3UUZA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKLCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uuzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uuzA02
1D6WA 3A85A 2D2DA 4MPUA 2OTVA 1EAIA 1SLVB 1UTJA 1DANH 4Z0KA 2A4OA 1NZQH 1LDTT 4KP0A 3UPEA 1DWCH 3MFJA 3KQBA 1HLTH 3BF6H 4O9VA 2P59A 1QTFA 2Y6TA 1NRQH 8LPRA 1UCYH 1TMTH 2ZO3H 2QGRA 2ZU2A 5EGMA 1EX3A 1W0YH 2SGQE 1MH0A 2CF8H 2V3OH 4Y0YE 5B6OA 1PPFE 2PWXA 1Y5UT 1MMJN 1A0JA 1L1JA 3RU4D 3A80A 1TNKA 4HFPB 3TJNA 1QL9A 2FPZA 2IOTA 4Y7BA 4ZH8A 3LOXA 5DP4A 1PYTD 2ZDVH 5H4IB 3ZZBA 3OTJE 3RMMH 1C2HA 2QYIA 3SGQE 1DT2A 1V2UT 1RXPA 2ZPSA 2BZAA 1C5ZB 1AO5A 3TJVA 1TABE 4GLYA 1D6RA 1XM1A 2WPJS 2FX4A 1HUTH 1AB9B 1BTWA 1GI9B 4ABHA 3M7QA 1TE0A 3ZVGA 3MMGA 4ABIA 3RXCA 1O37A 4VGCC 1EQ9A 3PMJA 3SU4A 5HM9A 1TBZH 1IQJA 2WINI 1GHWH 4UFEH 1LPGB 1FIZA 1BRCE 1K1OA 3MU1A 4O03A 3GYMA 2GX4A 3SGBE 1L2EA 2ILNA 1ANCA 1D3DB 1SC8U 2TPIZ 3STIA 1PQAA 1GGDC 1VR1H 3KQCA 4Y79A 4E06H 1BRAA 4DGJA 2C8XB 1NFWA 1C1MA 1TPAE 9LPRA 1ESTA 4AYYB 4HTCH 2GGVB 2PGQB 3MO9A 4A1TA 1Z6EA 4GCHG 2AGEX 1EAWA 1W10U 3MO6A 4B2CA 2G8TA 1Z8JB 2A7CA 3P6ZB 1P04A 4MDSA 1VJAU 1H8IH 1TOMH 2QA9E 2G4UA 1BOQA 5EQQA 3K65B 3PLPA 5HXFA 4JCNA 1SSXA 1C1UH 3QWCH 5A8YA 4D9QA 1T8OA 3LGYA 1GI7B 2GD4B 2EEKA 1V2OT 1NFUA 2FZZA 2VWLA 1GMCF 3A81A 1O5EH 4B2AA 4J2YB 1DX5M 4CHAC 1XVOA 8GCHF 5G4BA 1O3BA 1GL0E 3RU4E 4AN7A 3HPTB 2ZC9H 4XOJA 1HJ9A 3RU4T 3BTKE 1IQGA 1OOKB 1A3BH 1TPSA 2NU0E 2ZPQA 1NN6A 3SUEA 2PKSB 2ZIQH 1ANDA 3UOUA 1C1PA 1ZOMA 1C5UA 1O5FH 3FFGA 2OQUA 3GY3A 1BHXB 3VGCB 1MQ5A 3GCNA 4X1QU 3RXAA 3RMNH 1S81A 4CRFA 1B7XB 5T3HA 4Q2KA 4SGBE 1P01A 1SGQE 1EPTC 1O2TA 1O36A 5I25A 1OWJA 1NU7B 1EXFA 3MH7A 1O3IA 4U30A 1JXPA 2H2ZA 3RXHA 2FYQA 1V2JT 3QZQA 4ABBA 1C5WB 1JIMA 3UY9A 1C1VH 2R0KA 1BCUH 2A2QH 2HALA 4DURA 4BNRA 2ZCHP 1CGJE 1G3BA 1L1GA 1TGBA 3UQVA 3BTTE 1HRTH 1P2IA 2Z3CA 3E0NB 4ABAA 1GHYH 1RIWB 1ZMLA 5JB9S 3GCHC 4WXIA 3FVFB 4X2YA 2XXLA 1GI2A 4CRCA 5JBCS 3DFLA 1C5YB 1ZJKA 2ZDNA 1W14U 3PLKA 2BXUH 1QNJA 1L0ZA 3NPSA 1P02A 5EXLA 1K28D 3D23A 3QTVH 2VIOA 2VJ1A 3M3TA 3T26A 1G3EA 2THFB 3KNXA 4RKOB 2ZHWH 1CBWB 3SU5A 1EAXA 4CREA 2GP9B 3SBKA 3A8DA 3GY8A 4LXBH 1A0LA 3RC4A 3UREA 2FOHA 1A46H 3N7OA 2OLGA 1BMAA 4X8VH 1V2TT 1N6YA 1UTLM 3BV9B 3IG6B 1GBAA 2G00A 3RXFA 1ZR0A 2GKVE 1MCTA 3M5LA 1F0RA 1FY5A 1HIAB 2PUQH 2W26A 1RRKA 5C1YA 1KLTA 3I77A 1TBQH 1SB1H 1Z1IA 5DKMA 1DICA 1IQEA 2R9PA 1ANBA 3E16B 2QC2A 1MKWH 2Q1JA 1O3EA 1RTFB 1FPHH 1K1NA 1FY1A 3RXGA 4MNWA 3H7OA 3GICB 1CT4E 1QJ1B 2TGDA 1BBRK 1W13U 4KGAA 3K2UA 1QHRB 2XNIA 2A5KA 3S9BA 4UE7H 2AMQA 2XWBI 1ETTH 2FODA 3A86A 1HIAA 1P11E 3S69A 1FN8A 1AQ7A 5CHAB 3MH5A 4K60A 1GCTB 1T32A 2ODQA 1XX9A 3M5OA 1A7SA 5GCHG 3TNSA 2GV7A 3UWJH 1HV7A 3BG4B 3HK3B 1G3DA 5L30H 1P12E 2XBVA 1H9IE 1HDTH 4X0WU 2H6MA 1GVZA 2H9TH 1A4WH 2C8ZB 1QCPA 2P95A 5E0GA 1FY3A 1GI6A 5HGGA 1AN1E 2JH5D 3GDUA 1O2OA 3LKWA 3MNBA 1ZTLA 2G52A 2JETB 2GZ9A 3RXLA 2CV3A 2Z9LA 2PKAB 5CE1A 2G5VA 1JRSA 1P2QA 3KCGH 2BDYA 4OS6A 1FLEE 1S83A 2GZ8A 1EZQA 4E7NA 1SI5H 3AW1A 5AF9H 1YPGH 4THNH 3HK6B 3LDXH 1DWBH 1O2PA 1HYLA 4XBDA 1D3PB 3EAJA 4INHA 4MPXA 1O31A 2HGTH 1MCVA 1OP0A 3ZV9A 4CH2B 1O2YA 1P9UA 2XBYA 2PKAA 1OS8A 2WV4A 4M7GA 3R0FA 2OC1A 1DS2E 1KYNA 3TK6A 6CHAB 2PSYA 5GXPA 1Z8IB 1EUFA 1SLUB 1MBQA 1YGCH 1GVLA 1CT0E 2FM2A 3DUXH 3CENA 1MTWA 3MO3A 2CXVA 4JYUH 3SGAE 4MPVA 3SO3A 4JK6A 5DO4H 4ZAEA 3RC6A 3BTEE 1E0FD 2ZWLH 5E8EH 4Q7XA 2BDIA 2D26C 1YKTA 1EZXC 1KIGH 4CBOA 3UWIA 1N6XA 2HPPH 1EP6A 4Y8ZA 4YM9A 1GMHF 5C2ZA 2ZFTA 1P3EA 1NESE 3A7YA 3RM2H 4E05H 3OY6U 3ELAH 1QRZA 2TGTA 3OY5U 3P8OA 1SBWA 1J15A 1O2IA 1K1MA 5J4QA 5EW1H 5LGOA 1V2QT 2OUAA 2ZU1A 2VH6A 2JH0D 1G32B 3A84A 3TH4H 1GJBB 1C2GA 5FPYA 4VGCB 4GCHF 3QK1A 5T6FA 4DIIH 1HAXB 2PFEA 4I33A 2XC0A 5ABWA 1NO9H 2ESTE 1OWEA 3URDA 1GBEA 2GCTB 3OSYA 3EA7A 2NWNA 1DUEA 2ZU5A 5HM2A 1YPLH 3RXQA 3T5FH 5BPEA 3VB6A 1P0SH 3FP6E 5GJ4B 3VGCC 1N8OC 4Q80A 3UR9A 1D9IA 3QTOH 5K7RA 1CE5A 2STBE 4MLFB 3E6PH 1GJ8B 2Z3EA 1C4V2 3D62A 5BRRE 1LTOA 7KMEH 1OWIA 3E3TA 1C9PA 3KQDA 4TWYA 2ZNKH 5FX5A 3SNEA 1THRH 3GOVB 4NIXA 2WUCA 1SOTA 5F6MA 2A2XH 2NU3E 4A7IB 1P57B 3SJOA 4BXSA 1P3CA 1XXFA 2P93A 1GBFA 2FOEA 3SJ8A 2A4RA 4INKA 3URCA 1GHXH 1XVMA 4A6LA 2AEIH 2PR3A 2PSXA 1HAGE 4K69A 4K1TA 1HFDA 1ZSJA 4FUEA 4X1PU 3ITIA 1QQ4A 3UIRA 8ESTE 4WXVA 1GI4A 2Y5HA 4CHAB 1K9OE 3VB5A 5EOKA 1THPB 1JOUB 1YLDA 4TPYA 1TGTA 1AD8H 4K3JA 1DPOA 1HAOH 4WY3A 5JB8S 1O34A 3E0PB 4E7RG 1YLCA 1C2KA 3ZVFA 1P2MA 4MNXA 1E34B 3M5MA 3BTME 1YPHC 1UO6A 1CBWC 3TNTA 2Y82A 1GBLA 2ZFFH 4NFEA 4Y10E 4CRAA 1PJPA 1S0RA 2Y5GA 5ESTE 1V2RT 1D3QB 3MU5A 3Q3XA 2ALVA 4NIYA 3VFEA 1TX6A 2CMYA 3BTHE 1O0DH 1QB6A 1EPTB 1E36B 4YOJA 6ESTA 2GV6A 1T4UH 4RKJB 3IWMA 4NSVA 1XKAC 1LCYA 2B9LA 2HVXA 4BTTB 1FMGA 4FVDA 1TPOA 3L3TA 4DCDA 1LHDH 4OS4A 1DSUA 4I8LA 3RXEA 1BTHH 3ZZ9A 1WCZA 1MD7A 4AFSA 1ELGA 4MNYA 2W7UA 5C1UA 1OX1A 2ZGXH 1RJXB 1MU8B 1EPTA 3P70B 4DT7B 2HNTF 4X8TH 3GCHB 2Z9KA 3MH4A 4GPGA 1C5QA 3LPRA 4KTCA 4RN6A 2SGFE 2A0QB 1FXYA 2PW8H 3ATWA 3LIWA 2EI8A 4TY7A 4B76A 1UK3A 4X2WA 1BQYA 2TGPZ 