3UUZA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKLCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uuzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uuzA02
1C1QA 2FM2A 1EKBB 5AFYH 2G5VA 4JZEH 3GY6A 3ZYDA 1DOJA 1B0EA 4JK6A 2Y5HA 3RXAA 4SGBE 4AFQA 1ETRH 3KN2A 2CHAC 4MTBA 3NKKA 3UNQA 2WPMS 5DG6A 1BJVA 1TFXA 2F9BH 3BTME 4Y6DA 1GCTC 3LJOA 5C67A 2FI4E 2FOMB 5HYOA 1CA0B 1CO7E 1V2OT 2PUXB 1C5ZB 3UQOA 1CGJE 2VIOA 3PMBB 4CHAC 1DANH 2XNIA 1V6DA 3SO3A 1OOKB 4I8HA 1KLJH 2AMPA 2ESTE 1IOEA 4WJG2 1ELGA 3LGWA 2G4TA 4PROA 3A84A 4WVPE 4Y8XA 4JZ1A 3GOVB 5DK1A 5FHTA 1A5GH 2EEKA 1L1NA 2FOGA 2FTLE 4UD9H 1UTQA 3E91A 3ZV9A 4ESTE 1C5LH 4RKOB 1TPPA 5GCHG 3LONA 1JWTA 4CRGA 1P2MA 4DW2U 1A4WH 1O2SA 4B2BA 5DP5A 1SVPA 4ZHMU 3CP7A 1SGTA 4ABJA 4BXSA 3VGCC 1EAIA 1YBWA 2VJ1A 3UQVA 1TGNA 1W8BH 4A1VA 1YPMH 1CHOG 1GHBG 1KXDA 3SORA 1DWCH 3D62A 3PROA 4CH8B 1KDQA 2BHGA 1HPGA 3GY2A 2FO9A 3KHVA 2ZCHP 5DP4A 4H6SB 1IQNA 3RXHA 5E0JA 2OCVB 1BUIA 1MAYA 1NFUA 1NO9H 3TVJB 1QRZA 2H2ZA 1Z8GA 1AIXH 1GBEA 4BAQB 1SL3A 1UVTH 5ESBA 3ZZAA 1YPKH 1M9UA 1C2IA 4DJZB 1IQHA 2Z9IA 3MNCA 4ZHAA 1N6YA 1DWBH 1CGIE 2EI8A 4CRAA 5L6NH 3GISB 2FLBH 1W14U 5EXLA 2BDYA 2GMTC 2Z7FE 3SV8A 3QWCH 2PGBB 1EP5A 1GL1A 1THPB 6LPRA 4ISNA 3ZZCA 1O5EH 1DPOA 1QHRB 2QXHA 4SGAE 1AE5A 1EUFA 4WMDA 3TJUA 3DD2H 2ZTZA 1EB2A 2ALPA 2FTMA 2C90B 1TRYA 3O8RA 2FOFA 1SMFE 2EI6A 1CA8B 3FFGA 3FZDA 1QGFA 3KQDA 2ZGJA 1LHEH 1CU1A 3EDXB 1RXPA 4X1PU 1V2WT 1C2MA 1O3HA 4X1SU 3UOUA 8LPRA 4ZMAH 2ZU1A 4J1YA 2GCHF 4IW4E 3SV6A 1V2LT 1O3NA 3ATKA 2QA9E 1EJMA 3CS0A 2ZU4A 2YNAA 4FUJA 5ETXA 1ESTA 3A82A 3S9CA 3KCGH 3ZYEA 2ZHFH 1QL7A 4AOQA 5JBCS 3HK6B 1S85A 1NFXA 2G5NA 2J92A 1C5MD 2XBWA 1CVWH 1QJ1B 1S83A 1ZPCA 3BEFB 1G3CA 4ISOA 4FXGH 2P94A 1ZRBA 5TCCA 1KY9A 1WU1A 2XC0A 4U01A 1ELCA 4NA7A 4NFFA 4FUFA 1BHXB 2Y82A 3U9AH 5SGAE 1AD8H 3ZZ7A 1Z7KA 1XUGA 3FVFB 1C2LA 1G3EA 1GI2A 2R2MB 5JPMH 1SPJA 3LIWA 5A0BA 5BRRE 1EAXA 4DURA 3RXTA 2FLRH 2GZ8A 4YM9A 1PQ8A 3UOPA 4D7FA 2GP9B 2VWLA 1AO5A 1G30B 1MTNB 3ELAH 1C1VH 1FUJA 3PMJA 1P04A 3QLPH 5K7RA 1O3KA 2FWWA 1L0ZA 3M7UA 1Z1JA 1JIRA 3L3TA 5AF9H 1TGCA 4E7NA 3PMAB 2A0QB 2VIWA 1A3BH 3RC5A 1QRXA 1L4ZA 3MOCA 3RXGA 3A88A 2I6SA 3RXIA 1AFQB 2BQWB 1SLWB 5GDSH 1BHXF 1QFKH 3GDVA 2PGQB 4ZAEA 3LGIA 3SUGA 1O2KA 2C8YB 2C3SA 1Z8IB 1BMAA 3L33A 2TPIZ 1Y3UA 3S9AA 1BRCE 1MBMA 1P09A 1HFDA 3FAOA 2ZFRH 2CV3A 1HAVA 2ZHEH 1O32A 2WUCA 1FNIA 3LC5A 5EQRA 1BTUA 1C9TA 1DSTA 1MKXK 4WY3A 1ETTH 1C4V2 2QF3A 1ANBA 1S82A 3HKJB 2W5EA 5E0GA 4DOQA 1F2SE 1SLXB 1C5SA 3E3TA 3QGJA 1E38B 1UK3A 5GXPA 1RRKA 1IAUA 4ZUHA 1C2JA 1DDJA 1FLEE 2TGTA 1Y8TA 4KTUA 3GDSA 1K1OA 3AW0A 3RXVA 4BOHA 2FOAA 2AS9A 3EGKH 3Q76A 1H9IE 1KLTA 1WAYB 1BIOA 1KXFA 2CF9H 3TH3H 1RIWC 3K2UA 2R9PA 3ITIA 7GCHF 2BLQA 3F68H 3SGBE 2VWNA 1ACBE 2C8WB 1UVPA 1L4DA 2G4UA 1BTZA 1LVMA 2Y80A 2VB0A 1WYKA 2XBXA 1G2MA 4JYUH 4HFPB 2G52A 5JDUB 4XSKU 3MU4A 1GI9B 2BZ6H 5FCKA 3SQEE 1PJPA 2KAIA 5C3NA 3BG4B 2Z9JA 4I32A 4KTSA 5C2ZA 5HM9A 3EAJA 1H8DH 4UFGH 1TAWA 6GCHF 2Z9LA 4Q7XA 1J8AA 1LVBA 1QL8A 1ESAA 3ATIA 1DS2E 2BY7X 3TGJE 1QBNA 2QC2A 1DWEH 3B23B 3SV2H 1FONA 4E05H 1H1BA 1BRBE 1S5SA 4NIVA 3UWJH 1G3BA 1N6XA 1VITH 3RXOA 2ZC9H 1UCYE 1ZTKA 1JRTA 2UUKB 4VGCC 3RXLA 1Z6EA 2ODYB 1THRH 9ESTA 2BD3A 1C1MA 1SGCA 2RA3A 2BD8A 4AB9A 3RDZA 3ZVEA 3S69A 1HAVB 4QT8C 4XBBA 4DT7B 1D3PB 4BAKB 3RXQA 1Y3VA 2ZFPH 3A7TA 1QA7A 1G2LA 2D26C 1Y3XA 1P05A 1DT2A 1VCWA 2FOEA 1NTPA 4I7YH 2PSYA 3SNBA 3U1IB 1O30A 3RXEA 2Q6FA 1NRRH 3EE0B 2ZU2A 3KQCA 3V12A 1A0LA 4I33A 3SU1A 1GI8B 1RTLA 4AN7A 2A7JA 5FPYA 2ZI2H 4Z0KA 4ZKNU 2BLVA 1OX1A 1T7CA 1ZPZA 1O2QA 3OU0A 1ID5H 2B8OH 4CR9A 2B0FA 2NU2E 1MKXH 4AG1A 4ZROA 1YCPK 1P03A 1GBHA 4MNXA 1J17T 4AGKA 3M35A 4A5TS 2ILNA 2KAIB 1C5RA 4DVAU 2A2QH 1O37A 1GG6B 1C2DA 1CSOE 3MNBA 4RSPA 4Q7ZA 2SGPE 1MZAA 1FDPA 3LGVA 4GCHG 3MU8A 3F1SB 1ZHRA 2BD7A 2BX3A 6CHAC 2GT8A 3RXDA 1XM1A 2ZDMA 4Y8YA 2Y7ZA 1O2PA 1CQQA 3TGKE 3I77A 1ANDA 1SQAA 4CRCA 1SGDE 1TALA 1AVGH 4IC6A 4BTTB 3IITA 3P70B 4ZHLU 1AVWA 4I8KA 1HJ9A 4YLQH 1ZHMA 1K1PA 4AGJA 1MCVA 2GCTB 3PO1C 1S6FA 2PKAA 2FPZA 2Y5GA 2SGDE 5C1UA 1P12E 1QR3E 4ABGA 2BDIA 2B9LA 1H8IH 2P59A 3M37A 4FUGA 1TNHA 4ABBA 3FANA 5JYIA 4E7RG 2BX4A 2W7SA 2R0KA 1MAXA 2HNTF 2OINA 3PTBA 2FOCA 4BNRA 2QXGA 5C1YA 3C1KA 3DT0H 1LHFH 1TPSA 2F9OA 2QYIA 1LMWB 3Q3KA 1TOMH 2OC7A 2THFB 1VCPA 1VCQA 1O2MA 1C1OA 3T25A 4DIHH 3TK6A 1TGBA 3T5FH 3ZVFA 2ZFFH 2ZP0H 4M7GA 1MQ6A 1GMHG 1TMTH 3ZVCA 1L1GA 4ISLA 2F9VA 5F03A 5DP6A 1DX5M 1SBWA 1D9IA 4ISHH 1UO6A 1J14A 1J16A 1P06A 2WV5A 5HMAA 4GCHF 5FX6A 3A85A 4X2XA 5A09A 1SGEE 1F0UA 3A7ZA 3H5CB 1ZGVA 2BOKA 4YOIA 1ZGIA 5JB8S 2VIDA 1F92A 1HAHH 1HXEH 3MMGA 1ANEA 1UK2A 1SFIA 3M5MA 3GDUA 1BMLA 4ZKSU 1P11E 3KNXA 3GY3A 1AFQC 2ZPSA 2OBQA 1WUNH 1TPOA 2QCYA 1AWHB 1K1MA 1EPTA 2ZCLP 1GI0A 4OS7A 5F8TA 4NIWA 3SUFA 3PLKA 4D9QA 2R3YA 3KQBA 1SB1H 1S6HA 1TPAE 4FUCA 1C5UA 2GGVB 2PTCE 3RXCA 1LVOA 1SG8B 3T29A 5TJXA 2ZPQA 3P92A 1VITF 2BY9X 1INCA 2Z3CA 3V7TA 1ZSJA 4NIYA 3U8TH 2TGPZ 2JH6D 1C4Y2 2FI5E 5FPSA 3A80A 1KTTB 3SJKA 2HOBA 3A7WA 4FUIA 2NU3E 4NA8A 