2CMYA

Crystal complex between bovine trypsin and veronica hederifolia trypsin inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Helix-Turn-Helix Protease Inhibitory Motif in a Novel Trypsin Inhibitor from Seeds of Veronica (Veronica Hederifolia L.).
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cmyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cmyA02
2VWMA 1XVMA 1BZXE 1TNHA 4BXSA 1FPCH 5LH8A 4FUHA 2OC8A 2H9EH 4K1EA 4K69A 4ZHMU 4DT7B 2BXUH 3OY6U 2W7UA 1LKBA 4B2BA 1LPGB 1DE7H 1XUJA 3UOPA 1TBZH 1GI9B 1WUNH 1M9UA 1ELTA 2VH6A 1HAXB 2G8TA 1S6FA 4FXGH 3HKIB 1BOQA 1QFKH 1SVPA 2AFQB 1G3EA 1KXDA 1WAYB 4WMEA 3FANA 1F7ZA 3LH3A 3OY5U 1SOZA 3EA7A 2Y80A 2Y82A 1A7SA 4NZQA 2OLGA 1DWBH 1GGDC 2P94A 3PV4A 1C5NH 1E0FD 3LOXA 2OCVB 2F9VA 3MH4A 3HGNA 4KKDA 1Y3WA 1SGRE 2BX3A 3W94A 3BEFB 1W2KH 4I31A 1SLXB 3P8FA 1CE5A 3VB6A 1C5PA 1QJ7B 1P2NA 2FYRA 6LPRA 1W11U 1P2OA 6GCHF 3SUFA 2QAAA 1D6RA 1WBGB 1GDUA 1L1NA 1HIAA 2AMDA 2ZDVH 1O3KA 5F8TA 2C8XB 5DK1A 4CH2B 1OS8A 1O3CA 1GCTC 1Q2WA 1GCTB 1TIOA 1O5GH 4X1NU 3SGAE 3SO3A 6ESTA 3RU4E 2WPJS 2W26A 1O2OA 1CA0C 2A4QA 1OWIA 3RXQA 5C20A 3ATIA 1C2GA 4X6NA 2FYQA 1CU1A 2V3HH 1CQQA 2G4TA 3TNSA 4Y76A 3LONA 4LZ4B 3T5FH 3QN7A 3SV7A 3U8RH 2RCEA 1OXGA 3M5OA 1QTFA 3VB7A 1EOJA 3GCNA 1O3DA 4B75A 3LC3A 2C4FH 4RKOB 3PB1E 3PO1C 1Z8IB 2BY9X 1DWDH 2ZHFH 5GDSH 4JMYA 2XW9A 1P03A 3KQBA 4FUGA 1LHDH 1RTLA 2CHAC 2VB0A 3MH7A 1ARCA 1EZQA 2WPHS 3H5CB 1UCYK 3QX5H 3PTBA 3B8JA 1JXPA 3FFGA 4Y10E 1EAXA 1C2HA 2A5KA 4HGCA 1JRTA 3SGBE 1VJ9U 1SOTA 3MHWU 1XKAC 3TPIZ 1FV9A 3A7TA 1E36B 1O3PB 3KNXA 2FOBA 3CS0A 1YC0A 5GCHF 4ABAA 1SHHB 1MAXA 1Z71A 2D2DA 5L6NH 2PKSC 1BHXB 1YKTA 2ZFRH 1K1PA 3UUZA 1S82A 1O3BA 3D62A 3QZQA 2OC7A 1GVZA 3M35A 2ALPA 1Y5BT 5B6OA 2PHBA 1XXFA 1L1JA 1IQGA 1UTLM 1SC8U 3GY2A 1FY1A 1P0SH 3MI4A 3QTVH 2BLOA 3ZZ7A 2P3TB 2A0QB 2XBXA 4U2WA 3RMOH 5DP8A 5L2YH 2VIPA 4YM9A 1C5OH 2XC0A 1SR5C 4WH8A 1HV7A 1BBRK 3DHKH 3BTME 1C2JA 1G3BA 2FPZA 4Q7ZA 5DP4A 5T6DA 1SFQB 1YYY1 2FS8A 2ANKH 3SJ8A 4TPIZ 3LT3A 2PTNA 3TIUA 1H9IE 3JZ2B 1TA2A 3T25A 8GCHF 4OS6A 4KGAA 1HFDA 1INCA 2SGFE 3IWMA 4DCDA 2ZC9H 3CP7A 1Z8GA 2P95A 2GTBA 2GVFA 1T31A 1G30B 1GMCF 2OBOA 1HGTH 2HPQH 3A80A 1MH0A 5A09A 1TAWA 3LGTA 3M61U 3P95A 3A81A 3MU1A 1NT1A 1DM4B 1P9UA 1W7XH 2G51A 3U1JB 2BY5X 1BHXF 3E91A 3EAJA 2FDAA 4XBDA 2P59A 3A8AA 2A2QH 1PPEE 1IQIA 3CS7A 2RA3A 4CHAB 2ZQ2A 4CRAA 1GG6B 3SW2B 1SG8B 4DVAU 3BTEE 4I8LA 2OQUA 4HZHA 1EPTC 1V2MT 3VPKA 2ZHEH 1F92A 2FOGA 2AERH 3RM0H 3ZV9A 1PQ8A 1ZGVA 3ZZCA 1A5HA 1SPJA 3A8CA 2VVUA 3E8LA 1G37A 3ENSB 1FN6A 2RA0A 4ABHA 1RGQA 2VINA 1GHZA 3S9CA 3F9FA 1LHEH 2Q1JA 2AMQA 2ZU4A 1LVYA 1LHCH 3S69A 1QCPA 1DY8A 3A7YA 1UJ1A 4K3JA 1GHBF 5C5OA 4IN2A 2NU4E 1S5SA 2TGDA 3K9XB 5F03A 3CENA 1P11E 1TX6A 1V2JT 4BTUB 2CF9H 2XWAA 4TY7A 1T8MA 5JB9S 1FY8E 2ALVA 1SBWA 2ZO3H 1DOJA 5EG4A 1FQ3A 1O5FH 3BTQE 3ZZ4A 1NESE 2QYIA 1JWTA 1AUTC 1O3JA 3I78A 1IQNA 2HWLB 3LKWA 2JETC 1N8OC 1W8BH 1OWJA 2XBVA 4HFPB 1BRBE 3SNCA 2EI7A 3LGYA 3P8OA 3NWUA 2Z9JA 2J38A 1OSSA 2ZNKH 1BJUA 2VWLA 3SU6A 2W5EA 2OP9A 2ZFPH 1BRUP 3TNTA 1W0ZU 2TRMA 1TPPA 3PO1B 5HM2A 2FTLE 1DVAH 1DWCH 5GXPA 4BNRA 2R3YA 7LPRA 3S0NA 2Z3EA 2ANMH 3K6YA 1AVWA 3FP6E 1UTNA 1SHYA 1DICA 4J2YB 2BD7A 1O3EA 4GHQA 4TY6A 2BB4A 2QCYA 3E0PB 1A2CH 1SMFE 1C5YB 1B5GH 3GCHC 4GCHG 1BMAA 7KMEH 2Y7XA 3KL6A 1O5DH 3SNDA 1A0HB 3P70B 1BT7A 5CHAC 2Z9KA 4FU9A 3SJKA 1AZ8A 1TNJA 1BTYA 2WPMS 4ABGA 2ZTYA 5AFYH 1UTJA 3KCGH 3E6PH 1ZMJA 1CO7E 2GKVE 3OU0A 1HAPH 1C5WB 5JYIA 4A7IB 4INHA 3LGWA 6CHAC 5FXLA 1A46H 1NO9H 1NRSH 2TGTA 1UTPA 1KLIH 2P3FH 4YLQH 1THPB 2P3UB 1HUTH 5GCHG 1AMHA 4CRBA 2O8MA 2Z94A 1BB0B 5BPEA 3F9GA 2BVRH 4YOJA 1O35A 2PTCE 2BDAA 3RXUA 2ZPRA 1H8DH 1OYQA 1LVOA 1O2LA 4ZKRU 2NWNA 5GJ4B 2PSXA 2BQ7B 4ZAEA 2Z6BD 3BV9B 3UWIA 4THNH 2XWBI 4IMZA 2O9QA 2A4OA 5I25A 1MTSA 2CV3A 5A8ZA 1ESTA 4IC6A 2RG3A 1T7CA 1V2UT 5LPRA 1BDAA 4ZH8A 1JIRA 4JK5A 2JETB 3URDA 4U30A 4X6MA 4HTCH 1LDTT 4AB8A 4DOQA 1VJAU 1O2ZA 4IBLH 4ISNA 2J95A 3RMMH 1FUJA 3UPEA 1OYTH 1GHXH 1P2MA 1EAIA 1K1MA 3QWCH 3QLPH 1SGYE 1EZXC 3MNCA 4X8VH 2QXHA 3ZZBA 2WYGA 4CH8B 1QB6A 1L4DA 1RTKA 2G52A 1U6QA 4X0WU 3EGKH 2ZGCA 5A0BA 4Y0YE 3RMNH 1O2MA 5EW2H 1FJSA 2BXTH 2XBWA 2R2MB 1AZZA 2VIVA 2VWOA 1EATA 1QA7A 3RU4T 1ZR0A 2F9UA 1GI3A 1TBQH 5K0HA 2PFEA 1NN6A 1MD8A 1XXDA 4JZEH 2FIRH 2G4UA 1GI6A 3RXAA 2VVCA 3TGIE 3ATKA 6CHAB 1O2TA 4I8JA 2ZHDA 1C4Y2 2CN0H 1T4VH 3MH6A 4B73A 5JBAS 1H9HE 1ID5H 3HATH 2TBSA 3HK3B 1YF4A 4K8BA 3V7TA 1LQDB 4FUCA 2BY8X 1O31A 1THSH 2WINI 4RSPA 4VGCB 2QF3A 1MTNB 2P8OB 1CHOF 1O2QA 1BMMH 1F0RA 4K60A 1C1TA 4AFZA 4MTBA 2GCHF 2HALA 1DSTA 1O37A 4Y6DA 2HGTH 1IQFA 3EA9A 1ZRBA 3U8TH 1VITF 1AY6H 1A5IA 1TALA 1K1NA 1GHBG 1KIGH 2XNIA 5HGGA 2FM2A 2Z9IA 4ASHA 3BIUH 4FVDA 1WQSA 1ZMLA 4BANB 3UY9A 2VIWA 1MBQA 1E37B 1HAVB 2ZFTA 4MNYA 3VB5A 5F6MA 1P01A 1ABIH 1WQVH 1W7GH 2Y6TA 4NFFA 1CGHA 5EPNA 1BTWA 1MKXH 1DSUA 5FPTA 1V2LT 3ZYEA 2BVSH 1N8OB 3P8NA 5DJ7A 5BRRE 1AB9C 1ZPZA 1IQHA 1TE0A 2D8WA 2VWNA 2UWOA 1XUGA 3RXJA 1TX7A 1GHAF 1O2JA 3LPRA 2IPHA 1ORFA 5FX6A 4FU7A 3UWJH 1G2LA 4BOHA 1LVBA 1TONA 1TGCA 