4A92A

Full-length hcv ns3-4a protease-helicase in complex with a macrocyclic protease inhibitor.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
639
structure length
639
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
publication title A Macrocyclic Hcv Ns3/4A Protease Inhibitor Interacts with Protease and Helicase Residues in the Complex with its Full- Length Target.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 200
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4a92A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a92A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a92A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A03
4BRUA 5AJYA 3K0SA 4OS4A 1AGPA 2D7DA 1Z0JA 2YOGA 5CLLA 3PXGA 1YCPM 1ZZZA 1UO6A 2IHYA 2Q21A 1NMZA 3KQDA 1SKYE 2P6RA 1O2LA 1P7CA 3EQ0H 1C1RA 1OWHA 1O3KA 1AZ8A 1F5KU 1JAIA 5B58C 2QXJA 2D2EA 1UK2A 3CH4B 4JVNA 1C9TA 2WSSA 1ZC3A 4RKEA 3G01A 1Z6EA 1EFTA 1KTVA 5FOXA 4CHAC 1B7XB 3TUIC 4DB4A 1E9RA 1BBRH 3QG1A 3ATKA 1OIWA 2CF9H 3I5XA 1N0VC 1Q1EA 3RWOA 1NRNH 1P3JA 3O8RA 3KFVA 1Z8FA 4BNRA 4X8MA 2QZ4A 3LW8A 4IN1A 3CM0A 3BIVH 4BANB 2EWWA 3ZVMA 1YC0A 1JEDA 3ASZA 2XW9A 3ZS9A 2YOHA 3BTWE 3MFYA 5C1UA 2YVUA 2ODPA 2A4OA 2ZRMA 1Q31A 3G5UA 3SI3H 2ZGXH 1IOEA 1D3QB 1A1VA 4W5WA 4DLTA 3B23B 3E3TA 1K8RA 3OIVA 3LA6A 3ZVFA 1GL7A 2NG1A 5KNBA 1YPHC 4EFNA 5J4LA 4YOJA 1AM4D 1BS1A 1FZQA 1O35A 4IEIA 2OUAA 2KAIA 1KLJH 3IHWA 4YTAA 4QKQA 5HZHA 1NROH 1QURH 2NPIA 1F2UB 4LHZA 1NVUQ 2ODNA 3PTBA 1XEWX 4AFUA 1FIZA 2DFLA 3U3OA 5SGAE 1DAHA 5GCHG 5KDLA 3KTAB 3GLHA 4D4LA 4EFMA 1KO8A 1XZQA 2XTNA 2ZE5A 3BOSA 1RC8A 4ABFA 4QJ4A 2A7HA 4U02A 4Q1CA 7GCHF 4A9AA 4KXFB 4H6SB 4AK9A 1QBOA 3MNCA 4ZH8A 3ZQ6A 1TOMH 2C8WB 1II8B 4NFFA 6CHAB 3HU3A 2DWOA 4KVAA 2F91A 1XP8A 1LHFH 1DADA 2FSIA 2IYWA 4YMVA 3G82C 1X1RA 4X2VA 1C2JA 4Y0AA 3U8RH 4KP0A 4M1KA 4YC7A 1CBWC 4R98A 5AUQA 1ESBA 2WSSD 1ZNZA 2ORVA 3MI4A 3MHWU 1AS0A 2AFHE 1KLTA 1TPAE 4Q9LA 2XC4A 1UTJA 2ZTXA 3H5CB 4DG4A 3U7FB 5FTMA 1YZQA 4EPTA 1EZSC 1I2MA 2IW3A 2AX4A 4I1VA 4D8NA 2VP0A 1O2KA 4X8TH 1VCMA 2XXAA 4RD2A 3PUXA 5J4VA 2X1VA 2BY8X 3FHTA 2F4LA 4JLKA 4MVNA 2AR7A 3WP0A 3EZ7A 2UUKB 2ORIA 1HT2E 4BAOB 1R8SA 4URZR 1RD3B 3K9XB 1OWJA 1DAMA 1VCOA 3ZVDA 3LH1A 1CR1A 1LS6A 4KELA 2ZGHA 2VP4A 2NU1E 4OGYA 1K1MA 3TW4A 1U8AA 1G64A 1ZCBA 2YC4C 5GWZA 1PPBH 2A7CA 2JATA 3K70C 2D3WA 3RXPA 2GD4B 4RZ3A 4NU0A 1AVWA 1KXAA 1W0KA 5KSPA 1LQDB 2JLXA 5BN3A 2G1JA 3GDSA 3PG5A 1KJZA 1CP2A 2GAOA 1P2OA 1ZJ6A 2ZRBA 4FCVA 1DT2A 3CF6R 3WBJA 4UJ5A 2FMJA 1E1RA 2CLCX 2KBFA 3EPKA 1Z6TA 2OM2A 4CRFA 3C8UA 3AF4A 2FYQA 1Z0KA 2CE7A 1LVOA 4M22A 5H8WA 1FAKH 3ZZ0A 1T8OA 4DKXA 1SVOA 1ZM4A 1BZXE 3K0AB 1G7RA 2IYZA 1FW6A 1N6RA 4Y0VA 4N0DA 2Q0HA 1QQ4A 2G55A 2RCNA 3GFTA 1UCYE 2QXGA 3VXFH 3D31A 1K9OE 4GHQA 4EUNA 5C4GB 3KQCA 3KQNA 3VGCB 4DCTA 5FL7A 4IGDA 3QENA 3W95A 5KSOA 5J4SA 1RE0A 2EYUA 3GLIE 2CE2X 3ZZ6A 4RFSB 5CK5A 3QKUA 5CK4A 1AB9C 1IBRA 1CJKC 2ANYA 2ZRIA 3QOFA 1WMSA 1H9HE 1RXPA 4OHZA 2YNBA 1N6XA 2YC2C 4D4MA 1E2FA 2QM7A 3AF1A 3ZZ9A 2BY7X 1G19A 3UUZA 1NLZA 4TZ6A 2H6MA 3AW1A 1GBLA 4CEIA 5JYIA 4IN2A 4NHOA 2UKDA 2J34A 4NIXA 4OHYA 3U3MA 3W5JA 4O2RA 3A4LA 1GHAG 4KVGA 4H9GA 1FV9A 2GZDA 1P8VC 1GL1A 4JL5A 1ZTJA 1FQKA 2FJUA 3LLMA 1NIPA 1W0ZU 5EXMA 4JZEH 3NKKA 1ZINA 2P67A 4Z8XA 3BTTE 3FP7E 2QAGB 1XVMA 3FFGA 1YHNA 4G0NA 1SXJA 1TABE 1DITH 1A5IA 3KUDA 2WM9B 2QGZA 4ABAA 2FPMA 3W8RA 3CNLA 1SHKA 1WBBA 2N46A 1VG8A 3A8TA 2V7QD 3W6PA 1O3YA 5BQ5A 5JBBS 1M6NA 1S9HA 4ARZB 4IBLH 2FWWA 5D3MA 1WCZA 4LSGA 1TU4A 1HXEH 4WBSA 4IC5A 1XEWY 1ZSLA 4LV5B 1SVPA 2F9MA 4AB9A 1Z6XA 1YPKH 4MA4A 4TY6A 1EWQA 5DHAA 1LS1A 1CF4A 3UWOA 1CSOE 3EARA 3KHVA 4MNXA 1C5NH 3O47A 1O3NA 2LWIA 4XVQA 1Y5BT 1V2TT 5AFZH 3UOUA 2GT8A 1P04A 4PHFA 1KDQA 2O0HA 1A0JA 1NT1A 2C93B 3CONA 3EA0A 3SV8A 2CNWA 1IN5A 2GX4A 1ELBA 1N5IA 4Y6DA 2WWFA 2EFGA 4MQBA 1J16A 2HEIA 2GF9A 4U5XA 2JH5D 5FL7D 2JASA 3OAAD 3T25A 1S83A 4M1WA 1QGFA 2Y7ZA 5JBCS 3BFVA 1AIXH 3X1DA 4JBWA 5HM9A 1Z5ZA 1CLUA 2ZECA 1BA8B 1LHEH 2BHGA 1HV7A 3ZVRA 3H86A 5AF9H 4TPYA 3VFDA 9ESTA 1ZJKA 4EKDA 1Q2WA 1TOCB 5LPRA 4ERNA 2ZHFH 1Z6YA 4TT3A 3EYDA 4ZDWA 4HATA 2ZI3A 3OFNA 1E3MA 3HU2A 1VG9B 4L8GA 3A4MA 4AYVB 3K9HA 4DCVA 1R8QA 4ABJA 3QI2A 2ZVPX 3TGPA 2ODEA 1TF5A 4YDSA 1G3CA 2C95A 2BDHA 1OYYA 3U60B 1V2UT 3RS4A 3SUGA 4CHAB 5AVDA 1CS4C 3C4JA 1JR3D 1TL7C 1TF7A 4NA7A 1F3OA 2D2DA 3GJ3A 3U6BA 4KFTA 3SUEA 2V55B 3KB2A 1FOEB 1OH7A 5B6OA 2HXYA 4GBMA 1NVVR 1OOKB 2ODBA 5EE5B 2F1JA 3RXLA 1HEIA 2IS6A 4NCJA 2QP3A 1CGJE 1S0UA 4LZ1H 1SVIA 2OG2A 3QKSB 3SYJA 3S69A 4H42U 2EEKA 4HAVA 1FP6A 3QPVA 3SFVA 4CR5A 3TPIZ 3FMOB 5AUNB 5JMTA 2QTVB 1GBFA 1G8YA 3Q7QA 3BFKA 1JNYA 4WMEA 2RGNA 4D81A 2ZFRH 4H4FA 1UTNA 3U44B 1KKMA 5FPKA 4E22A 2G51A 2IS1A 4BFZA 1TB6H 5JS8A 3GDVA 3ZVLA 1X8KA 2WJGA 1T5LA 2VINA 4WXVA 4A0HA 3AVZA 1ZU4A 3SU6A 1D2MA 3KXIA 1QQUA 3HPTB 1JEEA 2KWIA 3AVUA 3WY8A 2ODYB 1OFIA 1K1OA 1UTPA 4JLBA 1XD9A 1AGJA 2V35A 2V6IA 4MNWA 4PR0A 2VA8A 2ATXA 1XKBC 4GL2A 1WAYB 2ZGCA 1HJ9A 2BD3A 1U9IC 2QPTA 1BB0B 3TGIE 2ULLA 3UQVA 1DAGA 1OKKD 4JLPA 4Q4AB 3PO1C 1XTSA 1UHBB 4I1OA 1IQEA 1KO4A 2QCYA 3NEYA 2MMCA 