4A92A

Full-length hcv ns3-4a protease-helicase in complex with a macrocyclic protease inhibitor.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
639
structure length
639
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Macrocyclic Hcv Ns3/4A Protease Inhibitor Interacts with Protease and Helicase Residues in the Complex with its Full- Length Target.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
total genus 200
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4a92A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a92A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a92A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A03
3MU0A 3C27B 5KDDA 2P6RA 1NIJA 1J14A 4FWIB 2ZJ8A 1COWD 5EE1A 4DCSA 1A5HA 1CRQA 1A0JA 3SN8A 2R3YA 5DP3A 3MH5A 3TH3H 2KAIB 4EFLA 3ZZBA 2R6AA 3BFXA 2FOCA 2E1RA 2X2EA 2EI8A 1QL8A 1LS6A 4TY7A 2YWEA 4DC9A 4NYIR 1IHTH 1UCYK 5JSZB 1DAMA 4CVNA 3A88A 4L9SA 1CHOF 4LOAA 1KAOA 5SZJA 4AYWA 1EZQA 3UNQA 3KQDA 2CE7A 2Z9JA 2GESA 1C5XB 2BIFA 3NIBA 1T0HB 4TYYA 1ZRKA 4FD2A 1IOZA 2GMTC 1B0EA 4ZHLU 2XXLA 2GXUA 3DDCA 3ZS8A 1RRCA 2I1VB 721PA 4ARZB 1Q31A 3L8ZA 1P9NA 4C9BA 2CN0H 4G5RA 2QSZA 1KLJH 1YPGH 1GJ9B 3TJUA 3KGPA 1T8NA 1O87A 2CCJA 4LK2A 2O8DB 4LC0A 1JRTA 3UG7A 5CDFA 2QG6A 1MO3A 1BBRK 3JZAA 1Z8RA 4X0WU 3RSLA 1Z71A 1KSJA 3KL6A 4INLA 5LD2C 3BXZA 1KNQA 1W49A 1LTOA 4LYAA 4E09A 2YKGA 1NFWA 3F0TA 2ZRCA 4QOSA 5CIWA 5ETXA 5LGOA 2AXPA 1Z63A 4RCZA 4DLYA 4OHXA 4A1VA 3LGWA 4PHTA 2A5KA 2DB3A 2O52A 2EI6A 3A1UA 5FBRB 2HUPA 1QBOA 2FWWA 2P3UB 4LBVA 1VJAU 1XTSA 1T6NA 2Z9LA 4I33A 1ELBA 1H65A 2FZLA 1IQGA 1NN6A 3TUIC 4DSOA 4MDFA 2G5VA 2AWNA 2JETC 2RCEA 2AX4A 2JH6D 5JSZA 2BD9A 2NU0E 4NCYA 4YESB 2W6ID 3U4QA 1FQJA 3FHCB 5JWHA 3VR3A 1P62B 3H84A 1KLIH 2ZTZA 3GLIA 2F91A 1BHXF 3KQHA 1O38A 3GD7A 3WMEA 5BN3A 1GPZA 2W6JD 2FGJA 1TQ4A 1N6LA 1XZPA 2R6DA 1VCQA 2AGEX 1X1RA 1SHHB 1T7CA 4CH2B 1T8TA 2ZRFA 2PJRA 1S82A 1DVAH 2FSHA 3EQ0H 1BT7A 4WW0A 1WE2A 2G51A 1C1MA 1GKIA 5L6NH 3KX2A 3RXUA 3K9LA 1HAHH 2ZS7A 4DVGA 4H6SB 3MJRA 3HR7A 1Z6AA 2GAAA 1GHAG 3BN9A 1EAUA 1T4GA 3ZIAD 4MNWA 1SGRE 1N0VC 4X2VA 3URCA 3QXSA 4ABDA 4O9VA 3IIMA 4EJSC 2VRWA 4EQ6A 3O8RA 2F9MA 2OAQ1 1SVOA 2VHTA 4D26A 2RGNA 1S5SA 1KMHB 2W5EA 2ASEA 5HPYB 4Q7KA 4W5WA 4B75A 1W0JA 2ZWLH 4PPNA 3SJBA 4ZAEA 2B7DH 1E79D 1T5LA 3JZ1B 2BZ6H 5FTMA 4PO1A 2F1JA 3IDQA 1TGCA 2RH5A 3U6KA 3SJAA 3TUZC 4PAQA 2VINA 4ISHH 2BD8A 1R0WA 1IN8A 1GMCG 5T3HA 4PC1A 4DCDA 3RC5A 1Z8JB 4OI1A 1A2KC 3LX8A 3TK5A 3AKEA 5SZIA 3GJ4A 2FTLE 3BTKE 2BB4A 1JR3D 1GKUB 1BJVA 2V0BA 2N42A 5E0HA 3CRRA 1ANCA 5FUWA 4PSVA 3T29A 4ZO4A 1OW3B 3TGPA 1ZIPA 3Q72A 3ZVLA 2BM1A 1ZW6A 4OI2A 1ZJKA 4YDSA 3CWZA 2ZI9A 2O8CB 1KI4A 2PT5A 1UCYE 3KKNA 1AU8A 3QTVH 3M5MA 3A58B 1E2HA 1O3PB 4MUAA 5DSZA 4R7ZA 2BEJA 2WPLS 5GXPA 2JLWA 3LY5A 5KOYA 3W5IA 4DJZB 2EQBA 1J8MF 1S1MA 1NRPH 1W4AA 4JBYA 2D62A 1BHXB 3ZD7A 4XWKA 2CJWA 5M04A 1OPHB 3SJ8A 5FI1B 3VB7A 3D49H 5DP4A 4GPTA 1O35A 4A2QA 4DLTA 4JL6A 2BMGB 2O8BA 2J0SA 4PZYA 5LB4A 3ZZTA 1ZTJA 1ESMA 4Q4HB 1E2IA 3M0EA 4GT1A 2VEDA 4RD0A 1HAGE 4Q19A 3OESA 4AG5A 4JZFH 4Q48A 1TPOA 1TLDA 5C3NA 1XD9A 4TMTA 2ULLA 1E0KA 1LHDH 5EQQA 2SGPE 1D6JA 4MGIR 4ZDKA 2PLXA 1NRJB 3TSWA 5GJ4B 4XSHA 3SZNA 4M22A 4DLSA 2OBMA 4LHZA 1XF9A 3BIFA 3U8TH 4NKRA 2YWGA 1J16A 1IXRC 3BS4A 3EZ9A 2CE2X 2AL7A 3GLGE 4B35A 1CA0B 4YLGA 5IK2D 4D9RA 1K6MA 1E2JA 3PLPA 8OHMA 1DAEA 3QQ5A 4YOJA 3EA0A 2VVUA 1XMNB 2KJQA 4H9GA 1CJKC 3RWMB 1AUTC 1ZBDA 4FWTA 4TTPA 3U7HB 3B1WA 3LXXA 3GOVB 3TJNA 4I7YH 3QSYA 4CRBA 1QGFA 1S85A 4CT4B 2OLJA 4RD4A 5I46H 2QY0B 3LDXH 2WKRA 1G9IE 2QA5A 3WHLA 3B1VA 4ZPXA 2ZU4A 2D7DA 1KMHA 2ZSDA 3GY8A 3BE4A 4Q4AB 5GADl 3DKVA 2ZFTA 1VHTA 2EC9H 5F8ZA 1O3KA 1E2GA 3U5ZB 2WIBA 4NSYA 2V1XA 4US2R 1TMKA 2XTMA 4C0KA 2IUTA 2RB4A 5E7JA 1L1GA 2VHQA 3NUMA 3RXPA 3Q7QA 3STJA 1L1NA 4CEIB 3MH7A 1O3NA 4L8GA 1KXCA 4UNNA 1NZQH 1O2IA 4EUNA 1JECA 3RMMH 2WIAA 1W2HA 4ESTE 3V12A 3ZV8A 4LSGA 3SBKA 2PWXA 1V3XA 5CLQA 4I1VA 1G3DA 2QXJA 3KXLA 1TX6A 1FAXA 1TNDA 2Q9AA 4MGKR 3M5LA 1IQEA 2JLZA 4ABBA 2DWPA 1HYQA 1P2VA 5ANRB 2OBLA 5EZ6B 1XMIA 3SGBE 2AK2A 4P33A 2BBOA 2H18A 1G291 5FI0B 2EW1A 1QHIA 4DVAU 5DP7A 2G0TA 3WYFA 1MMJN 1TMTH 1GG6C 2GCPA 3OEEA 2GJ9A 4DLRA 2KSQA 3PENA 2QAAA 3KIDU 2AXNA 4LBYA 4WBSA 1DOJA 4Y0AA 1S83A 1G6OA 5ABWA 1F6BA 2CLDX 5A2MH 2PTNA 4ISLA 1SLXB 4A0HA 4Y6DA 2H5CA 1XMJA 4JS0A 2BDAA 1ZHRA 2STAE 2ZUDA 4FUDA 1V6DA 1DX5M 1QB1A 4BECA 2PJZA 1COWA 5A09A 1C5YB 6ESTA 4KXFB 3ZS9A 1GJDB 1K1NA 2BJWA 1YRAA 5CITA 5GJCA 1B5GH 1GFIA 1R0YA 2D06A 5EOKA 1F7ZA 1OS8A 1BCUH 4XSGA 5DIFA 3CWQA 4D9QA 3WRXC 4DLZA 4AKHA 1EJNA 1S0RA 2OCVB 2DE9A 3PMBB 2DHRA 1Y3YA 4NYMQ 1CF4A 2GHIA 1E9CA 4JKYA 3QWCH 4C30A 3QY0A 1H4WA 1CBWC 3LO5A 4HLUC 3OAAA 1DPOA 2CJIA 1KSFX 3RM2H 3TLOA 1V43A 3RUOA 2J0VA 3QG5A 3M7TA 1C1RA 5K7RA 4IEEA 2V3HH 2VWNA 4A36A 3QEOA 2C8VA 4B1TA 2RA3A 4BRWA 1LPKB 3M7QA 3MMGA 3QXCA 4LUCA 1WBDA 1EAIA 2ZJYA 2WTUA 3PQCA 4KP0A 2ZRHA 1HE8B 2ZE8A 1HE1C 1K5GA 1II8A 2WWHA 1DE7H 2H9TH 5BQ5A 3SU6A 1J8YF 4I81A 4MYUA 5DP9A 1TX8A 1FUUA 2B7BA 1CJMA 2ZUCA 2AERH 4MKHA 4DT1B 4CHAC 1ZHMA 2BV3A 3LFUA 4GFDA 1E2MA 1MRSA 