4A92A

Full-length hcv ns3-4a protease-helicase in complex with a macrocyclic protease inhibitor.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
639
structure length
639
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title A Macrocyclic Hcv Ns3/4A Protease Inhibitor Interacts with Protease and Helicase Residues in the Complex with its Full- Length Target.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 200
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4a92A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a92A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a92A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A03
4S2EA 4I31A 4OQFA 5K0HA 1P10A 2F1IA 4MYHA 1E2EA 2ZYWX 1J7KA 3PUZA 4IOLA 1E1QD 1D6RA 3E5HA 3M7TA 6Q21A 4GI7A 2CBZA 1CHOG 2H8KA 4TZ0A 1FIZA 3HGPA 1OHHA 1IQMA 5TDHA 5JRZA 1I4DD 1DAFA 1TQ7B 1TQ2A 5GJ4B 3KKPA 4BFYA 3RXAA 4AI6A 3W34A 3QGJA 1D9XA 1MV5A 2ZAOA 2FI4E 3RXCA 2QMUA 4JKYA 2J3EA 1W8BH 4DCNA 4TY7A 2HLDA 2VO1A 3ZYEA 1ZCAA 2BD3A 1KHTA 3FMPB 2CJWB 3A36A 2B8TA 1D3PB 3W6PA 2R2WU 2PCJA 2WKQA 2Y5FA 4A0RA 1YCPK 3VTKA 5B64A 3CPJB 3S9CA 4MKHA 3K70C 4JYCA 1RYHA 1K6MA 4E07A 2ODNA 1UMAH 1MO3A 2Z5FA 1VHTA 4BFXA 4NIWA 4P33A 1C1SA 3D7MA 1TNJA 1GZSA 2XWBI 3K53A 3PEVA 4CEIB 4GCHG 3RAPR 1NN6A 3VB3A 1P2KA 4NZLA 2R2MB 1D8TA 4JL6A 2JGNA 3RANA 1P4SA 3DL0A 4SGBE 1FNMA 3CS7A 1W7XH 1HJAC 3F68H 2JLZA 1ESTA 3Q85A 3SZNA 5CJ2A 4BLSA 1O2LA 4PC7A 4A4DA 2RGAA 1K2I1 2ZU2A 1JR3A 1V5WA 5KU1A 4B35A 1MR3F 3E2IA 1BZXE 1TA6A 2BOVA 1J2JA 4OQXA 5EP1A 5FOXA 1KXEA 4MNYA 4M21A 1ANEA 4ISNA 4DCDA 1YCPM 3TIFA 2ZU3A 1SLUB 4Q19A 1II8A 3ATKA 4BNRA 4HAUA 4NDZA 3BEFB 2REBA 1GL6A 1DSTA 1JPJA 1ZSKA 4KI0A 4TL7A 5EPNA 1NRSH 4DDTA 2F9LA 1YHNA 1DAKA 1ZUHA 4JSTA 1GJCB 1E6CA 3I73A 2G4TA 2JLUA 1UTQA 4TL6A 5FI1B 2TPIZ 2ZFRH 5TMPA 4K69A 4QHSA 1S85A 1Z8JB 3PB1E 1NC6A 5EUMA 1Z6EA 1AN0A 4KTCA 3KXIA 2Z9KA 3F1SB 2EEKA 3SBKA 2ZI5A 3W90A 1FX0B 2OK5A 1JEEA 3FP7E 3RXOA 2WZQA 1G8GA 1G7RA 1O5CB 1GJ9B 1C5VA 3WMEA 4NU0A 2G5NA 2DFKB 3ZJYA 2FOAA 1F7ZA 4KP0A 3NBFA 1TUIA 3A85A 4V0MA 2P6NA 2CJWA 2BLOA 2DWPA 5B57C 4AG5A 4LHXA 3X1XA 1QL7A 1QJ7B 3FGNA 4Q21A 1O2VA 1XTJA 3T12A 4D0LB 4C0HA 4KBFA 4IMZA 2VSFA 2ZFFH 2XBYA 3U44B 2HVXA 2QY0B 4OS7A 4WOPA 2VIQA 1CRQA 3EASA 1W12U 2FS9A 4A1VA 1P9WA 1JB1A 1P57B 4B2CA 4RZ2A 4PTLA 2PWXA 1D2NA 1N3BA 4M1YA 4GZMA 4CEIA 3VU9B 3FMFA 1C2FA 1ZD1A 5B6OA 1S1CA 2QPTA 1LCYA 1VYVA 1MO5A 5AVDA 1AKYA 3MD0A 1E4YA 3KKNA 3MWJA 5CIQA 1P9NA 4KVAA 1EX3A 1AS0A 2V55B 2D2DA 2W2XA 1N0VC 1DWBH 8ESTE 1DE0A 4JBYA 3TLXA 3KF2A 3L33A 4XOJA 2QC2A 4QXAA 2ZSDA 2P16A 2HF9A 5AJZA 1O2HA 4EJSA 2WKPA 1AS3A 1H8DH 1V6DA 2CL6X 4JLAA 1MH1A 4HLUA 2A4OA 2CNWD 1VCOA 1DY9A 2A2QH 3LJOA 4NGAH 1YPHE 5EZ6B 4NFFA 1EB2A 2B7DH 2ULLA 2CHAC 2A4QA 4X8SH 2F3CE 1FTNA 1AE5A 3UPEA 2NMVA 2NO6A 3UWJH 1PPGE 1O2IA 4G1UC 3GEIA 2F9VA 4I81A 2VSXA 2QNRA 5B2ZA 2GCTC 2OCYC 3NVAA 1ANBA 2V4ZA 3LIWA 4JS0A 2BJWA 4ZI3A 1HGTH 2HV8A 4MDSA 3QEOA 4I1UA 4RZUA 2O8FB 4YMVA 3GLGB 2Z94A 1O3KA 4I8JA 1CTQA 2WIAA 2J59A 1FX0A 2PTNA 2G0NA 2PEZA 2DFNA 1C2GA 3AUYA 1CA0B 2GCNA 3S1AB 4TPIZ 1E9SA 1FY4A 1WU1A 1GMHF 3ATIA 4TMZA 2GT7A 1AQYA 5DKMA 4EPYA 2CK3D 3W8NA 1MTUA 2EFDB 3AP2A 4TT3D 1E2HA 4C0BA 1QB1A 4NG9H 4NIXA 3RXMA 1S3SA 1BMLA 4F38A 4CF7A 2SNWA 3CKLA 1G36A 4CRCA 4ZUHA 4N0DA 2HCBA 1GBIA 4UE7H 2FOEA 2HNTE 3OY5U 5AJWA 1TPPA 2J0UB 3FE2A 1AFEH 2QTVB 1W36C 4KVGA 2NU2E 1LS6A 2DR3A 2FZ4A 3A80A 3BXZA 2IBMA 3UR6A 4MDFA 3VU9A 3U3JA 1ANCA 2R8RA 1DUEA 4UQOA 2OC7A 1ZC4A 3KKMA 621PA 1U81A 3P32A 6LPRA 3C7KA 1JJ7A 4Y8XA 4XIGS 5E2OA 3SZRA 1U98A 3S69A 1YE8A 1MT0A 3PQCA 1X3SA 5HZKA 4D4MA 1TONA 3REFA 1C1RA 4BZXA 5EOKA 1NY22 3CENA 2X77A 3GFPA 4WIAA 1P75A 1O3LA 1UCYE 4DSUA 4G5OA 5I46H 4QBHA 2J4IA 3U61B 1OT3A 1IM2A 2KE5A 1BCUH 3I5YA 4M1KA 2BC9A 1EP6A 4OS5A 3LVRE 3RXQA 4RCZA 2E9SA 1B23P 1YR6A 5JBTA 1E32A 4Z8XA 3U1IB 3GLHE 4Z8YA 3GLHB 1P03A 3SORA 2Z9LA 4IEEA 4Q00A 2IL1A 2OLJA 3QE0A 3HDTA 3Q3YA 1GMCF 4QFMA 1HAOH 1NN1A 3SJ9A 2JLXA 3TNFA 3RP2A 3A8AA 3LBNA 3SR0A 2ALPA 4LYAA 2AXNA 3F8TA 1EXMA 1LPZB 1VKJA 3ZV9A 1BH2A 1ELCA 3TJOA 1HT2E 3SYKA 3A89A 5FPHA 4CVNA 2O8FA 1EJNA 2ZI6A 821PA 4RFSB 5DNYB 1ONBA 1F5NA 3PEYA 3CX7A 3S1AA 2QSYA 1EB1H 4UEHH 2ZTSA 4FINA 3Q7QA 2BX3A 3JZ2B 2XCFA 4B1TA 1OJLA 2XITA 2WBLC 4H1UA 4F4JA 3HKIB 4TYQA 3P1JA 4BLOA 4N3NA 2BDBA 2VIPA 2VSOA 4XSKU 1GMDG 2P5TB 2XGJA 1A4RA 1Y59T 4LC0A 1VG8A 2J0UA 2J38A 5GWZA 1KK0A 2ZJBA 3EGKH 1VG9B 2GDDA 5K8LA 2GESA 1O5FH 4JZFH 4OK5A 1HLTH 2C93B 3A86A 4Z51A 1N6YA 3L43A 3EIQA 3C4JA 4O0MA 3BGWA 4I1OA 1DAHA 3OEHD 2Y5GA 1R10A 5JBAS 3S7HB 3WY8A 2W6JD 3G5UA 1RXPA 2UWPA 3A37A 1BRCE 1C5MD 1VZQH 5DN6A 4C0LA 3SNDA 4CRWB 3MU5A 1ZYUA 3RM0H 4NWKA 2RGEA 3AGQA 1DM4B 2IJD1 4UJ3A 4MPXA 1O5AB 1TPSA 4A1TA 5CMXH 1MOZA 2FOBA 1F0UA 2J1LA 1ELGA 1QG4A 5FOVA 1UJ1A 4QL3A 4O2RA 4XE4A 2AXPA 2FEOA 3QDZB 4MH0R 3RWMB 1E0AA 3MJRA 3BE4A 