2CMYA

Crystal complex between bovine trypsin and veronica hederifolia trypsin inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title An Unusual Helix-Turn-Helix Protease Inhibitory Motif in a Novel Trypsin Inhibitor from Seeds of Veronica (Veronica Hederifolia L.).
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cmyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cmyA02
2Z3DA 1TPOA 1BTZA 1O3JA 1AB9C 3HATH 1CA0B 3HPTB 1H8IH 4LOYH 2ZGCA 1EB1H 3HKIB 2XYAA 3JZ2B 2Y7ZA 3KEEA 4WJG2 1AB9B 1SGRE 4RSPA 1GJBB 1QRXA 1QB6A 3NK8A 5IDKA 1LHFH 1UVPA 4DJZB 1MBQA 1BJVA 1YLDA 3SOSA 1NO9H 2EI7A 3ZVAA 1FQ3A 1Z6JH 1OS8A 2ZTXA 2BD8A 1T4UH 1C2GA 2BYAX 4MTBA 1L0ZA 1QL7A 4WY3A 3IWMA 2ZA5A 1HIAA 2ODPA 3B23B 1WV7H 4E7NA 3UR9A 1DY8A 5GDSH 4R0IA 2G8TA 2NU3E 3FZDA 1ANEA 4BTUB 3M7UA 2A5KA 2CMYA 1T32A 3V7TA 3TITA 2BDHA 2NU1E 4HZHA 3RXTA 2C3SA 2OLGA 3ZVGA 1ZSKA 1FIWA 2GMTC 3M35A 4WH6A 2ZNKH 3P8FA 3GY6A 2OBQA 2GMTB 1GI6A 3EA8A 1EOJA 2BDYA 1UTLM 4B1TA 1YF4A 3A87A 3EYDA 3ZZBA 4NSVA 3LJOA 1C5LH 1O2GH 4D9RA 1ZHMA 1K2I1 3RC4A 2ZFRH 2WPIS 1IQJA 3UIRA 1ZR0A 4GAWA 1SR5C 3UY9A 1L2EA 1ZMLA 1SLVB 5EPYA 2TGDA 4AFUA 1Y3YA 2G55A 3L3TA 1OP8A 1CGHA 3PTNA 4INLA 4D8NA 1GJCB 1W11U 1SHHB 1HV7A 3A88A 4I8HA 1NROH 3BV9B 4DGJA 2WINI 3TVJB 1K1PA 2AIPA 1EUFA 4J1YA 1TABE 2FP7B 2P59A 4RKOB 5H4IB 1NTPA 4AORA 4BAQB 4K1SA 1ESAA 2ZDNA 3AASA 1O2NA 1UJ1A 1XXFA 2AMQA 2ZPRA 4UFDH 3NPSA 1D3PB 7KMEH 2R3UA 1O3DA 1XXDA 2OQUA 2FESH 4CBOA 1D9IA 4Q2KA 1TWXB 1ZRKA 3MHWU 3ODDA 5DP4A 1SLXB 1T8OA 3ZYEA 4D9QA 1UK2A 1QY6A 4Y0YE 1TGBA 3PMAB 4BTIB 5LH8A 2SGAA 2ZHEH 1BBRE 1SGTA 1GMDF 1EATA 2FS8A 4UDWH 2AIQA 1S82A 5FX5A 1P02A 1DWCH 2A45B 2ZGBH 1P0SH 4AYYB 1C5MD 2GCHF 1CT0E 1SGPE 2ZU5A 2GP9B 1F0TA 4YLQH 1DICA 1BTYA 3V3MA 1K28D 1WSSH 2C93B 2PUQH 3SU0A 3O8RA 1H8DH 4DOQA 1TALA 3P92A 5T6DA 3ZYDA 3KHVA 1QQUA 1DOJA 5L6NH 2FYRA 4OGXA 5DP5A 3RM2H 8LPRA 1O2LA 3RMMH 1FONA 2F9NA 1QJ7B 1OYQA 2PLXA 5CHAC 3FP8E 7ESTE 2Y5HA 4X0WU 3S7KB 1IHSH 2FS9A 3GCTF 3T27A 1GJ5H 1MKXH 5CHAB 4BXWA 1GBHA 3RXJA 1GBJA 1QL9A 3C1KA 3TJOA 2HPPH 1ACBE 1IAUA 4X8UH 4O3UA 5FAHA 1XM1A 1QIXB 2WUCA 1QNJA 1KXAA 2QA9E 1GMHF 1Z8RA 4WF8A 5EG4A 3O8CA 1TOCB 1GJ8B 3BF6H 5ESBA 1MU8B 1MMJN 2BD9A 4KELA 1WBGB 1GL1A 3SU4A 1AFQC 4O9VA 1KXBA 4AFQA 4Z6AH 1O3IA 4A6LA 3B9FH 5AFYH 4NFEA 2G5VA 1BZXE 3RXKA 1AFQB 3O8BA 1RTLA 4FUFA 3RXRA 1TNIA 2CGAA 3GOVB 3UUZA 2XBYA 3SZNA 1UO6A 4Y8ZA 2XBWA 1HYLA 1QQ4A 1A3BH 1EJMA 4IGDA 3BIVH 2VVUA 2O8TA 1YPGH 5FBIA 2Y81A 1AE8H 1OOKB 2SGFE 4NZLA 1Q2WA 2BLVA 4YT7H 1C1WH 4NG9H 2EA3A 2XBXA 1OWJA 1QL8A 3SNAA 1CE5A 2Z3CA 3FAOA 3MH5A 3ATMA 2G00A 2XCNA 3MU0A 3VB7A 3U1IB 3PTBA 1O2UA 4GHTA 1WTGH 1BMLA 4IC5A 3LOXA 2P3UB 2PSXA 1N6YA 2K1QA 1Z8IB 3SU1A 5ETXA 1AZZA 3W95A 3LGWA 1CHOG 1D6RA 2BD2A 3ZVDA 1QR3E 4WH8A 4K8YA 2TGAA 3SJ8A 1OPHB 2SGPE 3LGTA 1KLIH 3SQEE 1C5TA 3K2UA 2ZU2A 3EDXB 3V0XA 1O2SA 1TYNA 1TX6A 2TRMA 1GI8B 2ZDVH 2TGPZ 4FUDA 1ZLRA 1NRPH 3SV6A 3KQCA 4LXBH 1UVTH 1QFKH 4K8BA 1A5IA 4H42U 4JYVH 5GXPA 4NZQA 3RU4E 5EQQA 3SBKA 1IQHA 1SL3A 2EC9H 2HPQH 1JXPA 1CA8B 3E8LA 3PMJA 3TLOA 3P8GA 1C2IA 3TNSA 5AHGH 2VVCA 1EKBB 3ZVEA 2WPKS 1B5GH 1PPHE 1ELEE 1ORFA 2STAE 4HTCH 3FZZA 4Y79A 2ANYA 3RXVA 2W3IA 2PTCE 5AVDA 1EAUA 4OS5A 4XE4A 5F6MA 1KIGH 1V2PT 1OWKA 3RXOA 3E3TA 5JBCS 3MH4A 1GBMA 1FPCH 3MWIU 3LT3A 4MNVA 1ANBA 1P06A 3SJOA 1RXPA 1C5VA 2ILNA 1GBIA 3BG8A 3MH6A 1GMDG 4I8JA 2BY5X 3P17H 5L2YH 4E7RG 2ZP0H 3Q77A 2Q6GA 4AFZA 1NRQH 3K9XB 1P3EA 5FPSA 5TJXA 4K5ZA 4GUXA 2RA0A 2WYJA 1HPGA 4D7GA 4H6TA 3AVZA 4AX9H 2P94A 1GI2A 1Y5UT 1FXYA 1BRCE 4I8GA 1NFXA 3EA9A 1MQ5A 1T8MA 2FI5E 1O2VA 2XXLA 4F49A 2GZ9A 1PPCE 7GCHF 4YZUA 1EOLA 1XVOA 2FYQA 1KTSB 3FP7E 3P8NA 5J4QA 1SGQE 3BEIB 1YPKH 1Y5BT 1HUTH 3SGAE 2FDAA 1PPFE 1SFIA 5FCRA 1FN6A 5F8XA 4AN7A 1GHZA 3FANA 1Z6EA 1E36B 2VINA 4SGBE 1DVAH 1IQIA 1O30A 1GBAA 1TGNA 1SQTA 2QY0B 1LVOA 2XWAA 4WVPE 2ZG0H 4JYUH 1MKXK 1W13U 3DFJA 5CE1A 3SUFA 1O3AA 8GCHF 1AKSB 1AUTC 4R8TB 1TMTH 1C1SA 3R3GB 2RA3A 4ZHAA 2UUKB 2O8LA 1SGDE 2FMJA 1BIOA 4FUEA 2G51A 1DLEA 3RXSA 3QGJA 2C8XB 1OWIA 3PLKA 2SNVA 1UTOA 1TRYA 3PLPA 1V2TT 3RU4T 1G30B 1C2JA 4IN1A 1AGJA 1JRSA 6ESTA 1ETSH 3GDVA 2DE9A 4QT8C 3M7TA 1P8VC 3DFLA 3ZZ6A 3RC5A 4XFQA 5FPTA 1ZPCA 3KGPA 4LK4A 3RXUA 4NIXA 5LPRA 2BY7X 2Q6DA 2G5NA 3MTYA 4GVUA 4K3JA 3UFAA 4DY7B 2BD3A 1AVWA 5DP8A 4B71A 5JBAS 3M7QA 1EASA 3E1XB 1YLCA 2A7JA 2DE8A 1JWTA 1ZPZA 3UWJH 1ZTJA 3RM0H 3QN7A 1AIXH 2BDIA 3DD2H 2FTMA 1GMCF 4OS4A 3ZZ3A 2GV7A 2FX4A 1OX1A 1TGTA 1TLDA 4B74A 2XTTB 1A3EH 1GVKB 3OU0A 3ATWA 2OCVB 4AFSA 1AO5A 2BB4A 3NWUA 1O34A 5LPFA 1O5GH 2GX4A 1SOTA 5DJ7A 4I32A 1DITH 4ZMAH 1H4WA 1A61H 1FY8E 5A09A 1GJ7B 4UE7H 1GJ9B 1O36A 1GGDC 1UTJA 2TIOA 1THPB 1DS2E 1HJAC 2VH6A 4XOJA 5JDUB 1O2ZA 1WCZA 4BXSA 2Y5GA 4Y6DA 1O3EA 2R0LA 1HJAB 1PQAA 1BITA 1VCPA 3BSQA 3SJKA 2ZDLA 1K1JA 1Z71A 1LVYA 1SPJA 1O2IA 1OKXA 4AB8A 5C1YA 1FIZA 1GVZA 4GCHF 2ZPSA 3TJNA 1DUAA 1HJ9A 2HNTF 1F92A 2BY8X 3HK6B 5GCHG 2HRVA 3MU1A 5T6GA 1L1NA 3UPEA 1C2DA 3DA9B 4CRFA 1QB1A 1QA0A 2ZC9H 3I78A 1A0HB 1BBRH 1O3BA 3RXLA 4ABDA 2QF3A 3SI4H 4X1PU 4AB9A 2ODYB 1O3GA 