3PYHA 2BMGB 3R0FA 5G4BA 3Q3YA 2KAIA 3FVFB 1LHGH 2ZU1A 5T6FA 2BHGA 3GYLB 1KXFA 4Y11E 1THRH 1K1JA 1UTOA 1YPLH 4OGXA 1F5KU 3Q3XA 5JBCS 2AIQA 2BZAA 4X8UH 5JBTA 3RXMA 4RKJB 1ETTH 4WF8A 2O8TA 5A0AE 1K21H 1KYNA 4ISIH 2H5DA 3E3TA 1ZPBA 1Y3YA 1EPTB 3VEQB 3BN9A 1V2TT 1EAWA 5ETXA 4GCHF 3AW0A 2J34A 3A84A 1DDJA 2WYJA 3MU4A 3TK6A 1PJPA 2PKSB 2C93B 2ZGHA 3P92A 2BX4A 2H9HA 3S9AA 1NFXA 1H9LB 2HOBA 1L4ZA 1Z6JH 1W12U 4OS2A 1XUIA 5EQRA 1MKWH 2QV1A 4JZDH 3MOCA 3RXPA 1O2WA 4GSOA 1HAOH 1QB1A 2ZP0H 2BOHB 2ODPA 2Z9GA 2A5AA 1V2PT 1TNLA 1QIXB 5EQSA 2ILNA 1J16A 1KY9A 2FZZA 1A1RA 1Y3UA 2WPIS 3FAOA 4B2CA 5AF9H 2Q6FA 1EPTA 2ZIQH 2J92A 5E2OA 4AFUA 1KXCA 2B9LA 1VITH 3LDXH 3PWCA 2HPPH 1VZQH 1V2VT 1AUJA 1E35B 2FLBH 3ZZAA 4MDSA 3TJVA 5TCCA 3SJIA 2AGEX 2P16A 2XBYA 1QHRB 1C1OA 4XBBA 4ISLA 1PPHE 2UUJB 2BD9A 4MG3A 1QY6A 1AFEH 4UEHH 3LIWA 1P57B 4LXBH 1PQ7A 1QJ6B 1O38A 1HDTH 2TGPZ 4B76A 3TH3H 1FPHH 1DS2E 4INKA 4K5ZA 1Z8JB 5GPIB 1C5LH 2UUYA 2HNTF 4I7YH 3A89A 1NFWA 5EU8A 3TJNA 1C2LA 1S85A 3A7XA 1GBIA 2D1JA 1O2PA 1SQTA 1AVXA 1O5AB 1ZTLA 2VGCB 5DP7A 4Y8XA 3SJOA 5HXFA 1EASA 1QL9A 1CT2E 1MCVA 1J15A 2GZ7A 2XRCA 1O2RA 1A3BH 3Q76A 1YLCA 2O8WA 3SBKA 1DUAA 2J94A 5FCKA 2BDGA 3NCLA 3PMHB 4DURA 3ZZ8A 4GVUA 4IGDA 1C4V2 1YCPM 4WJG2 1FNIA 4XE4A 2IOTA 3UOUA 3PMJA 3N7OA 4MNXA 4YT6H 5EPYA 4ISHH 1MKXK 3MNXA 2F91A 1HAIH 1SSXA 2ASUB 3Q00A 3RXTA 2VH0A 1GI7B 1DT2A 3T28A 1ZHMA 2CMYA 3QK1A 4DY7B 1C9TA 5AVDA 2ZU3A 1HAHH 1YPHE 4CR9A 1G32B 2NU3E 1BBRH 1XUFA 1N6XA 1MD7A 2HLCA 1C2FA 1NFUA 3E16B 4OS5A 1J9CH 2UUFB 3PROA 4Y7BA 1S83A 1TPSA 2UWPA 1J17T 1UK4A 2GCHG 1BQYA 3RXDA 1EP5A 4DGJA 1F5RA 2WPLS 2W7SA 3RXBA 1ZOMA 1BMNH 3TH4H 1SB1H 3M7QA 1XM1A 3RXEA 3P8GA 2Y5HA 4GHTA 3D49H 3A88A 4KTUA 5C1UA 1TWXB 4Y8YA 1HJ8A 2R0LA 1P09A 1UVSH 2SFAA 1A0JA 1TRYA 1EJNA 2GT7A 1Z7KA 4I33A 1SGNE 3TU7H 2PUQH 4AYVB 1FIWA 2R0KA 4A1VA 2O8UA 2JH0D 3STIA 3LGIA 3M5LA 1V2KT 1OWKA 3W95A 4INLA 3MU8A 4YLUA 4WXVA 1T8OA 3AW1A 4Q7YA 4GAWA 1AFQB 1IQKA 5C1XA 1TGSZ 4JK6A 1AE5A 4A92A 3KIDU 4R0IA 1A3EH 1QL8A 1EP6A 2AGIX 4MNVA 1KXBA 4OGYA 3NXPA 1BJVA 2Z3DA 1HAZB 1NRNH 1PQ5A 2J2UA 1AVGH 1Q3XA 1ARBA 1YPJH 3VXEH 3C1KA 3PWBA 4I8KA 2ZQ1A 1P2JA 1YPMH 1GBDA 3A7WA 2V0BA 1UCYE 4DW2U 2GCTB 1O3FA 2A1DB 5J4QA 4KTCA 1MU6B 4AG1A 1BIOA 3PMAB 4Z0KA 1GJDB 1F0TA 2UUKB 3GCTF 3ATWA 1K9OE 1YPEH 3SUGA 3S7KB 1V6DA 1FMGA 2BOKA 4AX9H 3UIRA 1G3DA 3UNSA 3BTTE 1AGJA 1TQ7B 3ZZ6A 4B2AA 1FLEE 1B0EA 2A31A 1Y5AT 4NWLA 2Y7ZA 3BTGE 1D4PB 1S6HA 1BUIA 3U98H 5EGMA 1DANH 4R8TB 1HAGE 1O2IA 2QN5T 1TMTH 1X7AC 5FPYA 3TVJB 1SFIA 1S81A 1RIWC 4JCNA 4KP0A 5EXLA 1V2OT 1IOEA 3DFLA 4NIVA 1O3LA 1GBTA 3MYWA 2YOLA 3KQEA 1C2KA 1ZJDA 1AKSA 1BTXA 2IN2A 3F9HA 2CXVA 1QNJA 1ZYOA 2GZ9A 4J1YA 1EZUC 4ZROA 1OX1A 3RXVA 5LPFA 4WH6A 1FY5A 1OKXA 2FS9A 1ACBE 2A2XH 4ZUHA 3VFEA 2RDLA 1YGCH 1BTHH 1FI8A 1DLEA 3A86A 1EB1H 1AWFH 2K1QA 1VCWA 2ZFQH 1V3XA 1MUEB 4LK4A 3RXKA 1KXAA 2F3CE 2H6MA 3PM3A 1XUHA 1QJ1B 1EQ9A 4UDWH 1GI0A 1ABJH 3HGPA 1ELBA 4BAMB 4WY3A 4WMDA 1ESBA 1MBMA 1DXWA 1GMHG 2GP9B 1O2SA 1HBTH 5EXNA 4D76A 1AB9B 1NRQH 3MTYA 3QO6A 3M5NA 2EEKA 4K2YA 3MH5A 4CRDA 2BVXH 3EQ0H 2C8ZB 1SLVB 4ABFA 5TCAA 2FOFA 4AFQA 1SQOA 1WCZA 1GI5A 2R9PA 3TITA 2BQ6B 1J14A 3NK8A 3QGJA 1TNKA 5HMAA 3BF6H 3KN2A 5DO4H 1Y8TA 1SGQE 2PLXA 5DGJA 1SGFA 1Z8RA 2ZDAH 2HNTC 2PGBB 1IAUA 3ODFA 1O3GA 1Z6EA 1GWAA 1GI1A 2BDCA 3K2UA 1T8NA 3GY7A 4DG4A 2EI6A 3MWIU 1SGDE 1KDQB 3M7TA 1VGCB 1KXEA 2ZZUH 4ZKNU 3HK6B 3AASA 1SGPE 2BDYA 1Z1JA 1IQJA 1O3NA 1ELFA 2C8WB 3BG4B 1GBAA 2XYAA 5IYTA 1B0FA 3UREA 4H42U 1E38B 1MMJN 1K22H 3LJOA 4U01A 3RC4A 4FUIA 1MZAA 4K1SA 2AIPA 3UR6A 1ZSLA 5T3HA 1Y59T 4VGCC 1BTPA 4X6PA 1BMLA 4NA9H 3OTJE 2QXIA 2ZCHP 4I8HA 3MO3A 1GHWH 1KDQA 3GCOA 1CHGA 3BEIB 3V13A 2G81E 5A8YA 1CBWB 3IITA 2PSYA 3SNEA 1XKBC 4X1RU 3LC5A 1DUEA 2HVXA 4Y8ZA 1C5QA 2CGAA 1GBJA 1F0SA 4K1TA 3GDVA 4YOGA 5FCRA 1S0QA 5AHGH 1GHYH 2XCFA 2ZEBA 3I77A 2P93A 3ZYDA 1GHVH 1SGCA 3BG8A 1PQAA 4LOYH 3JZ1B 1P2IA 1EOLA 3A83A 1UVTH 3TK5A 4UFEH 2BDHA 3AAUA 3MO9A 4X2YA 3AVZA 1GL0E 1P8VC 2OBQA 2H1UA 2BLWA 3QZRA 1YCPH 3BTKE 1BRAA 1ETRH 1C5TA 2SGDE 3A82A 3SHAH 5HM9A 5DP5A 1ZGIA 4YT7H 1XX9A 1HJAC 1TGTA 3FP7E 1EAUA 3SV8A 3S9BA 4E05H 3ZV8A 3M36A 2V3OH 1QQUA 1HCGA 3QGNB 3S7HB 1D3DB 1MQ5A 3OX7U 3R3GB 5FHTA 4ZXYH 3O8CA 3GY6A 3M7UA 1GHAG 3KF2A 1GJ4H 1H4WA 3T29A 4X1QU 5PTPA 1K2I1 1O0DH 2G55A 1VCPA 2BLVA 4HI3A 2NU0E 1EX3A 1RXPA 2ZGBH 3BEUA 4GLYA 2PKAB 1T8LA 4UONA 1D3QB 2J4IA 2ZU5A 2B0FA 4D7FA 3RXCA 5K7RA 4KELA 3TLOA 3BTDE 1K1LA 3EE0B 2ZGXH 4MPWA 1SQAA 1P05A 1GDQA 1UTMA 2BD8A 3MU5A 3FZDA 3OSYA 5GWZA 2F9NA 1MKWK 3ZVBA 1BCUH 2ANWA 1O34A 1AI8H 1LPKB 1N1LA 2PWXA 2ZTXA 1FN8A 1E34B 1GBFA 3STJA 1AD8H 1WYKA 2Z3CA 4UD9H 1O3AA 2QGRA 3T27A 4RN6A 2A7CA 4CRCA 2NU1E 1NROH 3O8DA 2PKAA 1P2QA 3I29A 1W13U 4I8GA 3E90B 3A87A 1G2MA 4MLFB 1A0LA 1HNEE 3LGVA 1ZJKA 1YBWA 3GY8A 1O3IA 2PV9B 3GY3A 5HYOA 3VGCB 2B8OH 3U69H 3DFJA 3ESTA 2BY6X 1AU8A 1NFYA 1WTGH 3FP8E 3GDSA 2ZF0H 5F8XA 4BAQB 4JZFH 1W3CA 1G36A 3NPSA 1GBKA 2ZDKA 3A8BA 3L33A 2AEIH 4A1TA 1CA8B 1IHTH 4XFQA 4E7NA 1O32A 2Y81A 3LJJA 1GBCA 1A61H 3SV2H 7ESTE 1HJ9A 1D3TB 