2OESA 3CH5A 3EAQA 4WY3A 1R5NA 1C5LH 4OI0A 5A0AE 1K1IA 4I99A 4C7OB 3GLHA 3M6AA 1W10U 3GFTA 3ADBA 1NL3A 4YM9A 1QJ1B 2WWXA 3QPWA 2K1QA 3ATWA 1PVOA 4URVR 1ZU5A 4KFRA 1UTLM 2MMGA 4X8UH 1T7CA 1D3DB 2ZS7A 3RS5A 1NI3A 5TY0A 5JJLA 2O8WA 4QNRA 3H09A 1NN0A 4RFSA 3H5CB 1UTOA 1VCQA 3KXLA 2IYRA 4XVUA 1O37A 4IOMA 3U7HB 3NC1C 1AWHB 4Q1DA 1NS3A 4DEYA 1OYTH 4Q4AB 2J41A 2HNTF 4FU9A 2HPPH 4NIVA 1G9IE 1UKZA 3U4QB 3BTWE 1R7RA 4L8GA 3AF1A 1P02A 2DBYA 2UZIR 4ZKRU 1E2FA 4C2TA 4OYHA 4JLVA 4XSHA 1VIYA 4JZIA 1A46H 2F1JA 4FCVA 1C9PA 1OH8A 5BW8A 2Y5HA 1H9LB 4NCJA 5IK2D 1EUFA 1G3BA 3AQ4A 1S1MA 3GLFB 1YPEH 2LKDA 3QJYA 3HPTB 3X1ZA 1W2KH 3RNLA 1F0TA 3THXB 2ZGXH 4AYWA 2YC2C 1PYTD 1P73A 5AK0A 3C15C 4KLZA 4NKRA 2V3CC 4X8TH 1P09A 4C4PA 4Q7MB 2ZYVX 3KKQA 1J8AA 1AVWA 3W3AA 1TL7C 2IYTA 4IRUB 3EWSA 4HAVA 4EPRA 1P60A 3ZD6A 2ZJOA 3T29A 1C2MA 5B30A 4D8NA 4C3ZA 1QBKC 3STJA 1RTFB 3THOA 3UWIA 3A83A 1C4V2 1A2CH 2QGNA 3OEED 1MRSA 5E0JA 3MWKA 1GJAB 5GCHF 1YJ5A 4PHFA 1G3QA 2D2EA 4FU8A 2AKYA 5GVRA 1K1NA 2HF8A 4NCYA 4BQSA 1SL3A 3D49H 2CK3A 1ABJH 2VIDA 2RGNA 3AW1A 5J40A 2AKAB 2F83A 4DW2U 4F4IA 2C8XB 2FOMB 1Q44A 3I5XA 4M7GA 5DSZA 4B2AA 5DGXA 2NU1E 1EPTC 1GHZA 3HR7A 4K8OA 2QP9X 1Y5UT 2R6DA 5EQQA 4RKJB 5FTMA 3H7TA 1WDTA 4GFDA 1GVZA 2WV4A 2C95A 3CR8A 4NYIR 4X1PU 3K9NA 4Q4AA 3SN6A 1AZZA 1T8NA 1TX4B 2A5JA 3O8BA 3TW8B 4A1XA 3U4QA 4JZ1A 3GY7A 5UKDA 4NL4H 1TABE 4EPXA 5IF9A 1GKIA 3URDA 5EE3A 1NRPH 3QXSA 1GL0E 2GP9B 3Q77A 1XJCA 4UXJA 3JZ1B 4EUNA 2FDCA 3UQOA 1G5RA 3M5LA 5DHFA 4AORA 3C16C 2IEYA 3KXKA 5BN4A 1S0QA 2V6NA 5EU8A 1NFUA 5JSZA 2XNIA 2ASUB 4A2PA 1N8OB 2VIVA 3GP8A 2QM7A 3AP3A 3P8FA 1QG2A 2WJGA 3A81A 2D4HA 3VKHA 3WRXC 3THXA 4ZH8A 2OC0A 1GG6B 4MRSA 1IAQA 1E36B 3I32A 3I4LA 1NT1A 1ZSJA 1XPOA 4URWR 1HE8B 2PJRA 4TYPA 1EGAA 2ZJ5A 3EARA 1XXHE 3L3TA 3IIMA 1XXHB 2JCSA 3TNTA 1IQNA 2GTPA 4QC2A 3TNSA 3B1VA 4E03A 1COWD 2FEQH 3GJ3A 3C1KA 2V3HH 3GDVA 1CJKC 2FZZA 3PUVA 2R65A 3RXRA 4YOGA 1KGDA 3E16B 3HPRA 1ZNZA 4FUIA 4BZQA 4UDWH 1HUQA 1JI0A 3LGIA 1JWTA 1GHBF 2ONJA 1FLEE 3N70A 1HAYB 1VITH 4XH9B 2Y7XA 2LNCA 1ZBDA 4TTPA 4I1VA 1LVBA 4XOIA 5AWFC 3VB7A 1F0RA 5E0GA 4UXHA 3VB5A 3ZVRA 1AWFH 1KY2A 4J1YA 4AB8A 3KQLA 4Z54A 3TH5A 4A8JB 5C4MA 2Q6DA 4A5TS 3UKDA 2ZFTA 4TMWA 2VWNA 1WOFA 1OFUX 4EJSC 6GCHF 5AHGH 2YV5A 2CN0H 3GY4A 4O03A 1SKYE 5ELXA 1SKYB 1C5TA 5FUXA 1WBGB 1UFQA 2JDID 2BY6X 4MPVA 1CKEA 4D0GA 3ECCA 2HOBA 1KTTB 1GHXH 3B6EA 1NVVR 2WV9A 4TL8A 4DSOA 1DICA 1OIWA 4K1EA 1IHUA 2FN4A 5IDKA 3SQXA 4Y10E 3DHWC 4Q7ZA 1TQ6A 5DGJA 1UK4A 2RA0A 4NA9H 1OH7A 4TMXA 4BLQA 4MVNA 3IWMA 1O2NA 1A7SA 4G5SA 1EX6A 3ZH9B 1Q12A 1G7SA 7LPRA 5C1XA 4JVMA 1DPOA 2H9EH 1Y3AA 4YONB 2PUQH 3U98H 2ODWA 2GTBA 3RUOA 1KXFA 2FOFA 3OAAA 1QF9A 5K8IA 5F9HA 4GL2A 5EE0A 2AMPA 3RU4D 5KSZA 2ZAMA 4X6OA 1O2JA 2QPOA 2GZHA 3MYWA 2FFQA 1UTJA 2QY9A 5DPAA 2BD5A 4KXFB 1GBKA 3EA8A 1NFWA 1PUJA 1Z8IB 3LNCA 4MPUA 4JLOA 4JMPA 3ZS9A 1BHXF 3UPUA 3LDXH 4ZMAH 2PUXB 2QTHA 1P2UA 1XXHA 4CYMA 2CMYA 4DCSA 4MRPA 4X8OA 5JECA 4Q01A 1C1MA 4CHAC 2VHQA 1TGSZ 2F7SA 4JMYA 1KIMA 1GOTA 4VGCB 2EI6A 5JS8A 1HXFH 2DY1A 4CGZA 1LPGB 4RSGA 4AFUA 4HLCA 4UXIA 1VGCB 4AKIA 1BA8B 3RXPA 1F3OA 1YLDA 1S84A 4BFZA 1FPHH 4ZCMA 4TSFD 2YNAA 1FONA 1XWIA 3FHCB 4RVCA 4AGKA 2GDJA 3P4YA 1MKYA 3GYLB 3LC5A 4INKA 5LH8A 1HXEH 2BY9X 1P3EA 1ZOMA 3T28A 1GKUB 3KQUA 3H1TA 3KKOA 1ESAA 1EASA 2ODBA 1BTWA 4FUHA 2BCJQ 1CGHA 4A8JA 2F3RA 5CYPA 2GZ7A 3VEQB 2AD1A 1Z7KA 2FMXA 1OOKB 4JYUH 2ZDNA 3SEAA 3EG5A 5DISB 2QQEA 2FO9A 4RJLA 2YKGA 3U6BA 721PA 2KSQA 2PZEA 1GDQA 1KAOA 3CPHA 4GLYA 1NMXA 3FMIA 5KDOA 2IPHA 4UD9H 3TMKA 4LZZA 2ATXA 1NJFA 1YPHC 8GCHF 4FIDA 1NZQH 4PPGA 5JBBS 2MSDB 1GG2A 1KK2A 3VX3A 1G5PA 1A5TA 3SV2H 1S6HA 2A5AA 1ZNXA 5LD2C 2Q9BA 3IEVA 5EPYA 3ZZBA 2SGFE 1W49A 1KDRA 3HWSA 1UKEA 1Z0JA 2CJIA 1GI6A 2BM2A 1L1GA 5C20A 4NMMA 2QXIA 3FVQA 4V0LA 4D9RA 4ESHA 4HFPB 2A5IA 3K0FB 1G3IA 3PJRA 1QTFA 1E0JA 4BTIB 3RMMH 2J95A 2ZRBA 3G0HA 4AKEA 2IYYA 1E2LA 3QQ5A 1V2KT 2OP9A 1W7GH 3EPLA 4LYHA 2BMDA 4JIMA 2LWIA 1W4RA 2H17A 4YDSA 2WKRA 2O8UA 2VP9A 3AF2A 1GBEA 2GAAA 3CNLA 3MJHA 2A2ZA 2G6BA 3F9HA 1MBMA 1W1WA 4O3UA 4UFEH 3GJ8A 5C5NA 1JRSA 1Z22A 3G01A 1SHYA 1XUGA 1GSIA 1MH0A 3DDCA 2GKVE 4NZQA 2W5EA 3ZZAA 1WMSA 2E1RA 4TLEA 3D3QA 5IT5A 4PAQA 1AIPA 1P05A 1NVUQ 3A7ZA 3I77A 3MFYA 4US0R 2BY8X 2BKUA 2UWLA 1H8EA 4O2LA 3QTVH 1Z28A 4GZLA 4BUJA 1UO6A 3HPQA 1ZR0A 3IEUA 1FAKH 1XJQA 3IIKA 2P93A 1PLJA 2LKCA 3KB2A 1MKWK 1S0RA 1LPKB 2AFHE 1DSUA 3R7WB 2JJ1A 2J7KA 3QKTA 2QMOA 2YWEA 1CBWB 1A7JA 4BAHB 3K09C 4QBFA 1QJ6B 2ONKA 1FW6A 1C2HA 1QHSA 2A5DA 2ZUCA 5J4VA 1N25A 4HAWA 2ZDMA 3FDIA 4AYXA 4NPHA 8LPRA 2RCNA 3SYJA 4Z1MD 3NDBB 3SN8A 1MQ6A 2UUFB 3MWLA 4N1AA 2Z4RA 3UNRA 2QXJA 4X1SU 3B1YA 4Y0YE 2YVUA 2J7PD 4DURA 2ZZUH 1DXWA 2ZRAA 3KL4A 3QZRA 4K8BA 3U9AH 4D0NA 3RU4E 4KTUA 4J2YB 1KI1A 1N1LA 5JPMH 4B6FA 2FPMA 2O0KA 1RIWC 1PFXC 1E2IA 2OD3B 4AZ2B 2ZFSA 4FWIB 3L0PA 2EYQA 1C5PA 