4TPIZ 4EPTA 5L3RA 3LIWA 5D3MA 5G53C 4IDNA 1C1UH 1TGSZ 5L3VA 1O33A 3ZZUA 4F38A 2XXAA 5EPNA 1Z22A 3CB4A 3HPRA 1NFXA 5JB8S 2BVSH 1PPBH 1N2CE 2GZ7A 5L2ZH 4FUHA 1ZMLA 3RM0H 2VH0A 4P0TA 1QG2A 4BAQB 2FIRH 2WVJA 5HKKA 1SGEE 3SE0A 2O8EB 2LPRA 2GEVA 3SEAA 4CBOA 4OGXA 1IBRA 1R4AA 2QTFA 2ZFSA 3P8NA 3AVWA 2BOHB 2WKPA 3GFPA 3GP8A 1OJLA 4JJZA 3GY5A 1PYTC 3H86A 1XWIA 4I8JA 1VITF 5TCCA 3TH4H 2BQ7B 1KGDA 2PCJA 5JRJA 4HB0A 1AIXH 3LRPA 3SNDA 1TFXA 4OS2A 1WAYB 5TJXA 2F9BH 2F43A 4Q66C 4WXIA 3GY4A 1GILA 4FUIA 2WWWA 4JLOA 3IQXA 1AZZA 2ORIA 4JZIA 4NE2A 4BPBA 2O8UA 1Z6XA 1CU1A 3HK6B 4U32A 2NO7A 3M3TA 1DXPA 3T1VA 3ZYCA 4DT1A 1N6RA 1IOEA 2WJGA 3LD9A 3L6PA 2XZLA 3CPJB 1TQ0B 2FI4E 4ASHA 1X3SA 5LB2A 2V55B 4RKEA 2A3RA 3VMFA 4A8JA 4WH6A 1W36C 2IC5A 4DB2A 3V13A 5G41A 3RANA 3QLPH 2CGAA 3RXCA 4TLEA 4Q1EA 1P2OA 4BXSA 1CLUA 3RS3A 2HYIC 3BERA 3REFA 1SXJD 2HCJB 1L2EA 3H0KA 1EOJA 1TQ7B 4ZI3A 2Q6DA 1DM4B 3SO3A 4A5TS 4FCWA 4EKDA 1LHFH 4FUGA 3LWNA 4B3BA 4F4JA 1SXJB 3QVVA 2ZUBA 3VB4A 4LHVA 1C2FA 2Z94A 5LBIA 1EKBB 4YM9A 5EP4A 1GHBF 1HYLA 2ZU2A 1AVWA 1QRXA 1DY9A 1EP6A 1RGQA 1GGDB 3PCRB 1V2OT 3HYTA 2IYZA 1QRAA 1P57B 1GBHA 1P03A 4KTUA 4D81A 2ALPA 1THSH 4DHEA 1KLTA 1YPHC 2FPLA 2ZI2H 1YR9A 3HPQA 4MKFA 5J4HA 2HJGA 4V02A 2C9CA 2YNAA 2QTVB 2Y5GA 1AGRA 2Z5FA 4M9FA 4TT3A 4GMXA 3U7FB 2JJ1D 4RN6A 2BLWA 3KKPA 1Z0IA 1EFTA 1E94E 4QBGB 1C1TA 1Z6YA 4LRWA 4BGDA 3H4MA 1KSNA 2H2ZA 3GLIE 2JA1A 4IDQA 3HGNA 2PKAB 2P94A 3TAUA 3CP7A 2NMVA 1HFDA 4KTSA 1JPNA 3FMOB 2WAXA 1EJAA 3UQVA 1VG1A 4ASUD 5JBCS 3GCHC 3UANA 3TJVA 2BYAX 4Y0VA 5LPEA 3EPJA 4FUEA 8LPRA 1DAKA 1CT2E 4TY6A 3AM1A 1ZINA 1S96A 6Q21A 3F5FA 4JZKA 3UWKA 4AGJA 4BAKB 2ZGXH 2JLVA 4R8TB 4OL0A 1A7JA 2PMKA 2IBMA 4NDZA 3K0CA 1MH1A 2TBSA 4NP6A 1S3SA 2DBYA 2BKEA 5DP5A 2BHGA 4GCHG 1CS4C 1O2NA 3U3JA 1TIOA 5HGGA 4HB2A 4W9MC 1ELGA 4AN7A 3CLVA 2VF8A 1OP8A 1DS2E 2W6IA 3TIUA 3A6PC 4D76A 5BWMA 1S9DA 2GZDA 5DO9A 1K22H 2G9NA 2A7CA 1JAHA 5AVDA 3FANA 3MWLA 2OSBA 4I1SA 3IHWA 1UBEA 3T28A 1N5LA 1E3MA 3SFVA 3RS2A 3D8BA 4LHWA 1UTMA 2SGDE 1XEWX 4XD7A 2R9VA 4WWYA 5JCZA 4P4UA 1XPOA 3LH5A 1ZD9A 5TDHA 1O2GH 1OIXA 3TE6A 1J9CH 1M8PA 3B8HA 3RU4T 4LXBH 1SULA 3P17H 2C98A 2A5AA 2PKSB 3E3TA 1Q44A 2XNIA 3LXRA 4NHOA 4CEJA 2N1BA 1EP5A 4HAZA 4Z1MA 5KDOA 3TBKA 1XFAA 4F49A 1G2LA 3LKWA 4EPXA 4FCVA 4LGMA 3ZVBA 3A80A 3CX7A 3HJNA 3FP7E 5JMTA 5EPYA 1W46A 2QT1A 2C78A 3FE2A 2CCKA 4KYUA 4V0MA 1OH6A 4ZCIA 4PQRA 4X1NU 5J4YA 2ZE6A 5CM9C 4ERNA 1KI1A 2GVZC 1KO8A 3T1OA 3R3GB 1W0JD 3A81A 1OKKA 1TRYA 5GNDA 1J70A 1F2UB 1AA9A 4G5OA 1D6WA 3M36A 4ESVA 2FOLA 3CO5A 2EFHB 1D3QB 2Y7ZA 3SU3A 5DPAA 1GITA 3CX8A 2A5JA 2OHFA 4UNQA 3W90A 5EJEA 1WMSA 1WTHD 1BMNH 3FGNA 4K3JA 3KJIA 4DEYA 3RMNH 2XX3A 1NJGA 5JS7A 1MU8B 5J4QA 1C1QA 2QN6A 3VFDA 1W48A 1Y5UT 1O2KA 3VR1A 4DEXA 5HE9A 3BH6A 5AR1A 3VB3A 4TWZA 1ELTA 3K2UA 1QJ7B 2QENA 2Q6GA 2GGVB 1TQ2A 3R7WB 3RXJA 2DR3A 1P2JA 2FFQA 5C2JB 3A1TA 1FPHH 2BD4A 4NIXA 1OH5A 1BYUA 2ZU3A 3FKSA 4L15A 4IC6A 2A9KA 1T8UA 3EAQA 1LQEA 4XFQA 4E07A 2BTCE 4O0MA 1XUJA 2AFIE 1AHTH 1HJAB 3K9NA 3VNUA 1P3JA 3QVUA 4MTBA 1O3YA 1HV8A 1O3AA 2GDDA 3DZDA 2ZPTX 3SORA 4NONA 3OTPA 2WWGA 5G40A 1GM5A 1EPTC 2EFEB 4OJQA 3RWOA 3FHTA 2QXGA 1N3BA 4AWXA 1J90A 2CVFA 1T32A 1T3HA 1P9SA 3L0IB 3HDTA 4E7NA 4E7RG 4MLFB 1U9IA 2NZJA 4LJ6A 1SLVB 5KSZA 2AWOA 1ZSLA 3QPUA 1S1CA 3NBFA 3FWYA 1EB2A 3Q76A 3A7XA 1YBWA 4QXAA 4OHZA 2O0JA 1DG1G 4G01B 1IN7A 1Q3XA 2GBLA 1U0LA 1RW4A 5EODA 4LDJA 4UNRA 3ZJYA 3GLHB 3W5JA 1R5NA 3T61A 1NMZA 2FFBA 3ENSB 2O8LA 1HAVB 1GI9B 2V3CC 2ODWA 2A4RA 1HT2E 2QP9X 1EFCA 1VG8A 1UTJA 1RYFA 3DA9B 1AN1E 2CXVA 4RKJB 2WWIA 3UR6A 1F2UA 4II7A 2QRZA 2ZRMA 1OFHA 4B6FA 1GL1A 1SSXA 3IO3A 2P93A 1LPGB 3DOFA 1M7BA 1F2SE 1MKYA 4JZDH 2SGFE 2A7QA 2AMDA 5JYIA 3TGJE 1P3CA 3B13B 1XTRA 2CLSA 4LC1A 4KVGA 3ONWA 4MNVA 4RZUA 2QY9A 1O39A 2ERXA 3NC1C 3M61U 4TZ0A 2B5TB 1EATA 5UKDA 1NVXQ 2VP2A 1BRAA 2DWOA 4X8HA 5FCRA 1D9IA 2ATXA 2JJ1A 4HATA 2ZDNA 4IOMA 4HI3A 1JIMA 2J7KA 4PPGA 4O03A 2ZPRA 3IHLA 2EI7A 1SGDE 4YXWA 4ZV4A 2Z3DA 1WUNH 4TMKA 4AX9H 2O8FB 4DJTA 3HKJB 1SVIA 1EK0A 1Z0DA 1CT0E 3AF0A 1GBTA 1YQTA 1SLUB 3SQHE 4BZQA 3ZV9A 1O3MA 2GEDA 2STBE 2GZ8A 3U98H 1XD2B 3VKHA 4ISNA 1C2DA 1OH7A 2AMQA 2BM2A 3L0OA 5F3WB 3UXMA 1FN8A 3BSQA 3IEUA 1FQ3A 1ZTLA 2GJSA 3ASYA 4HZHA 1A2CH 4MYCA 5EXTA 1II8B 1FXYA 2ZHWH 3Q3JB 1CHOG 1KI9A 2Z6VA 2ZDLA 2ORVA 3GDUA 3MO9A 4RI0A 1AKEA 1VCIA 2GVDC 1NVUQ 3DM5A 1AFQC 2FGKA 1LPZB 1CRPA 3M35A 3U69H 3SQWA 2WPJS 4BTTB 1D5CA 4TL9A 1RJXB 3VB6A 4IHQA 2WICA 1MRNA 2HVXA 4QJ3A 5LPFA 3C5HA 1ZUNB 1ESTA 2GCOB 3P8GA 5J4KA 3T5GA 1K2I1 4ZDWA 5SZHB 3K70B 5JJIA 2ZF0H 1IQLA 4M21A 2FOHA 4ZKDA 1EWQA 5EQTA 1YP9A 1OYQA 3HU3A 7GCHF 3K9HA 4EAQA 4UXHA 4C2UA 1P60A 5HCIA 4KFTA 2FOAA 1QL7A 3TVDA 2HALA 2O8BB 5FTKA 1U9IC 1C4OA 3BRWD 1SL3A 1QBKC 1T4UH 2OXRA 3OE7A 4H6TA 1NN1A 4NBSA 3ECCA 4QNRA 1O32A 4CRWB 3M5OA 3S7HB 3EPLA 3PM3A 3Q00A 4RSGA 3AKDA 3CKLA 5JBQA 4UKDA 4QBFA 3K09C 3KQNA 1DG3A 3SN6A 4Q4HA 3RXRA 3V7TA 2QAJA 3RYTC 2Z9KA 1YZKA 2ZRJA 3LC3A 3OFNA 4Y10E 3I61A 3B23B 1Z0KA 4Q7LA 1CBUA 4TN1A 1P2QA 3WHKA 2NU4E 1HH4A 3NEJA 3S69A 4RZ3A 4Z8YA 1FMLA 4F4OC 3NC0C 2CMKA 