1SI5H 5SGAE 4NCYA 2STAE 5EW1H 2SNVA 2WUCA 2VVVA 5JDUB 3SZNA 1PYTD 3B9FH 5LPEA 1F2SE 3SJ9A 1C4U2 3URCA 1GI4A 3PMBB 1LPZB 2ZPQA 2OQ5A 4NZLA 2ZECA 1DITH 4CBOA 5JB8S 5I46H 1Y3VA 3SV9A 1TBRH 3B23B 4H6TA 4ABBA 5CHAB 3Q3KA 1QBNA 4E7RG 1EZSC 2TPIZ 4JYTA 2BDBA 1SGIB 5A0CA 1TNIA 4MNWA 3A7VA 1L2EA 1O3OA 3A8DA 2ZA5A 1LMWB 4NA7A 1EXFA 1O5CB 3RDZA 1O30A 2Y5FA 1DXPA 1ELDE 4TWWA 3EYDA 5DG6A 1C5RA 5T6GA 4ABJA 4I32A 5DPAA 4UFDH 4F4OC 1MAYA 3PLBA 2AS9A 1ZMNA 4MPUA 1D3PB 1OWEA 2FX4A 1P3EA 1XUKA 3SUEA 1JOUB 2CJIA 2FO9A 1GBLA 3RLWH 4JYVH 2GX4A 4X1PU 3SU3A 1TYNA 1IHSH 1RRKA 1KLTA 1QR3E 1B7XB 2BTCE 2FODA 1NRPH 2R2WU 3SN8A 4A5TS 2YNAA 1RS0A 5FAHA 1HXFH 5DKMA 3KQCA 1KLJH 5E0HA 2G5NA 2A5IA 2JH6D 1YPKH 4JZIA 1UHBB 2A4GA 1PPCE 1SLUB 5IDKA 2FMJA 1FAKH 1UVUH 4NWKA 1EKBB 1O3HA 4NSYA 3T62A 1WSSH 4ZKOU 1AHTH 1W14U 1TRMA 1GBEA 2EA3A 1Z1IA 2BQWB 3VGCC 3ZZ5A 4Y79A 2FWWA 3Q77A 4NIXA 2TGAA 3KGPA 2ZG0H 3ZVAA 4IW4E 1QL7A 1O3MA 1O33A 1NM6A 2O8LA 5E0GA 1L0ZA 3QTOH 1DY9A 1ZTKA 1AWHB 2NU2E 2WUBA 3P17H 5AFZH 2FEQH 3GY5A 2VIDA 3MO6A 2IJOB 3GYMA 1QRZA 3SU1A 4F49A 1J8AA 3SI3H 1HXEH 1TPOA 1GI2A 1TABE 4MPVA 1AQ7A 1OWDA 2TIOA 2ZKSA 3T26A 4AG2A 1HYLA 1QBOA 2GT8A 2ZI2H 1D6WA 1W10U 3RM2H 2PR3A 4BAOB 3ZZ3A 1MCTA 4IMQA 1PYTC 1V2ST 4O97A 1GJ7B 1C5MD 4FUBA 4LZ1H 2SGPE 4D9RA 1TFXA 2AYWA 4ZKSU 2ZCLP 2JH5D 1MQ6A 1RTFB 1FONA 2YNBA 4DJZB 4FUDA 3UQOA 3SQHE 1P04A 4MPXA 1O2GH 4M7GA 3D23A 1TGNA 1C1WH 5CE1A 2JKHA 4IN1A 2WV4A 4AB9A 1C5ZB 2THFB 2ULLA 3ITIA 5C2ZA 3RMLH 1GGDB 1LKAA 2FESH 1BBRE 3BSQA 5L30H 1ETSH 1IQLA 2KAIB 4O9VA 2C3SA 2C90B 2XC5A 2QY0B 3EDXB 2OC1A 4NIWA 3M5MA 2HRVA 4X8TH 3UNRA 1C5SA 2OINA 3LGUA 1GVLA 1UK3A 3SU2A 3DUXH 2V6NA 3PLKA 4X8SH 1P9SA 1TNGA 1UTQA 1VR1H 4BAHB 1NY22 2R3UA 1P06A 1ZLRA 3F9EA 3K65B 1N6YA 4PROA 1IQMA 1AO5A 1SGTA 2VIQA 1MZDA 2DE8A 1DWEH 1QURH 2BYAX 2GDDA 1V2QT 4AOQA 1MTWA 4X2XA 5CMXH 1CGJE 1H1BA 1NPMA 1O2KA 1YP9A 1ZSKA 4NIYA 3DA9B 1CGIE 2ZDMA 1RFNA 3M3TA 1EUFA 1DPOA 1OOKB 2OXSA 4XDEA 1O2HA 2Z7FE 2A4RA 1GI8B 3BIVH 2LNCA 3RXFA 5C5NA 3O8RA 1ZPCA 2CHAB 2FI4E 1QQ4A 4WXIA 1QA0A 1O36A 1GJAB 3RUOA 4XOJA 1ELGA 1C1VH 2PW8H 3HKJB 5DP6A 1VCQA 3DT0H 4Q7XA 3TGJE 3GCHB 2FOAA 3SNBA 2A7HA 4Q80A 3UNQA 3SOSA 8LPRA 2F9OA 2SGAA 1VGCC 4BAKB 3BG4C 2F9BH 2FP7B 3RXHA 1HPGA 4Y0ZE 2GV6A 4NFEA 1A5GH 1ZTJA 1CSOE 5H4IB 1JMOH 2D26C 1GDNA 1MTNC 1NC6A 1PPBH 1AKSB 3MU0A 2GDEH 1C2EA 3K6ZA 4AGKA 5A2MH 2J9NA 1TPAE 1ANEA 3NZIA 4TPYA 1QGFA 2BZ6H 4CRGA 5C1YA 4XBCA 1EB2A 1UHBA 2GMTC 2W3IA 2OC0A 2OTVA 3E0NB 1CBWC 2FOEA 1T32A 2Q6DA 3EA8A 2GMTB 3D65E 1CHOG 1YPGH 3WY8A 1QB9A 1LCYA 1GJBB 1UO6A 4Q2KA 4QT8C 3T2NA 1ELAA 2UWLA 1PPZA 2FOMB 4H6SB 2AGGX 3PLPA 1ANDA 3A7ZA 5GIBA 2EC9H 3FZZA 2FOCA 3MNBA 1GMHF 2CF8H 2FTMA 8GCHG 1Y5UT 5JPMH 1ZSJA 3RU4D 1F5LA 2H9TH 4A6LA 3MMGA 1DLKB 5E8EH 1Q31A 2WPKS 4X2VA 4ZHAA 4X2WA 4D8NA 5FBIA 1H8IH 8ESTE 1K28D 1PPFE 1HLTH 1GMCG 4JZ1A 1C1RA 1OP0A 3L3TA 1ELCA 1C9PA 1RD3B 3QUMP 1TMBH 2ZDLA 4OS1A 4OS4A 4FUFA 3AAVA 1C1UH 2AMPA 3IG6B 3RC5A 4ESTE 3SI4H 3F6UH 2FX6A 1HJAB 1TOMH 5J4SA 2GCTC 1GBMA 1O5EH 2STBE 2BLQA 5ESTE 2GD4B 2ODQA 2GV7A 1GBBA 1FY4A 1BITA 1UMAH 3ATMA 2FOHA 1TLDA 2ZGJA 3VXFH 4BTIB 4FUEA 1C1PA 1C5UA 4B71A 1BTZA 9LPRA 4ZXXH 1GJ8B 1HIAB 1C2IA 1FXYA 1XVOA 3ZZDA 4CHAC 4NA8A 3BTWE 1O2NA 3LU9B 1O39A 4FVBA 2I6QA 1WOFA 1MU8B 2XXLA 1KSNA 1PPGE 4ISOA 1CVWH 5DP9A 3M37A 3BTHE 4WWYA 1D9IA 1C1NA 3U8OH 3NKKA 3TJOA 2FLRH 4X6OA 2H2ZA 1C1QA 2HNTE 4XSKU 2AH4X 2B5TB 2WV5A 2F9PA 4YZUA 1HB0B 1VITG 1S0RA 2ZHWH 4GPGA 5EOKA 2BY7X 4FU8A 2V35A 5TJXA 1UTKA 4KTSA 3ZVFA 1W0YH 3TH2H 2BD5A 4MQAA 5EXMA 4MVNA 1GJ5H 2Q6GA 1OP2A 4SGAE 4BXWA 1TGBA 2A7JA 4ABDA 5FPSA 2ESTE 1AIXH 2QIQA 1L1GA 5EQQA 4NG9H 4FUJA 3SU0A 3RLYH 5C3NA 3MFJA 3GICB 1ZZZA 1O2YA 4AFSA 1KTTB 3KHVA 2Y5GA 2FI3E 1QRWA 1UK2A 1JIMA 2PUXB 2SGQE 3L6PA 1IQEA 1C1MA 3SU4A 1FZZA 3RXSA 1CT4E 2VJ1A 4UFFH 7GCHF 3QDZB 2QXJA 4IS5A 1V2WT 3SHCH 1F0UA 1ZHRA 1GMDG 3U9AH 4AORA 4AN7A 1NZQH 5F8ZA 1ANBA 1O5BB 2FI5E 4OS7A 4UE7H 1PFXC 1AE8H 3SNAA 3MNSA 3VB4A 1O2UA 2ZTZA 4YOIA 9ESTA 1ANCA 1UVOA 1G3CA 3NUMA 1ELEE 1LO6A 3ELAH 3SUDA 2QC2A 3UTUH 4AGJA 1NRRH 1P3CA 3RXGA 1GG6C 1HAYB 1HAVA 3ZVGA 5C67A 3V12A 4X1SU 1ESAA 4Z6AH 3RXOA 3ODDA 4DIIH 2QXGA 4ABIA 1EJMA 3RC6A 3KQDA 4O3TA 4YESB 1QRXA 1ZRKA 2ZFFH 1LHFH 3H7OA 1LVMA 2BD4A 2VU8E 1RIWB 5ABWA 3RXRA 3RXIA 2P8OC 4A1XA 3A85A 1O2XA 2OD3B 4IC5A 3GY4A 4K8YA 5EODA 1GJCB 3TJUA 3P6ZB 1BRCE 2ZDNA 3GDUA 3SU5A 1UVPA 2A45B 1K1OA 1TMUH 1OWHA 4DIHH 1C2MA 1EJAA 1C5XB 4YTAA 2OUAA 1GJ9B 4JYUH 3PTNA 1KTSB 1JBUH 1ZHPA 4O3UA 1YLDA 3ZZ9A 1C5VA 1BTUA 3TGKE 1NS3A 4WVPE 2XC4A 4ZMAH 3DD2H 1AN1E 1GJ6A 4TYDA 2BDIA 1WTHD 1NTPA 2ODYB 2EI8A 3RP2A 3G01A 2W3KA 2Z9LA 3V0XA 1YPHC 1WU1A 2G5VA 1GVKB 1LQEA 5A8XA 5L2ZH 2PGQB 3ATLA 2BM2A 3M3VA 1RJXB 1MTUA 2DUCA 3TK9A 4NSVA 2XCNA 3SV6A 5FBEA 2G00A 8KME2 4ZHLU 4D9QA 3UFAA 1FIZA 4CR5A 2VGCC 1JRSA 7GCHG 1V2NT 2SNWA 5E2PA 1C1SA 2GZ8A 3GISB 1TB6H 3ZVDA 1NU9A 4UFGH 2M5TA 3SQEE 1P02A 1TX8A 3F68H 3HPTB 5E0JA 1YM0A 1FDPA 4TWYA 3H7TA 2FXRA 3UR9A 3M3SA 1TA6A 2F83A 2ZWLH 4AYYB 5JBBS 5ESBA 3GOVB 3GCTG 2H5CA 2VNTA 3LH1A 1SLWB 1OPHB 1Y3XA 1DFPA 2BD3A 4ABEA 1GPZA 1QBVH 4CRFA 3KEEA 4U32A 2QA9E 1O2VA 3U1IB 4Y7AA 1SGFG 6GCHG 2ZU2A 1FY3A 1S84A 4H4FA 2XTTB 1YCPK 2ZPSA 1P10A 4BTTB 4CREA 1T4UH 4E06H 3OYPA 1TOCB 3E1XB 3BTFE 2A32A 2DE9A 4YO9A 3SORA 1GBHA 4B74A 4SGBE 2ANYA 3SGQE 2ZHQH 3RXLA 1ELVA 2BD2A 5LGOA 3F1SB 1FAXA 2C8YB 2LPRA 1V2RT 3C27B 3V3MA 1HRTH 2QF0A 3VB3A 1LTOA 4AZ2B 4O03A 5FX5A 1CT0E 1P2KA 2ZCKP 1CA0B 1SL3A 1GCDA 4D7GA 2GGVB 1UCYH 4NGAH 1MTVA 1XMNB 1BA8B 1GL1A 1TQ0B 1OP8A 1NU7B 3ZVEA 2ZFSA 1DX5M 3UQVA 1GMDF 4CBNA 1AFQC 4WMFA 4Y71A 1A4WH 2SGEE 3O8BA 1K1IA 1TRNA 1WV7H 1SGEE 2VIOA 4B1TA 1G9IE 5DP3A 2B7DH 1P12E 4GUXA 1C2DA 2I6SA 3ZVCA
