4A92A

Full-length hcv ns3-4a protease-helicase in complex with a macrocyclic protease inhibitor.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
639
structure length
639
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title A Macrocyclic Hcv Ns3/4A Protease Inhibitor Interacts with Protease and Helicase Residues in the Complex with its Full- Length Target.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 200
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4a92A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a92A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a92A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A03
1AN1E 5BPEA 4X8LA 4B6FA 4O2LA 4FW9A 1HE1C 2PMKA 5JWOA 2QMOA 2PJZA 3KJHA 1IY0A 1UVTH 2ZJ8A 1SXJE 2FI5E 2P6UA 4DLXA 1RRPA 3P8GA 3EIEA 4AFSA 1KY9A 4B3XA 3U60B 1RJXB 3SGBE 4IDPA 4LZ4B 2BOKA 5E8EH 3Q7PA 3VPKA 2D2FA 2QF0A 1SKQA 2FOFA 1W5SA 2NO0A 4B74A 3T5FH 1L2EA 2ZJZA 1O2SA 3ZLJA 4AYYB 2AKYA 1D6WA 3PTBA 1Z71A 1QB6A 2PHBA 4Q9JA 2FNAA 2C8YB 2REOA 4A8JB 4GNKA 1F0RA 2AXPA 3HU3A 3BEUA 3SJAA 1CGHA 3RXKA 1UAAA 3FVQA 2BHRA 5DI3A 3UUZA 3PMBB 1FY4A 3MUFA 3X2SA 3EZFA 4HUQA 1HAHH 4LPKA 2JA1A 1CXZA 3AF4A 5J4HA 4JZIA 1RJ9B 4QC2A 2Y5HA 3TR0A 1U8YA 3IIMA 2FX3A 4Z8XA 2VSFA 4CGZA 4CEJB 1K2I1 1C2MA 4PO1A 2BVNA 4BFTA 3UQVA 2M5TA 1A5TA 3P1JA 4JBYA 2ZECA 1UTPA 2IT1A 3K70B 3EA8A 5HKKA 1QURH 1UO6A 3AK5A 5AR1A 1BRCE 4LHVA 3SS8A 3LIWA 1T3LA 2O8FA 3U5ZB 4ZCIA 1PQ5A 1O2WA 2WJIA 1OB2A 3S1AB 4O3UA 3OY5U 1GVNB 4KITB 3EC2A 3MWKA 3QVUA 2A3RA 1H9IE 2AL7A 1KJZA 4M1TA 4IC5A 2HF8A 3HGPA 4I33A 3HP1A 3C41J 3N2EA 4AB8A 5F9HA 1W5TA 4I99A 4I81A 4GHQA 3TLXA 4EIWA 2BXUH 1IONA 2EU8A 4BZQA 2HGTH 3WBKA 9ESTA 5JCZA 1DTSA 4LZZA 1LVYA 2QROA 1HIAB 1NU9A 4KGAA 5T6FA 1VR1H 1AGRA 4PPQA 1GJ4H 2CN0H 1P9RA 3MHWU 1SB1H 2J9RA 5BN5A 1W4AA 1BHXB 3AW1A 4Q80A 1GBIA 3WRYC 3D31A 1IQFA 7GCHG 2BLOA 3VB5A 4JIMA 2VP4A 2G9NA 4CRCA 3RP2A 1GRNA 1ORFA 4WXPA 2FDCA 4QBHA 1GAJA 221PA 3I1FA 1J16A 3U3OA 2KBFA 5DP4A 2ANMH 2WKRA 1S84A 4ZMAH 1US8B 4KELA 1YR7A 2ZI5A 1ARCA 5FTMA 1GHBF 1G36A 2J87A 2HT1A 3UG7A 3DFLA 4GBMA 2IWRA 4V02A 3IKJA 1SGDE 2RA0A 1FNMA 4JVMA 4U5XA 3GY6A 4WVPE 2B92A 4TYDA 1UHBB 3WHLA 4AG1A 4A8JC 3HPTB 3KQBA 3L2OB 4UQOA 2WKQA 1E9AA 1OF1A 1P2NA 3H5CB 3A80A 2FPMA 1XD8A 4CIDA 2HCJB 5BQ5A 4EAQA 4HTCH 2ZE8A 2XZPA 2IEZA 1HJ8A 1GBBA 2DE8A 4GZMA 1AVWA 3ND8A 4G1UC 2D2DA 3K09C 1CHOG 5FCRA 1TPOA 5KU1A 2AMDA 1GHXH 2EFEB 1KI4A 521PA 3MSXA 3WMFA 4LV8B 2FFHA 4A0GA 3FMIA 4K1TA 2ZE6A 1P8VC 5G53C 5FOUA 1QIXB 1OW3B 1XNJA 3QKRB 1FONA 2BLQA 4A1VA 5GJVC 1VIYA 2NO6A 1C1NA 3ZZUA 1SVOA 1OWKA 1IXSB 1JR3A 1GL7A 3OEHA 3GCTG 3EIHA 1TYNA 1A61H 1F6BA 4OBEA 2A5JA 3F3YA 1WBBA 3ZZ8A 4EFLA 2HT6A 3BH6A 3Q72A 1N6YA 5KHOC 5F8ZA 3VR3A 5JSZB 1DWBH 5FI1B 1SXJD 2ZGJA 1C1RA 5KPJA 3A8DA 1E3MA 4MGIR 4DJZB 1O2GH 2JH5D 1KO7A 3FKQA 1Z6YA 1IQEA 4Q9KA 4OS5A 3FOZA 1VGCB 4X8SH 4LGMA 2BD2A 3GJ0A 1TB6H 2SGPE 4OI4A 3A85A 1ZU5A 1MQ5A 2ASUB 1EJMA 1S8FA 3P17H 3ZV9A 1I2MA 2D3WA 2P3TB 3GY5A 3PYHA 1QBNA 1BA8B 3SYJA 2WYJA 4TYPA 3P6ZB 1O2PA 5CDFE 3HDTA 4X6OA 2WWXA 3DM5A 2Z6VA 1KDOA 3U44A 4D0LB 5FPYA 3D62A 4QGAA 5ABWA 3JZ1B 4NZLA 3MMPA 4IOKA 2XEXA 4MTBA 1HAVB 2ZITA 4KXFB 2JDIA 4YT7H 3RXSA 1ZJDA 3WYGA 4TLEA 1UTQA 3CZPA 2X19A 3M5MA 4BZXA 2V7QA 1GJ6A 1A5GH 1W47A 5FPHA 5EXMA 1K28D 3EDXB 3AVUA 1W0KD 1UVOA 1ZC4A 3X1ZA 3UTUH 1JI0A 1HFDA 4ZDIA 4Q7XA 5ESBA 1TX7A 5EXXA 2ODEA 1THPB 1MKWK 4Y0AA 4PC6A 1Z08A 2G1KA 3W34A 1C5VA 1XTQA 4B2AA 5DH9A 4BRUA 1NROH 1F5RA 1JJVA 1W48A 1S6HA 1PJPA 2CNWA 2ZIAA 3VX3A 1G41A 3AKCA 1JIRA 4IHQA 1LY1A 1TALA 1EFCA 2FOEA 1GSIA 1G2MA 1F0UA 1HAPH 3FAOA 2O8DA 4RCYA 1D5CA 3GDVA 2ZYUX 3PV5A 3LD9A 4QRHA 1RTFB 1AVXA 2PGBB 2Z0MA 2Z3CA 4IBLH 3PLKA 1DAGA 2IN2A 3R0FA 1M7BA 4KSBA 5JBAS 3OEED 4WXIA 5LGOA 4B3DA 1TNDA 1WXQA 1Z0JA 4G5SA 2O0HA 1DICA 2GKSA 1G19A 1ZD8A 4TQUS 2VHJA 2BM0A 4XWKA 4LYHA 4GCHG 4DT7B 4OKSA 3MU8A 3D7MA 3BD9A 1P62B 4GMDA 2BDHA 1KI1A 4LYAA 2D74A 1XEXA 3D6TB 3TGKE 2SHKA 3R7WA 3MTYA 4BANB 3K65B 1AO5A 2W6IA 1GDQA 2AH4X 4M9SA 1C5TA 5JBBS 5DHAA 1DANH 4D81A 1NY22 1QQ4A 2P67A 1CULC 4IRUB 4PZLA 2CMYA 3C15C 2H5CA 3RM0H 1BUIA 1ELEE 4UXIA 1KAOA 2BMDA 3CR8A 3RXEA 4FUHA 3U7GA 3GLHB 4J1YA 1VGCC 1D3DB 5EXSA 1EWQA 1M8PA 4H42U 2ZZUH 2ZQ5A 4Q66C 5LD2C 3LBHA 4AG6A 2C9CA 4CRDA 2VYFA 4B73A 4RSGA 4TWYA 3TU7H 1G3IA 4DCVA 1C1MA 4WW0A 5FOWA 4S35A 4KTUA 1NRNH 4XOJA 3NUMA 1UK3A 3RXQA 4OYHA 5AF9H 3O8DA 1ANCA 1Y63A 4FWTA 5AUPB 4D4JA 4FUIA 3KNXA 2HOBA 2CLCX 3S9BA 3BB3A 2ZI3A 1JXMA 2UZIR 3I5YA 3SU1A 2WOOA 1FQJA 5DSZA 1XCGB 1P3JA 1JR6A 5E3HA 2XTZA 3ZZ4A 1V2QT 1H8HD 3WY8A 3KXIA 2CHAB 1OYWA 2IS2A 4Q19A 3NC1C 2YHSA 2BY8X 1EX3A 1Y59T 3BS4A 1IJFA 5A0AE 3SORA 1Z5ZA 5A4JA 2FN4A 1EFTA 3BG4C 1OH6A 4TN1A 4KVGA 4RFVA 1CT4E 1BTUA 2KAIA 2KE5A 3AF0A 3LXRA 3EPHA 2BIFA 1SGPE 4DEXA 4OS1A 1E1RA 4WJG2 4ASHA 4IKEA 5BXQC 1BTZA 2FX6A 3U2QA 3OHMA 5DGXA 1C2FA 3QIAA 3FGNA 4P32A 5LBIA 1EXFA 4PTLA 3LGTA 5TCAA 1UTJA 4UEHH 1M7HA 1N5IA 1KTSB 1IY2A 3LX8A 1HTWA 3RS7A 1Z3IX 4Q21A 1W49A 1XJCA 3SI7A 5HXFA 3EG5A 1Z6XA 3U3JA 2I3BA 2P8OC 1CA8B 2FOMB 2G5VA 4NIVA 3K70D 1H8DH 