1ZSKA 1AE8H 1GI5A 5AHGH 4SGAE 1MKXK 2RDLA 3V3MA 2UUYA 1C9TA 6LPRA 4LK4A 1SVPA 1C1SA 3Q00A 1O5BB 4H6TA 2ODYB 3MYWA 1S82A 3M61U 1HPGA 5EODA 1ZJDA 2NU4E 1BZXE 3GY4A 4IBLH 4ABFA 3AAVA 1O3AA 1OYTH 2BY7X 3A7TA 5C1XA 1UTPA 3F68H 4X6MA 1ANEA 2CHAB 2BTCE 1IQNA 1AVXA 2FOMB 5GCHF 1ELDE 3ZYEA 1SG8B 1Y5AT 4OGYA 3ZZCA 1G3CA 1RTKA 3A7XA 3SV2H 3TU7H 5A0CA 3QUMP 1EOJA 3SHCH 3ZYDA 3SV7A 1FPCH 2Q6DA 3MU8A 4R0IA 1ZSLA 3O8CA 1SMFE 2M5TA 3UNQA 1FNIA 1OP8A 4X1NU 2A1DB 2H9HA 5IYTA 6CHAC 1BITA 2GT8A 3CS7A 5E0HA 2RA0A 4K8BA 5A0BA 1UVUH 1AFQC 1O2SA 4NZQA 1JWTA 2ZFRH 2FEQH 5AFYH 1Z71A 4QT8C 1RTLA 1THSH 1TGSZ 1ZRBA 1Y8TA 1NS3A 2Z94A 1LQDB 1P9SA 5JBTA 1KSNA 1O3NA 1NPMA 1LKAA 2SNVA 2XCNA 2W3IA 1HBTH 4WMFA 1O3JA 3SNDA 7ESTE 2C8YB 1ELAA 1F2SE 1C2EA 2TBSA 4Y0ZE 4BXWA 1W12U 2EC9H 1GPZA 1MZDA 3LC3A 3TK9A 1RD3B 1TOCB 1S6FA 1C4Y2 4DG4A 1HXFH 1SHHB 2SFAA 4XDEA 1V2ST 3RXUA 4BANB 1TNJA 2WYJA 3TPIZ 3B9FH 2AMDA 1TYNA 1Z8GA 1LHCH 1GJ6A 1F7ZA 2A4GA 3UOPA 1Z1JA 1MU6B 1ZMJA 2HNTE 1WAYB 4FVBA 1O2LA 1FIWA 1V2KT 1VITH 1GMHG 1Q3XA 2GCTC 2G4TA 1SGTA 3KGPA 1W7GH 4ZUHA 1AZZA 2BD4A 1EP5A 1YCPH 1BMLA 3VEQB 1IQMA 1HB0B 3ZZAA 1DY9A 3A7VA 1AE5A 5SGAE 4Y8YA 4IC5A 4A92A 3U1JB 1O3LA 4MPWA 4ZROA 2NU2E 1A1RA 2FS8A 4MTBA 4ZKRU 1C2MA 2VB0A 3PM3A 1ABJH 3LU9B 4I31A 2YNBA 3LT3A 5CMXH 1IOEA 1GBTA 5L2ZH 2H1UA 1SGDE 3HGNA 5DP7A 2GVFA 5L6NH 3LJJA 4ZHMU 3RM0H 1UTNA 1FV9A 1GBHA 1BIOA 3FP8E 1YBWA 1SGPE 1J16A 3RXKA 5DPAA 1YPJH 1W7XH 2BLOA 2C3SA 1RS0A 3ZZ6A 3I29A 3TJUA 4AB8A 1AVGH 1P10A 2B8OH 4AG2A 4JK5A 1KTTB 4LZ1H 2WUBA 1ARCA 3GISB 4WMDA 3WY8A 2J38A 1AGJA 1PYTC 2BLVA 1Z8RA 1OYQA 1C5MD 3Q76A 1ZPCA 2ANKH 2ZTXA 1P2NA 4XSKU 4AFQA 1O2XA 3DFJA 1RFNA 2VNTA 2Y7XA 2V6NA 3PTNA 2BVSH 1N8OB 1O2ZA 4H4FA 2ZCKP 4X6NA 2FS9A 4IS5A 4TY6A 3BG8A 3NUMA 1QRWA 3TLOA 1TWXB 1J17T 1MTVA 1BBRE 1TBRH 2EA3A 2W7SA 1LHFH 3QDZB 1VITF 2SNWA 2VVVA 1SQOA 5J4SA 2KAIB 2J95A 3TK5A 1G30B 2BQ6B 4YESB 2R2WU 3SU1A 2OXSA 1TA6A 1EZUC 2ANYA 1BTXA 2P3TB 3EA8A 1JIRA 5DP5A 2BY9X 3ZZ3A 3UNSA 2AMPA 2B5TB 2PLXA 2ZZUH 1C5XB 2ZHDA 2UUFB 2VWOA 1LVOA 3TITA 3BTFE 3GCOA 4WWYA 1BA8B 3RP2A 5FCRA 4AZ2B 3SHAH 2NU1E 1QQUA 3U8OH 3PV4A 4YO9A 2KAIA 2ZF0H 4Y7AA 4ZXYH 3SNCA 1TQ7B 4U01A 1A0HB 3F6UH 4RSPA 4DW2U 2F3CE 3SI3H 2FOAA 1WQSA 1UVTH 4IN1A 3PB1E 3EDXB 2OINA 2BD8A 3PWBA 4MG3A 2O8UA 4GSOA 1EOLA 4YOGA 4GHQA 3P17H 1FJSA 2JH6D 4JZEH 5FX6A 1INCA 2QXIA 4ZHAA 3JZ1B 1B0FA 3BTQE 3CP7A 1P03A 1QIXB 5T6GA 2XBWA 1MTNC 1C5VA 3RXMA 5DP8A 1P06A 3AW0A 4I8GA 3FANA 1UCYE 1BJUA 2CHAC 1LHGH 1NRRH 1T31A 3SU0A 3SJKA 2TGAA 1MZAA 2BDAA 1CGIE 1ELBA 3NXPA 4ISNA 3U1IB 3PMAB 3QO6A 1TMUH 3QGJA 1AI8H 4ISOA 4B74A 3GCTG 1MUEB 1QURH 3PROA 3RLWH 3QGNB 4NSYA 2BD5A 1TA2A 9ESTA 4BTUB 1KXDA 2GCHG 1C5NH 1FAKH 1G37A 1QY6A 1EKBB 3LC5A 5EQRA 1AUJA 2ZQ1A 5T6DA 2IPHA 1SGFG 1CHOF 2HWLB 1O3KA 1OPHB 1RGQA 3S9AA 2XW9A 1Z6JH 1OWHA 2BY6X 2ZGJA 1SLXB 2A4QA 2FI3E 1QL7A 5A8ZA 3T28A 3RXRA 2ODPA 1JRTA 1JBUH 5FXLA 4D7FA 1AKSB 1G36A 1SGNE 2QF0A 1SR5C 2OBQA 4NA8A 1C1RA 1GBMA 3ZZ4A 3TVJB 1C1OA 3GY6A 1J9CH 1KTSB 2QF3A 3MU0A 1DOJA 1AWFH 1QA7A 1NM6A 4H6SB 4GUXA 1XXDA 1VGCC 2PHBA 4FU9A 2OQ5A 1UVOA 1PQ7A 1TX8A 1NROH 1BHXF 2C93B 1GHAF 1GWAA 3QZRA 5DP6A 3SUGA 1AUTC 2YNAA 1A3EH 1EAUA 2OC0A 1NRPH 3BTWE 3S7KB 3VB7A 2ZDKA 2ZFPH 2FXRA 1AKSA 4LOYH 2AS9A 1JMOH 4NIVA 3SU6A 2G51A 1S5SA 1TNLA 4CRGA 1VJ9U 1MTUA 1BDAA 4CRDA 4K2YA 3M3SA 2BY8X 1Y3YA 3ZVBA 4D8NA 1BJVA 3SNAA 2ZGCA 1WQVH 1U6QA 1GBDA 2AYWA 1LVMA 2F9PA 2FTLE 1K22H 1F92A 1CQQA 1UCYK 1O2JA 3PWCA 1QBNA 2UWLA 1AFQB 4WF8A 2WV5A 4XBBA 3VXEH 3SV6A 3FZDA 4AFUA 3L6PA 2BMGB 1VCWA 2GDEH 1SGRE 5FBEA 1O2NA 1UK2A 4FU7A 2BB4A 3SZNA 1FDPA 2VGCC 4WH8A 2AIQA 2V0BA 3C1KA 5DG6A 2ZDLA 1MAYA 3UUZA 1TRYA 1Z7KA 2O8MA 1TNIA 3RDZA 1ETSH 1KY9A 2XWAA 4FUIA 5IDKA 1CU1A 1YP9A 2FTMA 5FCKA 2VVUA 2VINA 5DGJA 1GDUA 1MAXA 4KTUA 2FOFA 3DA9B 1EJNA 1TPPA 3BEFB 4AORA 1KLJH 1KLIH 1C2LA 2BLQA 1UTQA 4Y76A 4BAHB 4ZMAH 1SGIB 2PV9B 3AASA 1AMHA 3P8FA 1O3DA 4WMEA 1E35B 3T2NA 2F83A 4BAKB 1AIXH 1C5RA 5F8TA 2EI6A 3P95A 3RC5A 2C8WB 1XMNB 1ID5H 1ELCA 2A45B 4NCYA 1WV7H 1ELTA 5LPFA 2BQWB 7GCHG 1TIOA 1V6DA 2ZDMA 3A7ZA 2FLRH 2BZ6H 1D3TB 1AZ8A 1WTHD 1ELFA 1UTMA 1O30A 1DXWA 1C1NA 4ISLA 4K1EA 3GY7A 3O8DA 3UQOA 2B7DH 1YPEH 2F9BH 1IQKA 2P8OC 1UMAH 1H9HE 1PPBH 3F9GA 1KXAA 3ENSB 3MI4A 1DLKB 4FXGH 1HNEE 1O2KA 3NK8A 1UVSH 5C5NA 1CT2E 2W3KA 2ZGHA 2PTCE 1DVAH 2FOCA 1O3MA 2F91A 2Y5FA 3NCLA 1QBVH 5E2OA 4YT7H 1NFXA 2G55A 1VITG 5EPNA 1GG6C 1P09A 2BD2A 3BEIB 2J92A 3SUFA 3SQEE 2O8TA 1ZGVA 2A31A 1T8NA 3LGVA 5E2PA 4BAMB 3ZVDA 2FOBA 2I6SA 1IQIA 2PGBB 5TJXA 1GL1A 4ZKOU 1BUIA 1C5LH 1HAVB 2XC4A 4I7YH 1BTPA 2R3UA 1VCPA 1QGFA 1E37B 1K21H 1O39A 3OX7U 2ZFQH 1TB6H 2ZFSA 1ORFA 4F49A 4JYTA 2OP9A 2ZDAH 1CSOE 4XFQA 5GDSH 1F5RA 1DLEA 2BX4A 2AFQB 2BD9A 1ELVA 3HKJB 4AG1A 4NA7A 4AFZA 2QAAA 1F5KU 2SGDE 1HAVA 4ABEA 5FPTA 5TCAA 4B73A 4I8HA 5FPSA 2H9EH 4NIWA 1TNGA 2ZECA 1FUJA 1C1TA 1F0TA 3NWUA 2O9QA 5HMAA 3ZVAA 1BTUA 2UUKB 2J94A 1XKBC 2BOKA 8KME2 2GMTC 1EASA 3MHWU 4XBCA 4FUHA 2ZP0H 1GI1A 1PPHE 1V3XA 5JBBS 1F5LA 1IQHA 3GCTF 3GDSA 2QY0B 