2NU0E 1HIAA 3HPTB 2A2XH 2I6QA 2CMYA 3T26A 3LPRA 3TNSA 1UHBA 1PPCE 3ATMA 1AGJA 4X8SH 2BDBA 2BDHA 3OY6U 1UTPA 3T27A 4LK4A 4CRDA 2VVVA 4B76A 3P17H 4X8TH 3MNXA 4WMFA 3LOXA 1PQ5A 3BG8A 1OKXA 4I31A 9LPRA 5EPYA 1IHSH 3VB7A 1BBRK 4O9VA 1FXYA 1ELAA 1D3TB 1XUFA 3BF6H 2W3KA 2F9NA 1AU8A 1JIMA 2VU8E 1PPHE 1WQVH 3OYPA 1GBJA 2CJIA 3BG4C 1J9CH 2Q6GA 1THSH 3F9EA 2STAE 3VEQB 3B8JA 1XMNB 3UFAA 1SQTA 5L2ZH 4Y7AA 4KP0A 3SU0A 1QBOA 2PV9B 5IDKA 1EZUC 4YT7H 2DUCA 2G8TA 3GCNA 1BTXA 2G55A 2PTNA 1YPEH 4MNYA 1NS3A 3QN7A 4JCNA 3W95A 4YESB 1GHVH 1HAYB 2HALA 4TYDA 5CE1A 3B9FH 1C5QA 1GBLA 2VH6A 2M5TA 1Z1IA 2VNTA 1YPJH 1BDAA 1C5PA 1Y59T 3E90B 4TPYA 1HCGA 1HNEE 1AB9B 1DITH 1A7SA 4XOJA 4FU9A 3E0NB 3ATLA 5GIBA 4RKJB 2ZZUH 1H9HE 2FI3E 1CT2E 3RMMH 2FOBA 1ZPBA 1FPHH 3LU9B 2A4RA 4BXWA 2PR3A 1O3CA 2BYAX 4LZ4B 5ESTE 4IGDA 3VPKA 1ELVA 2ZGCA 1P57B 4OS6A 4R8TB 4NFEA 1O3LA 2GCHG 1T4VH 3A8AA 3M3TA 2PUQH 3TJVA 1VJAU 1NPMA 1ZSKA 3P8GA 2WINI 1HAZB 3SNDA 2ZIQH 1F5KU 1C2HA 1O36A 1DVAH 2IOTA 3Q00A 2V3HH 2R0LA 5EU8A 4BAHB 1QURH 1TQ7B 3LH1A 5CHAB 1SGFA 4YZUA 3GY5A 1Y5UT 4JZDH 4JK5A 1RFNA 1C5NH 1DWDH 1LVYA 4AZ2B 1QY6A 3IG6B 1BJUA 4Y11E 3GCOA 3UTUH 4JMYA 4CBOA 1O5DH 3MHWU 2OQ5A 2CGAA 1GG6C 1A0JA 1BT7A 5FAHA 4OS2A 3H7TA 3ZVGA 1OPHB 1W10U 1WBGB 4YTAA 1A46H 1XKAC 4BAMB 2BOHB 1YPLH 1TB6H 1OP0A 2HNTC 2OC8A 4NZLA 3M5OA 4HTCH 3M36A 1XVOA 4K1SA 4CH2B 2LPRA 2ZHDA 1WSSH 3RXMA 1HB0B 1PPFE 1BBRH 1O3PB 3TPIZ 2OTVA 3MNSA 1W13U 1LHGH 1L2EA 3A8DA 4UDWH 3T28A 1SOTA 3H7OA 1KSNA 1BOQA 2DE8A 3EYDA 1A5IA 4AORA 5LPFA 2ZHWH 1O2YA 2FODA 3RC6A 1GDNA 3FP7E 3KQEA 1EJNA 1MH0A 1TYNA 1IHTH 1WTHD 1GBAA 1YLCA 3ZVAA 1ZMJA 2P3UB 1GJBB 3AAUA 3TJOA 3VFEA 3A7XA 2XWBI 1QRWA 3JZ2B 1AE8H 3V0XA 3BIUH 2SGEE 4U32A 5DP9A 2OD3B 1K1LA 1P2JA 1W7XH 1OYTH 1JXPA 2GDEH 4XBCA 4IMQA 2IPHA 6ESTA 1OWIA 1C1TA 3SZNA 2OP9A 1F0SA 1C9PA 2UUYA 3D65E 4GHQA 1KDQB 1F0TA 4AG2A 4MLFB 3RU4D 1O3AA 5A8XA 2ZEBA 4AX9H 3M7TA 1ELEE 4WXVA 3GYMA 1C1SA 1GI4A 2NU1E 4X2WA 1E0FD 1YYY1 1FPCH 3SGAE 2FZZA 2BQ6B 7GCHG 1FZZA 2NU4E 3PTNA 3ZZ3A 2O8UA 3MWIU 4I8GA 3NWUA 4B1TA 3M3VA 3TIUA 4X6MA 4ZKOU 4Y71A 2ZDAH 3T2NA 3KGPA 4GAWA 2FXRA 1K1JA 1YC0A 2XBVA 2EI7A 4OGYA 2QGRA 3MFJA 1LDTT 4WMEA 1EZQA 1TRNA 1FY3A 1SLUB 2UUJB 2JKHA 2G51A 4IN2A 1B7XB 3SNCA 4NSVA 1KXAA 2PSXA 4AB8A 1TBQH 3Q3YA 6GCHG 1P2NA 2JH5D 4IMZA 3ZV8A 4AYVB 5F6MA 2ODPA 1ARBA 4H6TA 1CGHA 5J4SA 1D6WA 4HZHA 4MPWA 4ABAA 3RUOA 2Z3DA 2Y81A 3RXPA 3SUDA 1T8NA 1OWDA 2GV7A 3E8LA 3BTQE 2H5CA 4X2YA 1EQ9A 3HKIB 4TY6A 4XDEA 3BEUA 2O8LA 1V2TT 2Q1JA 1NRNH 4UFFH 3BN9A 1QQUA 1SFQB 1YCPM 1LKBA 2VIPA 1G9IE 3HK3B 2YOLA 1EASA 3KIDU 2VWMA 1HYLA 1TE0A 5DGJA 4X2VA 1T8OA 3PB1E 3SJIA 1BITA 3GCTG 3TITA 3TK9A 1B5GH 1SGIB 2GV6A 1IQGA 3QGNB 1UMAH 1GI6A 4WH8A 1K9OE 5L2YH 2XTTB 1XKBC 2ZGHA 1N8OB 1GWAA 2J9NA 3FP6E 2BD2A 4AFUA 2F3CE 1W3CA 4Y76A 1BTPA 3AASA 5PTPA 2BM2A 1KXCA 1O2HA 4MVNA 3UR9A 1G3DA 7ESTE 3RP2A 4XE4A 2GT7A 1AUJA 4ZXXH 1GL0E 1ELTA 2ANMH 3F9GA 2FS8A 1T31A 1NESE 3Q3XA 1J15A 3W94A 1UK4A 4FUBA 1NRPH 1K2I1 3MYWA 2P3FH 3T62A 5I25A 3A81A 8KME2 4INKA 3P8NA 2Z3EA 3P95A 2B7DH 4K1TA 3FP8E 4CRFA 2AIPA 4GHTA 1DSUA 4JZFH 4FUHA 3MU1A 1P3CA 2C8XB 1GBTA 3VB5A 1DFPA 4GVUA 2ZECA 2LNCA 2PFEA 3K9XB 3AAVA 1AKSA 5E2OA 3RXUA 1TABE 2ASUB 4O3UA 2J38A 1O39A 3RXKA 1MMJN 3L6PA 3BTTE 4X0WU 4TY7A 1FIWA 2J2UA 1ZOMA 2ZDLA 5HM2A 1XUKA 1CA0C 2RDLA 1K21H 3SHAH 1O3GA 5IYTA 4K1EA 1SHYA 1Z71A 2A31A 5EPNA 1BTWA 1CBWB 1SGQE 1RS0A 2UUFB 4GLYA 1ELBA 1EZXC 2WUBA 1H4WA 1C2EA 1DUAA 4UEHH 1P02A 3UNSA 3GCTF 4MNVA 2SNVA 1FJSA 2VINA 5EXNA 2BVRH 1RTKA 1V2MT 5T6DA 1BCUH 1GHXH 2P16A 3D49H 3RLWH 1YPHE 1YGCH 4CRBA 3F9FA 4ABIA 1FV9A 4Y7BA 3M5LA 3PLBA 3NCLA 1WTGH 3SJ9A 1G36A 4OS5A 5A2MH 3DFLA 1MQ5A 2ZWLH 3NZIA 2A7HA 2ZU5A 2AGEX 2GTBA 3A89A 2UWLA 3EQ0H 3SU6A 2Y7XA 1EAWA 2FESH 1EP6A 5CHAC 1BQYA 2K1QA 7LPRA 1D6RA 1OYQA 1O34A 1Q3XA 4B73A 3LC3A 1EOLA 3PYHA 2AYWA 5JB9S 3U1JB 2A7CA 1RGQA 1DUEA 2OC1A 2PW8H 1C1WH 1UTKA 1GGDB 1HUTH 3M3SA 2CN0H 1N1LA 1OWJA 2JETB 1TONA 1Z6JH 4A92A 3C27B 2QY0B 1K1NA 4I8JA 1O2LA 3BTFE 4YOGA 3SU2A 3VXFH 4MQAA 1AVXA 2D1JA 2J4IA 1O5GH 1IQFA 2RG3A 2TGAA 3URCA 4A1TA 1NRSH 1Z8RA 1MTUA 5DO4H 1O38A 2VWOA 1NZQH 1C5YB 1UJ1A 8ESTE 4TWWA 2VIQA 4LOYH 3QZQA 1CE5A 3UWIA 3SU3A 1GBCA 4TWYA 1GJ8B 4DY7B 3QTOH 4AFSA 1A3EH 1SSXA 1HAGE 3O8DA 2BTCE 1NN6A 1RJXB 1HLTH 3ZZ5A 1A1RA 2P3TB 3RC4A 2VIVA 5DP7A 4E06H 5C5NA 3G01A 3TGIE 5LH8A 4OGXA 5EQQA 1O2NA 1FN6A 3BTKE 2HNTE 1VITG 1TBRH 1P8VC 1MU8B 1P0SH 4B2AA 4NA9H 4A1XA 1BTHH 4A7IB 1TMUH 2ZFQH 3LH3A 3V3MA 1V3XA 3PV4A 3PLPA 4X8UH 2PWXA 1GJ4H 2R2WU 5E0HA 3F6UH 1SGPE 1V2KT 1HAPH 1TNIA 1WOFA 3LDXH 4FUEA 1ANCA 2WYJA 3SU5A 2SFAA 3UREA 1K28D 4JYTA 4KGAA 5C1XA 1S81A 3HGNA 2WPIS 3RM0H 4B71A 1F7ZA 3MTYA 5GJ4B 2GX4A 2VGCB 2ZNKH 4Q7YA 1VGCB 1BMNH 3S7HB 3AVZA 3EA7A 1GJAB 2PKSB 2ZHQH 2BZAA 1GBKA 1NFYA 1VZQH 1QTFA 2FEQH 1L1JA 1O2XA 1ZR0A 3RMOH 1UTLM 1YM0A 2CF8H 4TPIZ 1MTNC 4K5ZA 1TX6A 2OC0A 1P2IA 2V35A 1ELFA 3R0FA 1GDQA 1JOUB 7KMEH 1AI8H 2J94A 1KIGH 2VVUA 2XWAA 3K6ZA 1EATA 2QN5T 1KYNA 1FAXA 3RXJA 1GMCG 2ZTXA 1P9SA 2AMDA 