3U7FB 1US8B 5C46F 1Y63A 3RXUA 1U9IC 5FBLB 1V2TT 1T4GA 3GY3A 5E2PA 4EKDA 1F2TB 1AKEA 3AGPA 3M3VA 1BMFD 3AVVA 1C2EA 2GT8A 2FOLA 5EXPA 3SI3H 1OIXA 2IC5A 3GCOA 1SC8U 4MGIR 3SJBA 3QN7A 3FB4A 1RGQA 1KNXA 4EDHA 4A82A 4OQLA 1SZPA 3TIUA 1VHLA 1HBTH 2VRWA 2FFBA 4LWZA 2OAP1 1GJ6A 2C96A 5KO2A 3GLIB 3M3TA 2QRNA 1ZMNA 4O3TA 2O8CB 4I32A 9LPRA 4DLYA 2O0HA 4X8HA 5A2MH 2BY5X 2IXEA 5DP4A 1SGWA 2FE4A 1E9DA 5GADl 1P9RA 3WMGA 3QVVA 3NWJA 2ZS8A 2XXLA 1D5CA 3KQBA 4FUGA 3FAOA 2FNAA 3PROA 4JVLA 1ETRH 2WWFA 2WV5A 2CHGA 6CHAB 1BO6A 3T5FH 1QA0A 3EYDA 5TCAA 1SVWA 4Y0ZE 1IY0A 3SUDA 1OP8A 4Y11E 2XYAA 3F3YA 3J81k 4PZLA 3P8GA 2FX6A 2IN2A 1XB2A 4LZ1H 1BTHH 2QSZA 2BOKA 2VF8A 3SNCA 4CBOA 2J5XA 3R7WA 4KAXA 3SU4A 3KQEA 1C1WH 6ESTA 2A31A 1ZVQA 1N6IA 1TAWA 3RXJA 1EP5A 3TSZA 2ZA5A 5E95A 1C5YB 3SHAH 1JBUH 1C1QA 2REOA 3TR5A 1NBMD 3DPUA 3KZ1E 4OQMA 1OYQA 3S9BA 4GP7A 3W5JA 1GI7B 1SQTA 1THRH 2IW3A 3FANA 4Y0VA 4PQFA 3E6PH 1BJUA 1GHWH 1SVPA 3W5IA 1MZAA 1OIVA 1J8YF 5L30H 3UR9A 1KNQA 3OZXA 5AUPB 2AEIH 1T3SA 3QK1A 5AFZH 5EXSA 3MAAC 3CB4A 3AVWA 3QKSB 4DUGA 2QU8A 5IYTA 2ZSAA 1X7AC 1CJVC 1IJEA 3NTUA 2VWMA 1ZD8A 3GJ0A 3QG5A 2O8LA 3ZVAA 1ESBA 1US8A 2GK7A 2Y7ZA 5FBVB 1F2TA 2ZRMA 1SHKA 1LDTT 3D23A 3RS0A 3M37A 1S8FA 3KX2A 1NLFA 1ZPBA 2RHDA 3WYFA 3L8ZA 5CHAB 2EI7A 4PZZA 4TMTA 4B76A 2ZTXA 2P3SA 3B1XA 3T1QA 5EZ5A 4CEHB 2O8DA 4IW4E 4PAOA 2HXSA 1NMYA 1TGCA 3R8FA 3UQVA 1OE0A 1K1MA 2OLGA 1IQPA 2X8AA 3AVOA 5JJIA 4URZR 1EG7A 1KTSB 2PGQB 2FYRA 3NK8A 4NFEA 3KTAA 1Z8GA 1D4PB 3S7KB 3GLIA 4TQ9A 1O3BA 4WMDA 2J9RA 3QENA 4UONA 3PG5A 2O8CA 4OS2A 5GJVC 4TSFA 2O0JA 4MPWA 3GD7A 3M5NA 4Q4LA 1GBDA 3UNQA 3KCGH 1SVIA 2QF3A 1SXJB 1BBRH 1FUJA 1O3MA 1PJPA 2Z9JA 3SV7A 1EWQA 3V12A 2BBTA 4DIEA 3ZYDA 2QI9C 3UIRA 5FOUA 1KKMA 2TGDA 1DO0A 4XJXA 4Q7YA 1KO5A 1Z0FA 4HAYA 2AIPA 3SU0A 1J70A 3A84A 4IOJA 1Q1ZA 1UEJA 2WHXA 2H5CA 1NM6A 1J15A 2CL0X 2FXRA 4LHWA 1O2UA 3QGNB 1KI8A 1XTKA 2C77A 5CITA 1XUJA 3M61U 2N46A 1DELA 5P21A 1EAWA 2ZJZA 2FOGA 3SV6A 2FP7B 3OTJE 5FBIA 3P20A 2IYQA 1M7HA 2BDCA 1N6KA 1R0XA 2XNDA 4RY2A 2QA5A 3OE7A 5JBQA 2B7BA 3EPHA 1VYUA 4PAMA 3ZZUA 1C9TA 3A88A 1UBGA 2XJ9A 1AIXH 4EQ6B 4BXSA 5EQTA 1W2GA 2XB4A 1KMQA 1V2RT 4F49A 4XBBA 1S3GA 5SZJA 4ZXXH 1KXBA 2MSCB 3DFLA 3LGVA 3QKSA 1P2OA 1SVOA 1XD9A 1R0YA 4TMKA 1UVSH 5EP3A 2QUZA 5KPDA 3TH4H 2FLRH 4ASUD 3VR4A 1MMJN 2Z83A 1JR6A 4XWKA 1DLEA 1NIPA 2H18A 2BJVA 3EAJA 2QN6A 1JALA 2ZGCA 5AJXA 1FMJA 1E0FD 2VH5R 2ZPQA 5GNDA 2XNSA 4IJMA 3SNAA 1QHXA 2VHUA 1IN8A 4I8LA 1SGQE 3L6PA 4CEHA 5LB2A 1LQEA 2VWLA 1HPGA 3EZFA 2A9KA 5AJYA 2FWWA 4FW9A 2R62A 1EK0A 1QHNA 1C2JA 4BLRA 4FUBA 4W5WA 4NA8A 1II0A 3VAAA 1UEIA 1W46A 5HE9A 4AK9A 5EXXA 1DUAA 1G18A 1MTNB 5L2YH 4V03A 3UREA 1VCIA 3MMPA 3KDSE 1TFXA 1SXJA 1YZLA 4Q48A 2ORIA 4NIYA 2EI8A 1BYIA 1K5GA 1Q22A 1TGTA 5LBIA 5FTLA 2VVUA 1NSFA 1G30B 1KMHB 1DARA 1N6NA 1NVXQ 2N42A 5H4IB 1U0JA 3PMJA 1O3EA 1FQKA 1NBME 2AGEX 4Z1MA 4JYVH 1VCWA 2CL7X 3ICQB 4JLMA 4GOXA 4LI0A 4GDFA 1FMGA 3U3MA 1W14U 2CE2X 2DHRA 2MMCA 4ZHLU 1OXXK 3A7YA 2P6RA 4QHYA 5IHPA 8KME2 1FN6A 3A58B 4BLTA 2B5TB 2B8OH 3HYTA 2VP6A 2CF8H 3NIBA 1BMMH 1FV9A 5CM8B 2ZITA 5EJEA 4TWWA 5HZHA 1S6FA 2TMKA 3KJIA 4EQ6A 1W5TA 5FOWA 3L0IB 4YT7H 1CE5A 3K9GA 4ABYA 3V7TA 4KKDA 3A4NA 3LVQE 1BMFA 2QEQA 3IDQA 1YRAA 3TLOA 3ZVCA 1XCMA 2JETC 1HYLA 4P31A 4EFNA 4LX0A 5BXQC 3BD9A 3CO5A 3QIAA 1E9AA 1SLWB 3N7OA 4NYMR 2X2FA 1DTSA 2XSZA 1K1LA 4KLNA 2BZ6H 2ZCHP 2JLQA 2OSBA 3VKWA 4TLAA 1SLVB 2ZU5A 1TOCB 5FL7A 5JHGB 4TQAA 2GF9A 4IFBA 2IYWA 3C5CA 4PO9A 3LQRA 1TUEA 1R4AA 1FJSA 1P2SA 4ABAA 2B21A 3WMFA 4BXWA 1PV4A 4OHVA 3I92A 5TB5A 2PCLA 5EP2A 1CGJE 3TQFA 3ZIAA 5T1VA 2ZHDA 2VB0A 4IC5A 4MLFB 1XEXB 1WXRA 1QHRB 2NPFA 2PKAB 2I6QA 1PYTC 1IHSH 3U1JB 3SHFA 1HAHH 3JVVA 2QENA 1KXDA 4ZI2A 1BBRK 1O5EH 3ENSB 1Z6JH 1T5LA 1TLDA 1AU8A 2AS9A 4IVQA 4M4SA 1DS2E 2I4IA 4RD0A 1G3EA 3WP0A 1EZXC 4OK3A 3GMTA 3GCNA 2OV2A 1W0JA 1OXGA 3EA0A 1EESA 5EW2H 3UUZA 2Q1JA 1KMHA 4W5HA 4DWJA 2OBNA 1O38A 1L4DA 2G8TA 2AN9A 4GSOA 2CHVA 5CLLA 1UK3A 3RXSA 4WH8A 1WYKA 2R9PA 1D6WA 5F98A 3STIA 3JZAA 3VPKA 3DMNA 2HEIA 3ZZDA 1CLUA 1Z6XA 3NKVA 2OTVA 1O2TA 1L4ZA 3G82C 2JJ8A 1E9EA 1FN8A 2VP4A 2ODPA 1KLJH 1ELDE 1V2QT 1P01A 3JZMA 1DAEA 5CDFE 1AHTH 3LLUA 2ZPTX 4M53A 4DSNA 2ZP0H 4JLKA 4B3XA 2OCPA 1EFRD 3U60B 4A36A 1T4VH 2WJVA 5KOYA 3QKUA 2Z6VA 1RJ9A 1W4BA 5SGAE 4IOKA 1E2JA 4QOSA 4B3BA 2PSYA 4OI2A 1O5GH 3EA9A 1O2KA 4DKXA 1Z47A 5A8ZA 1C2IA 1CSOE 5EW1H 1NN5A 2OEPA 3L0SA 2Y81A 4JCNA 1VITG 2REXB 1FY5A 4QM7A 1SOTA 2TGPZ 3EC2A 1A0HB 1GBMA 1ZRHA 1PPEE 3CZPA 3FKQA 3CRMA 1OYYA 3CONA 3T34A 3W9YA 1GWAA 5EXNA 121PA 5HE8A 1INCA 4GUXA 1UBCA 1ZMJA 1NTPA 4ESTE 4Q7LA 3Q7PA 3ZGXA 1OF1A 2Y82A 1YP9A 3SV9A 1LKAA 1O32A 2C9OA 4NCKA 3PUWA 1P9SA 1K21H 3CW2A 2Z9GA 1X8LA 2JH5D 1G64A 4B6EA 2BLWA 1BKDR 2RGXA 1GHAG 1FOEB 3SJAA 4XFQA 3CR7A 1XEXA 2CXVA 4WF8A 2PKAA 3VGCC 4FVDA 4TWZA 3SW2B 5HKKD 1KSGA 3GEHA 4GHQA 2J0VA 1VJ9U 