3LGWA 1FAXA 4UONA 1S84A 3M3VA 4ZKSU 3D65E 1C1QA 2GCHF 2A7HA 4J1YA 3CS0A 1DSTA 5PTPA 2ANMH 2BVRH 1TMBH 2WPLS 4GAWA 4O3TA 1MTNB 1QRXA 2DUCA 3ZV8A 1ZGIA 1CHOG 1GBBA 3EE0B 1OWKA 4NFFA 5EU8A 2ZHQH 3A89A 4Y11E 1GJ4H 2K1QA 3QLPH 2SGEE 2YOLA 3M36A 2BYAX 3KF2A 5F8XA 1C2FA 3MWIU 2OC7A 1C5PA 1NC6A 4UFFH 1LMWB 1MKWK 3A87A 1ACBE 1LO6A 1LVBA 2VIVA 1Y3WA 4FU8A 1L4DA 2Y7ZA 1O3HA 1SGEE 3VB3A 3GY5A 2A5AA 3RXBA 4KKDA 1O2HA 1EJMA 3PMHB 2BDBA 1A5IA 3F1SB 1GHAG 4U32A 1GDQA 1LHEH 2AGIX 1A2CH 4AGJA 2XYAA 1ABIH 5FHTA 1GCDA 1K2I1 2H5CA 5LH8A 4WH6A 2STAE 3V12A 1O2MA 3ODFA 2DE9A 4ABGA 1GJCB 1K1LA 4B2BA 1B0EA 1BTYA 2EI7A 4BTIB 1TGCA 1QB9A 1S85A 3B23B 3RLYH 3UR6A 2UWPA 4AOQA 1VGCB 2V35A 1T8MA 2ZQ2A 3A8BA 5E0JA 3ZZDA 1EB2A 2QIQA 2QXJA 3BIUH 3ZVEA 2ASUB 1HAPH 4A1VA 2BY5X 5GIBA 4A1XA 1H9LB 4YT6H 2Z9GA 1TALA 1O33A 2RCEA 1XUKA 2ZU4A 2WPMS 4O97A 4D9RA 3DT0H 3T62A 1PPGE 4DVAU 1BMNH 3FZZA 4PROA 1GJDB 1FONA 2HNTC 4MNVA 3JZ2B 1CA0B 2IJOB 4ZXXH 2Q6GA 1GHVH 1PPZA 3AVZA 3UNRA 3UTUH 5A09A 3U69H 1O5DH 1KXEA 1O2UA 2WYGA 3V0XA 1WU1A 1TFXA 4ESTE 5JYIA 2B0FA 1GBJA 3BTDE 2FDAA 1EB1H 1T7CA 3GDVA 1S6HA 4MQAA 1YYY1 4DOQA 3SI4H 1C2JA 2BHGA 1GBCA 2W5EA 1AWHB 4GHTA 1L4ZA 2O8LA 1ZHRA 2BD3A 1XUHA 2AERH 2VGCB 2P3FH 5DP9A 2FMJA 3E1XB 4CBNA 3SU3A 1OWDA 1IQLA 1VZQH 4FUGA 1V2MT 1O2WA 1UVPA 1AHTH 5F8ZA 1F0UA 4HGCA 1SL3A 1QBOA 2UUJB 3PTBA 5EXMA 3ATKA 3E8LA 4INLA 2CF9H 2VVCA 1ESAA 2BVXH 2VIDA 5GWZA 1S0QA 3EQ0H 4YLUA 1GVKB 7GCHF 3SJ9A 2CGAA 1KXFA 2ZG0H 4IW4E 1OSSA 2Z3DA 1FI8A 5AFZH 3M5NA 4FUDA 4JZ1A 4K8YA 2J2UA 4UD9H 3M7TA 3R3GB 1Y3UA 1Q31A 3PO1C 3I78A 1SGYE 3MNXA 3HKIB 1AU8A 2IN2A 2A32A 5EQSA 1HAZB 3F9FA 1HJ8A 2A5IA 2J34A 4UFDH 5LPEA 1C1WH 2R2MB 1HCGA 1V2LT 2D1JA 4NWLA 1IHTH 1TAWA 1K1PA 4X6PA 3LONA 5LPRA 2ANWA 1FN6A 5JDUB 1KXBA 3S0NA 4X1RU 2P3UB 1NY22 1ZYOA 4TYDA 1GJ9B 4BOHA 2GTBA 1SFIA 4IC6A 2HOBA 2P8OB 3LH1A 3E90B 3TH3H 3RMLH 6GCHG 2I6QA 1O35A 2BX3A 4D7GA 2ZCLP 1W8BH 2QXGA 1GJAB 3S9CA 4K1SA 2BDGA 1T8LA 3W94A 2VWNA 4KTSA 1SQAA 3RXSA 4Q7ZA 4R8TB 2FOGA 1O3GA 2Z9JA 5FAHA 1GG6B 4IMZA 5AVDA 2VWMA 1DM4B 1OXGA 3LGTA 1J8AA 2XRCA 1GDNA 2ZHEH 3BIVH 1TX7A 2WPKS 2ZHFH 1QB1A 2SGAA 2BXTH 1LVYA 4OS7A 2HLCA 4WJG2 4AB9A 2VU8E 5A2MH 1G2MA 1TRMA 1BB0B 3EYDA 3L33A 1ZHMA 1PPCE 2BDCA 1GBKA 3ZVCA 4B1TA 2HRVA 1QJ6B 3KQEA 5EG4A 3QN7A 3VXFH 4FUBA 2C4FH 1MKXH 3KIDU 1YCPM 1NRNH 2ZTZA 3TH2H 1K1IA 4Z6AH 1P8VC 2FYRA 1HXEH 1MTSA 1IHSH 1XUIA 4DJZB 3C27B 4O3UA 1O2QA 3RXJA 4YLQH 2F9VA 3FAOA 4GVUA 1XUGA 1X7AC 2RG3A 3MOCA 1BMMH 3ODDA 1TONA 1F0SA 1GMDG 1HJAC 4X8SH 2F9UA 1GBIA 2FX6A 2GMTB 3D49H 2VIWA 2ULLA 1FY4A 4Y6DA 4NG9H 4D76A 1GI8B 1H8DH 3O8RA 1W3CA 3SV9A 3RXDA 1GHBG 1C2DA 3TGJE 1DFPA 2BD7A 3K9XB 3F9EA 5DP3A 4LZ4B 4ABJA 1EZSC 2ZEBA 4ASHA 1PPEE 1QA0A 1WOFA 5GPIB 1SHYA 5C20A 3RUOA 2J9NA 5EXNA 2TIOA 1DXPA 5FBIA 3K6YA 4NWKA 4F4OC 1CVWH 1DY8A 4YTAA 1KXCA 4UFGH 3LJOA 3T25A 1SFQB 4JMYA 3ZZ8A 1V2PT 1ZZZA 3GYLB 1OKXA 3SV8A 4TPIZ 3A7WA 2XBXA 1ARBA 4K5ZA 5A8XA 1CA0C 3BTGE 1AVWA 4ZKNU 1XUJA 1HAHH 3H5CB 2D8WA 2J4IA 2R3YA 3OU0A 5DK1A 3TIUA 1WYKA 3BN9A 3EA9A 3A88A 1ZTKA 3SN8A 1QR3E 3A82A 1IQFA 1AB9C 5DJ7A 3STJA 3TGIE 3KN2A 1K1JA 1DITH 4ABDA 3SNBA 1WSSH 1ZPZA 4X2VA 4MVNA 4X2XA 1W2KH 2FI5E 1QL8A 1GJ7B 1SLWB 1UTOA 3W95A 4HZHA 3KEEA 3SORA 4FUFA 4ISIH 2VH0A 3M7UA 1ZLRA 3SQHE 3OYPA 1CA8B 1C5SA 4B75A 2ZGBH 2ZA5A 3Q3YA 1A5GH 2C90B 1G9IE 3A83A 2BM2A 1LQEA 1NRSH 1O5AB 1L1NA 3SOSA 7LPRA 2R0LA 1UTKA 2AIPA 3KL6A 3VB4A 4OGXA 1NU9A 1V2WT 3U8TH 3ESTA 1ELEE 1A61H 1N1LA 5C5OA 3P8GA 2V3HH 1O32A 4B71A 1ZHPA 2ALPA 5HYOA 1NT1A 1P05A 1O5CB 1YPMH 3RXOA 1V2NT 1ETRH 2JKHA 2Z6BD 4UDWH 1C2IA 4NZLA 2ZKSA 4BAQB 1ZTJA 3UFAA 1EATA 5TCCA 3SW2B 1V2VT 1A5HA 2XTTB 1SOZA 2FLBH 4AGKA 1FZZA 2WPHS 1TLDA 1HAIH 1YCPK 3M35A 1H4WA 3GY2A 1W11U 2QN5T 3PLBA 1WUNH 1LPKB 1P2OA 4H42U 2Z9IA 1UJ1A 1O38A 2FIRH 4JYVH 2GZ7A 2FESH 3S7HB 2VIPA 2PKSC 1P2KA 3U8RH 3MNCA 1BRBE 1G2LA 3F9HA 1D4PB 2FO9A 2GT7A 1ESBA 1TQ0B 3B8JA 2DE8A 1T4VH 2ZTYA 1GGDB 2Y81A 1SQTA 4Y8XA 4DIHH 2GDDA 4FUCA 1Y3VA 2AGGX 2Q6FA 4XE4A 4I32A 1GMCG 3T27A 1O5GH 3K6ZA 5C3NA 4BAOB 2P16A 4CRBA 3M37A 3FP7E 2ZI2H 1W0ZU 2LPRA 8GCHG 4NA9H 4TWWA 2BOHB 3QX5H 3RXVA 3MTYA 5A0AE 3RXIA 3MH6A 3T29A 2XCFA 1HGTH 1SGFA 1VCQA 3RXPA 4JZDH 2TRMA 3VPKA 1CGHA 3O8BA 3DD2H 3DHKH 2UWOA 2SGPE 1HAYB 4YOIA 4IMQA 3U98H 3SUDA 3HGPA 3PO1B 4ZHLU 1CO7E 1AFEH 4HI3A 2VIQA 4JZIA 1O2VA 3AAUA 1Y59T 1RIWC 2OC8A 1PQ5A 1TNHA 2LNCA 2QCYA 1MQ6A 3ATIA 1YF4A 2F9NA 3A8AA 4OS2A 6GCHF 4IN2A 1PFXC 3ATLA 2CJIA 1E38B 1DWEH 1WTGH 4IGDA 2QXHA 3G01A 2PUXB 1P2JA 4I8JA 5ESBA 1YPHE 3SU2A 2OCVB 2Y80A 3KHVA 2F9OA 1Y5BT 2OD3B 1UHBB 5I46H 3LGIA 3MNSA 3ZZ5A 4UEHH 1QFKH 3MU4A 3ATMA 1ZPBA 1Y3XA 4JZFH 3TJOA 1YPKH 4CH8B 3TGKE 4OS1A 5EPYA 1O3PB 1YC0A 4DY7B 1B5GH 1WBGB 2XC5A 2A7JA 4OS5A 3P92A 1OP2A 2RA3A 4Y71A 4X8UH 5EW2H 3NZIA 2P94A 2ZU3A 1EJAA 1KDQB 1XUFA 1AY6H 1ZMNA 2CN0H 2OBOA 2ZPRA 3V7TA 2AH4X 1GJ5H 1O3FA 2QV1A 4CR9A 2BQ7B 2FWWA 1UHBA 1NFYA 1NTPA 3Q3KA 4ISHH 1Q2WA 4AX9H 1TGNA 3BEUA 2O8WA 3PMBB 4KELA 4X1SU 1MBMA 4WVPE 1BT7A 5JBAS 1FQ3A 3P8NA 1PQ8A 4A5TS 2H5DA 1J14A 1C4U2 1BBRH 1KDQA 4I8KA 1SGCA 3BSQA 4X6OA 5CHAC 1DUAA 1QJ7B 3IITA 3LGUA 1GCTC 1O2RA 1FY8E 1GMDF 5F03A 2FI4E 1C5TA 3H7TA 1IAUA 3BG4C 1H1BA 4CR5A 5C67A 1GHZA 1GI0A 2G5NA 1O2GH 3A8CA 1SPJA 1DWDH 2BDHA 1BTZA 3PYHA 1GHBF 2HPQH 3V13A 5JPMH 1BRUP 3Q77A 1UK4A 3RXTA 4NGAH 2Z7FE 5L2YH 2WPIS 1GI3A 1O3OA 3LH3A 3RMOH 4U2WA 2FP7B 3EGKH 1DE7H 1ZRKA 2JETC 1YM0A 3E91A 5ETXA 1C5OH 3NKKA 2G81E 4YZUA 2PTNA 1MD8A 3ZZ7A 2BLWA 3HATH 4FUJA 1O3CA 3U9AH 5K0HA 1M9UA 4Q7YA 1HJAB 1DDJA 4AYVB 1LKBA 1TRNA 1LPZB 3SJIA 1CHGA