5BYKA 1C2MA 3KZ1E 2ANBA 3VR2A 1EAWA 1NL3A 2ZPQA 2BJWA 3NH9A 3EIQA 2ASEA 5EE1A 1MT0A 3CP7A 2ZNKH 1CBWB 2V3OH 2A3RA 1VITF 4TYPA 2QU8A 1TUIA 4HAZA 5J47A 1XM1A 2A0QB 2CVHA 2CGAA 2G88A 1P61B 3MU8A 4E7NA 1SGCA 5K8LA 1SGQE 2PSXA 4Z8YA 4Q03A 3S1AA 1V2ST 4XBDA 2YNAA 1YLDA 2ASUB 1O3AA 2OSBA 2F83A 1E96A 1LF5A 2Y8EA 4A7IB 5C4MA 1QHHB 3CR7A 4X8UH 1V2QT 4AFSA 4MKFA 3BBPA 2PX3A 5TVKA 4G5OA 2R6CA 5C2ZA 4JKYA 3B9PA 4MRSA 3DZ8A 1TAGA 2GA8A 4CEJA 3SJCA 4B35A 3WHKA 4LCBA 2F3TA 2WJJA 1CA0C 3K70B 4PAMA 1B23P 1AS2A 4BTTB 4AIIA 3SJZA 2W0MA 4A2PA 2ZRJA 1YVDA 2WPHS 1C5LH 1E0SA 2UUFB 5J4YA 1BMAA 1KYNA 3P92A 1V43A 4JT4A 2ZITA 4RZUA 3VB7A 2W26A 3BAFA 1OS8A 1SLUB 121PA 3UMFA 2OC0A 4F7WA 3TMKA 3KEEA 1T0HB 2Z6BD 4OI4A 1G16A 2IOTA 2Y5GA 2ZEJA 5EQTA 1O2SA 2VLIA 5GIBA 1LHCH 4I8KA 4FMCB 1TEXA 4IDOA 4HUTA 1OXVA 1H8EA 2GXSA 2FOEA 2F9LA 3UR6A 2J7PA 4FINA 3RXKA 1AIPA 1PLKA 1FTNA 4FWTA 2VHUA 4HAYA 1NY6A 2IXFA 3F9FA 4NIYA 3LD9A 3UPUA 1SOTA 2P94A 1OFHA 5FTLA 4AKGA 1YU9A 4XD7A 1VYUA 2GVZC 1VTKA 3RMLH 2GV7A 1N5LA 1VECA 4GZMA 3W9YA 1ANCA 4Q19A 1A2CH 3TBKA 3PUZA 1I2DA 4QGAA 4M1TA 1AB9B 3ODFA 4ABHA 1S6FA 5TY0A 1II0A 3BH0A 4LV6A 5C5OA 2JLWA 4A92A 3SHAH 1ZUNB 1T7CA 1QR3E 3SC3A 1XFAA 4Q2KA 3ELAH 5H4IB 2YWHA 1ZD9A 1D3PB 3R8CA 1XKAC 1NM6A 2R9PA 1SGEE 2FF7A 3IIKA 3CR8A 2W0SA 1P12E 2FOBA 2ZRPA 3AGQA 2VBCA 1JXOA 2XC5A 2RGNC 1LDTT 3UNRA 5SZJA 1JI0A 2VHCA 1SFIA 3SYNA 5K8IA 5K0HA 4HAXA 3OY6U 1NRSH 5DP6A 2IXGA 2XITA 4DLXA 5C1YA 4E03A 5FL3A 3NKVA 1ZTKA 4V02A 4K2YA 1KO7A 2G5NA 4RKOB 1BTYA 3LC3A 4KHZA 2QSZA 1SGRE 1TGSZ 2KAIB 3VPKA 3U3RA 2ZS9A 1EB2A 1NLFA 4DZZA 3FKSA 1GI1A 1M8PA 3ZS8A 2K1QA 4BAMB 2GXAA 3GLHB 4BXWA 3QN7A 2R65A 3U7EB 2D62A 3ADKA 1F6BA 4OS1A 4TLBA 2D1JA 3GY8A 1J90A 1KI7A 3I92A 5L3RA 3T5GA 4YT6H 1C5YB 3LPRA 2QYIA 1FONA 1YM0A 1M2OB 2X19A 5ETXA 2J7PD 4LXBH 5LPEA 3GLIA 1O2XA 3ATMA 1SLXB 3PUYA 4OQFA 1BOFA 1O3HA 1L1JA 4POAA 4V0OA 4UXHA 3V9PA 2CN0H 5GVRA 1O3EA 1CKEA 1OW3B 2BMDA 5E95A 1E9EA 3QBTA 2UUJB 2FPZA 3EA7A 4G1UC 2QSYA 2J46A 3MH7A 3U8TH 4X8OA 2F9VA 4QHYA 2RA0A 3WYGA 1AUTC 1XXFA 5TV2A 2FZZA 4TLEA 5JDUB 1ZHPA 4DRZA 1IQMA 2IYSA 1F48A 2XXAB 1MOZA 1RYFA 2B7BA 4PQRA 1V6DA 2XNDA 2ZDKA 1ZOMA 5C67A 4X6NA 1DVRA 4P0TA 4BFXA 1AVGH 1KI6A 2IX3A 2OBMA 1O5FH 1RFLA 2ATVA 4US0R 1QY6A 2WJYA 3TLOA 5JLJA 5JBTA 1CRQA 2WMOB 1E4VA 2KE5A 4OKSA 4NG9H 2Z3CA 3R7WB 5KO2A 4Q7XA 1KSJA 1OSSA 1NRRH 3T1TA 3B85A 3M7TA 4WIAA 4D0GA 1VDZA 3BTDE 3M5LA 4DT1B 4FUBA 4F4OC 3VNVA 2FX4A 4JJZA 1MTNC 3IGFA 1Y3AA 1OH8A 3IBYA 3GISB 2IYVA 2GBLA 3B8HA 4XWKA 1D3TB 1YPGH 5KTYA 4Q4HB 1XTIA 3CPEA 1UKVY 2DFTA 2VO1A 1QF9A 2EVWX 1IY2A 5AR1A 5T6GA 3UG6A 4BAQB 1SSXA 2G00A 4O3TA 4TYNA 5FI1B 3FFBA 4DIDA 1OP2A 1DOAA 3B9FH 4B3XA 4GFDA 4ABBA 1ZPCA 3URDA 2WPJS 1SGIB 3QDZB 2RCEA 1JOUB 2ZEBA 1E2EA 2Q3HA 1COWA 2WINI 3K6ZA 3CIOA 1MD7A 3NXPA 5C1BA 2GCNA 5JBAS 3ICEA 2IYTA 2NU3E 2FTLE 1UKEA 3Q3XA 5FOVA 4FN5A 2XZLA 3OX7U 3T15A 1KI8A 1NRJB 1E0FD 3DOFA 2ZXUA 1CO7E 5TMPA 2ZIQH 5FR2A 1AFEH 1F5RA 5EE9A 4HYYA 1R2QA 4JVLA 2CLDX 3C27B 1JJVA 2CL6X 1H9IE 4ACBA 4AD8A 1G9XA 3CNNA 5KOYA 1DICA 1UTMA 1G5PA 3KKNA 2HJVA 1I4TD 4LJAA 2G52A 4LJ9A 4A0RA 4F4IA 3PO1B 1Q44A 4QJ3A 4EPRA 2X77A 1R5BA 1AK2A 2CCKA 1EB1H 2SGQE 1BBRK 2XNDD 4C0BA 2QGNA 4NCIA 1W4RA 2JDIA 2FFQA 2FEQH 1QHYA 1THPB 4D2IA 5CM9C 1ZPZA 2ZQ5A 2GK7A 4CT4B 1XUKA 4X6OA 2NO6A 3H84A 3ESTA 5EUMA 2AERH 2Y82A 3FOZA 5E0GA 1U99A 2ZUCA 1YPLH 5FPHA 1HV8A 3NHAA 3I5YA 1NY5A 1KIMA 3ZZBA 1WSSH 3PENA 1L4ZA 5DGJA 1GMDF 3L8YA 2Q3FA 4CIDA 1ZLRA 1GI8B 1W48A 3LVRE 4D7FA 3MOCA 1MTUA 3SV2H 1ZSKA 2ZTZA 1AGRA 4GAWA 4YM9A 1O2MA 3P32A 5DSZA 4F49A 2GEVA 4UNNA 1FMJA 1DLKB 4DDWA 5J40A 5D3MB 5EPYA 2WWGA 4DBLC 5CJPA 2NQ2C 4X2WA 4ZHAA 4QGGA 1XXDA 3P6ZB 3X1XA 1QJ6B 2BBOA 4R9UC 4B3FX 1E9DA 1DS2E 1W44A 1CA0B 1BJVA 4YMUA 4Q18A 4Y76A 3PWBA 1V3XA 3MSXA 5KNDA 4UONA 4YONB 2ORWA 3AF2A 4A1XA 1KDQB 1QL7A 3VB3A 1C1PA 2ZYUX 4HEJA 2KI5A 1COWD 5KSZA 4LK4A 1XD2A 3D23A 5T3HA 1W13U 3RMOH 2ZFQH 2FOGA 5FTJA 1JRSA 2VHJA 2HUPA 1G4AE 2OTVA 2ZI2H 4HDOB 3IKJA 1GI6A 1IN7A 2BDBA 2QY0B 3FWYA 3BG4C 4MRPA 1XUIA 4DCNA 3A89A 4I81A 2OE2A 1HQCA 4UE7H 4LX0A 3W8NA 4I8JA 4NKRA 3A37A 3LT3A 2IWRA 1E2DA 5TXGA 1GBIA 4JVSB 3M36A 4KKDA 4L9WA 2ZRAA 3C14C 3SNHA 1S85A 2REXB 5FUYA 3TH2H 4M9SA 1ZD1A 4V0ME 1AQUA 2JDID 2RH5A 5IDKA 5DHFA 4JLNA 1NJGA 3IO3A 1E37B 1LPZB 3QIAA 1JXPA 1KXEA 1C2IA 4U01A 1XVOA 3SQWA 2OO7A 3DA9B 2FOMB 4DOQA 3GCNA 4OK6A 3EAJA 3PUVA 3A8BA 1OWEA 4TL9A 3Q9LA 4B47A 1AN0A 3QLPH 4F92B 3KJGA 2HJGA 3U69H 2C04A 1A7JA 3FE2A 2WJIA 5A0FA 2M5TA 4JZDH 5A0AE 4Q7MB 4V03A 1PLJA 3SI4H 5DN6A 1NO9H 1HB0B 4GMDA 2A2QH 2AMDA 4H1UA 3F9GA 3MNXA 3WYFA 3GLGB 2FDCA 2O8CA 4JS0A 2VWOA 1YR6A 2A7JA 1YQTA 4PC1A 4PC2A 1PPGE 2WUBA 1OYWA 3QBVA 3HKJB 1DDJA 1P57B 5A8YA 3SZNA 2XRCA 5H68A 2WAYA 3AVOA 2IT1A 3L2OB 2ERYA 2FFHA 1G30B 1Z6GA 3AW0A 2WTUA 2O8EA 2VH5R 2B8OH 4L4UA 1MU6B 4EPWA 4YXWA 1EX6A 4LV8B 2R62A 2Q6TA 4CZ2A 1ZRKA 2Q3MA 4QRHA 1HCGA 3EZFA 2C77A 1YR7A 1UVPA 4ZI2A 4A1FA 2Y7XA 1YJ5A 3Q00A 4BGDA 1OJLA 3FANA 4ZDIA 2IYYA 3QQ5A 4M8NE 5DYGA 4LHWA 4AKEA 4JCNA 2FOFA 2YNMA 1FNIA 2J3EA 1BTXA 4HLQB 3H7TA 2IF2A 3KKQA 2WVJA 