3LC5A 1TUEA 1GMHF 1P73A 1E2EA 3D65E 3SNAA 4UFFH 3ZYEA 3LT3A 4I1SA 4HAYA 2GHIA 2PZFA 1C2EA 1QCPA 5G40A 5C18A 1U9IC 1BCUH 1UTKA 1YKSA 1E96A 3AAUA 3B8HA 2ZRAA 1IN4A 4ESHA 1L4ZA 3Q00A 2IYUA 4FUFA 1OSNA 3E2IA 3E3TA 3SQXA 4DG4A 1QBVH 2PCJA 2JETB 5L3QB 2ZDLA 4HB4A 1O37A 4ZHMU 4HAVA 2G6BA 2NU4E 1CIPA 1NSFA 1YRAA 3BXZA 4JSTA 2XNIA 2XSZA 1Q0UA 2QN6A 1T0JB 3A88A 1VYUA 4R2IA 1H8ED 1CR2A 3E6PH 1LTQA 2PW8H 1P7CA 3VQTA 4Z6AH 4NYJR 4X8TH 1D8TA 4UFGH 1SLWB 1E2FA 1GHWH 1AN0A 6LPRA 1L1GA 2BMEA 2R0KA 3LDXH 3GEEA 1Z8JB 5CHAB 4TQ9A 4UXHA 2JASA 1FQKA 2B7DH 4ISIH 1RS0A 2XBYA 2EYUA 2PZGA 1BMLA 1UVSH 1PPGE 4AFQA 4XDEA 3RS5A 5AFYH 4NL4H 1O3EA 3JZAA 2ZGHA 1YZQA 2LKCA 4LBZA 4MYCA 2CHAC 3EA7A 2Q6DA 3ZZBA 1IQLA 3L3TA 5JBCS 1FY3A 1OP0A 1AKSB 2REXB 1KXBA 3ZD7A 1PPEE 4I8GA 5FI0B 1TF2A 2NIPA 1Z2CA 4PX9A 3T5DA 4LDJA 1P04A 3OTJE 2FOCA 4DVAU 1GL6A 2V1UA 5GJBA 4OGXA 4CBNA 2W6JA 1JEDA 1GI0A 2JLUA 4ZPXA 3T1QA 4YC7A 2IJOB 2BB4A 1ODFA 3SNCA 2BDBA 1GBLA 1TX8A 2F9NA 1DLEA 3QKSA 3NWJA 1RRGA 3TGIE 2P16A 3FHOA 4MH0R 1ZSJA 3P92A 4B71A 4GDFA 1AIPA 1G291 4DSOA 1F0SA 4RCZA 5F6MA 4C0KA 2XRCA 2ZYTX 1G9XA 3OE7D 2G0TA 1WB9A 2CHVA 2ESTE 2RDLA 5A0CA 3GJ5A 2J0UA 1C5YB 1TONA 1O33A 1S82A 3CR7A 5EXLA 1KDRA 3THWB 4BAQB 4GZLA 1XM1A 2Z94A 4A0FA 1HXFH 2VF8A 2ZCHP 1XXHB 3SGAE 4DCUA 1DWDH 5IHPA 4LK4A 2GJKA 1XD9A 2XWAA 1E2QA 1RRKA 1QVRA 3RXAA 3W6OA 2FIRH 2K5UA 4RJLA 1K6MA 2ZRGA 4JL8A 5FL3A 1KY3A 721PA 1BTWA 1F0TA 1MKYA 1C5QA 4GLYA 2BC9A 5A0FA 1TWXB 1AWFH 1GMDG 1VYTA 4EJSA 4DLUA 1NC6A 3ZJYA 1JQLB 1HV7A 1XMVA 3ATMA 1UDXA 1EXMA 5G4BA 2ZVQX 4OS6A 4OS4A 2ZTXA 3V13A 4F49A 2QE7A 2VHQA 4AFZA 1T0HB 1AKYA 4DRZA 3NBZC 4QJ4A 1V2MT 3WNDA 1K5DA 1A82A 1DITH 1TGSZ 3SBDA 3U7EB 2GVFA 3UNQA 3NHAA 2XB2A 1C9KA 2JKHA 1ZMNA 3JZMA 5C5OA 4YLGA 2OC8A 5CHAC 5EQRA 1BOQA 3TSOA 1E2KA 2H17A 1DWCH 3ATIA 1KI6B 1I2DA 5FOSA 4FD2A 1II9A 4A15A 1YPGH 1K5GA 5CM8B 3UWOA 5GIBA 2QM8A 2TBSA 1N6OA 3UANA 4Q9IA 5AJVB 2CJWA 2ZRNA 3GQBA 2Q6TA 1TBZH 4CH2B 1R8QA 1KDTA 1MKXK 3TJOA 2QAGB 4K46A 4DURA 4FU9A 1XPRA 3EYDA 1GDNA 2VWMA 2BM1A 4M1YA 4DCTA 4JLDA 1ZD1A 3HWSA 4TLBA 1UK4A 5JI3E 2X2FA 2CV3A 6GCHG 2ONKA 4XE4A 5T1VA 3E0PB 1MKWH 1Q1EA 4TTRA 2ZR9A 1E0JA 1XDBA 2C77A 2Z43A 4G5GA 3A83A 1CHGA 1QHRB 1ZNYA 2ZJYA 3L43A 4D26A 1TABE 3UY9A 2YOFA 2G77B 4DKXA 4D8NA 4NFFA 3GPLA 2OLKA 3ICEA 1E2DA 2W58A 1WQ1R 2P6NA 1N6RA 2F3TA 2J7KA 3DHWC 2IWHA 2JATA 4MG3A 1WCZA 4D6PA 3ZS9A 4X6PA 1HBTH 4ZO4A 5EP2A 1DDJA 1X8LA 1BIOA 2ZPQA 4B3BA 2XJ9A 4F92B 2DB3A 2GDJA 4ZKSU 1JJ7A 4QFMA 5HZHA 5JRJA 3DKVA 3AVYA 2RGAA 2BZAA 3IHWA 4D9QA 1ELDE 1EWRA 1AS0A 2FODA 2QBYB 2AN9A 3RWMB 4PZZA 1GBKA 3P70B 4M21A 3QPUA 1S83A 4D4MA 1TQ6A 2IYQA 5IDVA 2ZA5A 1V3XA 4L4UA 4BECA 1LQEA 1RXPA 4KHZA 1RTKA 4R71A 5K8LA 1VJAU 1ELVA 5LPEA 2W2TA 1DAFA 1F2UB 3LVQE 3KEEA 1WUNH 3R9XA 3AW0A 4ASUD 1O3CA 4RD6A 1E2NA 2HVXA 4BFSA 3GEIA 4LHYA 2GETA 3P32A 3NBYC 4NPHA 2J7PA 3F0TA 1W7GH 1E2PA 4ZH8A 3EQ0H 3A6PC 4A6XA 1ZC3A 3U8RH 4E7NA 4CHAC 3GLFB 1GBFA 3P4YA 2AGGX 4WZBE 1NZQH 3IUYA 3L0PA 1C2GA 5CLLA 5JHHB 4K8OA 1LNZA 3REFA 4ZKDA 2V9PA 3VAAA 1KXEA 4XTCS 1P5ZB 4FMDF 2FP7B 3AQ4A 2BY6X 5DP8A 3PIRA 1Y8TA 3SU5A 4QHYA 4OI0A 3G01A 4YMTA 1ZTJA 3B1YA 1QJ7B 2WIAA 1JAHA 1MD7A 5EUMA 3NEJA 3ZZ6A 4Y0VA 2ZI6A 2QAGC 3KKQA 4CR9A 1EJNA 4HUTA 5DLQC 4ZKEA 1LDTT 3ZZ7A 1KSGA 2F1RA 1Z1JA 1F48A 4TMXA 1Q3TA 3V9PA 1CR1A 2DHRA 4I8HA 1SQOA 2Z4RA 2AIQA 2QP3A 1XUFA 3H0KA 1TA2A 2ANBA 2VIVA 1GI3A 4RZXA 3GY2A 1UKVY 4Q00A 2CCJA 3LGWA 2QI9C 2WWGA 4KYUA 3KGPA 1NT1A 3FZZA 4UKDA 1E98A 1GFIA 5HM9A 4I8LA 4X6MA 2C90B 3DFJA 2ZU4A 2ANCA 2IHBA 2ZRKA 1BJUA 2ZSAA 4IGDA 1PQ8A 2OCYC 3EC1A 2X2EA 4B76A 5F03A 4X1SU 2O8BB 3DM9B 2I6SA 2MMCA 3EWAA 3UK6A 4PHFA 2OLGA 1LO6A 2XYAA 2FFBA 4NCHA 5CM9C 1ONBA 2C78A 4K81B 4BAOB 2BX3A 1XD2B 4P31A 1O3KA 4JYTA 3F9HA 4CEHA 4PC7A 2ZSFA 1EAUA 1G37A 3CF2A 3LH5A 2BKEA 2MSCB 3QGNB 2HPQH 4MNYA 1UKEA 1O2JA 3CM0A 4Q1DA 5BYJA 2P95A 4G5RA 4PANA 4OJKA 3DT0H 1ZPZA 9LPRA 2IEYA 3X1YA 3MU4A 3TAHA 1MO4A 1Y3UA 2GK6A 2PFEA 2HNTF 5JZVA 1V2ST 1EZQA 3DVLA 3LW8A 1A7SA 1V6DA 2ZSBA 1UPTA 3U3KA 1JRTA 4NFEA 3THOA 4NWLA 1RIFA 4Q1AA 1XZPA 4O25A 5B6LA 2C5LA 1CT2E 3SV9A 2VEDA 3T26A 2Y7ZA 4US2R 1LPGB 2PLFA 2QSYA 1BT7A 1QZXA 4OL0A 1IOEA 3MO6A 3HU1A 2PLRA 4HZIA 1TAWA 2BBTA 2E9SA 2XWBI 3RM2H 4FUCA 3PO1B 4Q4LA 2WJJA 1QRXA 3LGUA 4MITA 3DD2H 1ZRHA 3RRNA 1TNHA 3OSYA 3IG6B 1W2GA 2C8WB 1DAHA 2JJ8A 2W7SA 3QBVA 3W8RA 1E9DA 1G6OA 1VJ9U 4CEIB 1W14U 1YZLA 4GOJA 4TY6A 5KUTA 2BLVA 3QF7A 3BTDE 4DT1B 1DAMA 2IYSA 3RMMH 1OOKB 4BZPA 2BBWA 4IOMA 1YHNA 4ZXYH 1T8NA 1NY5A 1TIOA 4MUBA 4WVFA 4ZHLU 4PSVA 2R6DA 1HUTH 3G5UA 8OHMA 3P8OA 2Q9CA 2Z5FA 3ZVRA 3THXA 2G1JA 2RGEA 2F91A 1CGJE 4XSKU 4A82A 5J4VA 3CRMA 4ITRC 4MNXA 1MMJN 4HI3A 1O0DH 1ZPCA 2CL0X 2C9YA 2FGKA 4V0OA 1XBTA 2BMFA 1MCTA 1GI5A 4AG2A 2ZO3H 1YU9A 1YR6A 3WRXC 4Q47A 5PTPA 1Z8FA 1BTHH 4F4CA 3RAPR 1ANEA 1O2UA 2ODQA 4V0KA 1THSH 3KKPA 1NTPA 4W7SA 3T35A 4BTIB 2EFDB 1QA7A 3CF6R 5EU8A 5EP1A 2P0EA 2TGDA 1N8OC 2QUZA 1IXZA 4YQFA 1HY3A 2P3UB 5HCIA 3NCLA 1WE2A 1PQAA 1FN6A 4GL2A 4ZUHA 4RZUA 1ZMJA 3CRW1 2D62A 3ENSB 2RGGA 4U01A 4A7IB 3ZZ3A 2F9UA 2THFB 1GP2A 1KK3A 1HURA 