1A46H 1OT3A 3I32A 2FNAA 1NRSH 1WA5A 5DHAA 1O3EA 4DUGD 2ZNKH 4PHGA 4BTUB 4E05H 5JRZA 1A5GH 1A1VA 2CF8H 3GYMA 4YOGA 1VECA 3UIRA 4GP7A 4GUXA 3OHMA 2UZIR 2F6RA 1G36A 4WXVA 4H4FA 3LBIA 3TQFA 1P6XA 3AGQA 5HKKD 3CNNA 3A84A 4Z6AH 1XU4A 2GF9A 1TA2A 1E0JA 3T15A 1QHGA 3CNOA 3OEED 1GL9B 3SJZA 4SGAE 1CA0C 2FEOA 1TABE 1BBRE 3MU1A 1SXJA 2GV6A 4GI7A 4JYCA 1L8QA 4PPQA 3K0SA 3TGIE 3RXLA 1TMBH 1GNQA 3U4QB 1GI8B 1QA7A 5JHGB 2W3KA 5AUQA 2ZJ5A 2VP0A 3HKIB 2GCTC 3SBDA 1K1LA 4KI0A 3WMFA 5HMAA 4OS4A 4PZLA 4WA7A 4NA8A 4LCBA 2CVHA 4IXNA 1RFLA 2ODBA 3AW1A 1BOFA 2PKSC 4NWLA 1Q1QA 3SYJA 4Q4LA 1I2MA 4JJKA 1RPZA 2C8XB 1RIWB 4KKDA 1F92A 3UOPA 3H2YA 4V0OA 2ATVA 2W83A 4YDHB 2H5EA 1LV7A 5KSYA 1O34A 3KFXA 1C4Y2 2YWFA 2IXGA 4IOKA 4NYJR 1EZXC 4X8LA 1AKSB 1CGIE 5FOVA 3O8CA 4A1XA 3U6BA 2WOJA 2GK6A 3PROA 4NCIA 1KJYA 1XKBC 1VMAA 2IUSA 521PA 1ODFA 2IT1A 3HU1A 3THXA 1K8RA 3ATIA 4BFVA 5KU1A 3UWIA 1Z0AA 3MNXA 1NLFA 1GG6B 4HZIA 1GBIA 1BZXE 3QEJA 4KLZA 5JBAS 1RXPA 1C1NA 2GT8A 1XNJA 1HB0B 4D2IA 1DAHA 2XWBI 4KTCA 1GRQA 2KBEA 1NLYA 3H09A 1MBQA 2HEIA 1GUAA 2PKAA 1AWFH 4X6NA 4AB9A 2XXAB 4ZKOU 3LA6A 1BUIA 1P01A 2XWAA 1QHNA 1UHBB 1O3OA 2R3UA 1T8MA 2OAP1 3KB2A 4JLDA 2D2EA 4HLDA 5JEEA 5TXGA 2JLQA 4EPWA 1ZP6A 3SOPA 1EAXA 3UWOA 4B6EA 2BD7A 3ZQ6A 3FYHA 1GBMA 4IOJA 2REOA 4JZ1A 4A4DA 3PUZA 2REBA 5J4SA 3LOXA 3TMKA 2ZCHP 4CDGA 2ODYB 2UUKB 2QPOA 5G3YA 3ZZ8A 1QVAA 3RRZA 2ERYA 2ANMH 2OFXA 4GZLA 2P6UA 3SJIA 5AK0A 1LO6A 2WOOA 3AK5A 5GVRA 3AUXA 1TF5A 3R8CA 1TE0A 1OKXA 4HAXA 3A8TA 1Z8IB 1DEKA 1H8HA 3ZVRA 2XJ9A 4B47A 2RAPA 1TTTA 3B78A 2D26C 1EB1H 1T9HA 1T0JB 4DBLC 3PTNA 4KYIB 2WV5A 4LJAA 2OFWA 3UREA 5ESBA 3H7OA 3RS7A 2Y5HA 2BX3A 5KTYA 5FL3A 2PW8H 2IS6A 4YLQH 3PR1A 4NIYA 2J0UA 3EIQA 3CZQA 1ZYUA 4IS5A 3GLHE 3NHAA 2FXRA 1V2TT 2J0QA 2XTZA 1XD2A 4AD8A 5A0AE 2ZEJA 3N2EA 1VHLA 4JYBA 2OXSA 3W9YA 1GMHG 2UUYA 3QKSA 4NYMR 3PYHA 2QF0A 3BTQE 2HNTC 3OYPA 2GV7A 1O2UA 3A37A 1V2WT 2VQSA 1W0YH 1V2ST 3LC5A 5E7IA 2J9NA 1GI5A 1A61H 2J2UA 2ANBA 5FPSA 3B82A 4HZUA 4PAMA 1JQJC 1G8PA 3D7MA 1G3QA 1OXVA 2ZRNA 3RMLH 1UJ1A 1SGIB 4FU9A 1E69A 1W44A 4KU4A 1HUQA 3U44B 1SXJE 2GDEH 1V2MT 4LZZA 1GMDG 1P4SA 5B6LA 3PEUA 2OQ5A 1YR7A 2XCNA 5E7MA 1KKLA 2BXTH 2NWNA 1GBBA 2IHBA 4TWWA 2WINI 3LW8A 1XUHA 3BOSA 2HXSA 4LBZA 4HB4A 1YM0A 3PTBA 2NPFA 2AN9A 4URWR 3X1YA 8GCHF 2IWRA 2QYIA 5GJWC 1YLDA 2C8ZB 5HTKA 4HAWA 4FIDA 4KITB 5GWZA 2BD5A 2FMJA 1UVSH 4CGZA 4WZ6A 3I5YA 3F6UH 1ELAA 4FMCF 2ZDKA 3JZMA 2IPHA 3KXIA 3PUYA 1NTPA 1T3SA 2W6JA 2ZROA 2ZJBA 2DE8A 1ELEE 1AI8H 5GIBA 3PMHB 1UHBA 5EXMA 4YMTA 2ANCA 3L43A 2PTCE 3JVUA 1WP9A 1QHRB 2IUUA 1NG1A 1N5KA 4TTQA 1DE0A 1Q1EA 5GCHF 1KZGB 4R2HA 1U8YA 3QKRA 2YC2C 2PT7A 1YKSA 1WOFA 2BD2A 1D2NA 3TPIZ 3QIAA 1JRSA 4JYUH 1C5RA 3FZDA 1TQ6A 2GCHF 2AD5A 4D7GA 1G41A 3UR9A 1O2XA 1KY9A 1KSGA 4HSEA 5EUMA 3S7KB 4AFSA 4ABAA 2OCBA 3K0AB 3IG6B 3ZZDA 1E2QA 5FH9A 2FDAA 4Q21A 5FX5A 3CBQA 4G5GA 1GCDA 2VIPA 1JXOA 2FH5B 2OO7A 1CT4E 4NGAH 5CIQA 2B0FA 3SU0A 3ODDA 5EE5B 3KJEA 1W12U 3CZPA 4CIDA 4AZ2B 2F3RA 2J38A 1VJ9U 4GHTA 4XVUA 4MYHA 2AK3A 4WZBE 4D4KA 1H9LB 4D0LB 3TLXA 2ZDMA 3DD2H 1MOZA 3W34A 3UY9A 2ODQA 3LLMA 1LVYA 4MITA 4DY7B 3GEIA 1E2NA 1R0ZA 2X2FA 1N6YA 5KSPA 5E0GA 3UNRA 4AYTA 1DWBH 1AK2A 4OYHA 1G2MA 4L16A 1F5KU 4MUBA 4Y0YE 2GP9B 1U90A 1DUAA 2RGEA 3AVYA 5JBBS 3EW9A 3GJ7A 1E79A 1X6VA 1RKBA 3L82B 1M6NA 2QNRA 1KY2A 1KNXA 2PLFA 2KWIA 2PX0A 4IVPA 5GJVC 2VSOA 1RE0A 4LJ8A 3R9XA 3URDA 2TGPZ 1W13U 2VWMA 2VSFA 3VQTA 5JHHB 1NN0A 4YZUA 5C1XA 3P8OA 1TAWA 4LY6A 3SUDA 4M1YA 4KFRA 2PR3A 5TB5A 3VHXA 4HUQB 1Z5ZA 4YT7H 1FDPA 5CK5A 2ZQ1A 2FO9A 5DK1A 4YMSA 2OCPA 4ZHAA 3B5JA 1Z08A 4FINA 2CDNA 1NBMD 1US8A 4V03A 2D74A 4UD9H 1O2QA 1YRBA 3QKRB 3SJOA 1FUKA 3EA9A 4D80A 3A8DA 3WYAA 3NKKA 2IEZA 2CL7X 3KTAA 1M74A 1M1YE 4HDCA 5KPDA 2JH0D 4R71A 1YJ5A 2WPKS 1Z0FA 5LPRA 1C1YA 1BQYA 1PUJA 1QR3E 2QGZA 4XTCS 2QN5T 2W2XA 2CF9H 1ZR0A 1II9A 2JJ2D 4HYYA 5DGJA 4K8OA 1XXFA 3EPHA 2RGGA 5A0BA 4C0AC 1SKQA 1HAOH 2C5LA 3RP2A 3CM0A 1ZVQA 1C2HA 3SU5A 5JLJA 1QY6A 4ABEA 2FX4A 1E9BA 5KNDA 1QTFA 3SI7A 4E5UA 2RGNC 2A7HA 3WBKA 4M0LA 1FIZA 1IY1A 4MYTA 3S1AA 3FKSD 3TK6A 3AV0B 3KXKA 3AF1A 4OKSA 1TNKA 2GXQA 2R2AA 2ZQ5A 1WQ1R 1HT1E 2GDJA 3K53A 3D6TB 3QKTA 1N6XA 1Q0UA 1GHBG 3UATA 3LBHA 3IWMA 3IIJA 3Q8XB 1SPJA 2VVVA 3OU0A 1O5FH 4DW2U 2R65A 2QP3A 1E4YA 3OIYA 2ZGJA 1SGWA 2PFEA 2HLDD 4VGCB 4BASA 1ORFA 5F2EA 1H8IH 3IIKA 4EFNA 1C2JA 4OGYA 3E16B 2PUQH 1S4QA 3GFTA 2AMPA 3NH9A 2PX3A 1WQVH 2SFAA 3OFND 2F9NA 3QPWA 3GMTA 3GCTF 4AG1A 2O8CA 3NVAA 4NCKA 3EZ2A 2QUZA 4QT8C 1K21H 5DI3A 4S35A 3EWAA 5FPKA 4X1RU 5H1YA 4C7OA 4FUCA 2JDID 2H8KA 1P5ZB 4TSFD 1T31A 2ZS8A 5JFGA 1G7TA 2BDIA 1OWJA 1TNIA 3QXHA 4P4SB 3OE7D 4XSKU 4FVBA 3A36A 4BLOA 1GTVA 1JXMA 1YCPM 3ELAH 3B7GA 2P3SA 3RHFA 4BNRA 1G32B 1THRH 3EC1A 5IRCD 1D9ZA 1N6HA 3ETLA 2CMYA 4DUGA 3EYDA 1GJAB 4JIMA 3RMOH 2BY6X 1SGNE 4ITRC 1EOLA 1C1VH 1DS6A 2V1UA 2Z0MA 3X1ZA 3RXAA 1W36B 2C96A 1SXJC 1IN4A 3B8JA 2B8WA 2ZPQA 1PLJA 1TUIA 1RIFA 1IHSH 4K8BA 1C1OA 1QQ4A 4CH8B 4KSBA 1OH8A 3P26A 3PWBA 1C1PA 1GJ8B 1UKVY 3R8FA 4AI6A 5JS8A 2XC5A 2GETA 3B2EA 1V2NT 4G5QA 1ETUA 4EFMA 4X8MA 2HNTF 4YONB 1P0SH 