4K1TA 1L4DA 1PFXC 2WPHS 5BPEA 5A09A 1C4Y2 3UR9A 2AMDA 2UUJB 3LGUA 1KXEA 1UTJA 1HRTH 1VCWA 2PTCE 2P8OC 3TU7H 3T29A 3PB1E 1LO6A 3TH2H 1ZRBA 2XBYA 1LHFH 1V2NT 4CBOA 1TQ0B 1Y5BT 3MNBA 4MPVA 1SGPE 3E0PB 1J15A 4MTBA 3FFGA 2FM2A 1GHZA 3LGWA 1O3OA 3RXTA 5L30H 3EA7A 3P6ZB 1C5VA 2GMTC 5GIBA 1GBAA 1NESE 3T27A 4DJZB 3BTHE 1HAHH 1VGCB 4B76A 3F9EA 2WINI 1FI8A 3KIDU 1A7SA 4ISLA 1TGTA 1XKAC 2FWWA 1EP6A 1BDAA 1OP2A 1ZR0A 2ZTXA 6GCHG 1O35A 4DIHH 1IQKA 3LJOA 1F92A 3RXQA 1GHBG 5I25A 2GCTB 2C90B 3MOCA 2G81E 4CH2B 4D9QA 1KXAA 3UNRA 2G5NA 3KGPA 1LKBA 4TYDA 2WV4A 3EGKH 1C2EA 2GVFA 1PPEE 1TX6A 4GCHF 2UUKB 1LKAA 1GCDA 1EJNA 1C5SA 2QXHA 3ATKA 2RA0A 2FXRA 4GHTA 2ZGCA 4GVUA 1NTPA 3SJ8A 1BQYA 3BEIB 1QFKH 5HM9A 1ZGVA 4O3UA 1U6QA 2ZDLA 2PKAB 1GJDB 2O8MA 1T7CA 5I46H 1FV9A 1O5AB 1VGCC 2HALA 3B8JA 2WPIS 2OLGA 2XWBI 2ZPRA 3P8GA 2B8OH 4XFQA 1SLXB 4WVPE 1TPAE 2F9PA 4K3JA 3LJJA 3ODDA 4KTCA 1C1NA 3GYMA 1QNJA 3CENA 3BTME 2GCTC 1O31A 1O2NA 1J14A 1LPZB 5JBCS 2P3UB 1GMCG 1OWHA 1P3EA 2YNBA 1BOQA 2ZIQH 1RS0A 1B0EA 1FDPA 3RU4E 3HGNA 4AGJA 1G2LA 1O5BB 1SI5H 1MQ5A 4MLFB 2XCNA 2ZKSA 3GDSA 3SBKA 1A3EH 2SGPE 5EQRA 1ELAA 3NPSA 3PLPA 3HK3B 1WTHD 1TOMH 2SGDE 2IPHA 5C1YA 3MH5A 1D9IA 2Y81A 2XBVA 3DFJA 5EW1H 2G00A 2PTNA 1P05A 3EYDA 2B7DH 4JZFH 1XVOA 1ZYOA 2GV6A 1AFEH 2DUCA 3QK1A 1AY6H 3HKJB 3SJ9A 1WSSH 1O3EA 4FU9A 1GMHF 1EZUC 2A7HA 4WWYA 2GZ7A 2STBE 1ELTA 4YTAA 3R0FA 4X6MA 3KNXA 3EA8A 1O2VA 3V12A 2ZP0H 5A8XA 3VB4A 5EQSA 1QL8A 2QGRA 2EI7A 1VCQA 3ZZ6A 1Z7KA 4AG2A 1MTVA 2ZFTA 4UFGH 1P2QA 1D3TB 3RM2H 1Y3XA 1FY3A 2J92A 3QGJA 5FPTA 3U8RH 2JH5D 2HPPH 3SNAA 4ZMAH 1F0UA 5E2PA 1FPHH 2JH0D 4I8KA 3VGCB 1UTQA 3UNQA 1GBCA 4ZUHA 5FBEA 5EU8A 2I6QA 1HAYB 1HUTH 4UD9H 4TY6A 3E8LA 3GY6A 4ISOA 4NA7A 4OS1A 1T8MA 3ZZBA 1SLWB 1RRKA 1UCYE 4K69A 2FYQA 2OINA 4NIWA 3K9XB 4NWLA 4VGCB 3MI4A 2HPQH 3ESTA 1QB9A 2P16A 3OU0A 1UCYK 4ZKOU 4JK5A 2OC0A 2BXUH 3LH3A 1W7XH 5K0HA 3TLOA 3MH7A 1C2HA 3LU9B 5AFYH 1D4PB 3RC5A 1K22H 1YC0A 2AYWA 2RG3A 4UDWH 1QHRB 2CV3A 2ZPQA 1UK2A 1CA0B 1FQ3A 3OY6U 2A4QA 4BNRA 1K1JA 4RN6A 1WUNH 2ZQ1A 3QDZB 1MTUA 2R0LA 3ZVGA 1SBWA 1IQEA 4IC5A 1DS2E 2BOHB 3ZZDA 2YNAA 3OTJE 5T6GA 1NM6A 4K1EA 2K1QA 1BHXF 2D26C 1EAIA 2VWLA 2A2QH 4KTUA 1MZDA 1QURH 1UTNA 4ABEA 4PROA 1DSUA 2TGDA 4WY3A 2ZFQH 1TNHA 3MMGA 3AAVA 2QYIA 3LC5A 1YLCA 3P8OA 2HGTH 2I6SA 2SNWA 1EZXC 3LDXH 2GDEH 4CR5A 4ASHA 2EEKA 3DA9B 1HIAA 2ZDNA 3P8NA 3SJIA 1C2JA 1UTKA 4WMEA 4NZLA 1NROH 1RTLA 1J17T 5JYIA 4DY7B 2ZGBH 2TPIZ 4IMZA 1DXWA 3SNCA 2FTLE 4ZROA 3SV8A 2XC5A 3P95A 2V3HH 1GI1A 1WU1A 1P8VC 4MG3A 1G2MA 4OS5A 3ENSB 2ZWLH 4ISIH 1A0JA 3G01A 1BJUA 1GI7B 1UTPA 4MPUA 1IAUA 1A3BH 5C5OA 1C1UH 4Y79A 4X8VH 2Q1JA 1XM1A 1BTYA 5EXLA 1W12U 3GCTG 1MZAA 1C1MA 1MBMA 2FX4A 4MNWA 4NA8A 1FY1A 3MU0A 1GJ9B 4KKDA 5G4BA 2Q6FA 1GJ4H 4UFEH 1AVWA 3CP7A 2A4GA 1K1LA 4NG9H 4ZAEA 1OP0A 1TX7A 1E35B 1GHVH 1KTSB 3A87A 1B5GH 1ELCA 3D23A 1SFQB 1O3BA 1V2OT 4TPYA 4WMDA 1S83A 3RXAA 3GCHC 1FPCH 1K1MA 4FXGH 1MMJN 4K60A 2ZG0H 1E0FD 1HAGE 4KELA 4LOYH 3KN2A 4QT8C 4ZKSU 2SGFE 2EC9H 3PMHB 1Z8JB 5DP3A 3TNTA 1MKXK 4K8YA 1O2LA 1W13U 2B5TB 1FLEE 3PMJA 1V2PT 4B74A 1TB6H 3ATWA 3A7ZA 2BDIA 1ZMJA 1XXFA 2ZNKH 1HJ9A 5ABWA 2CMYA 4JMYA 5F8TA 2VIVA 3PMBB 2B0FA 2PHBA 1O5GH 3MU1A 2SNVA 2A0QB 3V0XA 4DG4A 4ABJA 2ZDMA 1AUJA 1WQSA 4GUXA 4DIIH 3NXPA 1Y5AT 2W7UA 1XUKA 5EQQA 1THRH 2TRMA 1H9LB 2UWLA 1ELVA 1KSNA 1PQAA 2P59A 2Q6DA 5F8XA 1A61H 2ANYA 2XCFA 2ZI2H 2ASUB 3ZZCA 1TPOA 2G52A 3RMNH 3HK6B 4Q80A 2XBWA 2KAIA 5BRRE 2BXTH 4IN2A 1JRTA 5EXMA 2PUQH 2BYAX 1Y5UT 1MBQA 1UVPA 1C5NH 1Z1JA 1KTTB 4SGAE 1G30B 4GLYA 2ZF0H 2PKAA 2QXIA 1BTUA 1DOJA 1O2RA 3SU3A 1BBRH 1GWAA 3MWIU 2ZU3A 1NRNH 5C2ZA 1FY8E 2C8YB 1H8DH 3Q3YA 4AFUA 1Q31A 3LGVA 4INKA 4ABBA 6CHAB 2HNTE 4YT6H 1B0FA 1SOTA 1W14U 3I29A 3DT0H 1DY8A 3KHVA 3TPIZ 5TJXA 4ZKNU 4CRGA 2XNIA 3SUEA 1RFNA 1IQMA 1SGDE 4H6TA 4NGAH 5EG4A 8GCHF 2A4OA 1ELDE 1CGJE 2WUBA 1FJSA 1Z71A 4GCHG 3U9AH 3RC6A 1S84A 3BTGE 1OKXA 5FX6A 1AFQB 1JMOH 2WV5A 3SGBE 1W3CA 1GL1A 4AOQA 1LHGH 2FTMA 1ETSH 4UFFH 1T8LA 6ESTA 1W0YH 2BD5A 1E34B 2F91A 1V2WT 1O3LA 4BAQB 2BVXH 1W7GH 2TGAA 1CT4E 2Z3EA 2SGEE 1MUEB 4XSKU 1IQHA 1O2JA 3SQEE 4B2CA 1KXBA 4YZUA 1GDNA 1HGTH 4ABGA 2BLQA 1VZQH 6CHAC 4NA9H 2IOTA 3SV2H 2ZU5A 3EAJA 1OWKA 2VU8E 3URCA 1P11E 1TBRH 1ARCA 3ZV9A 2R9PA 1BMAA 