1E0AA 2Q9AA 4DSNA 1C4U2 3GY4A 3OESA 4Q2KA 1YPHC 2QXIA 1XWIA 4JLBA 3H2YA 3UMRA 1Q1BA 4TT3A 2H9HA 5JYIA 4TMZA 1MH1A 1C5ZB 3B78A 1N6XA 1NRRH 3RXOA 4I8KA 2TGTA 1TLDA 3ZVMA 4TMKA 4DUGA 1XU4A 3N5CA 4HB2A 4NDZA 4D2IA 1IBRA 3K0EA 3A81A 3C5CA 2RCNA 1OH8A 2FSGA 1OXSC 2GT8A 1RC8A 1XVOA 1JR3E 3HU2A 1SFQB 3PO1C 4X8MA 4GVUA 2XXLA 1Y3XA 2WWFA 4YM9A 2GF9A 3V0XA 4CR5A 2ZAMA 4NA9H 3A4MA 1T8TA 1H8HA 4A9AA 2IS1A 4X2XA 2X8AA 1RFLA 1HQCA 5EXTA 4GFDA 4JT2A 1Z0AA 1GJ9B 1EESA 4X8HA 1GOTA 4HFPB 4XOIA 4URVR 4WZ6A 3Q3JB 5JS8A 3RXTA 3DOFA 1HYLA 4MGKR 1H9HE 1OIXA 3SJ9A 1XXFA 1KTVA 1EAXA 1QB9A 4A8JA 3PENA 1Z0FA 1XTKA 4RFSB 3BEFB 3SJOA 3LGVA 3UPUA 2ZFTA 1HXEH 2WAXA 1A5HA 3TPIZ 1FQ3A 3GISB 2FWRA 2V1XA 2NO1A 1GG2A 2YZ2A 1MO3A 3QG1A 4HAXA 1GI1A 3MWIU 2VVCA 3G82C 4Y76A 2JEOA 3QXJA 3RXRA 4MYTA 3K09A 3PXGA 1IQIA 2ZRIA 1RJ9A 5A0BA 1E9RA 4A6LA 1TX4B 3FB4A 3QSYA 1CJTC 3EA0A 2O5VA 3GICB 1A5IA 2XAUA 1C2KA 4CW7A 1G8FA 3E1XB 1IN5A 4CEJA 1MKXH 1DS2E 1P05A 2ZHEH 3K6YA 1U90A 1P2MA 2YNMA 2BD5A 5JHGB 3NEYA 1TL7C 1U8ZA 8GCHF 2XC5A 4B43A 4O2RA 1SGIB 1CVWH 1LQDB 1NFWA 3RMOH 4Q9LA 4FXPA 4RVCA 1N6IA 1YZTA 5CDFA 2G00A 2WIBA 3SZEA 2Q9BA 4IEIA 2V6JA 4PHTA 4ABGA 1C2DA 2QN5T 3Q8XB 2VH6A 4CYMA 3S1AA 1GI8B 1AQ7A 5HKKD 3M35A 3L82B 4JKYA 1GKUB 2P6RA 1XUGA 1GHBG 2ZRJA 4KSCA 3SU6A 2HPPH 1DSTA 5C46F 2BY5X 4LBYA 1P12E 1D3QB 4G01B 1GHVH 1EKBB 4ZDJA 3E70C 5GJ4B 3IDQA 4UNRA 5B2ZA 1ELFA 3RDZA 1P6XA 3FHCB 1W36D 2ZDKA 1G7TA 5ELXA 3EXAA 4QHSA 3RXVA 1GRQA 1PQ7A 2OXSA 5LDDC 4LYFA 2Z9LA 3RXFA 3SV6A 1HIAA 4U00A 1K9OE 3AP3A 1Z63A 1MAXA 2O8EB 3T62A 4ZHAA 4AX9H 4Q7MB 2QP4A 1ZPBA 1ZUHA 1Q20A 3AB3A 1FUKA 3MH6A 2R0LA 1VCQA 3N70A 2CBZA 3QPVA 1SHZA 1IQHA 4KFTA 2G51A 4QNRA 3TNTA 3A89A 1P9NA 2QQ0A 3GFTA 1VG9B 4QJ3A 1N6LA 3PEYA 1NI3A 3KQHA 2G3YA 2VL7A 2GTPA 3MYWA 1DT2A 1TX6A 1PPHE 1VZQH 1IJEA 2P94A 1SGNE 2BDCA 3AF1A 1US8A 1DUEA 2BOVA 1TMTH 1O2XA 2QAAA 5EPNA 1KXDA 1P11E 2AXNA 4IMQA 1TBQH 4UE7H 1V2TT 4M1SA 5FPKA 2ZP0H 4X1QU 2CCGA 1O5DH 3A7XA 3SBKA 2BCGY 3QXXA 1CTQA 3VB6A 1KK2A 1UHBA 4SGAE 3TNSA 5E2OA 3W9YA 2GCTB 4WXVA 1I4TD 2DFNA 5ETXA 3JVUA 1C4OA 3GLGE 2CCKA 3PMJA 3DL0A 1BMFA 3UWJH 2ZGCA 2QYIA 1FPMA 8KME2 4TLDA 3F8TA 2UUJB 4L9SA 5TCCA 3EIQA 3M7TA 1GVKB 4XVRA 3HR7A 4E05H 3QKRA 1P2OA 4TLAA 2Z9IA 2FSIA 1J7KA 5AUQA 5EE1A 3W3ZB 3WXMA 5DISB 3ZVAA 4DLTA 1IHUA 1WAYB 1SVKA 2BEKA 3BB1A 3U3MA 2XXAB 5G41A 3KUCA 3IO3A 3SUEA 1GBCA 1N2CE 4PQYA 2PEYA 3C8UA 4A1XA 2NO9A 2XX3A 2V8OA 3ZZCA 5HGGA 3GY3A 2NU3E 5JSZA 4PPGA 4CBOA 4P0TA 1SGCA 4GT1A 1JR3D 3OEHD 1JXPA 3C7KA 4E09A 4Q1EA 1NG1A 3TK9A 2ATXA 4KFSA 1GGDB 1YZKA 3TVTA 1FDPA 3PEVA 4MLFB 3TITA 2ERXA 4CF7A 4ZCLA 2VP9A 3DPUA 1PLJA 3KDSE 1S81A 2FO9A 4I8JA 3IPYA 2J4IA 4RZ2A 4P4SB 3MNBA 2VIDA 2GZ9A 1V2RT 5TARA 3GY8A 4XIGS 1KO8A 1OPXA 5BWMA 1X86B 3HPQA 1AB9B 1NLYA 2B9LA 3QX5H 2ORWA 4R2HA 5L3RA 1FXYA 3NXSA 4M1KA 3O8RA 1ZM9A 2QY9A 3B82A 5F2EA 4UNQA 2C3SA 1HAVA 4IVQA 5CB8A 3VR5A 1FW6A 3ZQ6A 3KKNA 3C14C 1BH2A 1PPFE 4KU4A 2R44A 3QXHA 1AUJA 1G30B 5HR5A 1P2TA 1TGCA 3NZIA 1O36A 2WV4A 3TUZC 2JDID 2XZOA 1P60A 2RGDA 3SN8A 3R8FA 3SDZA 4ZKNU 4NHOA 1EG7A 3KKOA 1E2GA 3ZIAA 2ANYA 4Q7YA 2BOHB 2YOGA 2V7QD 3PJRA 4N0EA 2FXRA 3RSOA 1EOJA 5JECA 4U30A 2VU8E 3LC3A 5EQTA 1NRQH 2HNTE 5AJYA 2P3FH 3QTOH 3U1IB 2H9EH 1SI5H 2Z3DA 2YNBA 4GSYA 2HALA 1LPKB 1GMDF 2F9VA 4BTUB 2MMGA 4KYIB 3RU4E 1T5IA 4C7OB 4AD8A 2ZI7A 1TNIA 1MTSA 2I4IA 2ORVA 2ZUDA 4TTQA 2D1JA 3B8JA 4EDHA 1SPJA 2CNWD 1EPTB 2QT1A 1P72A 3SJBA 2QENA 1XPUA 3KQEA 5FPTA 1ZMXA 3B1VA 2XCNA 1SLXB 5E2PA 1L8QA 1EQ9A 2G88A 5DO4H 2WV5A 2AFIE 2WTUA 1XJ0A 4RZ3A 4K5ZA 5ANRB 4LYJA 4AN7A 3PR1A 4C30A 1P4SA 1Q57A 2REBA 2C95A 2H5EA 1HAIH 1GI7B 1TPSA 3U3RA 4IXMA 4JLKA 1O3DA 1O3PB 2VP2A 5F8TA 2CJIA 1U9IA 3AUXA 4CZ2A 1YR9A 4M9ZA 4NSVA 1GGDC 1KK0A 4LPSA 2GD4B 3SGQE 2ODWA 2J38A 1ETRH 3K9XB 2W6ID 3GLHA 3ZVLA 1KDPA 6GCHF 4BE7B 1GBTA 4N1AA 1V2NT 1W1WA 5HTKA 1WF3A 1AB9C 2BCJQ 3SUDA 3M3TA 2QNRA 2CVFA 4JK6A 3DEFA 4HGCA 4BLQA 3PUXA 3HKJB 2GK7A 5L6NH 5FOXA 2O8CB 4Q7KA 3RS4A 1HA3A 4YO9A 2NG1A 3ODFA 3UIEA 2BWJA 4FUDA 3L33A 1NMYA 1W4BA 1IY1A 3HGNA 1VCIA 1HDTH 3VKGA 1ZIPA 1UMAH 3DHKH 5C4MA 1D4PB 1GI2A 4PXAA 4OHZA 1KI7A 5JJLA 3F68H 1KJWA 2ZG0H 1FN8A 1W7XH 1XP8A 1GJBB 1NRSH 1GL9B 3HK6B 3N7OA 5EE9A 3QXCA 2GV7A 2PH1A 5H68A 1TFXA 3P95A 2F4LA 2A5AA 3TGJE 1LVGA 1DEKA 2BD3A 3TUIC 1RW4A 1LKBA 1U99A 1TAGA 4JZDH 3RXMA 3VMFA 4FCTA 3SJKA 2XB4A 1NL3A 1XEFA 1FY1A 1QNJA 1DAIA 4BXWA 4DDUA 4B44A 3OIVA 3SHAH 1NN6A 2ZPTX 2IXFA 1EPTC 2RGBA 3T1VA 4OI2A 5DG6A 4R98A 2YC2C 1KI3A 2VSXA 1OXUA 1O3AA 3NH6A 1Y5UT 1E1RD 1C5UA 4LHZA 5EOKA 4C0HA 2WJHA 2H57A 5KSYA 1NU7B 3R3GB 1BYIA 2ZNKH 3BTEE 3ZH9B 2EA3A 1O2QA 2XC0A 1XMSA 2HCBA 1RGQA 1CA0B 2SGFE 2ZCKP 2YVUA 4MQAA 3VR4A 3T1TA 5FH9A 2A4GA 2A0QB 3GJXC 3RXIA 4BXSA 4DVGA 1EAIA 2ILNA 2OCPA 1LMWB 4EFMA 2ZYVX 3UR6A 3LONA 1T4GA 2QRZA 2FFQA 1OWDA 3C27B 4ABAA 5E7MA 4EKDA 4KAXA 4B2IA 4RKOB 3CWZA 2OBQA 4IN1A 3VU9B 4N3NA 4Q18A 1UTLM 1BS1A 2TRMA 4DWJA 5L3QA 2C99A 3DUXH 2OLJA 1LPZB 3RXJA 1BHXF 1NSTA 1AI8H 3NDPA 4QT8C 5I46H 2R2AA 4Q4HB 1O3FA 2ZJ2A 2ORIA 2FA9A 4WH8A 4D9RA 1G3BA 2H9TH 2AKAB 4B3CA 1BB0B 4G5QA 