2ZRBA 4JVMA 3FOZA 1G3CA 2IS2A 5B64A 1ZU5A 5AJZA 1M7GA 1SBWA 4QGAA 3FMFA 3J81k 1AS3A 2V8OA 1N6PA 4XOJA 1OYYA 5PTPA 4DLUA 1CKEA 6LPRA 1Z06A 1HIAA 4ABJA 1Z6TA 4EPVA 3W95A 1W4RA 4Q1AA 1XDBA 1X7AC 5EP2A 2OCYC 3SYKA 4BWYA 3L33A 2B8OH 3BB1A 1AB9C 1IY0A 1HJ8A 3PEYA 5DN6A 3BTHE 2R0KA 2R9PA 4CRGA 2Z9IA 2J95A 1PYTD 4E03A 1O2LA 4EPYA 1CR1A 3KNXA 1DWCH 5A8ZA 1SGYE 4URVR 1KHTA 1KYIA 5DG6A 4CEHB 1G9XA 4CF7A 3NBXX 4GNKA 5FX6A 5DGXA 2JCSA 1XBTA 3RLWH 4R98A 3S9AA 3NBZC 2FJUA 1YCPK 1XKAC 4AFQA 1XD8A 4C7OB 2BLOA 4Q80A 1EXMA 4IGDA 3KJHA 4BAMB 5G4BA 1NVVQ 3A85A 3DFJA 1MAXA 3GFOA 3B85A 3ZVAA 2DUCA 3JVVA 1XUIA 1ANEA 5TV2A 3SV8A 3PITA 3ZIAA 2OZEA 3LX5A 3A87A 1VPLA 3SNAA 1HXFH 4YTAA 4ZXXH 4UFDH 4PC2A 1FP6A 3QE0A 2KBFA 4OHWA 4CHAB 2ESTE 4BZPA 2FLRH 1QHYA 4IJMA 1LVGA 1HEIA 1ZZZA 1QG4A 1L4ZA 2H1UA 1X8KA 2VB0A 3SJCA 4Q00A 3RXTA 3E2IA 4PANA 3BEFB 1OPXA 3T12A 3RXKA 4IW3B 4PO9A 1CULC 4Q7ZA 3IBYA 4O2RA 2VGCC 3GLIB 1P2UA 4RCYA 3RC3A 4U5XA 1F2TB 1KDTA 1N6NA 4LI0A 1A5TA 1P2SA 4AG2A 2ZS9A 2FEQH 1F5LA 1HPGA 3TNTA 1BJUA 1PLKA 5AJWA 2ZFRH 3UOUA 1A2BA 1G5TA 1ACBE 2Y5FA 3WRYC 2IJD1 1UBGA 1BMMH 4Z0KA 1QFKH 1SKYE 4RFSA 4A15A 2R6GA 2ZR9A 4AKIA 1QB6A 3RAPR 1WBBA 3MFJA 2FG5A 1UFQA 4LHYA 3FFBA 3KUDA 1ZM7A 5EZ5A 2ZFFH 1SG8B 1YR8A 2ZU6A 1FNNA 1MH0A 1GI0A 1ELFA 5EGMA 3VB5A 3LV8A 5AF9H 2F1HA 2QM8A 1KO1A 3WNCA 3VTKA 1SFQB 4U7DA 2J9RA 2Q3HA 2ZIQH 2G4UA 1O5GH 1X86B 1ZMXA 4WZAE 2GJKA 2CNWD 3A1WA 4AURA 2NU2E 1OYTH 4TMWA 4HEJA 5ELXA 4BUJA 1UPTA 4MRVA 4X6PA 1CP2A 2QAGC 2FZ4A 2AGGX 1E1QA 4IMZA 4ZHMU 4LYFA 3LGUA 3DVLA 1GVLA 2HJVA 2QZ4A 3C15C 4AKGA 3OSYA 4O2LA 1OLOA 5D3MB 2BDHA 1C5WB 1GKYA 4QHYA 1ONBA 1WCV1 5IF9A 2BOKA 3F1SB 2FOGA 1G16A 2ZHDA 2BY9X 1SI5H 5FCKA 1IJEA 2Y82A 2D4HA 3FTQA 2JDIA 1HAXB 2G00A 4JYTA 1BTYA 2OLGA 1AFQB 4FUJA 1OXGA 4B2LA 1N0UA 1YZTA 2C90B 3I78A 2VBCA 1Y3AA 4QJ5A 3W8RA 4BFTA 4AFUA 2BDGA 3BC1A 4FW9A 3T06B 5J5CA 1TL7C 5JI3E 1CTQA 3GJ5A 1DWEH 4B34A 4JSYA 3T27A 2QGRA 1KI3A 3T26A 4FU8A 4MKGA 4QBIA 1CJUC 2NIPA 4NA9H 4ILEA 5EU8A 1CO7E 4Q47A 2W00A 4DT7B 1SZPA 3TGKE 1TA6A 1K1OA 1JWTA 3FPAA 4UXJA 1E1RD 2WJIA 1P12E 3P4YA 2BY5X 2GZ9A 2P59A 3CS0A 1DANH 1NNEA 2DCUA 1NFUA 3ZVDA 3EARA 4QJ4A 4Q9LA 5L8VA 3HGPA 1PPEE 3T34A 4JLBA 3PO1C 5CDFE 1CSOE 1SHZA 2J1LA 3NKVA 1BRBE 1P73A 4M9SA 5FTLA 4XE4A 2W0SA 1KTTB 4M1MA 5P21A 1FMGA 1NN3A 1P10A 1U8ZA 2LKCA 5IDKA 4PC7A 5IDVA 1DLKB 1DWDH 3FVFB 1ARBA 4BFXA 1FONA 3WBJA 3CR8A 3K8YA 1ZNZA 2ZRDA 2OBQA 3LJJA 1O5AB 4B32A 1IJFA 4D25A 2QPAA 5DI9A 1U94A 4DDUA 1S81A 2JJ2A 4HB3A 5J47A 1AQYA 2XAUA 1BMFD 2CLCX 1GHZA 1MABA 2WPDA 1TNGA 4URUR 3VR2A 5F98A 1SGFA 2FZZA 3DFLA 1OWHA 1E2FA 1E32A 5FFMA 2F1IA 3A7YA 1E1QD 3VXFH 2FN4A 4C0LA 7GCHG 2ZRAA 2VIIA 4ISIH 1P9RA 2D2DA 4FCTA 2BKUA 3TK9A 4PHHA 3QUMP 4QG7A 3R7WA 3DMNA 5FAHA 1SVSA 3PWCA 3EASA 3STIA 3C41J 1LW7A 4ZIRA 4KGAA 1IAUA 1LQDB 3TAHA 2BDYA 4DWJA 1ZPZA 2QBYA 1KAGA 1O36A 1UDXA 4N1AA 1HDTH 2IYTA 1UO6A 2PZEA 5FR2A 3KQKA 4R0IA 3TW4A 4HUQA 2A2QH 3SHCH 3SYNA 2FOBA 1AGJA 1KMQA 1TGNA 1P75A 3WYGA 4DDTA 2L0XA 3MO6A 3L3TA 3UIEA 621PA 2NO9A 3SI4H 1C5PA 1BMFA 2HLDA 1LS1A 1C5MD 3DL0A 4QHTA 4PQYA 5BPEA 2W2TA 1IQKA 3EPKA 3F9GA 5FTJA 2D1JA 3TH2H 4KHZA 4B3CA 3SV6A 1HIAB 1ZD8A 5FBIA 4MRPA 1W0KD 4D6PA 3U60B 3G01A 4Q7MB 1Y8TA 1E35B 2ZJZA 1JIRA 3WNBA 3QNUA 3B9QA 1FTSA 2IYRA 2XB4A 1D3PB 3TSZA 2P2LA 1EG7A 1GNPA 1O2JA 3SYLA 3MTYA 1IQHA 7LPRA 5KUTA 2GJ8A 1NESE 1ZCBA 1GDDA 2VIQA 3MSXA 3EA8A 1W0ZU 4HDOB 1ZSKA 2B8TA 2NPIA 1WXQA 5DYGA 1C9TA 2VSXA 1DPFA 4TZ6A 3VEQB 3R0FA 1S9HA 1MR3F 1ZTKA 5KSOA 3C1KA 3SU4A 1HAPH 5JB9S 2OILA 1G7CA 2MMGA 3QGNB 2VLIA 4FUBA 1C2GA 1GHYH 4BAHB 1ELDE 4RFVA 3QF7A 4K46A 1FY5A 1ZPBA 1ARCA 5K8UA 3PEWA 1RTFB 5K8LA 5B2ZA 1ZRBA 2CHVA 2JLSA 2A0QB 2VNTA 5EG4A 2FESH 4TYDA 1I4TD 4PC3A 1RTLA 1S0QA 5EUQB 1AN0A 1HAVA 1JJVA 3TH5A 3NWJA 1OB2A 3K09A 2G52A 5EQRA 1AGPA 3LQQA 4LYHA 4PZZA 1BTPA 1OWKA 2WV9A 4B33A 4Y71A 1TOMH 3LPRA 4PSAA 1O3CA 3MU8A 3W6NA 3IKJA 4WF8A 3PMJA 1TONA 2OLKA 1OXUA 4M1WA 1M34E 1GRNA 2GD4B 3V9PA 1SQ5A 1HLTH 1KK2A 3EZFA 3PV5A 1PPHE 1O2HA 1OP2A 1B7XB 4BE7B 2IF2A 1OYWA 4TYNA 1G21E 4JCNA 1HCGA 5KDLA 4DCVA 3ND8A 5JECA 3MWJA 1AKSA 1EZSC 1LFDB 3BH7A 1D3TB 3MI4A 4YOIA 2F9OA 2V9PA 1DADA 2IWHA 2FFAA 3T2NA 1QBVH 2A5GA 2XSZD 2IL1A 1XMSA 5GJBA 2ANYA 2P3FH 1NJFA 3AUYA 2IYXA 1TADA 5AUNB 4NA7A 1W4BA 1KJZA 1AIPA 4UDWH 2IW3A 3UFAA 4TMXA 4TQ9A 5L3SB 2NO6A 1DO2A 4GOJA 4Z1MD 1TBQH 4A6XA 1NKTA 2BDTA 2Y7XA 1QJ6B 5DE3A 2ZGBH 2VPPA 4DIDA 5DJ7A 4JLAA 2I6SA 4RD1A 5DN6D 4M9ZA 1E1RA 1P8VC 4V0ME 2FSIA 1C4V2 4I99A 2G77B 3TR0A 3SZRA 1S3GA 3D31A 2J7PD 3GDVA 1U6QA 1O3GA 1OP0A 3V00A 1VG0B 4I8KA 4B76A 1NMXA 4JLVA 1CHGA 3EGKH 1WYKA 1G3IA 4TSFA 4WY3A 5T1VA 1MT0A 2IN2A 4Y8ZA 1FNIA 1N5JA 3I77A 2NU1E 2F9LA 3LGVA 1SB1H 1EASA 4EPRA 4ASUA 1K5DA 2VH6A 1E0SA 2QU8A 821PA 2ZYTX 1OWEA 4EQ6B 1F0SA 3GLGA 3OX7U 2DFNA 3BJIC 3OTJE 3GEEA 5IT5A 2ZI7A 2FEMA 2X8AA 3KFVA 4D0NA 2ZITA 1E2EA 4JLMA 1VIYA 1FV9A 3T1TA 1C5UA 2VWLA 2BQWB 3QO6A 3AGPA 3EE0B 1G19A 4XTRA 4P4TA 4B2AA 1GJ7B 1D2EA 4JK6A 3MMPA 3ZZ7A 2VL7A 4FI3C 1UTOA 2BLVA 1SGFG 2FSFA 2VA8A 4WH8A 4K2YA 2QAGB 2JH5D 1E2PA 2GK7A 3H5CB 1GHWH 