4O97A 2GT7A 5FXLA 2FS8A 1K1PA 5FBIA 4E7NA 4D7GA 1SGTA 4NSYA 1IQFA 2ZO3H 3DFLA 4BAHB 3SU2A 1CBWB 1FN6A 1GCTC 4B1TA 1CT0E 4NFFA 3QO6A 1SGYE 3L33A 2CN0H 2OQ5A 2FX6A 5F03A 4INLA 3GY2A 3T5FH 1AO5A 1BMMH 2ANKH 3ZYDA 2FESH 3SZNA 1O2TA 1MCTA 3U1JB 1AQ7A 2LPRA 3UOPA 4NSVA 1ZJDA 1O3FA 3MTYA 1GMDG 1TFXA 1NU9A 1YP9A 2BY8X 3SU6A 3ZVDA 4IS5A 1EZSC 1MTSA 3U69H 3ZZ9A 2PGQB 4TY7A 4D8NA 3QZRA 1GMHG 2R0KA 1J8AA 1A2CH 1DITH 1GL0E 2BY6X 1ZPZA 3UUZA 2O8UA 1EPTB 5FCRA 4BXSA 4E05H 1TBQH 3STIA 1GHYH 1E38B 3SUFA 4UEHH 1C9TA 1CQQA 1AD8H 1EAWA 5JB9S 4Q7YA 1A5GH 2BZ6H 2VIWA 3PROA 1W8BH 1SGNE 1C5ZB 3O8CA 4O3TA 1O2PA 4NCYA 1N6YA 1K9OE 3QZQA 2ZHFH 1ZLRA 1N8OC 3TVJB 1QTFA 2A31A 3NCLA 2O8WA 2VINA 4ABHA 2BDCA 3M5LA 4JYTA 2TIOA 1DE7H 2IJOB 2J94A 1C1VH 4DVAU 1JOUB 1RTFB 5E0GA 2JKHA 4I8GA 1F0TA 2ZQ2A 2AERH 1WTGH 4K1SA 3FZDA 1QBNA 1ELBA 1A46H 4FUEA 1GBBA 5GJ4B 3RXIA 3O8BA 3BG8A 1GI6A 1NFWA 1GDQA 1TIOA 3Q00A 2PFEA 3E91A 1ZSJA 3LC3A 3E3TA 1TX8A 2VH6A 1DWDH 1UCYH 3PV4A 1EX3A 1P10A 4E7RG 3M5OA 4MNVA 1SGRE 2VIQA 2QXGA 1C1SA 3MNSA 4FU7A 1K28D 1WQVH 3ZVAA 1NRPH 1O5EH 4KP0A 2VB0A 1JBUH 1O5DH 2NU0E 1GPZA 6LPRA 4D7FA 1NRRH 1YBWA 2C8XB 2W3IA 3PM3A 2PW8H 2ODPA 4ISHH 2ULLA 1XUIA 2ZDVH 1PPGE 4X8SH 2VVUA 1HAZB 2OD3B 2HNTC 2Z9GA 2FOMB 3TNSA 2PSYA 1P2KA 3BTKE 1INCA 1GBHA 1GBIA 1H1BA 2ZZUH 1O36A 2AFQB 3GICB 1ESAA 3OYPA 1LHCH 1C4V2 1KDQB 1GVKB 5EXNA 4MPXA 4FUDA 1KY9A 3K6ZA 1O32A 1XUFA 4K8BA 3RXCA 1UHBB 2Z9JA 3RXRA 3M35A 1TA6A 3Q3KA 1HPGA 4X0WU 2VIPA 2ZFRH 5E8EH 5DP9A 2QF0A 3TH3H 3FZZA 4JZIA 4A1TA 3A85A 2J4IA 4DCDA 3T62A 5J4SA 3PO1B 3RXPA 2C3SA 1QY6A 2O8TA 1ZMNA 5LGOA 2FOBA 1C2IA 3O8DA 2R3YA 1SG8B 3A7TA 5PTPA 5EGMA 1P06A 3MO9A 1LHDH 4GPGA 3VB7A 2AIQA 3RXGA 2AMPA 1SQAA 1T4UH 1HFDA 4YOJA 5JDUB 1L0ZA 4INHA 2BD8A 3MU5A 1DICA 2PUXB 3UR6A 3A8DA 4WMFA 1F5LA 1JXPA 2XC0A 1BRBE 1C5TA 3RLYH 1ZGIA 2SFAA 3ZVEA 1K1OA 1C5LH 2R3UA 1TONA 1IQNA 4I7YH 1T4VH 3A88A 3ATIA 4X1RU 1MH0A 1F7ZA 1W2KH 2A1DB 2ALPA 2TBSA 1YYY1 2FOFA 1GJBB 3STJA 2W5EA 1C1OA 1V2ST 4JZEH 2W7SA 3RP2A 3RXSA 2EA3A 3T26A 1YLDA 5L2ZH 1XMNB 4UONA 3NK8A 4AG1A 1J9CH 2BD9A 5E2OA 2ZU2A 1G3DA 1MKXH 2PKSB 3NKKA 1PQ7A 2GGVB 2ZHEH 4Y6DA 1WAYB 1SGEE 4X6OA 4ZXYH 1Z6EA 1CO7E 3F9GA 2UWOA 4X2WA 3MO6A 5DP4A 1TNKA 2XYAA 5GPIB 1O3JA 1AVXA 1O0DH 3MU4A 5DP8A 2FS9A 2WPKS 1GI4A 4BXWA 1V2JT 1DDJA 1V2LT 4NIXA 3RXVA 5GCHF 2V6NA 2OBQA 2F9VA 1LVYA 3VXFH 1EB2A 4Y11E 3SI4H 5JBAS 1BTXA 1O38A 2GCHG 4CRDA 1FONA 1TAWA 2ZFSA 3U98H 3O8RA 2ALVA 3NZIA 7LPRA 1NS3A 2DE8A 2JETB 2BLVA 1V2QT 4Y8XA 1AN1E 1TGCA 3FANA 2Z9KA 3V3MA 2ZPSA 2HWLB 1FMGA 2BDAA 3RMOH 2PKSC 1ZHPA 3F6UH 2Z6BD 3BTWE 4THNH 1BB0B 4SGBE 5C1XA 2UUFB 5FPYA 3ZVFA 1GBTA 3VB5A 1OX1A 4NFEA 2ZDKA 2P95A 3S9CA 1OWIA 5L6NH 3MU8A 4HFPB 2ZGJA 5C67A 1QL9A 1NN6A 1RTKA 5EW2H 4X6NA 1EZQA 1O2HA 3SHAH 3VGCC 2FEQH 4H4FA 3BG4B 3LGYA 4CBNA 1ZSLA 3H7OA 3ATMA 4JZ1A 3Q3XA 3D49H 3AVZA 1S81A 4Q7XA 3SOSA 3BEFB 2O8LA 1PPBH 2AGEX 1YF4A 1MU8B 4YT7H 4GAWA 3LKWA 3MHWU 2BVSH 1TA2A 3P70B 1FXYA 1V2KT 1TBZH 4VGCC 1SLVB 1BMNH 1L1NA 4OGYA 2BLOA 1C5OH 1DVAH 1PPFE 4BTTB 1BZXE 2ZHDA 4X1NU 1JRSA 2G4UA 6GCHF 1ANEA 3S7HB 2VWMA 1NY22 3LIWA 3A80A 1TNLA 3M36A 1GI3A 1GHBF 2Y5GA 4R0IA 1ZTKA 1G3CA 1GJ5H 4I8LA 1FNIA 2TGPZ 5DG6A 2BDHA 1BIOA 2G4TA 1CA0C 3M5MA 3M5NA 3EDXB 1N6XA 1UTMA 1BA8B 3BG4C 2OQUA 2ZECA 2ESTE 3S7KB 1QJ1B 2ZGXH 3VXEH 1A0LA 1O5CB 3ZZ5A 2FO9A 4AZ2B 2NU4E 1VR1H 2RA3A 1GJAB 3UFAA 1UJ1A 1SHYA 1B7XB 1C1TA 5A0BA 1O34A 1NPMA 4HGCA 1OSSA 2ZCHP 1O2WA 2A5AA 1Z8IB 4CRCA 3GYLB 1VITG 3A7XA 3BSQA 4AFQA 5T6FA 1YPHE 1NZQH 3SGQE 1CVWH 4CH8B 1HAIH 2IN2A 1K1IA 1AE5A 2BLWA 3B9FH 1CA8B 3M3SA 2QV1A 1O3KA 1JIRA 1C5PA 1DWBH 1D6WA 1AZZA 4A7IB 1SGFA 2NU3E 2PGBB 3V13A 2A4RA 1AKSB 3IITA 1GDUA 4ISNA 1T31A 3A89A 4X8TH 3D62A 3A8BA 1OWDA 1SMFE 2WYGA 3MO3A 7KMEH 1GMCF 1YPMH 2XXLA 1O33A 2FOHA 2FOGA 8ESTE 1TGBA 4I31A 2A5IA 3RMLH 2ZTZA 7GCHG 3ZZ7A 3SO3A 1EOLA 3BTTE 4D9RA 5A0AE 2H5DA 1CHOG 2QN5T 3ODFA 1DWCH 4RKOB 4FUBA 1Z8GA 4LZ1H 2ZCKP 1PYTD 4BOHA 1MAYA 1GI9B 1RJXB 2ZDAH 1TRMA 3IG6B 3TGKE 1WBGB 4Y0YE 1Z8RA 1SGCA 9LPRA 1HV7A 2BD2A 4TPIZ 1P3CA 3W94A 1SQTA 4O9VA 1OYQA 4X1QU 2WYJA 3LOXA 4Z6AH 1GI8B 2C93B 3RXDA 1T8OA 3SQHE 3RXJA 3F1SB 2AEIH 4OGXA 3TK5A 1Z1IA 1XUHA 1GHAG 1ORFA 1S0RA 2GV7A 2HNTF 1X7AC 2H5CA 4A6LA 4A5TS 3RDZA 4AB9A 1P03A 