2PKAB 3SOSA 1MTVA 1DLEA 1A0HB 2WYGA 5JBTA 3GICB 1DXPA 1UTMA 3WY8A 1W7GH 1O2ZA 1MKWK 1GI3A 3OY5U 4D8NA 3SNAA 2HPPH 4MPVA 3S0NA 2FDAA 3SU4A 1N8OC 2ZA5A 1V2JT 1O5BB 1XUHA 1O5FH 1C1UH 1O2UA 1Q31A 3NXPA 3RM2H 1GBFA 2AEIH 1O2OA 1T32A 4DCDA 2TGDA 1KXEA 4WH6A 2GZ9A 4BTUB 1TBZH 3SGQE 5A0AE 1C4U2 1ZMNA 1MZDA 4MPUA 5I46H 2CXVA 1PPBH 2O8WA 3RU4E 1QB6A 4KKDA 2B5TB 2ZO3H 8GCHF 2O8MA 2GD4B 1UVUH 2HWLB 1O3FA 2Q6DA 1E35B 1UCYK 3HATH 4F49A 1K1IA 5LPRA 4JYVH 4BANB 4NGAH 4B2CA 3MH6A 1NM6A 1S84A 2DE9A 1FY4A 1O3IA 1O3OA 1PPGE 4O97A 1C2GA 5FCRA 2AH4X 3MO9A 2F91A 1YPHC 1KLIH 1BTYA 1RIWB 2P8OB 3QX5H 4WXIA 2A45B 5EOKA 2H5DA 2V0BA 1W2KH 1EXFA 2WPJS 2AMQA 3BTWE 1UVSH 1WV7H 1IQJA 4INHA 3SI3H 1NFWA 1HJAB 1O33A 1SLVB 3STJA 4GPGA 2HLCA 1GMCF 4UFEH 2RCEA 1EPTB 2QAAA 4CREA 1LHDH 2Z9GA 1CBWC 3P6ZB 1ZLRA 2EA3A 1GHWH 3SBKA 4ABHA 2J34A 3GY7A 1K22H 3ODFA 1V2PT 1YPGH 1OP8A 5GPIB 4AYYB 2AERH 1C5XB 1SC8U 3HGPA 2W3IA 4Z6AH 1FY5A 3SI4H 3OTJE 4K8BA 3TU7H 4X1NU 1AUTC 3M61U 2OUAA 1CHGA 1D3DB 5JBAS 4YT6H 5EXMA 1QCPA 5JBBS 1YKTA 3UIRA 1VR1H 3S7KB 1LCYA 3PM3A 4VGCB 1IQLA 4LZ1H 3O8CA 1P2KA 2TBSA 4DIIH 4RN6A 1HIAB 3U98H 1UHBB 1MTWA 4I8LA 1WCZA 2D8WA 4NZQA 1FY8E 1C2KA 5EG4A 1YF4A 3K6YA 3QK1A 2ZG0H 4NIXA 1FY1A 1OP2A 2WPHS 1MKWH 5E2PA 1E36B 1EJAA 1GGDC 2ANWA 1HRTH 2BD5A 1O2VA 4U30A 1P10A 2ZTYA 3BV9B 3N7OA 2JETC 3M7QA 1GI7B 2FYQA 3ZZ4A 3QZRA 4AFZA 3UR6A 1FI8A 3E0PB 5H4IB 1FAKH 3PWCA 2ZFTA 1QJ7B 2W7UA 4R0IA 1ZTLA 4Y0YE 2ULLA 1MU6B 1HBTH 1ZSLA 3U8OH 2F9PA 5FPTA 1DE7H 1TX7A 2FYRA 2WV4A 3RXFA 3VB4A 2A4OA 1KTSB 1SGRE 5LPEA 1SGFG 1TLDA 2A5AA 1UCYH 1NU7B 3TJNA 2GDDA 2VH0A 1AN1E 2ANKH 2OBOA 2XRCA 1LTOA 1O3DA 4FUDA 4XBDA 1ETSH 3BSQA 1UTOA 1SGNE 1XXDA 3CS7A 3ZZ9A 3RU4T 1QA0A 2AIQA 2GCTC 1LO6A 2V3OH 4DG4A 1D3QB 1GVKB 2AFQB 3A7YA 2BMGB 6CHAB 3TNTA 1G37A 1GPZA 3SN8A 1OWKA 1HXFH 2OLGA 2XBYA 1PQ7A 5L30H 2A32A 1O31A 1OWHA 1DY8A 4UE7H 1GBDA 2UWPA 3URDA 2SNWA 2O9QA 2ZU3A 3K65B 1LPZB 2G81E 3TH4H 1EB1H 1FN8A 4ASHA 4ABFA 3FZZA 3PO1B 1RD3B 2D2DA 3BEIB 2BY6X 1AMHA 2RA0A 5A0CA 3BTEE 3SJOA 1HJ8A 2HGTH 1F0RA 1TMBH 3LKWA 5GCHF 2FX6A 2O8TA 1O0DH 2GZ7A 2VGCC 1SOZA 3P8OA 1QIXB 1VGCC 2P93A 1O3MA 4J2YB 2NWNA 2PKSC 1CHOF 1W0YH 1GHBF 5CMXH 2HRVA 2V6NA 1GI1A 4JZIA 4F4OC 4IC5A 5T6FA 5DP3A 1ARCA 5E8EH 2C93B 2ZGXH 4NWLA 1P9UA 2GVFA 1ZHPA 1ESBA 1ZZZA 4X6PA 1WQSA 1FQ3A 1DICA 1HDTH 1O2JA 2YNBA 2F9UA 2OXSA 1O2TA 3I78A 1DLKB 2UWOA 4X6OA 3JZ1B 4D9RA 1TQ0B 1V2RT 2QV1A 5A8ZA 3LT3A 5HGGA 1MUEB 2QIQA 1UVOA 5K0HA 4NSYA 3A8CA 2TIOA 1EOJA 4K3JA 4YLUA 3U8RH 4ZKRU 1U6QA 3SQHE 1TGSZ 4HI3A 1IQKA 1GVLA 4YO9A 5T6GA 1GMDG 3EA8A 1O2IA 1O3EA 1BRUP 1VJ9U 3LGYA 3V13A 5EW2H 2BD4A 2STBE 1TNGA 1QB9A 1C5WB 3OX7U 5C5OA 3A83A 3VB6A 3PMHB 1MD8A 5T3HA 3STIA 2Y6TA 1TNKA 3NK8A 2A4QA 2ALVA 4CR5A 1HV7A 1ZRKA 4DGJA 5AVDA 1YP9A 4Y8ZA 5ABWA 1O5CB 4THNH 1GJDB 1NT1A 2A4GA 4INLA 1GBBA 1SR5C 3LGTA 1GHZA 3TH2H 3E1XB 4X6NA 4D76A 1PQAA 1GBMA 3SV7A 5EQSA 1G32B 3GCHB 4K60A 1Y3WA 4GSOA 1AFEH 3MH4A 4OS1A 1DY9A 1GHYH 1T8LA 2SGFE 1AQ7A 2BVSH 3PWBA 3OSYA 4HGCA 2P8OC 3QTVH 1SQOA 4WWYA 3DFJA 2BY5X 5EGMA 2XCFA 1EZSC 1O35A 1C1RA 2J95A 1ELDE 2ZDNA 1LPGB 4IBLH 1ZJDA 2BLOA 3KF2A 1HAIH 1GDUA 1HJAC 5FBEA 2BLWA 1S0RA 1EPTC 3LJJA 3KEEA 3VXEH 4XFQA 1OXGA 2FS9A 1DXWA 3A86A 3MI4A 3S9BA 1JMOH 1AY6H 1C5TA 1QL9A 1TA6A 2G00A 3BTDE 3MO6A 1F5LA 1LKAA 1AB9C 1KXBA 1GMDF 4KTCA 5FX5A 2A5IA 2AGIX 3RXBA 1E37B 3NPSA 5DKMA 3RMLH 4ZXYH 2FP7B 4K2YA 2CHAB 1LHCH 4MDSA 3SW2B 1T8MA 1AHTH 1B0FA 2ZQ2A 1C5OH 1BBRE 1ABIH 1S0QA 4NWKA 1P2OA 2QF0A 1GCTB 4H4FA 5A8YA 1ZMLA 1BMMH 1YLDA 3BTHE 2C4FH 5J4QA 1GCDA 1ZJKA 2QXIA 4CHAB 4MNWA 1OSSA 2PHBA 1PFXC 4K8YA 1FIZA 2HVXA 2Z6BD 2Z9KA 1TNJA 1TWXB 1C5VA 1BZXE 2H9HA 1BRAA 2PLXA 4WF8A 2ZPRA 3BIVH 1LQDB 1GJ7B 4MG3A 5AHGH 3MU5A 1W0ZU 3ZZBA 1JBUH 1GHAG 2XYAA 1ZTJA 4X8VH 1AKSB 1IQIA 4O03A 4UFDH 1Y3YA 1DM4B 1F5RA 1W12U 5FXLA 3VGCB 2Y5FA 3E6PH 1NC6A 1HAXB 1O2RA 1NY22 4GUXA 1BB0B 3O8BA 1A5HA 2XC4A 1UTJA 1IQMA 1PYTD 1GBIA 5AFZH 1TRMA 2XXLA 5BPEA 1P3EA 2ZF0H 4YOJA 1PPZA 1NRQH 1OWEA 1V2QT 1Z8JB 1HGTH 2AGGX 2ZGBH 2A1DB 3ATWA 2BVXH 3RMNH 1QNJA 3RXRA 2IJOB 3SV9A 2ZDKA 2H9TH 5C20A 2BB4A 1QB1A 2BDCA 4IN1A 2ZKSA 3NUMA 3LGUA 4OS4A 1CT4E 2BD9A 2GMTB 2BY8X 2BXTH 1TGTA 1GJCB 3ENSB 2QXJA 1GJ5H 2JH0D 3A8BA 5FBIA 4NG9H 1HAOH 1PPEE 2ZDVH 5HXFA 1XVMA 5G4BA 4CBNA 1Y5BT 3DHKH 3E16B 4Q2KA 4LXBH 1MBQA 4Y79A 3GYLB 1NROH 3ESTA 3SJ8A 1C1PA 1PYTC 3QDZB 1GJ6A 1MCTA 2EC9H 1ORFA 3F9HA 3BTGE 2H6MA 3MO3A 2FIRH 3ZVBA 2SGAA 4FU7A 3UY9A 1NU9A 1GHAF 8GCHG 5B6OA 1RTFB 2ODQA 1SHHB 5F8XA 1P01A 1ZYOA 1FMGA 1C2FA 4ABEA 3I29A 3TLOA 2ZQ1A 3ZZ8A 3AW1A 1Q2WA 1QJ6B 2BDAA 3A7VA 5DP8A 2GKVE 3M5NA 2XC5A 1GI5A 2W26A 2Z94A 3KL6A 3SHCH 1GVZA 3VB3A 2VVCA 4BAOB 1EAUA 4MPXA 4B74A 4BTIB 5F8ZA 4A6LA 1E34B 1O5AB 1TA2A 1H9LB 3EA9A 2ANYA 2ZFSA 3CENA 4IS5A 3MH7A 3TK5A 1MTSA 3QUMP 3GY8A 1X7AC 5EW1H 1AZZA 3QO6A 1AZ8A 1GJ9B 2XCNA 3D23A 4FVDA 1D4PB 1A61H 1MD7A 2OQUA 4Y0ZE 1BA8B 3UPEA 3ZZ6A 1V2NT 4X1QU 1YCPH 3A87A 1XXFA 1XUJA 1XX9A 2FOHA 4ABDA 2C8ZB 2TRMA 2WPKS 3U69H 2FMJA 3DA9B 5DJ7A 1SI5H 4Q80A 3UUZA 4U2WA 1T4UH 2A5KA 4KELA 1TIOA 3MU0A 1V2VT 4ZH8A 3ZVDA 1A2CH 5GWZA 4H42U 3RLYH 2XW9A 3R3GB 1UTNA 2BDGA 3Q77A 1TNLA 4K69A 1TOCB 4O3TA 3RXSA 3ZZDA 1ABJH 1O2GH 5LGOA 5DPAA 1SGYE 1C1NA 4UONA 1TX8A 3GCHC 1W11U 2ZCKP 2HPQH 3SNEA 1QBVH 4FVBA 3P8FA 5EODA 2IN2A 2FX4A 1OS8A 1O3BA 1O2WA 4ISIH 4X1RU 1LPKB 2BQ7B 1EX3A 4B75A 3UNRA 1P2QA 3GY4A 1JRSA 2P95A 1CT0E 1LQEA 2H9EH 3SUEA 1V2ST 1GMHF 2R3UA 2WPLS 3ODDA 4NCYA 4FU8A 2F83A 2BXUH 3DUXH 1AWFH 4Y10E 3IWMA 1IQEA 4D7GA 1Y5AT 1V2UT 5TCAA 3MH5A 1O3JA 1QQ4A 1XUIA 2SGQE 2H1UA