chains in the Genus database with same CATH superfamily
5IK2D 2VWMA 1XVMA 1BZXE 1TNHA 4BXSA 1FPCH 5LH8A 4FUHA 2OC8A 2H9EH 4K1EA 3N99A 4K69A 4ZHMU 4DT7B 2BXUH 3ZIAD 3OY6U 2W7UA 1LKBA 4B2BA 1LPGB 1DE7H 1XUJA 3UOPA 1TBZH 1GI9B 1WUNH 1M9UA 1ELTA 2VH6A 1HAXB 2G8TA 1S6FA 4FXGH 3HKIB 1BOQA 1QFKH 1SVPA 2AFQB 1G3EA 1KXDA 1WAYB 4WMEA 2PP6A 3FANA 4XD7D 1F7ZA 3LH3A 3OY5U 1SOZA 3EA7A 2Y80A 2Y82A 1A7SA 4NZQA 2OLGA 1DWBH 1GGDC 2P94A 3PV4A 1C5NH 1E0FD 3LOXA 2OCVB 2F9VA 3MH4A 3HGNA 4KKDA 1Y3WA 1SGRE 2BX3A 3W94A 3BEFB 1W2KH 4I31A 1SLXB 3P8FA 1CE5A 5EJLA 3VB6A 1C5PA 1QJ7B 1P2NA 2FYRA 6LPRA 1W11U 1P2OA 6GCHF 5EJZA 3SUFA 2QAAA 1D6RA 1WBGB 1GDUA 1L1NA 1HIAA 2AMDA 2ZDVH 1O3KA 5F8TA 2C8XB 5DK1A 4CH2B 1OS8A 1O3CA 1GCTC 1Q2WA 1GCTB 1TIOA 1O5GH 4X1NU 3SGAE 3SO3A 6ESTA 3RU4E 2WPJS 2W26A 1O2OA 1CA0C 2A4QA 1OWIA 2LELA 3RXQA 5C20A 3ATIA 1C2GA 4X6NA 2FYQA 1CU1A 2V3HH 1WDIA 1CQQA 2G4TA 3TNSA 4Y76A 3LONA 4LZ4B 3T5FH 3QN7A 3SV7A 3U8RH 2RCEA 1OXGA 3M5OA 1QTFA 3VB7A 2KFWA 4AC9A 1EOJA 3GCNA 1O3DA 4B75A 3LC3A 2C4FH 4RKOB 3PB1E 3PO1C 2KR7A 1Z8IB 2BY9X 1DWDH 2ZHFH 5GDSH 4JMYA 2XW9A 1P03A 3KQBA 4FUGA 3SZEA 1LHDH 1RTLA 2CHAC 2VB0A 3MH7A 1ARCA 1EZQA 2WPHS 3H5CB 1UCYK 3QX5H 3PTBA 3B8JA 1JXPA 3OFND 3FFGA 4Y10E 1EAXA 1C2HA 2A5KA 4HGCA 1JRTA 3SGBE 1VJ9U 1SOTA 3MHWU 1XKAC 3OEED 3TPIZ 1FV9A 1FX0B 3A7TA 1E36B 1O3PB 3KNXA 2FOBA 3CS0A 1YC0A 5GCHF 4ABAA 1SHHB 1MAXA 1Z71A 2D2DA 5L6NH 2PKSC 1BHXB 1YKTA 2ZFRH 1K1PA 3UUZA 1S82A 1O3BA 3D62A 3QZQA 2OC7A 1GVZA 3M35A 2ALPA 1Y5BT 5B6OA 3OEHD 2PHBA 1XXFA 1L1JA 1IQGA 1UTLM 1SC8U 3GY2A 1FY1A 1P0SH 3MI4A 3QTVH 2BLOA 3ZZ7A 2P3TB 3WW7A 2A0QB 2XBXA 4U2WA 3RMOH 5DP8A 5L2YH 2VIPA 4YM9A 1C5OH 3CNRA 2XC0A 1SR5C 4WH8A 1HV7A 1BBRK 3DHKH 3BTME 4OM9A 1C2JA 1G3BA 2FPZA 4Q7ZA 3AK5A 5DP4A 5T6DA 1SFQB 1YYY1 2FS8A 2ANKH 3SJ8A 4TPIZ 3LT3A 2PTNA 3TIUA 1H9IE 3JZ2B 1TA2A 3T25A 8GCHF 4OS6A 4KGAA 1HFDA 1INCA 2SGFE 3IWMA 4DCDA 2ZC9H 3CP7A 3H09A 1Z8GA 2P95A 2GTBA 3DSGA 2GVFA 1T31A 1G30B 1GMCF 2OBOA 1HGTH 2HPQH 3A80A 1MH0A 5A09A 1TAWA 3LGTA 3M61U 3P95A 3A81A 3MU1A 1NT1A 2V7QD 3F2HA 1DM4B 1P9UA 1QZ8A 1W7XH 2G51A 1NBME 3U1JB 2BY5X 1BHXF 3E91A 3EAJA 5KECA 2FDAA 4XBDA 2P59A 3A8AA 2A2QH 1PPEE 1IQIA 3CS7A 2RA3A 4CHAB 2ZQ2A 4CRAA 1GG6B 3SW2B 1SG8B 4DVAU 3BTEE 4I8LA 2OQUA 4HZHA 1EPTC 1V2MT 3VPKA 2ZHEH 1F92A 2FOGA 2AERH 3RM0H 3ZV9A 1PQ8A 1ZGVA 3ZZCA 1A5HA 1SPJA 3A8CA 2VVUA 3E8LA 1G37A 3ENSB 1FN6A 2RA0A 4ABHA 1RGQA 2VINA 1GHZA 3S9CA 3F9FA 2EQNA 1LHEH 2Q1JA 2AMQA 2ZU4A 1LVYA 1LHCH 3S69A 1QCPA 1DY8A 3A7YA 1UJ1A 4K3JA 3KQ5A 1GHBF 5C5OA 4IN2A 2NU4E 1S5SA 2TGDA 3K9XB 5F03A 3CENA 1P11E 1TX6A 1V2JT 4BTUB 2CF9H 2XWAA 4TY7A 1T8MA 5KGOA 5JB9S 1FY8E 2ALVA 1SBWA 2ZO3H 1DOJA 5EG4A 1FQ3A 1O5FH 3BTQE 3ZZ4A 1NESE 2QYIA 1JWTA 1AUTC 1O3JA 3FOAA 3I78A 4RT1A 1IQNA 2HWLB 3LKWA 2JETC 1N8OC 1W8BH 1OWJA 2XBVA 4HFPB 5KEDA 2L74A 1BRBE 3SNCA 2EI7A 3LGYA 3P8OA 3NWUA 2Z9JA 2J38A 1OSSA 2ZNKH 1BJUA 2VWLA 3SU6A 4XRNA 2W5EA 2OP9A 2ZFPH 1BRUP 3TNTA 1W0ZU 2TRMA 1TPPA 3PO1B 5HM2A 2FTLE 1DVAH 1DWCH 5GXPA 4BNRA 2R3YA 7LPRA 3S0NA 2Z3EA 2ANMH 3K6YA 1AVWA 3FP6E 1UTNA 1SHYA 1DICA 4J2YB 2BD7A 1O3EA 4GHQA 4TY6A 2BB4A 2QCYA 3E0PB 1A2CH 1SMFE 1C5YB 1B5GH 4P02A 3GCHC 4GCHG 1BMAA 7KMEH 2Y7XA 3KL6A 5EJ1A 1O5DH 3SNDA 1A0HB 3P70B 1BT7A 5CHAC 2Z9KA 4FU9A 3SJKA 1AZ8A 1TNJA 1BTYA 2WPMS 4ABGA 2ZTYA 5AFYH 1UTJA 3KCGH 3E6PH 2F43B 1ZMJA 1CO7E 2GKVE 3OU0A 1HAPH 1C5WB 5JYIA 2CK3D 4A7IB 4INHA 3LGWA 6CHAC 5FXLA 1A46H 1NO9H 1NRSH 2TGTA 1UTPA 1KLIH 2P3FH 4YLQH 4TSFD 1THPB 2P3UB 1YWUA 1HUTH 5GCHG 1AMHA 2IPQX 4CRBA 2O8MA 2Z94A 1BB0B 5BPEA 3F9GA 2BVRH 2GJGA 1O35A 2PTCE 4YOJA 2BDAA 3RXUA 2ZPRA 1H8DH 4ACBA 1OYQA 1LVOA 1O2LA 4ZKRU 2NWNA 5GJ4B 2PSXA 2BQ7B 4ZAEA 2Z6BD 3BV9B 3UWIA 1MABB 4THNH 2XWBI 4IMZA 2O9QA 2A4OA 5I25A 4HG6A 1MTSA 2CV3A 5A8ZA 1ESTA 4Q4LA 4IC6A 2RG3A 5F53A 1T7CA 1V2UT 5LPRA 1BDAA 4ZH8A 1JIRA 4JK5A 2JETB 3URDA 4U30A 4X6MA 4HTCH 1LDTT 4AB8A 4DOQA 1VJAU 1O2ZA 4IBLH 4ISNA 2J95A 3RMMH 1FUJA 3UPEA 1OYTH 1GHXH 1P2MA 1EAIA 1K1MA 3QWCH 2KCOA 3QLPH 1SGYE 1EZXC 3MNCA 4X8VH 2QXHA 3ZZBA 2WYGA 4CH8B 1QB6A 1L4DA 1RTKA 2G52A 1U6QA 4X0WU 3EGKH 2ZGCA 5A0BA 4Y0YE 3RMNH 1O2MA 5EW2H 1FJSA 2BXTH 2XBWA 2R2MB 1AZZA 2VIVA 2VWOA 1EATA 1QA7A 3RU4T 1ZR0A 4YXWD 2F9UA 1GI3A 1TBQH 5K0HA 2PFEA 1H8HD 1NN6A 1MD8A 1XXDA 4ACAA 2JDID 4JZEH 2FIRH 2G4UA 1GI6A 3RXAA 2VVCA 1UW7A 3TGIE 3ATKA 6CHAB 1O2TA 4I8JA 2ZHDA 1C4Y2 2CN0H 1T4VH 3MH6A 4B73A 