1MTNB 2FP7B 3H5CB 2HOBA 1ZSKA 2QAAA 4CRBA 2BQWB 4X8UH 1NO9H 2CF8H 1PPHE 4CHAB 1L4ZA 1KDQA 2D2DA 3UIRA 3SORA 1GG6B 1WCZA 5LPFA 2QF3A 1DT2A 2QCYA 1UHBA 1EAUA 1VJ9U 3MYWA 3RXFA 4Y7BA 2FI3E 1LVBA 1SVPA 5T6DA 3QGNB 4YLQH 4Y0ZE 1ZMLA 1MAXA 1XXDA 2W3KA 1THPB 5IDKA 3BTEE 3SV6A 4KGAA 5E0HA 1RIWB 3U1IB 4AYVB 3A83A 1HJ8A 4JZDH 3JZ1B 3M7QA 4XBDA 4Y7AA 5A0CA 3GOVB 3SV9A 1FN8A 3RXOA 1IQGA 1MTNC 5A8YA 4IN1A 3A7WA 1BRCE 2CXVA 1AUTC 1MD7A 2PV9B 1GBKA 1L2EA 1GJCB 1Y3WA 1YPJH 4XOJA 4ZXXH 3SNDA 4AFSA 3RMMH 3KL6A 3V7TA 4FUJA 2BD4A 4B71A 5ESTE 1FZZA 1UVOA 2VWOA 5LPRA 3A86A 1CT2E 2FLRH 4WXIA 1HLTH 1OS8A 2GP9B 2OCVB 2FIRH 1ID5H 1EAXA 3RXEA 1QRZA 4ZHLU 1C1PA 1AZ8A 3GCOA 1C2FA 1EOJA 1C2KA 1K21H 3QUMP 1EJAA 1FY5A 3RM0H 2O9QA 1TMUH 2ANMH 1ZOMA 5TCAA 5JBTA 1SC8U 5IYTA 2RCEA 1ANBA 4HI3A 1TOCB 4AN7A 4GSOA 1AGJA 3ELAH 1DANH 4XBBA 1V6DA 1GHXH 3QWCH 3UREA 2J95A 2FLBH 1UK3A 3HKIB 1HXFH 2VIOA 2ZHWH 1SHHB 4NIVA 1A5IA 1ANDA 2Y5FA
chains in the Genus database with same CATH superfamily
3URDA 4B75A 4NWKA 3EA9A 3BV9B 2SGAA 3SJKA 4MNYA 3SV7A 3S69A 1AFQC 5EJ1A 5C5NA 3A7YA 1BT7A 1P04A 1O2KA 1C1RA 1T32A 1YPHC 1HAOH 2BM2A 1FAKH 2KM0A 5TCCA 2AIPA 1G9IE 4WH6A 4XDEA 2YOLA 2ZC9H 2BDYA 1S6FA 4X1PU 4FETA 3ITIA 4OS4A 3OEHD 1DUAA 5GDSH 2BZAA 1CSOE 2WSSD 3GCTF 4RKJB 5L2YH 1M9UA 1P2OA 1GJ6A 2CF9H 1BMLA 1E1RD 5JBBS 2NWNA 5F6MA 1OOKB 2VH0A 1HIAB 2CK3D 2BY9X 3OE7D 1UO6A 3F9FA 5C20A 2BD7A 1NRQH 1YKTA 1CBWC 4FUIA 1D3PB 3KYFA 2EI8A 2H6MA 2FYRA 1F5KU 4GHQA 2G5VA 5HYOA 3IWMA 2QF4A 1QIXB 1HJAB 2XTTB 1SLUB 1NC6A 2F3CE 3UWJH 1QGFA 1TNJA 5EPYA 3FVFB 3FP7E 4P00A 4YLUA 1AWHB 3LT3A 2Y5HA 3ZZ4A 4BAMB 3Q77A 2GD4B 1Y59T 2V0BA 1Y8TA 1AMHA 9ESTA 3UNSA 2VNTA 1SKYE 4Y76A 3F9HA 5FPSA 1BTPA 5A2MH 4UE7H 3S9BA 5H4IB 3T25A 2XBXA 5EJLA 3S9AA 3ZVCA 1D3DB 3FN8A 1QBOA 1O3GA 3P92A 1NFYA 1EPTC 1F5RA 2GMTB 3ZZ8A 1HYLA 2ZU1A 2ZFPH 3EE7A 2FOEA 1OWJA 4Y8ZA 1YCPK 1TMBH 2AH4X 1BMFD 1MKWK 2J9NA 5KECA 3JZ2B 5JPMH 1V2TT 5FL7D 3PWBA 1V2UT 3RLWH 3KEEA 1YM0A 1W0JD 4X2VA 1QJ6B 2ZTYA 5ESBA 3SU0A 3RUOA 1L1JA 1A1RA 1P2MA 4A1XA 3FP8E 1Z6JH 1LQDB 3SHCH 1FX0B 1V2RT 1ZPCA 4ABIA 1HJAC 2M2AA 3LONA 1XVMA 4MPWA 1KXDA 3F68H 1O5FH 3SU1A 1TPSA 1C5QA 1DSTA 2OUAA 5KGOA 4J2YB 4HTCH 2D1JA 3EE0B 4XE4A 2BHGA 2Q6GA 4BAKB 2WPJS 3KQCA 2J2UA 1O2OA 1SQOA 4LZ4B 1BBRE 4CREA 3UY9A 2H2ZA 1GVZA 3F2GA 4F55A 1C1QA 2KZ4A 2WUCA 2C8WB 3A8AA 3UPEA 1IQLA 4K2YA 1BBRK 1J16A 5EODA 1O3DA 1IHTH 4IBLH 2PSXA 2Y6TA 4BAOB 3F0OA 1AE8H 4FVDA 1SB1H 3C1KA 2AMQA 2VVVA 5HGGA 3VEQB 2CGAA 1CE5A 2GZ9A 4FUCA 4AORA 1GI5A 3FOAA 4U01A 1EXFA 1SGQE 2A32A 4LK4A 5HM2A 5DK1A 1CHGA 1C2LA 1GBEA 5FAHA 1NU7B 1AKSA 1C9PA 3MNXA 5F8ZA 3UQOA 2A7JA 3A8CA 1ABJH 2C4FH 1E37B 2PWXA 4YOIA 3L6PA 1ZHRA 2W26A 3KF2A 2HLCA 4IC6A 3SNEA 1QCPA 5DPAA 1SPJA 2P3FH 1L1GA 2GT8A 2KAIB 2NU2E 4OS6A 5CHAB 2BX3A 4BANB 1D3QB 2BQ7B 3W1EA 3GDUA 1DFPA 2KCAA 2QA9E 1TNGA 1SFIA 2FDAA 2FPZA 4H42U 3RC4A 1GBFA 4F49A 1ZTJA 1O39A 2AGGX 3A82A 3GDVA 5DP6A 1BCUH 1MTWA 1PPCE 4ABAA 2Y7ZA 2QIQA 4JK6A 2OP9A 1FUJA 1O3CA 1ZTLA 4A1VA 1ZJKA 1AIXH 1YPEH 3M3TA 2VBCA 1V2VT 3RU4T 4RSPA 3N99A 3GY4A 1A5HA 1TMTH 4U32A 1K1NA 2GX4A 3QX5H 4X2XA 1O3PB 2FMJA 2BOKA 2R2MB 3LGIA 1ETRH 1AWFH 3PLBA 4I32A 1MQ6A 2ZA5A 1NRSH 1QA0A 5GWZA 4MVNA 1IQJA 3CS0A 2FI4E 1CGHA 1GBDA 2QE7D 2ZCLP 4Y10E 4AFZA 1KXFA 3BF6H 4TWWA 4Q2KA 3SJOA 2GTBA 5CHAC 3PO1C 2CJIA 4MQAA 2OXSA 1LDTT 2Y80A 2F9BH 1TGNA 1KIGH 4IW4E 1XKBC 3SUGA 3P8FA 3PRBA 1FIZA 4Q7ZA 1ZPBA 1EQ9A 1TLDA 3AW0A 2B9LA 1C5UA 2VWNA 1C5YB 4UFDH 3PTBA 2V35A 3BTFE 3HPTB 1AU8A 1SGFG 2BY5X 1OYTH 1GMDF 1HNEE 2FZZA 2F83A 3UWIA 3ZZAA 4ABDA 2OC7A 2VVCA 3RXKA 2L6OA 3ZV8A 1YLNA 7ESTE 3TK6A 2XC4A 2Z9LA 5HXFA 3DSPA 1LCYA 1ANCA 4I8JA 1HAVB 4AYYB 1XUJA 2FOAA 1K0HA 3R3GB 1TRNA 3L3TA 1C5WB 1ZZZA 3NWUA 5EOKA 5DKMA 3NUMA 2WPMS 4FUHA 1DWEH 4AX9H 1UVUH 3SU4A 1RXPA 1G3EA 2ZHQH 3KCGH 1GI2A 1TE0A 1VJAU 4U30A 3DD2H 3S0NA 2J38A 3U8TH 5AFZH 3K65B 4NIYA 2ODYB 1TGSZ 4AB8A 1WV7H 2P93A 4FUFA 4Y8YA 3RU4D 2STAE 2C8ZB 1BITA 2V3OH 1C2MA 3VFEA 4DW2U 1O2YA 1G36A 4A92A 1DX5M 1P2JA 3PLKA 2VJ1A 3GCNA 3A7VA 4TT3D 3E1XB 1AB9B 4B2AA 3K2UA 1DM4B 1C2DA 1V3XA 5HMAA 2OC8A 1FY4A 2Z9IA 1PQ5A 1GJ7B 1W10U 3BEUA 4K5ZA 1F2SE 4XBCA 4YXWD 1UW7A 5DGJA 1P57B 1Y3UA 1UK4A 1LTOA 4D76A 3T2NA 5J4QA 4X1SU 4AGKA 1A0HB 4YOGA 1C4U2 