chains in the Genus database with same CATH superfamily
1C1QA 2FM2A 1EKBB 5AFYH 2G5VA 4JZEH 3GY6A 3ZYDA 1DOJA 1B0EA 4JK6A 2Y5HA 3RXAA 4SGBE 4AFQA 5KECA 1ETRH 3KN2A 2CHAC 4MTBA 3NKKA 3UNQA 2WPMS 5DG6A 1BJVA 1TFXA 2F9BH 3BTME 4Y6DA 1GCTC 3LJOA 5C67A 2FI4E 2FOMB 5HYOA 1CA0B 1CO7E 1V2OT 2PUXB 1C5ZB 3UQOA 1CGJE 2VIOA 3PMBB 4CHAC 1DANH 5EJ1A 2XNIA 1V6DA 3SO3A 1OOKB 4I8HA 1KLJH 2AMPA 2ESTE 1IOEA 4WJG2 1ELGA 2QE7D 2EY4C 2YMSB 3LGWA 2G4TA 4PROA 3A84A 5T1VA 4WVPE 4Y8XA 4JZ1A 3GOVB 5DK1A 5FHTA 1A5GH 2EEKA 1L1NA 2FOGA 2FTLE 4UD9H 1UTQA 3E91A 3ZV9A 4ESTE 1C5LH 4RKOB 1TPPA 5GCHG 3LONA 1JWTA 4CRGA 1P2MA 4DW2U 1A4WH 1O2SA 4B2BA 5DP5A 1SVPA 4ZHMU 3CP7A 1SGTA 4ABJA 4BXSA 3VGCC 1EAIA 1YBWA 2VJ1A 3UQVA 1TGNA 1W8BH 4A1VA 1YPMH 1CHOG 1GHBG 1KXDA 3SORA 1DWCH 3D62A 3PROA 4CH8B 1KDQA 2BHGA 1HPGA 3GY2A 2FO9A 3KHVA 2ZCHP 5DP4A 4H6SB 1IQNA 3RXHA 5E0JA 2OCVB 1BUIA 1MAYA 1NFUA 1NO9H 3TVJB 1QRZA 2H2ZA 3UAIC 1Z8GA 1AIXH 1GBEA 4BAQB 1SL3A 1UVTH 5ESBA 3ZZAA 1YPKH 1M9UA 1C2IA 4DJZB 1IQHA 2Z9IA 3MNCA 4ZHAA 1N6YA 1DWBH 1CGIE 2EI8A 4CRAA 5L6NH 3GISB 1WDIA 2FLBH 1W14U 5EXLA 2BDYA 2GMTC 2Z7FE 3SV8A 3QWCH 2PGBB 1EP5A 4FOUC 1GL1A 1THPB 6LPRA 4ISNA 3ZZCA 1O5EH 1DPOA 1QHRB 2QXHA 4SGAE 1AE5A 1EUFA 4WMDA 3TJUA 3DD2H 2ZTZA 1EB2A 2ALPA 2FTMA 2C90B 1TRYA 3O8RA 2FOFA 1SMFE 2EI6A 1CA8B 3FFGA 3FZDA 1QGFA 3KQDA 2ZGJA 1LHEH 1CU1A 3EDXB 1RXPA 4X1PU 1V2WT 1C2MA 1O3HA 4X1SU 3UOUA 8LPRA 4ZMAH 2ZU1A 4J1YA 2GCHF 4IW4E 3SV6A 1V2LT 1O3NA 3ATKA 2QA9E 1EJMA 3CS0A 3OEED 2ZU4A 2YNAA 4FUJA 5ETXA 2WSSD 1ESTA 3A82A 3S9CA 3KCGH 3ZYEA 2ZHFH 1QL7A 4AOQA 5JBCS 3HK6B 1S85A 1NFXA 2G5NA 2J92A 1C5MD 2XBWA 1CVWH 1QJ1B 1S83A 1ZPCA 3BEFB 1G3CA 4ISOA 4FXGH 2P94A 1ZRBA 5TCCA 1KY9A 1WU1A 2XC0A 4U01A 1ELCA 4NA7A 4NFFA 4FUFA 2XNDD 1BHXB 2Y82A 3U9AH 5SGAE 1W0KD 1AD8H 3ZZ7A 1Z7KA 1XUGA 3FVFB 1C2LA 1G3EA 3SYJA 1GI2A 2R2MB 5JPMH 1SPJA 5GNDA 3LIWA 5A0BA 5BRRE 1EAXA 4DURA 4RT1A 3RXTA 2FLRH 2GZ8A 4YM9A 2VBCA 1PQ8A 3UOPA 4D7FA 2GP9B 2VWLA 1AO5A 1G30B 1MTNB 3ELAH 1C1VH 1FUJA 3PMJA 1P04A 3QLPH 5K7RA 1O3KA 2FWWA 1L0ZA 3M7UA 4XRNA 1Z1JA 1JIRA 3L3TA 5AF9H 1TGCA 4E7NA 3PMAB 2A0QB 2VIWA 1A3BH 3RC5A 1QRXA 1L4ZA 3MOCA 3RXGA 3A88A 2I6SA 3RXIA 1AFQB 2BQWB 1SLWB 5GDSH 1BHXF 1QFKH 5IK2D 3GDVA 2PGQB 4ZAEA 3LGIA 3SUGA 1O2KA 2C8YB 2C3SA 1Z8IB 1BMAA 3L33A 2TPIZ 1Y3UA 3S9AA 1BRCE 1MBMA 1P09A 2V3MA 1HFDA 3FAOA 2ZFRH 4TT3D 2CV3A 1HAVA 2ZHEH 1O32A 2WUCA 1FNIA 3LC5A 5EQRA 1BTUA 1C9TA 1DSTA 1MKXK 4WY3A 1ETTH 1C4V2 2QF3A 1ANBA 1S82A 3HKJB 2W5EA 5E0GA 4DOQA 1F2SE 1SLXB 1C5SA 3E3TA 3QGJA 2L74A 3W1EA 1E38B 1UK3A 5GXPA 1RRKA 1IAUA 4ZUHA 1UW7A 4Z1MD 1C2JA 2KCOA 2M2AA 1DDJA 1FLEE 2TGTA 1Y8TA 4KTUA 3GDSA 1K1OA 3AW0A 3N7EA 3RXVA 4BOHA 2FOAA 2AS9A 3EGKH 3Q76A 1H9IE 1KLTA 1WAYB 1BIOA 1KXFA 2CF9H 3TH3H 1RIWC 3K2UA 2R9PA 3ITIA 7GCHF 1YWUA 2BLQA 3F68H 3SGBE 2VWNA 1ACBE 3DSPA 2C8WB 1UVPA 1L4DA 2G4UA 3KYFA 1BTZA 1LVMA 2Y80A 2VB0A 1WYKA 2XBXA 1G2MA 4JYUH 4HFPB 2PP6A 2G52A 5JDUB 1COWD 4XSKU 3MU4A 1GI9B 2BZ6H 5FCKA 3SQEE 1PJPA 2KAIA 5C3NA 3BG4B 2Z9JA 4I32A 4KTSA 5C2ZA 5HM9A 3EAJA 1H8DH 4UFGH 1TAWA 6GCHF 2Z9LA 4Q7XA 1J8AA 1LVBA 1QL8A 1ESAA 3ATIA 1DS2E 5KEDA 2BY7X 3TGJE 1QBNA 2QC2A 1DWEH 3B23B 3SV2H 1FONA 4E05H 1H1BA 1BRBE 1S5SA 4NIVA 3UWJH 1G3BA 1N6XA 1VITH 3RXOA 2ZC9H 1UCYE 1ZTKA 5HIYA 1JRTA 2UUKB 4VGCC 3RXLA 1Z6EA 2ODYB 1THRH 9ESTA 2BD3A 1C1MA 1SGCA 2RA3A 2BD8A 4AB9A 3RDZA 3ZVEA 3S69A 1HAVB 4QT8C 4XBBA 4DT7B 1D3PB 4BAKB 3RXQA 1Y3VA 2ZFPH 3A7TA 1QA7A 1G2LA 2D26C 1Y3XA 1P05A 1DT2A 1VCWA 2FOEA 1NTPA 4I7YH 2PSYA 3SNBA 3U1IB 1O30A 3RXEA 2Q6FA 1NRRH 3EE0B 2ZU2A 3KQCA 3V12A 1A0LA 4I33A 3SU1A 1GI8B 3OAAD 1RTLA 4AN7A 2A7JA 5FPYA 2ZI2H 4Z0KA 4ZKNU 2BLVA 1OX1A 1T7CA 1ZPZA 1S6LA 1O2QA 3OU0A 1ID5H 2B8OH 4CR9A 2B0FA 2NU2E 1MKXH 4AG1A 4ZROA 1YCPK 1P03A 1GBHA 4MNXA 1J17T 4AGKA 3M35A 4A5TS 2ILNA 2KAIB 1C5RA 4DVAU 2A2QH 1O37A 1GG6B 1C2DA 1CSOE 3MNBA 4RSPA 4RI0A 4Q7ZA 2SGPE 1MZAA 1FDPA 3LGVA 4P00A 2KCYA 4GCHG 3MU8A 3F1SB 1ZHRA 2BD7A 2BX3A 6CHAC 2GT8A 3RXDA 1XM1A 2ZDMA 4Y8YA 3UB0A 2Y7ZA 3OEHD 1O2PA 1CQQA 3TGKE 3I77A 1ANDA 1SQAA 4CRCA 1SGDE 1TALA 1AVGH 4IC6A 4BTTB 3IITA 3P70B 4ZHLU 1AVWA 4I8KA 1HJ9A 4YLQH 1ZHMA 1K1PA 4AGJA 1MCVA 2GCTB 3PO1C 1S6FA 2PKAA 2FPZA 2Y5GA 2SGDE 5C1UA 1P12E 1QR3E 4ABGA 2BDIA 2B9LA 1H8IH 2P59A 3M37A 4FUGA 1TNHA 4ABBA 3FANA 5JYIA 4E7RG 2BX4A 2W7SA 2R0KA 1MAXA 2HNTF 2OINA 3PTBA 2FOCA 4BNRA 2QXGA 5C1YA 3C1KA 3DT0H 1LHFH 1TPSA 2F9OA 2QYIA 1LMWB 3Q3KA 1TOMH 2OC7A 2THFB 1VCPA 5DSFA 1VCQA 1O2MA 1C1OA 3T25A 4DIHH 