chains in the Genus database with same CATH superfamily
1D6WA 3A85A 2D2DA 4MPUA 2OTVA 1EAIA 1SLVB 1UTJA 1DANH 4Z0KA 2A4OA 1NZQH 5HKKD 1LDTT 4KP0A 3UPEA 1DWCH 3MFJA 3KQBA 1HLTH 3BF6H 4O9VA 2P59A 2KR7A 1QTFA 2Y6TA 5B6LA 4AC9A 1NRQH 8LPRA 1UCYH 1TMTH 2ZO3H 2QGRA 2ZU2A 5EGMA 1EX3A 1W0YH 2SGQE 1MH0A 2CF8H 2V3OH 4Y0YE 5B6OA 1PPFE 2PWXA 1Y5UT 1MMJN 3VG8A 1A0JA 1L1JA 3RU4D 3A80A 1TNKA 4HFPB 3TJNA 1QL9A 2FPZA 2IOTA 4Y7BA 4ZH8A 2KM0A 3LOXA 5DP4A 1PYTD 2ZDVH 5H4IB 3ZZBA 3OTJE 3RMMH 1C2HA 2QYIA 3SGQE 1DT2A 1V2UT 1RXPA 2ZPSA 2BZAA 1C5ZB 3KYGA 3W1EA 1AO5A 3TJVA 1TABE 4GLYA 1D6RA 1XM1A 2WPJS 2FX4A 1HUTH 1AB9B 1BTWA 1GI9B 4ABHA 3M7QA 1TE0A 3ZVGA 2KCYA 3MMGA 3FO8D 4ABIA 3RXCA 1O37A 4VGCC 1EQ9A 3PMJA 3SU4A 5HM9A 1TBZH 1IQJA 2WINI 1GHWH 5HIYA 4UFEH 1LPGB 1FIZA 5KGOA 1BRCE 1K1OA 3MU1A 4O03A 3GYMA 2GX4A 3SGBE 1L2EA 2ILNA 1ANCA 1D3DB 1SC8U 2TPIZ 3STIA 1PQAA 1GGDC 3UB0A 1VR1H 3KQCA 4Y79A 4E06H 1BRAA 4DGJA 2C8XB 1NFWA 1C1MA 1TPAE 9LPRA 1ESTA 4AYYB 4HTCH 2GGVB 2PGQB 3MO9A 2L6OA 4A1TA 1Z6EA 4GCHG 2AGEX 1EAWA 1W10U 3MO6A 4B2CA 2G8TA 1Z8JB 2A7CA 3P6ZB 1P04A 4MDSA 1VJAU 1H8IH 1TOMH 2QA9E 2G4UA 1BOQA 5EQQA 3K65B 3PLPA 5HXFA 4JCNA 1SSXA 1C1UH 3QWCH 5A8YA 4D9QA 1T8OA 3LGYA 1GI7B 2GD4B 2EEKA 1V2OT 2KCPA 1NFUA 2FZZA 2VWLA 1GMCF 3A81A 1O5EH 4B2AA 4J2YB 1DX5M 4CHAC 1XVOA 8GCHF 5G4BA 1O3BA 1GL0E 3RU4E 4AN7A 3HPTB 2ZC9H 4XOJA 1HJ9A 3RU4T 3BTKE 4F48B 2KZ4A 1IQGA 1OOKB 1A3BH 1TPSA 2NU0E 2ZPQA 1NN6A 3PRBA 3SUEA 2PKSB 2ZIQH 1ANDA 3UOUA 1C1PA 1ZOMA 1C5UA 1O5FH 3FFGA 2OQUA 3GY3A 1BHXB 3VGCB 1MQ5A 3GCNA 4X1QU 3RXAA 3RMNH 1S81A 4CRFA 1B7XB 5T3HA 4Q2KA 4SGBE 1P01A 1SGQE 1EPTC 1O2TA 1O36A 5I25A 1OWJA 1NU7B 1EXFA 3MH7A 1O3IA 4U30A 1JXPA 2H2ZA 3RXHA 2FYQA 1V2JT 3QZQA 4ABBA 1C5WB 1JIMA 3UY9A 1C1VH 2R0KA 1BCUH 2A2QH 2IJD1 2HALA 4DURA 4BNRA 2ZCHP 1CGJE 1G3BA 1L1GA 1TGBA 3UQVA 3BTTE 1HRTH 1P2IA 2Z3CA 3E0NB 4ABAA 1GHYH 1RIWB 1ZMLA 5JB9S 2J97A 3GCHC 3FVFB 4WXIA 4X2YA 2XXLA 1GI2A 4CRCA 5JBCS 3DFLA 1C5YB 1ZJKA 2ZDNA 1W14U 3PLKA 2BXUH 1QNJA 1L0ZA 3NPSA 1P02A 5EXLA 1K28D 3D23A 3QTVH 2VIOA 2VJ1A 3M3TA 3T26A 1G3EA 2THFB 3KNXA 4RKOB 4F55A 2ZHWH 1CBWB 3SU5A 1EAXA 4CREA 2GP9B 3SBKA 3A8DA 3GY8A 4LXBH 1A0LA 3RC4A 3UREA 2FOHA 1A46H 3N7OA 2OLGA 1BMAA 4X8VH 1V2TT 1N6YA 1UTLM 3BV9B 3IG6B 1GBAA 2G00A 3RXFA 1ZR0A 2GKVE 1MCTA 3M5LA 1F0RA 1FY5A 1HIAB 3OTPA 2PUQH 2W26A 2RDEA 1RRKA 5C1YA 1KLTA 3I77A 1TBQH 1SB1H 1Z1IA 5DKMA 1DICA 1IQEA 2R9PA 1ANBA 3E16B 2QC2A 1MKWH 2Q1JA 1O3EA 1RTFB 1FPHH 1K1NA 1FY1A 3RXGA 4MNWA 3H7OA 3GICB 1CT4E 1QJ1B 2TGDA 2QE7D 1BBRK 1W13U 4KGAA 1KMHB 3K2UA 1QHRB 2XNIA 2A5KA 3S9BA 4UE7H 2AMQA 2XWBI 1ETTH 2FODA 3A86A 1HIAA 1P11E 3S69A 1FN8A 1AQ7A 5CHAB 3MH5A 4K60A 1GCTB 1T32A 2ODQA 1XX9A 3M5OA 1A7SA 5GCHG 3TNSA 2GV7A 3UWJH 1HV7A 3BG4B 3HK3B 1G3DA 5L30H 1P12E 1VKYA 2XBVA 1H9IE 1HDTH 4X0WU 2H6MA 1GVZA 2H9TH 1A4WH 2C8ZB 1QCPA 2P95A 5E0GA 2VBCA 1FY3A 1GI6A 3DCLA 5HGGA 1AN1E 2JH5D 3GDUA 1O2OA 3LKWA 3MNBA 1ZTLA 2G52A 2JETB 2GZ9A 3RXLA 2CV3A 2Z9LA 2PKAB 5CE1A 2G5VA 2KCOA 1JRSA 1P2QA 3KCGH 2BDYA 4OS6A 1FLEE 1S83A 2GZ8A 1EZQA 4E7NA 1SI5H 3AW1A 5AF9H 1YPGH 4THNH 3HK6B 3LDXH 1DWBH 1O2PA 1HYLA 4XBDA 1D3PB 3EAJA 4INHA 4MPXA 1O31A 2HGTH 1MCVA 1OP0A 3ZV9A 4CH2B 1O2YA 1P9UA 2XBYA 2PKAA 1OS8A 2WV4A 4M7GA 3R0FA 2OC1A 1DS2E 1KYNA 3TK6A 6CHAB 2PSYA 5GXPA 1Z8IB 3OAAD 1EUFA 1SLUB 1MBQA 1YGCH 1GVLA 1CT0E 2FM2A 3DUXH 3CENA 1MTWA 3MO3A 2CXVA 4JYUH 3SGAE 4MPVA 3SO3A 4JK6A 5DO4H 4ZAEA 3RC6A 3BTEE 1E0FD 2ZWLH 5E8EH 4Q7XA 2BDIA 2D26C 1YKTA 1EZXC 1KIGH 5GNDA 4CBOA 1YWUA 1N6XA 3UWIA 2HPPH 1EP6A 4Y8ZA 4YM9A 1GMHF 5C2ZA 2ZFTA 2M2AA 1P3EA 1NESE 3A7YA 3RM2H 4E05H 3OY6U 3ELAH 1QRZA 2TGTA 3OY5U 3P8OA 1SBWA 1J15A 1O2IA 1K1MA 5J4QA 5EW1H 5LGOA 1V2QT 2OUAA 2ZU1A 2VH6A 2JH0D 1G32B 3A84A 3TH4H 1GJBB 1C2GA 5FPYA 4VGCB 4GCHF 3QK1A 5T6FA 4DIIH 1HAXB 2PFEA 4I33A 2XC0A 5ABWA 1NO9H 2ESTE 1OWEA 3URDA 1GBEA 2GCTB 3OSYA 3EA7A 2NWNA 1DUEA 2ZU5A 5HM2A 1YPLH 3RXQA 3T5FH 5BPEA 3VB6A 1P0SH 3FP6E 5GJ4B 3VGCC 1N8OC 4Q80A 3UR9A 1D9IA 3QTOH 5K7RA 1CE5A 2STBE 4MLFB 3E6PH 1GJ8B 2Z3EA 1C4V2 3D62A 5BRRE 2XNDD 1LTOA 7KMEH 1OWIA 3E3TA 1C9PA 3KQDA 4TWYA 2ZNKH 5FX5A 3SNEA 1THRH 3GOVB 4NIXA 2WUCA 1SOTA 5F6MA 2A2XH 2NU3E 3WWFA 4A7IB 1P57B 2HLDD 3SJOA 4BXSA 3ZIAD 1P3CA 1XXFA 2P93A 1GBFA 2FOEA 3SJ8A 2A4RA 4INKA 3DSPA 3URCA 1GHXH 1XVMA 4A6LA 2AEIH 2PR3A 2PSXA 1HAGE 4K69A 4K1TA 1HFDA 1ZSJA 4FUEA 4X1PU 3ITIA 1QQ4A 3UIRA 8ESTE 4WXVA 1GI4A 2Y5HA 4CHAB 1K9OE 3VB5A 5EOKA 1THPB 1JOUB 1YLDA 4TPYA 1TGTA 1AD8H 4K3JA 