1S3SA 2V6NA 3BN9A 1B0UA 2XSZD 5GJWC 3D8BA 4AKGA 1NNEA 4THNH 4IDHA 1YLCA 3A8AA 4BPBA 2OILA 3RABA 4ESVA 3SNEA 3LY5A 4JLNA 2GKVE 3DA9B 3I92A 1SR5C 4CT4B 4H9GA 3URCA 1RVDA 2VVUA 2TIOA 2DYKA 2OXCA 3MWYW 4ZKRU 1AKSA 5C2JB 2OQUA 5FUYA 2Z3EA 3EGKH 2CL6X 4MRNA 1WOFA 2WWWA 4X2VA 4NCNA 3B1ZA 4DJTA 4BGDA 4QJ5A 3TJNA 1GL1A 3M61U 1THRH 3BH0A 1RD3B 1JECA 3ZVBA 4TTPA 3GCGA 4M8NE 3QBTA 3KJGA 2HDNB 3EZ9A 5JCPA 3IPXA 2NU0E 2Z9GA 1CT0E 1EFRA 1E2IA 4KFRA 1KLJH 1FIZA 4TYQA 4LJ8A 4TZ6A 1DY8A 2AGIX 2W6JD 1WBGB 4B47A 2I6QA 5C3NA 4TL7A 1G7SA 2BX4A 3EPLA 4I1UA 1COWA 1Y3YA 4FVDA 5B57C 4FVBA 2RGXA 3WYAA 5UKDA 1OWIA 2EC9H 3MJRA 2PT5A 5A09A 3AP1A 3F1SB 1HH4A 1UM8A 1WTHD 1QQUA 4NIXA 3THWA 1NN3A 1CJKC 4QG7A 1E9FA 4UFEH 1SGFA 1CA0C 1XXHA 1G8YA 4XD7D 4ABHA 1ZJ6A 5KSPA 3CRRA 1W2HA 3F6UH 3UR9A 1HLTH 4A2QA 4NG9H 1RYFA 3TVDA 4O03A 5GADl 2E87A 1W4CA 1K21H 3UWIA 4JMYA 1P61B 2FH5B 4AI6A 1QHNA 3WNCA 1NP6A 1E38B 3ATLA 4NSYA 1OKXA 4X6NA 2KBEA 2VP6A 1GI4A 5KSOA 2JGNA 1FAXA 5DYGA 3LQRA 3UMFA 3L8YA 1CBUA 1ELGA 4HATA 1ZGIA 4E7RG 5C2ZA 1FI8A 2A5DA 5C5NA 1P10A 2HLDA 1GG6B 3SUFA 1D2EA 1G5TA 1EX7A 2HJVA 1NRJB 4E07A 4GP7A 2QE7D 1KI6A 4JL6A 4Q03A 3UPEA 4K3JA 1KIMA 5FR1A 1IAQA 4Q4JB 1T3HA 4KCGA 2RGNA 2XOKA 2FPLA 5GVRA 4TYYA 5AVDA 5JFGA 3MFYA 3LPRA 4TPIZ 4Q1CA 2A7QA 1H4WA 2WZQA 2QAGA 1O2NA 3M7UA 4DLYA 1CRQA 2ZFFH 1SGTA 2FOHA 3R9IA 4JVLA 2HUPA 4BUJA 2HF9A 2BD9A 3U6BA 1P2SA 1JALA 3KUDA 5SZHB 1FLEE 1WP9A 4WMFA 3CF0A 5F8XA 4O97A 1EZXC 2QMHA 1C2IA 3BWDD 4NYMR 2R6AA 3X1WA 2OEPA 4X1RU 4V0MA 4NYJQ 3EASA 1EX6A 1XTJA 4RD4A 4NIWA 3LH1A 3LAWA 4Q02A 5J40A 4UJ3A 5AHGH 2GXAA 2ZU3A 4PO9A 4HLUC 4C0SA 1ZM2A 1GDDA 2FSHA 1OYYA 3SYLA 3SHWA 5GCHF 3REGA 1JB1A 5G3YA 2ZSDA 3ZQJA 1SGQE 1Y3WA 2FI3E 4H6TA 5SGAE 1E1QA 4CDGA 1EOLA 1YCPK 5DN6D 4CRAA 1MAYA 4KVAA 6CHAB 1C5NH 3SNHA 1O3NA 3N2IA 2WSSD 2O9QA 3GJ7A 2R2WU 2QBYA 2ZROA 2EFCB 3LXXA 4IC6A 3CRVA 1F5LA 2ODNA 4BASA 3SHFA 2WJVA 2OV2A 1YBWA 4M53A 4P33A 2IJD1 4NCJA 2CE2X 1W2KH 1TA6A 3B9FH 3VXEH 2R6CA 4WOPA 5H4IB 2Q6GA 4LY6A 1F2UA 4X0WU 5T6GA 3K9LA 1JXOA 2PL3A 1TPZA 2OP9A 5IRCD 5J4QA 4L15A 3IEUA 1CE5A 3SJ8A 1JRSA 2BD7A 1FL9A 1O3OA 3T34A 2J0SA 3W90A 3QY0A 4DIIH 4BNRA 4C3ZA 1ZINA 2PZEA 3ATKA 4EFNA 3GLFA 1O2MA 1GG6C 2J94A 1KJYA 3BF6H 1D3TB 3CZQA 1UF9A 3MWJA 4MGZR 2J7PD 1N6NA 1A2BA 2VLIA 1AK2A 1X8JA 1S1CA 3LGYA 1Z1IA 1FP6A 4AFUA 1DE7H 1YPJH 1E9CA 3CH5A 3A1TA 2FFAA 1JEEA 2HWLB 1T31A 4IVRA 3A84A 1NY6A 2QSZA 3EZ6A 2W2XA 2CXXA 2ZJOA 3VXFH 1FUUA 2ZE5A 4B2BA 3ICQB 2STBE 2BMGB 3VB3A 3RMNH 1Z22A 1OIWA 4AWXA 1ZCBA 1L7VC 1YRBA 3CONA 4Z8YA 2J41A 3SHCH 5L2ZH 2F43B 2AGEX 1P2UA 5DHFA 1AE5A 3GDUA 2WPDA 3NTUA 5JPMH 4K8YA 5BW8A 4AG5A 2ZM5A 1E79A 3LQQA 3OY6U 5JRZA 2F9OA 2HYDA 2YOHA 3UQOA 3FMOB 5FTNA 4HB0A 1Z29A 1SSXA 2Y5FA 1O5CB 2O0JA 3IIKA 4Z1MA 3GD7A 4B3GA 3I8SA 1MRSA 1OFUX 3BTWE 2IA5A 1TRNA 2O8BA 1X6VA 5KDLA 3RNLA 1UKZA 1RTLA 1SKYB 4KFUA 3E0NB 5DGJA 1A1RA 6Q21A 1GWNA 4AB9A 1XD2A 3T29A 1KTTB 1OFIA 1N5JA 1BTYA 2QU8A 2W00A 1ZYUA 3PUWA 1UBFA 2B7BA 3KL6A 3E90B 1VCPA 1VITH 6CHAC 4DLSA 3LOXA 1AWHB 3MNSA 2NGRA 3MNCA 3SI4H 2VIIA 1DOAA 3AKDA 3GEHA 1Z0IA 3SR0A 1DVAH 1EAWA 2ZDNA 2QC2A 4AKIA 1EUFA 4Y7AA 3QKTA 1AGJA 4OHYA 3TUJC 3PMAB 3M3SA 1P03A 3TJUA 3CX7A 2YWEA 3M6AA 3GYMA 1ELOA 1KI9A 3MU1A 5LD2B 1O2IA 2DWPA 4UNNA 1O3HA 3CS7A 1Z83A 3I4LA 1J70A 2NQ2C 1NVVR 2YNAA 3D49H 2FX4A 5GPIB 1K1NA 4ABIA 4DB4A 1DO2A 2Q1JA 1IAUA 2ANWA 2A9KA 1T8MA 2FEOA 5GXPA 4H1UA 1T5LA 4MYUA 1Z8IB 3TH4H 1KMHB 3NKKA 1VECA 4ZDWA 2EI7A 4P3YA 3H1TA 3I3SR 1NMZA 4A5TS 1EK0A 4LV5B 4WBSA 3AKEA 4CEIA 5BYKA 3QG5A 5F9FA 1G64A 2YJTD 1SVIA 3R8CA 4WXRA 4M9FA 4II7A 2BQWB 3RC5A 1O2OA 2V6IA 2ZRPA 4DT1A 3Q9LA 2QMUA 3IITA 1PYTC 3PEUA 4HAUA 421PA 1YR8A 4UNSA 3MD0A 1W0JD 1MABB 3MH5A 1Z0KA 4UONA 2JLQA 3EAQA 1MOZA 3BG4B 3SU3A 5JMTA 1A2CH 1NF3A 5FX6A 1LF5A 3BORA 2QL6A 1XXDA 2QIQA 5IT5A 3X1DA 5C1BA 3M3VA 1S5SA 3SOPA 1QL7A 3LH3A 3TJZA 3M0EA 1OYQA 3AAVA 1SQTA 4GSOA 1AHTH 1AFQB 1U8AA 3GFPA 1NIPA 5CITA 2QF3A 1FPCH 3MRSA 1FIWA 2ZI2H 1FFHA 3URDA 1G5RA 3QENA 2IS4A 1JNYA 4ZCMA 1IN8A 2JLWA 1P0SH 3B13B 2XNDA 2P8OB 2WPMS 4QGHA 5E4FA 1W8BH 2ODYB 4E5UA 3L6PA 2GAAA 2OCBA 4GPGA 2D06A 3U61B 1OXXK 4JMPA 3VKHA 2H7VA 1O3GA 3PFIA 4FUGA 4TY7A 1MBQA 1ZOMA 3A8BA 1ANBA 3ITIA 2QZ4A 1BMNH 1CRPA 1NO9H 3OAAD 3SU2A 3KX2A 2FZZA 1M2OB 3AGQA 1GNQA 3AVOA 3IILA 2AS9A 2BBOA 1OIVA 3F9EA 2FLRH 1S85A 4G3XA 2RCEA 3FWYA 3VFDA 3DOEA 2BVSH 4QL3A 1WSSH 1ZJKA 3U9AH 2ZQ1A 2YINC 3UNSA 2RGCA 3WMGA 1MBMA 4MA4A 1R0ZA 4XVUA 3PMHB 4IS5A 3TAUA 1VITF 4L5BA 5L8VA 2VO1A 3GLGA 4HYYA 1P9SA 4TT3D 4DB2A 5KNDA 4NYIQ 2ZANA 1ZVQA 4TMTA 1NKTA 3G0HA 3GY7A 4DUGD 5HYOA 2VH5R 1JWTA 3UWKA 2VWOA 1DVRA 2BVXH 1PZNA 4CRWB 3ZD6A 3BJIC 1LHEH 8GCHG 1KDQB 4I31A 3LBNA 1VHTA 5FL7D 1MCVA 1HUQA 2QT0A 4Z0KA 3IO5A 3KQDA 1GTVA 2O8UA 2ONJA 2ZFPH 5GNDA 4WMEA 4R0IA 4OQFA 2OFXA 2F6RA 2K1QA 2ZDAH 2GXQA 3KIDU 2DWOA 4AYWA 1GI9B 2H8KA 5IK2D 2JJ1A 1S9DA 5HE8A 5DO9A 4X8OA 4RFSA 1TOMH 3FFGA 2ZIQH 4X2WA 3KFVA 1W46A 1ZSLA 2ULLA 4YDHB 1ZHMA 5J4SA 1TGTA 5DP5A 3VGCC 3K0AB 5AJZA 3KL4A 1YJ5A 1Z2AA 2WVJA 2GV6A 3KCGH 2AD1A 4RKEA 3RLYH 2XBXA 2W0SA 3ZV8A 4NA8A 3UREA 