2G3YA 1MD8A 1GBJA 1SHYA 1HUTH 4MPXA 4RVCA 3IEUA 2C03A 3CNOA 1GMCG 1CJTC 1N5JA 2ZPSA 3DMNA 3A88A 2BQWB 1Q1QA 2UZ3A 3ZIAD 1Z29A 1IONA 4Q02A 5JI2E 4NZQA 1EATA 4Q66C 1ELDE 3RXCA 2BOKA 5KHOC 1PJRA 4JYBA 4PPGA 3RMNH 2AMPA 3MMPA 1TIOA 1O33A 3RAPR 1W0JD 3FDIA 3GOVB 4LJYA 3KQUA 4BFVA 1ARCA 4I8GA 5TCAA 1DWBH 2OCAA 4GCHG 2DY1A 5DP5A 1W2GA 3MUFA 1CT0E 1NBME 1DLEA 2WYJA 4GPTA 2OD3B 1TNIA 1HGTH 1D2EA 1BTZA 1IQFA 3RXMA 3DL0A 1CEEA 3Q72A 3I72A 5JHHB 2FH5B 2OINA 2QE7D 1G2LA 1C2HA 5DN6D 1IAUA 5CB8A 5LBIA 2H1LA 2WMNB 3T1VA 4LWZA 4DLRA 3OU0A 2GZ7A 4A4DA 5E7IA 1Y63A 4TYQA 3NWJA 3SQHE 2F9NA 1UM8A 2VP2A 1V2VT 4FU8A 2D74A 2ZHQH 2HNTC 3IO5A 1N3BA 5F03A 1C4U2 2ZFFH 1NY22 2FOAA 4WZAE 1MTNB 2VNTA 3PV4A 3A7WA 621PA 4JL8A 2PGBB 2WWYA 2PLXA 2ZS8A 1K1PA 1Q3XA 2ZTSA 1Z0FA 3L6PA 1O2HA 3CUEF 4RD3A 1P2TA 1C5ZB 3CB4A 2P3TB 1TNDA 3I62A 1N1LA 1IY0A 5C1XA 1Z0DA 5G3ZA 4WAUA 1LFDB 3JVUA 5E0JA 1D9IA 3DHWC 4TQUS 2KSQA 1X86B 1VGCC 3G0HA 3DDCA 2F43A 4JYUH 3U6KA 3EAQA 1CR4A 2WWXA 2WSMA 4TTQA 3QKRA 2YKGA 2ZJBA 1ZP6A 2H18A 4YLUA 2BDAA 2FEMA 3TITA 2ZU2A 1KI2A 1R0XA 1XPRA 3FPAA 4P31A 1W2KH 4JK5A 2BX3A 2TGTA 3UNQA 1NN5A 5JRJA 5JJKA 3KQKA 1QDEA 3CRMA 1VG1A 3TKLA 2WKRA 1N6IA 2ZROA 3UXMA 4ZKOU 1W5SA 3QPUA 1Z08A 1DXPA 4A8JC 1G6HA 3AGPA 4TL6A 4ZIRA 2WOOA 4Q1BA 2J2UA 4Y0YE 3SJIA 3L0OA 4WMFA 1O3MA 4LOAA 3T06B 4ZXXH 1OHHD 4B43A 3UIRA 2OCBA 2ZRDA 2A4QA 1G8FA 2AIQA 1EKBB 1DO0A 2QQ0A 1QVAA 3RM2H 4C0JA 4D6PA 3BTEE 1SOZA 1GCDA 2BOVA 4TWYA 3CRQA 3QZRA 2VTKA 1XB2A 3MU0A 2Q6FA 1C1NA 2Z9IA 3W6OA 1A4WH 1O2TA 1QRZA 1C5UA 5EE0A 3ZDQA 4BFSA 1EJAA 3BJIC 5JWOA 1ESAA 1GFIA 4LBYA 2FODA 1G21E 2HVXA 1WQ1R 3GD7A 4NYJR 2ZI9A 1BMLA 1ABIH 5DE3A 3CRVA 2JLUA 1G2MA 1ANKA 4EFLA 3L0SA 1K6MA 1XU4A 4CR9A 3T5FH 1II9A 2IK8A 1NVVQ 1FI8A 3AUXA 3ZGXA 1W2HA 1XCMA 1RJ9B 2YHSA 4X2XA 5JSZA 3MWYW 2VPPA 1C2KA 1F92A 5F8TA 4LRWA 2ZJ2A 2XTTB 4KTCA 4WZBE 1SL3A 2CHQA 2ZZUH 3U4QB 1RIWC 4B2PA 1GP2A 4NTZA 1DAIA 1GDQA 2G4TA 1K1LA 1T5IA 1TMTH 3PR1A 2CLSA 2VIVA 3M5NA 3Q76A 1IHTH 1LQEA 3UWJH 1J2JA 3KQEA 4Y8ZA 4FUCA 1VHLA 4HTCH 2J59A 3SNDA 3C15C 1KGDA 1JAHA 1ESMA 1QNJA 2ZI7A 2IYXA 1IQIA 2IA5A 5D3QA 2AS9A 3PB1E 3D49H 2F7SA 1Y3UA 3BE4A 3GLIB 1V2JT 1ELCA 2HT1A 1KJWA 4CRWB 4LUCA 4MYTA 4TTRA 1UKZA 2PHBA 1X8JA 4TN1A 5HKKA 1G17A 4PC3A 521PA 2ECKA 2ALVA 4JZIA 2OK5A 3D65E 5DP8A 2P95A 1WTHD 3SNEA 3TUZC 4WOPA 3BG4B 4AOQA 3BC1A 5AJZA 4CH8B 3HWSA 2FM2A 5IHPA 1Y3XA 4INKA 4JT2A 3L8ZA 4NSYA 1RRFA 1BH2A 1KYIA 4DCUA 2PMDA 2I3BA 2ZSFA 4NONA 1FY5A 1M7GA 5DISB 2CJWA 3UATA 4MNVA 3CWZA 1DY9A 1DFPA 2BMEA 4LOYH 3VEQB 3AAVA 1F2TB 4WY3A 3LIWA 3HP1A 3IQWA 3FKQA 1V2KT 1SULA 1EZXC 1KHTA 4X6MA 3GFPA 2IUUA 5T6FA 3BTFE 3O8CA 2ZF0H 2SHKA 2ZI5A 6GCHF 3RC5A 1O3IA 1OXSC 1X8LA 3TLXA 221PA 1E38B 1S4QA 2W6JA 2EI6A 3S9BA 1P2IA 1QHRB 3TR0A 3NWUA 1U6QA 4F4JA 1N8OC 3NEJA 2Y5FA 4AYYB 2Y5HA 1XF9A 1TEVA 2G0NA 3VR4A 1V2OT 4ZO4A 3V7TA 3M7QA 2H17A 3A1UA 1DWEH 4MRNA 4OS6A 2FYRA 4RN6A 3I4LA 4BUJA 4BAKB 4HGCA 4Y79A 2GTBA 2ZRNA 1CGHA 1E79A 2W6IA 3SN8A 1SVMA 1VPLA 4DW2U 4QGHA 3LV8A 4XWAA 3CW2A 3GEEA 1C1UH 2P6NA 1P2MA 1QTFA 4O3UA 2ZAOA 3P8GA 2O8MA 3FMPB 4D80A 3ZVNA 1D6RA 5FBLB 2O8DA 2FPLA 1TALA 1UK4A 1CR0A 1OXXK 2DFNA 4Q5IA 1US8A 3KF2A 5AFYH 3FP6E 4YT7H 4LJ8A 1U0HC 5EXXA 1S3GA 2VRWA 4GVUA 2YZ2A 4DJZB 5JWRA 5LB2A 1XMJA 4XTRA 1UKYA 1EG7A 3AKDA 2HPQH 5L2YH 2RAPA 5SZKB 4CEHB 3NVAA 3A7YA 2CVFA 2G77B 1AKSB 4V0MA 2VSOA 3TUJC 2JIZD 1P9SA 2ZPRA 3U61B 4EIWA 2XTZA 3GPLA 1UBCA 1VJ9U 5C5NA 2WPDD 3S7KB 4HDQB 2ZP0H 2B92A 5A2MH 1N6OA 1VIYA 2HPPH 5JCPA 3DHKH 5FPTA 1GHBG 1LB1B 4C0KA 4Q1EA 4NPHA 3NH6A 4LBZA 3MO3A 1BMFD 4FU7A 2SFAA 1EJMA 2WICA 3FGNA 1QIXB 2BM2A 3Q3KA 2LCFA 1E99A 1C5RA 1BHXB 2DCUA 5FHTA 1MQ5A 3SNCA 3E8LA 4F38A 8ESTE 4SGAE 4AYWA 4GSOA 1GL6A 1SI5H 1UBFA 3OEHD 1KY2A 1ZHMA 5SZHB 2CMYA 2J4IA 3SGAE 3TNSA 4ITRC 1K5GA 1OB5A 2C78A 2HLCA 5GJCA 1FN8A 2VWNA 1S6HA 1RTLA 5DK1A 3NXSA 1P9UA 2OAQ1 4QBIA 2BKUA 4E5UA 1HPGA 1P3CA 3MU5A 3ZYEA 1AZTA 3PM3A 1ESTA 1E6CA 1G32B 2STAE 2P3FH 1T8NA 4YESB 1DUEA 3W94A 4IOKA 4MGKR 1HAIH 4FUHA 4C0QC 4X8VH 4ZKDA 1XX9A 3L0PA 2OQUA 2AD5A 4X8LA 1GG6C 1HH4A 5CIQA 3A1WA 4A2QA 5J4QA 1Y59T 4HI0E 4WJG2 1GRNA 1OFTA 1E36B 3ZV8A 2WWHA 1C1OA 3E1XB 4Y7BA 4UKDA 2PJRA 3R9WA 4MDFA 1G18A 1QL8A 1SGDE 4GP7A 3BF6H 4QT8C 1O2WA 4YLQH 5G41A 3EPJA 4LDJA 1B0UA 3AP3A 3DKVA 1HIAA 3ND8A 4TMKA 3E91A 4XVUA 1V2RT 1O39A 1T8LA 4K60A 4I33A 2BB4A 5LH8A 2HYDA 1O2ZA 3A1SA 5FOTA 2B7DH 1VGCB 1Z63A 3RXGA 2GP9B 4CREA 3FMFA 3GY5A 2C2HA 1AO5A 1HNEE 1XJQA 4P3YA 4XVRA 2WV9A 4RJLA 2JJ1A 2OCYC 2HF9A 3E1SA 4FIDA 3OZXA 4AG6A 3LGYA 1YPMH 2FEOA 3W5IA 3H2YA 3BH6A 1O32A 2AL7A 4NWLA 2XCFA 4OQXA 2R6AA 5HR5A 1N6PA 4Q7ZA 1VYVA 4R2HA 3QKTA 1NBMA 1SQOA 4A8JB 5GADl 1HLTH 1MO4A 1SR5C 1YKSA 2EFEB 2PKAA 3VB5A 1JB1A 1C4OA 1L8QA 1P9WA 1O0DH 4B33A 2IUSA 3SO3A 1G3EA 2N1BA 5EW2H 4D25A 4MRVA 1AKYA 3UREA 2O8CB 2PT7A 4MITA 4FUIA 4PHTA 4Z1MA 2P8OC 2P0EA 2RGEA 4GOJA 1GMHG 2P2LA 1GHXH 4JMYA 5EQQA 1JQJC 3TIUA 4OS5A 1L7VC 4A6PA 3DOEA 2GCTC 1NFWA 5KU1A 1TONA 4KSCA 3STIA 2O8EB 3MD0A 2QXHA 3PEYA 5G53C 2EWVA 4MKHA 3PV0A 4CGZA 4NSVA 1IXSB 4KYIB 3FMIA 1MABA 1TRNA 1E2GA 2BKEA 