5JBAS 1H9HE 1ID5H 3HATH 2TBSA 3HK3B 1YF4A 4K8BA 3V7TA 1LQDB 4FUCA 2BY8X 1O31A 1THSH 2WINI 4RSPA 4VGCB 2QF3A 1MTNB 1E79D 2P8OB 5DN6D 1KMHB 1CHOF 1O2QA 1BMMH 1F0RA 4K60A 1C1TA 3DSOA 4AFZA 4MTBA 2GCHF 2HALA 1DSTA 1O37A 4Y6DA 2HGTH 1IQFA 3EA9A 1ZRBA 1SQRA 3U8TH 1VITF 1AY6H 1A5IA 1TALA 3F2GA 1K1NA 1GHBG 1KIGH 2XNIA 5HGGA 2FM2A 2Z9IA 4ASHA 3BIUH 4FVDA 1WQSA 4ZCNA 1ZMLA 4BANB 3UY9A 2VIWA 1MBQA 1E37B 1HAVB 2ZFTA 4MNYA 3VB5A 5F6MA 1P01A 1ABIH 1WQVH 1W7GH 2Y6TA 4NFFA 1CGHA 5EPNA 1BTWA 1MKXH 1DSUA 5FPTA 1V2LT 3ZYEA 2BVSH 1N8OB 3P8NA 5DJ7A 5BRRE 1AB9C 1ZPZA 1IQHA 2J5UA 1TE0A 2D8WA 2VWNA 2UWOA 1XUGA 3RXJA 1TX7A 1GHAF 1O2JA 3LPRA 2IPHA 1ORFA 5FX6A 4FU7A 3UWJH 1G2LA 4BOHA 1LVBA 1TONA 1TGCA 3PYHA 2BMGB 3R0FA 5G4BA 3Q3YA 2KAIA 3FVFB 1LHGH 2ZU1A 5T6FA 2BHGA 5EIYA 3GYLB 1KXFA 5GNDA 4Y11E 1THRH 1K1JA 1UTOA 1YPLH 4OGXA 1F5KU 3Q3XA 5JBCS 2AIQA 2BZAA 4X8UH 5JBTA 3RXMA 4RKJB 1ETTH 4WF8A 2O8TA 5A0AE 1K21H 1KYNA 4ISIH 2H5DA 5CDFE 3E3TA 1ZPBA 1Y3YA 1EPTB 2QF4A 3VEQB 3BN9A 1V2TT 1EAWA 5ETXA 4GCHF 3AW0A 3PV5A 2J34A 3A84A 1DDJA 1VKYA 2WYJA 3MU4A 3TK6A 1PJPA 2PKSB 2C93B 2ZGHA 3P92A 2BX4A 2H9HA 3S9AA 1NFXA 1H9LB 2HOBA 1L4ZA 1Z6JH 1W12U 4OS2A 1XUIA 5EQRA 1MKWH 5C94A 2QV1A 4JZDH 3MOCA 3RXPA 1O2WA 4GSOA 1HAOH 1QB1A 2ZP0H 2BOHB 2ODPA 2EY4C 2Z9GA 2A5AA 1V2PT 1TNLA 1QIXB 5EQSA 2ILNA 1J16A 1KY9A 2FZZA 1A1RA 1Y3UA 2WPIS 3FAOA 4B2CA 5AF9H 2Q6FA 1EPTA 2ZIQH 2J92A 5E2OA 4AFUA 1KXCA 2B9LA 1VITH 3LDXH 3PWCA 2HPPH 1VZQH 1V2VT 1AUJA 1E35B 2FLBH 3ZZAA 4MDSA 3TJVA 5TCCA 3SJIA 2AGEX 2P16A 2XBYA 1QHRB 1C1OA 4XBBA 4ISLA 1PPHE 2UUJB 2BD9A 4MG3A 1H8ED 1QY6A 1AFEH 4UEHH 3LIWA 1P57B 4LXBH 1PQ7A 1QJ6B 2OK5A 1O38A 1HDTH 2TGPZ 2F4LA 4B76A 3TH3H 1FPHH 1DS2E 4INKA 4K5ZA 1W0JD 1Z8JB 5GPIB 1C5LH 2UUYA 2HNTF 4I7YH 3A89A 1NFWA 5EU8A 3TJNA 1C2LA 1S85A 3A7XA 1GBIA 2D1JA 1O2PA 1SQTA 1AVXA 1O5AB 1ZTLA 2VGCB 5DP7A 1OHHD 4Y8XA 3SJOA 5HXFA 1EASA 1QL9A 1CT2E 1MCVA 1J15A 2GZ7A 2XRCA 1O2RA 1A3BH 3Q76A 1YLCA 2O8WA 3SBKA 1DUAA 2J94A 5FCKA 2BDGA 3NCLA 3PMHB 4DURA 3ZZ8A 2W6JD 4GVUA 4IGDA 1C4V2 1YCPM 4WJG2 1FNIA 4XE4A 2IOTA 3UOUA 3PMJA 3N7OA 4MNXA 4YT6H 5EPYA 4ISHH 2HLDD 1MKXK 3MNXA 2F91A 1HAIH 1SSXA 2ASUB 3Q00A 3RXTA 2VH0A 4B6FA 1GI7B 1DT2A 3T28A 1ZHMA 2CMYA 3QK1A 4DY7B 1C9TA 5AVDA 2ZU3A 1HAHH 1YPHE 4CR9A 2VBCA 1G32B 2NU3E 1BBRH 1XUFA 1N6XA 1MD7A 2HLCA 1C2FA 1NFUA 3E16B 4OS5A 1J9CH 2UUFB 3PROA 4Y7BA 1S83A 1TPSA 2UWPA 1J17T 1UK4A 2GCHG 1BQYA 3RXDA 1EP5A 4DGJA 1F5RA 2WPLS 2W7SA 3RXBA 1ZOMA 1BMNH 3TH4H 1SB1H 3M7QA 4F55A 1XM1A 3RXEA 1EFRD 3P8GA 2Y5HA 4GHTA 3D49H 3A88A 4KTUA 5C1UA 1TWXB 4Y8YA 1HJ8A 2R0LA 1P09A 1UVSH 2SFAA 1A0JA 1TRYA 1EJNA 2GT7A 1Z7KA 4I33A 1SGNE 3TU7H 2PUQH 4AYVB 1FIWA 2R0KA 4A1VA 2O8UA 2JH0D 3STIA 3LGIA 3M5LA 1V2KT 1OWKA 3W95A 2KM0A 3FO8D 4INLA 3MU8A 3GS9A 4YLUA 4WXVA 1T8OA 3AW1A 4Q7YA 4GAWA 1AFQB 1IQKA 5C1XA 1TGSZ 4JK6A 1AE5A 4A92A 3KIDU 4R0IA 1A3EH 1QL8A 1EP6A 2AGIX 3PRDA 4MNVA 1KXBA 4OGYA 3NXPA 1BJVA 2Z3DA 1HAZB 1NRNH 1PQ5A 2J2UA 1AVGH 1Q3XA 1ARBA 1YPJH 3VXEH 3C1KA 3PWBA 4I8KA 2ZQ1A 1P2JA 3OE7D 1YPMH 1GBDA 3A7WA 2V0BA 1UCYE 5HIYA 4DW2U 3N7DA 2GCTB 1O3FA 2A1DB 5J4QA 4KTCA 1MU6B 4AG1A 1BIOA 3PMAB 4Z0KA 1GJDB 1F0TA 2UUKB 3GCTF 3ATWA 1K9OE 1YPEH 3SUGA 2RFKC 3S7KB 1V6DA 1FMGA 2BOKA 4AX9H 3UIRA 2AHME 1G3DA 3UNSA 3BTTE 1AGJA 1TQ7B 3ZZ6A 4B2AA 1FLEE 1B0EA 2A31A 1Y5AT 4NWLA 2Y7ZA 3BTGE 1D4PB 1S6HA 1BUIA 3U98H 5EGMA 1DANH 4R8TB 1HAGE 1O2IA 2QN5T 1TMTH 1X7AC 5FPYA 5T1VA 3TVJB 1SFIA 1S81A 4DT4A 1RIWC 4JCNA 4KP0A 5EXLA 1V2OT 1IOEA 3DFLA 4NIVA 1O3LA 1GBTA 3MYWA 2YOLA 3KQEA 1C2KA 1SKYE 1ZJDA 1AKSA 1BTXA 2IN2A 3F9HA 2CXVA 1QNJA 1ZYOA 2GZ9A 4J1YA 1EZUC 4ZROA 1OX1A 2QF5A 3RXVA 5LPFA 2XOKD 4WH6A 1FY5A 1OKXA 2FS9A 1ACBE 2A2XH 4ZUHA 3VFEA 2RDLA 1YGCH 1BTHH 1FI8A 1DLEA 3A86A 1EB1H 1AWFH 2K1QA 1VCWA 2ZFQH 1V3XA 1MUEB 4LK4A 3RXKA 1KXAA 2F3CE 2H6MA 3PM3A 1XUHA 1QJ1B 1EQ9A 4UDWH 1GI0A 1ABJH 3HGPA 1ELBA 4BAMB 4WY3A 4WMDA 1ESBA 1MBMA 5FL7D 1DXWA 1GMHG 2GP9B 1O2SA 1HBTH 5EXNA 4D76A 1AB9B 1NRQH 3MTYA 3QO6A 3M5NA 2EEKA 4I86A 4K2YA 3MH5A 4CRDA 2BVXH 3EQ0H 2C8ZB 1SLVB 4ABFA 5TCAA 2FOFA 4AFQA 1SQOA 1WCZA 1GI5A 2R9PA 3TITA 2BQ6B 1J14A 3NK8A 3QGJA 1TNKA 5HMAA 3BF6H 3KN2A 5DO4H 1Y8TA 1SGQE 2PLXA 5DGJA 1SGFA 1Z8RA 2ZDAH 2HNTC 2PGBB 1IAUA 3ODFA 1O3GA 1Z6EA 1GWAA 1GI1A 2BDCA 3K2UA 1T8NA 3GY7A 4DG4A 2EI6A 3MWIU 1SGDE 1KDQB 3M7TA 1VGCB 1KXEA 2ZZUH 4ZKNU 3HK6B 3AASA 1SGPE 2BDYA 1Z1JA 1IQJA 1O3NA 1ELFA 2C8WB 3BG4B 1GBAA 2XYAA 5IYTA 1B0FA 3UREA 4H42U 1E38B 1MMJN 1K22H 3LJOA 4U01A 3RC4A 4FUIA 1MZAA 4K1SA 2AIPA 3UR6A 1ZSLA 5T3HA 1Y59T 4VGCC 1BTPA 4X6PA 1BMLA 4NA9H 4Z1MD 3OTJE 2QXIA 2ZCHP 4I8HA 3MO3A 1GHWH 1KDQA 3GCOA 1CHGA 3BEIB 3V13A 2G81E 5A8YA 1CBWB 3IITA 2PSYA 2IJD1 3SNEA 2JJ2D 1XKBC 4X1RU 3LC5A 1DUEA 2HVXA 2QE7D 4Y8ZA 1C5QA 2CGAA 1GBJA 1F0SA 4K1TA 3GDVA 4YOGA 5FCRA 1S0QA 5AHGH 1GHYH 2XCFA 2ZEBA 3I77A 2P93A 3ZYDA 1GHVH 1SGCA 3BG8A 1PQAA 4LOYH 3JZ1B 1P2IA 1EOLA 3A83A 1UVTH 3TK5A 4UFEH 2BDHA 3AAUA 3MO9A 4X2YA 3AVZA 3SYJA 1GL0E 1P8VC 2OBQA 2H1UA 2BLWA 2WV9A 3QZRA 1YCPH 3BTKE 1BRAA 1ETRH 1C5TA 2SGDE 3A82A 3SHAH 5HM9A 5DP5A 