1TRNA 2QYIA 1VR1H 2BDAA 3SV7A 2W26A 1HJ8A 1TBZH 5DO4H 1KSNA 4HFPB 4OS2A 1AZ8A 2FM2A 2BD7A 9ESTA 1O3LA 3QZRA 5E2OA 3SNEA 4FXGH 3SUEA 1XUJA 1O3CA 2GV6A 2H2ZA 1F7ZA 4Y11E 6GCHF 1FDPA 1KXFA 2FLRH 5FXLA 5TCCA 3TK5A 1FJSA 3ZVBA 3A8CA 3LIWA 2P8OC 3MO9A 3PWCA 1FN8A 3KQDA 2O8MA 4CR9A 2F9PA 4X6OA 1ARBA 4B2AA 1BA8B 1B7XB 1K21H 2P8OB 1DWBH 1OWEA 1P01A 3M5NA 2QGRA 4Y7AA 3T2NA 5EODA 1P57B 3ESTA 4IMQA 2GD4B 4DIHH 4Y71A 4X1NU 8GCHG 5A8YA 1C2EA 1V2RT 1L1GA 1LQDB 2OC8A 1S85A 1SGNE 4I7YH 3F6UH 2PUXB 5TCAA 2BD5A 2G52A 3DT0H 1MTUA 3TK9A 1YCPM 3RXPA 3GY7A 2BZ6H 2J94A 2J92A 2ZDMA 1MU6B 5AFZH 4UFGH 3ZZ8A 1NZQH 3NKKA 1W3CA 2FPZA 3ZVCA 2A5AA 5F03A 2BY6X 2VWOA 1OXGA 3AAUA 3SORA 5L30H 2GGVB 1NESE 2BLOA 3F9HA 1EB2A 3VB5A 1BJUA 1O2WA 2BX3A 2P93A 5EXNA 1GCDA 1WAYB 2ZGXH 1GHXH 1BHXF 3MI4A 1G3BA 1CT2E 3LGVA 2ZKSA 1GL0E 3KQEA 1P11E 1TFXA 4Q7YA 3BTKE 2G4UA 3T62A 2Y6TA 1YBWA 1DWEH 2VIQA 1B0EA 2FODA 1IHTH 3ATIA 1Y3WA 3OY6U 2A4OA 1YP9A 1ELTA 2ZECA 1NRNH 2D26C 3LGIA 5DG6A 1CQQA 2QV1A 1UTQA 4BANB 1UHBA 1AVGH 1QCPA 3GY8A 1UTMA 4CREA 1G3EA 3KQBA 4YOJA 1VITH 3TH4H 4ISNA 2AEIH 1DT2A 1F0RA 4X2XA 2ZDKA 1QBNA 2UWPA 3A7ZA 1ZZZA 1QTFA 3SN8A 9LPRA 1CVWH 5HM9A 3UQOA 3ZV9A 4BTTB 2H9HA 1ID5H 4YTAA 3GDSA 1ETTH 2Q1JA 1GPZA 1O37A 2CF8H 1J16A 1TPAE 3MFJA 2Z94A 3A83A 3DUXH 1HIAB 4BAKB 4ABJA 1JOUB 2A5IA 1LHGH 3ZZCA 1W2KH 2AGEX 1O35A 8KME2 3MNSA 3PB1E 2G81E 1K1NA 3RLWH 3CS7A 2ZWLH 3QZQA 1BMNH 2CV3A 5F8TA 1YYY1 2FWWA 4MLFB 2F3CE 1C1PA 1C5WB 4MVNA 5CMXH 4CR5A 1MZAA 4IN2A 2ZO3H 1YCPH 3PROA 4NWKA 1AMHA 2BDGA 4E06H 4NA8A 2VH0A 5JYIA 1T4VH 1GI5A 1T7CA 3E0PB 3ZZ5A 3T26A 1O33A 2BX4A 3I29A 1P3CA 1XUIA 1M9UA 4X8SH 1YPLH 1FV9A 1NRSH 1IQGA 2GKVE 3OTJE 1P2KA 3RP2A 1HDTH 1G36A 3STIA 1EP5A 2P16A 1YPHE 4ZH8A 2B5TB 1GVLA 1HAHH 4FVDA 4ZKRU 1C1MA 1VCQA 3ZZ7A 4IBLH 2Z9LA 1G9IE 1BBRK 2ALVA 1NU9A 4Y8YA 1SBWA 1SOZA 3E0NB 1F5LA 2M5TA 3KIDU 1SHYA 4ZUHA 1O3PB 1A46H 3RXGA 1J8AA 1J14A 4WMEA 1V3XA 1GBDA 1UCYE 1YC0A 2J34A 1FPHH 1MBMA 4MNWA 4XSKU 5E8EH 1TONA 4WXIA 5B6OA 2DUCA 5JBBS 2XCFA 3GCHB 1GBKA 4DIIH 1TX7A 3VFEA 3GYMA 2STBE 1PYTC 1CBWC 2ASUB 1O31A 1V2NT 1GI4A 1Z1IA 2ANKH 1KYNA 5J4SA 1CBWB 1O32A 1NN6A 1GBBA 4HGCA 1A0JA 1O5CB 1O2HA 2UWLA 1ZGVA 1IQFA 3M37A 1TA2A 3QX5H 4GPGA 5ESTE 2UUYA 4X6MA 5HMAA 1TPSA 1C1UH 4ZROA 5JB8S 1LPZB 4NIYA 1EAIA 2Y7XA 2V3HH 2UUFB 4OGYA 4ABHA 1MCTA 3LPRA 4IC6A 3M5MA 2A7CA 3UNQA 4NWLA 2QN5T 4A7IB 2BZAA 4X8VH 3MNBA 4WXVA 3VXFH 2QXIA 3AW0A 1LCYA 1P9SA 1V2WT 4U2WA 1EJNA 2NU4E 1RJXB 4WMFA 3U98H 1AFEH 2BQWB 1HAZB 1O2OA 3K6YA 3AW1A 2Q6FA 1BQYA 1QBOA 3SU2A 5JB9S 1V2ST 1HGTH 4A92A 1EPTA 4MPWA 1C5RA 1C9TA 2V3OH 4X1QU 3BIUH 1BB0B 5A8XA 1DM4B 1GG6C 4XDEA 1IQEA 3SU5A 4CBNA 1DUEA 1O2YA 4FUJA 3MO6A 3AAVA 2BOKA 4FUCA 3SI3H 3OSYA 2J2UA 1TMUH 1GG6B 1C1NA 4YESB 3RUOA 1E0FD 2VJ1A 3A85A 1YPJH 4Y76A 1W10U 1GI9B 1V2LT 3MH7A 5E0JA 5EXMA 2VIOA 1O3KA 3RXFA 1SGEE 1C5OH 1UTNA 1V6DA 4MG3A 2WYGA 4ISOA 3LONA 3OY5U 2GDEH 3EGKH 1W0ZU 2OD3B 3EE0B 1DLKB 1A0LA 1DPOA 1O2TA 3RXCA 1N1LA 1GJ6A 1QJ6B 4TPIZ 3VB3A 2EI8A 3BN9A 5SGAE 1G32B 3PV4A 1AVXA 3UOPA 1PPGE 1AHTH 2FI3E 1XUKA 2AERH 2FOFA 1KLJH 1ELVA 2F91A 5LGOA 2HLCA 2GTBA 1CGIE 1JIMA 3A8DA 2ZU4A 2AGIX 2QAAA 2AMPA 4FUBA 4VGCB 4NA7A 2JH5D 2FO9A 2QF0A 1ZMNA 2XC0A 2BVSH 3UREA 4UONA 1BOQA 4DURA 1AD8H 2FZZA 3RXBA 4NIVA 4B2CA 4KGAA 2PV9B 2IPHA 3LU9B 2AMDA 3K65B 1YCPK 2Z9IA 1F5RA 2JH6D 1Y3XA 1VITF 1HLTH 1YPMH 1QA7A 2C4FH 2VIDA 4U32A 1ESTA 2WUBA 2V6NA 5DKMA 3LGUA 1L4DA 1WYKA 1MCVA 3ODFA 4KP0A 3SV9A 2LNCA 1UK3A 2GCHG 1HAPH 2SGDE 4I8KA 2AS9A 1GJAB 3RXEA 2BDBA 1AY6H 1UTKA 1BTPA 1O5EH 1GHWH 1K1LA 1AWHB 3U8OH 3GY3A 1K9OE 4MPUA 1FY3A 4DCDA 1C9PA 1SQOA 1YGCH 4O3TA 2D1JA 3A8AA 1LPKB 3M5LA 2HNTC 2G4TA 6CHAC 1L4ZA 4FUIA 2ZCLP 1RTKA 5DP3A 1IQNA 3A7WA 3LC5A 1LHDH 3GCTG 4AG2A 5DP9A 6CHAB 2QXGA 1WQVH 1G2MA 1NFYA 5C3NA 7LPRA 3ITIA 3E91A 1ZYOA 2ZHQH 2FOAA 2BXTH 4BAOB 4Y10E 3BEFB 5A2MH 1ZPBA 2F9BH 4KKDA 2P95A 2LPRA 3H5CB 4JZ1A 1GMHG 3BTME 4Y8XA 4LZ4B 1A1RA 3ZZAA 4GLYA 2A32A 1JRTA 2A4QA 4UFEH 5EU8A 2VIVA 1NFWA 2VWNA 4ABBA 2VWLA 2YNAA 1MD8A 5JBTA 2BD4A 3DHKH 1D6WA 4GSOA 4TYDA 4BNRA 1PFXC 2BXUH 1MTNC 3QTOH 2ZIQH 1O2RA 2GT8A 4AZ2B 4ABGA 1P09A 5A0BA 1TPPA 2C90B 1C5XB 1MTNB 1MH0A 5C5OA 1LHCH 5GJ4B 1NY22 1Y3VA 4JK5A 1UK4A 1A5GH 2PKSC 2Z9KA 1HNEE 3W94A 1KLTA 2PKSB 2BM2A 4UFFH 2Z6BD 2ZFSA 1O2MA 2FEQH 1SLUB 2OC7A 2PKAA 2WV5A 3S9CA 5E2PA 2TPIZ 5T6FA 3F1SB 1P2IA 2Z9JA 1SGCA 2EI6A 1J9CH 1SGFA 3RXMA 2RDLA 4OS1A 1V2JT 1RS0A 3SO3A 4X1SU 1TOMH 1AQ7A 2Z3EA 1ZOMA 3OX7U 2THFB 4FVBA 1THRH 1D3QB 2A4GA 1PQ8A 3ATKA 3A81A 1P2MA 4E05H 2EEKA 1LTOA 1ELBA 2PWXA 2ZHFH 1WQSA 3ZZDA 1ETRH 1EZSC 2CHAC 3SJIA 1LVMA 1A4WH 3Q3YA 1NRRH 2AYWA 1C5PA 1S5SA 2XRCA 1K1IA 3T28A 1KXDA 3NXPA 2CHAB 4YLUA 3SU3A 3KCGH 1LVBA 1N8OC 3RMOH 2B0FA 2VNTA 2BLWA 1X7AC 4J2YB 1N8OB 4JZDH 1MTSA 1IQMA 3D62A 1RFNA 4X6PA 1AE5A 2A2QH 4CRCA 5E0GA 3GISB 2ZTYA 1SSXA 2PFEA 3A8BA 2F83A 1ANDA 3SV8A 1F0UA 5C67A 3QO6A 2OC1A 1OP2A 1KXCA 3ZZ4A 2FOEA 1XKBC 1MZDA 1GBLA 2B7DH 2Y5FA 1SG8B 4KTSA 4B73A 3LC3A 3JZ1B 3KF2A 3GICB 3SHCH 2ULLA 1ABJH 3T29A 1LDTT 4UD9H 3RXIA 1W0YH 