4B44A 2AK2A 4J1YA 5JFGA 2VIOA 3CPHA 1GG2A 4D76A 1LKBA 2VGCC 2RGBA 4Z0KA 1KSFX 1T3LA 1RIWB 4JVMA 2ANMH 4JZFH 1S9DA 1TRMA 3B2EA 3E2IA 5FOSA 5EXPA 4Q4LA 2C8VA 1VCWA 3QXJA 5B2ZA 3UK6A 4HZUA 4ZKSU 4DSNA 4B76A 1T9HA 2XJ9A 5F6MA 2W2VA 4M21A 3SJOA 1BYIA 4UQOA 1GHVH 2V54A 4PPNA 2HRVA 2SGDE 3Q85A 2ZI4A 4YMSA 4IW3B 3T5DA 3RXVA 2XOKD 1EK0A 1C9KA 2OLJA 2JJ1D 2A5YB 2NU2E 3TH4H 1GNPA 3E0PB 2DB3A 3HATH 5BN4A 1E94E 2Z4SA 1HAVA 4WH8A 3KKPA 1H8HD 4LHXA 3UY9A 1CA8B 1OWIA 3CS0A 1QJ7B 3LQQA 3SJKA 1E9CA 1ZM9A 2YYZA 1MCVA 1H65A 1QHNA 4CH2B 1ARBA 4AI6A 4PZZA 1WP9A 2QBYB 1DG3A 5GNDA 2HT6A 2P5SA 4HB0A 1Z83A 4X1SU 1MU8B 1KXFA 4THNH 4TYDA 2PCJA 4YMTA 1S2MA 2VWLA 3GJ4A 3OYPA 3DMDA 1S0RA 5JEEA 2W83A 2HCJB 4WMDA 1V2LT 2PUXB 2NGRA 1XEXA 4E05H 4ZCIA 1SBWA 4PO8A 5DLQC 1CHOF 1NFUA 3UQOA 1F60A 1TQ7B 1LTOA 3QF7A 4Z1MD 4DEYA 2J45A 1LHDH 3W34A 4EJSC 3NBYC 1SGWA 1CULC 1NF3A 3QG5A 4E7RG 1Q0UA 2GWHA 1A0LA 4ABDA 1HFDA 4R7ZA 2AGGX 4JLOA 1BBRE 1TPPA 1AS3A 3SU3A 2FGKA 3LU9B 3BEUA 1XMIA 2ONJA 1GVZA 1HXFH 1TLDA 1ZC4A 2A5JA 4RD0A 1OFUX 3VB4A 2ZSDA 1WQSA 1TQ2A 1AA9A 2ZYVX 1FY8E 1MRNA 5EXNA 1N8OB 1FUUA 2O8UA 1NG9A 1U2RA 3JZ1B 5BRRE 3PFIA 4IVPA 3Q3JB 3BORA 1LVYA 2GCHG 5JBQA 1DXWA 1FX0A 2P3UB 2BVNA 1WU1A 3HU1A 2H9TH 3K9NA 3RXSA 1CT4E 2CK3A 1KY9A 4I1UA 1QB6A 1GVNB 2UZIR 1Z07A 3THOA 3UANA 3QKRB 5F98A 1CQQA 1QHSA 4W9MC 3SN6A 3KL6A 2I6SA 2D8WA 1DE0A 3RSLA 3ZVAA 4AKIA 5ELXA 2OBOA 3BTGE 3IILA 3M37A 1LY1A 1UEJA 1DARA 3NCLA 4Q1DA 5IYTA 1XUHA 2XC0A 2ZDNA 1BRBE 1E1QA 5EW1H 2ZRLA 1N0WA 1MZDA 2H57A 2ZA5A 2VU8E 4L5BA 2CL0X 1MQ6A 2WV4A 3RVBA 3UFAA 1CU1A 3B1YA 1T6NA 1FJSA 4ZIRB 1P73A 3SHWA 3FTQA 4KLNA 5FX6A 4DVGA 1KAGA 3U7GA 3AVQA 4NCNA 2ANWA 5E4FA 2Z9LA 1KMHB 3A4NA 3EIEA 8LPRA 5PTPA 2FLBH 1EESA 5FUXA 1C5OH 2F9UA 1RKBA 2QY9A 4ZHLU 2BQ6B 3ATWA 2YWGA 3WRYC 1G8GA 1H1BA 4PO9A 1KMQA 5E2OA 4UFDH 1Q20A 3T12A 1NJFA 7LPRA 3HKIB 3H1TA 1TTTA 2ZQ1A 1ZRBA 1XCPA 4KJZA 5ANRB 2TIOA 5LGOA 4M9QA 2PL3A 2GDDA 3EIHA 4Y7AA 3VAAA 3QXHA 2AKAB 2ZDVH 1P72A 5FBQB 1C1WH 3CLVA 1VCQA 1YLCA 4AY2A 1VCIA 1XRJA 2PLFA 1WYKA 4PQYA 1UCYK 1EAXA 1WXRA 3RS5A 3LY5A 5JSZB 4DIHH 5CHAC 4INLA 3GY3A 2GDEH 3GEIA 4FI3C 2BYAX 5JPMH 1G3IA 2ZM5A 1DUAA 1G7TA 1W8BH 4ISLA 1QRWA 1YPJH 3OHMA 1GBKA 3R0FA 3LAWA 2A78A 3K70D 3ZQJA 2ZIAA 3P17H 1DAFA 1QVRA 2BV3A 3RWMB 1E2IA 1GG6B 1GJ6A 3ZYDA 3A86A 2OC8A 3FAOA 2J0UB 1XMNB 3KNXA 5AK0A 1FMGA 3QUMP 3RU4D 1NVWQ 3BWDD 2CK3D 4RY2A 1AN1E 1YPHE 3CRRA 5B64A 1EPTC 4JLDA 1OP0A 5AHGH 1IN6A 4PX9A 2GCOA 1NNEA 1KTSB 1D3DB 3TU7H 1QG2A 2IEZA 4ABEA 4NYIR 4UXIA 1ZNWA 3DM5A 4F91B 4K81B 1KOFA 5DP4A 1CGIE 5B57C 1EGAA 2ZSBA 4P4UA 1KKLA 1C5TA 3Q5DA 5M04A 3GFOA 2FSFA 1N25A 3MMGA 3UTUH 3LOXA 1Y5AT 4JIMA 1EFRA 3SS8A 1ETUA 4KBGA 5EU8A 4K8OA 4Q80A 3HR7A 5AUOB 2DUCA 1KJYA 4C4PA 3GEHA 1HJAC 5JB9S 3P4YA 4F4CA 4DLVA 821PA 1C2EA 3TQCA 4FMDB 2PBRA 1EAIA 5DJ7A 2QG6A 5EXTA 4N0EA 3GLFB 3OIUA 3RSOA 2VP5A 3K0CC 2CJWB 1GL0E 3TJVA 2QP9X 4BWYA 1ZM3A 9LPRA 4D0LB 2RDLA 5FBIA 1ZSJA 4NZYA 4A15A 1FNMA 2QMUA 4JYCA 4QGFA 3TE6A 1AJEA 2GZ8A 3Q77A 3WNBA 4BEBA 3RP2A 4B2LA 3TK6A 8GCHG 1WQVH 4TQ9A 4URWR 3SQXA 4DB2A 2F9BH 3EZ9A 3GCGA 4RKJB 2Z83A 3BSQA 1BHXF 1TNLA 1R0YA 3RRNA 1GJ7B 4OHVA 1EXFA 3GCTG 3LXXA 2GRJA 1PPCE 4JL6A 2A45B 3MWJA 3RYTC 3M35A 3EGKH 1RYHA 2IYLD 3RC6A 4C2TA 2P8OB 1C1YA 5L3VA 1AWHB 3WMEA 2J5XA 1YZTA 1G7CA 4D7GA 3AKEA 1U8ZA 1RZ3A 4IOMA 4BLQA 2GCTB 1TX6A 1S0QA 3OIWA 4ABGA 4S35A 5JHGB 3TVTA 2A4GA 5A8ZA 1W1WA 2BM0A 2N42A 2HNTF 2UWPA 2VVCA 1SGYE 2ZTYA 4U32A 4IMQA 1ZRHA 1TNJA 3ONWA 3DKPA 4TWWA 4AFZA 3KTAA 2O8DB 2ZGBH 1P4SA 4LC0A 1UADA 4IFEA 4IVRA 2VGCB 1BO6A 2NO7A 5C46F 2E9SA 1GIAA 3QPWA 5SZIA 2FXRA 3GY6A 4B3CA 1AVXA 1E35B 2IYQA 1XMVA 3KGPA 2DPXA 2V9PA 5FBVB 2R0LA 2ZU0C 3GQBA 3P8FA 3QUSA 4M9XA 3IHLA 1Y8TA 3NDPA 1II8A 3SORA 1ZR0A 4PO1A 3UMSA 3RXDA 2DR3A 1RRCA 1KSGA 3F9HA 2BXUH 5FOWA 4WXRA 2FS9A 1NLYA 1W7XH 3ZVBA 5CDFE 4D26A 4CRAA 1AZSC 1ANDA 1GI4A 2CCGA 1VKJA 1E2PA 2G0TA 1SMFE 1TWXB 1T31A 4XTCS 4EQ6B 3N70A 2AWOA 1BRCE 4ESHA 3R20A 2ZSEA 2GV6A 1FUKA 1O2RA 1SLWB 1JPNA 2QN5T 1UVTH 2K5UA 1ELVA 2BC9A 1HAYB 4ZCLA 1QB1A 2F3CE 3A7ZA 4K1SA 1E9BA 2A2XH 3MH6A 3DFLA 2CBZA 4NFEA 3RC3A 2P65A 4LYJA 5L30H 1HURA 1P3EA 4A1TA 3TK9A 2JJ2A 1YPEH 4O2LA 1WOFA 3B1XA 3U5ZB 1OH5A 1ETTH 1XDBA 4KFSA 2QTHA 4BLRA 1Z47A 1K5DA 4E06H 1KY3A 4EJSB 1W7GH 3RXFA 1W0KD 1HAPH 2GGVB 1GZSA 1O5GH 4NYJQ 4B2IA 4Y8XA 4WW0A 1O3CA 1OX1A 3ATIA 1T4GA 2XNIA 2ERXA 4DDVA 5FBEA 1BKDR 4QNMA 1O2GH 1E1RD 3FB4A 1NRQH 2ZREA 3BRWD 4D4KA 4MGZR 1ELEE 3GYLB 1D6JA 3DO6A 1IJEA 3RDPA 4Y8YA 1HIAB 5DI3B 3KJHA 2BD7A 3HPQA 4PPQA 1GI3A 1P9RA 2R6DA 3BK7A 1J99A 3NK8A 1NN3A 4M9ZA 4WZ6A 2PT5A 1SG8B 5HXFA 3NC1C 3IWMA 2QPAA 3B13B 4AORA 2CF8H 2F9OA 2JAQA 2EI7A 2OESA 2CDNA 1C9PA 1CIPA 4BRWA 2F55A 2ZDAH 4P4TA 3WRXC 4CDGA 3B1VA 2BIFA 3AVVA 1E2LA 2PX0A 1GJ8B 2QAAA 1NSTA 1RGQA 1GVLA 2J41A 4OL0A 1G3UA 4RFSA 2VIDA 4HSEA 3X1ZA 1GJDB 1DVAH 1NVXQ 1FN6A 1RJXB 5KNCA 3SFZA 3BTME 1OE0A 1W4CA 4IVQA 4NYMR 1FQJA 3EC2A 4MGYR 1SQAA 1PQ8A 5K8UA 4DXAA 2P93A 1ZCAA 2FX6A 3HGNA 3R8FA 4QXAA 4X1QU 2P6UA 1T91A 1L2TA 1JRTA 2W00A 1LMWB 1NZQH 4AB8A 4BECA 2BLWA 5F8ZA 