3TK6A 1TGBA 4HG6A 3T5FH 3ZVFA 2ZFFH 3FOAA 2ZP0H 4M7GA 1MQ6A 1GMHG 1TMTH 3F2HA 3ZVCA 1L1GA 4ISLA 2F9VA 5F03A 5DP6A 1DX5M 1SBWA 1D9IA 4ISHH 1UO6A 1J14A 1J16A 1P06A 2WV5A 3SZEA 2J98A 5HMAA 4GCHF 4AC9A 5FX6A 3A85A 4X2XA 5A09A 1SGEE 1F0UA 3A7ZA 3H5CB 1ZGVA 2BOKA 4YOIA 1ZGIA 5JB8S 2VIDA 1F92A 1HAHH 1HXEH 3MMGA 1ANEA 1UK2A 1SFIA 2OK5A 3M5MA 3GDUA 1BMLA 3F0PA 4ZKSU 1P11E 3KNXA 3GY3A 1AFQC 2ZPSA 2OBQA 1WUNH 1TPOA 2QCYA 1AWHB 1K1MA 4F48B 1EPTA 3N7DA 2ZCLP 1GI0A 4OS7A 5F8TA 4NIWA 3SUFA 3PLKA 5C17A 4D9QA 2R3YA 3KQBA 1SB1H 1S6HA 1TPAE 4FUCA 1C5UA 2GGVB 2JIZD 2PTCE 3RXCA 3DSOA 1LVOA 1SG8B 3T29A 5TJXA 2ZPQA 3P92A 4ZCNA 1VITF 2BY9X 1INCA 2Z3CA 3V7TA 1ZSJA 4NIYA 3U8TH 2TGPZ 2JH6D 1C4Y2 2FI5E 5FPSA 3A80A 1KTTB 3SJKA 2HOBA 3A7WA 4FUIA 2NU3E 4NA8A 2NU0E 1HIAA 3HPTB 2A2XH 2I6QA 2CMYA 3T26A 3LPRA 3TNSA 1UHBA 1PPCE 3ATMA 1AGJA 4X8SH 2BDBA 2BDHA 3OY6U 1UTPA 3T27A 4LK4A 4CRDA 2VVVA 4B76A 3P17H 4X8TH 3MNXA 4WMFA 3LOXA 1PQ5A 3BG8A 1OKXA 4B6EA 4I31A 9LPRA 5EPYA 1IHSH 3VB7A 1BBRK 4O9VA 1FXYA 1ELAA 1D3TB 1XUFA 3BF6H 2W3KA 2F9NA 2J98B 1AU8A 1JIMA 2VU8E 1PPHE 1WQVH 3OYPA 1GBJA 2CJIA 3BG4C 1J9CH 2Q6GA 1THSH 3F9EA 2STAE 3VEQB 3B8JA 1XMNB 3UFAA 1SQTA 5L2ZH 4Y7AA 4KP0A 3SU0A 1QBOA 2PV9B 5IDKA 1EZUC 4YT7H 2DUCA 2G8TA 3GCNA 1BTXA 2G55A 2PTNA 1YPEH 4MNYA 1NS3A 3QN7A 4JCNA 3W95A 4YESB 1GHVH 1HAYB 2HALA 4TYDA 5CE1A 3B9FH 1C5QA 1GBLA 2VH6A 2M5TA 3OTPA 1Z1IA 2VNTA 1YPJH 1BDAA 1C5PA 1Y59T 3EE7A 3E90B 4TPYA 1HCGA 2IJD1 1HNEE 1AB9B 1DITH 1A7SA 4XOJA 4FU9A 3E0NB 3ATLA 5GIBA 4RKJB 2ZZUH 4XD7D 1H9HE 2FI3E 1CT2E 3RMMH 2FOBA 1ZPBA 1FPHH 3LU9B 2A4RA 4BXWA 2PR3A 1O3CA 2BYAX 4LZ4B 5ESTE 4IGDA 3VPKA 1ELVA 2ZGCA 1P57B 3F0OA 4OS6A 4R8TB 4NFEA 1O3LA 2GCHG 1T4VH 3A8AA 3M3TA 2PUQH 3TJVA 1VJAU 1NPMA 1ZSKA 3P8GA 2WINI 1HAZB 3SNDA 2ZIQH 1F5KU 2WHXA 1C2HA 1O36A 1DVAH 2IOTA 3Q00A 2V3HH 2R0LA 5EU8A 4BAHB 1QURH 1TQ7B 3LH1A 5CHAB 1SGFA 4YZUA 3GY5A 1Y5UT 4JZDH 4JK5A 1RFNA 1C5NH 1DWDH 1LVYA 4AZ2B 1QY6A 3IG6B 1BJUA 4Y11E 3GCOA 3UTUH 4JMYA 4CBOA 1O5DH 2J97A 3MHWU 2OQ5A 2CGAA 1GG6C 1A0JA 1BT7A 1VKYA 5FAHA 4OS2A 3H7TA 3ZVGA 1OPHB 1W10U 1WBGB 4YTAA 1A46H 1XKAC 4ACBA 4BAMB 5FL7D 2BOHB 1YPLH 1TB6H 1OP0A 2HNTC 2OC8A 4NZLA 3M5OA 4HTCH 3M36A 1XVOA 4K1SA 4CH2B 2LPRA 2ZHDA 1WSSH 3RXMA 1HB0B 1PPFE 3FO8D 1BBRH 1O3PB 3TPIZ 2OTVA 3MNSA 2QF4A 1W13U 1LHGH 1L2EA 3A8DA 4UDWH 3T28A 1SOTA 3H7OA 1KSNA 1BOQA 2DE8A 3EYDA 1A5IA 4AORA 5LPFA 2ZHWH 1O2YA 2FODA 3RC6A 1GDNA 3FP7E 3KQEA 1EJNA 1MH0A 1TYNA 1IHTH 1WTHD 1GBAA 1YLCA 3ZVAA 1ZMJA 2P3UB 1GJBB 3AAUA 3TJOA 3VFEA 3A7XA 2XWBI 1QRWA 3JZ2B 1AE8H 3V0XA 3BIUH 2SGEE 4U32A 5DP9A 2OD3B 1K1LA 1P2JA 1W7XH 1OYTH 1JXPA 2GDEH 4XBCA 4IMQA 2IPHA 6ESTA 1OWIA 1C1TA 3SZNA 2OP9A 1F0SA 1C9PA 2UUYA 2WV9A 3D65E 4GHQA 1KDQB 1F0TA 4AG2A 4MLFB 3RU4D 1O3AA 5A8XA 2ZEBA 4AX9H 3M7TA 1ELEE 4WXVA 2HLDD 3GYMA 1C1SA 1GI4A 2NU1E 4X2WA 1E0FD 1YYY1 1FPCH 3SGAE 2FZZA 2BQ6B 7GCHG 1FZZA 2NU4E 3PTNA 3ZZ3A 2O8UA 3MWIU 4I8GA 3NWUA 4B1TA 3M3VA 3TIUA 4X6MA 4ZKOU 4Y71A 2ZDAH 3T2NA 3KGPA 4GAWA 2FXRA 1K1JA 1YC0A 2XBVA 2EI7A 4OGYA 2QGRA 2KCAA 3MFJA 1LDTT 4WMEA 1EZQA 1TRNA 1FY3A 1QZ8A 1SLUB 2UUJB 2JKHA 2G51A 4IN2A 1B7XB 3SNCA 4NSVA 1KXAA 4ASUD 3PV2A 2PSXA 4AB8A 1TBQH 3Q3YA 6GCHG 1P2NA 2JH5D 4IMZA 3ZV8A 4AYVB 5F6MA 2ODPA 1ARBA 4H6TA 1CGHA 5J4SA 1D6WA 4HZHA 4MPWA 4ABAA 3RUOA 2Z3DA 2Y81A 3RXPA 3SUDA 1T8NA 1OWDA 2GV7A 3E8LA 3BTQE 2H5CA 4X2YA 1EQ9A 3HKIB 4TY6A 4XDEA 3BEUA 2O8LA 1V2TT 2Q1JA 1NRNH 4UFFH 3BN9A 1QQUA 1SFQB 1YCPM 1LKBA 2VIPA 1G9IE 3HK3B 2YOLA 1EASA 3KIDU 2VWMA 1HYLA 1TE0A 5DGJA 4X2VA 1T8OA 3PB1E 1H8ED 3SJIA 1BITA 3GCTG 3TITA 3TK9A 1B5GH 1SGIB 2GV6A 1IQGA 3QGNB 1UMAH 2F4LA 1GI6A 4WH8A 1K9OE 2W6JD 5L2YH 2XTTB 1XKBC 2ZGHA 1N8OB 1GWAA 2J9NA 3FP6E 2BD2A 4AFUA 2F3CE 1W3CA 4Y76A 1BTPA 3AASA 3U28C 5PTPA 2BM2A 1KXCA 3WWBA 1O2HA 4MVNA 3UR9A 1G3DA 3PV5A 7ESTE 3RP2A 4XE4A 2GT7A 1AUJA 2KCPA 4ZXXH 2ANMH 1GL0E 1ELTA 3F9GA 1MABB 2FS8A 1T31A 1NESE 3Q3XA 1J15A 3W94A 1UK4A 4FUBA 1NRPH 1K2I1 3KQ5A 3MYWA 2P3FH 2CK3D 3T62A 5I25A 3A81A 8KME2 4INKA 3P8NA 2Z3EA 3P95A 2YMSD 2B7DH 3F2GA 4K1TA 4F55A 3FP8E 4CRFA 2AIPA 4GHTA 1DSUA 4JZFH 4FUHA 3MU1A 1YLNA 1P3CA 2C8XB 1GBTA 3VB5A 1DFPA 4GVUA 2ZECA 2LNCA 2PFEA 3K9XB 3AAVA 1AKSA 5E2OA 3RXUA 1TABE 2ASUB 4O3UA 3FN8A 2J38A 1O39A 3RXKA 1MMJN 3L6PA 3BTTE 4X0WU 4TY7A 1FIWA 2J2UA 1ZOMA 3DCLA 2ZDLA 5HM2A 1XUKA 1CA0C 2RDLA 1K21H 3SHAH 1O3GA 5IYTA 4K1EA 1SHYA 1Z71A 2A31A 5EPNA 1BTWA 1CBWB 1SGQE 2W6ID 1RS0A 2UUFB 4GLYA 1ELBA 1EZXC 2WUBA 1H4WA 1C2EA 4I86A 1DUAA 4UEHH 1P02A 3UNSA 3GCTF 4MNVA 2SNVA 1FJSA 2VINA 5EXNA 2BVRH 1RTKA 2YMSC 1V2MT 5T6DA 2AHME 3H09A 1BCUH 1GHXH 2P16A 3D49H 3RLWH 1YPHE 1YGCH 2K0QA 4CRBA 3F9FA 4ABIA 1FV9A 1FX0B 4Y7BA 3M5LA 3PLBA 3NCLA 1WTGH 3SJ9A 1G36A 4OS5A 2JJ2D 3DFLA 1MQ5A 2ZWLH 3NZIA 2A7HA 5A2MH 2ZU5A 2AGEX 2GTBA 3A89A 2UWLA 3EQ0H 5F53A 3SU6A 2Y7XA 1EAWA 2FESH 1EP6A 5CHAC 1BQYA 2K1QA 2QF5A 7LPRA 1D6RA 1OYQA 3PRDA 1O34A 1Q3XA 4B73A 3LC3A 1EOLA 3PYHA 2AYWA 5JB9S 3U1JB 2A7CA 1RGQA 1DUEA 2OC1A 2PW8H 1C1WH 1UTKA 1GGDB 1E79D 1HUTH 3M3SA 2CN0H 1N1LA 