2KB0A 1CF4A 4IGDA 1TF5A 4C9BA 3PO1B 2W00A 3BB4A 5FUWA 2AX4A 1YPGH 2HWLB 2IF2A 2PZFA 4EPTA 3SQEE 2OC1A 1W47A 3RC6A 2BVRH 3MO6A 1GDUA 1TMBH 5JCPA 1IONA 4U5XA 2E87A 3QBVA 4D81A 3CIOA 2F91A 1ZSLA 2VGCC 1RRKA 1ZZZA 2GVFA 5KYKA 1T8MA 1BYUA 3HATH 1GI9B 2P67A 2PW8H 2J92A 4DJTA 1Z6YA 1YCPH 5CDFA 1KDOA 1S96A 4G5RA 1CEEA 5FPTA 2P94A 4Q02A 3KQDA 2NPIA 1F2UB 2GBLA 1O3OA 1XF9A 1YZNA 4FI3C 4GBMA 1SGCA 5GIBA 1B0UA 1DBSA 5JI2E 3KJHA 3U3KA 3TGIE 4Q1FA 4XD7D 2OINA 4Q4HB 1CXZA 3VX4A 1B0EA 3RXIA 4M9XA 1THPB 7ESTE 1E37B 4ON9A 4XTCS 2CCJA 4GPGA 3RS3A 3Q76A 1G6OA 2AGIX 3C5HA 2V54A 1UCYH 7GCHG 1TQ0B 2HPQH 2PL3A 2DWOA 2A30A 1T6NA 2DUCA 1NIJA 2QAGA 1TE0A 5GJBA 1FY8E 2VHJA 3RXKA 1X1SA 2FSHA 2B9LA 4C2UA 2ECKA 1H65A 4FMDF 1P2TA 2JH6D 1DG3A 2BBWA 2WOJA 4HUTA 1SFQB 5L3RA 3HJNA 3GDUA 4JYBA 1AJEA 3TRFA 4LBVA 4TPYA 1EFHA 1OSSA 2XAUA 4Q18A 1PZNA 4PHTA 3RXDA 1MKXK 3H2YA 1AB9B 1HAGE 4B3GA 1ESNA 3V0XA 3NUMA 1FPMA 2BDIA 3TKLA 4I8HA 3PLKA 2OBQA 3M1IA 2BM0A 4DLWA 3BV9B 4A92A 1ZHMA 2GZ8A 2Z3EA 3AVZA 1TU4A 3PMHB 2GK6A 2C8ZB 2ZRGA 4PR0A 3CLVA 4L16A 1GWNA 1R2QA 2W7SA 1Y8TA 1U0HC 4QBIA 1SGPE 1NFXA 1F48A 3Q3KA 5DYIA 2ZE7A 1SGRE 2ZJ2A 1ZPZA 2ZU4A 4CRGA 3B9QA 2FIRH 1YR8A 1GBAA 4Q1EA 3MUFA 3UK6A 2UKDA 1L4UA 2OHFA 1QRAA 4JLDA 1BBRE 1ZP6A 1NU7B 3GCHC 3BS4A 1HAZB 4P4TA 1GCTB 3TE6A 2W7UA 1XD8A 2BEJA 1IN6A 5HCNA 1V2NT 4F4OC 3PR1A 2ZRFA 1M8PA 2ZJYA 3ZDQA 2W3KA 4YOIA 2J2UA 4JZEH 1TNHA 2H6MA 5CE1A 3SNHA 3T35A 4G01B 4DLSA 3RYTC 1LHCH 3PYHA 3WBJA 2BWJA 3ZVMA 3PTBA 4YZUA 4IXNA 1K9OE 3SI7A 2HCJB 2ZQ5A 1XZQA 3ZVFA 1AS2A 2LCFA 4XWAA 4G5GA 4EAQA 2O52A 1PLLA 1SQOA 1JOUB 2HLCA 4FWTA 2Z7FE 3TR0A 1BUIA 1F2UA 5G3YA 4UKDA 2QRZA 3CNNA 4UFGH 3FTQA 4ZKEA 2HJGA 1ZTJA 3P95A 4OL0A 5DP3A 4J0QA 4URXR 5A4JA 1YPLH 3P8NA 1P3CA 1L0ZA 4Q4HA 3R0FA 3DFJA 1G8HA 5T6FA 3KQNA 4GMDA 2LPRA 2ZE5A 2A5GA 2QMHA 4LK4A 4NTZA 1JAIA 2P8OC 2DB3A 4JZKA 1D2MA 1BT7A 3RC5A 1BOQA 1AFQB 2ZS9A 1ZM3A 4PPFA 4W7SA 1SHZA 1ZM9A 4GT1A 3IBGA 4G5QA 5G41A 2FX4A 2YOHA 3T1OA 5LPNA 3IQWA 5BWMA 2IHYA 4TLDA 3K9LA 3NH9A 1GKYA 1ZMXA 2NU4E 4UNNA 1GHVH 1LF5A 1C2KA 5DI3B 1C5ZB 1KI2A 4TYWA 3KNXA 5BN5A 4AWXA 3ZQ6A 4B75A 4BTUB 1SQ5A 4B2PA 3KN2A 5FTNA 3H0KA 1AKSA 4XSGA 3TGPA 5JB9S 2ZCLP 3BJIC 1EFCA 2WPIS 3QF4B 1Z1IA 1BTUA 2AYWA 5DJ7A 2X19A 4D76A 1N6XA 1NPMA 3ZZ0A 2ZTYA 2ZJAA 1QHGA 3UIEA 2VP5A 3K0CA 3NHBA 3TJUA 2GDEH 4GPTA 2PEYA 4GRAA 3WNCA 3UMFA 4RZ3A 3VB4A 3RMNH 3NCLA 1RTKA 5KTYA 1EZSC 4WXIA 4KJZA 3I3SR 3QF7A 1MBQA 5HGGA 3BC1A 3BTHE 4NCNA 4QRHA 2AWNA 3NH6A 2R6FA 4V0ME 1EFRA 3UG7A 2GWHA 3U7EB 5JWRA 3FHOA 1NMZA 2RGBA 2V6IA 3GCTG 3K9HA 3LGTA 2A5YB 4BRWA 3HP1A 2PKSB 4KTSA 4HUQB 2ANMH 5KNDA 4GSYA 4GAWA 1NU9A 2SGDE 1ELTA 3GYMA 2P2LA 2W6IA 2BVSH 3CRVA 3K0SA 1QB9A 4YMUA 2UUJB 4FUFA 1O3CA 3ZVLA 2IX3A 5ABWA 2F1RA 4U2WA 1KI9A 2YNMA 1CHGA 4JT4A 4IHQA 5I25A 1ZM7A 1MABA 1C4U2 4Y79A 4DG4A 1IXZA 3AF3A 5FOSA 3SC3A 1XCGB 3DA9B 1UCYK 1ODFA 2ZU0C 1A2KC 4Q9JA 1Z07A 3FP8E 4Q9IA 1G3DA 3V3MA 2NO1A 1E99A 5JDUB 3L0OA 4BECA 3X1YA 3IHWA 2RG3A 2EU8A 1VDZA 3RXTA 1VYTA 1NVWQ 1JIRA 4YESB 4CR5A 1TPOA 5DN6D 2W0SA 2KAIA 5HKKA 3ZZ4A 2G55A 1DITH 4PFSA 3OESA 4EFMA 3K70B 1G41A 2XRCA 2ZECA 1C5XB 3QSYA 3SU2A 3I78A 2PJZA 3QUSA 3TUIC 3MO3A 1DLKB 1DG1G 1VCMA 2QT0A 3EE0B 1OXUA 1GL1A 2GMTC 2DE9A 3U8OH 3H84A 3QF4A 2P59A 1SPJA 4UNQA 2ZVQX 1SSXA 1T8UA 1FNNA 2IS2A 2AWOA 2ZGBH 2GEVA 3LOXA 4LK2A 1G20E 3AH8A 4A6PA 1XMVA 3GJXC 1E1RA 3SQHE 3AKEA 1O2SA 2ZI7A 4AG1A 2IT1A 3U5ZB 2C8YB 3RABA 2ZQ2A 1O2YA 3U8RH 1K8RA 1HJAB 1WB9A 3PWCA 2WUBA 4ABIA 5BQ5A 3QXJA 4IBLH 5HXFA 3B8JA 3PV5A 1O3NA 1K1OA 4AG6A 1HY3A 1GGDC 1WTGH 2OO7A 1T0JB 2EFGA 1M74A 5EE1A 1RC8A 4AC9A 4HEJA 5DK1A 4QGHA 2RMKA 3RRMA 3Q5EA 3I61A 4FN5A 4AN7A 5EQSA 4M9QA 4PPNA 1IQJA 4XD7A 2FGJA 2GV6A 2IK8A 1T91A 3O8CA 4JZDH 5ESTE 1RRGA 1GIAA 3CRW1 3U2QA 1AGJA 4HUQA 1F92A 1PPCE 3AKDA 1O31A 1G3CA 4Q03A 3SU3A 3B9FH 4F91B 5JS7A 4B3CA 3HU1A 1QVAA 1MTSA 1UTKA 1G17A 2XTZA 3BIFA 4UNRA 5E0HA 1O2XA 2GX4A 1V2VT 3VB6A 1GJDB 3IILA 1T0HB 4IDQA 3T62A 3MI4A 4PC6A 1EJMA 1YU9A 1UJ2A 4TY6A 2X1VA 3BEUA 2ZI2H 1G3UA 1N5IA 1IQHA 1AMHA 2J87A 4M1SA 4YMSA 2HT6A 3IO5A 1X1RA 1DWEH 3LGUA 5DYGA 1XUKA 4GMXA 1EOJA 3NZIA 4I4LA 4RCYA 3TITA 4DB2A 2JEOA 4CW7A 3LX5A 2VWOA 1GI1A 3R20A 4LV8B 3M5OA 2BMEA 2G77B 3NXPA 3OIWA 1EZUC 3RXLA 2GGVB 2XBXA 3F9FA 3KIDU 1HYQA 1JQJC 5FBQB 1LF0A 4E7RG 1RS0A 2BKEA 2QQ0A 1E4VA 2QL6A 4R9UC 1G7CA 1ANDA 1UTMA 5C2JB 2F9PA 3U7GA 4HI3A 1E79A 1LMWB 3GLGE 2H92A 3RDPA 2WSSA 3F9GA 1BDAA 1KXCA 3OIYA 2FLBH 1C1OA 4MNWA 4Y0AA 4X1RU 1SGFA 4NBSA 3SJKA 3ASYA 4O9VA 1MZDA 1DVRA 1IQLA 1DANH 2V1UA 5GXPA 2V1XA 3T5DA 1E2MA 4BWYA 5HMAA 1RZ3A 1XP8A 4FMBB 4C0JA 2G1JA 1CJTC 2EYUA 3PVSA 3LBHA 1TALA 1O3YA 3SGAE 1O2MA 4NE2A 4Y7BA 1QHHB 3A7TA 4K2YA 3D6TB 3SU1A 3Q5DA 5ANRB 1R8QA 3TVTA 1E3MA 1SVSA 3R3GB 3U44A 1R0ZA 3MU4A 5EXTA 1GJ4H 2R44A 2CHAB 2WMOB 2BX4A 3UY9A 2J45A 4KU4A 1Q0UA 3T06B 5EGMA 1S82A 2XOKA 