1DPOA 1HAOH 4WY3A 5JB8S 1O34A 3E0PB 4E7RG 1YLCA 1C2KA 3ZVFA 1P2MA 4MNXA 1E34B 3M5MA 3BTME 1YPHC 1UO6A 1CBWC 3TNTA 2Y82A 1GBLA 2ZFFH 4NFEA 4Y10E 4CRAA 1PJPA 1S0RA 2Y5GA 5ESTE 1V2RT 1D3QB 3MU5A 3Q3XA 4OM9A 2ALVA 4NIYA 3VFEA 1TX6A 2QF4A 2CMYA 3BTHE 1O0DH 1QB6A 1EPTB 1E36B 4YOJA 6ESTA 2GV6A 1T4UH 4RKJB 3IWMA 4NSVA 1XKAC 1LCYA 2B9LA 2HVXA 4BTTB 1FMGA 4FVDA 1TPOA 3L3TA 4DCDA 1LHDH 4OS4A 1DSUA 4I8LA 3RXEA 1BTHH 3ZZ9A 1WCZA 1MD7A 4AFSA 1ELGA 4MNYA 2W7UA 5C1UA 1OX1A 5IK2D 2ZGXH 1RJXB 1MU8B 1EPTA 3P70B 5CDFE 4DT7B 2HNTF 4X8TH 3GCHB 2Z9KA 3MH4A 4GPGA 1C5QA 3LPRA 2IPQX 4KTCA 2SGFE 4RN6A 5C17A 2A0QB 1FXYA 2PW8H 3ATWA 3LIWA 2EI8A 4TY7A 4B76A 1UK3A 4X2WA 1BQYA 2TGPZ 2WV9A 1ZSKA 1AE8H 1GI5A 5AHGH 4SGAE 1MKXK 2RDLA 3V3MA 2UUYA 1C9TA 6LPRA 4LK4A 1SVPA 3PRDA 1C1SA 3Q00A 1O5BB 2LP6A 4H6TA 2ODYB 3SZEA 3MYWA 1S82A 3M61U 1HPGA 5EODA 1ZJDA 2NU4E 1BZXE 3GY4A 4IBLH 4ABFA 3AAVA 1O3AA 1OYTH 2BY7X 3A7TA 5C1XA 1UTPA 3F68H 3AK5A 4X6MA 1ANEA 2K8IA 2CHAB 2BTCE 1IQNA 1AVXA 2FOMB 5GCHF 1ELDE 3ZYEA 1SG8B 1WDIA 1Y5AT 4OGYA 3ZZCA 1G3CA 3N99A 1RTKA 3A7XA 3SV2H 3TU7H 5A0CA 3QUMP 1EOJA 3SHCH 3ZYDA 3SV7A 1FPCH 2Q6DA 1E1QD 3MU8A 4R0IA 1ZSLA 3O8CA 1SMFE 2M5TA 3UNQA 1FNIA 1OP8A 4X1NU 2A1DB 2H9HA 5IYTA 6CHAC 1BITA 2GT8A 3CS7A 5E0HA 4FETA 2RA0A 4K8BA 5A0BA 1UVUH 1AFQC 1O2SA 4NZQA 1JWTA 2ZFRH 2FEQH 5AFYH 1Z71A 4QT8C 1RTLA 1THSH 1TGSZ 1ZRBA 1Y8TA 1NS3A 2Z94A 1LQDB 1P9SA 5JBTA 1KSNA 1O3NA 1NPMA 1LKAA 2SNVA 2XCNA 2W3IA 1HBTH 4WMFA 1O3JA 3SNDA 7ESTE 2C8YB 1ELAA 1F2SE 1C2EA 2JJ2D 2TBSA 4Y0ZE 4BXWA 1W12U 2EC9H 1GPZA 1MZDA 3LC3A 3TK9A 1RD3B 1TOCB 1S6FA 1QZ8A 1C4Y2 2LELA 4DG4A 3KYFA 1HXFH 1SHHB 2SFAA 4XDEA 1V2ST 3RXUA 4BANB 1TNJA 2WYJA 3TPIZ 3B9FH 2AMDA 3WWBA 1TYNA 1Z8GA 1LHCH 1GJ6A 1F7ZA 2A4GA 3UOPA 1Z1JA 1MU6B 1ZMJA 2HNTE 1BMFD 1WAYB 4FVBA 1O2LA 1FIWA 1V2KT 1VITH 1GMHG 1Q3XA 2GCTC 2G4TA 1SGTA 3KGPA 1W7GH 4ZUHA 1AZZA 2BD4A 3CNRA 1EP5A 1YCPH 1BMLA 3VEQB 1IQMA 1HB0B 3ZZAA 1DY9A 3A7VA 1AE5A 5SGAE 4Y8YA 4IC5A 4A92A 3U1JB 1O3LA 4MPWA 4ZROA 2NU2E 1A1RA 2FS8A 3F2HA 4MTBA 4ZKRU 1C2MA 2VB0A 3PM3A 1ABJH 3LU9B 4I31A 2YNBA 3LT3A 5CMXH 1IOEA 1GBTA 5L2ZH 2H1UA 1SGDE 2AHME 2CK3D 3HGNA 5DP7A 2GVFA 5L6NH 3LJJA 2V7QD 4ZHMU 3RM0H 1UTNA 1FV9A 1GBHA 1BIOA 3FP8E 3PV5A 1YBWA 1SGPE 1J16A 3RXKA 5DPAA 1YPJH 1W7XH 2BLOA 2C3SA 1RS0A 3ZZ6A 3I29A 3TJUA 4AB8A 1AVGH 1P10A 2B8OH 2L74A 4AG2A 4JK5A 1KTTB 4LZ1H 2WUBA 1ARCA 3GISB 4WMDA 3WY8A 2J38A 1AGJA 1PYTC 5HIZA 5C94A 2BLVA 1Z8RA 1OYQA 1C5MD 3Q76A 4P00A 1ZPCA 2ANKH 2ZTXA 1P2NA 4XSKU 4AFQA 1O2XA 3DFJA 1RFNA 2VNTA 2Y7XA 2V6NA 3PTNA 2BVSH 1N8OB 1O2ZA 4H4FA 2ZCKP 4X6NA 2FS9A 4RI0A 4IS5A 4TY6A 3BG8A 3NUMA 1QRWA 3TLOA 4M9FA 1TWXB 1J17T 1MTVA 1BBRE 1TBRH 2EA3A 2W7SA 1LHFH 3QDZB 1VITF 2SNWA 2VVVA 1SQOA 5J4SA 2KAIB 2J95A 3TK5A 1G30B 2BQ6B 4YESB 2R2WU 3SU1A 2OXSA 1TA6A 1EFRD 3OFND 1EZUC 2ANYA 1BTXA 2P3TB 3EA8A 5C0TA 1JIRA 5DP5A 2BY9X 3ZZ3A 3UNSA 2AMPA 2B5TB 2PLXA 2ZZUH 1C5XB 2ZHDA 2UUFB 2VWOA 1LVOA 3TITA 3BTFE 3GCOA 4WWYA 1BA8B 3RP2A 5FCRA 4AZ2B 3SHAH 4FOUC 2NU1E 1QQUA 3U8OH 3PV4A 4YO9A 2KAIA 2ZF0H 4Y7AA 4ZXYH 3SNCA 1TQ7B 4U01A 1A0HB 3F6UH 4RSPA 3OE7D 4DW2U 2F3CE 2JIZD 3SI3H 2FOAA 1WQSA 1UVTH 4IN1A 3PB1E 3EDXB 2BD8A 2OINA 3PWBA 4MG3A 2O8UA 4GSOA 1EOLA 4YOGA 4GHQA 2JJ1D 3P17H 1FJSA 2JH6D 4JZEH 5FX6A 1INCA 2QXIA 4ZHAA 4ASUD 3JZ1B 1B0FA 3BTQE 3CP7A 1P03A 1QIXB 5T6GA 2XBWA 1MTNC 1C5VA 2W6ID 3RXMA 5DP8A 1P06A 3AW0A 4I8GA 2GJGA 3FANA 1UCYE 1BJUA 2CHAC 1LHGH 1NRRH 1T31A 3SU0A 3SJKA 2TGAA 1MZAA 2BDAA 2QF5A 1CGIE 1ELBA 3NXPA 4ISNA 3U1IB 3PMAB 3QO6A 1TMUH 3QGJA 1AI8H 4ISOA 4B74A 3GCTG 1MUEB 1QURH 3PROA 3RLWH 3QGNB 4NSYA 1YY3A 2BD5A 1TA2A 9ESTA 4BTUB 1KXDA 2GCHG 4DT4A 1C5NH 1FAKH 1G37A 1QY6A 1EKBB 2XOKD 3LC5A 5EQRA 1AUJA 2ZQ1A 5T6DA 2IPHA 1SGFG 1CHOF 2HWLB 1O3KA 1OPHB 1RGQA 3S9AA 2XW9A 3DSOA 1Z6JH 1OWHA 2BY6X 2ZGJA 1SLXB 2A4QA 2FI3E 1QL7A 2EY4C 5A8ZA 3T28A 3RXRA 2ODPA 1JRTA 1JBUH 5FXLA 4D7FA 1AKSB 1G36A 1SGNE 2QF0A 1SR5C 2OBQA 4NA8A 1C1RA 1GBMA 3ZZ4A 3TVJB 1C1OA 3GY6A 1J9CH 1KTSB 2QF3A 3MU0A 1DOJA 5DN6D 1AWFH 1QA7A 1NM6A 4H6SB 4GUXA 1XXDA 1VGCC 2PHBA 4FU9A 2OQ5A 1UVOA 1PQ7A 1TX8A 1NROH 1BHXF 2C93B 1GHAF 1GWAA 3QZRA 5DP6A 3SUGA 1AUTC 2YNAA 1A3EH 1EAUA 2OC0A 1NRPH 3BTWE 4RT1A 3S7KB 3VB7A 2ZDKA 2ZFPH 2FXRA 1AKSA 4LOYH 3OEED 2AS9A 1JMOH 4NIVA 3SU6A 2G51A 1S5SA 1TNLA 4CRGA 1VJ9U 1MTUA 1BDAA 4CRDA 4K2YA 3M3SA 2BY8X 1Y3YA 3ZVBA 3GS9A 4D8NA 1BJVA 3SNAA 2ZGCA 1WQVH 1U6QA 1GBDA 2AYWA 1LVMA 2F9PA 2FTLE 1UW7A 1K22H 1F92A 1CQQA 1UCYK 2V3MA 1O2JA 3PWCA 1QBNA 2UWLA 1AFQB 4WF8A 2WV5A 5T1VA 4XBBA 3VXEH 3SV6A 3FZDA 4AFUA 3L6PA 2BMGB 1VCWA 2GDEH 2PP6A 1SGRE 5FBEA 1O2NA 1UK2A 4FU7A 2BB4A 3SZNA 1FDPA 2VGCC 4WH8A 2AIQA 2WPDD 2V0BA 3C1KA 4ACBA 5DG6A 2ZDLA 1MAYA 3UUZA 1TRYA 1Z7KA 2O8MA 1TNIA 1NBMD 3RDZA 1ETSH 1KY9A 2XWAA 4FUIA 5IDKA 1CU1A 1YP9A 2FTMA 5FCKA 2VVUA 2VINA 5DGJA 5EJ1A 1GDUA 1MAXA 4KTUA 2FOFA 3DA9B 1EJNA 1TPPA 3BEFB 4AORA 1KLJH 3F2FA 1KLIH 1C2LA 3DSGA 2BLQA 1UTQA 4Y76A 4BAHB 4ZMAH 1SGIB 2PV9B 3AASA 1AMHA 3P8FA 1O3DA 4WMEA 1E35B 3T2NA 2F83A 4BAKB 1AIXH 1C5RA 