5C0UA 3TGIE 3W95A 2JETC 1ELGA 3DHKH 5HKKD 4X6PA 3SNBA 1F0RA 3AASA 8GCHG 4B73A 1TRYA 4ESTE 2KX4A 4CRAA 1O3AA 1HBTH 2Y7XA 2J34A 4P02A 3OSYA 2AS9A 2FI5E 3PRDA 3T28A 4NZQA 1UVSH 3QTVH 1ACBE 1THSH 1HXEH 2Y82A 1QRWA 3QN7A 4J1YA 2OBOA 2A2XH 1C2GA 4OS2A 3OY5U 1AB9C 1G32B 1AVGH 1ARBA 1QB6A 1PPZA 1P12E 3KQEA 5DJ7A 1EKBB 4ABFA 3TJUA 1ELFA 2ZGHA 4X2YA 3ZVBA 1LHEH 1ESTA 1YCPM 1UTLM 1BJVA 1EPTA 2FOCA 4DT7B 4YM9A 3BTDE 4DURA 2A45B 2BD3A 3TGJE 1P9SA 1BRAA 3M61U 5JB8S 1D6RA 1GBJA 2XW9A 1YPLH 1BUIA 1QL7A 2F9UA 2ILNA 2Z3CA 5K7RA 1TYNA 2LNCA 3GCHB 2RDEA 1C5MD 1CGIE 3SGAE 3P17H 1E36B 1K2I1 1S5SA 1ZHMA 2G55A 5A8ZA 2BDGA 3PMAB 1JIMA 2G51A 8KME2 4M7GA 1NT1A 3BIUH 3PTNA 2ANWA 3SU5A 1Y3YA 2RDLA 3BIVH 3H7TA 1QRXA 3K6YA 3QLPH 1LPKB 1O3NA 2BVRH 2PLXA 3LGTA 1F0SA 1FIWA 1Y3VA 1WOFA 1YWUA 1DLEA 2Z94A 2QC2A 3UOUA 1TQ7B 1A4WH 4OS7A 4RT1A 1OWEA 4HZHA 4WXVA 3MNCA 1PQ8A 2Z3DA 5CMXH 2BTCE 1UVTH 3BTQE 4ASUD 3FP6E 1O30A 4Z0KA 1BRUP 4DOQA 1KLTA 1GBMA 2ODQA 2HRVA 1UTOA 2JH6D 4M9FA 3RXMA 5LH8A 1O3HA 1Q3XA 1RD3B 1P0SH 3TJNA 1AHTH 3VB6A 1O2IA 1P2NA 2AGIX 3AAUA 3MFJA 1O3IA 2VGCB 1BTWA 2OTVA 1H9HE 3GY3A 1IOEA 1H8ED 1S6HA 4CR9A 3DSOA 5B6OA 4TSFD 2P94A 2Z7FE 1O2ZA 4MDSA 3PWCA 3KQDA 3E90B 4TWYA 1CU1A 5AHGH 1ABIH 1VITH 3UQVA 2XWAA 5T3HA 1O37A 1P01A 1H4WA 3GY7A 1AI8H 1YCPH 1XX9A 3GISB 4F4OC 1MKWH 1TALA 1OP8A 2CHAB 2NU1E 4ZHMU 8LPRA 3HGPA 1IQIA 5GXPA 1G3BA 1MU6B 1WYKA 2GCHF 2XRCA 3LH1A 1YPGH 1O2SA 1LVMA 4WH8A 3WY8A 1BTHH 5HIZA 3SN8A 4KTSA 1BTZA 2UUYA 1QR3E 2KR7A 3ATLA 3LPRA 2VGCC 1MD8A 2H1UA 3GY5A 1P9UA 2ZU4A 1EJMA 3UTUH 5AVDA 1Q2WA 5EPNA 1SOZA 2FODA 3Q76A 1P09A 3E6PH 1LMWB 1KXCA 3SI3H 2LP6A 4FU8A 1EASA 3PYHA 3OTPA 3RXHA 1LPGB 4E06H 3KQ5A 4JYUH 1GHWH 5DO4H 4CHAC 3TITA 2BMGB 1MCVA 3TH4H 2QY0B 1GG6C 1GBLA 2CHAC 2H9TH 2JDID 4H6SB 5CHBA 3EQ0H 2BDBA 2D8WA 1LVOA 1HCGA 1O2GH 2BB4A 2PR3A 1C1WH 2ZEBA 5E0JA 2TGTA 1QQUA 1G37A 3RXLA 2YMSC 1NFXA 1XUGA 1NFUA 1O3MA 2VIDA 3DUXH 3RXUA 1RIWC 1EP5A 1C5RA 5DP7A 1GCTB 1QBVH 1BHXB 5FX5A 1PYTC 3SW2B 2SGQE 3M3VA 2A7CA 3M37A 3OX7U 5AF9H 5SGAE 3D65E 4MNXA 2G8TA 1W11U 1HDTH 1GI0A 4B2BA 3ZYEA 1EB1H 5FHTA 4DGJA 1KLJH 1O2XA 2GDDA 2EI6A 2BQ6B 3GY8A 2ZFFH 4ZKRU 1GVLA 4FOUC 5DP5A 5T1VA 1HAVA 4CRFA 1SL3A 5C1UA 3E16B 4O03A 2EY4C 2UWPA 3M7UA 1DPOA 3SUDA 1P02A 3B23B 4JYVH 4IMQA 1T8NA 1FAXA 3HATH 1O2MA 1VCPA 5C3NA 1DXPA 1EATA 1VITF 1SR5C 1UMAH 1H9IE 1YPKH 1N1LA 1P2IA 1PJPA 1OPHB 2HVXA 4ZH8A 3UAIC 4I33A 1O2UA 3I77A 3KQBA 1YGCH 4Q4LA 3MH4A 3M7TA 3NRLA 1GGDB 2H9HA 2V7QD 1N8OB 4I8HA 4BTUB 4YESB 2R2WU 2THFB 3FAOA 3I78A 1KYNA 2F9NA 3ZZ3A 3E0NB 1QA7A 1ELEE 3A81A 3VPKA 4LXBH 1QQ4A 2H9EH 5LPEA 2WPLS 7GCHF 1O2QA 3VB3A 4FUGA 2M5TA 4AC9A 5FCKA 1DY9A 1ETTH 2GZ8A 4ZHAA 4FVBA 2J98B 3BN9A 1CHOF 1S0QA 1DUEA 5GCHG 2P8OB 1KLIH 1TPPA 1QJ7B 5ETXA 1SQRA 1W0ZU 4YO9A 1SGIB 1HB0B 3TIUA 1HAXB 2OC1A 1H8IH 2F9OA 1ESBA 1LQEA 1S85A 4JCNA 2P3TB 3C27B 3N7OA 3TK9A 2BY7X 2GKVE 3AW1A 2BX4A 4WF8A 1TNIA 5DSFA 3CS7A 3TJVA 1GGDC 1DLKB 3RXBA 2DE9A 3A84A 3U8OH 1QB1A 1V2MT 1SSXA 1EUFA 1C5XB 1IHSH 1OXGA 3MH6A 1S82A 1TWXB 2QXJA 5CE1A 1GHAF 4WJG2 1JWTA 2A5KA 3QTOH 4IGDA 4BTIB 4Y71A 3TJOA 4U2WA 1HAPH 4R8TB 1GJ8B 1ZRKA 1TABE 1RGQA 4K1TA 1L4DA 1PFXC 2WPHS 5BPEA 5A09A 1C4Y2 3UR9A 2AMDA 2UUJB 3LGUA 1KXEA 1UTJA 1HRTH 1VCWA 2F4LA 2PTCE 2P8OC 3TU7H 3T29A 3PB1E 1LO6A 3TH2H 1ZRBA 2XBYA 1LHFH 1V2NT 4CBOA 1TQ0B 1Y5BT 3MNBA 4MPVA 1SGPE 3E0PB 1J15A 4MTBA 3FFGA 2FM2A 1GHZA 3LGWA 1O3OA 3RXTA 5L30H 3EA7A 3P6ZB 1C5VA 2GMTC 5GIBA 1GBAA 1NESE 3T27A 4DJZB 3OAAD 1E1QD 3BTHE 1HAHH 1VGCB 4B76A 3F9EA 2WINI 1FI8A 3KIDU 1A7SA 2WHXA 4ISLA 1TGTA 1XKAC 2FWWA 2JIZD 1EP6A 1BDAA 1OP2A 1ZR0A 2ZTXA 6GCHG 1O35A 4DIHH 1IQKA 3LJOA 1F92A 3RXQA 1GHBG 5I25A 2GCTB 2C90B 3MOCA 1EFRD 2G81E 4CH2B 4D9QA 1KXAA 3UNRA 2G5NA 3KGPA 1LKBA 4TYDA 2WV4A 3EGKH 1C2EA 2GVFA 1PPEE 1TX6A 4GCHF 2UUKB 1LKAA 4ACAA 2WV9A 1GCDA 1EJNA 1C5SA 2QXHA 3ATKA 2RA0A 2FXRA 3F2HA 4GHTA 2ZGCA 4GVUA 1NTPA 3SJ8A 1BQYA 3BEIB 1QFKH 5HM9A 1ZGVA 4O3UA 1U6QA 2ZDLA 2PKAB 1GJDB 2O8MA 1T7CA 5I46H 1FV9A 1O5AB 2GJGA 1VGCC 2HALA 3B8JA 2WPIS 2OLGA 2XWBI 5C94A 2ZPRA 3P8GA 2B8OH 4XFQA 1SLXB 4WVPE 1TPAE 2F9PA 4K3JA 3LJJA 3ODDA 4KTCA 1C1NA 3GYMA 1QNJA 3CENA 3BTME 2GCTC 1O31A 1O2NA 3UB0A 1J14A 1LPZB 5JBCS 2P3UB 1GMCG 1OWHA 1P3EA 2YNBA 1BOQA 2ZIQH 1RS0A 