3S0NA 2B7CA 2GCTB 1PJRA 1YGCH 4DOQA 2KI5A 5KSPA 2H57A 2ZCKP 4CRFA 1N6LA 2AR7A 5KNBA 4DIHH 2EVWX 1HFDA 4CH8B 1WCV1 3K6ZA 4DT1B 2GXSA 4D2IA 3L82B 4K8YA 1B0FA 1L7VC 2ZSBA 4BFSA 1GMHG 4D4KA 3SU5A 4MRNA 1C4OA 2GCPA 5FL3A 4MG3A 5EUQB 1JAHA 1AQ7A 4WW0A 4Q4JB 4CBNA 1XRJA 5JRJA 2ZSEA 2BD2A 1XEFA 4JL5A 3CX6A 1OS8A 3LFUA 1H9HE 4Q47A 1TGBA 3NWUA 4L9SA 2MSEB 2WMNB 4WBSA 4D80A 1OW3B 1BQYA 3B23B 1D2EA 2QXGA 2ZXUA 1ZMLA 1W36B 3VXFH 1TYNA 4MQBA 4U30A 1GILA 4QJ3A 4LHYA 2GZAA 3WYGA 3M0EA 4ZDJA 2IYVA 3C27B 4DLRA 2OG2A 4YOJA 1N6OA 2CDNA 1ARCA 2SFAA 2ZI9A 1CGIE 1CR1A 3GJ5A 3NEJA 3GLGA 1HV7A 1Z71A 1GBBA 1Y3UA 3TBKA 3PITA 1KO7A 3FKSA 2BYAX 5A0CA 1FXYA 4B43A 5C5OA 1A5GH 4DXAA 4PC3A 1G37A 4Y8ZA 1ZM2A 2Q3FA 4IVPA 1TMUH 4ABEA 3AVQA 4OKSA 5L3VA 2BEKA 2IYSA 1MD8A 1PPFE 2ZI3A 4CIDA 5DIFA 2VIIA 3PXGA 1XUHA 1QHHA 4AGJA 3ITIA 1T9HA 5JFGA 5CIWA 1O3AA 1WCZA 4LJ8A 1GMCG 3EZ6A 4NHOA 5J4LA 1ZTLA 4PHHA 1GJBB 1ZC3A 4HB3A 3V13A 2TIOA 1KJZA 4HSEA 1F0SA 3LWNA 2ZHQH 1WA5A 1YPMH 1RIFA 4G3XA 1J17T 4B73A 2CCKA 3OAAD 1NRRH 1W48A 2ZHWH 4DLXA 2XJ4A 1SFIA 3KJEA 2GHIA 1MTWA 2QN5T 2WWWA 2V7QA 1IQGA 1TNGA 2WPLS 2VA8A 2D62A 1G21E 5DH9A 2FA9A 4ZDIA 4H9GA 2GNOA 1QY6A 4R2IA 1KLTA 4C0KA 1XM1A 4Q4JA 4ZPXA 2ZF0H 3K0AB 4TL9A 2RB4A 1YPJH 2SGQE 1YZTA 4X6NA 2B6HA 3K1JA 3K6YA 2CVHA 1E38B 3OYPA 1LTQA 3R9WA 5FUYA 4NSVA 4A15A 3P6ZB 3U6KA 2A4GA 3EDXB 2WAXA 4ZDKA 3AEZA 1O3FA 4IW3B 4JLJA 1FFHA 1GFIA 3BTGE 2UZ3A 4QKQA 4UJ5A 2RGGA 4LRWA 1XTSA 1V2PT 2DWQA 3CNOA 2NO9A 2BDTA 4LXBH 2CF9H 2OCAA 2BQ6B 1GNPA 1FIWA 1Q31A 4MKIA 1QHYA 2N1BA 4WJG2 3BG4C 4IVRA 3ZS8A 3UWOA 1G5TA 2YHSA 1HQYE 1BRBE 3LD9A 1GBLA 2PMKA 2ERYA 1R5OA 5C67A 5F3WB 4LC1A 2IS4A 3EXAA 1E96A 2OBLA 3EQ0H 3TVJB 1WV7H 2UWOA 3VR6A 1LS1A 1CT2E 5G40A 1DEKA 3RVBA 3LW7A 3SYNA 2H5EA 2J94A 2BMJA 4D82A 2IUTA 1CULC 1E34B 5KDLA 3KFVA 2I3BA 4ACBA 1LW7A 4R71A 1NO9H 3EPJA 5AUOB 2XX3A 4IDNA 2C78A 4II7A 3GLFE 1Q3TA 2DYKA 2PHBA 1TF2A 2HT1A 1V2LT 1DWCH 1G7TA 1OKXA 3SNBA 8OHMA 2J0QA 3B78A 3W8RA 1KXAA 2WUCA 1Z6TA 4MNXA 5HPYB 1E9FA 1YYY1 3QLPH 3SUGA 1FY3A 3M5MA 3DOFA 3CH4B 2ZYUX 4TWYA 1VMAA 1KZ7B 2WPHS 2I6SA 1Q1QA 4LSGA 1GBFA 1DAGA 1ELVA 3GY6A 3BAFA 5DLQC 4PANA 3K0AA 2G5VA 2FTLE 2WVJA 4ZXYH 3CRRA 5H70A 3A6PC 2NOAA 3FMOB 4O3MA 3O8RA 2RGDA 1HAIH 1R0WA 1KDPA 4C7OA 1P06A 4CT5A 3GY5A 3PWBA 1AQUA 4OI4A 3ZV8A 3QI2A 2WIBA 3RXGA 1K1JA 1H8ED 3SV8A 1ELEE 1ELBA 4R0IA 4FCWA 4NYIQ 1C5OH 1EWRA 4KV9A 4QBGB 1G16A 1O33A 3L2OB 2WM9B 2FPZA 2C98A 3PIRA 4ZKDA 3T2NA 2JJ1D 1UAAA 2C04A 1QBOA 1DAIA 3ADKA 2VVVA 2G0TA 4KELA 4KCGA 3EA5A 4LPSA 2ZC9H 4M9SA 5HYOA 4C0SA 4I33A 1Z8RA 3AAVA 1Q21A 2JIZA 5J4SA 2GCHF 5GJCA 3BTDE 3TJVA 3SNEA 3QPVA 1JJVA 2NZJA 4KBGA 3SBDA 2F43B 4X2VA 2GA8A 5GJWC 1A1RA 1P0SH 2BZAA 1ZM4A 4QT8C 4P32A 1KSNA 4MKFA 2F55A 1G32B 2XB2A 4A1FA 1TX6A 3R8CA 1F5LA 3K8YA 4E5UA 3KHVA 1CHOF 4LBZA 1P2MA 2HUPA 5EODA 2C99A 4K60A 3PTNA 3RSLA 1HE1C 3QZQA 2GF0A 3I1FA 1QBVH 2M5TA 2BQ7B 1YR9A 2C2HA 4WMFA 3CM0A 1MTVA 3NBYC 2ZSFA 3TJZA 1XXDA 4OS6A 3QNUA 2OE2A 2YC4C 3GLFA 2FV8A 2I1QA 3BTKE 2XW9A 4LV5B 2ZGJA 2F9BH 4DLUA 1DXPA 4TYYA 2QBYB 4WZBE 2O8BB 1NLYA 4HATA 2BDAA 3UXMA 4B71A 2QT1A 5E8EH 1NKTA 2OZEA 3R9XA 1AGRA 1T8TA 5EG4A 1CBUA 3AUXA 4C0QC 3N2EA 2G81E 3OHMA 5B58C 4WXRA 1HRTH 4RD1A 1EPTB 1VR1H 1UDXA 2PX0A 3HKJB 3OY6U 1XZPA 4OHWA 1E9RA 4AKGA 4ABGA 3Q9LA 1JECA 4YDHB 4MYTA 1OKKA 3UTUH 3RMOH 2GVZC 1TIOA 1ZHPA 4GCHF 1GDNA 1Z0DA 2FG5A 4TLBA 1TMTH 3A8BA 1Z2CA 3CX8A 1HUTH 1PPBH 3ZZ3A 1TRMA 4LJAA 2GXAA 4NZYA 1Z6AA 4MQAA 3RXHA 1MKWH 1A61H 1NVVQ 3NBZC 1U8AA 4CRAA 4YMTA 4ISOA 2G3YA 1DADA 3EW9A 3B60A 4QJ5A 1CR4A 1ZCBA 2GV7A 1AZ8A 1LVMA 3OIVA 4DSTA 1XX9A 4LDJA 4WZ6A 2FSGA 4HLUC 1ZJDA 4AG2A 4ABBA 4IN2A 2BCGY 3C41J 4F93B 3P26A 4URYR 1B5GH 3RC3A 3HK6B 1H9IE 2F9NA 1OWHA 4ASHA 3T1VA 3B13B 4AD8A 1DT2A 4Q7KA 2GZDA 1I4LD 4QGAA 3QG1A 3QX5H 1RRFA 4PO8A 2D1JA 1ID5H 4YLGA 2F43A 1Z0IA 1JBKA 1KI3A 3RSOA 1GHBG 2FZLA 1VJAU 1K22H 1HQCA 2B0FA 4MGKR 4QJ4A 2FOHA 1TU3A 1GI2A 2BXTH 3LKWA 4X2XA 1TBRH 1KIGH 1M7GA 4Q7JB 3AM1A 1TX8A 1G6HA 4TMVA 3WNBA 4MITA 3MU0A 4DUGD 1KTVA 1OPHB 2QAAA 4IN1A 5LGOA 4TTQA 1SOZA 5LPEA 2THFB 1OYWA 2QIQA 1EZQA 3SU6A 1ZHRA 4AFZA 3VR5A 1N2CE 6GCHG 1I2DA 2OQUA 3GISB 3BH7A 1OP0A 2GJ8A 1P12E 4EJSB 2O9QA 2QBYA 1FI8A 2O8BA 2WAYA 3MTYA 2C03A 2ZRNA 3VFDA 2WPDA 1VECA 4P4UA 4BOHA 2BDGA 4KFSA 4ZCLA 4AYVB 3IG6B 3MGCA 4LOYH 1EPTA 1DO2A 3SS8A 2ZANA 1DY8A 1WQ1R 2OCBA 4YXWA 1O87A 5H1YA 2BBSA 1KSFX 2FH5B 2D06A 4B47A 1Y3WA 2AIQA 3F6UH 1XEWX 1CJMA 4EFLA 3B5JA 1V2UT 1HB0B 1HT1E 3ZYCA 2QROA 4JKIA 1EFUA 3VXEH 5JWHA 1UPTA 1XMNB 5FH9A 1RJXB 5L3SB 2ZI4A 3VFEA 1S0UA 1BRUP 1XXFA 2Z6BD 4ZKOU 4YMWA 4K81B 1TEVA 1FP7A 1Q3HA 5L6NH 4Y76A 3BTQE 3A8CA 2P65A 3SJOA 1HDTH 2QM8A 4B74A 2BD4A 4CR9A 4WVFA 4QM6A 3UMRA 3RWOA 2R9VA 4A6XA 1AN1E 1NKSA 3S9AA 1TMKA 2YJTD 2F9MA 3K0EA 2C4FH 1UTNA 1QZXA 1SVKA 4Q80A 2FEMA 4P4SB 3W3ZB 1E2QA 1TBQH 4LGMA 1CQQA 5FPKA 