3WNDA 4AFZA 7ESTE 2QMOA 4X2WA 1G1MA 1Z29A 2XOKA 2R2WU 1YLCA 1NS3A 4Q4JA 4X8VH 4ESHA 1QL9A 4NH0A 4A8JB 1HQCA 1JEEA 3MU5A 4F4IA 3ZZ9A 3RXMA 4ZH8A 1GMHF 4PROA 3RXSA 4QBHA 4Y79A 2R6FA 1O3DA 3NG1A 2AH4X 4WIAA 4Z54A 2G0NA 1A4WH 1AJEA 3TUJC 3RDZA 1LHCH 2P67A 2YHSA 4JMPA 2A1DB 1V2QT 2IYQA 1C2IA 4JLPA 1QHXA 3QJYA 3ZVFA 2NG1A 1GI1A 1I4DD 4JLJA 5FR1A 4QC2A 3NZIA 4Y7AA 1BIFA 1UTQA 2CHQA 2ZSAA 1GBEA 2OC7A 2Q1JA 1GMDF 3BWDD 3ZZ6A 3W3ZB 2A2XH 4OQNA 3QF4A 4E22A 3IQWA 1XM1A 1U0JA 1KXAA 5F9HA 1VGCC 1T5IA 1RC8A 4LJ9A 5HYOA 5B30A 3QZQA 4D4JA 2YOHA 3SJ9A 8GCHG 3AKYA 2QXIA 1XB2A 3PEVA 3P1JA 2J34A 4W5HA 3AVUA 6GCHF 1AQ7A 2W7SA 4OS6A 2V6IA 3LGTA 5EXXA 4UFFH 4OJKA 5T6DA 3UWJH 5GPIB 2F83A 1JXPA 3AB3A 2JGNA 4H1VA 4DIHH 4G3XA 1D2MA 2JETB 1FAKH 2FMXA 1IQMA 1O2TA 2PCLA 1YF4A 1FLEE 3S0NA 1GBJA 4MPUA 3ATMA 3VHLB 3H1TA 3VKGA 2IA5A 3MUFA 5CMXH 1P7CA 2H16A 5GCHG 1ZRHA 5FBLB 2B21A 3GQBA 3U8OH 1EFHA 4B73A 1W5TA 2QMEA 3U2QA 4BQSA 3MYWA 4HLQB 3W8NA 5KPJA 1YPHE 3QGJA 1AD8H 2QAGA 1BTWA 1GL6A 3B1XA 3SOSA 3ESTA 3OIVA 3U3OA 4NSVA 3IPYA 1SVWA 1G18A 4Z8XA 1TNLA 1H8HD 4WXRA 1R2QA 1TBRH 4G0NA 3QOFA 4LPSA 4ABYA 2OEPA 1ANDA 3TW8B 2A5IA 1XXHA 1VIAA 4WVPE 2C95A 1PV4A 3KQEA 4S2EA 2QT0A 3IBGA 4KFUA 4ZKSU 3KCGH 1DAFA 1NBMA 4YMUA 1JOUB 3NDPA 2NGRA 4GPGA 2AS9A 1PQ5A 4K1TA 3K70D 2F55A 4ABGA 1Z1JA 2WMNB 4Y76A 3LAWA 5KHOC 2QF3A 4QHSA 2FLBH 4A0GA 2YV5A 1RIWC 3KKQA 2C8WB 1TGTA 2FM2A 2O8WA 3MFYA 1Z8FA 1P04A 1DARA 2ZAMA 2J59A 2QIQA 1W7XH 1D3DB 4JVSB 1HBTH 4DLVA 1D9XA 4C0JA 4DDWA 4A9AA 2AFHE 1DSUA 4V0KA 4H42U 3WXMA 4NYIQ 4ZDJA 5EXNA 2WYJA 4TQUS 3CRQA 1SQOA 4US1R 1C2KA 2ZDVH 4U00A 4ZDIA 2VJ1A 2AGIX 1GJ5H 1YKTA 3P95A 4NWKA 1G3MA 5B58C 1UAAA 2EWWA 1FTNA 1OB5A 5A0CA 2ZRPA 1P72A 4A7IB 1TEXA 4WMDA 3I4LA 3K0CC 3K6YA 3BEIB 1BB0B 5BN4A 5EW2H 1P02A 1MZAA 3WP0A 4M1SA 3FAOA 5DP8A 1M7HA 3PB1E 5BW8A 3IEVA 4BLQA 2HV8A 2PL3A 4M7GA 1T4VH 1GHVH 4A92A 3BTFE 3DPUA 3ADCA 1DDJA 1QURH 1GHXH 2PBRA 1QHHA 3GLHA 2WJYA 5FL7A 1PJPA 1WDTA 1LF5A 1Z6JH 1Z7KA 4Q9HA 1G3EA 5JCPA 1G8FA 5FOUA 4GRAA 2PMDA 1CVWH 3PV4A 1VITH 3A1VA 4GLYA 2A4QA 4D4MA 1YZUA 4O97A 4YLUA 1VCWA 1QNJA 1Q3HA 3CUEF 2AFQB 3ZD6A 3MAAC 2A32A 3GJ0A 1ZIOA 2R0LA 1IN6A 3BIVH 1QQUA 2FX3A 1OIVA 2RG3A 1GI3A 3E5HA 2FODA 1GJCB 4NMMA 4Q9JA 1LMWB 2IHYA 4UONA 5SGAE 2F4LA 3CRMA 2H57A 2WM9B 2ZVQX 1SOTA 1QJ1B 2X77A 2ZAOA 3A7VA 2FPZA 3SQEE 3UMFA 4POAA 4FU7A 3GCNA 2OV2A 3TJZA 3QK1A 4UQOA 3M3SA 5EP1A 1TPSA 3CS7A 1O3BA 1TRMA 4ABIA 2CHGA 5KO2A 1NVVR 5E0JA 1XCMA 3T5DA 1HQYE 1WBGB 3K70C 1J17T 1N6IA 4OK5A 4ZIRB 2I1QA 3CENA 1L2TA 3FZZA 4NU0A 2GX4A 2H9EH 4UJ5A 3BV9B 1BMLA 1C1WH 1XZQA 4HGCA 4NG9H 1Q57A 5TMPA 2ZYWX 1FOEB 3I62A 4R9UC 1MKXK 4I4LA 2VF7A 4JL8A 1E0AA 2XBWA 5C1BA 1V2VT 3SUEA 4X1QU 5DI3B 3P70B 1VKJA 1L4UA 3BIUH 4IW4E 2J7PA 2XEXA 1ZPCA 1L1JA 3BORA 3RXBA 4DB4A 1A3BH 1HXEH 1SGPE 2BOVA 3DHKH 2QE7A 3C14C 5EE3A 4M1TA 2QI9C 3R20A 1MKXH 2ZSFA 2BQ6B 2WPHS 1JBKA 1Z3IX 2K5UA 5F9FA 2JKHA 4NL4H 2TPIZ 5E2PA 1W10U 1N8OB 4BLRA 4AGKA 3RXGA 3Q5EA 3U1IB 1OHHD 3SZEA 2VHUA 1PPFE 3GJ3A 4BFYA 1C1SA 4Q5IA 2OD3B 2J4IA 2BX4A 1OSNA 1QIXB 3E0PB 5L30H 4PAOA 3SV7A 4RKOB 1TNHA 3EDXB 3P6ZB 2XZPA 1AVGH 4KODA 1X8JA 2J5XA 3AAVA 2F9UA 4OHYA 1XUGA 3ATLA 1K1MA 1GDQA 3IUYA 3GJXC 3TVTA 1FQKA 2FI5E 2OUAA 2OP9A 1TAGA 2NU3E 1K28D 2DWQA 1P9WA 5F8XA 2A2ZA 3KQLA 2GBLC 3KB1A 3L8YA 4DURA 1OKKD 1E37B 3SNEA 3U9AH 1XPRA 2WHXA 3NHBA 4EIWA 3SQXA 2YNBA 2SGQE 1KIMA 2FPMA 4DCNA 1UEJA 5KNCA 1JNYA 4PPFA 3SR0A 2ZJ2A 1PQ7A 4MPWA 1Z07A 2CXXA 9LPRA 2ZM5A 2Z83A 5EXPA 5DKMA 4JLKA 2FA9A 2W7UA 1DTSA 1YU9A 3IPXA 3PUWA 1ZOMA 2FFHA 5JEDA 4WXPA 2ANWA 1Q1ZA 1WXRA 2ZR0A 1NL3A 2SNVA 2H7VA 1ZJDA 3D62A 1FP7A 3HATH 3I92A 3AVXA 2AYWA 1G37A 3PLKA 1UKEA 2WJJA 2WAYA 1Q22A 3CR7A 3I29A 3X1XA 4ACAA 4QGHA 1E9EA 1FFHA 3ZLJA 1FW6A 4P3YA 4IXMA 1NROH 1O2PA 1GDNA 3UPEA 2W3IA 5LH8A 2A4GA 1F0RA 2BBWA 2QGNA 3CONA 1J2JA 3VKWA 5FBVB 3TK1A 2OXCA 1XEWY 4A2PA 4AKEA 2VYFA 3THYA 121PA 4PR0A 4TTRA 1G7SA 1SC8U 4US0R 1LB1B 1GOTA 1E34B 2ZYVX 3KKMA 2J92A 3UNSA 1FJSA 4TWYA 1GI4A 1O3LA 1OWDA 3SHAH 2ZP0H 2HT6A 2ZHEH 2OC0A 3Q77A 4ZKNU 1HNEE 2XC0A 2BM0A 1P2TA 4AK9A 3GYLB 3KL4A 1RFNA 3RXFA 3R9IA 2IXFA 2QMHA 1MABB 4X8SH 1W1WA 1SQTA 2HYDA 4OM9A 1X8LA 2C99A 4LBWA 4CZ2A 3VPKA 3TR5A 1JR3A 2AD1A 4I8GA 3DZ8A 2W0MA 4Q7JB 1MO6A 1G3BA 4MG3A 3CF6R 4DOQA 3C4JA 2YVUA 1UVUH 4TLCA 2KAIA 3CRVA 1Z6GA 2NQ2C 2A5DA 2JATA 5FUXA 1HJAC 4HZUB 3V4RA 1O3HA 2ZHQH 1BITA 5DYIA 2DY1A 1YCPH 2XCFA 4Q9IA 3E1XB 2WPDD 5A8XA 2VU8E 4UNSA 3LLUA 2UVQA 1AZTA 1TU3A 1M2OB 2UWPA 3T5FH 1R0XA 1ZMNA 4MH0R 2FS8A 4M8NE 3BH0A 2BWJA 5F03A 1ZAKA 2P5TB 4WAUA 1A7SA 1GI7B 2Q9BA 2C93B 4RSPA 4LX0A 5KYKA 1UTLM 8ESTE 3TQCA 5L3QB 2ZRKA 2O8DA 1IXZA 3GCOA 3RC8A 4O3TA 1SVMA 4ZMAH 3A4LA 1V2JT 3QENA 1GI2A 1QHSA 1GJ4H 4HUTA 5IYTA 6CHAC 5C20A 3NXSA 5JI2E 1PFXC 1LTQA 3BBPA 4Y8XA 4YMWA 3S9CA 1XPUA 4DCTA 1MTNB 3TNSA 2ALVA 1HY3A 2I4IA 1UTKA 4CR9A 5C4GB 4X6OA 1OFIA 1MV5A 4XBDA 5JDUB 5CB8A 3WMGA 1RVDA 2XOKD 2WV4A 2V7QD 1AWHB 4NPHA 2H92A 4OQFA 8KME2 5TARA 2VP5A 2EYQA 3AVZA 1V2LT 2SGEE 1B23P 1RRGA 2Q0HA 3SNBA 5JJKA 4Q4JB 4UJ3A 2Z3CA 3THWA 5BYKA 2WBLC 5A4JA 2CL6X 2B6HA 