1F2TB 2H92A 3GLIB 3RSLA 1SLVB 4OS7A 3NG1A 2DFTA 2IC5A 1JAIA 3TH2H 3W6NA 4O9VA 1XFAA 3R9WA 1NN5A 8LPRA 4AYXA 2FZLA 3VB4A 2GJ9A 2VIWA 3CNNA 1AFQC 5B58C 4QGFA 5TY0A 4QKQA 5EE5B 1A4RA 2PKSB 1BITA 3RC3A 2R3UA 3VR6A 1D9ZA 4INHA 3CIOA 1XKBC 1ID5H 2W3IA 3LBIA 3EWSA 4WH6A 4O3MA 1C2HA 4JVSB 4B32A 2OM2A 2ZGXH 3CB4A 2FF7A 3K9GA 2R62A 4A36A 4V0LA 3P27A 4B75A 4A1FA 4ZAEA 2J9NA 1GM5A 1W13U 3PLPA 1WRBA 3VEQB 5T6DA 3BC1A 1B23P 1J8YF 3Q3XA 2IXGA 1KLIH 1G3CA 2VTKA 1A0JA 3E91A 3UKDA 3ZDQA 1TNKA 1YKTA 3SOSA 3QZQA 1TEXA 2VIQA 5DK1A 1SXJB 1ZNZA 3T06B 5CYOA 4TQAA 5EQSA 1YCPH 3M7QA 2GJ8A 4WA7A 1YE8A 2F9PA 1HJAC 3P8FA 4ISHH 1CO7E 2WPKS 1Z8RA 2ECKA 2G4UA 2O8EA 3QTVH 5BRRE 821PA 1RKBA 3LVRE 3EZ2A 3EX7C 2Y5GA 2WWYA 5K8IA 2G8TA 1LS6A 2C4FH 3PUZA 1JPJA 4BWYA 3S9AA 1AM4D 2EI6A 1YYY1 3HK3B 1E4YA 3RMLH 3THYB 5DIFA 1GJ7B 1X3SA 1GJ5H 2BBSA 2C96A 1GBMA 3UMSA 1KK1A 1WDTA 4A1TA 4JLMA 2AX4A 2RH5A 1YPMH 2XTNA 2F9LA 2IUTA 4M7GA 3BSQA 3DZ8A 1YZGA 2DY1A 1SGRE 3QE0A 2FJUA 2G52A 1OXTA 1S0UA 2CK3A 2SGAA 1YLDA 3A1UA 2WWHA 2FYQA 1GPZA 2IK8A 3ZVNA 3F9FA 4DIHH 1J15A 3GLHE 3TK6A 2KWIA 4ISLA 4ABDA 2F1HA 5TDHA 1R2QA 1HPGA 5SZIA 2ZTYA 1UKYA 5IDKA 2Y8EA 4LRWA 3RRYA 4KO8A 2IBMA 2IXEA 1ESAA 1KMQA 3MO3A 2QTHA 4HZUB 3SE0A 1GKYA 2A78A 3B9QA 1E4VA 4OK5A 4LUCA 4LJYA 3KQCA 2QORA 3QLPH 1ACBE 3LO5A 4GP6A 2NU2E 1RPZA 4Q9HA 3GYLB 5CB6A 3MFJA 1UEJA 1C5SA 1WXRA 1G4UR 2ZS7A 4HDOB 2VWNA 3STIA 2GA8A 3SW2B 5A2MH 3ZZ0A 2NMVA 1CS4C 2A5IA 3W5JA 1BMFD 5EE3A 3I77A 2Y82A 4ESTE 3WNBA 1NN1A 5CE1A 1I4LD 1LVBA 4FCVA 1LS1A 4TL9A 5LPRA 5FTKA 3BG8A 1PPCE 2PKSC 2OE2A 3CKLA 3ZZ9A 2XXAA 2GVDC 4XD7A 3RVBA 4EUNA 2DFKB 1C5LH 3IQWA 1SULA 2JLVA 2FGJA 3PUYA 5K7RA 1T4UH 1V2UT 3BV9B 5FBIA 3RWOA 1BOFA 1H1BA 1OWJA 1K1MA 4J0QA 3LRPA 4PPFA 2FSFA 3K0FB 2QV1A 1AFEH 2ZAOA 4CT5A 4XVQA 3GLIE 5FOTA 1H9LB 1ELTA 4FMCB 1HAGE 5KOYA 3QN7A 2XZLA 3OX7U 1Z0DA 4P4SA 1Z6JH 4GOXA 3GCHC 1P3CA 2RA3A 1LTOA 5L3SB 1MQ6A 1SXJC 3ZVEA 3CW2A 3ZVGA 2PMDA 3KXKA 3BTFE 3IGFA 3BTKE 1AZ8A 2FS9A 4EQ6B 5DNYB 1TU3A 1V2JT 3PV0A 3AM1A 1C5RA 1KNQA 1RZ3A 3FMFA 1TMBH 2EI8A 3SV8A 1F5NA 1SOTA 5EPYA 4H1VA 2VWLA 1QGFA 1T8UA 1SC8U 3CH4B 3I61A 3ZGXA 2KJQA 5C67A 2LCFA 3LA6A 3D3QA 3GMTA 1ELBA 1FV9A 3BTQE 3C1KA 5DKMA 1Q22A 2OBMA 4CHAB 3SEAA 1V2VT 3BRWD 3HR8A 3VTKA 1T3SA 1SFIA 1QY6A 3M5LA 1UADA 3CUEF 4LX0A 4QM7A 1P3EA 4ABEA 3ZZAA 2QXHA 3RDPA 1EB2A 1GMCF 4TL6A 2VGCB 4HEJA 3QQ5A 3K0SA 4D80A 4BFUA 1HAXB 4HAWA 2O52A 1TRMA 1VCMA 2EWVA 5AJXA 1EZUC 1HQYE 2XBVA 3UFAA 4XBCA 4J2YB 3ZZ5A 3K9HA 1P2KA 2BMJA 1Q21A 2QGZA 5DPAA 2TMKA 3ZIAD 3SFVA 4WMDA 1FZQA 4C7OA 2DWQA 1HAOH 5EP3A 1EASA 2FDAA 3PWCA 1GWAA 3SI3H 1NVWQ 1N5LA 4D82A 3M1IA 2CF8H 3KFXA 1TPPA 1EPTA 3TIUA 1GNPA 4FWIB 3WP1B 3K2UA 1NM6A 1V2PT 3AASA 1YF4A 1E37B 1Q3HA 2Z6BD 3ADKA 2F1JA 4YOIA 4MUAA 5L3VA 1CLUA 4LHXA 1DG1G 4PPNA 1TEVA 3PEWA 4IN2A 3F9GA 5LB2A 2E1RA 3VHXA 5DN6A 4POAA 3SYKA 5FBWB 2TGPZ 2UUYA 3WBJA 1GBHA 1U0HC 4AURA 2BLWA 1N6KA 2DBYA 2VQSA 2WSSA 1L2TA 4IOJA 4U2WA 4DDVA 3A1SA 2A4RA 2WJGA 5EXPA 3S7HB 3SUGA 1Z07A 2ZXUA 2A5GA 1VCWA 2OCAA 2J0VA 1NVUQ 1GL0E 2OQ5A 2QXGA 2J45A 3TK5A 4CREA 3RC4A 1A2KC 2FOLA 1QFKH 1KXCA 1TU4A 1N1LA 3M37A 3GFOA 2VHUA 4N0DA 3EARA 2GESA 2GJAA 4FUJA 3IBGA 1UVPA 1GJDB 1NJGA 4RI0A 4LJ7A 1BRUP 2STAE 1KOFA 1YQTA 3W3AA 5I25A 5AFZH 2X1VA 2O8CA 5DP9A 4CVNA 1C2JA 1Q31A 2GCHF 1A7JA 2A31A 3WY9A 1OFTA 1W3CA 2ZRCA 4HSEA 1IXRC 5H70A 4WZAE 1ZHPA 2A2XH 2ZRDA 4MPUA 3WP0A 3OU0A 3H4MA 3TVJB 1Q3XA 1G3EA 5EW2H 1V5WA 3T15A 1XXHE 1P09A 2ZUBA 1B0EA 1DFPA 1HT2E 4R9UC 3E8LA 4IDNA 3K0CC 2FTMA 3DZDA 1N0WA 2YV5A 3OIWA 2VIPA 4ACAA 1OV4A 4Y6DA 1SZPA 3KB2A 1GJAB 1YPLH 5BN4A 1O5FH 4OM9A 2PJRA 2R3YA 4K69A 1VCOA 3PROA 2VGCC 1LW7A 3AVXA 3E5HA 1XTIA 1NFXA 1OHHA 1DE0A 2BYAX 1U2RA 5DJ7A 1IM2A 2UUFB 4HLCA 3VNVA 2Q6FA 1D9IA 5FBQB 2PKAB 4XJXA 4BAMB 5T3HA 4Y0ZE 1LHCH 1IN6A 1V2LT 4Y71A 1N5KA 4YMWA 3A4LA 1VKJA 1C4V2 1P2JA 4C0BA 4KTSA 3KHVA 1AGPA 2JH0D 1RE0A 3MOCA 3AKYA 2R9VA 3PV4A 3LLMA 3KQKA 2OXRA 4AYVB 2GRJA 1OS8A 121PA 1GIAA 3BFXA 4EPXA 1EFUA 3I32A 1FNIA 1PUIA 5SZJA 4MPXA 1BO6A 1OSSA 2GAOA 1HCGA 4DEYA 4JYVH 4NYIR 3RXPA 1O30A 3TE6A 2GBLA 1J8AA 3TNFA 1ANDA 4C9BA 1ZW6A 5D3MB 5EZ6B 4W5WA 3ZZTA 4Q4AB 1LHDH 5K0HA 3NK8A 2F3CE 2L0XA 1O39A 3QF4B 1WV7H 2SGEE 3SN6A 1N8OB 1C5MD 5EZ5A 1O2HA 2P59A 5B64A 4DHEA 2P93A 2IL1A 2ZHDA 2VINA 1G1MA 4IJMA 2Z7FE 3OFND 3STJA 4UD9H 3EAJA 1C1VH 3K70C 4I7YH 4AY2A 4MKIA 4XWAA 5M04A 1H8IH 1G2LA 2ZEJA 2WPLS 3AH8A 3VU9A 1XTRA 1XPOA 2FTLE 3CS0A 1ZP6A 3KTAB 4V0ME 3RANA 2WJYA 5KPDA 4OQXA 1KO4A 3SJCA 3BTGE 1L4YA 4Q4HA 2CLDX 3KZ1E 1O2RA 2ZJ5A 5HE9A 3H84A 4S2EA 2FMXA 3QXSA 2WM9B 4YXWD 1J9CH 1TMUH 1TF5A 1XEWX 5CJPA 2QA5A 2XW9A 2ZSEA 3HYTA 4U7DA 2H1UA 3RRMA 2B0FA 2GZAA 4E06H 2A30A 3FHTA 4HLQB 5EP4A 1ELAA 1ESBA 1X7AC 4GI7A 5FBEA 5AUOB 1FX0B 3OTPA 1E2LA 1DPOA 1IN7A 1LF0A 1QVAA 4BAHB 1CGIE 5FUVA 2GJSA 4V0NA 1DXPA 4GUXA 2EYQA 1GI6A 2GF0A 1X1SA 1O34A 1VG0B 4Z54A 2IUUA 2P65A 1W0JA 4DC9A 5C20A 4GAWA 2OC7A 4RD3A 3BBPA 3L0SA 1KXAA 3TR5A 1ZD9A 2RMKA 1VTKA 1BZXE 1OT3A 2SGDE 5EGMA 1D3PB 3MGCA 2J2UA 1ZR0A 3FYHA 1S6FA 3MMGA 1EP5A 3AUYA 1ZAKA 3BOSA 3K53A 2UWOA 