2BHGA 4NA9H 2Z7FE 1V2VT 1LKAA 1OWHA 1A7SA 1UCYH 3HK3B 3WY8A 3UTUH 4TY7A 5EW2H 1O5DH 4A1TA 1MKWH 1P05A 3G01A 7GCHG 5FCKA 3MO3A 3UR6A 1C1QA 3B8JA 1SB1H 2F9OA 1W7XH 2YOLA 3Q3KA 2R0KA 5PTPA 3P8OA 3P95A 2ZCHP 5DK1A 1C5SA 2AFQB 2J38A 1O2XA 2A4RA 1Y8TA 2OC0A 2NWNA 5C5NA 1P03A 3ZV8A 1GHBF 5C20A 2PGQB 1PPBH 1DY9A 3PWBA 2C8WB 3S9BA 3PLBA 1Y3UA 2GDDA 1C5ZB 4X2WA 3VB4A 1SFQB 2A31A 2CXVA 1ESBA 1B0FA 1S83A 1HAIH 2QXJA 3SUDA 1PQ7A 1QRWA 1G3CA 3S69A 4ZHMU 1RIWC 4FUHA 1LKBA 2R9PA 1NC6A 1O38A 5BPEA 1ZSJA 1RTFB 1OSSA 1PYTD 1RIWB 2ZDAH 1BCUH 4JZFH 1W12U 1EP6A 1NPMA 2ZU1A 4O97A 4WWYA 1TMBH 1LHEH 1INCA 2GCTC 5EPNA 1H9HE 2HOBA 2KAIA 1DWDH 1EX3A 2I6QA 3URCA 1EQ9A 4X2VA 1VCWA 2GCTB 5EGMA 1GI7B 3A86A 1K22H 1GBFA 1CHGA 1P12E 3TU7H 1TX8A 3BTDE 1EJAA 2ZFPH 1V2QT 2J95A 4TWYA 3K6ZA 1ZGIA 1QGFA 2PGBB 1EZXC 3OYPA 1ZHRA 1O3FA 3ATLA 2CJIA 4CRDA 1LO6A 1GI0A 6LPRA 1GI1A 1XKAC 1O5BB 1XVMA 1EZUC 1NT1A 2ZCKP 1D3TB 1GMCG 2XNIA 2Z9GA 3A80A 2C8ZB 1WU1A 3LJJA 1ZMJA 3F9EA 1C2FA 5HXFA 2WPHS 4DT7B 5EQRA 5FHTA 5E0HA 1DANH 1XMNB 2V0BA 2XC5A 1ELCA 2KAIB 3RDZA 3T25A 3BTWE 3TPIZ 1Q3XA 1GI3A 1GDNA 4FUGA 2H6MA 1W7GH 1P2QA 1JMOH 4D7FA 1S0QA 3CENA 5AF9H 1GDQA 3BTGE 2VWMA 3M36A 1FY5A 1VGCC 1FAKH 3U8TH 1Z8GA 2R2MB 1HFDA 1ELAA 1VGCB 2FTLE 1C1VH 2W5EA 1ABIH 1NS3A 1TBRH 1ELDE 1QBVH 2FI4E 4YO9A 3D49H 4NGAH 1V2MT 1TNLA 1FLEE 2A1DB 1LMWB 3N7OA 1MQ6A 1NM6A 1SVPA 4ASHA 4GCHG 1UHBB 1EAWA 3E90B 3M3TA 4WMDA 5I25A 3T5FH 1CHOF 1BTUA 1TNKA 1KY9A 3Q3XA 1C5YB 1O39A 1Z1JA 2VIWA 2A0QB 3F68H 1MUEB 3O8DA 1GHVH 1GHAF 3UQVA 2VB0A 3S7HB 1ZTLA 1T31A 2XC4A 4TY6A 1H1BA 3ZVFA 1DSUA 2IOTA 4MQAA 1QURH 1Q31A 3V12A 5EXLA 5K0HA 3TJVA 3A7VA 1J15A 2NU2E 1E38B 5GWZA 1OP0A 1GBCA 1HAVA 3U9AH 2GZ7A 3CP7A 1EZQA 3HGPA 1C2LA 6GCHG 2IJOB 5A0CA 1CSOE 4KTUA 1SGYE 1CO7E 4JZIA 5G4BA 3EQ0H 2V35A 1YKTA 1FI8A 1UCYK 3GCHC 4HI3A 1QRZA 3UNSA 1PJPA 1GHBG 1K1MA 1O3OA 1MKWK 3MU4A 1C2HA 1C4V2 4ESTE 1V2UT 1MTVA 1G37A 4ZKNU 3E16B 2QIQA 1QB9A 3HKJB 3FFGA 1XX9A 2A7HA 3BEUA 3MU8A 3A7XA 3TH2H 4ABFA 1O3NA 2FOHA 2QCYA 2XWBI 1HAVB 1AN1E 1ZJKA 1P2OA 1TQ7B 1S0RA 1O2JA 2I6SA 1TNJA 1S81A 1W14U 1GWAA 1D3DB 1IQKA 1W8BH 2GT7A 1O2QA 2ZHWH 2A2XH 2F9UA 2VVVA 2FIRH 2O9QA 4INKA 4AGKA 2OP9A 1UMAH 1THSH 2OXSA 1AI8H 4ISIH 1HAYB 1CU1A 2SNWA 1DDJA 1K1OA 3R0FA 1O3HA 3VB6A 1MD7A 2VIPA 2HWLB 3HGNA 1BUIA 4JMYA 4OS6A 2ODQA 2BTCE 2H9EH 1A2CH 1TNGA 3A82A 3MMGA 3UWIA 1BTHH 3IITA 1GJ4H 5HM2A 4TPYA 1VZQH 1SGFG 3P70B 1FMGA 1FUJA 2GZ8A 1G2LA 1QJ1B 3FVFB 1E34B 2R3YA 5GIBA 1SC8U 3SNBA 3SGQE 1BRUP 2RG3A 3F9FA 2FXRA 4INHA 4X8TH 1JIRA 4ABAA 3MNXA 8ESTE 4I33A 3RMNH 3BG4C 1C5NH 1XUGA 5F8ZA 1WUNH 3GY4A 2R2WU 1BT7A 2WPLS 3TNTA 4Q7XA 1BTWA 3GCOA 3BG4B 5HGGA 2TBSA 1AWFH 4SGAE 2PSYA 3IG6B 2BVRH 5FBEA 5ABWA 1GCTC 2WPJS 4K69A 1BRAA 3BTFE 4ZAEA 1TE0A 3QK1A 2W3KA 4AG1A 1FY1A 3GY2A 1GCTB 1C5QA 4H4FA 1E35B 3H7TA 4Y7BA 1GHYH 1EPTC 3TH3H 1HAGE 4CRGA 2ZPQA 2ESTE 1EPTB 1FY4A 4IS5A 1PPZA 2WV4A 4VGCC 5LPEA 3TGKE 1BMMH 4BAHB 3QTVH 3RXAA 3S9AA 1MAYA 1DE7H 2ZI2H 1GHAG 1TAWA 2ZGHA 1NU7B 4RKJB 4MPXA 4DVAU 3M3VA 1QHRB 4THNH 1S6HA 2ZQ1A 3GYLB 2YNBA 1XUHA 1ZHPA 4Q80A 3Q00A 2XW9A 1EAXA 1C2MA 2PW8H 2PR3A 3BTQE 4XBBA 3A84A 3VXEH 1NFUA 4LZ1H 2B8OH 1O2KA 1N6XA 1RRKA 2RCEA 1U6QA 5FPYA 3TK6A 1Z8JB 2Y80A 3U8RH 1BRBE 3ENSB 4MPVA 1V2OT 3STJA 2HGTH 2BVXH 3URDA 5DGJA 5A0AE 1C1OA 2ZHDA 2ZZUH 2GVFA 3RXDA 1FZZA 2Y82A 4ZKOU 2J4IA 4JCNA 1F5KU 2ZGJA 3MNCA 1IQLA 5GCHF 3Q76A 3GY5A 4Z0KA 2FX6A 5EW1H 2NU0E 3QGNB 1AUJA 3GCNA 1DX5M 4A1VA 1G3DA 3MU5A 3SNCA 4U01A 3RXQA 2PTNA 3QDZB 3EA7A 1DXWA 2O8UA 4ABIA 2SGEE 3A7TA 4MDSA 2WPMS 4AGJA 1RGQA 1AKSA 1TA6A 1UVUH 4X6NA 1GDUA 1JBUH 3C27B 3RC6A 1LQEA 3GDUA 1TBQH 1C1TA 1CGJE 3BTTE 1ANCA 2P3TB 3RXHA 1V2KT 1A5HA 1IOEA 3TIUA 3BTEE 3LGYA 3QWCH 4BOHA 1T8LA 1CT4E 3MYWA 4XBCA 4AYVB 2QXHA 3V13A 1MAXA 1TNHA 3M5OA 1GBTA 1EXFA 2AGGX 5I46H 3LH3A 1S84A 3LKWA 5GPIB 4RN6A 1D4PB 3SGBE 1SLWB 4B2BA 1TGSZ 4ISLA 2CN0H 4AOQA 3SU6A 4Q7ZA 2F9VA 2VU8E 1ZJDA 5IYTA 3VGCC 1HXEH 2H1UA 2OQ5A 4YOGA 3KNXA 4H6SB 2B9LA 2BQ6B 3SHAH 2UUJB 3VGCB 1C4U2 1ARCA 4FU9A 2HALA 2OUAA 1OYTH 2JKHA 1C5UA 1ZTKA 4A1XA 1HAXB 3PMHB 4X2YA 1H9LB 4D76A 1Y59T 2H5DA 3ELAH 3EAJA 1O3MA 3TGJE 1KTTB 3SQHE 5DP6A 1SMFE 3FP6E 1DXPA 3PO1C 1TB6H 3BTHE 2BMGB 1BTXA 3MOCA 5EOKA 4I8LA 4B76A 1FNIA 4CH2B 1KDQA 3F9GA 3PO1B 1DFPA 1F2SE 3M61U 4K60A 1F0SA 1XUFA 4JYTA 5DPAA 4U30A 4K1EA 1VJ9U 4FU7A 1E37B 4OS7A 3UNRA 4CH8B 1C1RA 1Z7KA 4MNYA 3A89A 1H9IE 1TQ0B 4F4OC 1C4Y2 1OWDA 3UOUA 1S6FA 2BLQA 4O03A 2FOBA 1BHXB 4Y0ZE 2FOMB 3TJUA 2PKAB 3CS0A 2BDCA 3L6PA 2AH4X 2D8WA 3D23A 2HNTE 1L1JA 3SJ9A 1O2PA 2H5CA 3L33A 3U1JB 2OBOA 3PMBB 3VPKA 4ABEA 2PHBA 2FOGA 3P6ZB 2QC2A 5A8ZA 1P2NA 1GBEA 1UVOA 4K2YA 4A5TS 1HXFH 1MTWA 1HAOH 1ELFA 1KDQB 4DW2U 2SFAA 2SGQE 3S0NA 4PROA 2ZFQH 2P3FH 2ZQ2A 4JZEH 4K1TA 2C8YB 4UEHH 1VITG 4ZXXH 3PM3A 4YT6H 2FOCA 1ELGA 2ZEBA 3SW2B 4NSYA 1HB0B 1YM0A 1GGDB 2TGTA 4IMZA 4JK6A 3KL6A 3A7YA 3RMLH 5FX6A 3SV2H 4BAMB 4GHQA 2OINA 4CRAA 1LPGB 3I77A 4ISHH 3NUMA 3D65E 1O0DH 1GJDB 2JETC 1TRMA 3TGIE 4NFFA 4NCYA 4FU8A 2ZFTA 1BDAA 2BOHB 4YM9A 5K7RA 2JETB 1P9UA 5C1XA 1WOFA 3E6PH 1FAXA 3SUGA 2VGCC 1TGCA 1VJAU 1J17T 5C1UA 4I31A 2J9NA 3PYHA 2UWOA 1C2KA 2ZU3A 2BQ7B 4DG4A 1RD3B 2VGCB 2XBVA 4CHAC 4MNXA 3SNDA 3NCLA 1ZSLA 5DP7A 4CRBA 1SI5H 1O5AB 5L2ZH 1PPEE 4CHAB 1PQ5A 3KN2A 2ZF0H 1T8NA 1SQAA 4TWWA 2ZTZA 1UVSH 3H7OA 2BY9X 2D2DA 3M3SA 4NIWA 2FLBH 5C2ZA 5HYOA 1P04A 1WTHD 1P10A 4IW4E 2HVXA 2H9TH 3RLYH 4ZKSU 5BRRE 1BMAA 2ZFFH 1ZRBA 2W7SA 2OTVA 3NZIA 1HRTH 2IN2A 4YOIA 3QUMP 3LDXH 2CF9H 2ANMH 1TIOA 2W7UA 4X1RU 1O5FH 1SGIB 1HCGA 3QLPH 2ALPA 1KXEA 1UTPA 3U69H 3ZZ9A 2ANWA 4XBDA 4B75A 4ZXYH 5T3HA 5JPMH 3RU4D 5EQSA 2JH0D 1YPEH 4ZHLU 1P2JA 1CA0C 2O8WA 1DSTA 1Y5AT 3VEQB 4M7GA 3LH1A 1HBTH 1AU8A 4KTCA 1YPHC