1OWJA 2JETB 1TONA 1Z6JH 1NBMD 5HIZA 4A92A 3C27B 2QY0B 1K1NA 4I8JA 1O2LA 3BTFE 4YOGA 3SU2A 3VXFH 4MQAA 1AVXA 2D1JA 2J4IA 5C94A 1O5GH 1IQFA 2RG3A 2TGAA 3URCA 5EIYA 2JDID 4A1TA 1NRSH 1Z8RA 1MTUA 3OE7D 5DO4H 1O38A 2VWOA 1NZQH 1C5YB 1UJ1A 8ESTE 4TWWA 2VIQA 4LOYH 3QZQA 1CE5A 3UWIA 3SU3A 1GBCA 3KYGA 4TWYA 1GJ8B 4DY7B 3QTOH 4AFSA 1A3EH 1SSXA 1HAGE 3O8DA 2BTCE 1NN6A 1RJXB 1HLTH 3ZZ5A 1A1RA 2P3TB 3RC4A 2VIVA 5DP7A 4E06H 5C5NA 3G01A 4B6FA 3TGIE 5LH8A 2RDEA 4OGXA 5EQQA 1O2NA 1FN6A 3BTKE 2HNTE 1VITG 1TBRH 1P8VC 1MU8B 1P0SH 4B2AA 2JJ1D 4NA9H 4A1XA 1BTHH 4A7IB 1TMUH 2ZFQH 3LH3A 3V3MA 1V3XA 3PV4A 3PLPA 4X8UH 2PWXA 1GJ4H 2R2WU 5E0HA 3F6UH 1SGPE 1V2KT 1HAPH 1TNIA 1WOFA 3LDXH 4FUEA 1ANCA 2WYJA 3SU5A 2SFAA 3UREA 1K28D 4JYTA 4KGAA 5C1XA 2KR7A 1S81A 3HGNA 2WPIS 3RM0H 4B71A 1F7ZA 3MTYA 5GJ4B 2GX4A 2VGCB 2ZNKH 4Q7YA 1VGCB 1BMNH 3S7HB 3AVZA 2K8IA 3EA7A 1GJAB 2PKSB 4OM9A 2ZHQH 2BZAA 1GBKA 1NFYA 4P02A 1VZQH 1QTFA 2FEQH 1L1JA 1O2XA 1ZR0A 3RMOH 1UTLM 1YM0A 2CF8H 4TPIZ 1MTNC 4K5ZA 1TX6A 2OC0A 1P2IA 3MQKC 1EFRD 2V35A 1ELFA 3R0FA 1GDQA 1JOUB 7KMEH 1AI8H 2J94A 1KIGH 2VVUA 2XWAA 3K6ZA 1EATA 2QN5T 1KYNA 1FAXA 3RXJA 1GMCG 4ACAA 2ZTXA 1P9SA 2AMDA 2PKAB 3SOSA 1MTVA 1DLEA 1A0HB 2WYGA 5C0UA 5JBTA 3GICB 1DXPA 1UTMA 3WY8A 1W7GH 1O2ZA 1MKWK 1GI3A 3OY5U 4D8NA 3SNAA 2HPPH 4MPVA 3S0NA 2FDAA 3OFND 3SU4A 1N8OC 2ZA5A 1V2JT 1O5BB 1XUHA 1O5FH 1C1UH 1O2UA 1Q31A 3NXPA 3RM2H 1GBFA 2AEIH 1O2OA 1T32A 4DCDA 2TGDA 1KXEA 4WH6A 2GZ9A 4BTUB 1TBZH 3SGQE 5A0AE 1C4U2 1ZMNA 1MZDA 4MPUA 5I46H 2CXVA 1PPBH 2O8WA 3RU4E 1QB6A 4KKDA 2B5TB 2ZO3H 8GCHF 2O8MA 2GD4B 1UVUH 2HWLB 1O3FA 2Q6DA 1E35B 1UCYK 3HATH 4F49A 1K1IA 5LPRA 4JYVH 4BANB 4NGAH 4B2CA 3MH6A 1NM6A 1S84A 2DE9A 1FY4A 1O3IA 1O3OA 1PPGE 4O97A 1C2GA 2KFWA 5FCRA 2AH4X 3MO9A 2F91A 1YPHC 1KLIH 1BTYA 1RIWB 2P8OB 3QX5H 4WXIA 2A45B 5EOKA 2H5DA 2V0BA 1W2KH 1EXFA 2WPJS 2AMQA 3BTWE 1UVSH 1WV7H 1IQJA 4INHA 3SI3H 1NFWA 1HJAB 1O33A 1SLVB 3STJA 4GPGA 2HLCA 1GMCF 4UFEH 2RCEA 1EPTB 2QAAA 4CREA 1LHDH 2Z9GA 1CBWC 3P6ZB 4TSFD 1ZLRA 2EA3A 1GHWH 3SBKA 4ABHA 2J34A 3GY7A 1K22H 3ODFA 1V2PT 1YPGH 1OP8A 5GPIB 4AYYB 2LP6A 2AERH 1C5XB 1SC8U 3HGPA 2W3IA 4Z6AH 1FY5A 2WZQA 3SI4H 3OTJE 4K8BA 3TU7H 4X1NU 1AUTC 3M61U 2OUAA 1CHGA 1D3DB 5JBAS 4YT6H 5EXMA 1QCPA 5JBBS 1YKTA 3UIRA 1VR1H 3S7KB 1LCYA 3PM3A 4VGCB 1IQLA 4LZ1H 3O8CA 1P2KA 2IPQX 2TBSA 4DIIH 3AK5A 4RN6A 1HIAB 3U98H 1UHBB 1MTWA 4I8LA 1WCZA 2D8WA 4NZQA 2RFKC 1FY8E 1C2KA 5EG4A 1YF4A 3K6YA 3QK1A 2ZG0H 4NIXA 1FY1A 1OP2A 2WPHS 1MKWH 5E2PA 1E36B 1EJAA 1GGDC 2ANWA 1HRTH 2BD5A 1O2VA 4U30A 1P10A 2ZTYA 3BV9B 3N7OA 2JETC 3M7QA 1GI7B 2FYQA 3NRLA 3ZZ4A 3QZRA 4AFZA 3UR6A 1FI8A 3E0PB 5H4IB 1FAKH 3PWCA 2ZFTA 1QJ7B 2W7UA 4R0IA 1ZTLA 4Y0YE 2ULLA 1MU6B 1HBTH 1ZSLA 3U8OH 2F9PA 5FPTA 1DE7H 1TX7A 2FYRA 2WV4A 3RXFA 3VB4A 2A4OA 1KTSB 1SGRE 5LPEA 1SGFG 1TLDA 2A5AA 1UCYH 1NU7B 3TJNA 2GDDA 2VH0A 1AN1E 2ANKH 2OBOA 2XRCA 1LTOA 1O3DA 4FUDA 4XBDA 1ETSH 3BSQA 1UTOA 1SGNE 1XXDA 3CS7A 3ZZ9A 3RU4T 1SKYE 1QA0A 2AIQA 2GCTC 1LO6A 2V3OH 4DG4A 1D3QB 1GVKB 2AFQB 3A7YA 2BMGB 6CHAB 3TNTA 1G37A 1GPZA 3PRBA 1E1RD 3SN8A 1OWKA 5EJZA 1HXFH 2OLGA 2XBYA 1PQ7A 5L30H 2A32A 1O31A 1OWHA 1DY8A 4UE7H 1GBDA 2UWPA 3URDA 2SNWA 2O9QA 2ZU3A 3K65B 1LPZB 2G81E 3TH4H 1EB1H 1FN8A 4ASHA 4ABFA 3FZZA 3PO1B 1RD3B 2D2DA 3BEIB 2BY6X 1AMHA 2RA0A 5A0CA 3BTEE 3SJOA 1HJ8A 2HGTH 1F0RA 1TMBH 3LKWA 5GCHF 2FX6A 2O8TA 1O0DH 2GZ7A 2VGCC 1SOZA 3P8OA 1BMFD 1QIXB 4YXWD 1VGCC 2P93A 1O3MA 4J2YB 2KM0A 2NWNA 2PKSC 1CHOF 1W0YH 1GHBF 5CMXH 2HRVA 2V6NA 1GI1A 4JZIA 4F4OC 4IC5A 5T6FA 5DP3A 1ARCA 2LELA 1NBME 5E8EH 2C93B 2ZGXH 4NWLA 1P9UA 2GVFA 1ZHPA 1ESBA 1ZZZA 4X6PA 1WQSA 1FQ3A 1DICA 1HDTH 1O2JA 2YNBA 3ZIAD 2F9UA 2OXSA 1O2TA 3I78A 1DLKB 2UWOA 4X6OA 3F2FA 3JZ1B 4D9RA 1TQ0B 1V2RT 2QV1A 5A8ZA 3LT3A 2HVYB 5HGGA 1MUEB 2QIQA 1UVOA 5K0HA 4NSYA 3A8CA 2TIOA 1EOJA 4K3JA 4YLUA 3U8RH 4ZKRU 1U6QA 3SQHE 1TGSZ 4HI3A 1IQKA 1GVLA 4YO9A 5T6GA 1GMDG 3EA8A 1O2IA 1O3EA 1BRUP 3WWFA 1VJ9U 3LGYA 3V13A 5EW2H 2BD4A 2STBE 1TNGA 1QB9A 1C5WB 3OX7U 5C5OA 3A83A 3VB6A 3PMHB 1MD8A 5T3HA 3WW7A 3STIA 2Y6TA 1TNKA 3NK8A 2A4QA 2ALVA 4CR5A 1HV7A 1ZRKA 4Q63A 4DGJA 1KMHB 5AVDA 1YP9A 4Y8ZA 5ABWA 1O5CB 4THNH 1GJDB 1NT1A 2A4GA 4INLA 1GBBA 1SR5C 3LGTA 3FKSD 1GHZA 3TH2H 2GJGA 3E1XB 4X6NA 4D76A 1PQAA 1GBMA 5CHBA 5EQSA 3SV7A 1G32B 3GCHB 4K60A 1Y3WA 4GSOA 1AFEH 3MH4A 4OS1A 1DY9A 1GHYH 1T8LA 2SGFE 1AQ7A 2BVSH 3PWBA 3OSYA 4HGCA 2P8OC 3QTVH 1SQOA 4WWYA 3DFJA 2BY5X 5EGMA 2XCFA 1EZSC 1O35A 1C1RA 2J95A 1ELDE 2ZDNA 5DN6D 1LPGB 4IBLH 1ZJDA 2BLOA 3KF2A 1HAIH 1GDUA 1HJAC 5FBEA 4DT4A 2BLWA 1S0RA 1EPTC 3LJJA 3KEEA 3VXEH 4XFQA 1OXGA 2FS9A 1DXWA 3A86A 3MI4A 3S9BA 1JMOH 1AY6H 1W0JD 1K0HA 1C5TA 1QL9A 1TA6A 2G00A 3BTDE 3MO6A 1F5LA 1LKAA 1AB9C 1KXBA 1GMDF 4KTCA 5FX5A 2A5IA 2AGIX 3RXBA 1E37B 3F3BA 3NPSA 5DKMA 3RMLH 4ZXYH 2FP7B 4K2YA 2CHAB 1LHCH 4MDSA 3SW2B 1T8MA 1AHTH 1B0FA 2ZQ2A 1C5OH 1BBRE 1ABIH 1S0QA 4NWKA 4RT0A 1P2OA 2QF0A 1GCTB 4H4FA 5A8YA 1ZMLA 1BMMH 1YLDA 3BTHE 2C4FH 5J4QA 1GCDA 1ZJKA 2QXIA 4CHAB 4MNWA 1OSSA 2PHBA 1PFXC 4K8YA 5B6LA 