3RRYA 5EP4A 2EI8A 3FVQA 1MTWA 4ACAA 4KU4A 4K46A 2C9CA 3PCRB 1O34A 1XJCA 2QAGA 5EP1A 2G83A 4LBVA 3RHFA 5E3HA 1SXJD 5DPAA 2W2TA 3THXB 2CHGA 3THWB 2XCNA 4KV9A 4MQAA 4Q1FA 3QGNB 4UXJA 1LVMA 3CZPA 3RMMH 3ADDA 2O52A 1FMLA 3VQTA 2Y81A 3BG8A 1R5NA 3MAAC 3DM9B 4PHHA 4DHEA 4DSOA 2O8LA 4MDEA 2VIIA 5DP7A 3BH7A 1MABB 2V6NA 4UFEH 3F68H 4XWOA 4PSVA 1J8YF 1UBEA 2NIPA 2HLDA 1Z1IA 4TSFA 4X1NU 1E4YA 5CHAB 1GRRA 2BLOA 1N0UA 1CXZA 2BX4A 4DCDA 4ON9A 4GI7A 3VMFA 1QBKC 3VKWA 2P59A 4C0AC 3RXRA 1TNHA 2Z94A 2A32A 3VX3A 3EDXB 3MO9A 2Z9KA 2O5VA 2ODWA 3H09A 2TMKA 1DSUA 3TGKE 4HZUB 7GCHG 3FVFB 4RKFA 5GCHF 4G5QA 5GPIB 1TX7A 5B6LA 3LO5A 5FR1A 3ENSB 1GBBA 4CRDA 3P8NA 1EZQA 2CNWD 1BTUA 2WIAA 2Q6GA 2OV2A 1Q3HA 1ETSH 1EPTB 3KIDU 2FX3A 4DLZA 3PV5A 2BMFA 3M3SA 1PFXC 2OBNA 2GETA 2Y6TA 4FUEA 1KO1A 4MDSA 1G3DA 2ZFTA 1TGBA 2BHRA 4DSTA 4AX9H 5TARA 4I8HA 4HFPB 4K8BA 4DSUA 1Y3WA 3V12A 1YZLA 4DUGA 1SVWA 2OXRA 4Q7KA 5F8XA 5CMXH 4TT3D 1IHSH 2FA9A 1XCGB 3OFND 1FPMA 1CJVC 2BD8A 2ZJZA 1FLEE 2KBEA 1HJAB 1A61H 1RRGA 1NFYA 4ASUA 1DWCH 3PTNA 1OH6A 1SXJC 3E6PH 3DT0H 2FI4E 3W6NA 4MUBA 1X1SA 3K0FA 4BTIB 4FXGH 4B3GA 4M2LA 1JR3E 1D5CA 5EQSA 3ETLA 3LW7A 2FMXA 5FTNA 1Q12A 2Z7FE 2Q9AA 5A0CA 1MRSA 3A7XA 1G37A 2MSDB 1Z8GA 1HAHH 1KK3A 2AGIX 3AP2A 1IQGA 1SGPE 3NG1A 1VG0B 2PH1A 3J81k 2YWEA 2FIRH 4HI3A 2H5DA 1LVBA 4TL8A 2J0SA 4U7DA 4INHA 1AU8A 1MAXA 3M1IA 5HCNA 1F2SE 2QT0A 5EQRA 2Z5FA 5F2EA 1YCPK 4FUGA 1UAAA 1BRUP 1MO5A 4LK2A 2NOAA 5FAHA 1PUIA 2QF0A 4YOGA 3LGWA 5FCRA 3HYRA 3X1WA 2KB0A 1ZMLA 1PPEE 3K2UA 3MTYA 1DPFA 4Q21A 2QT1A 3T26A 1TGNA 5HYOA 4GDFA 1ETRH 2JLSA 3PITA 3UR9A 2E87A 2DBYA 2ZHDA 1UMAH 1NN1A 4RD6A 4MKGA 3T1QA 1UVUH 2YJTD 1OF1A 1E2JA 2W58A 3SYLA 3OSYA 2OUKA 1W11U 2BLQA 3HJNA 5JB8S 4LJ7A 2ZC9H 4I31A 1NFXA 3CO5A 1G7SA 3WXMA 1BTPA 2ZU4A 1D6WA 4BLPA 4KI0A 1GL9B 3KXKA 2RGCA 4ZXYH 3DVLA 1Z8JB 1GOTA 1CE5A 4DUGD 2VF7A 3A6PC 1UHBA 3IIMA 5IK2A 1Z6JH 1GHYH 2W5EA 1IN8A 2NO9A 5FPYA 2FI3E 2NU4E 3A85A 4TMTA 2QM8A 1T8MA 3WMFA 3ICQB 3K1JA 2NO1A 1GM5A 3CRW1 3I32A 2VB0A 3PWCA 4UNQA 2O8BA 3SV7A 4DY7B 4O25A 2TPIZ 3SUFA 4NCYA 3A83A 1GHAF 3B1WA 1MH0A 2ZUDA 4Q9JA 2BDCA 3AF3A 2ZFPH 3S7HB 1C5PA 3MH5A 1A4RA 2BVXH 3LLUA 2XXLA 4M0LA 2IF0A 3AVPA 1OSNA 3I29A 1NP6A 4JYVH 1D4PB 1QHHA 3RNLA 2HWLB 3QEOA 3MYWA 1E2QA 1O2YA 3C41J 2HGTH 2EA3A 2GJKA 1X3SA 2BVSH 1K22H 1OXUA 3UIEA 1U8YA 3PMJA 2PMKA 4BE7B 3GLGE 3SBDA 1YBWA 2OCVB 2DFKB 2PZGA 4BZQA 4PFSA 4PC7A 3P27A 2JA1A 4QHTA 1E32A 3TW8B 3A87A 3GY7A 3LKWA 4Q9HA 3SI7A 4C7OA 5F9FA 2BCJQ 1TMKA 3IUYA 4LY6A 2Z9GA 1YZGA 2V1XA 2SGPE 2X2FA 1ZMNA 2DHRA 1YZKA 4NL4H 4JMPA 2OLKA 3T1OA 2GCOB 5E0HA 1E69A 2OBLA 3ZYCA 2XJ4A 1C2FA 1AY6H 2A4RA 1ORFA 4URUR 3TNFA 4BFUA 1H8ED 2BMGB 721PA 1TF2A 5CDFA 4MUAA 3LGVA 2TGAA 4WVPE 1JJ7A 2VH6A 1Z0AA 2NMVA 4TTPA 5JWHA 5IK2D 3M5OA 4Q7LA 3SQEE 4KYUA 2C5LA 2SNVA 2JCSA 5GVSA 4IOLA 4XD7D 2ZSAA 1ZBDA 3F0TA 5IT5A 1OKXA 1N6HA 2WIBA 3QXXA 4UNSA 4CT5A 1SVKA 1KZGB 1WF3A 1F0TA 2CEAA 4RCYA 1V2NT 3LFUA 1TX4B 1NU7B 2VVUA 4URYR 1O5AB 1S1CA 2BTCE 4MYCA 4URVR 3PLKA 3BB4A 5AJVB 4DURA 4MPWA 1EASA 3BIFA 2C98A 1GJ5H 2QL6A 3ZVGA 4C9BA 1C5SA 2B6HA 4IJMA 4XSGA 3U2QA 1GGDC 1SFQB 5CB6A 2ZHWH 1I4DD 3SU8A 2AHOA 3WP1B 1Z0IA 1L4UA 2IHBA 1AWFH 3NTUA 3C5HA 3THYA 1GJBB 1SLVB 1ZJDA 3IG6B 3PIRA 2J92A 2OQ5A 1G41A 2C9YA 3QF4A 4RZ2A 4A6XA 1NSFA 1FY3A 1W49A 4XSHA 3RS2A 4ILEA 5CJ2A 3GJ7A 1L1GA 2AWNA 1HYLA 1LV7A 1TBQH 1P62B 1OPXA 1TU3A 4KLZA 4KGAA 1Y3YA 1PV4A 4Q1AA 1MUEB 4TPIZ 3FKSD 3SR0A 1UJ1A 3RLWH 1FZZA 1KNQA 1EFCA 3PJRA 2B8WA 5CIWA 4UDWH 4XJXA 3UWKA 1DAEA 1JR6A 4Q7YA 3UOPA 4BLOA 3AVTA 2GESA 4YLGA 5J4KA 3AH8A 4OS2A 2XZPA 2EFCB 1X6VA 2FP7B 2J87A 4RSPA 4LYAA 1KXCA 2FN4A 3U1IB 1SZPA 4PQFA 2FGJA 3A82A 1C1QA 3WNDA 1P2NA 1KI4A 4K69A 2HDNB 1GWNA 1IQNA 1N6YA 3DZDA 1P6XA 3NDBB 2AXPA 1EJNA 2BQ7B 4EPVA 4QM7A 2EFHB 1Z2CA 4ISHH 3PEVA 1P5ZB 4C2UA 2C8XB 2VIWA 1TNGA 1C5WB 3KQHA 2GZAA 1VITG 4U00A 4QJ5A 1C5XB 2IS2A 5EXLA 1F5NA 3F9EA 3F8TA 4N1AA 4CEIB 1QCPA 1SHZA 2G8TA 2WPKS 1FP7A 1Y3VA 4OQNA 1Y5UT 3CWQA 4RD4A 4HAWA 2PW8H 4CYMA 1OIVA 3KKMA 3V4FA 5EP3A 1XX6A 1R6BX 3QK1A 1SGFG 2R6GA 3VNUA 4KO8A 3LX5A 3AM1A 2AN9A 3X2SA 3A58B 2JETC 2GXUA 3HR8A 3EPLA 3OY5U 1SXJB 1UDXA 1A7SA 5DO9A 3A80A 1ZIOA 4CRCA 3OE7A 3R7WA 5KSYA 2XX3A 4IKEA 3BXZA 1GNRA 3BTQE 3SGBE 1WRBA 2F1RA 1ZNYA 4DT1A 2V7QA 1DBSA 2Q9CA 2KJQA 4HLUA 4M53A 2IJD1 1YR9A 1YYY1 1ZUHA 2QMEA 2WJHA 2C9OA 3KL4A 3M0EA 3QEJA 5EGMA 2PZFA 4B75A 4Q4HA 2WPLS 3MWKA 1NTPA 5B30A 4Q7JB 2H9EH 2ZRHA 1NN6A 1GKYA 4PZLA 1D9ZA 1V5WA 2F3RA 4DCSA 2GZHA 3GJXC 3SU1A 2GNOA 4B32A 1R0WA 4EPXA 1W36D 2BM1A 5HPYB 4B71A 3L33A 4HB3A 3K09A 1YR8A 3CBQA 3TK5A 4OHWA 1CR2A 3C16C 5HCIA 2FV8A 2BZAA 5L2ZH 1T8UA 3KB1A 4C0LA 2SGAA 2XBYA 5GJVC 4XSKU 3LVQE 3AUYA 4WA7A 1GITA 5C20A 2ZR0A 4LYFA 2A9KA 2OEPA 1Z7KA 3OAAA 1O3OA 5EP2A 3CPJB 1MZAA 3QTVH 2DE8A 1YZUA 1UF9A 5EPNA 4QNRA 1RW4A 3KCGH 3BB3A 1Z1JA 1AKEA 1RPZA 1O3FA 4ESTE 2YOLA 4MYUA 1U9IA 4NYIQ 1TAWA 4RFVA 3QE0A 1ZM7A 2O8TA 3JZ2B 4JYTA 1ZUIA 1U81A 2AIPA 4Q9KA 1TQ6A 1GBTA 5A09A 2JJ8A 4P4SA 5CM8B 1G5RA 3NHBA 4PHGA 1EP5A 1JR3A 3N5CA 3A81A 4O3MA 4KSBA 2MSCB 2XTMA 2OBQA 3S9AA 2DWPA 