1B0EA 1FDPA 3RU4E 3HGNA 4AGJA 1G2LA 1O5BB 1SI5H 1MQ5A 4MLFB 2XCNA 2ZKSA 3GDSA 3SBKA 2F43B 1A3EH 2SGPE 5EQRA 1ELAA 3NPSA 3PLPA 2JJ2D 3HK3B 1WTHD 1TOMH 2SGDE 3ZIAD 2IPHA 5C1YA 3MH5A 1D9IA 2Y81A 2XBVA 3DFJA 5EW1H 2G00A 2PTNA 1P05A 3EYDA 2B7DH 4JZFH 1XVOA 2J5UA 2EQNA 1ZYOA 2GV6A 1AFEH 2DUCA 3QK1A 1AY6H 3HKJB 3SJ9A 1WSSH 1O3EA 4FU9A 1GMHF 1EZUC 2A7HA 4WWYA 2GZ7A 2STBE 1ELTA 4YTAA 3R0FA 4X6MA 3KNXA 3EA8A 1O2VA 3V12A 2ZP0H 5A8XA 3VB4A 5EQSA 1QL8A 1YY3A 2QGRA 2EI7A 1VCQA 3ZZ6A 1Z7KA 4AG2A 1MTVA 2ZFTA 5IK2D 4UFGH 1P2QA 1D3TB 3RM2H 1Y3XA 1FY3A 2J92A 3QGJA 5FPTA 3U8RH 2JH5D 2HPPH 3SNAA 4ZMAH 1F0UA 5E2PA 1FPHH 2JH0D 4I8KA 3VGCB 1UTQA 3UNQA 1GBCA 4ZUHA 5FBEA 5EU8A 2I6QA 1S6LA 1HAYB 1HUTH 4UD9H 4TY6A 3E8LA 3GY6A 4ISOA 4NA7A 4OS1A 1T8MA 3ZZBA 1SLWB 1RRKA 1UCYE 4K69A 2FYQA 2OINA 4NIWA 4F48B 3K9XB 4NWLA 4VGCB 3MI4A 2HPQH 5EJZA 3ESTA 1QB9A 2P16A 3OU0A 1UCYK 4ZKOU 4JK5A 2OC0A 2BXUH 3LH3A 1W7XH 5K0HA 3TLOA 3MH7A 1C2HA 3LU9B 5AFYH 1D4PB 3RC5A 1K22H 1YC0A 2AYWA 2RG3A 4UDWH 1QHRB 2CV3A 2ZPQA 1UK2A 1CA0B 1FQ3A 3OY6U 2A4QA 4BNRA 1K1JA 2RFKC 4RN6A 1WUNH 2ZQ1A 2XOKD 3QDZB 1MTUA 2R0LA 3ZVGA 1SBWA 1IQEA 4IC5A 1DS2E 2BOHB 3ZZDA 2YNAA 3OTJE 5T6GA 1NM6A 4K1EA 2K1QA 3PV2A 1BHXF 5C17A 2D26C 1EAIA 2VWLA 2A2QH 4KTUA 1MZDA 1QURH 1UTNA 3N7DA 4ABEA 4PROA 1DSUA 2TGDA 4WY3A 2ZFQH 5C0TA 1TNHA 3MMGA 3AAVA 2QYIA 3LC5A 1YLCA 3P8OA 2HGTH 2I6SA 2SNWA 1EZXC 3LDXH 2GDEH 4CR5A 4ASHA 2EEKA 3DA9B 1HIAA 2ZDNA 3P8NA 3SJIA 4B6FA 1C2JA 1UTKA 4OM9A 4WMEA 4NZLA 1NROH 1RTLA 1J17T 5JYIA 4DY7B 2ZGBH 2TPIZ 4IMZA 1DXWA 3SNCA 2FTLE 4ZROA 3SV8A 2XC5A 3P95A 2V3HH 1GI1A 1WU1A 1P8VC 2J98A 4MG3A 1G2MA 4OS5A 2JJ1D 3ENSB 2ZWLH 4ISIH 1A0JA 3G01A 1BJUA 1GI7B 1UTPA 4MPUA 1IAUA 2OK5A 1A3BH 4Z1MD 5C5OA 1C1UH 4Y79A 4X8VH 2Q1JA 1XM1A 1BTYA 5EXLA 1W12U 3GCTG 1MZAA 1C1MA 1MBMA 2FX4A 4MNWA 4NA8A 1FY1A 3MU0A 1GJ9B 4KKDA 5CDFE 5G4BA 2Q6FA 1GJ4H 4UFEH 1AVWA 3CP7A 2A4GA 1K1LA 4NG9H 4ZAEA 1OP0A 1TX7A 1E35B 1GHVH 1KTSB 3A87A 1B5GH 1ELCA 3D23A 1SFQB 1O3BA 1V2OT 2YMSD 4TPYA 4WMDA 1S83A 3RXAA 3GCHC 1FPCH 1K1MA 4FXGH 1MMJN 4K60A 2ZG0H 1E0FD 1HAGE 4KELA 4LOYH 3KN2A 4QT8C 4ZKSU 2SGFE 2EC9H 3PMHB 1Z8JB 5DP3A 3TNTA 1MKXK 4K8YA 1O2LA 1W13U 2B5TB 1FLEE 3PMJA 1V2PT 4B74A 1TB6H 3ATWA 3A7ZA 2BDIA 1ZMJA 1XXFA 2ZNKH 1HJ9A 5ABWA 2CMYA 4JMYA 5F8TA 2VIVA 3PMBB 2B0FA 2PHBA 1O5GH 3MU1A 2SNVA 2A0QB 3V0XA 4DG4A 1VKYA 4ABJA 2ZDMA 1AUJA 1WQSA 4GUXA 4DIIH 3NXPA 1Y5AT 2W7UA 1XUKA 5EQQA 1THRH 2TRMA 4XRNA 1H9LB 2AHME 2UWLA 1ELVA 1KSNA 1PQAA 2P59A 2Q6DA 3PV5A 5F8XA 1A61H 2ANYA 2XCFA 2ZI2H 2HVYB 2ASUB 3ZZCA 1TPOA 2G52A 3RMNH 3HK6B 4Q80A 2XBWA 2KAIA 5BRRE 2BXTH 4IN2A 1JRTA 5EXMA 2L74A 2PUQH 2BYAX 1Y5UT 1MBQA 1UVPA 1C5NH 1Z1JA 1KTTB 4SGAE 1G30B 4GLYA 2ZF0H 2PKAA 2QXIA 1BTUA 1DOJA 1O2RA 3SU3A 1BBRH 1GWAA 3MWIU 2ZU3A 1NRNH 5C2ZA 1FY8E 2C8YB 3GS9A 1H8DH 3Q3YA 1H8HD 4AFUA 1Q31A 3LGVA 4INKA 4ABBA 6CHAB 2HNTE 4YT6H 1B0FA 1SOTA 1W14U 3I29A 3DT0H 1DY8A 3KHVA 3TPIZ 5TJXA 4ZKNU 4CRGA 2XNIA 3SUEA 1RFNA 1IQMA 1SGDE 4H6TA 4NGAH 5EG4A 8GCHF 2A4OA 1ELDE 1CGJE 4Q63A 2WUBA 1FJSA 1Z71A 4GCHG 5F53A 3U9AH 3RC6A 1S84A 3BTGE 1OKXA 5FX6A 1AFQB 1JMOH 2WV5A 3SGBE 1W0KD 1W3CA 1GL1A 4AOQA 1LHGH 2FTMA 1ETSH 4UFFH 1T8LA 6ESTA 1W0YH 2BD5A 1E34B 2F91A 1V2WT 1O3LA 4BAQB 2BVXH 1W7GH 2TGAA 1CT4E 2IJD1 3OEED 2Z3EA 2SGEE 1MUEB 4XSKU 1IQHA 1O2JA 3H09A 3SQEE 4B2CA 1KXBA 4YZUA 1GDNA 1HGTH 4ABGA 2BLQA 1VZQH 6CHAC 4NA9H 2IOTA 3SV2H 2ZU5A 3EAJA 1OWKA 2VU8E 3URCA 1P11E 1TBRH 1ARCA 3ZV9A 2R9PA 1BMAA 4O97A 2V3MA 2GT7A 3F0PA 1NBMD 5FXLA 2FS8A 1K1PA 5FBIA 4E7NA 4D7GA 1SGTA 4NSYA 1IQFA 2ZO3H 3DFLA 4BAHB 3SU2A 1CBWB 1FN6A 1GCTC 4B1TA 1CT0E 4NFFA 3QO6A 1SGYE 3L33A 2CN0H 2OQ5A 2FX6A 5F03A 4INLA 3GY2A 3T5FH 1AO5A 1BMMH 2ANKH 3ZYDA 2FESH 3SZNA 1O2TA 1MCTA 3U1JB 1AQ7A 2LPRA 3UOPA 4NSVA 1ZJDA 1O3FA 3MTYA 1GMDG 1TFXA 1NU9A 1YP9A 2BY8X 3SU6A 3ZVDA 4IS5A 1EZSC 1MTSA 3U69H 3SZEA 2W6ID 3ZZ9A 2PGQB 4TY7A 4D8NA 3QZRA 1GMHG 2R0KA 1J8AA 1A2CH 1DITH 1GL0E 2BY6X 1ZPZA 3UUZA 2O8UA 1EPTB 5FCRA 4BXSA 4E05H 1TBQH 3STIA 1GHYH 1E38B 3SUFA 4UEHH 1C9TA 1CQQA 1AD8H 1EAWA 5JB9S 4Q7YA 2HLDD 1A5GH 1COWD 2BZ6H 2VIWA 3PROA 1W8BH 1SGNE 1C5ZB 3O8CA 4O3TA 1O2PA 4NCYA 1N6YA 1K9OE 1WXRA 4DT4A 3QZQA 2ZHFH 1ZLRA 1N8OC 3TVJB 1OHHD 1QTFA 2A31A 3NCLA 2O8WA 2VINA 4ABHA 2BDCA 3M5LA 