1OXVA 2IS1A 4CHAB 1QB6A 2XNDD 3OE7D 2OXCA 3DOEA 5FHTA 3CZQA 1GBHA 1F5KU 1AK2A 4DJZB 1YF4A 1CIPA 4EPVA 1P2JA 3ZZ9A 4BAOB 1W0KD 1UTPA 2H2ZA 1KO1A 3D8BA 1OXTA 3LX8A 2IJOB 1OV4A 1CA0C 1ZTKA 1F2SE 2BD7A 4JVSB 1QQUA 3QUMP 2ZU1A 2OQ5A 2IXFA 1CR2A 3AV0B 2ZDAH 2RA3A 2STAE 1FTSA 2WJJA 2IHBA 1TGNA 2R6CA 5CJPA 1RFNA 2KBEA 1P5ZB 1DDJA 2ZPSA 2SHKA 4RD4A 4BFTA 2O8MA 2ZTZA 2ZG0H 5A8XA 8GCHG 3FFBA 2HNTC 4B2BA 4QGFA 4H6TA 5H8WA 1U8YA 3QVUA 1RD3B 1XMJA 2R2AA 3RMLH 4BGDA 4OGYA 4AX9H 1C5UA 3MNBA 1KJYA 1CP2A 4XBCA 4ABHA 5FBEA 4IXMA 1Y3VA 3AK5A 1NROH 5LD2B 1XBTA 2VP2A 2FFAA 3RHFA 2EQBA 1O3JA 2Q3MA 1SKQA 2HXYA 1L1JA 3A82A 2BOHB 3RLWH 1IN7A 5L3SA 1SXJD 3TUJC 3AKYA 1SBWA 4OK6A 1AA9A 3UMSA 2QCYA 3MNXA 1SR5C 4X8LA 3DKVA 2SGAA 4ABJA 2FI5E 3QEJA 3Q72A 4B3FX 1VPLA 2QGRA 2ANWA 1HAVB 1ZINA 1QHIA 2HDNB 2GJKA 2IUUA 3MFJA 1W13U 1XKBC 5E7JA 2VH6A 2F3TA 4KITB 3ASZA 1W0YH 1E35B 5F2EA 3C14C 3CP7A 4PHGA 2BM1A 2P5SA 2ANKH 4P4SA 1DS6A 4S35A 4HZIA 5CLQA 4I8GA 2ZIQH 4MNVA 4BEJA 3LGYA 3WXMA 1TNLA 2R3UA 1ZAKA 2ZRLA 2BHGA 5GVSA 3RC8A 1O2ZA 4Z6AH 4AURA 4WXVA 2ZEJA 3I8SA 2CV3A 2A4RA 2A45B 1SGIB 2BDHA 2SGEE 3SFZA 1BMAA 2D3WA 4IEIA 3LH3A 2JLRA 5AR1A 1BIOA 1JXOA 3MRSA 3KEEA 1E94E 5JZVA 4D26A 3K0FA 1CVWH 3MOCA 2F1HA 1XEWY 1ACBE 4NP6A 2CE7A 4F7WA 3FOZA 3SDZA 3A1WA 3LRPA 1AUJA 3CWQA 4OBEA 1TNIA 1A0JA 2XSZD 1GI5A 4ACAA 1LHFH 1O30A 2FWRA 3GLIE 2VNTA 3OU0A 5CK5A 5FL7D 1E1QA 1JNYA 4I7YH 1KI7A 5BYJA 4WWYA 5A0FA 3N5CA 2AERH 3BWDD 2YYZA 1GMDF 2GJ9A 5FXLA 4HDCA 2A2XH 5JCZA 3TU7H 2ATVA 1RIWB 4MUAA 1EATA 3A1TA 3ZIAD 1ZGVA 2R6AA 3QWCH 1U94A 1OB2A 2ZR9A 1BITA 4ABDA 1H8HD 1P9UA 2YOFA 2CMKA 2ZR7A 2V3OH 1GL9B 2QPAA 4LJ5A 2B92A 1P2IA 4O25A 4KSCA 4MDEA 4M2LA 4JLPA 1S9HA 3TK9A 1QRXA 4A7IB 3E70C 1YKSA 5HM2A 2G00A 5TARA 3QTOH 1HCGA 1W0JD 4NYJQ 3ATLA 5ESBA 3UATA 1XVMA 3UFAA 1S9DA 3K2UA 3TJNA 1GI4A 1CT4E 1HAVA 4LPKA 2Z4SA 3SJCA 1EX7A 4DC9A 4O97A 4U00A 2BMGB 3BBPA 2EC9H 2ZHFH 1GVNB 1KDTA 2FDAA 4M22A 1YVDA 3LT3A 4F4CA 1SGDE 1G8FA 2A78A 4NYJR 2VIOA 1E2KA 3MH7A 3RLFA 1WAYB 5DP6A 1PPZA 1Z0AA 3R9IA 4DLVA 3VMFA 2BD9A 4XVQA 3TAHA 1TOMH 4HAZA 1BTPA 2RGNC 4OJQA 2V9PA 4QNMA 5DO9A 3GICB 3SGBE 1XTQA 1L2EA 1KY9A 1IHTH 2QXHA 1WBDA 5J4HA 3FVFB 1WF3A 1Z63A 3ESTA 4LJ7A 1E98A 5IDVA 4ZHMU 3V4FA 2WSMA 3ZZ6A 3K09A 5FPYA 4A6LA 3SU8A 3Q00A 4LJ4A 3N2IA 4DVGA 1Y3YA 1A3BH 2FJUA 1J9CH 1LFDB 4M9ZA 4DGJA 2OT3B 3RRYA 2HJVA 1N6RA 4V02A 2UUYA 1YZUA 4M9FA 3CBQA 4OM9A 3X1WA 2JKHA 5IRCD 1KYNA 3TW4A 3KGPA 5EE5B 4D6PA 3ND9A 3THWB 4OHXA 1SXJE 1W2HA 1L4YA 2A1DB 4E22A 1VIAA 1R5BA 1J99A 2VQSA 2NU0E 1DOJA 3UG6A 2AH4X 4MA4A 4MRRA 4A0GA 2ODQA 1V2ST 1N5LA 2NGRA 1CR0A 1M34E 2PX3A 3A1UA 4DB4A 5FR1A 3ZQJA 2PV9B 2IWHA 2EFHB 4OHYA 3LXXA 1XUFA 1SB1H 1NRJB 4DHEA 4BAQB 3ZVBA 2UVQA 1QIXB 5HR5A 4PO1A 1U9IA 5HTKA 1GNQA 2K5UA 1Z29A 2RAPA 1LNZA 2G83A 1ZGIA 3BH6A 3DM5A 3WP1B 3VQTA 3T61A 1SGEE 2QE7D 1P2VA 5KPJA 3SQWA 2PR3A 1G8PA 4HB2A 3NDPA 3KQKA 3Q3JB 1GBCA 2A5KA 1GJ7B 1SG8B 3LJJA 5BRRE 4RN6A 1P3JA 5L3QB 4HB0A 2BMFA 2YWFA 3QXHA 4D25A 3TK6A 3BFXA 2G52A 3B7GA 2GETA 1XX6A 1HNEE 2BDYA 4ZV4A 5FI0B 1G4UR 1UVUH 4LOAA 4JBWA 1W5SA 4INHA 3IPXA 5LPFA 4HDQB 3BIUH 3LY5A 2GCOB 1W0KA 1BRAA 3A8DA 1GJ5H 1H1BA 2H7VA 5JSZB 1ZLRA 2QA9E 4Q1CA 2GXUA 1P62B 4FUCA 1LHEH 1VCPA 2OILA 2GEDA 4BAMB 3SO3A 1QNJA 1FZQA 5CB8A 4LUCA 2YNBA 4DRZA 3TK1A 5EXLA 2WTUA 4AY2A 1U2RA 1G3RA 3PEUA 2CNWA 2F9UA 1BHXB 4HLDA 5HM9A 4WAUA 3OX7U 4HLQB 3MU8A 4JVNA 3FHTA 4ABFA 3DEFA 1E2NA 2HALA 1TBZH 3P27A 5SZIA 3P17H 1FP6A 1YC0A 2OUKA 4EIWA 4C30A 7KMEH 3BG8A 2GJSA 3VNUA 3DM9B 1WSSH 2O5VA 2A7CA 3RXBA 1U6QA 3THWA 3AF4A 1HEIA 3A1VA 1FQ3A 2W2VA 3DO6A 3FFGA 3NBXX 3H7OA 1RE0A 1CO7E 5G53C 5DG6A 1YRBA 1P2QA 1N8OC 1PQAA 1SGNE 3SZEA 2NG1A 3RS2A 4DT7B 1HJ8A 2PGBB 4FCTA 2VF7A 4RD2A 2F9OA 1J90A 1RRPA 4TT3A 1GG6C 3PUYA 3SUFA 4X2YA 2WPKS 1O5DH 1ZJ6A 3ETLA 2ASEA 3DKPA 1PPHE 4V0KA 1J14A 3KUCA 2Z3CA 2PTCE 2ODEA 4XDEA 4ZKSU 5CYOA 1Z5ZA 3EC1A 3WHLA 1C2LA 1G2MA 1Y5BT 3A1SA 4KFUA 2Z9IA 2IEZA 1YZGA 1XU4A 3T25A 4PSKA 3NEYA 1TPZA 2EWWA 5L3QA 4A2QA 1GVKB 2VJ1A 2WJHA 2NU3E 1D3QB 2NO7A 2CLCX 2FM2A 2OLKA 1B7XB 2G4UA 1NSTA 3M36A 5TXGA 1XFAA 1XTRA 5LPRA 4JLBA 3KUDA 4NYMQ 3M3SA 4BE7B 2EFEB 2ZFQH 1ESMA 1IY1A 4RSPA 1FQJA 2GCOA 2XBVA 2TGTA 4A8JC 2CEAA 5D3MB 3H86A 5L2ZH 2H5DA 1KJWA 4NCHA 3GJ4A 3B1ZA 1V3XA 3B9PA 2AGGX 1C5QA 4D4JA 5FTKA 3LU9B 1ZRBA 1TAGA 2KBFA 2ANYA 4CZ2A 3GY2A 5J4KA 1X8JA 1YBWA 4AYYB 3T5GA 1A3EH 1NRQH 2NTYC 1F5RA 2X2EA 4LYJA 3RXVA 2BVNA 3DVLA 1XUIA 1NJGA 3H4MA 1O2OA 4OS4A 2Y6TA 2FPKA 4EPWA 3WRYC 1MO6A 3AB3A 4BEBA 3O47A 4WZAE 3TPIZ 1XJ0A 1YKTA 2FGKA 2TRMA 1C1VH 1KI4A 3ONWA 2W83A 3DD2H 1ZW6A 4PQYA 3B2EA 3D62A 1NG1A 4MGZR 3IO3A 2R3YA 1UDWA 2D2FA 5FOTA 3TSWA 5TCCA 1G8YA 1MKXH 1RTLA 1ZPCA 2AL7A 1V2MT 3CPEA 4H1VA 3QXCA 1Z06A 2WOOA 4FXGH 4B2LA 1H8HA 2VHTA 1W3CA 2R0LA 3PFIA 4HYYA 1C5WB 2JLSA 3T15A 2JLVA 4UNPA 3SOSA 2V8OA 4ZROA 5J4YA 2XC0A 4KSBA 