2QA9E 5JEDA 3KQNA 5CYPA 4MKFA 2V55B 1II8B 2B6HA 1O3JA 2FEMA 1DO0A 3F5FA 4DY7B 3GLFE 2OBOA 1OX1A 1FY5A 2FM2A 4HLUA 1C5WB 2ZC9H 2OD3B 2VA8A 1EFRD 5JI2E 2ZU0C 4DLWA 1QF9A 2XNSA 3RS2A 2F9BH 1QL9A 3RXCA 2QGRA 5A8ZA 5E0HA 5DI9A 1P02A 3QVVA 1QB1A 3RXUA 1Z6EA 4GPTA 1Q2WA 4LC1A 2H18A 1UTMA 1COWD 1KI2A 4A0RA 1C1WH 1S0QA 1K1PA 3OAAA 3B5JA 3I29A 5FR2A 4F4IA 3CP7A 4NU0A 5DYIA 4ARZB 1QHHB 3IIJA 4RD0A 3ECCA 1XTSA 1MO5A 4IMZA 2PR3A 4MRRA 4QBIA 3ADCA 4LJ9A 2GCNA 5JWHA 3FANA 2P2LA 1G16A 4D76A 4ABBA 1U94A 1HE8B 2PT7A 3RC8A 2ZRHA 1O5AB 3A7TA 4MKGA 4R7ZA 1V2KT 4ISNA 1O35A 1SVMA 1O3BA 2ZU2A 2QG6A 1BIFA 1XJQA 2QCYA 2IS6A 2HYIC 2CXVA 1XUJA 1UBEA 1QBKC 1N0VC 2PCLA 3TW4A 4DBLC 2D8WA 3GOVB 1O2YA 5FL7A 2FYRA 1OE0A 3J81k 1P2IA 5F98A 1KLTA 2FV8A 3AVWA 2ZRLA 1PVOA 1QG2A 4BRWA 1YGCH 1L1NA 1XVMA 3AV0B 4KJZA 2VRWA 1E2HA 3IWMA 1ARBA 5GCHG 2SFAA 3QNUA 4Q4JA 5IK2A 3JZ2B 4JZ1A 3OIYA 1FOEB 3UXMA 1RYHA 1XX6A 1ANKA 2R65A 2HLDD 2C93B 1YPHE 4JJZA 4IOLA 1X1RA 4SGBE 1G7CA 4OK3A 4AKEA 1DLKB 2Z4SA 4URZR 4AZ2B 4B2PA 1F3OA 3QDZB 4XSGA 1R4AA 2PGQB 1A3BH 4C2UA 1SGEE 4B3FX 3R20A 4D0GA 2OESA 4QHTA 3SYNA 2XOKD 3U8OH 2CHQA 1G3RA 1ZCAA 3TK1A 4FIDA 2BDTA 2OT3B 2FOBA 2OBNA 2JCSA 2VHTA 2UVQA 1M74A 4HDCA 3NH9A 5EXNA 2QPOA 3BIUH 4HB3A 1N3BA 2BDIA 4I1VA 4PAOA 1SGYE 2WWIA 4Z51A 3SU0A 1QHIA 3CBQA 2CLSA 2AWNA 3T61A 4TSFA 1TQ7B 2JH6D 2V54A 1YZUA 3TKLA 4NMMA 2ZJAA 2ATVA 5IYTA 2BQ7B 2YWFA 4AOQA 3ETLA 2A32A 1AZTA 3VX4A 2D2EA 2ZDVH 2QTVB 2RB4A 2QPAA 1GCDA 3W95A 3MNXA 2FE4A 3LKWA 5JLJA 3LNCA 3A8CA 5EW1H 1GHAF 3QJYA 1Q44A 1ZUNB 1G3MA 4OQMA 3GP8A 5EE0A 4LOAA 5HCNA 3LW7A 4K1SA 4IW4E 1VG1A 3NPSA 4LXBH 3U4QB 1A4WH 4NCIA 2BY9X 1S4QA 2GMTB 4Y7BA 3B7GA 1FMJA 1XUHA 2A45B 2FMJA 3LLUA 1E1QD 3MH7A 2AYWA 2BQ6B 1AKEA 4U02A 2IF0A 2C04A 2GILA 4IVPA 2W83A 3I73A 1G5PA 3X1XA 1C5PA 4ZIRB 1FUJA 3FP7E 4KBFA 2IYWA 4LK2A 1AZZA 1SG8B 2ZYWX 1O3IA 3QUSA 4ZI2A 4UNPA 5SZKB 2WBLC 4FCWA 2FZ4A 1MUEB 1IOZA 2DPXA 5CLQA 1NG9A 4YMUA 2O8LA 4US0R 3FDIA 2GCOB 4LJ5A 1WQSA 2BVRH 5J4LA 1OB5A 1G4AE 4HI0E 1C9TA 1GUAA 1UFQA 2EVWX 2OBLA 2GP9B 3TH3H 1IQKA 2NWNA 1VMAA 4MYHA 3CPJB 1SLUB 2XJ4A 2R8RA 4PC3A 1Z7KA 2VSOA 1P01A 1NLZA 1P9UA 4B6EA 4RD1A 3UIRA 1FPHH 3CO5A 3SV2H 4D4KA 4Q1FA 1G18A 4OS2A 2YWHA 2GDEH 3A82A 2WPHS 2ZTZA 2H2ZA 1E36B 1E0SA 2IYXA 2OSBA 2IYTA 2F43A 3TMKA 4ERNA 4NA7A 2PTCE 1XCMA 1BBRE 4XBBA 4A6PA 1O2VA 2BTCE 3BTHE 3EE0B 2O8MA 3QO6A 4KBGA 3MG9A 2QXJA 4LSGA 1YPKH 5TVKA 1C9PA 1L4DA 1UCYE 1ZIOA 2WPDD 3D23A 3E16B 3PV2A 3JVVA 1Z06A 4DCSA 2ZHQH 1E79D 1ZNXA 1D2MA 5JB8S 2B7CA 4LI0A 4JS0A 3U7HB 4Z1MD 4AIIA 1ABIH 1FAKH 5GVSA 1KKLA 1DUAA 2BDAA 1NBMA 2JJ2A 1V2WT 1W10U 4TZ0A 3BTME 1W7AA 3DDCA 1P2QA 2R6GA 5D3QA 5J5CA 1HEIA 1T8OA 4Q7ZA 2GMTC 1FMLA 4Q7JB 4BLPA 1BMMH 3ND9A 3T1OA 2PUQH 4PO8A 1TQ4A 3NHBA 4MQBA 1KAGA 2EQBA 4X1NU 5FAHA 4TMWA 1KYNA 4NE2A 1O32A 1OLOA 5E0JA 2Y80A 1KSFX 4M0LA 1O2LA 3WHKA 1II0A 5K8TA 2FWWA 1TGBA 2B8WA 4QM6A 1MT0A 4IFEA 4NYMQ 2ZU5A 4Q7LA 2CF9H 3EPJA 4PC1A 4KI0A 4JVNA 3L0OA 2JLSA 1G21E 5EUQB 2RHMA 1WU1A 2OFOA 4YMVA 4AYTA 1LVOA 2BY7X 2ASEA 3O47A 1R8SA 4RKFA 1O3MA 1KMHA 2JETC 4JLVA 1PLKA 3PVSA 2UWLA 4WAUA 3P8NA 1FMGA 1KO5A 4EPWA 1SGFG 3A7WA 3I78A 5KDDA 3U98H 4Y79A 5FX5A 4HAZA 4MKHA 1CU1A 4JYUH 3TIFA 4JZEH 3QZRA 7KMEH 4RY2A 3KN2A 1NKSA 2GZ7A 2Z83A 3UNRA 4BQSA 1AIXH 4X2YA 2I1VB 1MABA 3NKVA 1NJFA 4DGJA 4NZQA 1MTVA 2X77A 3ASZA 3PG5A 1CSOE 2SNWA 1AQUA 2HLCA 2VP0A 1NIJA 2FESH 1G6HA 3GJ3A 4KLZA 1R5OA 1S0RA 4URYR 3B85A 4YT6H 4M1WA 1VITG 1Z47A 4NTZA 5FCKA 2Y6TA 1GHYH 3BFKA 3Q85A 2ZRMA 2NO7A 2GNOA 1CR4A 1T8LA 1UTOA 3QWCH 4FMBB 1LCYA 5DI3B 4JBXA 1VHLA 3A58B 1G3UA 2BV3A 2ZS8A 2IYRA 4HUQB 5P21A 1AVGH 2J95A 2ZFQH 1DAEA 5C1XA 1DM4B 2IX3A 4URXR 3ZYCA 5C1YA 4W9MC 3U6KA 4C2TA 1JIMA 4B2LA 1F60A 4W5JA 1C1OA 4DXAA 1M9UA 4JL5A 2BDYA 3U8TH 2XNDD 1BKDR 2WMOB 2VHCA 2QM7A 1AD8H 1ZGVA 4ZXXH 2J5XA 1WMSA 3O8CA 4K8BA 4C0QC 1F2SE 2CHGA 4BFVA 5B6OA 1GDUA 5FTJA 1Z28A 5C4GB 3V7TA 1JQJC 5EJEA 4NZYA 2O8FB 2PUXB 2QY0B 4KKDA 3OZXA 1ZRKA 1PJRA 4PZYA 4B48A 3CENA 2OAP1 2UWPA 1W36B 2CMKA 4XFQA 4MPWA 3FE2A 4DCNA 1BRBE 1NFUA 2G5NA 2RHDA 4JCNA 3VHLB 1B7XB 4DZZA 1LKAA 3ZVFA 1MTNB 4ILEA 3QPWA 2VP5A 4PSKA 3MI4A 1KDQA 4Y8YA 2F7SA 4A2WA 1YCPM 1FTNA 3DO6A 2TGAA 1CR0A 2NOAA 2C9OA 4YESB 1NPMA 1ZLRA 1Z8GA 2PSYA 1AUTC 3A7ZA 2FU5C 1IHSH 2FG5A 1G7RA 2JIZD 1DELA 3RC6A 4TLCA 1PUJA 1HV8A 2V3HH 4TYWA 3FTQA 1XMNB 1I4DD 4LCBA 1EATA 4NCYA 4ON9A 1IQMA 3MLEA 1YVDA 1BTPA 3NXPA 2FPKA 4ABFA 2ZU1A 1DY9A 4H4FA 5KTYA 1GHZA 2XBWA 3K0AA 1OKKD 2QGNA 2JJ1D 1INCA 4B34A 3RS3A 1MTWA 5L30H 2RGNC 3A87A 1F2TA 3BEIB 3GLIA 4O0MA 1D6JA 4JK5A 2JAQA 3L0IB 1KY2A 1O5BB 5H8WA 1CKEA 1NVVQ 4PROA 2BJVA 2QTFA 3MO9A 2UUKB 3K9NA 1KSJA 5LPFA 4A2PA 3SFZA 3V3MA 3SU8A 3ODDA 3ZYDA 4TYNA 3M5NA 5EODA 4YONB 4GRAA 1BDAA 1R0YA 4NCKA 1E0FD 2WPJS 2GEVA 2HRVA 3K8YA 1KI8A 2WPIS 5FBVB 4DLRA 1E32A 3W5IA 3OFNA 3LWNA 3QEJA 1ZM3A 3P4XA 3A4NA 1O3LA 4P4TA 4PQRA 1YC0A 1ZZZA 3TSWA 1O31A 2LWIA 2V4ZA 7GCHF 2NTYC 3A36A 2CEAA 3CX8A 3CPEA 1AJEA 3PLBA 4GOKA 1QHGA 3GDSA 2ZS9A 1WQVH 2ZPRA 1U98A 3I5XA 1SXJA 1ZTLA 2O8WA 1C1UH 2XTTB 2PTNA 4YXWA 4UFDH 2Q3MA 1A46H 2WINI 