4DRZA 3ZYEA 1R10A 2X1VA 2FDCA 2HCBA 4HAVA 1E9SA 3ICEA 2J3EA 3LH3A 1MD7A 2OC1A 4KJZA 2HRVA 3QUSA 2VIDA 2BVRH 5CK4A 1BS1A 3EAJA 2BJVA 2Q6TA 4C2TA 1BRCE 2PH1A 2ECKA 1KI8A 3Q3YA 1ZUIA 4LZ1H 4FMDF 1MTVA 1O30A 1XVMA 1ZNXA 4I8LA 2TRMA 2WPIS 2BXUH 3REGA 3VXEH 1C2EA 1WU1A 1VYTA 2IYLD 2KB0A 2Z7FE 3ZVGA 4OQXA 1TEVA 4XWAA 2J46A 2AKYA 2QORA 4KBFA 4PC6A 2ZHFH 3VU9A 4Q1CA 2ZRGA 2ODNA 1NO9H 3ZZAA 2THFB 1NM6A 2JLXA 4NZQA 4FMCB 1ESAA 4KAXA 4RZXA 2FV8A 2RGBA 3FHOA 1AUJA 4CYMA 1ELVA 3CIOA 1DELA 1CR0A 2YZ2A 2G88A 2FF7A 2WSMA 3AQ4A 1AM4D 1BOQA 2XZOA 3TIFA 1R8QA 3M7UA 3U7EB 3VAAA 2ODPA 1YZNA 3TRFA 3MRSA 5EE9A 4Q2KA 1KDQA 4ZCLA 1KI6B 3U7GA 5J4LA 5BRRE 3I73A 1HV7A 2GCTB 4IDPA 2OESA 3MJHA 4HAUA 1G20E 3ZDQA 3RXEA 3IGFA 4H1UA 1EXFA 1UM8A 4Y7BA 3VU9B 2Q3FA 1O2YA 2ZFQH 1B0FA 2VWOA 1BO6A 4ZKRU 2ZVPX 3A4MA 1Y59T 3UMRA 3D23A 4UFEH 2J87A 4NCHA 3V3MA 1M9UA 4I31A 2BVNA 3TVJB 1VCMA 3SV9A 3RLFA 4D8NA 4Y8YA 1X1SA 1GBCA 2R2MB 1LVBA 3OAAD 3Q7PA 1W11U 1JR6A 1I2DA 4JK5A 1KDQB 3AP1A 1P2NA 1Q3TA 3FFGA 1ZJ6A 2OG2A 1LF0A 2XTNA 1CBWB 1MKWH 3R9WA 1IHUA 4QNMA 1GBLA 2NO1A 1O5CB 1LNZA 1LKAA 3A7WA 2PLRA 5C1YA 4KO8A 1BRUP 2I3BA 3BK7A 1L7VC 3S9BA 4MQAA 1QHHB 4JVLA 3GY7A 3S1AB 3KN2A 2SGAA 4INHA 4HLCA 1G8YA 4C4PA 3BAFA 4K5ZA 4ON9A 4QL3A 4DIEA 2ZE5A 3QXXA 4QM6A 1MTWA 4KV9A 1MZDA 2ZC9H 5LPNA 1U2RA 2CHAC 2XBXA 4MGZR 4A0FA 1HRTH 1XEFA 4L5BA 3UG6A 5K8IA 4O3MA 5JWRA 2YYZA 1AS2A 1SOZA 2RHMA 3PVSA 1NP6A 4WMFA 2JLRA 1E99A 3QF4B 3PUVA 4B44A 1VCOA 1KIGH 2J94A 3P20A 5DO4H 1O37A 1TRNA 2Q9CA 5TY0A 3RC6A 5H70A 2D8WA 4D0GA 1E9AA 2RA0A 1SHYA 1Q1BA 4LWZA 4TL8A 1DLEA 1SHKA 3OEHD 2JLUA 4AC9A 1AY6H 3K9XB 2V7QA 5B57C 2A5FA 3UTUH 4LOYH 2ZA5A 3SU2A 2MMCA 1JJ7A 2D7CA 4M9XA 4I32A 1C9PA 1E4VA 2PZFA 4JBWA 4QGFA 2BBTA 2ASUB 2FWRA 3EWSA 5FTNA 4M1KA 3K0FB 4DLWA 3A82A 4URXR 2ORWA 1F60A 4YC7A 2ZRLA 2IEYA 3HP1A 4B2CA 3B60A 3ZZCA 1NRQH 1EWRA 3CPEA 2BDCA 2JLYA 2A31A 3L0PA 1LHEH 1F5NA 4YQFA 4CRAA 1TX4B 3VNVA 2QEQA 1AS0A 2LNCA 3SGAE 2RDLA 2R8RA 1NIPA 4I1UA 4PHFA 3PJRA 3AP2A 2Y80A 2VIOA 4NYJQ 3G0HA 2ZECA 3DO6A 3RS5A 3W6OA 2GF0A 5FPYA 1LCYA 1O2WA 4Q1FA 1GRRA 2YJTD 1EJMA 1XVOA 1DXWA 3A8BA 1G4UR 1HAIH 4M1OA 2O9QA 2C3SA 1ETSH 3LVQE 4MRRA 4D82A 4PQFA 2BC9A 3RS4A 3OY5U 3BTWE 1P2IA 2FYRA 1PPZA 1MCVA 4KSCA 1KDPA 3U3KA 3F8TA 1I4LD 1EZUC 3AASA 1Q21A 1KK1A 2RGDA 3SNHA 5C5OA 1MTNC 2PSXA 1K1PA 1XRJA 5CHAB 5C2ZA 5TCAA 3AH8A 2XRCA 1FY4A 4XVRA 2DPXA 2UKDA 1XXHB 1J8AA 5HZHA 1VG9B 4F4CA 2ZI5A 4ABHA 2SNWA 1ZC4A 2H17A 4C0HA 2WPMS 2EEKA 2OUKA 2FPKA 2DYKA 2HDNB 1KI2A 1Z28A 2R44A 1G8GA 1QRWA 4U02A 1P61B 1U8AA 5KNBA 2DFKB 2GILA 4U2WA 1PLLA 2X19A 4GSOA 4B3DA 4TPYA 1NBME 4AIIA 1JBUH 2CK3A 4CBNA 1KTSB 2AIQA 1GWAA 4GZMA 4CRFA 2QTHA 1KXDA 1EESA 3VGCB 2H1LA 3ODFA 3K0FA 1QBNA 3I72A 2WJVA 5FPHA 4X1PU 2FTMA 2O5VA 5C4MA 4MPVA 4LJ7A 4MPXA 4OK3A 5T6FA 1DO0A 3FVQA 3PIRA 5H8WA 1RRKA 4J0QA 1N25A 1KKMA 3SNCA 4ZUHA 2D3WA 2YOFA 1E36B 1PZNA 1SVLA 3UPUA 4Q7XA 1F3OA 1A0LA 4URYR 1TGBA 1E6CA 2IYSA 1NKSA 1WV7H 1HUTH 2WYGA 1UK4A 1P09A 2WWFA 5C46F 1AVXA 3CF0A 1C5ZB 2V3OH 5FUYA 2ZIAA 3RXOA 1TWXB 4Q4AA 3THXB 2P16A 4N3NA 3FKQA 4DIIH 1NT1A 1IQJA 1TALA 2HXYA 4MNYA 2UWLA 1BTHH 3MCAA 3KF2A 4EJSB 1N8OC 3LBNA 4K69A 4BTIB 3E90B 1VR1H 4IFEA 3ZGXA 4LJ4A 2ANKH 4AYVB 3GLFE 1BTXA 1ZCAA 1T91A 2F1RA 1TU4A 4IKEA 2GZHA 1O2OA 2SHKA 2PGQB 1ZMJA 1KTVA 1NI3A 5K0HA 2GTPA 4WOPA 1XJQA 4GAWA 3RXDA 2ZXUA 1XXHE 4C0QC 1UBFA 1E0FD 3HWSA 1JEDA 4XD7D 3TSOA 4GP6A 3A83A 4X2YA 3SS8A 1PPCE 1BMAA 1G6HA 2PEYA 2OBNA 1DITH 3MOCA 3AF2A 1Z6EA 4Q1BA 4NCNA 3HPTB 2XC4A 1JPJA 3OEHA 5C1UA 3RABA 5FUVA 1E96A 1P9UA 4CW7A 2CHAB 2UZ3A 2GA8A 4Q02A 4U01A 2ZPSA 3F3YA 1EUFA 1R5OA 2XNDA 3C16C 3BG8A 3CH5A 2V6NA 4SGBE 4CR5A 4L9WA 2KI5A 1O0DH 4GMDA 4XWOA 4BXWA 1F2TA 5CB6A 2HT1A 1P2MA 3SW2B 4D7FA 4Z51A 1GGDC 1DICA 3I3SR 3U8RH 5CYPA 5L2YH 1FY1A 3B9PA 5JZVA 4QM7A 1FL9A 1W4CA 4FUFA 2BY8X 4M53A 4QGGA 4GCHF 1OV4A 4P32A 3ZZ3A 3A86A 2QP4A 1TQDA 1Z0JA 4JMYA 3X1DA 2P3TB 2C9OA 4FMDB 4N0EA 4UEHH 1RZ3A 1W7GH 3NXPA 3GY3A 4LYJA 1OIWA 5E8EH 3E70C 2C4FH 2YINC 3VGCC 3TJOA 2QA9E 1IN5A 3E0NB 5IK2A 4O25A 1OSSA 2TIOA 4B2BA 3GLFB 9ESTA 4GL2A 4LK4A 2ILNA 4TT3D 2RGCA 1H9IE 1Y3VA 4UFGH 4C0SA 1IXSB 3HU2A 2G4TA 3CX6A 4NCJA 1VYUA 3HYRA 4JKIA 1E2LA 4LJYA 3EA7A 2A78A 2W58A 4DLXA 1IQFA 2QL6A 4R2IA 2PHBA 1O2VA 1VCPA 2GTBA 2WUBA 1JI0A 1ZGIA 2BBSA 3F9HA 4B74A 4A2WA 1Y3WA 3DMDA 3PXGA 3K65B 1EX3A 2VP9A 5C67A 1CR2A 1ZNYA 1E38B 1BH2A 5AUOB 4PTLA 1FY3A 2M5TA 2XYAA 1AMHA 3Q3KA 2AHOA 2WMOB 2XTTB 2QC2A 1C5NH 3GLFA 3IO5A 3O8DA 1QB9A 3BG4B 3M6AA 3B1ZA 3AW0A 2ZQ2A 2OE2A 3BFVA 2QRNA 1FNMA 1GSIA 1UADA 4EJSA 2MSDB 5TVKA 4Y11E 3PLBA 4I1OA 1G8HA 3GCTG 2ZJAA 2OK5A 4TLBA 2PZGA 1OF1A 1FY8E 1ANBA 3ZVCA 1NSTA 3THWB 2CJWB 4QFMA 4AYYB 1XJCA 1J7KA 4IN2A 3DT0H 2AEIH 4K1EA 2JASA 1Y5AT 4AY2A 1C5QA 1KXBA 5HR5A 3V0XA 4K1SA 1TX7A 2P6NA 4RD6A 4TLDA 5AJXA 2B7CA 2RMKA 4NIVA 1SVPA 3EC2A 2Z4RA 1IQPA 1BBRH 2XNSA 2GXSA 3X2SA 3MWIU 2VP4A 2Z43A 1KK0A 2QQ0A 1T8OA 3CW2A 4BRUA 2F3CE 3MH4A 3F9FA 3ZVEA 1AQUA 5CE1A 1FUJA 2QSYA 3Q5DA 3FP8E 2GWHA 2C77A 1S8FA 1R6BX 1E2KA 4GOKA 2JJ8A 4FVDA 1WSSH 1O2RA 3V4FA 2OQUA 2GAOA 