2J9NA 5TV2A 2JETB 3PLPA 1S83A 3KFXA 3VR2A 2VH0A 4D7FA 4US1R 1MUEB 5AUNB 1GBTA 1O34A 4DCVA 4RZXA 3BTME 3A7WA 4URUR 2ZVPX 2DCUA 1MRNA 3EZ7A 1PQ5A 4HZHA 3BEIB 2PSXA 2ZRDA 3GDSA 3PENA 3MHWU 2CVFA 4VGCC 5KSOA 2HGTH 3UNSA 1OLOA 3W6OA 1EXFA 2FSFA 2DFLA 1R6BX 3DZ8A 2IS6A 1VGCC 4THNH 1QFKH 1RYFA 2BTCE 1LVGA 3CF2A 3E8LA 3PMBB 2PLRA 3HU3A 2JASA 3OEHA 2GKSA 5FUVA 1UVOA 4AKHA 1WQSA 1MU8B 2W6JA 1D3TB 3JVUA 3K9XB 5L8VA 2BB4A 4AYTA 3MU1A 1G9XA 4Y71A 1GM5A 3TH3H 5D3MA 1ZNYA 4X1NU 2KJQA 1U8ZA 3ICEA 2XZLA 2XZOA 1GJ8B 4A9AA 4WMEA 2W6ID 2QORA 1IBRA 2ZJ8A 1OFHA 1KK3A 2YOGA 3FWYA 1DFPA 1M9UA 5F03A 5H68A 1G1MA 4RD3A 2ZIAA 4TYNA 3ZVDA 1BTXA 5FBRB 5E7MA 4BFUA 2ZE8A 1T3LA 1G4AE 4L15A 1EJAA 3M7UA 4IDHA 2F4LA 1T32A 1HIAB 1OB5A 3REGA 5DP7A 5C2ZA 3U3RA 4W9MC 1S81A 1JPNA 3P4XA 2RH5A 1W0ZU 3I62A 4BRUA 4AFQA 3SFVA 2H16A 1SLXB 3NXSA 4HZUB 1CJUC 2G9NA 1KAGA 2ZDLA 2ZRKA 3B8HA 1C5SA 5DP5A 1ZJKA 1E0KA 1QQ4A 4X2WA 1M1YE 1ORFA 2FTMA 2Q6FA 3I29A 3B1WA 3ELAH 5E4FA 3QKRB 1N5JA 2IYUA 3VKGA 1X8KA 2WWYA 4GOKA 2W26A 1N0WA 5BN3A 1O2PA 1UKVY 1AY6H 1IQIA 5J4QA 3BK7A 2QE7A 1GL7A 5JI3E 2Q6TA 1QCPA 4MKGA 1LVYA 2BXUH 1UKYA 1ARBA 5FBWB 4K3JA 1P8VC 1ELOA 1E1RD 1TF7A 3E91A 3MCAA 2AHOA 3ADDA 2H9TH 2Q0HA 2CXXA 1JXPA 1QRWA 1ELAA 4X0WU 4B44A 4M0LA 3W94A 4Q1AA 3ZVEA 1TQ4A 4JYTA 1IOZA 1WBBA 2VYFA 2ZNKH 2QTFA 4HDOB 5JYIA 3SOPA 3AVPA 2A0QB 2IYLD 5T3HA 4FVBA 1HA3A 2GXQA 3PM3A 5C1BA 1TPAE 2C8WB 1NN3A 1KLIH 1YQTA 1KO8A 3A87A 5IK2A 2NQ2C 3AVTA 1CRPA 1TX7A 4RI0A 1T5IA 2ZYTX 2HYIC 1AO5A 2ZO3H 3VGCB 1ZRKA 2IWRA 1KDQB 4ZIRB 3TGKE 1RKBA 4E09A 1EQ9A 2ZRHA 1A0LA 4KGAA 4X6PA 1CBWC 4BASA 2Y80A 1J8MF 1MAXA 1WE2A 1RW4A 2JATA 3ODDA 4FU7A 2G1KA 2ZRJA 1OWJA 2PT5A 4MYUA 1Y5AT 4BAKB 2W58A 3IGFA 3EX7C 3E0NB 3ND8A 5DHAA 4BLPA 3AAUA 3X2SA 1D9IA 2VGCB 2XZPA 1V2JT 5JBCS 1FMLA 3UANA 2OM2A 1GRRA 3KL6A 1U99A 4W5JA 2Q9CA 2ZWLH 2ZUBA 1QRZA 1NLZA 1Z83A 3SI4H 1P2NA 3OEEA 1LKBA 2VU8E 1HIAA 3K65B 5SZHB 3LH5A 3GFOA 2C9CA 5G4BA 3MH5A 5AF9H 2ZFPH 4B33A 1WQVH 4CH2B 2AFQB 3TK5A 2C5LA 4P0TA 1AZSC 4DDWA 4HZUA 1M2OB 1AE8H 4ISLA 4ESVA 1UHBB 3ODFA 2QP3A 2Q21A 3MNCA 3ZZ8A 4LBWA 3BORA 3QKRA 3P70B 3TVDA 5K8UA 3K70D 4NA7A 1QR3E 3KB1A 4NH0A 1TRYA 1YZKA 2RKOA 1CT0E 1TRNA 2QG6A 1L1NA 3HYRA 1KI6B 2WWIA 3LV8A 1K1PA 1Y3XA 3AF0A 4QGGA 4Q1BA 1W11U 2XXAB 5TJXA 4LY6A 4IDPA 2BV3A 1UVTH 4CT4B 4DDVA 2W2TA 5FX6A 4ERNA 3E3TA 1E79D 1TADA 2VPPA 1XTIA 4ZCIA 1P11E 2WSSD 5KHOC 1P61B 1Q1BA 2C90B 2GD4B 3HR8A 1JEDA 3IIJA 4ITRC 1AGPA 2I1VB 1U0LA 2PMDA 1GP2A 3ZZ5A 1LB1B 1O3HA 1N6HA 1F6BA 2ZU6A 1S2MA 4DLTA 4KFTA 1E2GA 2QV1A 4IDOA 5LB4A 4F92B 1W7AA 6CHAC 3BN9A 3E1SA 3F9EA 4INLA 3BFKA 4M8NE 1LHDH 1OSNA 4IMQA 4B34A 1KDQA 4ZIRA 2A32A 1N6PA 1HV8A 4V0NA 4B3DA 1UADA 3E0PB 1XMIA 2GZ9A 4CEJB 1O2RA 2O8EB 1ELFA 5EQRA 2O8DB 1A4WH 3M7QA 2AK2A 1COWA 1GTVA 1LO6A 2XBWA 3BERA 2C9YA 3GCHB 4IC6A 2XOKD 3KTAB 2BIFA 1TB6H 5FFMA 3Q3XA 5FPSA 4LCBA 1RPZA 5CK4A 1QGFA 2PH1A 4LYFA 1KZGB 2ODYB 1UBFA 4H6SB 4I8KA 5A09A 2FU5C 3TQCA 2WWHA 3FZDA 4PXAA 4C0AC 5DE3A 3PEWA 1LQDB 4U01A 4CRBA 1LHGH 1XCPA 1NESE 3MNSA 3B82A 1CU1A 3V00A 5J47A 4FMCB 3SGQE 3ZVGA 1MCTA 1EAXA 3SJZA 1W4CA 2BLQA 3SBEA 1V2WT 1S5SA 3MLEA 521PA 1Q1EA 1XVOA 5BYKA 1YR7A 2HRVA 1MQ5A 1UHBA 1BMNH 3CRQA 4TYDA 4ZHAA 2JDIA 1AD8H 1FZZA 1BIFA 1O35A 2FFHA 5CHAC 3RU4T 2P0EA 2RHMA 2V6JA 4SGAE 1F60A 1E2DA 3IPYA 4NWLA 1ETUA 2BBOA 1WRBA 2P8OB 1KI6A 5D3QA 1QL8A 2ZROA 4TZ6A 3MO9A 3GOVB 3T26A 5AJVB 2ZKSA 2XXAA 2Z3DA 2D7DA 2C3SA 1AVGH 1SGYE 1R8SA 3MMGA 3HU2A 1C1NA 1TNKA 1GRNA 4Q9LA 2ZPRA 2VLIA 2OFXA 2WYJA 4E7NA 2OUAA 1ETSH 2FOCA 5FR2A 2Q9AA 2XEXA 3LBIA 1SXJC 4GOJA 2XTMA 3FKSD 1BJVA 2B8WA 5F8XA 4YTAA 4DCTA 2NWNA 3FFAA 4LV6A 3U69H 3KQCA 4E06H 1MAYA 5EE9A 1XPUA 4D9QA 4L9WA 4Y7AA 4YQFA 2OCVB 2YOLA 1A1VA 3PUXA 2XC4A 1VTKA 5C18A 2ALVA 1ETTH 4A2WA 1V2OT 1OWEA 4V0OA 4US2R 3P92A 3PV0A 5FX5A 1C4Y2 5F8ZA 2OC8A 4CEJA 2ZQ1A 2O8EA 2FPLA 3RM2H 4NCIA 4DEXA 4G0NA 1MCVA 4Q9HA 2KWIA 1C1PA 3VR1A 1ZIOA 3AW0A 3VR3A 1QBNA 1I2MA 1G3MA 1FPCH 3TSOA 2P3FH 1KSJA 3RLYH 3IBYA 5FAHA 3MH4A 4JT2A 1T8LA 2IOTA 1JXMA 3V4RA 1W4AA 2GJAA 3DMDA 4NONA 1CS4C 1C1YA 4K46A 5DI3A 2V7QD 1BB0B 3I72A 1DE7H 4LBYA 2FSIA 1FAXA 2JLWA 4JK5A 1SMFE 1IY2A 1WXQA 4OQNA 1O3GA 3LC3A 2ORVA 4TLCA 3LO5A 5AFYH 4AOQA 2JJ2D 4MGYR 1IQEA 3AVUA 1UM8A 3AKCA 4UNSA 1OP2A 3ZD7A 3E90B 2PBRA 1GCDA 1Z2AA 4MRVA 3MG9A 3OFND 4I1SA 3C8UA 3BH0A 1FL9A 4ISHH 5SZKB 1W36D 3M4YA 1DWDH 3LW8A 3GCGA 3AVXA 3RRZA 3BTEE 2Q3HA 421PA 4YLQH 2GAOA 1D9ZA 4X6MA 4M1OA 3ZZCA 5FTJA 3MWIU 1QL9A 4Y6DA 3IQXA 1YLCA 2XTTB 4WA7A 1FY1A 4AB9A 1QA7A 1MTNC 1E9BA 1XDBA 5LDDC 1RRCA 4JLNA 2RDLA 1GRQA 1A5HA 1ZYOA 1AZTA 3BB1A 2SNVA 4K5ZA 1ZIPA 1DVAH 1TNDA 1OFTA 4B2IA 5F8TA 1PUIA 4BFWA 1E2PA 4D4LA 4FUEA 2GMTB 2R6GA 5DP8A 2VEDA 1XD2B 5C3NA 1VCNA 5A8YA 4LJ6A 1IJFA 1O39A 4A0FA 1HAPH 1OWDA 3OF5A 2ZDKA 1Z1JA 1BS1A 3UWKA 1E69A 2VP0A 4DVAU 2VVCA 3W6NA 1Z6GA 3PMAB 2EFCB 1LVOA 