2O0KA 1P06A 1S96A 2LKDA 1W36C 4V03A 3KXLA 1OP8A 4DLZA 3LGIA 1G8PA 1AS2A 1GITA 1NS3A 1QDEA 1W44A 3I8XA 1J14A 3FMPB 1MTNC 1Y3AA 2R6FA 4LBVA 2G0NA 1ZM7A 4AKHA 1ZNWA 4JKIA 3THYA 4BLTA 2ZDMA 4Y10E 1Y3VA 4IDOA 4WY3A 2A4OA 5JBQA 2P3SA 3PQCA 4NP6A 1DWEH 1CEEA 2HV8A 2FS8A 1TMKA 1K1LA 1CHOF 2PSXA 4JSYA 3RU4D 2ZU6A 1KGDA 3H09A 3GJ8A 3KJIA 4M1MA 1M34E 2WKPA 1P75A 2C2HA 1IQPA 4CH8B 2OFWA 4YLQH 1DAKA 2QMEA 3W8NA 2Q3HA 4B2CA 3Q5DA 2KSQA 1WBDA 1W0KA 2HEIA 3TJVA 3U44B 3FP8E 4C0JA 3AVZA 3QUMP 1T32A 4JBWA 1C5XB 3GCTF 4NWKA 2CK3D 4XWOA 5B30A 3HATH 1O5EH 2LPRA 2J3EA 3T25A 4LZ1H 1E9EA 3A1VA 2I1QA 1L1JA 4AC9A 4HZUA 4BLSA 3TGPA 1C2LA 3T2NA 1M6NA 1C5OH 1FTSA 3TQCA 3SQHE 2BZ6H 1C1TA 4FI3C 4CRGA 3U1JB 2B8OH 1ZBDA 2V35A 2FLBH 1XCPA 1DARA 4QOSA 2OUAA 2Q3FA 3OYPA 4OK6A 1QTFA 2LNCA 1Q12A 1TF7A 3QGJA 1E2MA 3QK1A 1G8HA 5J4KA 4MDEA 3L8ZA 3RLWH 3FKSD 3BH7A 1QRZA 5E7IA 3Q7QA 1G9IE 4OJQA 3OEEA 1G8GA 3DKPA 4Q48A 2O8DB 1A3EH 1GRRA 3VR1A 2VNTA 2AHOA 4AGJA 4TMVA 1XUKA 3SNBA 1PLLA 4PR0A 4L8GA 3ZS8A 3H7OA 4JLPA 1GMCG 3K0FA 4BOHA 4ZV4A 3AVVA 4DIEA 5E7JA 1OFHA 1C1QA 3KJEA 3LFUA 2OC1A 1SVSA 2BJWA 4DCDA 5L3SA 2W7UA 2SNVA 2G55A 2WUBA 4K60A 4B33A 2H16A 4LV6A 4EQ6A 3UOUA 1T6NA 4JYCA 1XEXB 3Q5EA 3MWLA 1P2VA 3R7WB 2CDNA 2ZUCA 5ESTE 1KKMA 3FP6E 3K6ZA 4DDTA 2Y7XA 4MRSA 3IQXA 1D6RA 2W2VA 2QP9X 1E34B 2AFQB 1LFDB 1W4RA 2RAPA 3NVAA 2A7CA 1QHXA 2HJGA 4GHTA 5EQQA 2WV9A 5HM2A 1JBKA 3B60A 1WCV1 2D7DA 3K0CA 5FBRB 4QXAA 5F3WB 1ETSH 2FPZA 3HPRA 3IBYA 2Y81A 3ADBA 3PM3A 1O2KA 1QHYA 3GLGB 1MU6B 4JZFH 4NH0A 3KB1A 1TUIA 5L2YH 2O8TA 1HNEE 2R9PA 1GBEA 1F92A 1VPLA 3TH5A 2A5KA 3SZNA 4UJ5A 2IF2A 2KB0A 4A0HA 2FOAA 3PUVA 4FUEA 3V00A 5LB4A 2ZI4A 4GCHF 4D0NA 2YOLA 2OO7A 6ESTA 2W0MA 2AMPA 1ZSKA 4PHHA 2RKOA 2GVZC 2RG3A 1FNNA 1GILA 1N25A 4B1TA 5FOVA 1O2ZA 1UEIA 2C8XB 3QI2A 1EFHA 2WAYA 5DP7A 1MZDA 3MU0A 2QAJA 3VFEA 5TXGA 4FMDB 2A7HA 1HB0B 3EPKA 1MV5A 1S9HA 2CL7X 3KQLA 1K8RA 3P26A 2V3OH 2GCHG 4QBFA 2A2QH 3I72A 2AIPA 5J47A 1V2OT 1UDWA 1GNRA 1P9WA 2KAIB 2ZEBA 4OHWA 5DE3A 4BFXA 3BTTE 2ANKH 2AK3A 1E9SA 1QR3E 3RXHA 1Q1ZA 1X8KA 3B1WA 2AEIH 2F83A 2BXTH 4Y0YE 4XTRA 3S9CA 2WYGA 2MSDB 1O87A 1EJAA 2V0BA 1Z6GA 1JMOH 3S69A 2XITA 3S0NA 1R5NA 1M1YE 3A86A 5TB5A 4PFSA 2NPFA 2ZE7A 3RS0A 3ATWA 4LJAA 2J92A 1E69A 2GGVB 1BYUA 2P5TB 4OHVA 3T27A 2F9MA 2WICA 1GBDA 4E03A 1QRWA 1SVLA 3AGPA 3SNDA 4LC0A 1J17T 2GCPA 2IOTA 4YMSA 4M9XA 4MRPA 2B8TA 2WHXA 3P20A 2R2MB 4KP0A 1RRFA 1TNGA 4UDWH 3VKWA 5E95A 5HZKA 2XTMA 2PEZA 4JLJA 1EZSC 4URWR 1HAZB 1SHHB 4PC2A 1DS6A 3AP2A 1GVLA 3GCNA 1H8EA 1SBWA 4OI1A 1DSUA 1W12U 4WWYA 1OH5A 1K22H 4MGYR 4DW2U 2BD8A 5GJCA 3TSZA 2DCUA 1NMXA 2VBCA 1TTTA 3MJHA 2H1LA 2DUCA 1IQJA 1AU8A 5HMAA 3LDAA 1CF4A 1MO6A 4RSPA 3QEOA 3B9PA 2IUSA 1NN0A 1VDZA 1BMAA 1CJMA 1TQ0B 1ZYOA 2PX0A 2IPHA 1ZTKA 5KNCA 2OUKA 4F4OC 1AS3A 1DX5M 4QNMA 1FY8E 2BDGA 1E9BA 3C5HA 4FINA 1A1VA 1NLFA 2C8VA 1J90A 1SVPA 1QBOA 1Z6TA 2PKAA 2J59A 1CBWB 1DPFA 4NONA 2ODPA 1BJVA 1OHHD 2OINA 2AERH 5KO2A 3BB4A 1DXWA 2VF7A 2Z9KA 3ASYA 2QRNA 4BLOA 2ZR0A 2H6MA 4UXJA 1PV4A 2XGJA 1IQGA 2NZ8A 2W26A 2GWHA 1OJLA 3MU5A 2F3RA 1IHTH 4H6SB 1DBSA 2AR7A 3AVPA 1OXGA 1ESNA 2WOJA 5FBLB 1UBCA 5JJKA 2ZF0H 1GBJA 3ONWA 5CJ2A 1BBRK 4NGAH 3V4RA 1GZSA 3A7VA 4CRBA 1DOJA 3CNLA 3LX5A 1AA9A 1OPHB 4X8UH 5FUXA 5D3MA 3FVFB 4PSAA 4Q4AA 2KI5A 3OE7A 1LV7A 3QF4A 3AVTA 1UCYK 2IYVA 4RD2A 1W0ZU 1AZSC 2VH0A 1VYVA 3QKSB 1GCTB 2UKDA 3PB1E 4BEBA 4NKRA 4C0AC 1LHGH 1TOCB 5JWRA 3CRQA 4DOQA 4M1OA 1ZUIA 1CJUC 5GDSH 3SJIA 1T91A 1S1MA 4BFYA 4TPYA 1V43A 3K1JA 4FU7A 3VNUA 1L0ZA 2J0UB 2GEUA 2ZETA 3ZVDA 3BAFA 1YPEH 2DE9A 2A2ZA 3KTAA 4EPTA 1OH7A 2UZ3A 3BIFA 3UATA 2ZHFH 4DLVA 1FJSA 1XB2A 2WMNB 2JLXA 5TJXA 1ETUA 2A7JA 4RKJB 1OP2A 2PX3A 2PLXA 1C1YA 2B5TB 3AF3A 1WTGH 1NFYA 1ESTA 4WIAA 2AWOA 1TPAE 3SO3A 4Y8XA 4URUR 4IW3B 4B35A 1D2NA 2ZCLP 2D4HA 1FP7A 2YYZA 4ZDKA 4LJ4A 1O2TA 1HJ9A 1XX9A 1K1IA 1NRPH 1FX0A 4IDQA 3C16C 4EJSB 1R7RA 1TE0A 3KF2A 4U32A 4NIYA 1R0WA 1A0LA 3SBEA 2HNTC 4XSHA 3B23B 1Q1QA 2WUCA 1N6PA 1RIWB 2AD5A 1AE8H 4TWWA 4YTAA 1XRJA 4DDWA 2BKUA 1E0KA 1R10A 2Z9JA 2ZTSA 3PTNA 1E99A 2OC0A 2A4QA 4I1OA 3RHFA 1TRYA 1SQ5A 3NBXX 1O5GH 3VB7A 2WSMA 3CX6A 5K8UA 3T28A 1ZU4A 2PWXA 3I62A 5GWZA 1MH0A 4RN6A 1CBWC 2YKGA 3MAAC 4XBDA 2ZVPX 2W5EA 1EP6A 5JBTA 1U0JA 3VGCB 3Q76A 2C03A 4LJ6A 1II8A 3EA9A 3M36A 4X1PU 3LU9B 3RLFA 3SJZA 4MNVA 2A1DB 2W3KA 1QA0A 2AMQA 1VIAA 5TMPA 2ZFRH 2CJWB 1NVXQ 4KLNA 2IYLD 3OIUA 3CNOA 2GCTC 4YDSA 3TQFA 1XKAC 4VGCB 2GXUA 2ZPSA 5G3ZA 2ALVA 5LPNA 5JEEA 2OAQ1 4TL8A 3NWUA 4INKA 4A92A 1T7CA 3Q77A 1BRAA 1MR3F 2BEJA 3EW9A 1KO1A 3ELAH 4LOYH 2F55A 1MU8B 1LB1B 4E22A 1P57B 4JLAA 4AK9A 1GJCB 2ALPA 4JZKA 1EGAA 4Y11E 3FFAA 5KNBA 3NC0C 4ARZA 1QHHA 2GX4A 3W6PA 1GCTC 4FMCF 1PPZA 2A5FA 1BQYA 3TW8B 4FU8A 3EZ7A 3VR2A 1ABJH 4ZKOU 3SZRA 4JT4A 1E6CA 1Y5AT 1OWHA 2GZDA 2IYYA 1B0FA 1PFXC 3MH4A 4MDFA 4LHWA 2ZR7A 3UG6A 3A1WA 5DP3A 4MNWA 3RXDA 4ZROA 4TWZA 3B1XA 1C4Y2 2OZEA 1YM0A 4MPVA 5JS7A 1CP2A 5LH8A 1KSHA 2N46A 2GZ8A 1HJAB 2ZFSA 3CWQA 1SMFE 4K1EA 3S7KB 3BERA 2VB0A 1G3QA 4OHXA 2C98A 3KQUA 1SKYE 1TQDA 5AJWA 2BHGA 2NU1E 4DSUA 1DG3A 2GT7A 1MRNA 4QBGB 