1ZGIA 4YT7H 1XX9A 1HJAC 1TGTA 3FP7E 1EAUA 3SV8A 3S9BA 4E05H 3ZV8A 3M36A 2V3OH 1QQUA 3W1EA 1HCGA 3QGNB 3S7HB 1D3DB 1MQ5A 2KCPA 3OX7U 3R3GB 5FHTA 4ZXYH 3GY6A 5C0UA 3O8CA 3M7UA 1GHAG 3KF2A 1GJ4H 1H4WA 3MQKC 3T29A 4X1QU 5PTPA 1K2I1 1O0DH 2G55A 1VCPA 2BLVA 4HI3A 2NU0E 1EX3A 1RXPA 2ZGBH 3BEUA 4GLYA 4B6EA 2PKAB 1T8LA 4UONA 1D3QB 2J4IA 2ZU5A 2B0FA 4D7FA 3RXCA 5K7RA 4KELA 3TLOA 3BTDE 1K1LA 3EE0B 2K0QA 2ZGXH 4MPWA 1SQAA 1P05A 1GDQA 1UTMA 2BD8A 3MU5A 3DCLA 3FZDA 3OSYA 5GWZA 2F9NA 1MKWK 3ZVBA 1BCUH 2ANWA 1O34A 1AI8H 1LPKB 1N1LA 2PWXA 2ZTXA 1FN8A 1E34B 1GBFA 2L6OA 3STJA 1AD8H 1WYKA 2Z3CA 4UD9H 1O3AA 2QGRA 3T27A 4RN6A 2A7CA 4CRCA 2NU1E 1NROH 3O8DA 2PKAA 1P2QA 3I29A 1W13U 2W6ID 4I8GA 3E90B 2J97A 3A87A 1G2MA 4MLFB 1A0LA 3KYFA 1HNEE 3LGVA 1ZJKA 1YBWA 3GY8A 1O3IA 2PV9B 3GY3A 5HYOA 3VGCB 2B8OH 3U69H 3DFJA 3ESTA 2BY6X 1AU8A 1NFYA 1WTGH 3FP8E 3GDSA 2ZF0H 5F8XA 4BAQB 4JZFH 1W3CA 1G36A 3NPSA 4F48B 1GBKA 2ZDKA 3A8BA 3L33A 2AEIH 4A1TA 1CA8B 1IHTH 4XFQA 4E7NA 1O32A 2Y81A 3LJJA 1GBCA 1A61H 3SV2H 1E1RD 7ESTE 1HJ9A 1D3TB 1SI5H 5SGAE 4NCYA 2STAE 3F2FA 5EW1H 2SNVA 2WUCA 2VVVA 5JDUB 3SZNA 1PYTD 3B9FH 2LP6A 1F2SE 5LPEA 3SJ9A 1C4U2 3URCA 1GI4A 3PMBB 1LPZB 2ZPQA 2OQ5A 4NZLA 2ZECA 1DITH 4CBOA 5JB8S 5I46H 1Y3VA 3SV9A 1TBRH 3B23B 3U28C 4H6TA 4ABBA 5CHAB 3Q3KA 1QBNA 4E7RG 1EZSC 2TPIZ 4FETA 4JYTA 5C17A 2BDBA 1SGIB 5A0CA 1TNIA 4MNWA 3A7VA 1L2EA 1O3OA 3A8DA 2ZA5A 1LMWB 4NA7A 1EXFA 1O5CB 3RDZA 1O30A 2Y5FA 1DXPA 1ELDE 4TWWA 3EYDA 5DG6A 1C5RA 5T6GA 4ABJA 4I32A 5DPAA 4M9FA 4UFDH 4F4OC 1MAYA 3PLBA 2AS9A 1ZMNA 4MPUA 1D3PB 1OWEA 2FX4A 1P3EA 1XUKA 3SUEA 1JOUB 2CJIA 2FO9A 1GBLA 3RLWH 4JYVH 2GX4A 4X1PU 3SU3A 1TYNA 1IHSH 1RRKA 1KLTA 1QR3E 1B7XB 2BTCE 2FODA 1NRPH 2R2WU 3SN8A 4A5TS 2YNAA 1RS0A 5FAHA 1HXFH 5DKMA 3KQCA 1KLJH 5E0HA 2G5NA 2A5IA 2JH6D 1YPKH 3VG8A 4JZIA 1UHBB 2A4GA 1PPCE 1SLUB 5IDKA 2FMJA 1FAKH 1UVUH 4NWKA 1EKBB 1O3HA 4NSYA 3T62A 1WSSH 4ZKOU 1AHTH 1W14U 1TRMA 1GBEA 2EA3A 1Z1IA 2BQWB 3VGCC 3ZZ5A 4Y79A 2FWWA 3Q77A 4NIXA 1E1QD 2TGAA 3KGPA 2ZG0H 3ZVAA 4IW4E 1QL7A 1O3MA 1O33A 2WSSD 1NM6A 2O8LA 5E0GA 1L0ZA 3QTOH 1DY9A 1ZTKA 1AWHB 2NU2E 2WUBA 3P17H 5AFZH 2FEQH 3GY5A 2VIDA 3MO6A 2IJOB 3GYMA 1QRZA 3SU1A 4F49A 1J8AA 3SI3H 1HXEH 1TPOA 1GI2A 1TABE 4MPVA 1AQ7A 1OWDA 2TIOA 2ZKSA 3T26A 4AG2A 3F0OA 1HYLA 1QBOA 2GT8A 2ZI2H 1D6WA 1W10U 3RM2H 2PR3A 4BAOB 3ZZ3A 1MCTA 4IMQA 1PYTC 1V2ST 4O97A 1GJ7B 1C5MD 4FUBA 4LZ1H 2SGPE 4D9RA 1TFXA 2AYWA 4ZKSU 2ZCLP 2JH5D 1MQ6A 1RTFB 1FONA 2YNBA 4DJZB 4FUDA 3UQOA 3SQHE 1P04A 3OAAD 5CHBA 4MPXA 1O2GH 5B6LA 4M7GA 3D23A 1TGNA 1C1WH 5CE1A 2JKHA 4IN1A 2WV4A 4AB9A 1C5ZB 2THFB 2ULLA 3ITIA 5C2ZA 3RMLH 1GGDB 1LKAA 2FESH 1BBRE 3BSQA 5L30H 1ETSH 4Q63A 1IQLA 2KAIB 4O9VA 2C3SA 2C90B 2XC5A 2QY0B 3EDXB 2OC1A 4NIWA 3M5MA 2HRVA 4X8TH 3UNRA 1C5SA 2OINA 3LGUA 1GVLA 1UK3A 3SU2A 3DUXH 2V6NA 3PLKA 4X8SH 1P9SA 1TNGA 1UTQA 1VR1H 4BAHB 1NY22 2KCYA 2R3UA 1P06A 1ZLRA 3PV2A 3F9EA 3K65B 1N6YA 4PROA 1IQMA 1AO5A 1SGTA 2VIQA 1MZDA 2DE8A 1DWEH 5C0TA 1QURH 2BYAX 2GDDA 1V2QT 4AOQA 1MTWA 4X2XA 5CMXH 1CGJE 1H1BA 1NPMA 2YMSB 1O2KA 1YP9A 1ZSKA 4NIYA 3DA9B 1CGIE 2ZDMA 1RFNA 3M3TA 1EUFA 4P00A 1DPOA 1OOKB 2OXSA 4XDEA 1O2HA 2Z7FE 2A4RA 1GI8B 3BIVH 2LNCA 3RXFA 5C5NA 3O8RA 2JIZD 3FN8A 1ZPCA 1W0KD 2CHAB 2FI4E 3UAIC 1QQ4A 4WXIA 1QA0A 3PRBA 1O36A 1GJAB 3RUOA 4XOJA 1ELGA 1C1VH 2PW8H 3HKJB 5DP6A 1VCQA 3DT0H 4Q7XA 3TGJE 3GCHB 2FOAA 3SNBA 2A7HA 4Q80A 3UNQA 3SOSA 8LPRA 2F9OA 2SGAA 1VGCC 4BAKB 3BG4C 2F9BH 2FP7B 3RXHA 1HPGA 2KZ4A 4Y0ZE 2GV6A 4NFEA 1A5GH 1ZTJA 1CSOE 5H4IB 3F3BA 1JMOH 2D26C 1GDNA 1MTNC 1NC6A 1PPBH 1AKSB 3MU0A 2GDEH 1C2EA 3K6ZA 4AGKA 5A2MH 2J9NA 1TPAE 1ANEA 3NZIA 4TPYA 1QGFA 2BZ6H 4CRGA 5C1YA 4XBCA 1EB2A 3EE7A 1NBMD 1UHBA 2GMTC 2W3IA 2OC0A 2OTVA 3N7EA 3E0NB 1CBWC 2FOEA 1T32A 2Q6DA 3EA8A 2GMTB 3D65E 1CHOG 2KCAA 1YPGH 3WY8A 1QB9A 2YMSD 1LCYA 1GJBB 1UO6A 4Q2KA 4QT8C 3T2NA 1YLNA 1ELAA 2UWLA 1PPZA 2FOMB 4H6SB 2AGGX 3PLPA 1ANDA 3A7ZA 5GIBA 2EC9H 3FZZA 2FOCA 3MNBA 5DSFA 1GMHF 2CF8H 2FTMA 8GCHG 1Y5UT 5JPMH 1ZSJA 3RU4D 1F5LA 2H9TH 2WZQA 4A6LA 3MMGA 1DLKB 5E8EH 1Q31A 2WPKS 4X2VA 1COWD 4ZHAA 1WXRA 4X2WA 4D8NA 5FBIA 1H8IH 8ESTE 1K28D 1PPFE 1HLTH 1GMCG 4JZ1A 1C1RA 1OP0A 3L3TA 1ELCA 1C9PA 1RD3B 3QUMP 1TMBH 5HIZA 2ZDLA 4OS1A 4OS4A 4FUFA 3AAVA 1C1UH 2AMPA 3IG6B 3RC5A 4ESTE 3SI4H 3F6UH 2FX6A 1HJAB 1TOMH 5J4SA 2GCTC 1GBMA 3NRLA 1O5EH 3WWFA 2STBE 2BLQA 5ESTE 2GD4B 2ODQA 4TT3D 2GV7A 1GBBA 1FY4A 1BITA 1UMAH 3ATMA 2FOHA 1TLDA 2ZGJA 3VXFH 4BTIB 4FUEA 1C1PA 1C5UA 4B71A 1BTZA 2WHXA 9LPRA 4ZXXH 1GJ8B 2V3MA 1HIAB 1C2IA 1FXYA 1XVOA 3ZZDA 4CHAC 4NA8A 3BTWE 2J98B 1O2NA 1K0HA 3LU9B 1O39A 4FVBA 2I6QA 1WOFA 1MU8B 2XXLA 1KSNA 1PPGE 3WWBA 1BMFD 4ISOA 1CVWH 5DP9A 3M37A 3BTHE 4WWYA 1D9IA 1C1NA 3U8OH 3NKKA 3TJOA 2FLRH 4X6OA 2H2ZA 1C1QA 2HNTE 4XSKU 2F9PA 2AH4X 2B5TB 2WV5A 4YZUA 1HB0B 1VITG 1S0RA 2ZHWH 4GPGA 5EOKA 2BY7X 4FU8A 2J98A 2V35A 5TJXA 1UTKA 4KTSA 3ZVFA 1W0YH 3TH2H 2BD5A 4MQAA 5EXMA 4MVNA 1GJ5H 2Q6GA 1OP2A 4SGAE 4BXWA 1TGBA 2A7JA 4ABDA 5FPSA 2ESTE 1AIXH 2QIQA 1L1GA 5EQQA 4NG9H 4FUJA 3SU0A 3RLYH 2M2AA 5C3NA 3MFJA 