4JYTA 2TIOA 1DE7H 2IJOB 2J94A 1C1VH 3DCLA 4DVAU 1JOUB 1RTFB 5E0GA 2JKHA 4I8GA 1F0TA 2ZQ2A 2AERH 1WTGH 4K1SA 3FZDA 1QBNA 1ELBA 1A46H 4FUEA 1GBBA 5GJ4B 3RXIA 3O8BA 3BG8A 1GI6A 1NFWA 1GDQA 1TIOA 3Q00A 2PFEA 3E91A 2KCOA 1ZSJA 3LC3A 3E3TA 1TX8A 2VH6A 1DWDH 1UCYH 3PV4A 1EX3A 1P10A 3U28C 4E7RG 3M5OA 4MNVA 1SGRE 2VIQA 2QXGA 1C1SA 3MNSA 4FU7A 1K28D 1WQVH 3ZVAA 1NRPH 1O5EH 4KP0A 2VB0A 2KCPA 1JBUH 1O5DH 2NU0E 1GPZA 6LPRA 4D7FA 1NRRH 1YBWA 2C8XB 2W3IA 3PM3A 2PW8H 2ODPA 4ISHH 2ULLA 1XUIA 2ZDVH 1PPGE 4X8SH 2VVUA 5DN6D 1HAZB 2OD3B 2HNTC 2Z9GA 2FOMB 3TNSA 2PSYA 1P2KA 3BTKE 2WPDD 1INCA 3CNRA 1GBHA 1GBIA 1H1BA 2ZZUH 1O36A 2AFQB 3GICB 1ESAA 3OYPA 1LHCH 1C4V2 1KDQB 1GVKB 5EXNA 4MPXA 4FUDA 1KY9A 3K6ZA 1O32A 1XUFA 4K8BA 3RXCA 1UHBB 3WWFA 2Z9JA 3RXRA 3M35A 1TA6A 3Q3KA 1HPGA 4X0WU 2VIPA 2ZFRH 5E8EH 5DP9A 4ZCNA 2QF0A 3TH3H 3FZZA 4JZIA 4A1TA 3N7EA 3A85A 2J4IA 4DCDA 3T62A 5J4SA 3PO1B 3RXPA 2C3SA 1QY6A 1QZ8A 2O8TA 1ZMNA 5LGOA 2FOBA 1C2IA 3O8DA 2R3YA 1SG8B 1WDIA 3A7TA 5PTPA 5EGMA 1P06A 3MO9A 1LHDH 4GPGA 3VB7A 2AIQA 3RXGA 2AMPA 1SQAA 1T4UH 1HFDA 4YOJA 5JDUB 1L0ZA 4INHA 2BD8A 3MU5A 1DICA 2PUXB 3UR6A 3A8DA 4WMFA 1F5LA 1JXPA 2XC0A 1BRBE 1C5TA 3RLYH 1ZGIA 2SFAA 3ZVEA 1K1OA 1C5LH 2R3UA 1TONA 1IQNA 4I7YH 1T4VH 3A88A 3ATIA 4X1RU 1MH0A 3MQKC 1F7ZA 1W2KH 2A1DB 2ALPA 2TBSA 1YYY1 2FOFA 1GJBB 3STJA 2W5EA 1C1OA 1V2ST 4JZEH 2W7SA 3RP2A 3RXSA 2EA3A 3T26A 1YLDA 3F3BA 5L2ZH 1XMNB 4UONA 3NK8A 4AG1A 1J9CH 2BD9A 5E2OA 2ZU2A 1G3DA 1MKXH 2PKSB 2K0QA 3NKKA 1PQ7A 2GGVB 2ZHEH 4Y6DA 1WAYB 1SGEE 4X6OA 4ZXYH 1Z6EA 1CO7E 3F9GA 2UWOA 4X2WA 3MO6A 5DP4A 1TNKA 2XYAA 5GPIB 1O3JA 1AVXA 1O0DH 3MU4A 5DP8A 2FS9A 2WPKS 1GI4A 4BXWA 1V2JT 1DDJA 1V2LT 4NIXA 3RXVA 5GCHF 5EIYA 2V6NA 5KEDA 2OBQA 2F9VA 1LVYA 3VXFH 1EB2A 4Y11E 3SI4H 5JBAS 1BTXA 1O38A 2GCHG 2IPQX 4CRDA 1FONA 1TAWA 2ZFSA 3U98H 3O8RA 2ALVA 3NZIA 7LPRA 1NS3A 2DE8A 2JETB 2BLVA 1V2QT 4Y8XA 1AN1E 1TGCA 3FANA 2Z9KA 3V3MA 2ZPSA 2HWLB 1FMGA 1E79D 2BDAA 3RMOH 2PKSC 1ZHPA 3F6UH 2Z6BD 3BTWE 4THNH 1BB0B 4SGBE 5C1XA 4RT0A 2UUFB 5FPYA 3ZVFA 1GBTA 3VB5A 1OX1A 4NFEA 2ZDKA 2P95A 3S9CA 1OWIA 5L6NH 3MU8A 4HFPB 2ZGJA 5C67A 1QL9A 1NN6A 1RTKA 5EW2H 4X6NA 1EZQA 1O2HA 3SHAH 3VGCC 2FEQH 4H4FA 3BG4B 3LGYA 4CBNA 1ZSLA 3H7OA 3ATMA 4JZ1A 3Q3XA 3D49H 3AVZA 1S81A 4Q7XA 3SOSA 3BEFB 2O8LA 1PPBH 5HIYA 2AGEX 1YF4A 1MU8B 4YT7H 4GAWA 3LKWA 3MHWU 2BVSH 1TA2A 3P70B 1FXYA 1V2KT 1TBZH 4VGCC 1SLVB 1BMNH 1L1NA 4OGYA 2BLOA 1C5OH 1DVAH 1PPFE 4XD7D 1BZXE 4BTTB 2ZHDA 4X1NU 1JRSA 2G4UA 6GCHF 1ANEA 3S7HB 2VWMA 1NY22 3LIWA 3A80A 1TNLA 3M36A 1GI3A 1GHBF 3AK5A 2Y5GA 4R0IA 1ZTKA 1G3CA 1GJ5H 4I8LA 1FNIA 5B6LA 2TGPZ 5DG6A 2BDHA 1BIOA 2G4TA 1CA0C 3M5MA 3M5NA 3EDXB 1N6XA 1UTMA 4HG6A 1BA8B 3BG4C 2OQUA 2ZECA 2ESTE 3S7KB 1QJ1B 2ZGXH 3DSGA 3VXEH 1A0LA 1O5CB 3ZZ5A 2FO9A 4AZ2B 2NU4E 1VR1H 2RA3A 1GJAB 3UFAA 1UJ1A 1SHYA 2KCYA 1B7XB 1C1TA 2LELA 3VG8A 5A0BA 1O34A 1NPMA 4HGCA 1OSSA 2ZCHP 1O2WA 2A5AA 1Z8IB 4CRCA 3GYLB 1VITG 3A7XA 3BSQA 4AFQA 5T6FA 1YPHE 1NZQH 3SGQE 1CVWH 2XNDD 4CH8B 1HAIH 2IN2A 1K1IA 1AE5A 2BLWA 3B9FH 1CA8B 3M3SA 2WZQA 2QV1A 1O3KA 1JIRA 1C5PA 1DWBH 1D6WA 1AZZA 4A7IB 1SGFA 2NU3E 2PGBB 3V13A 2A4RA 1AKSB 2K8IA 3IITA 1GDUA 4ISNA 1T31A 3A89A 4X8TH 3D62A 3A8BA 1OWDA 1SMFE 2WYGA 3MO3A 7KMEH 1GMCF 1YPMH 2XXLA 1O33A 2FOHA 2FOGA 8ESTE 1TGBA 4I31A 2A5IA 3RMLH 2ZTZA 7GCHG 3ZZ7A 3SO3A 3SYJA 1EOLA 3BTTE 4D9RA 5A0AE 2H5DA 1CHOG 2QN5T 3ODFA 1DWCH 3FKSD 4FUBA 4RKOB 1Z8GA 3F2FA 2ZCKP 4LZ1H 1PYTD 4BOHA 1MAYA 5GNDA 1GI9B 1RJXB 2ZDAH 1TRMA 3IG6B 3TGKE 1WBGB 4Y0YE 1Z8RA 1SGCA 9LPRA 1HV7A 2BD2A 4TPIZ 1P3CA 3W94A 1SQTA 4O9VA 1OYQA 4X1QU 2WYJA 3LOXA 4Z6AH 1GI8B 2C93B 3RXDA 1T8OA 3SQHE 3RXJA 3F1SB 2AEIH 4OGXA 3TK5A 1Z1IA 1XUHA 1GHAG 1ORFA 1S0RA 2GV7A 2HNTF 3KYGA 1X7AC 1MABB 3WWBA 2H5CA 4A6LA 4A5TS 3RDZA 4AB9A 1P03A 1MTNB 2FP7B 3H5CB 2HOBA 1ZSKA 2QAAA 4CRBA 2QF5A 2BQWB 3WW7A 4X8UH 4RI0A 4I86A 1NO9H 2CF8H 1PPHE 4CHAB 1L4ZA 1KDQA 2D2DA 3UIRA 3SORA 1GG6B 1WCZA 5LPFA 2QF3A 1DT2A 2QCYA 1UHBA 1EAUA 1VJ9U 3MYWA 3RXFA 3FO8D 4Y7BA 2FI3E 1LVBA 1SVPA 5T6DA 3OFND 3QGNB 4YLQH 4Y0ZE 1ZMLA 1MAXA 2YMSB 1XXDA 2W3KA 1THPB 5IDKA 3BTEE 3SV6A 4KGAA 5E0HA 1RIWB 3U1IB 4AYVB 3A83A 1HJ8A 4JZDH 3JZ1B 3M7QA 4XBDA 4Y7AA 1NBME 5A0CA 3GOVB 3SV9A 1FN8A 3RXOA 1IQGA 1MTNC 5A8YA 4IN1A 3A7WA 1BRCE 2CXVA 1AUTC 1MD7A 4B6EA 2PV9B 1GBKA 1L2EA 1GJCB 1Y3WA 1YPJH 4XOJA 4ZXXH 3SNDA 1KMHB 3RMMH 4AFSA 3KL6A 3V7TA 4FUJA 4ACBA 2BD4A 4B71A 5ESTE 1FZZA 1UVOA 2VWOA 2PP6A 5LPRA 3A86A 1CT2E 2FLRH 4WXIA 1HLTH 1OS8A 2GP9B 2OCVB 2FIRH 1ID5H 1EAXA 3RXEA 1QRZA 4ZHLU 1C1PA 1AZ8A 3GCOA 1C2FA 1EOJA 1C2KA 2J97A 1K21H 3QUMP 1EJAA 1FY5A 3RM0H 2O9QA 1TMUH 2ANMH 1ZOMA 5TCAA 5JBTA 1SC8U 5IYTA 2RCEA 1ANBA 4HI3A 1TOCB 4AN7A 4GSOA 1AGJA 3ELAH 1DANH 4XBBA 1V6DA 1GHXH 3QWCH 3UREA 2J95A 2FLBH 1UK3A 2W6JD 3HKIB 1HXFH 2VIOA 2ZHWH 1SHHB 4NIVA 1A5IA 1ANDA 2Y5FA 2KFWA