3WMEA 1RRCA 5FTLA 1YZNA 4ASUA 1QHSA 5IF9A 4Q5IA 2FI4E 3T12A 1KZ7B 1QRAA 5CIQA 1ETTH 2YWGA 2JIZA 1JPNA 2Q21A 3B2EA 1C1SA 5FXLA 1NBME 1HAYB 4EJSC 1XEWY 5DP6A 2ZJBA 2QPTA 4XH9B 2C8ZB 4FXGH 1GHAG 4YZUA 4ZI3A 3ESTA 3A7YA 2AFHE 1NESE 1RIWC 2QEQA 3M5OA 3BFVA 2JLYA 2N1BA 1W11U 3IHLA 5EG4A 1OKKA 2CVHA 2J46A 4DIDA 2ZQ2A 2IHYA 3HKIB 2ZI9A 2GEDA 1WYKA 5BN3A 2FEQH 3OF5A 2NZJA 5H1YA 4O3TA 2IYZA 1KXFA 2GTBA 2DR3A 1AQYA 4F4JA 3B6EA 4EPVA 4Y8ZA 4PQFA 3UOPA 3AF2A 2BM2A 2OCVB 2P5SA 3SQEE 1GMHG 1SVWA 4D25A 1HT1E 1H65A 4NBSA 4OQLA 1D9XA 3TBKA 1O3YA 4BAKB 1TNJA 5FUWA 4M4SA 3TRFA 1TQ2A 3U69H 2ZGBH 5FFMA 1XMJA 4Q1BA 1S2MA 2H5DA 5JDUB 1KZGB 4D7GA 2V3CC 1U0LA 1ZMLA 1QG4A 2ZHWH 4JYBA 2PBRA 1ESMA 4MVNA 4VGCC 5FPSA 4I4LA 1C1PA 4INLA 1J99A 1W0YH 3BGWA 1K1JA 3HJNA 2G83A 3GJ6A 3T5GA 1ELCA 4MDSA 3TLOA 1TADA 1K1OA 1MD8A 3C4JA 3NDBB 3W94A 4TSFD 4L9WA 2EWWA 3ZZDA 3E1SA 4OGYA 4DSTA 4OQNA 621PA 3PITA 4LBWA 5AK0A 1XZQA 4BTTB 5E0GA 3GJ4A 3U4QA 2J0QA 1J2JA 4Q01A 3U7FB 1N0UA 1GJ8B 1XMIA 5JB9S 1KHTA 1QJ6B 3NBFA 1XF9A 1KYIA 2F1IA 4JJKA 4QGGA 4MRVA 3RXLA 1HRTH 3H86A 5JJIA 2XCFA 2EFGA 4CRFA 4ZIRA 1KIGH 1UTNA 4M9QA 2OK5A 2D26C 1SGWA 3FZDA 3GCHB 2JLRA 3RXGA 1ZHRA 3AVQA 3PWBA 1G32B 7LPRA 2ZRBA 4CEHB 5KYKA 3FPAA 1JOUB 1TBRH 4A4DA 1XUIA 1DADA 5CIWA 2YC4C 3RXBA 3EA5A 3NIBA 3DMDA 3H7TA 3ZVCA 1E2JA 3RRZA 4BLRA 1EB1H 4EPRA 2EEKA 2GCOA 1PPBH 2Q0HA 1Y5BT 1ZM4A 3RU4T 3V12A 2PV9B 4PHGA 5J4YA 3QOFA 4AORA 1SHKA 1BTXA 1FZZA 4G5OA 3HYRA 2DFLA 5KDOA 2G4TA 1L4UA 4C0LA 5A8XA 1F5KU 2JLZA 4ISOA 5AUNB 4US1R 4BFZA 3Q3YA 4HDQB 1KNXA 2ZRFA 4M22A 2HXYA 3A37A 4M2LA 2G81E 4ABJA 2ERYA 2ZREA 1TNLA 2OHFA 4P4UA 1O38A 1SOZA 1IQNA 1T4VH 3SU4A 5A8YA 5CMXH 1MTUA 2J1LA 4IFBA 1CJVC 4YOGA 1PYTD 5FHTA 4G0NA 2VIOA 2GDDA 3M4YA 4KV9A 1Z6AA 4L16A 1N6HA 1LVMA 3A8TA 1A0HB 4JLOA 2XC4A 8ESTE 1B5GH 1OYTH 2HXSA 1SHYA 2BD4A 1UBGA 1JBUH 4LWZA 3LJJA 1UJ1A 4D7FA 1R5BA 4R8TB 4AGKA 1J8MF 3FFBA 3FKSA 4C4PA 4W5HA 4BFWA 4F93B 1LHFH 1G17A 3QKUA 1KSNA 1UVUH 2SGQE 4PAMA 4BEJA 4HZHA 4WF8A 4GMXA 5TV2A 5CK5A 3AEZA 1OWEA 1HYQA 2FOGA 2A5YB 2ZWLH 3IEVA 3LV8A 1QL8A 1R0XA 3THXB 4YOJA 2AK2A 3SC3A 4X8VH 4ACBA 2J34A 4FUBA 2VJ1A 3BIVH 1WA5A 1HGTH 1GBAA 2MSEB 4PAQA 5C1UA 2OG2A 1VG8A 3GCOA 1CQQA 1OXVA 2VPPA 4F91B 3ADDA 1VCNA 1BBRH 7ESTE 4FN5A 4F38A 1QJ1B 5HPYB 2GBLC 1GVZA 1RFNA 5AWFC 1NBMD 2JJ2D 1SQAA 1AY6H 4I32A 3RUOA 3WYFA 1UCYH 5KSZA 1T9HA 3SQWA 1S3GA 2TPIZ 2OTVA 1M7GA 2ODBA 1U81A 1E94E 1MZAA 2N42A 3KKMA 1YP9A 4YLUA 3MCAA 3RYTC 3CPHA 1UJ2A 1UK2A 2EW1A 2GXSA 4F7WA 1TGNA 3V4FA 1ZRBA 2IW3A 3BK7A 1SL3A 1AMHA 1E35B 5CK4A 2D7CA 2B21A 2CGAA 2ZKSA 4KTCA 3LJOA 1R6BX 4K2YA 3CLVA 3PCRB 1U6QA 4IEEA 5A5GA 2VVVA 3Q3KA 4D4LA 1F7ZA 2QQEA 1GKIA 3SV7A 2EFHB 4ABYA 2GZHA 1G20E 3O8BA 4HLDA 3DMNA 4KODA 2NPIA 3BE4A 1G3DA 2CE7A 4EPYA 4IXNA
chains in the Genus database with same CATH superfamily
1AN1E 2O5CA 4X8LA 2DETA 4FW9A 4PS0A 2ZJ8A 1V1MA 2R7LA 2DKNA 3H6HA 2FI5E 2H2WA 5BW5A 5JXHA 4DLXA 4IEFB 3P8GA 1KY9A 3EMKA 4B3XA 2A9JA 1RJXB 4FMPA 2WY2D 4P00A 5KNLA 2XDAA 2QF0A 5SY9A 3ZGLA 3EVDA 4TKUA 1W5SA 4B74A 1I6KA 3AESA 3GLVA 1E4EB 2R00A 3KZXA 3VI3B 2A1IA 1LLCA 4COKA 3DAGA 3ZLJA 4AYYB 2AKYA 2IVZA 5F23A 1Z71A 1QB6A 2PHBA 3HYLA 2FNAA 2REOA 3WNQA 3D2AA 3LY8A 3BEUA 1TCBA 3SJAA 5DT2A 4AQYB 4BMPB 3RXKA 3AUJB 4IHJF 1UAAA 3FVQA 5IUJC 5CGQB 3F0PA 5BXYA 1G59A 5DYWA 3X2SA 1E7WA 3HHEA 4LPKA 2AOTB 2WQZA 2CB9A 3O4IA 1CXZA 4K26A 2OVFA 5ER6A 5J4HA 1EZ1A 1RJ9B 2A67A 2E4XA 3E7DA 3IMKA 4OLFA 3NHMA 1U8YA 3OKPA 3IIMA 3PIDA 5BQOA 4MQ5A 1C9DB 1WVIA 1Z12A 1KJQA 5I5GA 4GOLD 2RGYA 3UQVA 2H5LA 1A5TA 3P4UA 2FMKA 3UY4A 1T6XA 2IT1A 3Q9SA 1HZZA 3OPQA 3NKLA 3LIWA 4AMUA 1N2IA 4L2IB 4ZCIA 4TTSA 4DMLA 1O2WA 2WJIA 2VLBA 1OB2A 3BHIA 2DTXA 4WXHA 3OY5U 4HNGA 1RMQA 2X0JA 3EC2A 3MWKA 3QVUA 2A3RA 3DTVD 3PNYA 4M1TA 3EXEA 4XE5A 3C41J 3SJ7A 2PRKA 5F9HA 1PK9A 4YN3A 1NXTA 4EIWA 3N2LA 4G56A 1C8VB 2FEXA 1IONA 2EU8A 3WBKA 9ESTA 5JCZA 4AAYA 4LZZA 2QROA 2AN3A 2YYYA 3LCMA 1HIAB 5T6FA 3PX2A 4PPQA 5ABPA 1P9RA 3BDVA 3MHWU 1SB1H 3WW7A 3A9TA 3BM5A 3VC7A 2D1QA 4BQFA 4DHWA 1W4AA 4M46A 1Y48E 4WCDA 3D31A 7GCHG 1T34A 5A6VA 2C84A 4JIMA 2DG2A 1DIHA 1WLSA 3HA5A 3D3JA 4RCVA 2JARA 3N74A 2FPWA 4HWRA 221PA 3IAM6 2SICE 3I1FA 4UHEA 1L5YA 4RA6A 2WKRA 5F2NA 4KELA 3SKYA 2ONCA 2IEAA 1YR7A 4UDXX 5FTMA 4X20B 1G36A 2HT1A 3UG7A 3B3QA 3NYRA 2IWRA 3USCS 4V02A 2ECOA 1HE5A 2YMSB 4JDPA 4JVMA 1WVGA 2ATCA 5DOZA 1OXKB 4KN8A 1UHBB 4EQZA 4AJ4A 1Q7BA 2AGVA 1SUDA 5A03A 3V4LA 4G9BA 2BKXA 3K35A 1NQVA 3Q7RA 3I05A 4ZVTA 1GBBA 1J23A 2DE8A 3LHKA 4GZMA 3RTEA 1SCUB 3ND8A 2HMWA 4PG6A 3K09C 1CHOG 2PKXA 1TPOA 4C20A 4LV8B 2GN2A 3FMIA 4K1TA 3UH1A 1OW3B 2PWBA 2XODA 5HIMA 3K31A 4AS3A 4NZZA 3CVUA 2HJSA 3OZEA 2JD1A 1OWKA 3M6MD 1GL7A 3OEHA 4MHTA 3EIHA 4DNPA 3Q7EA 1TYNA 1A61H 1WBBA 2Y6UA 1JYSA 1C9YA 2YV2A 5H7XA 3BH6A 3EE6A 4NR0A 2H1CA 4J94A 4U9IS 1N6YA 2FB9A 3VR3A 2AQKA 3RUEA 1KAMA 1XQVA 5FI1B 5K3FA 1SXJD 2CZCA 5KPJA 3UF0A 3WFZA 1U8UA 4MGIR 4DJZB 3MAJA 3C43A 1MJHA 3EIXA 1Y3HA 2JH5D 1XV5A 3VPAA 4HL6A 1IQEA 3FVWA 1OT5A 3EXG2 3KPYA 1RD4A 1RM0A 1KGSA 2BD2A 2B20A 3AUTA 3A85A 4F4DA 2I7CA 3HACA 4DXDA 1S8F