3GICB 1ZZZA 1O2YA 4AFSA 1KTTB 3KHVA 2Y5GA 2FI3E 1QRWA 4RT0A 2YMSC 1UK2A 1JIMA 2PUXB 3KYGA 2SGQE 3L6PA 1IQEA 1C1MA 3SU4A 1FZZA 3RXSA 1CT4E 2VJ1A 4UFFH 7GCHF 3QDZB 3FKSD 2QXJA 4IS5A 1V2WT 3SHCH 1F0UA 1ZHRA 1GMDG 3U9AH 2HVYB 4AORA 4AN7A 1NZQH 5F8ZA 1ANBA 1O5BB 2JJ1D 2FI5E 4OS7A 4UE7H 1PFXC 2RDEA 1AE8H 1YY3A 3SNAA 3MNSA 3VB4A 1O2UA 2ZTZA 4YOIA 9ESTA 1ANCA 1UVOA 1G3CA 3NUMA 1ELEE 1LO6A 3ELAH 3SUDA 2QC2A 3UTUH 4AGJA 1NRRH 1P3CA 3RXGA 1GG6C 1HAYB 1HAVA 3OTPA 3ZVGA 5C67A 3V12A 4X1SU 1ESAA 4Z6AH 3RXOA 3ODDA 4DIIH 2QXGA 4ABIA 1EJMA 3RC6A 3KQDA 4O3TA 4YESB 1QRXA 1ZRKA 2ZFFH 1LHFH 3H7OA 1LVMA 2BD4A 2VU8E 1RIWB 5ABWA 3RXRA 3RXIA 2P8OC 4A1XA 3A85A 1O2XA 2OD3B 4IC5A 3GY4A 4K8YA 5EODA 1GJCB 3TJUA 3P6ZB 1BRCE 2ZDNA 3GDUA 3SU5A 1UVPA 2A45B 1K1OA 1TMUH 1OWHA 4DIHH 1C2MA 1EJAA 1C5XB 4YTAA 2OUAA 1GJ9B 4JYUH 3PTNA 1KTSB 1JBUH 1ZHPA 4O3UA 1YLDA 3ZZ9A 1C5VA 1BTUA 3TGKE 1NS3A 4WVPE 2XC4A 4ZMAH 3DD2H 1AN1E 1GJ6A 4TYDA 2BDIA 1WTHD 1NTPA 2KX4A 2EI8A 2ODYB 3G01A 3RP2A 2W3KA 2Z9LA 3V0XA 1YPHC 1WU1A 2G5VA 1GVKB 1LQEA 5A8XA 5L2ZH 2PGQB 3ATLA 2BM2A 3M3VA 1RJXB 1MTUA 2DUCA 3TK9A 4NSVA 2XCNA 3SV6A 5FBEA 2G00A 8KME2 4ZHLU 4D9QA 3UFAA 1FIZA 4CR5A 2VGCC 1JRSA 7GCHG 1V2NT 3F0PA 5HKKD 2SNWA 5E2PA 1C1SA 2GZ8A 3GISB 1TB6H 3ZVDA 1NU9A 4RI0A 4UFGH 2M5TA 3SQEE 1P02A 1TX8A 3F68H 3HPTB 5E0JA 1YM0A 3UB0A 1FDPA 4TWYA 3H7TA 2XNDD 2FXRA 3UR9A 3M3SA 1TA6A 2F83A 2ZWLH 4AYYB 5JBBS 5ESBA 3GOVB 3GCTG 2WPDD 2H5CA 2VNTA 3LH1A 1SLWB 1OPHB 1Y3XA 1DFPA 2BD3A 4ABEA 1GPZA 1QBVH 4CRFA 3KEEA 4U32A 2QA9E 1O2VA 3U1IB 4Y7AA 1SGFG 6GCHG 2ZU2A 1FY3A 1S84A 4H4FA 2XTTB 1YCPK 2ZPSA 1P10A 4BTTB 4CREA 1T4UH 4E06H 3OYPA 1TOCB 3E1XB 3BTFE 2A32A 2DE9A 4YO9A 3SORA 1GBHA 1S6LA 4B74A 4SGBE 2ANYA 3SGQE 3DSPA 2ZHQH 3RXLA 1ELVA 2BD2A 5LGOA 3F1SB 1FAXA 2C8YB 2LPRA 1V2RT 3C27B 3V3MA 1HRTH 2QF0A 3VB3A 1LTOA 4AZ2B 4O03A 5FX5A 1CT0E 1P2KA 2K8IA 2ZCKP 1CA0B 1SL3A 4ASUD 1GCDA 4D7GA 2GGVB 1UCYH 4NGAH 1MTVA 1XMNB 1BA8B 1GL1A 1TQ0B 1OP8A 1NU7B 3ZVEA 2ZFSA 1DX5M 3UQVA 1GMDF 4CBNA 1AFQC 4FOUC 4WMFA 4Y71A 1A4WH 2SGEE 3O8BA 1K1IA 1TRNA 1WV7H 1SGEE 2VIOA 4B1TA 1G9IE 5DP3A 2B7DH 1P12E 4GUXA 1C2DA 2I6SA 3ZVCA
chains in the Genus database with same CATH topology
2VWMA 1XVMA 1BZXE 1TNHA 4BXSA 1FPCH 5LH8A 4FUHA 2OC8A 2H9EH 4K1EA 4K69A 4ZHMU 4DT7B 2BXUH 3OY6U 2W7UA 1LKBA 4B2BA 1LPGB 1DE7H 1XUJA 3UOPA 1TBZH 1GI9B 1WUNH 1M9UA 1ELTA 2VH6A 1HAXB 2G8TA 1S6FA 4FXGH 3HKIB 1BOQA 1QFKH 1SVPA 2AFQB 1G3EA 1KXDA 1WAYB 4WMEA 3FANA 1F7ZA 3LH3A 3OY5U 1SOZA 3EA7A 2Y80A 2Y82A 1A7SA 4NZQA 2OLGA 1DWBH 1GGDC 2P94A 3PV4A 1C5NH 1E0FD 3LOXA 2OCVB 2F9VA 3MH4A 3HGNA 4KKDA 1Y3WA 1SGRE 2BX3A 3W94A 3BEFB 1W2KH 4I31A 1SLXB 3P8FA 1CE5A 3VB6A 1C5PA 1QJ7B 1P2NA 2FYRA 6LPRA 1W11U 1P2OA 6GCHF 3SUFA 2QAAA 1D6RA 1WBGB 1GDUA 1L1NA 1HIAA 2AMDA 2ZDVH 1O3KA 5F8TA 2C8XB 5DK1A 4CH2B 1OS8A 1O3CA 1GCTC 1Q2WA 1GCTB 1TIOA 1O5GH 4X1NU 3SGAE 3SO3A 6ESTA 3RU4E 2WPJS 2W26A 1O2OA 1CA0C 2A4QA 1OWIA 3RXQA 5C20A 3ATIA 1C2GA 4X6NA 2FYQA 1CU1A 2V3HH 1CQQA 2G4TA 3TNSA 4Y76A 3LONA 4LZ4B 3T5FH 3QN7A 3SV7A 3U8RH 2RCEA 1OXGA 3M5OA 1QTFA 3VB7A 1EOJA 3GCNA 1O3DA 4B75A 3LC3A 2C4FH 4RKOB 3PB1E 3PO1C 1Z8IB 2BY9X 1DWDH 2ZHFH 5GDSH 4JMYA 2XW9A 1P03A 3KQBA 4FUGA 1LHDH 1RTLA 2CHAC 2VB0A 3MH7A 1ARCA 1EZQA 2WPHS 3H5CB 1UCYK 3QX5H 3PTBA 3B8JA 1JXPA 3FFGA 4Y10E 1EAXA 1C2HA 2A5KA 4HGCA 1JRTA 3SGBE 1VJ9U 1SOTA 3MHWU 1XKAC 3TPIZ 1FV9A 3A7TA 1E36B 1O3PB 3KNXA 2FOBA 3CS0A 1YC0A 5GCHF 4ABAA 1SHHB 1MAXA 1Z71A 2D2DA 5L6NH 2PKSC 1BHXB 1YKTA 2ZFRH 1K1PA 3UUZA 1S82A 1O3BA 3D62A 3QZQA 2OC7A 1GVZA 3M35A 2ALPA 1Y5BT 5B6OA 2PHBA 1XXFA 1L1JA 1IQGA 1UTLM 1SC8U 3GY2A 1FY1A 1P0SH 3MI4A 3QTVH 2BLOA 3ZZ7A 2P3TB 2A0QB 2XBXA 4U2WA 3RMOH 5DP8A 5L2YH 2VIPA 4YM9A 1C5OH 2XC0A 1SR5C 4WH8A 1HV7A 1BBRK 3DHKH 3BTME 1C2JA 1G3BA 2FPZA 4Q7ZA 5DP4A 5T6DA 1SFQB 1YYY1 2FS8A 2ANKH 3SJ8A 4TPIZ 3LT3A 2PTNA 3TIUA 1H9IE 3JZ2B 1TA2A 3T25A 8GCHF 4OS6A 4KGAA 1HFDA 1INCA 2SGFE 3IWMA 4DCDA 2ZC9H 3CP7A 1Z8GA 2P95A 2GTBA 2GVFA 1T31A 1G30B 1GMCF 2OBOA 1HGTH 2HPQH 3A80A 1MH0A 5A09A 1TAWA 3LGTA 3M61U 3P95A 3A81A 3MU1A 1NT1A 1DM4B 1P9UA 1W7XH 2G51A 3U1JB 2BY5X 1BHXF 3E91A 3EAJA 2FDAA 4XBDA 2P59A 3A8AA 2A2QH 1PPEE 1IQIA 3CS7A 2RA3A 4CHAB 2ZQ2A 4CRAA 1GG6B 3SW2B 1SG8B 4DVAU 3BTEE 4I8LA 2OQUA 4HZHA 1EPTC 1V2MT 3VPKA 2ZHEH 1F92A 2FOGA 2AERH 3RM0H 3ZV9A 1PQ8A 1ZGVA 3ZZCA 1A5HA 1SPJA 3A8CA 2VVUA 3E8LA 1G37A 3ENSB 1FN6A 2RA0A 4ABHA 1RGQA 2VINA 1GHZA 3S9CA 3F9FA 1LHEH 2Q1JA 2AMQA 2ZU4A 1LVYA 1LHCH 3S69A 1QCPA 1DY8A 3A7YA 1UJ1A 4K3JA 1GHBF 5C5OA 4IN2A 2NU4E 1S5SA 2TGDA 3K9XB 5F03A 3CENA 1P11E 1TX6A 1V2JT 4BTUB 2CF9H 2XWAA 4TY7A 1T8MA 5JB9S 1FY8E 2ALVA 1SBWA 2ZO3H 1DOJA 5EG4A 1FQ3A 1O5FH 3BTQE 3ZZ4A 1NESE 2QYIA 1JWTA 1AUTC 1O3JA 3I78A 1IQNA 2HWLB 3LKWA 2JETC 1N8OC 1W8BH 1OWJA 2XBVA 4HFPB 1BRBE 3SNCA 2EI7A 3LGYA 3P8OA 3NWUA 2Z9JA 2J38A 1OSSA 2ZNKH 1BJUA 2VWLA 3SU6A 2W5EA 2OP9A 2ZFPH 1BRUP 3TNTA 1W0ZU 2TRMA 1TPPA 3PO1B 5HM2A 2FTLE 1DVAH 1DWCH 5GXPA 4BNRA 2R3YA 7LPRA 3S0NA 2Z3EA 2ANMH 3K6YA 1AVWA 3FP6E 1UTNA 1SHYA 1DICA 4J2YB 2BD7A 1O3EA 4GHQA 4TY6A 2BB4A 