5F8TA 2EI6A 3P95A 3RC5A 2C8WB 1XMNB 1ID5H 1ELCA 2A45B 4NCYA 1WV7H 1ELTA 5EJZA 5LPFA 2BQWB 7GCHG 1TIOA 1V6DA 2ZDMA 3A7ZA 2FLRH 2BZ6H 1D3TB 1AZ8A 1WTHD 1ELFA 1UTMA 1O30A 1DXWA 1C1NA 4ISLA 4K1EA 3GY7A 3O8DA 3UQOA 2B7DH 1YPEH 1E1RD 2F9BH 1IQKA 2P8OC 4XRNA 1UMAH 1H9HE 1PPBH 3F9GA 1KXAA 3ENSB 3MI4A 1DLKB 4FXGH 1HNEE 1O2KA 3NK8A 1UVSH 5C5NA 1CT2E 2W3KA 2ZGHA 2PTCE 1DVAH 2FOCA 1O3MA 2F91A 2Y5FA 3NCLA 1QBVH 5E2OA 4YT7H 1NFXA 2G55A 4TT3D 1H8HD 1VITG 5EJLA 5EPNA 1GG6C 1P09A 2BD2A 3BEIB 2J92A 3SUFA 3SQEE 2O8TA 1ZGVA 2A31A 1T8NA 3LGVA 5E2PA 4BAMB 3ZVDA 2FOBA 2I6SA 1IQIA 1NBME 2PGBB 3F2GA 5TJXA 1GL1A 4ZKOU 1BUIA 1C5LH 1HAVB 2XC4A 4I7YH 1BTPA 2R3UA 1VCPA 1QGFA 1E37B 1K21H 1O39A 3OX7U 2ZFQH 1TB6H 2ZFSA 1ORFA 4F49A 4JYTA 2OP9A 2ZDAH 1CSOE 4XFQA 5GDSH 1F5RA 1DLEA 2BX4A 2AFQB 2BD9A 1ELVA 3HKJB 4XD7D 4AG1A 4NA7A 4AFZA 2QAAA 1F5KU 2SGDE 1HAVA 4ABEA 5FPTA 5TCAA 4B73A 4I8HA 5FPSA 2H9EH 4NIWA 1TNGA 2ZECA 1FUJA 1C1TA 1F0TA 3NWUA 2O9QA 5HMAA 3ZVAA 1BTUA 2UUKB 2J94A 1XKBC 2BOKA 8KME2 2GMTC 1EASA 3MHWU 4XBCA 4FUHA 2ZP0H 1GI1A 3MQKC 1PPHE 5DSFA 1V3XA 5JBBS 1K0HA 1F5LA 1IQHA 3GCTF 3GDSA 3OEHD 2QY0B 3LGWA 1FAXA 4UONA 1S84A 3M3VA 4ZKSU 2KFWA 3D65E 1C1QA 2GCHF 2A7HA 4J1YA 3CS0A 1DSTA 5PTPA 2ANMH 2BVRH 1TMBH 2WPLS 4GAWA 4O3TA 1MTNB 2KX4A 1QRXA 2DUCA 3ZV8A 1ZGIA 1CHOG 2J5UA 1GBBA 3EE0B 1OWKA 4NFFA 5EU8A 2ZHQH 3A89A 4Y11E 4Q63A 1GJ4H 2K1QA 3QLPH 2SGEE 1E79D 2YOLA 3M36A 2BYAX 3KF2A 5F8XA 1C2FA 3MWIU 2OC7A 1C5PA 1NC6A 4UFFH 1LMWB 1MKWK 3A87A 1ACBE 1LO6A 1LVBA 2VIVA 2OK5A 2K0QA 1SKYE 1Y3WA 4FU8A 1L4DA 2Y7ZA 1O3HA 1SGEE 3VB3A 3GY5A 2A5AA 3RXBA 4KKDA 1O2HA 1EJMA 2HVYB 3PMHB 2BDBA 1A5IA 3F1SB 1GHAG 4U32A 1GDQA 1LHEH 2AGIX 5CHBA 1A2CH 4AGJA 2XYAA 1ABIH 1OHHD 5FHTA 1GCDA 1K2I1 4Z1MD 2H5CA 5LH8A 4WH6A 2STAE 3V12A 1O2MA 3ODFA 2DE9A 1W0JD 4ABGA 1GJCB 1K1LA 4B2BA 1B0EA 1BTYA 2EI7A 4BTIB 1TGCA 1QB9A 1S85A 3B23B 3RLYH 3UR6A 2UWPA 4AOQA 1VGCB 2V35A 1T8MA 2ZQ2A 3A8BA 5E0JA 3ZZDA 1EB2A 2QIQA 2QXJA 3BIUH 3ZVEA 2ASUB 1HAPH 4A1VA 2BY5X 5GIBA 4A1XA 1H9LB 2EQNA 4YT6H 2Z9GA 1TALA 1O33A 2RCEA 1XUKA 2ZU4A 2WPMS 4O97A 4D9RA 3DT0H 3T62A 1PPGE 4DVAU 1BMNH 3FZZA 4PROA 1GJDB 1FONA 2HNTC 3PV2A 4MNVA 3JZ2B 1CA0B 2IJOB 4ZXXH 2Q6GA 1GHVH 1PPZA 3AVZA 3UNRA 3UTUH 5A09A 3U69H 1O5DH 1KXEA 1O2UA 2WYGA 3V0XA 1WU1A 1TFXA 4ESTE 4ACAA 5JYIA 2YMSC 2B0FA 1GBJA 3WW7A 3BTDE 2FDAA 1EB1H 1T7CA 3GDVA 1S6HA 4MQAA 1YYY1 4DOQA 3SI4H 1C2JA 2BHGA 1GBCA 2W5EA 1AWHB 4GHTA 1L4ZA 2O8LA 1ZHRA 2BD3A 1XUHA 2AERH 2VGCB 2P3FH 5DP9A 2FMJA 3E1XB 4P02A 4CBNA 3SU3A 1OWDA 1IQLA 1VZQH 4FUGA 1V2MT 1O2WA 1UVPA 1AHTH 5F8ZA 1F0UA 4HGCA 1SL3A 1W0KD 1QBOA 2UUJB 3PTBA 5EXMA 4B6EA 3ATKA 3E8LA 4INLA 2CF9H 2VVCA 1ESAA 5C0UA 2BVXH 2VIDA 5GWZA 1S0QA 3EQ0H 4YLUA 1GVKB 7GCHF 3SJ9A 2CGAA 1KXFA 2ZG0H 4IW4E 1OSSA 2Z3DA 1FI8A 5AFZH 3M5NA 4FUDA 4HG6A 4JZ1A 4K8YA 2J2UA 2WHXA 4UD9H 3M7TA 3R3GB 1Y3UA 1Q31A 3PO1C 3I78A 1SGYE 3MNXA 3HKIB 1AU8A 3F0OA 2IN2A 2KCAA 2A32A 4TSFD 1HAZB 5EQSA 3F9FA 2JDID 1HJ8A 2A5IA 2J34A 4UFDH 5LPEA 1C1WH 2R2MB 1MABB 1HCGA 1V2LT 2D1JA 1H8ED 4NWLA 1IHTH 1TAWA 1K1PA 4X6PA 3LONA 5LPRA 2ANWA 1FN6A 5JDUB 1KXBA 3S0NA 4X1RU 2P3UB 1NY22 1ZYOA 4TYDA 1GJ9B 4BOHA 3KQ5A 2GTBA 1SFIA 4IC6A 2HOBA 2P8OB 3LH1A 3N7EA 3E90B 3TH3H 3RMLH 6GCHG 2I6QA 1O35A 2BX3A 4D7GA 2ZCLP 1W8BH 3F0PA 2QXGA 1GJAB 3S9CA 4K1SA 2BDGA 1T8LA 3W94A 2VWNA 4KTSA 1SQAA 3RXSA 4Q7ZA 4R8TB 2FOGA 1O3GA 2Z9JA 5FAHA 1GG6B 4IMZA 5AVDA 2VWMA 2W6JD 1DM4B 1OXGA 3LGTA 1J8AA 2XRCA 1GDNA 2ZHEH 3BIVH 1TX7A 2WPKS 2ZHFH 1QB1A 2SGAA 2BXTH 4I86A 1LVYA 4OS7A 2HLCA 4WJG2 4AB9A 2VU8E 5A2MH 1G2MA 1TRMA 1BB0B 1WXRA 3EYDA 3L33A 1ZHMA 1PPCE 2BDCA 1GBKA 3ZVCA 4B1TA 2HRVA 1QJ6B 3KQEA 5EG4A 3QN7A 3VXFH 4FUBA 5FL7D 2C4FH 1MKXH 3KIDU 1YCPM 1NRNH 2ZTZA 3TH2H 1K1IA 4Z6AH 1P8VC 2FYRA 1HXEH 1MTSA 1IHSH 1FX0B 1XUIA 4DJZB 3C27B 1YLNA 4O3UA 1O2QA 3RXJA 4YLQH 2F9VA 3FAOA 3F3BA 3H09A 4GVUA 1XUGA 1X7AC 2RG3A 3MOCA 1BMMH 3ODDA 1TONA 1F0SA 1GMDG 1HJAC 2F43B 4X8SH 3EE7A 2F9UA 1GBIA 2FX6A 3N7DA 2GMTB 3D49H 2VIWA 2ULLA 1FY4A 4Y6DA 4NG9H 4D76A 1GI8B 1H8DH 3O8RA 1W3CA 3SV9A 3RXDA 1GHBG 1C2DA 3TGJE 1DFPA 2BD7A 3K9XB 3F9EA 5DP3A 4LZ4B 4ABJA 1EZSC 2ZEBA 4ASHA 1PPEE 1QA0A 2J98B 1WOFA 5GPIB 1SHYA 3FKSD 5C20A 3RUOA 2J9NA 5EXNA 2TIOA 1DXPA 5FBIA 3K6YA 4NWKA 4F4OC 1CVWH 1DY8A 4YTAA 1KXCA 4UFGH 3LJOA 3T25A 1SFQB 4JMYA 3ZZ8A 1V2PT 1ZZZA 3GYLB 1OKXA 3SV8A 2J98A 4TPIZ 3A7WA 2XBXA 1SQRA 1ARBA 4K5ZA 5A8XA 1CA0C 3BTGE 1AVWA 4ZKNU 1XUJA 1HAHH 3H5CB 2D8WA 2J4IA 2R3YA 3OU0A 5DK1A 5KEDA 3TIUA 1WYKA 3BN9A 3EA9A 3A88A 1ZTKA 3SN8A 1QR3E 3A82A 1IQFA 1AB9C 5DJ7A 3STJA 3TGIE 3KN2A 1K1JA 1DITH 4ABDA 3SNBA 1WSSH 1ZPZA 4X2VA 4MVNA 4X2XA 1W2KH 2FI5E 1QL8A 1GJ7B 1SLWB 1UTOA 3W95A 4HZHA 3KEEA 3SORA 4FUFA 4ISIH 2VH0A 3M7UA 1ZLRA 3SQHE 3OYPA 1CA8B 1C5SA 4B75A 2ZGBH 2ZA5A 3Q3YA 1A5GH 2C90B 1G9IE 3A83A 2BM2A 1LQEA 1NRSH 1O5AB 1L1NA 3SOSA 7LPRA 2R0LA 1UTKA 2AIPA 3KL6A 3VB4A 4OGXA 1NU9A 1V2WT 3U8TH 3ESTA 1ELEE 1A61H 1N1LA 5C5OA 4ZCNA 3P8GA 2V3HH 1O32A 4B71A 1ZHPA 2ALPA 5HYOA 1NT1A 1P05A 5EIYA 1O5CB 1YPMH 3RXOA 1V2NT 