1ZNXA 2ZYTX 1MO6A 1MKXK 3W3AA 3ZZUA 1BMNH 1B0FA 4W5HA 1QL9A 1TFXA 1FTSA 3SV9A 1F5LA 4ZI3A 4L9SA 3OE7D 1S1MA 2AGEX 2BWJA 4YOIA 1UFQA 1J8AA 4LJ5A 2WOJA 1ZYOA 2Z4RA 1CT2E 2GBLC 1GJ9B 1LVGA 1UCYH 1IQJA 1IM2A 3OEEA 4QOSA 2W3IA 2FS8A 3U8OH 3CF0A 4NZLA 1THRH 2RA3A 5ESTE 1FIWA 1K21H 4VGCC 2HF8A 5TDHA 1W36C 3TH5A 3L43A 1OXGA 3TNTA 1HRTH 1O2JA 1TE0A 4J0QA 3ZZDA 1O3GA 4RD1A 1OP8A 2GT7A 1I4LD 2WYGA 4EAQA 2GCPA 1RFNA 2Z3DA 3QXCA 1GI5A 2OFOA 3I77A 4ISOA 4LI0A 1XTJA 1MTSA 2J38A 1BQYA 1MR3F 1IAQA 4MG3A 5EZ5A 2W7UA 3QVVA 4QBFA 3LONA 2QIQA 3RUOA 4MYHA 1W5TA 3UMRA 3LGUA 3M61U 2XSZA 1SKYB 2IJOB 4JSYA 1FXYA 3ZH9B 4UFFH 4X2YA 2DYKA 4PANA 3BN9A 4HLCA 4DVAU 4D9QA 2J1LA 1BYUA 1GI2A 4FMCF 2NO0A 3GICB 4KTUA 1O5CB 4WXIA 1OKKA 1PLLA 4NMMA 1O2IA 1TRYA 3BGWA 3CH5A 4LJ4A 1SPJA 3MGCA 3T2NA 4TMVA 3WNCA 4KCGA 1XXHE 1E9SA 3QX5H 2JKHA 2D26C 2BXTH 4TLDA 2ZCKP 2LPRA 1AE5A 1ONBA 4JBYA 1DY8A 3S0NA 2ZDLA 1RS0A 1A3EH 1D2NA 1L1NA 2RB4A 4LPSA 2BY9X 3SOPA 3SU5A 1G3RA 5A5GA 2BBSA 5BWMA 3STJA 1BCUH 3EASA 4UNPA 3FZZA 1HA3A 3K0FB 4GZLA 1DEKA 2NWNA 1GJAB 4TQAA 4MGIR 1O36A 1E34B 1O2PA 2EYQA 3S1AB 3CS7A 1XEFA 4HLUC 1GI0A 4ZKEA 4NIVA 2PGQB 1GDNA 1OPHB 2XBWA 3QJYA 4I32A 4QM6A 3GLGA 1MH1A 1SC8U 3KJIA 3RANA 1T3HA 1GGDB 4ZKNU 3N7OA 2QTFA 4YMWA 1U90A 3OEED 3B9QA 1AQYA 2OC1A 2CXVA 4WF8A 4C30A 4CEJB 3FYHA 1N6LA 4HLDA 4MPUA 2R44A 4X8HA 2PWXA 3BTKE 4NBSA 4XH9B 2ZS7A 2D06A 3RLFA 2GMTC 4GUXA 5HE9A 3K09C 1XTKA 1K1NA 2OXCA 3KFXA 3PUWA 4Z51A 4QHSA 1ABJH 4YXWD 3TVJB 2WHXA 5BXQC 1KK2A 1WUNH 4X8SH 2C96A 5HGGA 3RC8A 2GDJA 2HNTE 4JZKA 3LGIA 4FMBB 1QA0A 4ISIH 3PEUA 1TGTA 2L0XA 3V3MA 2XSZD 1KNXA 2IYRA 3T28A 3MFJA 1O2OA 2BD9A 3GJ8A 3IIJA 4II7A 2TRMA 1KK0A 2ZRCA 3FHCB 2JEOA 1A0HB 1MCTA 1E98A 3EC1A 4HDCA 4BLSA 1FQ3A 4B6EA 2PR3A 1VHTA 1JXMA 2GJ9A 1F0SA 1FFHA 3EX7C 1CJMA 2OFXA 2OILA 1XBTA 3E70C 4KBFA 2HXSA 3IITA 1ANBA 4CF7A 2I6QA 3U9AH 3AVXA 4OHXA 2BDIA 4OYHA 3DPUA 2FLRH 1ODFA 2O8BB 1ACBE 1NS3A 3KQLA 4XBBA 4G5RA 1AUJA 2QNRA 4GHTA 1U0LA 1WE2A 2QC2A 2ONKA 4IDPA 3AP1A 3SYKA 2HV8A 4K3JA 1A2KC 4UJ3A 4NYMQ 2Q1JA 1GRQA 3NBXX 1GMDG 1THSH 3LWNA 1Q22A 4F93B 4QFMA 4IDQA 4HZHA 1EP6A 2ZU5A 4P32A 1ELAA 2BDTA 1O30A 1W3CA 4IOJA 1UVSH 3UKDA 1MV5A 2JETB 1NKTA 1TBZH 5I25A 2D4HA 2JLQA 1BIOA 7ESTE 2ZVQX 5T1VA 2ZKSA 2BD4A 1ZU5A 1HJ8A 3SJ9A 3AQ4A 4WXPA 2OAP1 1QBVH 3P4XA 3SJ8A 1GJCB 1R5OA 4I1SA 7KMEH 4BASA 3U3KA 5BPEA 5BN5A 5CLQA 2HCBA 5DH9A 2R9VA 1BJUA 4NDZA 3RXQA 1TBRH 4C7OB 4V0KA 1Z71A 1N6KA 2XBVA 1ZGVA 1M7BA 1P01A 5LPFA 4B48A 4JLVA 2CMKA 2WPMS 3VR5A 1MKWK 2BDGA 2R3UA 5L3SA 2C3SA 3GJ5A 1J70A 4DLYA 3AEZA 2G81E 4AZ2B 4I4LA 2IL1A 5UKDA 5KDDA 4QBGB 4DT7B 1ZHRA 3WMGA 1QHXA 4DLWA 3ECCA 1C1MA 4BPBA 2PLRA 3PMBB 1XPOA 2RG3A 4EDHA 1U0JA 1Q3TA 5E7MA 3Q7PA 2XZOA 3RS7A 3UWIA 1W4BA 3MWLA 2GXQA 4XOIA 3GY2A 1GHZA 3SOSA 3LRPA 2OZEA 2X2EA 4OK3A 2PUQH 2QMHA 5G3YA 1K2I1 3SJBA 1YKTA 1IHUA 4Q47A 3H4MA 1GWAA 3F6UH 4Z54A 5EZ6B 3P26A 2RGXA 3QO6A 4B2AA 3VU9A 2VP9A 3K65B 2B9LA 3TQFA 3UG7A 1KI6B 3U1JB 2LKCA 1KDRA 3H0KA 4UEHH 4R2IA 3NIBA 3GDUA 2C99A 2F9PA 2O8FA 1DAKA 1OWDA 1G5TA 4DIEA 4ZCMA 1IXRC 5FBRB 3B6EA 3I8XA 1GKUB 2FI5E 1P9NA 1WCV1 1KSHA 4HZIA 1CRPA 2YWFA 1Q1BA 1FY1A 1KXDA 3ZZ5A 1OYQA 2ZO3H 3THYB 4V0LA 2FTMA 2CJIA 2FNAA 1E0KA 1QHGA 2J9RA 3M6AA 5GDSH 3QF4B 2HOBA 2HYIC 5JZVA 5DIFA 2GAAA 1P2SA 1RJ9A 5AUPB 1LPGB 1S3SA 2EU8A 2WV5A 4DGJA 4Z6AH 3K0EA 1Z22A 1EX3A 1O3PB 4MKIA 3U4QA 4CBOA 3SGQE 4VGCB 3R9XA 4TYYA 1PQ7A 4FXPA 1W36B 4JLMA 1P2KA 3IPXA 1HQYE 4MPVA 4HB4A 2BEJA 4QBHA 2FU5C 2LNCA 3EXAA 3HK6B 1UPTA 1ZM2A 2BY5X 1MTVA 2R6FA 1XZPA 4U30A 1UK3A 3TJNA 4A5TS 1KDOA 3SBEA 1TPOA 4PROA 1GVKB 1G36A 3BB1A 5FOUA 3CF2A 2V3HH 1JMOH 4PSAA 2I4IA 2IEYA 1P2JA 3DD2H 2O8WA 5KDOA 3Q8XB 4NH0A 1E9AA 3SU2A 5FPSA 5HKKD 4CW7A 1GMCF 4AG1A 3K6YA 4LPKA 1M7HA 3B82A 3TSWA 4NCKA 4NWKA 5C18A 1S96A 1HE8B 4ABIA 5G4BA 1GBHA 4JKIA 1HY3A 3ZJYA 4AGKA 4K1TA 4K8YA 3VFEA 2C8ZB 3D8BA 1H8DH 3RDZA 3KX2A 6Q21A 5HMAA 3EPHA 2V3CC 2BVRH 5BYJA 5JI3E 2LKDA 1F2TA 4E07A 2QI9C 5TJXA 3AASA 4GCHF 4ZV4A 3F3YA 1S81A 4TMXA 1O38A 2J94A 4QL3A 5LDDC 2AFIE 4US1R 2NTYC 1WBGB 5A0BA 3OESA 2VQSA 2ZUBA 2R0KA 2GKSA 2VIQA 2IWHA 4A6LA 4B73A 1IQLA 1KO5A 2DE9A 3BEFB 4S2EA 4OS7A 5EUQB 2W6JD 3NC0C 4I7YH 1VZQH 2QRNA 3ZZ3A 3KXLA 4YO9A 2Q6DA 2CHVA 3EE0B 3EA5A 4PC6A 3RXIA 4MTBA 4OQLA 3TK1A 1C1SA 1YCPH 3MJHA 4ZKRU 4YZUA 3RRMA 1GNQA 1SQTA 2OFWA 2ZETA 5G40A 2ZWLH 3VR3A 4FVBA 2ZR7A 3VKHA 2GMTB 3LNCA 3GCHC 1E79D 5E7JA 2XWAA 2W6ID 1NIJA 1GAJA 3U3JA 1AMHA 3VB6A 3BTHE 2H5CA 1OV4A 5DP3A 3TSOA 4AG2A 4Q01A 3EWSA 1G3QA 1M74A 2PJZA 4BAHB 5FI0B 2XGJA 1VIAA 1D8TA 2GJSA 1XD2B 2IXEA 3DUXH 1QRXA 3NBFA 3LQRA 1ELFA 2AEIH 4FUFA 2ZAMA 4M4SA 1KTTB 1C2DA 2FOCA 1FAXA 2IPHA 1XXHA 1Z8RA 4HAUA 3L0IB 3MJRA 1NESE 2H1UA 1UDWA 1BRAA 2FOLA 3T34A 2G6BA 2WAXA 5L3QA 1KAOA 4O97A 2OLGA 4JBXA 1RTKA 4CEHA 1AE8H 3VXEH 1AKSA 3SU4A 1NMXA 4P4SB 3SW2B 4MH0R 2FDAA 4URXR 3RXAA 3I8SA 4TYWA 4BFWA 4HUQA 3NPSA 1OIXA 3Q5EA 1HYQA 3VR1A 2BBWA 3VX4A 3MRSA 2JLRA 1EQ9A 2RGDA 5IDVA 4OGXA 4IS5A 2SNWA 3GLFE 4JJKA 1ELGA 8KME2 1R4AA 1P09A 3RXEA 1J14A 1IQKA 5TB5A 2GJ8A 1E2KA 2QORA 1L0ZA 1PZNA 1KIGH 4B1TA 