chains in the Genus database with same CATH superfamily
2Z3DA 1COWD 1BTZA 1TPOA 1O3JA 1AB9C 3HATH 1CA0B 3HPTB 1H8IH 4LOYH 2ZGCA 1EB1H 3HKIB 2XYAA 3JZ2B 2Y7ZA 3KEEA 4WJG2 1AB9B 1SGRE 4RSPA 1GJBB 3OE7D 4RT0A 1QRXA 1QB6A 3NK8A 5IDKA 1LHFH 1UVPA 4DJZB 1MBQA 1BJVA 1YLDA 3SOSA 1NO9H 2EI7A 3ZVAA 1FQ3A 1Z6JH 1OS8A 2ZTXA 2BD8A 1T4UH 1C2GA 2BYAX 4MTBA 1L0ZA 1QL7A 4WY3A 3IWMA 2ZA5A 1HIAA 2ODPA 3B23B 1WV7H 4E7NA 3UR9A 1DY8A 5GDSH 4R0IA 2G8TA 2NU3E 3FZDA 1ANEA 4BTUB 3M7UA 2J98B 2A5KA 2CMYA 1T32A 3V7TA 3TITA 2BDHA 2NU1E 4HZHA 2WZQA 3RXTA 2C3SA 2OLGA 3ZVGA 1ZSKA 1FIWA 2GMTC 3M35A 4WH6A 2ZNKH 3P8FA 3GY6A 2OBQA 2GMTB 1GI6A 3EA8A 1EOJA 2BDYA 1UTLM 4B1TA 1YF4A 3A87A 3EYDA 3ZZBA 4NSVA 3LJOA 1C5LH 1O2GH 4D9RA 1ZHMA 1K2I1 3RC4A 2ZFRH 2WPIS 1IQJA 3UIRA 1ZR0A 4GAWA 1SR5C 3UY9A 1L2EA 1ZMLA 1SLVB 5EPYA 2TGDA 4AFUA 1Y3YA 2G55A 3L3TA 1OP8A 1CGHA 3PTNA 4INLA 4D8NA 1GJCB 1W11U 5KGOA 1SHHB 1HV7A 3A88A 4I8HA 1NROH 3BV9B 4DGJA 5EIYA 2WINI 3TVJB 1K1PA 2AIPA 1EUFA 4J1YA 1TABE 2FP7B 2P59A 4RKOB 5H4IB 1NTPA 4AORA 4BAQB 4K1SA 1ESAA 2ZDNA 3AASA 1O2NA 1UJ1A 1XXFA 2AMQA 2ZPRA 4UFDH 3NPSA 1D3PB 7KMEH 2R3UA 1O3DA 1XXDA 2OQUA 2FESH 4CBOA 1D9IA 4Q2KA 1TWXB 3OEED 1ZRKA 3MHWU 3ODDA 5DP4A 1SLXB 1T8OA 3ZYEA 4D9QA 1UK2A 1QY6A 4Y0YE 1TGBA 3PMAB 4BTIB 5LH8A 2SGAA 2ZHEH 1BBRE 1SGTA 2KZ4A 1GMDF 1EATA 2FS8A 4UDWH 2AIQA 1S82A 5FX5A 1P02A 1DWCH 2A45B 2ZGBH 1P0SH 4AYYB 1C5MD 2GCHF 1CT0E 3SYJA 1SGPE 2ZU5A 2GP9B 1F0TA 4YLQH 1DICA 1BTYA 3V3MA 1K28D 2WSSD 1WSSH 2C93B 2PUQH 3SU0A 3O8RA 1H8DH 4DOQA 5C0TA 1TALA 3P92A 5T6DA 3ZYDA 3KHVA 1QQUA 1DOJA 5L6NH 2FYRA 4OGXA 5DP5A 3RM2H 8LPRA 1O2LA 3RMMH 1FONA 2F9NA 1QJ7B 1OYQA 2PLXA 5CHAC 3FP8E 7ESTE 2Y5HA 4X0WU 3S7KB 1QZ8A 1IHSH 2FS9A 3GCTF 3T27A 1GJ5H 1MKXH 5CHAB 4BXWA 2K0QA 1GBHA 3RXJA 1GBJA 1QL9A 3C1KA 3U28C 3TJOA 2HPPH 1ACBE 1IAUA 4X8UH 4O3UA 5FAHA 1XM1A 1QIXB 2WUCA 1QNJA 1KXAA 2QA9E 1GMHF 1Z8RA 3FOAA 3W1EA 4WF8A 5EG4A 3O8CA 1TOCB 1GJ8B 3BF6H 5ESBA 1MU8B 1MMJN 2BD9A 4KELA 1WBGB 1GL1A 3SU4A 1AFQC 4O9VA 1KXBA 4AFQA 4Z6AH 1O3IA 4A6LA 3B9FH 5AFYH 4NFEA 2G5VA 1BZXE 3RXKA 1AFQB 3O8BA 1RTLA 2KR7A 3UAIC 4FUFA 3RXRA 1TNIA 2CGAA 3GOVB 3UUZA 2XBYA 3SZNA 3DSPA 1UO6A 1SKYE 2XBWA 1HYLA 4Y8ZA 1QQ4A 1A3BH 1EJMA 4IGDA 3BIVH 2VVUA 2O8TA 1YPGH 5FBIA 2Y81A 1AE8H 1OOKB 2SGFE 4NZLA 1Q2WA 2BLVA 4YT7H 1C1WH 4NG9H 3N99A 2EA3A 2XBXA 1OWJA 1QL8A 3PV2A 1CE5A 2Z3CA 3SNAA 3FAOA 3MH5A 3ATMA 2G00A 2XCNA 3MU0A 3VB7A 3U1IB 3PTBA 1O2UA 4GHTA 1WTGH 1BMLA 4IC5A 3LOXA 2P3UB 2PSXA 1N6YA 2K1QA 1Z8IB 3SU1A 5ETXA 1AZZA 3W95A 3LGWA 1CHOG 1D6RA 2BD2A 3ZVDA 2PP6A 1QR3E 4WH8A 4K8YA 2TGAA 3SJ8A 1OPHB 2SGPE 3LGTA 1KLIH 3SQEE 1C5TA 3K2UA 2ZU2A 3EDXB 3V0XA 1O2SA 1TYNA 1TX6A 2TRMA 1GI8B 2ZDVH 2TGPZ 4FUDA 3WWBA 1ZLRA 1NRPH 3SV6A 3KQCA 4LXBH 1UVTH 1QFKH 4K8BA 4M9FA 1A5IA 4H42U 4JYVH 5GXPA 4NZQA 3RU4E 5EQQA 3SBKA 1IQHA 1SL3A 2EC9H 2HPQH 2JIZD 1JXPA 1CA8B 3E8LA 3PMJA 3SZEA 3P8GA 1C2IA 3OAAD 5AHGH 2VVCA 3TLOA 3TNSA 1EKBB 3ZVEA 2WPKS 1B5GH 1PPHE 1ELEE 1ORFA 2STAE 4HTCH 3FZZA 4Y79A 2ANYA 3RXVA 2W3IA 2PTCE 5AVDA 1EAUA 4OS5A 4XE4A 5F6MA 1KIGH 1V2PT 1OWKA 3RXOA 3E3TA 5JBCS 3MH4A 1GBMA 1FPCH 3MWIU 3LT3A 2EY4C 4MNVA 1ANBA 1P06A 3SJOA 1RXPA 1C5VA 2ILNA 1GBIA 3BG8A 3MH6A 1GMDG 4I8JA 2BY5X 3P17H 5L2YH 4E7RG 2ZP0H 3Q77A 2Q6GA 4AFZA 1NRQH 3K9XB 1P3EA 5FPSA 5TJXA 4K5ZA 4GUXA 2RA0A 2WYJA 1HPGA 4D7GA 4ZCNA 3KYFA 4H6TA 3AVZA 4AX9H 2P94A 1GI2A 1Y5UT 1FXYA 1BRCE 4I8GA 3NRLA 1NFXA 3EA9A 1MQ5A 1T8MA 2FI5E 1O2VA 2XXLA 4F49A 2GZ9A 1PPCE 7GCHF 4YZUA 1EOLA 1XVOA 2FYQA 1KTSB 3FP7E 3P8NA 5J4QA 1SGQE 3BEIB 1YPKH 1Y5BT 1HUTH 3SGAE 2FDAA 1PPFE 1SFIA 5FCRA 1FN6A 5F8XA 4AN7A 1GHZA 3FANA 1Z6EA 1E36B 2VINA 4SGBE 1DVAH 1IQIA 1O30A 1GBAA 1TGNA 1SQTA 2QY0B 1LVOA 2XWAA 4WVPE 2ZG0H 4JYUH 1MKXK 1W13U 3DFJA 5CE1A 3SUFA 1O3AA 8GCHF 1AKSB 1AUTC 4R8TB 1TMTH 1C1SA 3R3GB 2RA3A 4ZHAA 2UUKB 2O8LA 1SGDE 2FMJA 1BIOA 4FUEA 2G51A 1DLEA 3RXSA 3QGJA 2C8XB 1OWIA 3PLKA 3DSGA 2SNVA 2OK5A 1UTOA 1TRYA 3PLPA 1V2TT 3RU4T 1YY3A 1G30B 2W6JD 3KQ5A 1C2JA 4IN1A 1AGJA 1JRSA 6ESTA 1ETSH 3GDVA 2DE9A 4QT8C 3M7TA 1P8VC 3DFLA 3ZZ6A 3RC5A 4XFQA 5FPTA 2CK3D 1ZPCA 3KGPA 4LK4A 3RXUA 4NIXA 5LPRA 2BY7X 2Q6DA 2G5NA 3MTYA 4GVUA 1YWUA 4K3JA 3UFAA 4DY7B 2BD3A 1AVWA 5DP8A 4B71A 5JBAS 3M7QA 1EASA 3E1XB 1YLCA 2A7JA 2DE8A 1JWTA 1ZPZA 3UWJH 1ZTJA 3RM0H 3QN7A 1AIXH 2BDIA 3DD2H 2FTMA 1GMCF 4OS4A 3ZZ3A 2GV7A 2FX4A 1OX1A 1TGTA 1W0KD 1TLDA 4B74A 2XTTB 1A3EH 