1ETRH 2JKHA 2Z6BD 4UDWH 1C2IA 4NZLA 2ZKSA 4BAQB 1ZTJA 3UFAA 1EATA 5TCCA 3SW2B 1V2VT 1A5HA 2XTTB 1SOZA 2FLBH 4AGKA 5F53A 1FZZA 2WPHS 1TLDA 1HAIH 1YCPK 3M35A 1H4WA 3GY2A 1W11U 2QN5T 2YMSB 3PLBA 1WUNH 1LPKB 1P2OA 4H42U 2Z9IA 1UJ1A 1O38A 2FIRH 4JYVH 2GZ7A 2FESH 3S7HB 2VIPA 2PKSC 1P2KA 3U8RH 3MNCA 1BRBE 1G2LA 2RFKC 3F9HA 1D4PB 2FO9A 2GT7A 1COWD 1ESBA 1TQ0B 3B8JA 2DE8A 1T4VH 2ZTYA 1GGDB 2Y81A 1SQTA 4Y8XA 4DIHH 2GDDA 4FUCA 1Y3VA 2AGGX 2Q6FA 4XE4A 4I32A 1GMCG 3T27A 1O5GH 3K6ZA 5C3NA 2WZQA 4BAOB 2P16A 4CRBA 3M37A 3FP7E 2ZI2H 1W0ZU 2LPRA 8GCHG 4NA9H 4TWWA 2BOHB 3QX5H 3RXVA 3MTYA 5A0AE 3RXIA 3MH6A 3T29A 2XCFA 1HGTH 1SGFA 1VCQA 3RXPA 4JZDH 2TRMA 3VPKA 1CGHA 3O8BA 3DD2H 3DHKH 2UWOA 3U28C 2SGPE 1HAYB 4YOIA 3UAIC 3FN8A 4IMQA 3U98H 2F4LA 3SUDA 3HGPA 3PO1B 4ZHLU 1CO7E 1AFEH 4HI3A 2VIQA 4JZIA 1O2VA 3AAUA 1Y59T 1RIWC 2OC8A 1PQ5A 1TNHA 2LNCA 2QCYA 1MQ6A 3ATIA 1YF4A 2F9NA 3A8AA 4OS2A 6GCHF 4IN2A 1PFXC 4RT0A 3ATLA 3SYJA 2CJIA 1E38B 1DWEH 1WTGH 4IGDA 2QXHA 3G01A 2PUXB 1P2JA 4I8JA 5ESBA 1YPHE 3SU2A 2OCVB 2WSSD 2Y80A 3KHVA 2F9OA 1Y5BT 2OD3B 1UHBB 5I46H 3LGIA 3MNSA 3ZZ5A 4UEHH 1QFKH 3MU4A 3ATMA 1ZPBA 1Y3XA 4JZFH 3TJOA 1YPKH 4CH8B 3TGKE 4OS1A 5EPYA 1O3PB 1YC0A 4DY7B 1B5GH 1WBGB 2XC5A 2A7JA 4OS5A 3P92A 1OP2A 2RA3A 4Y71A 4X8UH 5EW2H 3NZIA 2P94A 2ZU3A 1EJAA 1KDQB 1XUFA 1AY6H 1ZMNA 2CN0H 2OBOA 2ZPRA 3V7TA 2AH4X 1GJ5H 1O3FA 2QV1A 4Q4LA 4CR9A 2BQ7B 2FWWA 1UHBA 1NFYA 1NTPA 3Q3KA 4ISHH 1Q2WA 4AX9H 4YXWD 1TGNA 3BEUA 2O8WA 3PMBB 4KELA 4X1SU 1MBMA 4WVPE 1BT7A 5JBAS 1FQ3A 3P8NA 1PQ8A 4A5TS 2H5DA 1J14A 1C4U2 1BBRH 1KDQA 3NRLA 4I8KA 1SGCA 3BSQA 4X6OA 5CHAC 1DUAA 4B6FA 1QJ7B 3IITA 3LGUA 1GCTC 1O2RA 1FY8E 1GMDF 5F03A 2FI4E 1C5TA 3H7TA 1IAUA 3BG4C 1H1BA 4CR5A 5KECA 5C67A 1GHZA 1GI0A 2G5NA 1O2GH 3A8CA 1SPJA 1DWDH 2BDHA 1BTZA 3FOAA 3PYHA 1GHBF 1S6LA 2HPQH 3V13A 5JPMH 1BRUP 3Q77A 1UK4A 3RXTA 4NGAH 2Z7FE 5L2YH 2WPIS 1GI3A 1O3OA 3LH3A 3RMOH 4U2WA 2FP7B 3EGKH 1DE7H 1ZRKA 2JETC 1YM0A 3E91A 5ETXA 1C5OH 3NKKA 2G81E 4YZUA 2PTNA 1MD8A 3ZZ7A 2BLWA 2YMSD 3HATH 4FUJA 1O3CA 3U9AH 5K0HA 1M9UA 4Q7YA 1HJAB 1DDJA 4AYVB 1LKBA 1TRNA 1LPZB 3SJIA 1CHGA
chains in the Genus database with same CATH topology
1D6WA 3A85A 2D2DA 4MPUA 2OTVA 1EAIA 1SLVB 1UTJA 1DANH 4Z0KA 2A4OA 1NZQH 1LDTT 4KP0A 3UPEA 1DWCH 3MFJA 3KQBA 1HLTH 3BF6H 4O9VA 2P59A 1QTFA 2Y6TA 1NRQH 8LPRA 1UCYH 1TMTH 2ZO3H 2QGRA 2ZU2A 5EGMA 1EX3A 1W0YH 2SGQE 1MH0A 2CF8H 2V3OH 4Y0YE 5B6OA 1PPFE 2PWXA 1Y5UT 1MMJN 1A0JA 1L1JA 3RU4D 3A80A 1TNKA 4HFPB 3TJNA 1QL9A 2FPZA 2IOTA 4Y7BA 4ZH8A 3LOXA 5DP4A 1PYTD 2ZDVH 5H4IB 3ZZBA 3OTJE 3RMMH 1C2HA 2QYIA 3SGQE 1DT2A 1V2UT 1RXPA 2ZPSA 2BZAA 1C5ZB 1AO5A 3TJVA 1TABE 4GLYA 1D6RA 1XM1A 2WPJS 2FX4A 1HUTH 1AB9B 1BTWA 1GI9B 4ABHA 3M7QA 1TE0A 3ZVGA 3MMGA 4ABIA 3RXCA 1O37A 4VGCC 1EQ9A 3PMJA 3SU4A 5HM9A 1TBZH 1IQJA 2WINI 1GHWH 4UFEH 1LPGB 1FIZA 1BRCE 1K1OA 3MU1A 4O03A 3GYMA 2GX4A 3SGBE 1L2EA 2ILNA 1ANCA 1D3DB 1SC8U 2TPIZ 3STIA 1PQAA 1GGDC 1VR1H 3KQCA 4Y79A 4E06H 1BRAA 4DGJA 2C8XB 1NFWA 1C1MA 1TPAE 9LPRA 1ESTA 4AYYB 4HTCH 2GGVB 2PGQB 3MO9A 4A1TA 1Z6EA 4GCHG 2AGEX 1EAWA 1W10U 3MO6A 4B2CA 2G8TA 1Z8JB 2A7CA 3P6ZB 1P04A 4MDSA 1VJAU 1H8IH 1TOMH 2QA9E 2G4UA 1BOQA 5EQQA 3K65B 3PLPA 5HXFA 4JCNA 1SSXA 1C1UH 3QWCH 5A8YA 4D9QA 1T8OA 3LGYA 1GI7B 2GD4B 2EEKA 1V2OT 1NFUA 2FZZA 2VWLA 1GMCF 3A81A 1O5EH 4B2AA 4J2YB 1DX5M 4CHAC 1XVOA 8GCHF 5G4BA 1O3BA 1GL0E 3RU4E 4AN7A 3HPTB 2ZC9H 4XOJA 1HJ9A 3RU4T 3BTKE 1IQGA 1OOKB 1A3BH 1TPSA 2NU0E 2ZPQA 1NN6A 3SUEA 2PKSB 2ZIQH 1ANDA 3UOUA 1C1PA 1ZOMA 1C5UA 1O5FH 3FFGA 2OQUA 3GY3A 1BHXB 3VGCB 1MQ5A 3GCNA 4X1QU 3RXAA 3RMNH 1S81A 4CRFA 1B7XB 5T3HA 4Q2KA 4SGBE 1P01A 1SGQE 1EPTC 1O2TA 1O36A 5I25A 1OWJA 1NU7B 1EXFA 3MH7A 1O3IA 4U30A 1JXPA 2H2ZA 3RXHA 2FYQA 1V2JT 3QZQA 4ABBA 1C5WB 1JIMA 3UY9A 1C1VH 2R0KA 1BCUH 2A2QH 2HALA 4DURA 4BNRA 2ZCHP 1CGJE 1G3BA 1L1GA 1TGBA 3UQVA 3BTTE 1HRTH 1P2IA 2Z3CA 3E0NB 4ABAA 1GHYH 1RIWB 1ZMLA 5JB9S 3GCHC 4WXIA 3FVFB 4X2YA 2XXLA 1GI2A 4CRCA 5JBCS 3DFLA 1C5YB 1ZJKA 2ZDNA 1W14U 3PLKA 2BXUH 1QNJA 1L0ZA 3NPSA 1P02A 5EXLA 1K28D 3D23A 3QTVH 2VIOA 2VJ1A 3M3TA 3T26A 1G3EA 2THFB 3KNXA 4RKOB 2ZHWH 1CBWB 3SU5A 1EAXA 4CREA 2GP9B 3SBKA 3A8DA 3GY8A 4LXBH 1A0LA 3RC4A 3UREA 2FOHA 1A46H 3N7OA 2OLGA 1BMAA 4X8VH 1V2TT 1N6YA 1UTLM 3BV9B 3IG6B 1GBAA 2G00A 3RXFA 1ZR0A 2GKVE 1MCTA 3M5LA 1F0RA 1FY5A 1HIAB 2PUQH 2W26A 1RRKA 5C1YA 1KLTA 3I77A 1TBQH 1SB1H 1Z1IA 5DKMA 1DICA 1IQEA 2R9PA 1ANBA 3E16B 2QC2A 1MKWH 2Q1JA 1O3EA 1RTFB 1FPHH 1K1NA 1FY1A 3RXGA 4MNWA 3H7OA 3GICB 1CT4E 1QJ1B 2TGDA 1BBRK 1W13U 4KGAA 3K2UA 1QHRB 2XNIA 2A5KA 3S9BA 4UE7H 2AMQA 2XWBI 1ETTH 2FODA 3A86A 1HIAA 1P11E 3S69A 1FN8A 1AQ7A 5CHAB 3MH5A 4K60A 1GCTB 1T32A 2ODQA 1XX9A 3M5OA 1A7SA 5GCHG 3TNSA 2GV7A 3UWJH 1HV7A 3BG4B 3HK3B 1G3DA 5L30H 1P12E 2XBVA 1H9IE 1HDTH 4X0WU 2H6MA 1GVZA 2H9TH 1A4WH 2C8ZB 1QCPA 2P95A 5E0GA 1FY3A 1GI6A 5HGGA 1AN1E 2JH5D 3GDUA 1O2OA 3LKWA 3MNBA 1ZTLA 2G52A 2JETB 2GZ9A 3RXLA 2CV3A 2Z9LA 2PKAB 5CE1A 2G5VA 1JRSA 1P2QA 3KCGH 2BDYA 4OS6A 1FLEE 1S83A 2GZ8A 1EZQA 4E7NA 1SI5H 