2B8TA 2NPFA 4X6PA 3A84A 4G3XA 3QSYA 2G9NA 2ZJ8A 5EOKA 1PVOA 1RRPA 3LH3A 2IYUA 4FU9A 3GY4A 1TPSA 3TAHA 4G5GA 1SVSA 4OI1A 3BFXA 5IRCD 4K5ZA 4B3DA 2REOA 3GJ0A 4JLJA 4LHVA 1EOLA 1P0SH 1VYTA 2ZI6A 3P70B 3IDQA 4GSYA 4LHYA 2ZQ2A 1T32A 3PEWA 6LPRA 1LPKB 2IS4A 3ODDA 3PV2A 1EUFA 4X0WU 3ZVEA 1O2VA 3SUDA 1YGCH 2I1QA 4LJ6A 3TAUA 1TMUH 3EZ2A 4OJQA 3LBHA 1EOJA 1JBKA 3BEIB 1HBTH 2MSEB 5FUVA 2VF8A 4BLTA 4BQSA 3CENA 1NC6A 2XWBI 3M4YA 2B7CA 2G1KA 4IW4E 4LC1A 2BY6X 1W7AA 1P2VA 3AK5A 1N6NA 2VHQA 3MG9A 4DDUA 2OC7A 1Z06A 4IC6A 3NBZC 4AN7A 3AVYA 2PKSC 4GP6A 3D7MA 1HDTH 1M9UA 5KPDA 1P75A 3KJEA 3A1TA 4AWXA 1ZIPA 1ZAKA 3SJAA 3ZIAA 4Q9IA 1SGNE 2HALA 2BOHB 3PYHA 1J7KA 2G5VA 3ZD6A 4Y10E 1TADA 3RXJA 1W0JA 1F0UA 1H4WA 1G9IE 2H92A 4BZXA 4ESVA 2RKOA 2D7CA 3CX6A 1DS6A 4A8JA 1DX5M 2PFEA 4FVDA 3B1ZA 3RC4A 3LX8A 1NBMD 2FSGA 1DELA 1G20E 1OB2A 5AJXA 2H16A 3GJ6A 1JPJA 2PZEA 2IUTA 3NZIA 4ABYA 1TQ0B 3QGJA 2GK6A 5JECA 1JQLB 4ZUHA 2AH4X 1XUFA 2QE7A 6GCHG 5K8TA 4OI0A 1YP9A 4A0GA 2Y80A 1J9CH 3VR6A 1ZYUA 1U98A 4J2YB 1FDPA 4TY7A 4PZYA 4R8TB 2UVQA 3EWAA 1O5EH 3BV9B 1GJ4H 2FOHA 1PPZA 2PV9B 1GBEA 4YDHB 3PMAB 2FZ4A 2AFQB 1W47A 3BERA 5TCCA 1OWKA 5DG6A 4FCTA 3QZQA 3HPRA 1OXTA 5HTKA 1GBCA 5LD2C 2DWQA 3AKCA 3P95A 3D3QA 2WWIA 3ZZ7A 4M9FA 1NRPH 1XD8A 4KODA 2VWMA 1GBMA 1J17T 2CV3A 1PUJA 1ANEA 2FG5A 3MNSA 2AKYA 2YV5A 3ADCA 1GDUA 1EFUA 2JGNA 3TVDA 5KYKA 2O0KA 4KFRA 3OTJE 1P10A 1SGTA 1ZGIA 4C0SA 1EAUA 1NI3A 3WHLA 4NA9H 2XNSA 3AB3A 1TUEA 2JH6D 4W5JA 1CHGA 3E16B 3E5HA 2R2MB 1P03A 4US2R 1QBNA 4JLAA 5L8VA 1FUJA 2QGRA 3RXOA 4A82A 2F43B 1MKYA 4ZROA 3REGA 1F0RA 4E09A 2UWLA 1C1VH 2P3SA 2THFB 2OP9A 1P06A 3PROA 1UBGA 2JLZA 3ZZ4A 3RLYH 1KZ7B 1XNJA 1OT3A 2H9HA 2AMQA 2C4FH 3VKGA 2GJAA 2XAUA 1TQDA 1O3BA 3LJJA 2VSXA 2C90B 1JBUH 2B0FA 1TPZA 1QRAA 1C4V2 3T29A 3KN2A 2EFDB 3TJUA 3LGTA 4B2CA 1OHHA 3R3GB 5L6NH 1NMYA 5LB4A 1XWIA 2QBYA 3M5MA 3RS3A 2X8AA 1ZVQA 2WWWA 1P02A 3TSZA 1A46H 4RSGA 2EQBA 3RABA 4KAXA 1AD8H 3AF0A 1AZZA 2ZJ5A 3L3TA 2J95A 3I1FA 3CX7A 1LCYA 1GILA 1R7RA 3H7OA 1UTQA 5IF9A 1GHBF 3LDAA 1K1JA 3LC5A 2QP4A 2GVDC 4ZDKA 1W12U 1KK1A 1CJUC 1T3SA 1C5QA 1A2BA 1T8TA 1KLIH 1QZXA 3URCA 3GP8A 4L15A 1GBDA 1TNKA 2PEZA 2A1DB 5FUWA 3LXRA 3IBGA 4PXAA 1NG1A 1C4Y2 1ZD8A 4TLCA 1U94A 1OYTH 3BIUH 2ZGJA 1O2QA 3WYAA 4UNRA 2QXIA 2G4UA 1XMSA 3LH5A 1N5KA 1XUJA 5C3NA 2VEDA 1DSTA 3V00A 1IY1A 3N2EA 1JIMA 1L4YA 4DWJA 2FFAA 3T35A 4Q4JA 2ZFSA 5L3SB 4FUJA 4O03A 4A36A 3RS0A 3M7UA 5AWFC 3ZZAA 1YRAA 4A2WA 3AVWA 3P20A 4ZAEA 1Z8IB 2XB4A 1LKAA 5ABWA 3K9LA 4AG5A 3GCHB 1OLOA 1ZMJA 2E1RA 4PAOA 5EG4A 5FFMA 2BJVA 4AURA 5EE3A 1ELOA 5JCZA 1UJ2A 1Q1ZA 2FO9A 2VVVA 4ZMAH 5BW8A 2GKVE 4NE2A 3T62A 5FBWB 2A5FA 2GEUA 3EZ6A 1KI9A 1GKIA 4PAQA 1G8HA 2JH0D 4XBCA 3TJOA 1E1QD 1L2EA 2IBMA 2ZU1A 1A5TA 3U7HB 1IQPA 4A0FA 3A36A 2MMGA 1K1IA 1E2NA 3M3VA 2QAJA 2BZ6H 2BD2A 3I3SR 2ZE6A 3RXBA 4JK6A 5DI9A 1V2WT 1GCTC 2ILNA 1Z3IX 3WBKA 3BS4A 3CKLA 2WJVA 3AV0B 4GT1A 1KMHA 5H70A 3VU9B 2GILA 4PPFA 1KDTA 4V0NA 1B0EA 1BTWA 2PTNA 3SHFA 3P1JA 1AFQC 3ADBA 3QNUA 2O8FB 2VSFA 2VP6A 2QMOA 1Q57A 3NUMA 4CRGA 2XYAA 4B3BA 2QEQA 3W90A 4DJTA 3I78A 1C1TA 3ITIA 3FFAA 4DLSA 4RI0A 1WDTA 1SGFA 1MKXH 2OXSA 2P5TB 2ZYWX 1C2GA 4M1OA 2GTPA 2WBLC 3A8AA 1G1MA 2ANCA 4IDNA 4OI2A 2B21A 1QG4A 3N2IA 3SZRA 2ZCHP 1XPUA 3FP8E 2A30A 3B78A 1WTGH 1TA2A 1IJFA 1GMHF 4M1MA 1AHTH 3E0NB 4KFUA 5KUTA 3X1YA 4IHQA 4TMWA 1G3BA 2VJ1A 4WH6A 4DIIH 3WY9A 3MNBA 5EODA 1NN0A 4D9RA 4KTSA 1LF0A 4UFGH 4A1VA 1LHGH 4IDHA 3IPYA 2FZLA 4C0HA 2J0UA 2QV1A 1F2UA 4TZ0A 4G01B 4LZZA 1TGCA 4BZPA 2AYWA 4TWZA 4B6FA 3I61A 2H5EA 5HZKA 1PPHE 3A8CA 3RU4E 1QHIA 4PSKA 2Z43A 1US8B 1A1RA 1Q21A 1DPOA 2BEKA 1E2MA 2YINC 3UPEA 1TQ4A 1IXZA 2GEDA 1ZW6A 2P16A 5E2PA 1J15A 3EG5A 4L16A 5FXLA 2J0VA 4Y71A 3MWIU 1VR1H 1C2LA 2PKSB 4M1YA 1DOJA 3ZZ8A 4EPYA 2ALPA 2ZE7A 4AYXA 1EFRD 1BMMH 1O2NA 1IOZA 2JIZA 4O9VA 2TGDA 4GOXA 2WPDA 3GLFA 3Q3YA 1O87A 4SGBE 1N2CE 5FH9A 3OF5A 4KITB 4XE4A 1JECA 4DLUA 2CXXA 4CBNA 1BMFA 1E2HA 1YF4A 2QN6A 1FPHH 1GI9B 1GSIA 5DGXA 4DDTA 3EA8A 4FUDA 1RTFB 1G4UR 1CHOG 2WZQA 1WXQA 1HAZB 2FWRA 1K28D 3O8DA 3HDTA 6ESTA 1EFHA 2UUYA 3OEHA 4G5SA 5A8XA 2ANKH 1EWRA 4UD9H 3LBIA 3GCOA 2PCLA 3EW9A 1AQ7A 1BDAA 3PVSA 1GDDA 2ZE8A 2IC5A 1P05A 1LO6A 3U98H 2CHAC 4B74A 3E90B 2F1IA 3K53A 2JLYA 2AK3A 5GJ4B 3HYTA 3KKOA 4TLAA 5K7RA 1V2MT 1PQAA 1H9LB 3B5JA 5LD2B 1WA5A 4X1RU 4TMZA 3PLPA 1TYNA 3JVVA 4R71A 3SZEA 2VH0A 3CX8A 1O5DH 1JWTA 1G6OA 3B60A 1YE8A 1MAYA 1EX7A 2WKQA 2Z0MA 4AGJA 5GXPA 1SKQA 2GCHF 1CTQA 2ZANA 1DG1G 3K0AA 5JJLA 1VCPA 2ZJOA 3AKYA 1Z6AA 2ZPTX 1MBQA 1W10U 1XTRA 4IXMA 4D0NA 5J5CA 3VHXA 1DWDH 2WUCA 3RXUA 1XXHB 3F1SB 3GLHE 4H1VA 1BTHH 2GVFA 2ZG0H 3B8JA 2H8KA 2TGPZ 1SHHB 1MBMA 1IQHA 5CITA 3S9CA 4FCWA 4MLFB 5L3QB 1X7AC 4GNKA 2SGEE 2H7VA 3SE0A 2QA9E 2V4ZA 1BOQA 1Z2AA 1FL9A 3QWCH 2H2ZA 1S5SA 1R10A 5DKMA 1GI7B 1E9FA 1P2UA 4O0MA 1YRBA 2AD1A 4DC9A 4XDEA 3V0XA 4I99A 1JALA 2I1VB 4GMXA 1VCNA 1UEIA 2A5GA 2NZ8A 3ZD7A 4HUQB 1F7ZA 4EQ6A 5JS7A 4N3NA 2V1UA 4HB2A 2J9NA 1H8IH 1O2UA 1UTOA 2ESTE 1W4AA 1ID5H 3I73A 1O3JA 1HAOH 2W7SA 4D4JA 2PKAB 3MLEA 1L4DA 3JZAA 5P21A 2BLVA 3PQCA 1SVLA 2CCJA 