1GVKB 3OU0A 3ATWA 2OCVB 5HIZA 4AFSA 1AO5A 2BB4A 3NWUA 1O34A 5LPFA 5C17A 1O5GH 2GX4A 1SOTA 5DJ7A 4I32A 1DITH 4ZMAH 1H4WA 1A61H 1FY8E 5A09A 1GJ7B 4UE7H 1GJ9B 1O36A 1GGDC 1UTJA 2TIOA 1THPB 1DS2E 1HJAC 2VH6A 4XOJA 5JDUB 1O2ZA 1WCZA 4BXSA 2Y5GA 4Y6DA 1O3EA 2R0LA 1HJAB 1PQAA 1BITA 1VCPA 3BSQA 3SJKA 2ZDLA 1K1JA 1Z71A 3F3BA 1LVYA 1SPJA 1O2IA 1OKXA 4AB8A 5DSFA 5C1YA 1FIZA 5GNDA 2KX4A 1GVZA 4GCHF 2ZPSA 3TJNA 1DUAA 1HJ9A 2L6OA 4RI0A 2HNTF 1F92A 2BY8X 3HK6B 5GCHG 2HRVA 3MU1A 5T6GA 1L1NA 3UPEA 1C2DA 3DA9B 4CRFA 1QB1A 1QA0A 2ZC9H 3I78A 1A0HB 1BBRH 1O3BA 3RXLA 4ABDA 2QF3A 3SI4H 4X1PU 4AB9A 2ODYB 1O3GA 1TRNA 2QYIA 1VR1H 2BDAA 3SV7A 2W26A 1HJ8A 1TBZH 5DO4H 1KSNA 1BMFD 4HFPB 4OS2A 1AZ8A 2FM2A 2BD7A 9ESTA 1O3LA 3QZRA 5E2OA 3SNEA 4FXGH 3SUEA 1XUJA 1O3CA 2GV6A 2H2ZA 1F7ZA 4Y11E 6GCHF 1FDPA 1KXFA 2FLRH 5FXLA 5TCCA 2IJD1 3TK5A 1FJSA 4Z1MD 3ZVBA 3A8CA 3LIWA 2P8OC 3MO9A 3PWCA 1FN8A 3KQDA 2O8MA 4CR9A 2F9PA 4X6OA 1ARBA 4B2AA 1BA8B 2K8IA 1B7XB 1K21H 2P8OB 1DWBH 1OWEA 1P01A 3M5NA 2QGRA 4Y7AA 3T2NA 5EODA 1P57B 3ESTA 4IMQA 4Q4LA 2GD4B 4DIHH 4Y71A 4X1NU 8GCHG 1E1QD 5A8YA 1C2EA 1V2RT 1L1GA 1LQDB 2OC8A 1S85A 1SGNE 4I7YH 3F6UH 2PUXB 5TCAA 2BD5A 2G52A 3DT0H 1MTUA 3TK9A 1YCPM 3RXPA 3GY7A 2BZ6H 2J94A 2J92A 2ZDMA 1MU6B 5AFZH 4UFGH 3ZZ8A 1NZQH 3NKKA 1W3CA 2FPZA 3ZVCA 2A5AA 4XD7D 4TSFD 2BY6X 5F03A 2VWOA 1OXGA 3AAUA 3SORA 5L30H 2AHME 2GGVB 1NESE 2BLOA 3F9HA 1EB2A 3VB5A 1BJUA 1O2WA 2BX3A 2P93A 5EXNA 1GCDA 1WAYB 2ZGXH 1GHXH 1BHXF 2VBCA 3MI4A 1G3BA 1CT2E 3LGVA 2ZKSA 1GL0E 3KQEA 1P11E 1TFXA 4Q7YA 3BTKE 2G4UA 3T62A 1K0HA 2Y6TA 1YBWA 1DWEH 2VIQA 1B0EA 2FODA 1IHTH 3ATIA 1Y3WA 4ACBA 3OY6U 2A4OA 1YP9A 3F2GA 1ELTA 2ZECA 1NRNH 2D26C 3LGIA 5DG6A 1CQQA 2QV1A 1UTQA 4BANB 1UHBA 1AVGH 1QCPA 2W6ID 3GY8A 1UTMA 1UW7A 4CREA 1G3EA 3KQBA 4YOJA 1VITH 3TH4H 4ISNA 2AEIH 1DT2A 1F0RA 4X2XA 3F2HA 2ZDKA 1QBNA 2UWPA 3A7ZA 1ZZZA 1QTFA 3SN8A 9LPRA 1CVWH 5HM9A 3UQOA 3ZV9A 4BTTB 2H9HA 1ID5H 4YTAA 3GDSA 1ETTH 2Q1JA 1GPZA 1O37A 2CF8H 1J16A 1TPAE 3MFJA 2Z94A 3A83A 3DUXH 1HIAB 4BAKB 4ABJA 1JOUB 2A5IA 2GJGA 1LHGH 3ZZCA 1W2KH 2AGEX 1O35A 8KME2 3MNSA 3PB1E 2G81E 1K1NA 3RLWH 3CS7A 2ZWLH 2V3MA 3QZQA 1BMNH 2CV3A 4I86A 1YYY1 5F8TA 2FWWA 4MLFB 2F3CE 1C1PA 1C5WB 4MVNA 5CMXH 4CR5A 1MZAA 4IN2A 2ZO3H 1YCPH 3PROA 4NWKA 1AMHA 2BDGA 4E06H 4NA8A 2VH0A 5JYIA 1T4VH 1GI5A 1T7CA 3E0PB 3ZZ5A 3T26A 1O33A 2BX4A 3I29A 1P3CA 1XUIA 1M9UA 4X8SH 1YPLH 1FV9A 1NRSH 1IQGA 2GKVE 3OTJE 1P2KA 3RP2A 1HDTH 1G36A 3STIA 1EP5A 2LELA 2P16A 1YPHE 4ZH8A 2B5TB 1GVLA 1HAHH 4FVDA 4ZKRU 1C1MA 1VCQA 3ZZ7A 4IBLH 2Z9LA 1G9IE 1BBRK 2ALVA 1NU9A 4Y8YA 1SBWA 1SOZA 5CHBA 3E0NB 1F5LA 4F55A 2M5TA 3KIDU 1SHYA 4ZUHA 1O3PB 1A46H 2IPQX 1J8AA 3RXGA 1J14A 4WMEA 1V3XA 3N7EA 1GBDA 4P00A 1UCYE 1YC0A 2J34A 1FPHH 1MBMA 4MNWA 4XSKU 5E8EH 1TONA 4WXIA 5B6OA 2DUCA 2WPDD 5JBBS 2XCFA 3GCHB 1GBKA 4DIIH 1TX7A 3VFEA 3GYMA 2STBE 1PYTC 1CBWC 2ASUB 1O31A 1V2NT 1GI4A 1Z1IA 2ANKH 1KYNA 5J4SA 1CBWB 1O32A 1NN6A 1GBBA 4HGCA 1A0JA 1O5CB 1O2HA 2UWLA 1ZGVA 1IQFA 3M37A 1TA2A 3QX5H 4GPGA 5ESTE 1S6LA 2UUYA 4X6MA 5HMAA 1TPSA 1C1UH 4ZROA 5JB8S 1LPZB 4NIYA 1EAIA 2Y7XA 2V3HH 1E1RD 5HKKD 2UUFB 4OGYA 4ABHA 1MCTA 3LPRA 4IC6A 1OHHD 3M5MA 2M2AA 2A7CA 3UNQA 4NWLA 3ZIAD 2QN5T 4A7IB 2BZAA 4HG6A 4OM9A 4X8VH 3MNBA 4WXVA 3VXFH 2QXIA 3AW0A 1LCYA 1P9SA 1V2WT 4U2WA 1EJNA 2NU4E 1RJXB 4WMFA 3U98H 1AFEH 2BQWB 1HAZB 1O2OA 3K6YA 3AW1A 2Q6FA 1BQYA 1QBOA 3SU2A 2RDEA 5JB9S 1V2ST 1HGTH 4A92A 1EPTA 4MPWA 1C5RA 1C9TA 2V3OH 4X1QU 3BIUH 1BB0B 5A8XA 1DM4B 1GG6C 4XDEA 1IQEA 3SU5A 4CBNA 1DUEA 1O2YA 4FUJA 3MO6A 3AAVA 2BOKA 4FUCA 3SI3H 3OSYA 2J2UA 1TMUH 1GG6B 1C1NA 4YESB 3RUOA 1E0FD 2VJ1A 3A85A 1YPJH 4Y76A 1W10U 1GI9B 1V2LT 3MH7A 4B6FA 5E0JA 5EXMA 2HLDD 2VIOA 1O3KA 3EE7A 3RXFA 1SGEE 1C5OH 1UTNA 1V6DA 4MG3A 2WYGA 4ISOA 3LONA 3OY5U 2GDEH 3EGKH 1W0ZU 2WHXA 2OD3B 1W0JD 3EE0B 1DLKB 1A0LA 1DPOA 1O2TA 3RXCA 1N1LA 1GJ6A 1QJ6B 4TPIZ 5CDFE 3VB3A 2EI8A 3BN9A 5SGAE 1G32B 3PV4A 1AVXA 3UOPA 1PPGE 2JDID 1AHTH 2FI3E 1XUKA 2AERH 2FOFA 1KLJH 1ELVA 2F91A 5LGOA 2HLCA 2GTBA 1CGIE 1JIMA 3A8DA 2ZU4A 2AGIX 2QAAA 2AMPA 4FUBA 4VGCB 4NA7A 2JH5D 2FO9A 2QF0A 1ZMNA 2XC0A 2BVSH 3UREA 4UONA 1BOQA 4DURA 1AD8H 2FZZA 3RXBA 4NIVA 4B2CA 4KGAA 2PV9B 2HVYB 2IPHA 3LU9B 2AMDA 3K65B 1YCPK 2Z9IA 1F5RA 2JH6D 1Y3XA 1VITF 1HLTH 1YPMH 1QA7A 2C4FH 2VIDA 4U32A 1ESTA 2WUBA 2V6NA 5DKMA 3LGUA 1NBMD 4DT4A 1L4DA 1WYKA 1MCVA 3ODFA 4KP0A 3SV9A 2LNCA 1UK3A 2GCHG 1HAPH 2SGDE 4I8KA 2AS9A 1GJAB 3RXEA 2BDBA 3WW7A 1AY6H 1UTKA 1BTPA 1O5EH 2YMSD 1GHWH 1K1LA 1AWHB 3U8OH 3GY3A 1K9OE 4MPUA 1FY3A 4DCDA 1C9PA 1SQOA 1YGCH 4O3TA 2RFKC 2D1JA 3A8AA 1LPKB 3M5LA 2HNTC 2G4TA 6CHAC 1L4ZA 4FUIA 2ZCLP 5KEDA 1RTKA 5FL7D 5DP3A 1IQNA 3A7WA 3LC5A 1LHDH 3GCTG 4AG2A 5DP9A 6CHAB 2QXGA 1WQVH 4FETA 1G2MA 1NFYA 5C3NA 7LPRA 3ITIA 3E91A 1ZYOA 2ZHQH 2FOAA 2BXTH 4BAOB 3F2FA 2JJ2D 4Y10E 3BEFB 5A2MH 1ZPBA 2F9BH 4KKDA 2P95A 2LPRA 3H5CB 4JZ1A 1GMHG 3BTME 4Y8XA 2EQNA 4LZ4B 3WWFA 1A1RA 3ZZAA 4GLYA 2A32A 1JRTA 2A4QA 4UFEH 5EU8A 2VIVA 5DN6D 1NFWA 2VWNA 4ABBA 2VWLA 2YNAA 1MD8A 1WXRA 5JBTA 2BD4A 3DHKH 1D6WA 4GSOA 