1FIZA 2HVXA 2Z6BD 2Z9KA 1TNJA 1TWXB 1C5VA 1BZXE 2H9HA 1BRAA 2PLXA 4WF8A 2ZPRA 3BIVH 1LQDB 1GJ7B 4MG3A 5AHGH 3MU5A 1W0ZU 3ZZBA 1JBUH 1GHAG 2XYAA 1ZTJA 4X8VH 1AKSB 1IQIA 4O03A 4UFDH 1Y3YA 1DM4B 1F5RA 1W12U 5FXLA 3VGCB 2Y5FA 3E6PH 1NC6A 1HAXB 1O2RA 3CNRA 1NY22 4GUXA 1BB0B 3O8BA 1A5HA 2XC4A 1UTJA 1IQMA 1PYTD 1GBIA 5AFZH 1TRMA 2XXLA 5BPEA 1P3EA 2ZF0H 4YOJA 1PPZA 1NRQH 1OWEA 1V2QT 2L6OA 1Z8JB 1HGTH 2AGGX 2ZGBH 2A1DB 3ATWA 2BVXH 3RMNH 1QNJA 3RXRA 2IJOB 3SV9A 2ZDKA 2H9TH 5C20A 2BB4A 1WXRA 1QB1A 2BDCA 4IN1A 2ZKSA 3NUMA 3LGUA 4OS4A 1CT4E 2BD9A 2GMTB 2BY8X 2BXTH 1TGTA 2EQNA 1GJCB 3ENSB 2QXJA 1GJ5H 2JH0D 3A8BA 5FBIA 4NG9H 1HAOH 1PPEE 5EJLA 2ZDVH 1SQRA 5HXFA 1XVMA 5G4BA 4CBNA 1Y5BT 3DHKH 3E16B 5CDFE 4Q2KA 2J5UA 4LXBH 1MBQA 4Y79A 3GYLB 1NROH 3ESTA 3SJ8A 1C1PA 1PYTC 3QDZB 3VG8A 1GJ6A 1MCTA 2EC9H 1ORFA 3F9HA 3BTGE 2H6MA 3MO3A 2FIRH 3ZVBA 2SGAA 4FU7A 3UY9A 1NU9A 1GHAF 8GCHG 5B6OA 1RTFB 2ODQA 1SHHB 5F8XA 1P01A 1OHHD 1ZYOA 4FETA 1FMGA 1C2FA 4ABEA 3I29A 3TLOA 2ZQ1A 3ZZ8A 3AW1A 1Q2WA 1QJ6B 2BDAA 3A7VA 5DP8A 2GKVE 3M5NA 2XC5A 1GI5A 2W26A 2Z94A 3KL6A 3SHCH 1GVZA 3N99A 2F43B 3VB3A 1YY3A 2VVCA 4BAOB 1EAUA 4MPXA 4B74A 4BTIB 5F8ZA 3GS9A 2KZ4A 4A6LA 1E34B 1O5AB 1TA2A 1H9LB 3EA9A 2ANYA 2ZFSA 3CENA 4IS5A 3MH7A 3DSGA 5KGOA 3TK5A 1MTSA 3QUMP 3GY8A 1X7AC 5EW1H 1AZZA 3QO6A 1AZ8A 1GJ9B 2XCNA 3D23A 4FVDA 1D4PB 1A61H 1MD7A 2OQUA 4Y0ZE 1BA8B 3UPEA 3ZZ6A 1V2NT 4X1QU 1YCPH 3A87A 5C0TA 1XXFA 1XUJA 1XX9A 2FOHA 4ABDA 2C8ZB 2TRMA 2V7QD 2WPKS 4M9FA 3U69H 2FMJA 3DA9B 5DJ7A 1SI5H 4Q80A 3UUZA 4U2WA 1T4UH 2A5KA 4KELA 1TIOA 5HKKD 3MU0A 1V2VT 4ZH8A 3ZVDA 1A2CH 5GWZA 4H42U 3RLYH 2XW9A 1H8HD 3R3GB 1UTNA 2BDGA 3Q77A 1TNLA 4K69A 1TOCB 4O3TA 3RXSA 3ZZDA 1ABJH 1O2GH 5LGOA 5DPAA 1SGYE 1C1NA 4UONA 1TX8A 3GCHC 1W11U 2ZCKP 2HPQH 3SNEA 1QBVH 4FVBA 3P8FA 5EODA 2IN2A 2FX4A 2KX4A 1OS8A 1O3BA 1O2WA 4ISIH 4X1RU 1LPKB 2BQ7B 1EX3A 1E1QD 4B75A 3UNRA 1P2QA 3GY4A 1JRSA 2P95A 1CT0E 1LQEA 2H9EH 3SUEA 1V2ST 1GMHF 2R3UA 2WPLS 3ODDA 4NCYA 2WPDD 4FU8A 2XOKD 2F83A 2BXUH 4Q4LA 3DUXH 1AWFH 4Y10E 3IWMA 1IQEA 4D7GA 1Y5AT 1V2UT 5TCAA 3MH5A 1O3JA 1QQ4A 1XUIA 2SGQE 2H1UA
chains in the Genus database with same CATH topology
1C1QA 2FM2A 1EKBB 5AFYH 2G5VA 4JZEH 3GY6A 3ZYDA 1DOJA 1B0EA 4JK6A 2Y5HA 3RXAA 4SGBE 4AFQA 1ETRH 3KN2A 2CHAC 4MTBA 3NKKA 3UNQA 2WPMS 5DG6A 1BJVA 1TFXA 2F9BH 3BTME 4Y6DA 1GCTC 3LJOA 5C67A 2FI4E 2FOMB 5HYOA 1CA0B 1CO7E 1V2OT 2PUXB 1C5ZB 3UQOA 1CGJE 2VIOA 3PMBB 4CHAC 1DANH 2XNIA 1V6DA 3SO3A 1OOKB 4I8HA 1KLJH 2AMPA 2ESTE 1IOEA 4WJG2 1ELGA 3LGWA 2G4TA 4PROA 3A84A 4WVPE 4Y8XA 4JZ1A 3GOVB 5DK1A 5FHTA 1A5GH 2EEKA 1L1NA 2FOGA 2FTLE 4UD9H 1UTQA 3E91A 3ZV9A 4ESTE 1C5LH 4RKOB 1TPPA 5GCHG 3LONA 1JWTA 4CRGA 1P2MA 4DW2U 1A4WH 1O2SA 4B2BA 5DP5A 1SVPA 4ZHMU 3CP7A 1SGTA 4ABJA 4BXSA 3VGCC 1EAIA 1YBWA 2VJ1A 3UQVA 1TGNA 1W8BH 4A1VA 1YPMH 1CHOG 1GHBG 1KXDA 3SORA 1DWCH 3D62A 3PROA 4CH8B 1KDQA 2BHGA 1HPGA 3GY2A 2FO9A 3KHVA 2ZCHP 5DP4A 4H6SB 1IQNA 3RXHA 5E0JA 2OCVB 1BUIA 1MAYA 1NFUA 1NO9H 3TVJB 1QRZA 2H2ZA 1Z8GA 1AIXH 1GBEA 4BAQB 1SL3A 1UVTH 5ESBA 3ZZAA 1YPKH 1M9UA 1C2IA 4DJZB 1IQHA 2Z9IA 3MNCA 4ZHAA 1N6YA 1DWBH 1CGIE 2EI8A 4CRAA 5L6NH 3GISB 2FLBH 1W14U 5EXLA 2BDYA 2GMTC 2Z7FE 3SV8A 3QWCH 2PGBB 1EP5A 1GL1A 1THPB 6LPRA 4ISNA 3ZZCA 1O5EH 1DPOA 1QHRB 2QXHA 4SGAE 1AE5A 1EUFA 4WMDA 3TJUA 3DD2H 2ZTZA 1EB2A 2ALPA 2FTMA 2C90B 1TRYA 3O8RA 2FOFA 1SMFE 2EI6A 1CA8B 3FFGA 3FZDA 1QGFA 3KQDA 2ZGJA 1LHEH 1CU1A 3EDXB 1RXPA 4X1PU 1V2WT 1C2MA 1O3HA 4X1SU 3UOUA 8LPRA 4ZMAH 2ZU1A 4J1YA 2GCHF 4IW4E 3SV6A 1V2LT 1O3NA 3ATKA 2QA9E 1EJMA 3CS0A 2ZU4A 2YNAA 4FUJA 5ETXA 1ESTA 3A82A 3S9CA 3KCGH 3ZYEA 2ZHFH 1QL7A 4AOQA 5JBCS 3HK6B 1S85A 1NFXA 2G5NA 2J92A 1C5MD 2XBWA 1CVWH 1QJ1B 1S83A 1ZPCA 3BEFB 1G3CA 4ISOA 4FXGH 2P94A 1ZRBA 5TCCA 1KY9A 1WU1A 2XC0A 4U01A 1ELCA 4NA7A 4NFFA 4FUFA 1BHXB 2Y82A 3U9AH 5SGAE 1AD8H 3ZZ7A 1Z7KA 1XUGA 3FVFB 1C2LA 1G3EA 1GI2A 2R2MB 5JPMH 1SPJA 3LIWA 5A0BA 5BRRE 1EAXA 4DURA 3RXTA 2FLRH 2GZ8A 4YM9A 1PQ8A 3UOPA 4D7FA 2GP9B 2VWLA 1AO5A 1G30B 1MTNB 3ELAH 1C1VH 1FUJA 3PMJA 1P04A 3QLPH 5K7RA 1O3KA 2FWWA 1L0ZA 3M7UA 1Z1JA 1JIRA 3L3TA 5AF9H 1TGCA 4E7NA 3PMAB 2A0QB 2VIWA 1A3BH 3RC5A 1QRXA 1L4ZA 3MOCA 3RXGA 3A88A 2I6SA 3RXIA 1AFQB 2BQWB 1SLWB 5GDSH 1BHXF 1QFKH 3GDVA 2PGQB 4ZAEA 3LGIA 3SUGA 1O2KA 2C8YB 2C3SA 1Z8IB 1BMAA 3L33A 2TPIZ 1Y3UA 3S9AA 1BRCE 1MBMA 1P09A 1HFDA 3FAOA 2ZFRH 2CV3A 1HAVA 2ZHEH 1O32A 2WUCA 1FNIA 3LC5A 5EQRA 1BTUA 1C9TA 1DSTA 1MKXK 4WY3A 1ETTH 1C4V2 2QF3A 1ANBA 1S82A 3HKJB 2W5EA 5E0GA 4DOQA 1F2SE 1SLXB 1C5SA 3E3TA 3QGJA 1E38B 1UK3A 5GXPA 1RRKA 1IAUA 4ZUHA 1C2JA 1DDJA 1FLEE 2TGTA 1Y8TA 4KTUA 3GDSA 1K1OA 3AW0A 3RXVA 4BOHA 2FOAA 2AS9A 3EGKH 3Q76A 1H9IE 1KLTA 1WAYB 1BIOA 1KXFA 2CF9H 3TH3H 1RIWC 3K2UA 2R9PA 3ITIA 7GCHF 2BLQA 3F68H 3SGBE 2VWNA 1ACBE 2C8WB 1UVPA 1L4DA 2G4UA 1BTZA 1LVMA 2Y80A 2VB0A 1WYKA 2XBXA 1G2MA 4JYUH 4HFPB 2G52A 5JDUB 4XSKU 3MU4A 1GI9B 2BZ6H 5FCKA 3SQEE 1PJPA 2KAIA 5C3NA 3BG4B 2Z9JA 4I32A 4KTSA 5C2ZA 5HM9A 3EAJA 1H8DH 4UFGH 1TAWA 6GCHF 2Z9LA 4Q7XA 1J8AA 1LVBA 