5ESBA 4JSTA 2QRZA 1PYTD 1SB1H 1GUAA 1E0AA 3TRFA 4AC9A 2PEYA 4NP6A 4I8LA 5GJWC 3SHCH 1WBDA 2UWOA 1VJAU 2JJ2D 4FW9A 2ZJAA 3MU4A 3MH4A 5F3WB 2NZJA 2VHTA 4QC2A 3O8BA 5CYPA 2O0JA 4FD2A 5HE8A 4CRBA 1UTKA 4ZHMU 1A5GH 1XJ0A 3REFA 5DNYB 3RM0H 4AKHA 4EJSA 3FZDA 4R0IA 2A5KA 3F5FA 1O37A 4XFQA 4ARZA 3PMHB 4OJKA 1ELTA 1NU9A 4OK5A 1W14U 4IEEA 1VMAA 2A7QA 5E8EH 1O3LA 4MNYA 2QF3A 3RXTA 2FSHA 4BEJA 1RVDA 1S82A 3D62A 3T61A 4YQFA 2QA5A 1T4VH 1UTLM 2EC9H 1KXBA 3W3ZB 1DANH 1MKWH 421PA 4Q48A 2GHIA 2A31A 5DI3A 3QTOH 5JJIA 2OCPA 4NA8A 1T4UH 4XOJA 1HUQA 5GJBA 1HAGE 2JLVA 4NGAH 3GMTA 6CHAC 3C1KA 1BT7A 4GRAA 1NKSA 1VITH 2TBSA 5KPJA 1XTQA 3IQXA 2O9QA 2A5IA 1IN4A 3V4RA 1G291 2WKPA 2XOKA 2XEXA 3DEFA 3ND9A 4M1SA 4RZXA 1BUIA 2EW1A 1EXMA 1EZUC 4C3ZA 2A5DA 1S84A 2XBXA 1H8HA 1HAVB 1LW7A 2R2WU 4RCZA 1M1YE 3RXHA 3V13A 8OHMA 1CVWH 4IXNA 2PSYA 3LDXH 4WWYA 2AXNA 1E0JA 4DEXA 4XIGS 1LTQA 2RHDA 3OIYA 3K9GA 3RU4T 2FFBA 3QXSA 4BFYA 1XUGA 5DYIA 2Z3EA 5CE1A 2FE4A 1AI8H 1QJ1B 1GCTB 1ESNA 2XB2A 1SQ5A 1PYTC 5JEDA 5LPNA 1INCA 3OTPA 3TIFA 4NIWA 1BIFA 2V6JA 2ZRKA 3KDSE 4ASHA 2Z9JA 2QQEA 1AFQB 1XEXB 2IN2A 3SV6A 5FX5A 2PTCE 2R8RA 4ZPXA 4TL7A 1DO2A 1TX8A 3SBKA 2A5AA 1S8FA 3VHLB 5EJEA 8GCHF 2ZRGA 3T27A 3AAUA 4LYHA 3THXA 1MMJN 3THWA 1P11E 3KQBA 3SEAA 4GOKA 3EA9A 1SXJE 4PTLA 2FESH 2VYFA 2BBTA 3TJZA 3GCTF 4Y0ZE 1DTSA 4BXSA 1RRKA 2BDYA 1A5HA 4IRUB 3QKSA 4QG7A 4H6TA 1DM4B 3M3TA 2RGGA 1M34E 3UNSA 4LZ4B 1KI3A 2RGAA 1CBUA 2V8OA 3QY0A 4BFTA 2GZ9A 1YZNA 2VIPA 3SU0A 4D82A 2QUZA 4GLYA 3TGJE 2HLDD 1ZPBA 4NCHA 4TSFD 1QFKH 2ZCLP 3ZZTA 5I46H 3K8YA 1MO3A 2QROA 3U44A 1ZTLA 2QENA 2ZU6A 1FX0B 4K1EA 2Q9BA 4GPGA 5FTKA 2QPOA 2ZU3A 3LBNA 4B2BA 3HGPA 5HM2A 3CZQA 4FWIB 2R3YA 3SDZA 2CL7X 3TR5A 1LNZA 2ODQA 3VGCC 1TMBH 4B34A 1C5MD 4ZDJA 1TA6A 2STBE 2R2AA 4AYTA 1G3MA 1P60A 2B5TB 1QA7A 1QB9A 1ZMXA 2A2ZA 1KSNA 2NU0E 1DE7H 5EXSA 4U2WA 2F6RA 3L82B 1EPTA 5H1YA 1FPCH 2WPIS 1UVOA 3MO6A 1A3BH 2GF0A 1B5GH 1GBAA 1HTWA 1KI1A 4Q4AA 2V0BA 1O31A 2W3KA 1A82A 1BITA 3ASYA 3IEVA 4JZ1A 2C8YB 1GPZA 1PPFE 1HE1C 4CVNA 3SNAA 1JIRA 2VL7A 3RRZA 3A8DA 3BD9A 4FMDF 1D9XA 4AFQA 2ZRFA 4ASUD 5DP9A 4W7SA 2QAGC 1NPMA 3SNBA 5DO4H 1PQ5A 4OM9A 3K0CA 1R0ZA 2BMJA 1WV7H 5T6DA 4IFBA 4MRRA 2RHMA 3FHOA 3HK3B 5J4HA 4WVFA 1FNNA 3P8OA 3ZLJA 1G8PA 1Z28A 1KDPA 1V2PT 4Y11E 5F9HA 2RMKA 2YOFA 4X1PU 3ZVCA 1WB9A 1C5VA 2REBA 3KUCA 3A1VA 2BCGY 2ZDMA 2ZHEH 4BOHA 1O5BB 3ATLA 4BTUB 3R9IA 3C5CA 3TH3H 1FY4A 1T0JB 2W2XA 1O3DA 2SGFE 2BD5A 1PJPA 3QVUA 4IMZA 3VTKA 3MCAA 3GYMA 5C2JB 2Z6VA 5CYOA 1W0YH 2CHAB 1GTVA 5JRZA 1J8MF 4Q00A 4M7GA 3JZMA 3PLBA 2J7KA 1HT1E 1W46A 4Q4JB 3DFJA 3A7VA 1HAXB 5FCKA 2J0QA 4P33A 2OHFA 3ZV9A 2D2FA 2ZJYA 4OBEA 3ZZCA 3D6TB 3A7TA 4OQMA 1GHWH 1RIFA 4LGMA 5AJWA 3C7KA 3LJOA 3MU1A 2F1HA 4LBWA 5A4JA 2ZR9A 3B7GA 2FPKA 1P2QA 2OT3B 4ISNA
chains in the Genus database with same CATH superfamily
3OQJA 3K0SA 3CZRA 2G08A 2XCSB 1J8VA 1Y1RA 3QM1A 2BFDA 1AGPA 2W70A 3OQ6A 1YCPM 3PJGA 1P7CA 2LIPA 4CDRA 1C1RA 1OWHA 3UCEA 2D2EA 2FKAA 5CVUA 1AXEA 3IT3A 4BJ1A 1IK6A 4NECA 2FLWA 2AR9A 1BBRH 4S1OA 2N0SA 1OIWA 3JATB 3Q8WA 2CF9H 3I5XA 1MFZA 1W9HA 4IIJF 4YRQA 4Z7JA 3W5CA 4PZ0A 3FPKA 3QPAA 2GN4A 4X8MA 2QZ4A 3H1AA 4IN1A 3CM0A 4BANB 3B36A 1JEDA 3Q9NA 4MR9B 2H1HA 2NTEA 2YOHA 2NWQA 3MFYA 1AURA 5C1UA 4DBVO 3MTDA 2ZRMA 3AW9A 2ZGXH 1D3QB 1THMA 3E3TA 3OKFA 5TF4A 2P41A 5KNBA 3IOCA 3F6PA 3GXBA 3TO5A 3OT5A 3PCXA 1HZJA 4YOJA 2XY4A 1FZQA 1PTJC 2OUAA 5AOCA 2KAIA 2YV3A 5HZHA 3ORSA 2NPIA 3VHQA 1K7SN 1XEWX 2DQSA 2HB6A 2DFLA 3KEOA 1OXMA 1Z4IA 4ZK6A 4TTAA 1Y4UA 3KTAB 1KU0A 3GLHA 4D4LA 1GYQA 4ZANA 4EFMA 1KO8A 2CLEB 1WZCA 3PWZA 3GWZA 4IDDA 4N5NA 2ZE5A 3RTCA 1RC8A 2F2TA 3VR5D 2PUWA 4Z4QA 4U02A 5C8VA 4TVKA 1N1DA 4A9AA 4H6SB 4AK9A 4BO9A 3RJ9A 1Z18A 1GNLA 4ZH8A 3JPYA 4QXPA 1O94C 5LKRA 1R1DA 1QYWA 2VJYA 4FGWA 2F91A 1MUUA 1DADA 2DUUA 5DHRA 2HQRA 4NCXA 4YMVA 1X1RA 4J6FA 3KDPA 4HFNA 4KP0A 4MV5A 4TROA 1CBWC 3DMGA 4R98A 3DUFB 2H4YA 3NNNA 2WSSD 2ORVA 1KR5A 1AS0A 1I1QB 4DY6A 4FMPA 2XC4A 2OD9A 1I6WA 3I0MA 3H5CB 1Q2UA 3U7FB 2P4SA 2GN8A 4YJKA 1KMNA 2W2NA 1KFCB 4GPEA 5J4VA 1S3IA 3FHTA 1KMCA 2PGOA 3K6KA 4JLKA 3LWDA 5KEDA 1SXPA 3WP0A 5HIIA 3PFCA 1HT2E 2QZPA 3NHKA 1GQFA 4KL8S 3LH1A 1TKAA 3ZK8A 4KELA 2GEKA 4IMPA 1EA7A 2WE8A 1K1MA 3TW4A 1G64A 4WV3A 1ZCBA 4MUXA 3W2FA 3O1IC 2A7CA 1J1ZA 5HCUA 5GINE 2Y76A 5EFZA 1FUYB 4RZ3A 3QVOA 4Q3LA 4ZU6X 4NU0A 4TRMA 1AVWA 1LQDB 4OFWA 1RLUA 3ISVA 1CP2A 1PNQA 4DLNA 2BN4A 3PA8A 2JD1A 4DMKA 4NMLA 2NVUA 4CRFA 3C8UA 2CV1A 3A6EA 2FYQA 2LDBA 2CE7A 3ZZ0A 1ZM4A 5ABPA 1BZXE 1OCEA 3AHCA 4YALA 3HDGA 1GARA 3MAGA 4Y0VA 3K5PA 3NCTA 2G55A 2RCNA 2H4FA 5A6SA 2GBFA 1CNEA 2IPAB 2PGXA 4IGIA 1JHDA 4B3IA 1PO7A 3IUEA 3BQMB 3S7TA 3VGCB 5F3DA 4DCTA 2G40A 3EEQA 3W95A 3TS1A 1JDTA 1O96B 2HFKA 3LQKA 4O4HB 5GZ3A 4MP8A 5I7HA 1TVCA 2PGIA 2DY0A 4Y7CA 4EJ0A 4D9KA 2CE2X 3NGMA 4RFSB 3QKUA 4KDFA 5CK4A 1GU0A 1IBRA 2ANYA 1QVZA 2ZRIA 5H9WA 1H9HE 4WLOA 1RCTE 1E2FA 3ZZ9A 2PU5A 5AI5A 4GYYA 4TZ6A 2H6MA 3AFHA 1E6LA 3L5KA 4IN2A 1T15A 4NHOA 5I5EA 2UKDA 2J34A 3VV2A 4DVJA 1RC0A 1Y9EA 2Z58A 1OTYA 2GZDA 2J5RA 5DHQA 4CHGA 3H2BA 1GL1A 3QOXA 4JL5A 4JQYA 4NS1A