4TYDA 5EJZA 1PFXC 2BXUH 1MTNC 4BNRA 3QTOH 2ZIQH 1O2RA 2GT8A 4AZ2B 4ABGA 1P09A 5A0BA 1TPPA 2C90B 2LP6A 1C5XB 1MTNB 1MH0A 5C5OA 1LHCH 5GJ4B 1NY22 1Y3VA 4JK5A 3MQKC 1UK4A 1A5GH 2PKSC 2Z9KA 1HNEE 3W94A 1KLTA 2PKSB 2BM2A 2QE7D 4UFFH 2Z6BD 2ZFSA 1O2MA 2FEQH 1SLUB 2OC7A 2PKAA 2WV5A 3S9CA 5E2PA 5EJLA 2TPIZ 5T6FA 3F1SB 1P2IA 2Z9JA 1SGCA 3FKSD 2EI6A 1J9CH 1SGFA 3RXMA 2RDLA 4OS1A 1V2JT 1RS0A 3SO3A 4X1SU 1TOMH 1AQ7A 2Z3EA 1ZOMA 3OX7U 2THFB 4FVBA 1THRH 1D3QB 2A4GA 1PQ8A 3ATKA 3A81A 1P2MA 4E05H 2EEKA 1LTOA 1ELBA 2PWXA 2ZHFH 1WQSA 3ZZDA 1ETRH 1EZSC 2CHAC 3SJIA 1LVMA 1A4WH 3Q3YA 1NRRH 2AYWA 1C5PA 1S5SA 2XRCA 1K1IA 3T28A 1KXDA 3NXPA 2CHAB 4YLUA 3SU3A 3KCGH 1LVBA 1N8OC 3RMOH 2B0FA 2VNTA 2BLWA 1X7AC 4J2YB 1N8OB 4JZDH 1MTSA 1IQMA 3D62A 1RFNA 4X6PA 1AE5A 2A2QH 4CRCA 5E0GA 3GISB 2ZTYA 1SSXA 2PFEA 3A8BA 2F83A 1ANDA 3SV8A 1F0UA 5C67A 3QO6A 2OC1A 1OP2A 1KXCA 3ZZ4A 2FOEA 1XKBC 1MZDA 1GBLA 2B7DH 2Y5FA 1SG8B 4KTSA 4B73A 3LC3A 3JZ1B 3KF2A 3GICB 3SHCH 2ULLA 1ABJH 3T29A 1LDTT 4UD9H 3RXIA 1W0YH 2BHGA 4NA9H 2Z7FE 1V2VT 1LKAA 1OWHA 1A7SA 4YXWD 1UCYH 1YLNA 3HK3B 3WY8A 1KMHB 3UTUH 4TY7A 5EW2H 1FX0B 1O5DH 4A1TA 1MKWH 1P05A 3G01A 7GCHG 5FCKA 3MO3A 3UR6A 1C1QA 3B8JA 1SB1H 2F9OA 1W7XH 2YOLA 3Q3KA 2R0KA 5PTPA 3P8OA 3P95A 2ZCHP 3FN8A 5DK1A 1C5SA 2AFQB 2J38A 1O2XA 2A4RA 1Y8TA 2OC0A 2NWNA 5C5NA 1P03A 3ZV8A 1GHBF 5C20A 2PGQB 1PPBH 1DY9A 3PWBA 2QF5A 2C8WB 3S9BA 3PLBA 1Y3UA 2GDDA 1C5ZB 4X2WA 3VB4A 5IK2D 1SFQB 2A31A 2CXVA 1ESBA 1B0FA 1S83A 1HAIH 2QXJA 3SUDA 1PQ7A 1QRWA 1G3CA 3S69A 4ZHMU 1RIWC 4FUHA 1LKBA 2R9PA 1EFRD 1NC6A 1O38A 5BPEA 1ZSJA 1RTFB 1OSSA 1PYTD 1RIWB 2ZDAH 1BCUH 4JZFH 1W12U 1EP6A 1NPMA 2ZU1A 4O97A 4WWYA 3KYGA 1TMBH 1LHEH 1INCA 2GCTC 5EPNA 1H9HE 2HOBA 2KAIA 1DWDH 1EX3A 2I6QA 3URCA 3UB0A 1EQ9A 4X2VA 1VCWA 2GCTB 5EGMA 1GI7B 3A86A 1K22H 1GBFA 1CHGA 1P12E 3TU7H 2J98A 1TX8A 3BTDE 1EJAA 2ZFPH 1V2QT 2J95A 4TWYA 3K6ZA 1ZGIA 1QGFA 2L74A 3H09A 2PGBB 1EZXC 3OYPA 1ZHRA 1O3FA 3ATLA 2CJIA 1NBME 4CRDA 1LO6A 1GI0A 6LPRA 1GI1A 1XKAC 1O5BB 1XVMA 1EZUC 2QF4A 1MABB 1NT1A 2ZCKP 1D3TB 1GMCG 2XNIA 2Z9GA 3A80A 1E79D 2C8ZB 1WU1A 3LJJA 1ZMJA 3F9EA 1C2FA 5HXFA 2WPHS 4ASUD 5EQRA 4DT7B 5FHTA 5E0HA 1DANH 1XMNB 2V0BA 2XC5A 1ELCA 1WDIA 2KAIB 3RDZA 3T25A 3BTWE 3TPIZ 1Q3XA 1GI3A 1GDNA 4FUGA 2H6MA 1W7GH 1P2QA 1JMOH 4D7FA 1S0QA 3CENA 5AF9H 1GDQA 3BTGE 2VWMA 3M36A 1FY5A 1VGCC 1FAKH 3U8TH 1Z8GA 2R2MB 1HFDA 1ELAA 1VGCB 2FTLE 1C1VH 2W5EA 1ABIH 1NS3A 5T1VA 1TBRH 1ELDE 1QBVH 2FI4E 4YO9A 3D49H 4NGAH 1V2MT 1TNLA 1FLEE 2A1DB 1LMWB 3N7OA 1MQ6A 1NM6A 1SVPA 4ASHA 4GCHG 1UHBB 1EAWA 3E90B 3M3TA 4WMDA 5I25A 3T5FH 1CHOF 1BTUA 1TNKA 3N7DA 1KY9A 3Q3XA 1C5YB 2KCOA 1O39A 1Z1JA 2VIWA 3OTPA 2A0QB 3F68H 1MUEB 3O8DA 1GHVH 1GHAF 3UQVA 2VB0A 3S7HB 1ZTLA 1T31A 2XC4A 4TY6A 1H1BA 3ZVFA 1DSUA 2IOTA 4MQAA 1QURH 1Q31A 3V12A 5EXLA 5K0HA 3TJVA 3A7VA 1J15A 2NU2E 1E38B 5GWZA 1OP0A 1GBCA 1HAVA 3U9AH 2GZ7A 3CP7A 1EZQA 3HGPA 1C2LA 6GCHG 2IJOB 5A0CA 1CSOE 4KTUA 1SGYE 1VKYA 1CO7E 4JZIA 4Q63A 5G4BA 3EQ0H 2V35A 1YKTA 1FI8A 1UCYK 3GCHC 4HI3A 1QRZA 3UNSA 4F48B 1PJPA 1GHBG 1K1MA 1O3OA 1MKWK 3MU4A 1C2HA 1C4V2 4ESTE 1V2UT 1MTVA 1G37A 4ZKNU 3E16B 2QIQA 2KFWA 1QB9A 3HKJB 3FFGA 1XX9A 2A7HA 3BEUA 3MU8A 3A7XA 3TH2H 4ABFA 1O3NA 2XOKD 2FOHA 2QCYA 4TT3D 2XWBI 3PRDA 1HAVB 1AN1E 1ZJKA 1P2OA 1TQ7B 1S0RA 1O2JA 2KCPA 3DCLA 2I6SA 1TNJA 1S81A 1W14U 1GWAA 1D3DB 1IQKA 1W8BH 2GT7A 1O2QA 2ZHWH 2A2XH 2F9UA 2VVVA 2FIRH 2O9QA 4INKA 4AGKA 2OP9A 1UMAH 3PV5A 1THSH 2OXSA 1AI8H 4ISIH 1HAYB 1CU1A 2SNWA 1DDJA 1K1OA 3R0FA 1O3HA 3VB6A 1MD7A 2VIPA 2HWLB 3HGNA 1BUIA 4JMYA 4OS6A 2ODQA 2BTCE 2H9EH 1A2CH 1TNGA 2F4LA 3A82A 4AC9A 3MMGA 3UWIA 1BTHH 5EJ1A 3IITA 1GJ4H 5HM2A 4TPYA 1VZQH 1SGFG 3F0PA 3P70B 1FMGA 1FUJA 2GZ8A 1G2LA 5F53A 1QJ1B 3FVFB 1E34B 2R3YA 5GIBA 1SC8U 3SNBA 3SGQE 1BRUP 2RG3A 3F9FA 2FXRA 4INHA 4X8TH 2F43B 1JIRA 4ABAA 3MNXA 3VG8A 8ESTE 3OEHD 4I33A 3RMNH 3BG4C 1C5NH 1XUGA 5F8ZA 1WUNH 3GY4A 2R2WU 1BT7A 2WPLS 3TNTA 4Q7XA 1BTWA 3GCOA 3BG4B 5HGGA 2TBSA 1AWFH 4SGAE 2PSYA 3IG6B 2BVRH 5FBEA 5ABWA 1GCTC 2WPJS 4K69A 1BRAA 3BTFE 4ZAEA 1TE0A 3QK1A 2W3KA 4AG1A 1FY1A 3GY2A 1GCTB 1C5QA 4H4FA 1E35B 3H7TA 4Y7BA 1GHYH 1EPTC 3DSOA 3TH3H 1HAGE 4CRGA 1H8HD 2ZPQA 2ESTE 1EPTB 1FY4A 4IS5A 1PPZA 2WV4A 4VGCC 5LPEA 3TGKE 1BMMH 4BAHB 4B6EA 3QTVH 3RXAA 2WV9A 3S9AA 1MAYA 1DE7H 2ZI2H 1GHAG 1TAWA 2ZGHA 1NU7B 4RKJB 4MPXA 4DVAU 3M3VA 1QHRB 4THNH 1S6HA 2ZQ1A 3GYLB 2YNBA 1XUHA 1ZHPA 4Q80A 3Q00A 2XW9A 1EAXA 1C2MA 2PW8H 2PR3A 3BTQE 5C94A 4XBBA 3A84A 3VXEH 1NFUA 4LZ1H 2B8OH 1O2KA 1N6XA 1RRKA 2RCEA 1U6QA 5FPYA 3TK6A 1Z8JB 2Y80A 3U8RH 5KECA 1BRBE 2JJ1D 3ENSB 4MPVA 1V2OT 3STJA 2HGTH 2BVXH 3URDA 5DGJA 5A0AE 1C1OA 2ZHDA 2ZZUH 2GVFA 3RXDA 1FZZA 2Y82A 2XNDD 4ZKOU 2J4IA 4JCNA 1F5KU 2ZGJA 3MNCA 1IQLA 5GCHF 3Q76A 3GY5A 4Z0KA 2FX6A 5EW1H 2NU0E 3QGNB 1AUJA 3GCNA 1DX5M 4A1VA 1G3DA 3MU5A 3SNCA 4U01A 3RXQA 2KCAA 2PTNA 3QDZB 3EA7A 1DXWA 2O8UA 4ABIA 2SGEE 3A7TA 4MDSA 2WPMS 4AGJA 1RGQA 1AKSA 1TA6A 1UVUH 4X6NA 1GDUA 1JBUH 3C27B 2J5UA 3RC6A 1LQEA 3GDUA 1TBQH 1C1TA 1CGJE 3BTTE 1ANCA 2P3TB 3RXHA 1V2KT 1A5HA 1IOEA 3TIUA 