3K1JA 3NBYC 3E6PH 5JBTA 4BLPA 1GWNA 1OFTA 3PV0A 5E3HA 4BEBA 4URZR 2F9VA 2A30A 1LVMA 1NRNH 2CCGA 1GZSA 2FSGA 2ZANA 3SV2H 2XBYA 2CEAA 1XTKA 1UTPA 4OS7A 2ZETA 1EPTB 3RNLA 1XUFA 2A7JA 2P5SA 1CGHA 1V2UT 1YPLH 3SHFA 4LHXA 3NCLA 1R8SA 2QROA 1ZSJA 5DHFA 4F92B 1Z2AA 3T25A 4QKQA 4C0BA 4U30A 3TNFA 4X8TH 1NRRH 1BTUA 4TL7A 3CPHA 2IF0A 3B6EA 3BFKA 2OBOA 1J99A 3AVVA 5A8YA 6CHAB 4A6LA 1G3UA 3BTME 1N6OA 2W2VA 5FOWA 2A4OA 2ZEBA 1BTZA 1ABJH 3RVBA 1OX1A 4MRSA 1S6HA 1DBSA 1WB9A 5A5GA 1ANKA 2QXHA 4LPKA 4XBCA 2ZO3H 3QI2A 5CHAC 1QA0A 4BFWA 1L4DA 4XH9B 1OE0A 3I8XA 5GDSH 1MU6B 2ZYUX 3KKOA 1F48A 3RXQA 4W7SA 1LKBA 2HF9A 2IJOB 1G5RA 3MH6A 4X6MA 3SU8A 4QRHA 4W5JA 3LVRE 4Q1DA 2ZCKP 2ZTSA 1GL0E 5FL7D 3QPVA 2QQEA 2G83A 1OWIA 4X2XA 3KQUA 1D4PB 3FB4A 1SLWB 2TGTA 2VO1A 1PQ8A 3VFEA 5I25A 1QCPA 1G3RA 4UXIA 2Y8EA 1A1RA 1ELCA 4NFFA 2AKAB 3ZVMA 3I5XA 2QPTA 7KMEH 3RXVA 5JPMH 3RRNA 5E2OA 5A0FA 3N70A 1GNRA 1E98A 1E9RA 4BLTA 1NG9A 3A4NA 4MDEA 3Q9LA 1ZNWA 1O2SA 1K1JA 1NY6A 3DOEA 1W3CA 1PJRA 3BGWA 1AE8H 4WVFA 1W8BH 2G5NA 1RRPA 3G5UA 1O3IA 3X1WA 3SHWA 1GHAF 4RY2A 3ASZA 2O0KA 4F7WA 5JJLA 1A4RA 2Q3MA 4TQAA 1N6KA 2GKSA 4IVQA 4MDSA 4LV5B 4YXWD 1H9HE 3MNSA 3MWKA 2WSSA 5CYOA 3Q85A 1UEIA 4XBBA 4XIGS 3UUZA 4DDVA 1A3EH 1W7AA 1FX0B 3N5CA 1GCTB 2GJAA 1K1IA 2LKDA 4KLNA 1DY8A 5FBQB 1GJBB 5G3ZA 3OIUA 2NTYC 4GOXA 1XTJA 4IFBA 2F9PA 3ND9A 2EWVA 1UMAH 1A82A 1ESNA 2EU8A 4AYXA 4HFPB 3KHVA 3LT3A 4YO9A 1CR4A 1GJ6A 2GT7A 1GMCF 2REXB 3DHWC 3EA5A 2QE7D 4CRCA 1U0HC 1YGCH 5IHPA 3ZZ4A 1HAZB 2WUCA 3OIWA 4C3ZA 3QZRA 3E1SA 3U1JB 3GPLA 5AFYH 5DP6A 3GEHA 5F6MA 3TITA 3QBVA 2YNMA 1Z1IA 4TLAA 2LCFA 2V4ZA 4B3GA 3GJ8A 1Q20A 1G5PA 1KI6A 1Y5BT 3P8FA 4X8OA 1NSFA 1C2MA 3GICB 4NFEA 3AVOA 2ZG0H 1YE8A 3VX4A 3LU9B 3K0EA 3WY8A 1FN6A 2GNOA 3VX3A 4DKXA 3ATWA 1TYNA 2TGDA 4DG4A 2RCNA 2G3YA 4NZYA 1DAGA 2VTKA 1GVKB 1HJ9A 1US8B 1SGTA 2BMDA 2HNTE 5AUPB 1H8EA 5DH9A 2BLQA 1VCNA 4P31A 3KTAB 1CJTC 4XVQA 4OI4A 3N7OA 2VH5R 3DEFA 2QCYA 2EFCB 1AZSC 1Q12A 2XITA 1MAYA 2QMUA 3MHWU 4TYPA 4BFSA 1ZYOA 2BMEA 3UQOA 1KO7A 1ELOA 2OT3B 1AE5A 5EE0A 1GP2A 4YMVA 2O0HA 4LV8B 3D65E 4K8YA 1HA3A 1Z2CA 5HXFA 1SR5C 3F68H 4J1YA 5GVSA 2WJHA 3SU1A 1WRBA 3ZH9B 1D8TA 4Q01A 1CGJE 4DSTA 2XNDD 3GCHB 1SQAA 1XUKA 1JMOH 1BYIA 2C04A 1AZ8A 4FMBB 5LDDC 4ZXYH 4GDFA 3F9EA 2IYUA 3THYB 4MVNA 2F43B 5AHGH 4DCUA 3M3VA 3LNCA 2OC8A 1GBAA 1YHNA 1Z83A 1UJ2A 5EXSA 1TMUH 3MU4A 2XSZA 2UWOA 1IQIA 3OF5A 4JVNA 4BFZA 1MUEB 1KZ7B 3BB3A 5J40A 1FX0A 1Y3UA 1S84A 1C5SA 3TKLA 3BTEE 1LY1A 2JEOA 4V0NA 1RS0A 3CNLA 4BAOB 1IM2A 3GDSA 2NZ8A 4CEIA 1TF2A 3HR8A 1YZLA 4B2PA 1GG2A 2H5DA 1O3FA 4DGJA 1U99A 4IMQA 2E87A 1VDZA 2A45B 3O8BA 1UTNA 4HI0E 3MWYW 4A0RA 4JT4A 1V5WA 2HWLB 5AWFC 3QDZB 3KDSE 4GSYA 4MKIA 3SDZA 1ZU4A 2WWXA 2B92A 4BOHA 4E06H 1UKYA 3QG1A 5HCNA 4IEIA 1C9KA 1T3LA 1FIWA 2PGBB 1UVPA 4L4UA 1PVOA 3A7ZA 1HURA 1NVWQ 4HLUA 1MQ6A 1SVKA 1MTSA 1OOKB 2ZREA 4ZKEA 2BZAA 1UBCA 1XX6A 2GKVE 1KJWA 1XXDA 4IOLA 2RKOA 2H6MA 2IOTA 2C2HA 4OS5A 1ZM3A 4M2LA 4PFSA 2OTVA 1G17A 1YPJH 1C4U2 4MRNA 2ZSBA 5HM9A 3FDIA 1ZC3A 4F93B 1OFUX 4Q7YA 2IXEA 4IDHA 1TPPA 3LJOA 1J15A 2AR7A 1SGQE 4FN5A 4JL5A 3SI3H 4TMZA 4NTZA 1CEEA 2F7SA 3BD9A 1Z47A 2N46A 4MGYR 1YZQA 4VGCC 1QZXA 3U3MA 1V2KT 5L3QA 1ZM2A 4ACBA 3P27A 3WY9A 2ZZUH 2FYQA 5ESTE 1KDOA 2FOFA 4B2IA 1RRFA 3T1QA 1MCTA 4OS1A 4CRDA 2RHDA 3M1IA 2BEKA 3QX5H 1WTGH 4OQMA 1ID5H 2J41A 4B43A 4G1UC 2GCNA 4OBEA 1EQ9A 2OFOA 2OCAA 4Q9KA 2O8MA 4A1TA 1IONA 1KK3A 1FPMA 2IYYA 2ZJOA 3PO1B 2ZRIA 1MO5A 5EQSA 1V2RT 3LQRA 1JR3E 1WF3A 3SFZA 2FOEA 1C5OH 3RXIA 1NY22 1FZQA 3UK6A 5F8TA 3AF4A 1E2DA 3SUGA 3Q3XA 1L4YA 3KQBA 2K1QA 1BIOA 3AVTA 2PV9B 5T6GA 3NPSA 2YC4C 2BD3A 1IAQA 4HAYA 2IYWA 5CJPA 3P92A 5AFZH 4D4LA 5B6OA 1W2GA 2TGAA 2I6QA 2VHJA 4RKFA 1ZUHA 5DNYB 3OY6U 4JBXA 3LONA 1TPAE 1ZM9A 1KDRA 1RTKA 1YC0A 4ABFA 1GBDA 3O47A 2FOMB 2NOAA 1ZHPA 1KY3A 4RD3A 421PA 4A8JC 2YOGA 3LH1A 3SUFA 1F5RA 4NZLA 2WSSD 2ZU0C 3A8CA 2BCJQ 3EIHA 1HAYB 4BFUA 3DM9B 4DSNA 1GVZA 1O3JA 5FOTA 2OINA 4JLNA 2HGTH 1MBMA 2JIZA 4OI0A 4PX9A 2G55A 4TL6A 1AFEH 1OHHA 3RS0A 3A89A 1FI8A 3BF6H 3ICQB 2P95A 1ABIH 1SKYB 3I8SA 4BANB 4GHQA 4XJXA 5SZKB 1ESBA 4KELA 3P32A 3THOA 2G1KA 3T62A 4BZXA 3H7TA 1P11E 1SMFE 2Y6TA 3ADBA 1RJ9B 2GRJA 2V6JA 2BMJA 2VIWA 4K60A 2RGAA 3C8UA 2XBVA 3NTUA 5C5NA 3WP1B 2UUJB 3W3AA 4P4SA 3FMPB 1N5IA 2R62A 1XJ0A 3EZ7A 4DZZA 2BHRA 2J45A 2VGCB 4AB8A 4RVCA 1UF9A 5FOSA 4B48A 2F3TA 2GCOA 4IRUB 4EDHA 1VITG 2WWYA 3GISB 3SJKA 4HTCH 4YT6H 2HOBA 2VIVA 3BEUA 3UMSA 2ZTXA 1Q2WA 1BA8B 1NC6A 4RJLA 1W0KA 4G5SA 2D2FA 2ZU5A 4M4SA 4OHVA 1HTWA 1CA8B 1JALA 4IC5A 1JQLB 2ZFPH 1QF9A 2C03A 1UDWA 1THPB 1KO5A 5BN5A 1C5LH 2ONJA 4ZCMA 2WZQA 1KSHA 1OXSC 221PA 1S2MA 3U3RA 2RGXA 5EP3A 4Q18A 1QRZA 5E4FA 3NDBB 2XGJA 3RU4D 2J0UB 2VHCA 1UVTH 2G8TA 3ATKA 2H9HA 4XDEA 1DOAA 4TYQA 1B0UA 1Y63A 1KXFA 2IS1A 2IX3A 1YPKH 1EX7A 5HM2A 1LHGH 3M4YA 2ZDAH 1INCA 5H68A 5FXLA 4IBLH 2XW9A 2JAQA 5AJYA 2GCHG 1NFYA 4MA4A 1G64A 1OXTA 1RJ9A 3QKUA 1EPTA 1NLZA 4OQLA 2O8TA 3B9FH 1TF7A 1VGCB 1FMJA 1GVNB 5BYJA 1RD3B 2WKQA 3GY6A 1CQQA 2YOLA 4DXAA 5C18A 4N0DA 2HPQH 1ETRH 4GBMA 2YWHA 1R5BA 1DAIA 3P4XA 1U98A 1EFRD 