1QL8A 1ESAA 3ATIA 1DS2E 2BY7X 3TGJE 1QBNA 2QC2A 1DWEH 3B23B 3SV2H 1FONA 4E05H 1H1BA 1BRBE 1S5SA 4NIVA 3UWJH 1G3BA 1N6XA 1VITH 3RXOA 2ZC9H 1UCYE 1ZTKA 1JRTA 2UUKB 4VGCC 3RXLA 1Z6EA 2ODYB 1THRH 9ESTA 2BD3A 1C1MA 1SGCA 2RA3A 2BD8A 4AB9A 3RDZA 3ZVEA 3S69A 1HAVB 4QT8C 4XBBA 4DT7B 1D3PB 4BAKB 3RXQA 1Y3VA 2ZFPH 3A7TA 1QA7A 1G2LA 2D26C 1Y3XA 1P05A 1DT2A 1VCWA 2FOEA 1NTPA 4I7YH 2PSYA 3SNBA 3U1IB 1O30A 3RXEA 2Q6FA 1NRRH 3EE0B 2ZU2A 3KQCA 3V12A 1A0LA 4I33A 3SU1A 1GI8B 1RTLA 4AN7A 2A7JA 5FPYA 2ZI2H 4Z0KA 4ZKNU 2BLVA 1OX1A 1T7CA 1ZPZA 1O2QA 3OU0A 1ID5H 2B8OH 4CR9A 2B0FA 2NU2E 1MKXH 4AG1A 4ZROA 1YCPK 1P03A 1GBHA 4MNXA 1J17T 4AGKA 3M35A 4A5TS 2ILNA 2KAIB 1C5RA 4DVAU 2A2QH 1O37A 1GG6B 1C2DA 1CSOE 3MNBA 4RSPA 4Q7ZA 2SGPE 1MZAA 1FDPA 3LGVA 4GCHG 3MU8A 3F1SB 1ZHRA 2BD7A 2BX3A 6CHAC 2GT8A 3RXDA 1XM1A 2ZDMA 4Y8YA 2Y7ZA 1O2PA 1CQQA 3TGKE 3I77A 1ANDA 1SQAA 4CRCA 1SGDE 1TALA 1AVGH 4IC6A 4BTTB 3IITA 3P70B 4ZHLU 1AVWA 4I8KA 1HJ9A 4YLQH 1ZHMA 1K1PA 4AGJA 1MCVA 2GCTB 3PO1C 1S6FA 2PKAA 2FPZA 2Y5GA 2SGDE 5C1UA 1P12E 1QR3E 4ABGA 2BDIA 2B9LA 1H8IH 2P59A 3M37A 4FUGA 1TNHA 4ABBA 3FANA 5JYIA 4E7RG 2BX4A 2W7SA 2R0KA 1MAXA 2HNTF 2OINA 3PTBA 2FOCA 4BNRA 2QXGA 5C1YA 3C1KA 3DT0H 1LHFH 1TPSA 2F9OA 2QYIA 1LMWB 3Q3KA 1TOMH 2OC7A 2THFB 1VCPA 1VCQA 1O2MA 1C1OA 3T25A 4DIHH 3TK6A 1TGBA 3T5FH 3ZVFA 2ZFFH 2ZP0H 4M7GA 1MQ6A 1GMHG 1TMTH 3ZVCA 1L1GA 4ISLA 2F9VA 5F03A 5DP6A 1DX5M 1SBWA 1D9IA 4ISHH 1UO6A 1J14A 1J16A 1P06A 2WV5A 5HMAA 4GCHF 5FX6A 3A85A 4X2XA 5A09A 1SGEE 1F0UA 3A7ZA 3H5CB 1ZGVA 2BOKA 4YOIA 1ZGIA 5JB8S 2VIDA 1F92A 1HAHH 1HXEH 3MMGA 1ANEA 1UK2A 1SFIA 3M5MA 3GDUA 1BMLA 4ZKSU 1P11E 3KNXA 3GY3A 1AFQC 2ZPSA 2OBQA 1WUNH 1TPOA 2QCYA 1AWHB 1K1MA 1EPTA 2ZCLP 1GI0A 4OS7A 5F8TA 4NIWA 3SUFA 3PLKA 4D9QA 2R3YA 3KQBA 1SB1H 1S6HA 1TPAE 4FUCA 1C5UA 2GGVB 2PTCE 3RXCA 1LVOA 1SG8B 3T29A 5TJXA 2ZPQA 3P92A 1VITF 2BY9X 1INCA 2Z3CA 3V7TA 1ZSJA 4NIYA 3U8TH 2TGPZ 2JH6D 1C4Y2 2FI5E 5FPSA 3A80A 1KTTB 3SJKA 2HOBA 3A7WA 4FUIA 2NU3E 4NA8A 2NU0E 1HIAA 3HPTB 2A2XH 2I6QA 2CMYA 3T26A 3LPRA 3TNSA 1UHBA 1PPCE 3ATMA 1AGJA 4X8SH 2BDBA 2BDHA 3OY6U 1UTPA 3T27A 4LK4A 4CRDA 2VVVA 4B76A 3P17H 4X8TH 3MNXA 4WMFA 3LOXA 1PQ5A 3BG8A 1OKXA 4I31A 9LPRA 5EPYA 1IHSH 3VB7A 1BBRK 4O9VA 1FXYA 1ELAA 1D3TB 1XUFA 3BF6H 2W3KA 2F9NA 1AU8A 1JIMA 2VU8E 1PPHE 1WQVH 3OYPA 1GBJA 2CJIA 3BG4C 1J9CH 2Q6GA 1THSH 3F9EA 2STAE 3VEQB 3B8JA 1XMNB 3UFAA 1SQTA 5L2ZH 4Y7AA 4KP0A 3SU0A 1QBOA 2PV9B 5IDKA 1EZUC 4YT7H 2DUCA 2G8TA 3GCNA 1BTXA 2G55A 2PTNA 1YPEH 4MNYA 1NS3A 3QN7A 4JCNA 3W95A 4YESB 1GHVH 1HAYB 2HALA 4TYDA 5CE1A 3B9FH 1C5QA 1GBLA 2VH6A 2M5TA 1Z1IA 2VNTA 1YPJH 1BDAA 1C5PA 1Y59T 3E90B 4TPYA 1HCGA 1HNEE 1AB9B 1DITH 1A7SA 4XOJA 4FU9A 3E0NB 3ATLA 5GIBA 4RKJB 2ZZUH 1H9HE 2FI3E 1CT2E 3RMMH 2FOBA 1ZPBA 1FPHH 3LU9B 2A4RA 4BXWA 2PR3A 1O3CA 2BYAX 4LZ4B 5ESTE 4IGDA 3VPKA 1ELVA 2ZGCA 1P57B 4OS6A 4R8TB 4NFEA 1O3LA 2GCHG 1T4VH 3A8AA 3M3TA 2PUQH 3TJVA 1VJAU 1NPMA 1ZSKA 3P8GA 2WINI 1HAZB 3SNDA 2ZIQH 1F5KU 1C2HA 1O36A 1DVAH 2IOTA 3Q00A 2V3HH 2R0LA 5EU8A 4BAHB 1QURH 1TQ7B 3LH1A 5CHAB 1SGFA 4YZUA 3GY5A 1Y5UT 4JZDH 4JK5A 1RFNA 1C5NH 1DWDH 1LVYA 4AZ2B 1QY6A 3IG6B 1BJUA 4Y11E 3GCOA 3UTUH 4JMYA 4CBOA 1O5DH 3MHWU 2OQ5A 2CGAA 1GG6C 1A0JA 1BT7A 5FAHA 4OS2A 3H7TA 3ZVGA 1OPHB 1W10U 1WBGB 4YTAA 1A46H 1XKAC 4BAMB 2BOHB 1YPLH 1TB6H 1OP0A 2HNTC 2OC8A 4NZLA 3M5OA 4HTCH 3M36A 1XVOA 4K1SA 4CH2B 2LPRA 2ZHDA 1WSSH 3RXMA 1HB0B 1PPFE 1BBRH 1O3PB 3TPIZ 2OTVA 3MNSA 1W13U 1LHGH 1L2EA 3A8DA 4UDWH 3T28A 1SOTA 3H7OA 1KSNA 1BOQA 2DE8A 3EYDA 1A5IA 4AORA 5LPFA 2ZHWH 1O2YA 2FODA 3RC6A 1GDNA 3FP7E 3KQEA 1EJNA 1MH0A 1TYNA 1IHTH 1WTHD 1GBAA 1YLCA 3ZVAA 1ZMJA 2P3UB 1GJBB 3AAUA 3TJOA 3VFEA 3A7XA 2XWBI 1QRWA 3JZ2B 1AE8H 3V0XA 3BIUH 2SGEE 4U32A 5DP9A 2OD3B 1K1LA 1P2JA 1W7XH 1OYTH 1JXPA 2GDEH 4XBCA 4IMQA 2IPHA 6ESTA 1OWIA 1C1TA 3SZNA 2OP9A 1F0SA 1C9PA 2UUYA 3D65E 4GHQA 1KDQB 1F0TA 4AG2A 4MLFB 3RU4D 1O3AA 5A8XA 2ZEBA 4AX9H 3M7TA 1ELEE 4WXVA 3GYMA 1C1SA 1GI4A 2NU1E 4X2WA 1E0FD 1YYY1 1FPCH 3SGAE 2FZZA 2BQ6B 7GCHG 1FZZA 2NU4E 3PTNA 3ZZ3A 2O8UA 3MWIU 4I8GA 3NWUA 4B1TA 3M3VA 3TIUA 4X6MA 4ZKOU 4Y71A 2ZDAH 3T2NA 3KGPA 4GAWA 2FXRA 1K1JA 1YC0A 2XBVA 2EI7A 4OGYA 2QGRA 3MFJA 1LDTT 4WMEA 1EZQA 1TRNA 1FY3A 1SLUB 2UUJB 2JKHA 2G51A 4IN2A 1B7XB 3SNCA 4NSVA 1KXAA 2PSXA 4AB8A 1TBQH 3Q3YA 6GCHG 1P2NA 2JH5D 4IMZA 3ZV8A 4AYVB 5F6MA 2ODPA 1ARBA 4H6TA 1CGHA 5J4SA 1D6WA 4HZHA 4MPWA 4ABAA 3RUOA 2Z3DA 2Y81A 3RXPA 3SUDA 1T8NA 1OWDA 2GV7A 3E8LA 3BTQE 2H5CA 4X2YA 1EQ9A 3HKIB 4TY6A 4XDEA 3BEUA 2O8LA 1V2TT 2Q1JA 1NRNH 4UFFH 3BN9A 1QQUA 1SFQB 1YCPM 1LKBA 2VIPA 1G9IE 3HK3B 2YOLA 1EASA 3KIDU 2VWMA 1HYLA 1TE0A 5DGJA 4X2VA 1T8OA 3PB1E 3SJIA 1BITA 3GCTG 3TITA 3TK9A 1B5GH 1SGIB 2GV6A 1IQGA 3QGNB 1UMAH 1GI6A 4WH8A 1K9OE 5L2YH 2XTTB 1XKBC 2ZGHA 1N8OB 1GWAA 2J9NA 3FP6E 2BD2A 4AFUA 2F3CE 1W3CA 4Y76A 1BTPA 3AASA 5PTPA 2BM2A 1KXCA 1O2HA 4MVNA 3UR9A 1G3DA 7ESTE 3RP2A 4XE4A 2GT7A 1AUJA 4ZXXH 1GL0E 1ELTA 2ANMH 3F9GA 2FS8A 1T31A 1NESE 3Q3XA 1J15A 3W94A 1UK4A 4FUBA 1NRPH 1K2I1 3MYWA 2P3FH 3T62A 5I25A