3BTEE 3LGYA 3QWCH 4BOHA 1T8LA 4P02A 1CT4E 3MYWA 4XBCA 4AYVB 2QXHA 3V13A 1MAXA 1TNHA 3M5OA 1GBTA 1EXFA 2AGGX 5I46H 3LH3A 1S84A 3LKWA 5GPIB 3F0OA 4RN6A 1D4PB 3SGBE 1SLWB 4B2BA 1TGSZ 4ISLA 2CN0H 4AOQA 3SU6A 4Q7ZA 2F9VA 2VU8E 1ZJDA 5IYTA 3VGCC 3OFND 1HXEH 2H1UA 2OQ5A 4YOGA 3KNXA 4H6SB 2B9LA 2BQ6B 3SHAH 2UUJB 3VGCB 1C4U2 1ARCA 4FU9A 2HALA 2OUAA 1OYTH 2JKHA 2V7QD 1C5UA 1ZTKA 4A1XA 5B6LA 1HAXB 3PMHB 4X2YA 1H9LB 4D76A 1Y59T 1H8ED 2H5DA 3ELAH 3EAJA 1O3MA 3TGJE 1KTTB 3SQHE 5DP6A 1SMFE 3FP6E 1DXPA 3PO1C 1TB6H 3BTHE 2BMGB 1BTXA 3MOCA 5EOKA 4I8LA 4B76A 1FNIA 4CH2B 1KDQA 3F9GA 3PO1B 1DFPA 1F2SE 3M61U 3PRBA 1F0SA 4K60A 1XUFA 4JYTA 5DPAA 4U30A 4K1EA 1VJ9U 4FU7A 1E37B 4OS7A 3UNRA 4CH8B 1C1RA 1Z7KA 4MNYA 3A89A 1H9IE 1TQ0B 4F4OC 1C4Y2 1OWDA 3UOUA 1S6FA 2BLQA 4O03A 2FOBA 1BHXB 4Y0ZE 4RT1A 2FOMB 3TJUA 2PKAB 3CS0A 2BDCA 3L6PA 2AH4X 2D8WA 3D23A 2HNTE 1L1JA 3SJ9A 2J97A 1O2PA 3FO8D 2H5CA 3L33A 3U1JB 2KCYA 2OBOA 3PMBB 3VPKA 4ABEA 2PHBA 2FOGA 3P6ZB 2QC2A 5A8ZA 1P2NA 1GBEA 1UVOA 4K2YA 4A5TS 1HXFH 1MTWA 1HAOH 1ELFA 1KDQB 4DW2U 2SFAA 2SGQE 3S0NA 4FOUC 4PROA 2ZFQH 2P3FH 2ZQ2A 4JZEH 4K1TA 2C8YB 4UEHH 1VITG 4ZXXH 3PM3A 4YT6H 2FOCA 1ELGA 2ZEBA 3SW2B 4NSYA 1HB0B 1YM0A 1GGDB 2TGTA 4IMZA 4XRNA 4JK6A 3KL6A 3A7YA 3RMLH 5FX6A 3SV2H 4BAMB 4GHQA 2OINA 4CRAA 1LPGB 3I77A 4ISHH 3NUMA 3D65E 1O0DH 1GJDB 2JETC 3AK5A 1TRMA 3CNRA 3TGIE 4NFFA 2YMSC 4NCYA 4FU8A 2ZFTA 1BDAA 2BOHB 4YM9A 5K7RA 2JETB 1P9UA 5C1XA 1WOFA 3E6PH 1FAXA 3SUGA 2VGCC 1TGCA 2YMSB 1VJAU 1J17T 5C1UA 4I31A 2J9NA 3PYHA 2UWOA 1C2KA 2ZU3A 2BQ7B 4DG4A 1RD3B 2VGCB 2XBVA 4CHAC 4MNXA 3SNDA 3NCLA 1ZSLA 5DP7A 4CRBA 1SI5H 1O5AB 2KM0A 5L2ZH 1PPEE 4CHAB 1PQ5A 3KN2A 2ZF0H 1T8NA 1SQAA 4TWWA 2ZTZA 1UVSH 3H7OA 2BY9X 2D2DA 3M3SA 4NIWA 2FLBH 5C2ZA 5HYOA 1P04A 1WTHD 1P10A 4IW4E 2HVXA 2H9TH 3RLYH 4ZKSU 5BRRE 1BMAA 2ZFFH 1ZRBA 2W7SA 2OTVA 3NZIA 1HRTH 2IN2A 4YOIA 5C0UA 3QUMP 5HIYA 3LDXH 2CF9H 2ANMH 1TIOA 2W7UA 1SQRA 4X1RU 1O5FH 1SGIB 1HCGA 3QLPH 2ALPA 1KXEA 1UTPA 3U69H 3ZZ9A 2ANWA 4XBDA 4B75A 4ZXYH 5T3HA 5JPMH 3RU4D 5EQSA 2JH0D 1YPEH 4ZHLU 1P2JA 1CA0C 2O8WA 4ACAA 1DSTA 1Y5AT 3VEQB 4M7GA 3LH1A 1HBTH 1AU8A 4KTCA 1YPHC 3GS9A
chains in the Genus database with same CATH topology
2Z3DA 1TPOA 1BTZA 1O3JA 1AB9C 3HATH 1CA0B 3HPTB 1H8IH 4LOYH 2ZGCA 1EB1H 3HKIB 2XYAA 3JZ2B 2Y7ZA 3KEEA 4WJG2 1AB9B 1SGRE 4RSPA 1GJBB 1QRXA 1QB6A 3NK8A 5IDKA 1LHFH 1UVPA 4DJZB 1MBQA 1BJVA 1YLDA 3SOSA 1NO9H 2EI7A 3ZVAA 1FQ3A 1Z6JH 1OS8A 2ZTXA 2BD8A 1T4UH 1C2GA 2BYAX 4MTBA 1L0ZA 1QL7A 4WY3A 3IWMA 2ZA5A 1HIAA 2ODPA 3B23B 1WV7H 4E7NA 3UR9A 1DY8A 5GDSH 4R0IA 2G8TA 2NU3E 3FZDA 1ANEA 4BTUB 3M7UA 2A5KA 2CMYA 1T32A 3V7TA 3TITA 2BDHA 2NU1E 4HZHA 3RXTA 2C3SA 2OLGA 3ZVGA 1ZSKA 1FIWA 2GMTC 3M35A 4WH6A 2ZNKH 3P8FA 3GY6A 2OBQA 2GMTB 1GI6A 3EA8A 1EOJA 2BDYA 1UTLM 4B1TA 1YF4A 3A87A 3EYDA 3ZZBA 4NSVA 3LJOA 1C5LH 1O2GH 4D9RA 1ZHMA 1K2I1 3RC4A 2ZFRH 2WPIS 1IQJA 3UIRA 1ZR0A 4GAWA 1SR5C 3UY9A 1L2EA 1ZMLA 1SLVB 5EPYA 2TGDA 4AFUA 1Y3YA 2G55A 3L3TA 1OP8A 1CGHA 3PTNA 4INLA 4D8NA 1GJCB 1W11U 1SHHB 1HV7A 3A88A 4I8HA 1NROH 3BV9B 4DGJA 2WINI 3TVJB 1K1PA 2AIPA 1EUFA 4J1YA 1TABE 2FP7B 2P59A 4RKOB 5H4IB 1NTPA 4AORA 4BAQB 4K1SA 1ESAA 2ZDNA 3AASA 1O2NA 1UJ1A 1XXFA 2AMQA 2ZPRA 4UFDH 3NPSA 1D3PB 7KMEH 2R3UA 1O3DA 1XXDA 2OQUA 2FESH 4CBOA 1D9IA 4Q2KA 1TWXB 1ZRKA 3MHWU 3ODDA 5DP4A 1SLXB 1T8OA 3ZYEA 4D9QA 1UK2A 1QY6A 4Y0YE 1TGBA 3PMAB 4BTIB 5LH8A 2SGAA 2ZHEH 1BBRE 1SGTA 1GMDF 1EATA 2FS8A 4UDWH 2AIQA 1S82A 5FX5A 1P02A 1DWCH 2A45B 2ZGBH 1P0SH 4AYYB 1C5MD 2GCHF 1CT0E 1SGPE 2ZU5A 2GP9B 1F0TA 4YLQH 1DICA 1BTYA 3V3MA 1K28D 1WSSH 2C93B 2PUQH 3SU0A 3O8RA 1H8DH 4DOQA 1TALA 3P92A 5T6DA 3ZYDA 3KHVA 1QQUA 1DOJA 5L6NH 2FYRA 4OGXA 5DP5A 3RM2H 8LPRA 1O2LA 3RMMH 1FONA 2F9NA 1QJ7B 1OYQA 2PLXA 5CHAC 3FP8E 7ESTE 2Y5HA 4X0WU 3S7KB 1IHSH 2FS9A 3GCTF 3T27A 1GJ5H 1MKXH 5CHAB 4BXWA 1GBHA 3RXJA 1GBJA 1QL9A 3C1KA 3TJOA 2HPPH 1ACBE 1IAUA 4X8UH 4O3UA 5FAHA 1XM1A 1QIXB 2WUCA 1QNJA 1KXAA 2QA9E 1GMHF 1Z8RA 4WF8A 5EG4A 3O8CA 1TOCB 1GJ8B 3BF6H 5ESBA 1MU8B 1MMJN 2BD9A 4KELA 1WBGB 1GL1A 3SU4A 1AFQC 4O9VA 1KXBA 4AFQA 4Z6AH 1O3IA 4A6LA 3B9FH 5AFYH 4NFEA 2G5VA 1BZXE 3RXKA 1AFQB 3O8BA 1RTLA 4FUFA 3RXRA 1TNIA 2CGAA 3GOVB 3UUZA 2XBYA 3SZNA 1UO6A 4Y8ZA 2XBWA 1HYLA 1QQ4A 1A3BH 1EJMA 4IGDA 3BIVH 2VVUA 2O8TA 1YPGH 5FBIA 2Y81A 1AE8H 1OOKB 2SGFE 4NZLA 1Q2WA 2BLVA 4YT7H 1C1WH 4NG9H 2EA3A 2XBXA 1OWJA 1QL8A 3SNAA 1CE5A 2Z3CA 3FAOA 3MH5A 3ATMA 2G00A 2XCNA 3MU0A 3VB7A 3U1IB 3PTBA 1O2UA 4GHTA 1WTGH 1BMLA 4IC5A 3LOXA 2P3UB 2PSXA 1N6YA 2K1QA 1Z8IB 3SU1A 5ETXA 1AZZA 3W95A 3LGWA 1CHOG 1D6RA 2BD2A 3ZVDA 1QR3E 4WH8A 4K8YA 2TGAA 3SJ8A 1OPHB 2SGPE 3LGTA 1KLIH 3SQEE 1C5TA 3K2UA 2ZU2A 3EDXB 3V0XA 1O2SA 1TYNA 1TX6A 2TRMA 1GI8B 2ZDVH 2TGPZ 4FUDA 1ZLRA 1NRPH 3SV6A 3KQCA 4LXBH 1UVTH 1QFKH 4K8BA 1A5IA 4H42U 4JYVH 5GXPA 4NZQA 3RU4E 5EQQA 3SBKA 1IQHA 1SL3A 2EC9H 2HPQH 1JXPA 1CA8B 3E8LA 3PMJA 3TLOA 3P8GA 1C2IA 3TNSA 5AHGH 2VVCA 1EKBB 3ZVEA 2WPKS 1B5GH 1PPHE 1ELEE 1ORFA 2STAE 4HTCH 3FZZA 4Y79A 2ANYA 3RXVA 2W3IA 2PTCE 5AVDA 1EAUA 4OS5A 4XE4A 5F6MA 1KIGH 1V2PT 1OWKA 