3NWUA 1YYY1 1N1LA 1EX6A 4NIWA 2CNWA 1TPZA 2Q21A 1S0UA 3DKPA 3W94A 3D3QA 2BMFA 3EXAA 5CJ2A 3SC3A 4ZI2A 4LZ4B 1AKYA 3KZ1E 3NEYA 2AIPA 3KJGA 2VVCA 1PUIA 1DSTA 4UNPA 4M9QA 2QBYB 2FX6A 1G7RA 4A6PA 1H8ED 2FE4A 4FXPA 2DFLA 2HF8A 1UVOA 1EFUA 2ZR7A 3IITA 5H4IB 3CH4B 4JT2A 1JB1A 4F91B 4Y0ZE 2CV3A 5DISB 1XX9A 2GZAA 5FBEA 1VYVA 1RYHA 3LDAA 2FU5C 2EFDB 1TNJA 1QVRA 2E9SA 3FP6E 2KE5A 4WJG2 3ZQJA 1EAWA 2ZGCA 4XOIA 3MO3A 1F0TA 3RC4A 4B3XA 5HE8A 5AJVB 2CL0X 3RU4E 2EYUA 1O2MA 3PUXA 1QDEA 3G82C 6GCHG 2G1JA 1C5TA 1GBFA 3BTTE 1XMVA 1MTUA 2CK3D 2QV1A 2EFGA 5JWOA 1KYNA 3C5CA 1D6RA 3PFIA 1XTIA 2BCGY 2O8EA 3GJ6A 2C8YB 3VR4A 1F0UA 4MQBA 3T35A 3PV2A 4I8HA 1IY2A 2HPPH 4ZROA 3BTDE 5FBWB 1Z8GA 2JIZD 1C2LA 3ZVNA 3B1YA 2FP7B 2V54A 2ZU1A 3NH6A 1WQSA 3A7TA 3U61B 3EZ6A 1WCZA 3KEEA 3RRMA 4HDQB 1G30B 2EVWX 3QXJA 1O2ZA 4LJ5A 1P2KA 1E9FA 3ADKA 5D3QA 3OZXA 1NMYA 4IDOA 2O8FA 2W26A 1N0WA 1CJVC 3MD0A 3JZ2B 4CT5A 1W5SA 1P3EA 3RSOA 4A1FA 4PSKA 3CF2A 2V35A 1NU9A 4CEJB 1PPGE 3GCGA 1MO4A 2ZKSA 1CIPA 1YVDA 1SFIA 3RRYA 1W2KH 1KXEA 3E8LA 1DFPA 1KI7A 4RFSB 4DSUA 3AF3A 4KVAA 3A8AA 5LD2B 5HZKA 1TB6H 4PO8A 2PEZA 2BY7X 4CREA 3C7KA 1MD8A 2R6CA 1K9OE 1DVRA 1ZGVA 1ETTH 1GCTC 2GVFA 2C9YA 3AAUA 2FS9A 1XEXB 1FZZA 3L2OB 2XJ4A 3MNBA 1PQAA 3KQCA 3VR6A 4V0LA 2QM7A 3GY2A 2Y81A 2Z3EA 3SBEA 3M5NA 3BG4C 4INKA 4J2YB 3RXHA 5CM8B 2MSCB 4ISOA 1NF3A 3KUCA 1S6FA 3QKSB 4THNH 1JAIA 4FXGH 5FPTA 2IK8A 1O31A 1KOFA 4LV6A 1KO4A 3DUXH 2ZI6A 2PUXB 1SGCA 3ZYDA 2CBZA 4KBGA 3W6PA 4UE7H 1NN5A 1VZQH 1GIAA 2ONKA 2P0EA 2OM2A 5J4VA 1BKDR 1OXXK 5DLQC 5K8TA 3SGQE 1AB9B 1BDAA 4JZEH 1O5BB 1EGAA 4X1SU 3GLGB 3N2IA 1G4AE 1YR6A 3BTGE 1EFRA 1U81A 3LW7A 4CEHA 3QTOH 1H8DH 2Z4SA 2G6BA 5CLLA 4KCGA 2G81E 1ZD1A 1C5VA 2B9LA 4WMEA 2A5YB 1XCGB 2VP6A 2P8OC 3QBTA 1CXZA 1YZGA 3EIEA 2ZI4A 1TUEA 2ZI3A 5FHTA 1H1BA 2GMTB 1O5DH 5E95A 4AOQA 3BB4A 2ZTYA 3NK8A 4MNXA 1DT2A 3U44A 4KFSA 1T8LA 1XTQA 3MLEA 1NU7B 2P65A 2GXAA 2Q6FA 2Z9GA 2NO0A 1LDTT 4BLSA 1Y3XA 3ITIA 3QN7A 3PG5A 3AVQA 2TMKA 2EA3A 1FPCH 1A0HB 3E91A 4Q03A 3AKCA 4ARZA 1W14U 2BVXH 1CE5A 4IN1A 2XB2A 4TMVA 1V2PT 1HGTH 1TBZH 4GVUA 5FOXA 4IVRA 3FFAA 2ODEA 4K81B 4AORA 2ZCLP 1GL7A 4OK6A 1VTKA 2GEUA 1UK3A 5EXLA 2DFTA 3EG5A 4BEJA 5EW1H 2Z6BD 1E9DA 3MNCA 2IS4A 1YPEH 5L3SA 1GDUA 3UKDA 3PMAB 1GBKA 3ZZ5A 4JYVH 4JSTA 1UKZA 4PXAA 1LVOA 2ZGHA 1II0A 1XEXA 4B3FX 4B71A 4TYWA 2ZE7A 4O3UA 3L0SA 4A82A 1R7RA 2HLCA 1XP8A 2ZSEA 2FI3E 3EX7C 1L0ZA 2UUFB 3HK3B 3RDPA 1NY5A 1AO5A 4AG6A 1MQ5A 3CRW1 3ADDA 1MKWK 1UK2A 1ZLRA 3A1SA 2PSYA 3AEZA 1ZM4A 2MSEB 3MGCA 3LGYA 3VR5A 3K6ZA 3K9GA 3LGIA 3TU7H 1IQNA 3AP3A 3ZZ0A 3IILA 4RD2A 3RLYH 3FMIA 1W36D 2P8OB 1NPMA 2IYVA 3MG9A 1GI6A 1DUEA 4X8UH 5BXQC 2BDBA 2LWIA 1YPMH 1W47A 1TOCB 1O5EH 1XCPA 3K0AA 1GAJA 1P06A 3AVPA 3I1FA 4RZ2A 3M37A 1A5IA 1UCYH 1P05A
chains in the Genus database with same CATH superfamily
2C8KA 3PQ6A 3MU0A 1V8DA 3U7QA 3UGQA 3FOAA 1XZ8A 2PKYX 3C27B 3ESBA 3R0QA 5KDDA 1T8YA 3R44A 3TSCA 4TTJA 2P6RA 1NIJA 3R3ZA 1DC5A 3WQRA 2R79A 3DHNA 1J14A 3JQCA 4RV4A 4FWIB 2BCEA 4MW9A 1CVRA 2ZJ8A 1D4FA 1COWD 2XI4A 5EE1A 2Q6KA 4DCSA 3LKBA 1VMDA 3VR3D 2VDWB 4QU8A 1A5HA 5SY4A 4BX9A 2AUMA 1CRQA 3ELDA 5E6UA 1A0JA 3IEMA 5FDFA 3SN8A 1RJEA 2QVGA 3MUEA 4D44A 2R3YA 5DP3A 2R48A 1QF6A 1P33A 3MH5A 5C35A 3TH3H 2WB4A 2KAIB 4QPDA 4EFLA 5BMVA 3WB1A 5EZQA 5EJ7A 5IJZA 5JH7A 1JXQA 4H3KB 3ZZBA 4YNBA 3MJEA 3PUKA 2R6AA 3BFXA 4MW1A 2PQ2A 3DL2A 3EVNA 4PNPA 4DYHA 1KWKA 3MELA 2FOCA 2E1RA 3RU3A 4AF7A 2AV6A 1ZVVA 2X2EA 2EI8A 2G5CA 1RM5A 1QL8A 4R8LA 1PV2A 1Q17A 1LS6A 4WRRA 2ZWOA 1OXKB 3SJ7A 4TY7A 4ETMA 2DWCA 4I1YA 1JEAA 5B5SA 2P69A 4N0QA 2FYTA 1AV6A 4PU0A 4J4HA 2YWEA 3P9KA 4P4LA 4PSUA 4DC9A 2CNDA 4NYIR 2FEWB 3FI9A 4KP7A 2IYEA 4LE1A 1IHTH 1UCYK 2R5FA 4CM9D 5JSZB 1DAMA 3U4CA 4C7JA 1W52X 2V45A 4C22A 1R0CA 2FOIA 4YUZA 4CVNA 3A88A 4RL4A 4L9SA 1CHOF 4COOA 4LOAA 1KAOA 3AEQB 3DZCA 4X1KB 1JHQA 4MRMA 1EZQA 3LUBA 5DSXA 4WOBA 3UNQA 5SZJA 4AYWA 4BEWA 4GE0A 1Q14A 3KQDA 4QYMA 2O3RA 2YW2A 1DWOA 2CE7A 2Z9JA 2GEBA 2GESA 2PYDA 2NSYA 2VHYA 2XUOA 1P3Y1 2C2ZA 3JQGB 4UMFA 1C5XB 2BIFA 3NIBA 1T0HB 2M32A 2YZMA 1UP7A 3GPDG 2HZBA 3JQ9C 4TYYA 2C1XA 5BSUA 5BUSA 1ZRKA 4FD2A 4K7JA 4EBBA 1IOZA 2HIMA 1PGOA 2EIXA 2VA9A 4DREA 4GX1A 3PIDA 1PFGA 3W06A 3KKEA 2GMTC 3ZDCA 1B0EA 2J9GA 4ZHLU 2XXLA 1FQOA 5FBKA 4DANA 2GXUA 3DDCA 3ZS8A 4KXQA 2I1VB 3OHSX 721PA 1RRCA 3VR6D 2YWRA 1ZK2A 4ARZB 1Q31A 3GQBB 3TRIA 3IE1A 3L8ZA 4NESA 5AW6A 1TZ2A 1P9NA 4C9BA 1KBZA 5JAQA 2CN0H 2RHWA 4G5RA 2Q1SA 4MPTA 3KELA 5CAEB 2QSZA 1KLJH 3ICPA 4S3MA 3N8KA 5AM5A 3AINA 1YPGH 1GJ9B 3TJUA 2FW9A 2DP4E 5ALIA 3JQAD 3T5MA 4ARUA 3KGPA 4A73A 1OBFO 3FG9A 1T8NA 3I0ZA 1JEOA 4K2AA 5LP6B 4HNVA 2NTEA 4Z9YA 5ERGB 4NAVA 2CXRA 3FKJA 1O6CA 3R9XB 3OCUA 1I3MA 2X22A 2IUEA 3KV1A 1O87A 4KGXA 4XQEA 3AUAA 4TXLA 2CCJA 3E9RA 3ZOZA 2Q1WA 4LK2A 5TQJA 4LC0A 2PNFA 2O8DB 1N9ZA 1ESEA 2AOWA 3TPZA 1JRTA 3UB2A 1CUSA 1ESCA 1A9XB 3UG7A 2ZBDA 4LRSB 5B1IA 1D6NA 5CDFA 5C7LO 4ZAYA 2QG6A 1HOXA 1QDUA 1MO3A 1UH5A 4P7JA 4RGYA 5JW6A 3IC5A 1BBRK 3O95A 3JZAA 1VLMA 3PHLA 4H3HB 3ME5A 1Z8RA 4X0WU 2FAXA 3SFTA 3DE5X 3EOZA 4MWTA 3LMKA 3QPCA 1Z71A 5CLHA </