chains in the Genus database with same CATH topology
3URDA 4B75A 4NWKA 3EA9A 3BV9B 2SGAA 3SJKA 4MNYA 3SV7A 3S69A 1AFQC 5C5NA 3A7YA 1BT7A 1P04A 1O2KA 1C1RA 1T32A 1YPHC 1HAOH 2BM2A 1FAKH 5TCCA 2AIPA 1G9IE 4WH6A 4XDEA 2YOLA 2ZC9H 2BDYA 1S6FA 4X1PU 3ITIA 4OS4A 1DUAA 5GDSH 2BZAA 1CSOE 3GCTF 4RKJB 5L2YH 1M9UA 1P2OA 1GJ6A 2CF9H 1BMLA 5JBBS 2NWNA 5F6MA 1OOKB 2VH0A 1HIAB 2BY9X 1UO6A 3F9FA 5C20A 2BD7A 1NRQH 1YKTA 1CBWC 4FUIA 1D3PB 2EI8A 2H6MA 2FYRA 1F5KU 4GHQA 2G5VA 5HYOA 3IWMA 1QIXB 1HJAB 2XTTB 1SLUB 1NC6A 2F3CE 3UWJH 1QGFA 1TNJA 5EPYA 3FVFB 3FP7E 4YLUA 1AWHB 3LT3A 2Y5HA 3ZZ4A 4BAMB 3Q77A 2GD4B 1Y59T 2V0BA 1Y8TA 1AMHA 9ESTA 3UNSA 2VNTA 4Y76A 3F9HA 5FPSA 1BTPA 5A2MH 4UE7H 3S9BA 5H4IB 3T25A 2XBXA 3S9AA 3ZVCA 1D3DB 1QBOA 1O3GA 3P92A 1NFYA 1EPTC 1F5RA 2GMTB 3ZZ8A 1HYLA 2ZU1A 2ZFPH 2FOEA 1OWJA 4Y8ZA 1YCPK 1TMBH 2AH4X 1MKWK 2J9NA 3JZ2B 5JPMH 1V2TT 3PWBA 1V2UT 3RLWH 3KEEA 1YM0A 4X2VA 1QJ6B 2ZTYA 5ESBA 3SU0A 3RUOA 1L1JA 1A1RA 1P2MA 4A1XA 3FP8E 1Z6JH 1LQDB 3SHCH 1V2RT 1ZPCA 4ABIA 1HJAC 3LONA 1XVMA 4MPWA 1KXDA 3F68H 1O5FH 3SU1A 1TPSA 1C5QA 1DSTA 2OUAA 4J2YB 4HTCH 2D1JA 3EE0B 4XE4A 2BHGA 2Q6GA 4BAKB 2WPJS 3KQCA 2J2UA 1O2OA 1SQOA 4LZ4B 1BBRE 4CREA 3UY9A 2H2ZA 1GVZA 1C1QA 2WUCA 2C8WB 3A8AA 3UPEA 1IQLA 4K2YA 1BBRK 1J16A 5EODA 1O3DA 1IHTH 4IBLH 2PSXA 2Y6TA 4BAOB 1AE8H 4FVDA 1SB1H 3C1KA 2AMQA 2VVVA 5HGGA 3VEQB 2CGAA 1CE5A 2GZ9A 4FUCA 4AORA 1GI5A 4U01A 1EXFA 1SGQE 2A32A 4LK4A 5HM2A 5DK1A 1CHGA 1C2LA 1GBEA 5FAHA 1NU7B 1AKSA 1C9PA 3MNXA 5F8ZA 3UQOA 2A7JA 3A8CA 1ABJH 2C4FH 1E37B 2PWXA 4YOIA 3L6PA 1ZHRA 2W26A 3KF2A 2HLCA 4IC6A 3SNEA 1QCPA 5DPAA 1SPJA 2P3FH 1L1GA 2GT8A 2KAIB 2NU2E 4OS6A 5CHAB 2BX3A 4BANB 1D3QB 2BQ7B 3GDUA 1DFPA 2QA9E 1TNGA 1SFIA 2FDAA 2FPZA 4H42U 3RC4A 1GBFA 4F49A 1ZTJA 1O39A 2AGGX 3A82A 3GDVA 5DP6A 1BCUH 1MTWA 1PPCE 4ABAA 2Y7ZA 2QIQA 4JK6A 2OP9A 1FUJA 1O3CA 1ZTLA 4A1VA 1ZJKA 1AIXH 1YPEH 3M3TA 1V2VT 3RU4T 4RSPA 3GY4A 1A5HA 1TMTH 4U32A 1K1NA 2GX4A 3QX5H 4X2XA 1O3PB 2FMJA 2BOKA 2R2MB 3LGIA 1ETRH 1AWFH 3PLBA 4I32A 1MQ6A 2ZA5A 1NRSH 1QA0A 5GWZA 4MVNA 1IQJA 3CS0A 2FI4E 1CGHA 1GBDA 2ZCLP 4Y10E 4AFZA 1KXFA 3BF6H 4TWWA 4Q2KA 3SJOA 2GTBA 5CHAC 3PO1C 2CJIA 4MQAA 2OXSA 1LDTT 2Y80A 2F9BH 1TGNA 1KIGH 4IW4E 1XKBC 3SUGA 3P8FA 1FIZA 4Q7ZA 1ZPBA 1EQ9A 1TLDA 3AW0A 2B9LA 1C5UA 2VWNA 1C5YB 4UFDH 3PTBA 2V35A 3BTFE 3HPTB 1AU8A 1SGFG 2BY5X 1OYTH 1GMDF 1HNEE 2FZZA 2F83A 3UWIA 3ZZAA 4ABDA 2OC7A 2VVCA 3RXKA 3ZV8A 7ESTE 3TK6A 2XC4A 2Z9LA 5HXFA 1LCYA 1ANCA 4I8JA 1HAVB 4AYYB 1XUJA 2FOAA 3R3GB 1TRNA 3L3TA 1C5WB 1ZZZA 3NWUA 5EOKA 5DKMA 3NUMA 2WPMS 4FUHA 1DWEH 4AX9H 1UVUH 3SU4A 1RXPA 1G3EA 2ZHQH 3KCGH 1GI2A 1TE0A 1VJAU 4U30A 3DD2H 3S0NA 2J38A 3U8TH 5AFZH 3K65B 4NIYA 2ODYB 1TGSZ 4AB8A 1WV7H 2P93A 4FUFA 4Y8YA 3RU4D 2STAE 2C8ZB 1BITA 2V3OH 1C2MA 3VFEA 4DW2U 1O2YA 1G36A 4A92A 1DX5M 1P2JA 3PLKA 2VJ1A 3GCNA 3A7VA 3E1XB 1AB9B 4B2AA 3K2UA 1DM4B 1C2DA 1V3XA 5HMAA 2OC8A 1FY4A 2Z9IA 1PQ5A 1GJ7B 1W10U 3BEUA 4K5ZA 1F2SE 4XBCA 5DGJA 1P57B 1Y3UA 1UK4A 1LTOA 4D76A 3T2NA 5J4QA 4X1SU 4AGKA 1A0HB 4YOGA 1C4U2 3TGIE 3W95A 2JETC 1ELGA 3DHKH 4X6PA 3SNBA 1F0RA 3AASA 8GCHG 4B73A 1TRYA 4ESTE 4CRAA 1O3AA 1HBTH 2Y7XA 2J34A 3OSYA 2AS9A 2FI5E 3T28A 4NZQA 1UVSH 3QTVH 1ACBE 1THSH 1HXEH 2Y82A 1QRWA 3QN7A 4J1YA 2OBOA 2A2XH 1C2GA 4OS2A 3OY5U 1AB9C 1G32B 1AVGH 1ARBA 1QB6A 1PPZA 1P12E 3KQEA 5DJ7A 1EKBB 4ABFA 3TJUA 1ELFA 2ZGHA 4X2YA 3ZVBA 1LHEH 1ESTA 1YCPM 1UTLM 1BJVA 1EPTA 2FOCA 4DT7B 4YM9A 3BTDE 4DURA 2A45B 2BD3A 3TGJE 1P9SA 1BRAA 3M61U 5JB8S 1D6RA 1GBJA 2XW9A 1YPLH 1BUIA 1QL7A 2F9UA 2ILNA 2Z3CA 5K7RA 1TYNA 2LNCA 3GCHB 1C5MD 1CGIE 3SGAE 3P17H 1E36B 1K2I1 1S5SA 1ZHMA 2G55A 5A8ZA 2BDGA 3PMAB 1JIMA 2G51A 8KME2 4M7GA 1NT1A 3BIUH 