3AW1A 5AF9H 1YPGH 4THNH 3HK6B 3LDXH 1DWBH 1O2PA 1HYLA 4XBDA 1D3PB 3EAJA 4INHA 4MPXA 1O31A 2HGTH 1MCVA 1OP0A 3ZV9A 4CH2B 1O2YA 1P9UA 2XBYA 2PKAA 1OS8A 2WV4A 4M7GA 3R0FA 2OC1A 1DS2E 1KYNA 3TK6A 6CHAB 2PSYA 5GXPA 1Z8IB 1EUFA 1SLUB 1MBQA 1YGCH 1GVLA 1CT0E 2FM2A 3DUXH 3CENA 1MTWA 3MO3A 2CXVA 4JYUH 3SGAE 4MPVA 3SO3A 4JK6A 5DO4H 4ZAEA 3RC6A 3BTEE 1E0FD 2ZWLH 5E8EH 4Q7XA 2BDIA 2D26C 1YKTA 1EZXC 1KIGH 4CBOA 3UWIA 1N6XA 2HPPH 1EP6A 4Y8ZA 4YM9A 1GMHF 5C2ZA 2ZFTA 1P3EA 1NESE 3A7YA 3RM2H 4E05H 3OY6U 3ELAH 1QRZA 2TGTA 3OY5U 3P8OA 1SBWA 1J15A 1O2IA 1K1MA 5J4QA 5EW1H 5LGOA 1V2QT 2OUAA 2ZU1A 2VH6A 2JH0D 1G32B 3A84A 3TH4H 1GJBB 1C2GA 5FPYA 4VGCB 4GCHF 3QK1A 5T6FA 4DIIH 1HAXB 2PFEA 4I33A 2XC0A 5ABWA 1NO9H 2ESTE 1OWEA 3URDA 1GBEA 2GCTB 3OSYA 3EA7A 2NWNA 1DUEA 2ZU5A 5HM2A 1YPLH 3RXQA 3T5FH 5BPEA 3VB6A 1P0SH 3FP6E 5GJ4B 3VGCC 1N8OC 4Q80A 3UR9A 1D9IA 3QTOH 5K7RA 1CE5A 2STBE 4MLFB 3E6PH 1GJ8B 2Z3EA 1C4V2 3D62A 5BRRE 1LTOA 7KMEH 1OWIA 3E3TA 1C9PA 3KQDA 4TWYA 2ZNKH 5FX5A 3SNEA 1THRH 3GOVB 4NIXA 2WUCA 1SOTA 5F6MA 2A2XH 2NU3E 4A7IB 1P57B 3SJOA 4BXSA 1P3CA 1XXFA 2P93A 1GBFA 2FOEA 3SJ8A 2A4RA 4INKA 3URCA 1GHXH 1XVMA 4A6LA 2AEIH 2PR3A 2PSXA 1HAGE 4K69A 4K1TA 1HFDA 1ZSJA 4FUEA 4X1PU 3ITIA 1QQ4A 3UIRA 8ESTE 4WXVA 1GI4A 2Y5HA 4CHAB 1K9OE 3VB5A 5EOKA 1THPB 1JOUB 1YLDA 4TPYA 1TGTA 1AD8H 4K3JA 1DPOA 1HAOH 4WY3A 5JB8S 1O34A 3E0PB 4E7RG 1YLCA 1C2KA 3ZVFA 1P2MA 4MNXA 1E34B 3M5MA 3BTME 1YPHC 1UO6A 1CBWC 3TNTA 2Y82A 1GBLA 2ZFFH 4NFEA 4Y10E 4CRAA 1PJPA 1S0RA 2Y5GA 5ESTE 1V2RT 1D3QB 3MU5A 3Q3XA 2ALVA 4NIYA 3VFEA 1TX6A 2CMYA 3BTHE 1O0DH 1QB6A 1EPTB 1E36B 4YOJA 6ESTA 2GV6A 1T4UH 4RKJB 3IWMA 4NSVA 1XKAC 1LCYA 2B9LA 2HVXA 4BTTB 1FMGA 4FVDA 1TPOA 3L3TA 4DCDA 1LHDH 4OS4A 1DSUA 4I8LA 3RXEA 1BTHH 3ZZ9A 1WCZA 1MD7A 4AFSA 1ELGA 4MNYA 2W7UA 5C1UA 1OX1A 2ZGXH 1RJXB 1MU8B 1EPTA 3P70B 4DT7B 2HNTF 4X8TH 3GCHB 2Z9KA 3MH4A 4GPGA 1C5QA 3LPRA 4KTCA 4RN6A 2SGFE 2A0QB 1FXYA 2PW8H 3ATWA 3LIWA 2EI8A 4TY7A 4B76A 1UK3A 4X2WA 1BQYA 2TGPZ 1ZSKA 1AE8H 1GI5A 5AHGH 4SGAE 1MKXK 2RDLA 3V3MA 2UUYA 1C9TA 6LPRA 4LK4A 1SVPA 1C1SA 3Q00A 1O5BB 4H6TA 2ODYB 3MYWA 1S82A 3M61U 1HPGA 5EODA 1ZJDA 2NU4E 1BZXE 3GY4A 4IBLH 4ABFA 3AAVA 1O3AA 1OYTH 2BY7X 3A7TA 5C1XA 1UTPA 3F68H 4X6MA 1ANEA 2CHAB 2BTCE 1IQNA 1AVXA 2FOMB 5GCHF 1ELDE 3ZYEA 1SG8B 1Y5AT 4OGYA 3ZZCA 1G3CA 1RTKA 3A7XA 3SV2H 3TU7H 5A0CA 3QUMP 1EOJA 3SHCH 3ZYDA 3SV7A 1FPCH 2Q6DA 3MU8A 4R0IA 1ZSLA 3O8CA 1SMFE 2M5TA 3UNQA 1FNIA 1OP8A 4X1NU 2A1DB 2H9HA 5IYTA 6CHAC 1BITA 2GT8A 3CS7A 5E0HA 2RA0A 4K8BA 5A0BA 1UVUH 1AFQC 1O2SA 4NZQA 1JWTA 2ZFRH 2FEQH 5AFYH 1Z71A 4QT8C 1RTLA 1THSH 1TGSZ 1ZRBA 1Y8TA 1NS3A 2Z94A 1LQDB 1P9SA 5JBTA 1KSNA 1O3NA 1NPMA 1LKAA 2SNVA 2XCNA 2W3IA 1HBTH 4WMFA 1O3JA 3SNDA 7ESTE 2C8YB 1ELAA 1F2SE 1C2EA 2TBSA 4Y0ZE 4BXWA 1W12U 2EC9H 1GPZA 1MZDA 3LC3A 3TK9A 1RD3B 1TOCB 1S6FA 1C4Y2 4DG4A 1HXFH 1SHHB 2SFAA 4XDEA 1V2ST 3RXUA 4BANB 1TNJA 2WYJA 3TPIZ 3B9FH 2AMDA 1TYNA 1Z8GA 1LHCH 1GJ6A 1F7ZA 2A4GA 3UOPA 1Z1JA 1MU6B 1ZMJA 2HNTE 1WAYB 4FVBA 1O2LA 1FIWA 1V2KT 1VITH 1GMHG 1Q3XA 2GCTC 2G4TA 1SGTA 3KGPA 1W7GH 4ZUHA 1AZZA 2BD4A 1EP5A 1YCPH 1BMLA 3VEQB 1IQMA 1HB0B 3ZZAA 1DY9A 3A7VA 1AE5A 5SGAE 4Y8YA 4IC5A 4A92A 3U1JB 1O3LA 4MPWA 4ZROA 2NU2E 1A1RA 2FS8A 4MTBA 4ZKRU 1C2MA 2VB0A 3PM3A 1ABJH 3LU9B 4I31A 2YNBA 3LT3A 5CMXH 1IOEA 1GBTA 5L2ZH 2H1UA 1SGDE 3HGNA 5DP7A 2GVFA 5L6NH 3LJJA 4ZHMU 3RM0H 1UTNA 1FV9A 1GBHA 1BIOA 3FP8E 1YBWA 1SGPE 1J16A 3RXKA 5DPAA 1YPJH 1W7XH 2BLOA 2C3SA 1RS0A 3ZZ6A 3I29A 3TJUA 4AB8A 1AVGH 1P10A 2B8OH 4AG2A 4JK5A 1KTTB 4LZ1H 2WUBA 1ARCA 3GISB 4WMDA 3WY8A 2J38A 1AGJA 1PYTC 2BLVA 1Z8RA 1OYQA 1C5MD 3Q76A 1ZPCA 2ANKH 2ZTXA 1P2NA 4XSKU 4AFQA 1O2XA 3DFJA 1RFNA 2VNTA 2Y7XA 2V6NA 3PTNA 2BVSH 1N8OB 1O2ZA 4H4FA 2ZCKP 4X6NA 2FS9A 4IS5A 4TY6A 3BG8A 3NUMA 1QRWA 3TLOA 1TWXB 1J17T 1MTVA 1BBRE 1TBRH 2EA3A 2W7SA 1LHFH 3QDZB 1VITF 2SNWA 2VVVA 1SQOA 5J4SA 2KAIB 2J95A 3TK5A 1G30B 2BQ6B 4YESB 2R2WU 3SU1A 2OXSA 1TA6A 1EZUC 2ANYA 1BTXA 2P3TB 3EA8A 1JIRA 5DP5A 2BY9X 3ZZ3A 3UNSA 2AMPA 2B5TB 2PLXA 2ZZUH 1C5XB 2ZHDA 2UUFB 2VWOA 1LVOA 3TITA 3BTFE 3GCOA 4WWYA 1BA8B 3RP2A 5FCRA 4AZ2B 3SHAH 2NU1E 1QQUA 3U8OH 3PV4A 4YO9A 2KAIA 2ZF0H 4Y7AA 4ZXYH 3SNCA 1TQ7B 4U01A 1A0HB 3F6UH 4RSPA 4DW2U 2F3CE 3SI3H 2FOAA 1WQSA 1UVTH 4IN1A 3PB1E 3EDXB 2OINA 2BD8A 3PWBA 4MG3A 2O8UA 4GSOA 1EOLA 4YOGA 4GHQA 3P17H 1FJSA 2JH6D 4JZEH 5FX6A 1INCA 2QXIA 4ZHAA 3JZ1B 1B0FA 3BTQE 3CP7A 1P03A 1QIXB 5T6GA 2XBWA 1MTNC 1C5VA 3RXMA 5DP8A 1P06A 3AW0A 4I8GA 3FANA 1UCYE 1BJUA 2CHAC 1LHGH 1NRRH 1T31A 3SU0A 3SJKA 2TGAA 1MZAA 2BDAA 1CGIE 1ELBA 3NXPA 4ISNA 3U1IB 3PMAB 3QO6A 1TMUH 3QGJA 1AI8H 4ISOA 4B74A 3GCTG 1MUEB 1QURH 3PROA 3RLWH 3QGNB 4NSYA 2BD5A 1TA2A 9ESTA 4BTUB 1KXDA 2GCHG 1C5NH 1FAKH 1G37A 1QY6A 1EKBB 3LC5A 5EQRA 1AUJA 2ZQ1A 5T6DA 2IPHA 1SGFG 1CHOF 2HWLB 1O3KA 1OPHB 1RGQA 3S9AA 2XW9A 1Z6JH 1OWHA 2BY6X 2ZGJA 1SLXB 2A4QA 2FI3E 1QL7A 5A8ZA 3T28A 3RXRA 2ODPA 1JRTA 1JBUH 5FXLA 4D7FA 1AKSB 1G36A 1SGNE 2QF0A 1SR5C 2OBQA 4NA8A 1C1RA 1GBMA 3ZZ4A 3TVJB 1C1OA 3GY6A 1J9CH 1KTSB 2QF3A