3RXOA 3E3TA 5JBCS 3MH4A 1GBMA 1FPCH 3MWIU 3LT3A 4MNVA 1ANBA 1P06A 3SJOA 1RXPA 1C5VA 2ILNA 1GBIA 3BG8A 3MH6A 1GMDG 4I8JA 2BY5X 3P17H 5L2YH 4E7RG 2ZP0H 3Q77A 2Q6GA 4AFZA 1NRQH 3K9XB 1P3EA 5FPSA 5TJXA 4K5ZA 4GUXA 2RA0A 2WYJA 1HPGA 4D7GA 4H6TA 3AVZA 4AX9H 2P94A 1GI2A 1Y5UT 1FXYA 1BRCE 4I8GA 1NFXA 3EA9A 1MQ5A 1T8MA 2FI5E 1O2VA 2XXLA 4F49A 2GZ9A 1PPCE 7GCHF 4YZUA 1EOLA 1XVOA 2FYQA 1KTSB 3FP7E 3P8NA 5J4QA 1SGQE 3BEIB 1YPKH 1Y5BT 1HUTH 3SGAE 2FDAA 1PPFE 1SFIA 5FCRA 1FN6A 5F8XA 4AN7A 1GHZA 3FANA 1Z6EA 1E36B 2VINA 4SGBE 1DVAH 1IQIA 1O30A 1GBAA 1TGNA 1SQTA 2QY0B 1LVOA 2XWAA 4WVPE 2ZG0H 4JYUH 1MKXK 1W13U 3DFJA 5CE1A 3SUFA 1O3AA 8GCHF 1AKSB 1AUTC 4R8TB 1TMTH 1C1SA 3R3GB 2RA3A 4ZHAA 2UUKB 2O8LA 1SGDE 2FMJA 1BIOA 4FUEA 2G51A 1DLEA 3RXSA 3QGJA 2C8XB 1OWIA 3PLKA 2SNVA 1UTOA 1TRYA 3PLPA 1V2TT 3RU4T 1G30B 1C2JA 4IN1A 1AGJA 1JRSA 6ESTA 1ETSH 3GDVA 2DE9A 4QT8C 3M7TA 1P8VC 3DFLA 3ZZ6A 3RC5A 4XFQA 5FPTA 1ZPCA 3KGPA 4LK4A 3RXUA 4NIXA 5LPRA 2BY7X 2Q6DA 2G5NA 3MTYA 4GVUA 4K3JA 3UFAA 4DY7B 2BD3A 1AVWA 5DP8A 4B71A 5JBAS 3M7QA 1EASA 3E1XB 1YLCA 2A7JA 2DE8A 1JWTA 1ZPZA 3UWJH 1ZTJA 3RM0H 3QN7A 1AIXH 2BDIA 3DD2H 2FTMA 1GMCF 4OS4A 3ZZ3A 2GV7A 2FX4A 1OX1A 1TGTA 1TLDA 4B74A 2XTTB 1A3EH 1GVKB 3OU0A 3ATWA 2OCVB 4AFSA 1AO5A 2BB4A 3NWUA 1O34A 5LPFA 1O5GH 2GX4A 1SOTA 5DJ7A 4I32A 1DITH 4ZMAH 1H4WA 1A61H 1FY8E 5A09A 1GJ7B 4UE7H 1GJ9B 1O36A 1GGDC 1UTJA 2TIOA 1THPB 1DS2E 1HJAC 2VH6A 4XOJA 5JDUB 1O2ZA 1WCZA 4BXSA 2Y5GA 4Y6DA 1O3EA 2R0LA 1HJAB 1PQAA 1BITA 1VCPA 3BSQA 3SJKA 2ZDLA 1K1JA 1Z71A 1LVYA 1SPJA 1O2IA 1OKXA 4AB8A 5C1YA 1FIZA 1GVZA 4GCHF 2ZPSA 3TJNA 1DUAA 1HJ9A 2HNTF 1F92A 2BY8X 3HK6B 5GCHG 2HRVA 3MU1A 5T6GA 1L1NA 3UPEA 1C2DA 3DA9B 4CRFA 1QB1A 1QA0A 2ZC9H 3I78A 1A0HB 1BBRH 1O3BA 3RXLA 4ABDA 2QF3A 3SI4H 4X1PU 4AB9A 2ODYB 1O3GA 1TRNA 2QYIA 1VR1H 2BDAA 3SV7A 2W26A 1HJ8A 1TBZH 5DO4H 1KSNA 4HFPB 4OS2A 1AZ8A 2FM2A 2BD7A 9ESTA 1O3LA 3QZRA 5E2OA 3SNEA 4FXGH 3SUEA 1XUJA 1O3CA 2GV6A 2H2ZA 1F7ZA 4Y11E 6GCHF 1FDPA 1KXFA 2FLRH 5FXLA 5TCCA 3TK5A 1FJSA 3ZVBA 3A8CA 3LIWA 2P8OC 3MO9A 3PWCA 1FN8A 3KQDA 2O8MA 4CR9A 2F9PA 4X6OA 1ARBA 4B2AA 1BA8B 1B7XB 1K21H 2P8OB 1DWBH 1OWEA 1P01A 3M5NA 2QGRA 4Y7AA 3T2NA 5EODA 1P57B 3ESTA 4IMQA 2GD4B 4DIHH 4Y71A 4X1NU 8GCHG 5A8YA 1C2EA 1V2RT 1L1GA 1LQDB 2OC8A 1S85A 1SGNE 4I7YH 3F6UH 2PUXB 5TCAA 2BD5A 2G52A 3DT0H 1MTUA 3TK9A 1YCPM 3RXPA 3GY7A 2BZ6H 2J94A 2J92A 2ZDMA 1MU6B 5AFZH 4UFGH 3ZZ8A 1NZQH 3NKKA 1W3CA 2FPZA 3ZVCA 2A5AA 5F03A 2BY6X 2VWOA 1OXGA 3AAUA 3SORA 5L30H 2GGVB 1NESE 2BLOA 3F9HA 1EB2A 3VB5A 1BJUA 1O2WA 2BX3A 2P93A 5EXNA 1GCDA 1WAYB 2ZGXH 1GHXH 1BHXF 3MI4A 1G3BA 1CT2E 3LGVA 2ZKSA 1GL0E 3KQEA 1P11E 1TFXA 4Q7YA 3BTKE 2G4UA 3T62A 2Y6TA 1YBWA 1DWEH 2VIQA 1B0EA 2FODA 1IHTH 3ATIA 1Y3WA 3OY6U 2A4OA 1YP9A 1ELTA 2ZECA 1NRNH 2D26C 3LGIA 5DG6A 1CQQA 2QV1A 1UTQA 4BANB 1UHBA 1AVGH 1QCPA 3GY8A 1UTMA 4CREA 1G3EA 3KQBA 4YOJA 1VITH 3TH4H 4ISNA 2AEIH 1DT2A 1F0RA 4X2XA 2ZDKA 1QBNA 2UWPA 3A7ZA 1ZZZA 1QTFA 3SN8A 9LPRA 1CVWH 5HM9A 3UQOA 3ZV9A 4BTTB 2H9HA 1ID5H 4YTAA 3GDSA 1ETTH 2Q1JA 1GPZA 1O37A 2CF8H 1J16A 1TPAE 3MFJA 2Z94A 3A83A 3DUXH 1HIAB 4BAKB 4ABJA 1JOUB 2A5IA 1LHGH 3ZZCA 1W2KH 2AGEX 1O35A 8KME2 3MNSA 3PB1E 2G81E 1K1NA 3RLWH 3CS7A 2ZWLH 3QZQA 1BMNH 2CV3A 5F8TA 1YYY1 2FWWA 4MLFB 2F3CE 1C1PA 1C5WB 4MVNA 5CMXH 4CR5A 1MZAA 4IN2A 2ZO3H 1YCPH 3PROA 4NWKA 1AMHA 2BDGA 4E06H 4NA8A 2VH0A 5JYIA 1T4VH 1GI5A 1T7CA 3E0PB 3ZZ5A 3T26A 1O33A 2BX4A 3I29A 1P3CA 1XUIA 1M9UA 4X8SH 1YPLH 1FV9A 1NRSH 1IQGA 2GKVE 3OTJE 1P2KA 3RP2A 1HDTH 1G36A 3STIA 1EP5A 2P16A 1YPHE 4ZH8A 2B5TB 1GVLA 1HAHH 4FVDA 4ZKRU 1C1MA 1VCQA 3ZZ7A 4IBLH 2Z9LA 1G9IE 1BBRK 2ALVA 1NU9A 4Y8YA 1SBWA 1SOZA 3E0NB 1F5LA 2M5TA 3KIDU 1SHYA 4ZUHA 1O3PB 1A46H 3RXGA 1J8AA 1J14A 4WMEA 1V3XA 1GBDA 1UCYE 1YC0A 2J34A 1FPHH 1MBMA 4MNWA 4XSKU 5E8EH 1TONA 4WXIA 5B6OA 2DUCA 5JBBS 2XCFA 3GCHB 1GBKA 4DIIH 1TX7A 3VFEA 3GYMA 2STBE 1PYTC 1CBWC 2ASUB 1O31A 1V2NT 1GI4A 1Z1IA 2ANKH 1KYNA 5J4SA 1CBWB 1O32A 1NN6A 1GBBA 4HGCA 1A0JA 1O5CB 1O2HA 2UWLA 1ZGVA 1IQFA 3M37A 1TA2A 3QX5H 4GPGA 5ESTE 2UUYA 4X6MA 5HMAA 1TPSA 1C1UH 4ZROA 5JB8S 1LPZB 4NIYA 1EAIA 2Y7XA 2V3HH 2UUFB 4OGYA 4ABHA 1MCTA 3LPRA 4IC6A 3M5MA 2A7CA 3UNQA 4NWLA 2QN5T 4A7IB 2BZAA 4X8VH 3MNBA 4WXVA 3VXFH 2QXIA 3AW0A 1LCYA 1P9SA 1V2WT 4U2WA 1EJNA 2NU4E 1RJXB 4WMFA 3U98H 1AFEH 2BQWB 1HAZB 1O2OA 3K6YA 3AW1A 2Q6FA 1BQYA 1QBOA 3SU2A 5JB9S 1V2ST 1HGTH 4A92A 1EPTA 4MPWA 1C5RA 1C9TA 2V3OH 4X1QU 3BIUH 1BB0B 5A8XA 1DM4B 1GG6C 4XDEA 1IQEA 3SU5A 4CBNA 1DUEA 1O2YA 4FUJA 3MO6A 3AAVA 2BOKA 4FUCA 3SI3H 3OSYA 2J2UA 1TMUH 1GG6B 1C1NA 4YESB 3RUOA 1E0FD 2VJ1A 3A85A 1YPJH 4Y76A 1W10U 1GI9B 1V2LT 3MH7A 5E0JA 5EXMA 2VIOA 1O3KA 3RXFA 1SGEE 1C5OH 1UTNA 1V6DA 4MG3A 2WYGA 4ISOA 3LONA 3OY5U 2GDEH 3EGKH 1W0ZU 2OD3B 3EE0B 1DLKB 1A0LA 1DPOA 1O2TA 3RXCA 1N1LA 1GJ6A 1QJ6B 4TPIZ 3VB3A 2EI8A 3BN9A 5SGAE 1G32B 3PV4A 1AVXA 3UOPA 1PPGE 1AHTH 2FI3E 1XUKA 2AERH 2FOFA 1KLJH 1ELVA 2F91A 5LGOA 2HLCA 2GTBA 1CGIE 1JIMA 3A8DA 2ZU4A 2AGIX 2QAAA 2AMPA 4FUBA 4VGCB 4NA7A 2JH5D 2FO9A 2QF0A 1ZMNA 2XC0A 2BVSH 3UREA 4UONA 1BOQA