2QCYA 3E0PB 1A2CH 1SMFE 1C5YB 1B5GH 3GCHC 4GCHG 1BMAA 7KMEH 2Y7XA 3KL6A 1O5DH 3SNDA 1A0HB 3P70B 1BT7A 5CHAC 2Z9KA 4FU9A 3SJKA 1AZ8A 1TNJA 1BTYA 2WPMS 4ABGA 2ZTYA 5AFYH 1UTJA 3KCGH 3E6PH 1ZMJA 1CO7E 2GKVE 3OU0A 1HAPH 1C5WB 5JYIA 4A7IB 4INHA 3LGWA 6CHAC 5FXLA 1A46H 1NO9H 1NRSH 2TGTA 1UTPA 1KLIH 2P3FH 4YLQH 1THPB 2P3UB 1HUTH 5GCHG 1AMHA 4CRBA 2O8MA 2Z94A 1BB0B 5BPEA 3F9GA 2BVRH 4YOJA 1O35A 2PTCE 2BDAA 3RXUA 2ZPRA 1H8DH 1OYQA 1LVOA 1O2LA 4ZKRU 2NWNA 5GJ4B 2PSXA 2BQ7B 4ZAEA 2Z6BD 3BV9B 3UWIA 4THNH 2XWBI 4IMZA 2O9QA 2A4OA 5I25A 1MTSA 2CV3A 5A8ZA 1ESTA 4IC6A 2RG3A 1T7CA 1V2UT 5LPRA 1BDAA 4ZH8A 1JIRA 4JK5A 2JETB 3URDA 4U30A 4X6MA 4HTCH 1LDTT 4AB8A 4DOQA 1VJAU 1O2ZA 4IBLH 4ISNA 2J95A 3RMMH 1FUJA 3UPEA 1OYTH 1GHXH 1P2MA 1EAIA 1K1MA 3QWCH 3QLPH 1SGYE 1EZXC 3MNCA 4X8VH 2QXHA 3ZZBA 2WYGA 4CH8B 1QB6A 1L4DA 1RTKA 2G52A 1U6QA 4X0WU 3EGKH 2ZGCA 5A0BA 4Y0YE 3RMNH 1O2MA 5EW2H 1FJSA 2BXTH 2XBWA 2R2MB 1AZZA 2VIVA 2VWOA 1EATA 1QA7A 3RU4T 1ZR0A 2F9UA 1GI3A 1TBQH 5K0HA 2PFEA 1NN6A 1MD8A 1XXDA 4JZEH 2FIRH 2G4UA 1GI6A 3RXAA 2VVCA 3TGIE 3ATKA 6CHAB 1O2TA 4I8JA 2ZHDA 1C4Y2 2CN0H 1T4VH 3MH6A 4B73A 5JBAS 1H9HE 1ID5H 3HATH 2TBSA 3HK3B 1YF4A 4K8BA 3V7TA 1LQDB 4FUCA 2BY8X 1O31A 1THSH 2WINI 4RSPA 4VGCB 2QF3A 1MTNB 2P8OB 1CHOF 1O2QA 1BMMH 1F0RA 4K60A 1C1TA 4AFZA 4MTBA 2GCHF 2HALA 1DSTA 1O37A 4Y6DA 2HGTH 1IQFA 3EA9A 1ZRBA 3U8TH 1VITF 1AY6H 1A5IA 1TALA 1K1NA 1GHBG 1KIGH 2XNIA 5HGGA 2FM2A 2Z9IA 4ASHA 3BIUH 4FVDA 1WQSA 1ZMLA 4BANB 3UY9A 2VIWA 1MBQA 1E37B 1HAVB 2ZFTA 4MNYA 3VB5A 5F6MA 1P01A 1ABIH 1WQVH 1W7GH 2Y6TA 4NFFA 1CGHA 5EPNA 1BTWA 1MKXH 1DSUA 5FPTA 1V2LT 3ZYEA 2BVSH 1N8OB 3P8NA 5DJ7A 5BRRE 1AB9C 1ZPZA 1IQHA 1TE0A 2D8WA 2VWNA 2UWOA 1XUGA 3RXJA 1TX7A 1GHAF 1O2JA 3LPRA 2IPHA 1ORFA 5FX6A 4FU7A 3UWJH 1G2LA 4BOHA 1LVBA 1TONA 1TGCA 3PYHA 2BMGB 3R0FA 5G4BA 3Q3YA 2KAIA 3FVFB 1LHGH 2ZU1A 5T6FA 2BHGA 3GYLB 1KXFA 4Y11E 1THRH 1K1JA 1UTOA 1YPLH 4OGXA 1F5KU 3Q3XA 5JBCS 2AIQA 2BZAA 4X8UH 5JBTA 3RXMA 4RKJB 1ETTH 4WF8A 2O8TA 5A0AE 1K21H 1KYNA 4ISIH 2H5DA 3E3TA 1ZPBA 1Y3YA 1EPTB 3VEQB 3BN9A 1V2TT 1EAWA 5ETXA 4GCHF 3AW0A 2J34A 3A84A 1DDJA 2WYJA 3MU4A 3TK6A 1PJPA 2PKSB 2C93B 2ZGHA 3P92A 2BX4A 2H9HA 3S9AA 1NFXA 1H9LB 2HOBA 1L4ZA 1Z6JH 1W12U 4OS2A 1XUIA 5EQRA 1MKWH 2QV1A 4JZDH 3MOCA 3RXPA 1O2WA 4GSOA 1HAOH 1QB1A 2ZP0H 2BOHB 2ODPA 2Z9GA 2A5AA 1V2PT 1TNLA 1QIXB 5EQSA 2ILNA 1J16A 1KY9A 2FZZA 1A1RA 1Y3UA 2WPIS 3FAOA 4B2CA 5AF9H 2Q6FA 1EPTA 2ZIQH 2J92A 5E2OA 4AFUA 1KXCA 2B9LA 1VITH 3LDXH 3PWCA 2HPPH 1VZQH 1V2VT 1AUJA 1E35B 2FLBH 3ZZAA 4MDSA 3TJVA 5TCCA 3SJIA 2AGEX 2P16A 2XBYA 1QHRB 1C1OA 4XBBA 4ISLA 1PPHE 2UUJB 2BD9A 4MG3A 1QY6A 1AFEH 4UEHH 3LIWA 1P57B 4LXBH 1PQ7A 1QJ6B 1O38A 1HDTH 2TGPZ 4B76A 3TH3H 1FPHH 1DS2E 4INKA 4K5ZA 1Z8JB 5GPIB 1C5LH 2UUYA 2HNTF 4I7YH 3A89A 1NFWA 5EU8A 3TJNA 1C2LA 1S85A 3A7XA 1GBIA 2D1JA 1O2PA 1SQTA 1AVXA 1O5AB 1ZTLA 2VGCB 5DP7A 4Y8XA 3SJOA 5HXFA 1EASA 1QL9A 1CT2E 1MCVA 1J15A 2GZ7A 2XRCA 1O2RA 1A3BH 3Q76A 1YLCA 2O8WA 3SBKA 1DUAA 2J94A 5FCKA 2BDGA 3NCLA 3PMHB 4DURA 3ZZ8A 4GVUA 4IGDA 1C4V2 1YCPM 4WJG2 1FNIA 4XE4A 2IOTA 3UOUA 3PMJA 3N7OA 4MNXA 4YT6H 5EPYA 4ISHH 1MKXK 3MNXA 2F91A 1HAIH 1SSXA 2ASUB 3Q00A 3RXTA 2VH0A 1GI7B 1DT2A 3T28A 1ZHMA 2CMYA 3QK1A 4DY7B 1C9TA 5AVDA 2ZU3A 1HAHH 1YPHE 4CR9A 1G32B 2NU3E 1BBRH 1XUFA 1N6XA 1MD7A 2HLCA 1C2FA 1NFUA 3E16B 4OS5A 1J9CH 2UUFB 3PROA 4Y7BA 1S83A 1TPSA 2UWPA 1J17T 1UK4A 2GCHG 1BQYA 3RXDA 1EP5A 4DGJA 1F5RA 2WPLS 2W7SA 3RXBA 1ZOMA 1BMNH 3TH4H 1SB1H 3M7QA 1XM1A 3RXEA 3P8GA 2Y5HA 4GHTA 3D49H 3A88A 4KTUA 5C1UA 1TWXB 4Y8YA 1HJ8A 2R0LA 1P09A 1UVSH 2SFAA 1A0JA 1TRYA 1EJNA 2GT7A 1Z7KA 4I33A 1SGNE 3TU7H 2PUQH 4AYVB 1FIWA 2R0KA 4A1VA 2O8UA 2JH0D 3STIA 3LGIA 3M5LA 1V2KT 1OWKA 3W95A 4INLA 3MU8A 4YLUA 4WXVA 1T8OA 3AW1A 4Q7YA 4GAWA 1AFQB 1IQKA 5C1XA 1TGSZ 4JK6A 1AE5A 4A92A 3KIDU 4R0IA 1A3EH 1QL8A 1EP6A 2AGIX 4MNVA 1KXBA 4OGYA 3NXPA 1BJVA 2Z3DA 1HAZB 1NRNH 1PQ5A 2J2UA 1AVGH 1Q3XA 1ARBA 1YPJH 3VXEH 3C1KA 3PWBA 4I8KA 2ZQ1A 1P2JA 1YPMH 1GBDA 3A7WA 2V0BA 1UCYE 4DW2U 2GCTB 1O3FA 2A1DB 5J4QA 4KTCA 1MU6B 4AG1A 1BIOA 3PMAB 4Z0KA 1GJDB 1F0TA 2UUKB 3GCTF 3ATWA 1K9OE 1YPEH 3SUGA 3S7KB 1V6DA 1FMGA 2BOKA 4AX9H 3UIRA 1G3DA 3UNSA 3BTTE 1AGJA 1TQ7B 3ZZ6A 4B2AA 1FLEE 1B0EA 2A31A 1Y5AT 4NWLA 2Y7ZA 3BTGE 1D4PB 1S6HA 1BUIA 3U98H 5EGMA 1DANH 4R8TB 1HAGE 1O2IA 2QN5T 1TMTH 1X7AC 5FPYA 3TVJB 1SFIA 1S81A 1RIWC 4JCNA 4KP0A 5EXLA 1V2OT 1IOEA 3DFLA 4NIVA 1O3LA 1GBTA 3MYWA 2YOLA 3KQEA 1C2KA 1ZJDA 1AKSA 1BTXA 2IN2A 3F9HA 2CXVA 1QNJA 1ZYOA 2GZ9A 4J1YA 1EZUC 4ZROA 1OX1A 3RXVA 5LPFA 4WH6A 1FY5A 1OKXA 2FS9A 1ACBE 2A2XH 4ZUHA 3VFEA 2RDLA 1YGCH 1BTHH 1FI8A 1DLEA 3A86A 1EB1H 1AWFH 2K1QA 1VCWA 2ZFQH 1V3XA 1MUEB 4LK4A 3RXKA 1KXAA 2F3CE 2H6MA 3PM3A 1XUHA 1QJ1B 1EQ9A 4UDWH 1GI0A 1ABJH 3HGPA 1ELBA 4BAMB 4WY3A 4WMDA 1ESBA 1MBMA 1DXWA 1GMHG 2GP9B 1O2SA 1HBTH 5EXNA 4D76A 1AB9B 1NRQH 3MTYA 3QO6A 3M5NA 2EEKA 4K2YA 3MH5A 4CRDA 2BVXH 3EQ0H 2C8ZB 1SLVB 4ABFA 5TCAA 2FOFA 4AFQA 1SQOA 1WCZA 1GI5A 2R9PA 3TITA 2BQ6B 1J14A 3NK8A 3QGJA 1TNKA 5HMAA 3BF6H 3KN2A 5DO4H 1Y8TA 1SGQE 2PLXA <