3PTNA 2ANWA 3SU5A 1Y3YA 2RDLA 3BIVH 3H7TA 1QRXA 3K6YA 3QLPH 1LPKB 1O3NA 2BVRH 2PLXA 3LGTA 1F0SA 1FIWA 1Y3VA 1WOFA 1DLEA 2Z94A 2QC2A 3UOUA 1TQ7B 1A4WH 4OS7A 1OWEA 4HZHA 4WXVA 3MNCA 1PQ8A 2Z3DA 5CMXH 2BTCE 1UVTH 3BTQE 3FP6E 1O30A 4Z0KA 1BRUP 4DOQA 1KLTA 1GBMA 2ODQA 2HRVA 1UTOA 2JH6D 3RXMA 5LH8A 1O3HA 1Q3XA 1RD3B 1P0SH 3TJNA 1AHTH 3VB6A 1O2IA 1P2NA 2AGIX 3AAUA 3MFJA 1O3IA 2VGCB 1BTWA 2OTVA 1H9HE 3GY3A 1IOEA 1S6HA 4CR9A 5B6OA 2P94A 2Z7FE 1O2ZA 4MDSA 3PWCA 3KQDA 3E90B 4TWYA 1CU1A 5AHGH 1ABIH 1VITH 3UQVA 2XWAA 5T3HA 1O37A 1P01A 1H4WA 3GY7A 1AI8H 1YCPH 1XX9A 3GISB 4F4OC 1MKWH 1TALA 1OP8A 2CHAB 2NU1E 4ZHMU 8LPRA 3HGPA 1IQIA 5GXPA 1G3BA 1MU6B 1WYKA 2GCHF 2XRCA 3LH1A 1YPGH 1O2SA 1LVMA 4WH8A 3WY8A 1BTHH 3SN8A 4KTSA 1BTZA 2UUYA 1QR3E 3ATLA 3LPRA 2VGCC 1MD8A 2H1UA 3GY5A 1P9UA 2ZU4A 1EJMA 3UTUH 5AVDA 1Q2WA 5EPNA 1SOZA 2FODA 3Q76A 1P09A 3E6PH 1LMWB 1KXCA 3SI3H 4FU8A 1EASA 3PYHA 3RXHA 1LPGB 4E06H 4JYUH 1GHWH 5DO4H 4CHAC 3TITA 2BMGB 1MCVA 3TH4H 2QY0B 1GG6C 1GBLA 2CHAC 2H9TH 4H6SB 3EQ0H 2BDBA 2D8WA 1LVOA 1HCGA 1O2GH 2BB4A 2PR3A 1C1WH 2ZEBA 5E0JA 2TGTA 1QQUA 1G37A 3RXLA 1NFXA 1XUGA 1NFUA 1O3MA 2VIDA 3DUXH 3RXUA 1RIWC 1EP5A 1C5RA 5DP7A 1GCTB 1QBVH 1BHXB 5FX5A 1PYTC 3SW2B 2SGQE 3M3VA 2A7CA 3M37A 3OX7U 5AF9H 5SGAE 3D65E 4MNXA 2G8TA 1W11U 1HDTH 1GI0A 4B2BA 3ZYEA 1EB1H 5FHTA 4DGJA 1KLJH 1O2XA 2GDDA 2EI6A 2BQ6B 3GY8A 2ZFFH 4ZKRU 1GVLA 5DP5A 5C1UA 1HAVA 4CRFA 1SL3A 3E16B 4O03A 2UWPA 3M7UA 1DPOA 3SUDA 1P02A 3B23B 4JYVH 4IMQA 1T8NA 1FAXA 3HATH 1O2MA 1VCPA 5C3NA 1DXPA 1EATA 1VITF 1SR5C 1UMAH 1H9IE 1YPKH 1N1LA 1P2IA 1PJPA 1OPHB 2HVXA 4ZH8A 4I33A 1O2UA 3I77A 3KQBA 1YGCH 3MH4A 3M7TA 1GGDB 2H9HA 1N8OB 4I8HA 4BTUB 4YESB 2R2WU 2THFB 3FAOA 3I78A 1KYNA 2F9NA 3ZZ3A 3E0NB 1QA7A 1ELEE 3A81A 3VPKA 4LXBH 1QQ4A 2H9EH 5LPEA 2WPLS 7GCHF 1O2QA 3VB3A 4FUGA 2M5TA 5FCKA 1DY9A 1ETTH 2GZ8A 4ZHAA 4FVBA 3BN9A 1CHOF 1S0QA 1DUEA 5GCHG 2P8OB 1KLIH 1TPPA 1QJ7B 5ETXA 1W0ZU 4YO9A 1SGIB 1HB0B 3TIUA 1HAXB 2OC1A 1H8IH 2F9OA 1ESBA 1LQEA 1S85A 4JCNA 2P3TB 3C27B 3N7OA 3TK9A 2BY7X 2GKVE 3AW1A 2BX4A 4WF8A 1TNIA 3CS7A 3TJVA 1GGDC 1DLKB 3RXBA 2DE9A 3A84A 3U8OH 1QB1A 1V2MT 1SSXA 1EUFA 1C5XB 1IHSH 1OXGA 3MH6A 1S82A 1TWXB 2QXJA 5CE1A 1GHAF 4WJG2 1JWTA 2A5KA 3QTOH 4IGDA 4BTIB 4Y71A 3TJOA 4U2WA 1HAPH 4R8TB 1GJ8B 1ZRKA 1TABE 1RGQA 4K1TA 1L4DA 1PFXC 2WPHS 5BPEA 5A09A 1C4Y2 3UR9A 2AMDA 2UUJB 3LGUA 1KXEA 1UTJA 1HRTH 1VCWA 2PTCE 2P8OC 3TU7H 3T29A 3PB1E 1LO6A 3TH2H 1ZRBA 2XBYA 1LHFH 1V2NT 4CBOA 1TQ0B 1Y5BT 3MNBA 4MPVA 1SGPE 3E0PB 1J15A 4MTBA 3FFGA 2FM2A 1GHZA 3LGWA 1O3OA 3RXTA 5L30H 3EA7A 3P6ZB 1C5VA 2GMTC 5GIBA 1GBAA 1NESE 3T27A 4DJZB 3BTHE 1HAHH 1VGCB 4B76A 3F9EA 2WINI 1FI8A 3KIDU 1A7SA 4ISLA 1TGTA 1XKAC 2FWWA 1EP6A 1BDAA 1OP2A 1ZR0A 2ZTXA 6GCHG 1O35A 4DIHH 1IQKA 3LJOA 1F92A 3RXQA 1GHBG 5I25A 2GCTB 2C90B 3MOCA 2G81E 4CH2B 4D9QA 1KXAA 3UNRA 2G5NA 3KGPA 1LKBA 4TYDA 2WV4A 3EGKH 1C2EA 2GVFA 1PPEE 1TX6A 4GCHF 2UUKB 1LKAA 1GCDA 1EJNA 1C5SA 2QXHA 3ATKA 2RA0A 2FXRA 4GHTA 2ZGCA 4GVUA 1NTPA 3SJ8A 1BQYA 3BEIB 1QFKH 5HM9A 1ZGVA 4O3UA 1U6QA 2ZDLA 2PKAB 1GJDB 2O8MA 1T7CA 5I46H 1FV9A 1O5AB 1VGCC 2HALA 3B8JA 2WPIS 2OLGA 2XWBI 2ZPRA 3P8GA 2B8OH 4XFQA 1SLXB 4WVPE 1TPAE 2F9PA 4K3JA 3LJJA 3ODDA 4KTCA 1C1NA 3GYMA 1QNJA 3CENA 3BTME 2GCTC 1O31A 1O2NA 1J14A 1LPZB 5JBCS 2P3UB 1GMCG 1OWHA 1P3EA 2YNBA 1BOQA 2ZIQH 1RS0A 1B0EA 1FDPA 3RU4E 3HGNA 4AGJA 1G2LA 1O5BB 1SI5H 1MQ5A 4MLFB 2XCNA 2ZKSA 3GDSA 3SBKA 1A3EH 2SGPE 5EQRA 1ELAA 3NPSA 3PLPA 3HK3B 1WTHD 1TOMH 2SGDE 2IPHA 5C1YA 3MH5A 1D9IA 2Y81A 2XBVA 3DFJA 5EW1H 2G00A 2PTNA 1P05A 3EYDA 2B7DH 4JZFH 1XVOA 1ZYOA 2GV6A 1AFEH 2DUCA 3QK1A 1AY6H 3HKJB 3SJ9A 1WSSH 1O3EA 4FU9A 1GMHF 1EZUC 2A7HA 4WWYA 2GZ7A 2STBE 1ELTA 4YTAA 3R0FA 4X6MA 3KNXA 3EA8A 1O2VA 3V12A 2ZP0H 5A8XA 3VB4A 5EQSA 1QL8A 2QGRA 2EI7A 1VCQA 3ZZ6A 1Z7KA 4AG2A 1MTVA 2ZFTA 4UFGH 1P2QA 1D3TB 3RM2H 1Y3XA 1FY3A 2J92A 3QGJA 5FPTA 3U8RH 2JH5D 2HPPH 3SNAA 4ZMAH 1F0UA 5E2PA 1FPHH 2JH0D 4I8KA 3VGCB 1UTQA 3UNQA 1GBCA 4ZUHA 5FBEA 5EU8A 2I6QA 1HAYB 1HUTH 4UD9H 4TY6A 3E8LA 3GY6A 4ISOA 4NA7A 4OS1A 1T8MA 3ZZBA 1SLWB 1RRKA 1UCYE 4K69A 2FYQA 2OINA 4NIWA 3K9XB 4NWLA 4VGCB 3MI4A 2HPQH 3ESTA 1QB9A 2P16A 3OU0A 1UCYK 4ZKOU 4JK5A 2OC0A 2BXUH 3LH3A 1W7XH 5K0HA 3TLOA 3MH7A 1C2HA 3LU9B 5AFYH 1D4PB 3RC5A