3BRWD 5CB6A 3IITA 2J34A 4IKEA 1G2LA 1KKLA 3SHCH 4KYUA 3TGJE 2H9HA 1QVRA 1GGDB 4M1WA 2ZRIA 4IFEA 1DPFA 4FMCF 3LONA 1KK1A 3GQBA 3T27A 2AD5A 4B32A 1H8IH 1JQLB 2H1UA 5DI9A 5E7IA 3I8XA 4P3YA 2FMJA 2Y8EA 4BZPA 1OH5A 3WBKA 3AP1A 1O36A 2F6RA 3OSYA 5JHHB 1Q3XA 2WICA 4R2HA 2BLVA 1C2DA 3GJ7A 3QOFA 2EW1A 2FF7A 2NIPA 3LQQA 1IXSB 2P95A 1M6NA 3LDAA 4U32A 4D7GA 2GRJA 1SVMA 2ZHEH 2W0MA 2FESH 3U3OA 4JJKA 2WPMS 3PV2A 3IKJA 1ZNWA 2ORWA 1GDDA 1A2BA 2ESTE 2J7PA 2BY7X 1JMOH 221PA 1XKAC 2VINA 1JIMA 4X8VH 1DX5M 1XMSA 3ATMA 2OXRA 1FDPA 2EWVA 5AUQA 1C5RA 1UVPA 5GPIB 3DT0H 1ABIH 1RJ9B 5C4GB 2IA5A 4DDUA 2V35A 5C1UA 1GITA 2O8TA 5BPEA 2ZETA 4YLUA 4ILEA 2IYXA 1U90A 5KUTA 3CUEF 4AIIA 2WPJS 2JIZD 3SE0A 3BF6H 1OXSC 1TA2A 4GP6A 2SGPE 1Z0KA 1W44A 4PC1A 2A3RA 1LV7A 3WHKA 1NNEA 3E1XB 1T4UH 3EIHA 1V43A 4Q7XA 5FCRA 1ZUNB 1XD2A 4OS1A 3D31A 5M04A 3GY8A 1T3HA 1GI3A 1TEXA 4Q66C 2DPXA 4ZDWA 4RFVA 2YWGA 2PFEA 3RXEA 1RFLA 2Q6GA 2VL7A 4U02A 3QY0A 5JEEA 2JAQA 2OAQ1 3NKKA 1NP6A 2WYGA 2QAJA 1CA8B 4QG7A 4GHTA 1P72A 5T6GA 4FMDB 1IN4A 1O2GH 2GBLC 2G88A 1T8OA 2XWAA 1GHYH 1AI8H 4JBXA 2A5FA 2J46A 1TWXB 4DLZA 2CGAA 1A5IA 4OGXA 4DCUA 3ZVNA 1HH4A 3BTTE 4HGCA 2IYZA 1QDEA 1NRNH 2P3TB 3F5FA 2P3UB 5ETXA 1SI5H 1EAUA 2A7HA 4XBDA 3THYB 5B6LA 2IUSA 4TTRA 3VHLB 1TQDA 1Z8FA 1O3DA 1X6VA 5KNCA 4ZO4A 2W3IA 2VIWA 1OKKD 1VITF 4LHZA 4XTRA 2JA1A 2AFIE 2D74A 2QAGC 3TAUA 1THSH 1NBMA 2HYDA 2C8VA 5FCKA 3CF0A 3WY9A 1OHHD 2WINI 1SQAA 1YM0A 3A7VA 1RVDA 5JMTA 3NHAA 3KJGA 3RXFA 2AMQA 4A0HA 3D65E 2PZGA 3FZZA 2OBOA 5F6MA 4M1TA 1OWIA 1M7BA 4L5BA 1OX1A 2HLDD 4PSVA 3BFVA 3B85A 2V0BA 1IQFA 2BHRA 2ZRPA 2NZ8A 4UFDH 4TQUS 2DFTA 3BSQA 3O8DA 1DOAA 1BTYA 4MTBA 5A0BA 1E9CA 1NY6A 3VNVA 3W95A 4X8MA 1Q20A 3RRNA 1AUTC 1H4WA 1GHAF 1N0UA 2PLFA 9ESTA 2D8WA 3LA6A 2ANBA 3PO1C 2XC5A 1BTZA 1X86B 4Q9KA 3EZ9A 1AM4D 1PQ8A 4PSAA 1Q2WA 2QF0A 4ISIH 3V9PA 2VHCA 2WJYA 3ADCA 4MYCA 2FODA 4U7DA 3FP6E 1WUNH 3GEEA 2QZ4A 2QMEA 3KQHA 4WXPA 4K1SA 4OJKA 3ZLJA 3VHXA 1SGFG 2STBE 1P7CA 2H1LA 4RKEA 1ANKA 2QAGB 2GEUA 2TBSA 4WH6A 1IN5A 3RS7A 4XWOA 1Q57A 3AASA 5KSYA 2ZREA 4LJ9A 2OFWA 4PX9A 4YT6H 4TN1A 1OFIA 2DE8A 3WYAA 4CDGA 2ILNA 1FUKA 4DT1A 2Z0MA 3EIEA 3ZZTA 4HAXA 1JR3D 1SVLA 4FXPA 3CF6R 3DUXH 3ZZ7A 1ZD9A 3URCA 4PPQA 2QGZA 4ARZB 3NC0C 3UOPA 3BB3A 3WNDA 2YWHA 4H42U 1L8QA 3BIVH 1LY1A 1O2WA 1BOFA 2IF0A 2WPDD 3F0TA 4LHVA 3MSXA 1HTWA 1IAUA 2JJ2A 2ZE6A 4PC2A 5TVKA 1MU6B 2ZEBA 1EAIA 2ANCA 3MWYW 3A7XA 2P6UA 4BPBA 1TTTA 2VTKA 3OFNA 3THYA 4BFVA 4YXWD 1SULA 1UF9A 4BANB 1O0DH 4HI0E 1MD7A 4KO8A 3PV4A 4R7ZA 3IUYA 2QYIA 2OXSA 7GCHF 4DIIH 4JL8A 1O3IA 2ERXA 4Z0KA 1OPXA 1II9A 4YO9A 4HB4A 4XVRA 2YINC 2CHQA 3RDZA 2UUKB 5EXMA 1AB9C 1O5BB 2FYQA 4DZZA 3QPUA 2PLXA 1KO4A 4HTCH 3AVYA 3EA7A 2ZRCA 1VG0B 4ASUA 3M35A 1T31A 2FS8A 5KDDA 1DAMA 4DBLC 4KYIB 3EPKA 2WWGA 2OBMA 2IXGA 1SGTA 1D6JA 5DP9A 1NY5A 4POAA 2XCNA 3K0CC 1L2TA 3LH1A 4Y8YA 3PLBA 4RKOB 1ZU4A 1NF3A 1GCTC 4KODA 3LPRA 4H4FA 5GDSH 5F9FA 4PZYA 2EA3A 2VBCA 5K7RA 1IOEA 5DO4H 2GILA 4M1MA 4X1QU 3EWAA 4DY7B 1GUAA 4OI1A 1G291 4FD2A 2BVXH 5JLJA 1SHHB 3SYLA 4B48A 2CCGA 3LAWA 4NSYA 3OIUA 2TGAA 1GBJA 1GI0A 5HCIA 3T1TA 4PROA 4Q5IA 4YC7A 1GAJA 3EZ2A 4GVUA 1AKSB 5JEDA 3BG4B 1G19A 1YPKH 1KY3A 3DHKH 1S4QA 1Z3IX 1JRTA 4ARZA 3SJIA 3FYHA 3A8TA 1MO4A 1NFYA 1E0SA 2BQWB 1HAXB 3SJ8A 4R98A 1C5NH 1FNIA 4ZKNU 2RCEA 2D7CA 3X1DA 2A7JA 4ZAEA 5JB8S 3A4MA 2NO0A 3CWZA 5G3ZA 5CM9C 1KSHA 4RKFA 5C1YA 1WTHD 2R0KA 3UOUA 4K1TA 3BOSA 4RD6A 3HK3B 2FI3E 1WP9A 2CLDX 4L4UA 1AFQC 2ZR0A 1J16A 4AFSA 2A7QA 1EOLA 5J5CA 2OFOA 2ZGHA 3U8TH 2XTNA 3CS0A 4Q2KA 2ZUDA 3GPLA 3GJ6A 4N0EA 1K5DA 5EP4A 3OTPA 5T6DA 3QO6A 1C9KA 3QBTA 1VG1A 2CLSA 2L0XA 2WJIA 2RGCA 3SHWA 3LLMA 1QURH 3Q8XB 1XPRA 1GVLA 1GI8B 3DZDA 4IS5A 4GNKA 3QXXA 2ZM5A 4LZ4B 3LXRA 1P6XA 1C1UH 2PT7A 1KOFA 4JSYA 5K8TA 2Z43A 2JLYA 2ZDVH 1XNJA 1O3PB 2GVDC 3PCRB 1KYIA 1A82A 3L8YA 1FUUA 2JH0D 1EKBB 3BTFE 4CRDA 3P8OA 3LGWA 1OH6A 4CREA 3HGNA 1Z08A 1K28D 1OWKA 1UK2A 3TUZC 3NPSA 2BD8A 2YZ2A 2AK3A 4FUDA 1O2QA 4BTTB 4DIDA 1MABB 1UBEA 4UFFH 1HURA 5GCHG 4WVPE 1PQ7A 4QHTA 1LTOA 3TH2H 4LJYA 1YZQA 4E05H 3FPAA 1JR3E 3A4LA 4R8TB 4OHZA 3SUEA 2QP4A 5JWOA 1NG9A 5JJKA 2AMDA 3RS4A 1GPZA 4MUBA 1PLKA 2FX3A 3RC4A 2KAIB 1II8B 1EFTA 4PQRA 5PTPA 1IQKA 2J0SA 3IHLA 4FUJA 1N5KA 2PKSC 1P04A 4JJZA 3GCTF 2GCHG 1AVXA 5A5GA 3NG1A 4JK6A 2G51A 5E3HA 3MH6A 4KHZA 1HJ9A 1ZUIA 2D26C 1IXRC 1GNRA 1C1TA 1I4TD
chains in the Genus database with same CATH superfamily
1MC4A 5F5XA 1VLQA 2DHCA 3LKBA 4GXQA 2V9CA 4DBVO 2H0AA 3PUZA 1D6RA 1HG1A 4GI7A 2ZB4A 5CPFA 3ND5A 2JLBA 4DV2B 1I4DD 3MRVA 1ODLA 4BFYA 5KVQA 4AI6A 3AHDA 5G1OA 3MMNA 2J6IA 3C5WP 1L8AA 4GW3A 4H1HA 2QMUA 3PQEA 4KX3A 4N49A 2XUOA 4TY7A 2VZEA 1RWVA 2HLDA 2VO1A 3ZYEA 4L5IA 2Q0SA 1WCIA 1Q95A 3GJSA 4JD5A 3FMPB 1CHDA 1D6NA 3W6PA 3ZY3A 4KXNA 2PCJA 2O23A 3TNJA 4A0RA 1YCPK 3VTKA 3S9CA 4MKHA 3UKJA 1CG6A 2WAOA 2KCAA 4ATNA 1K6MA 1UMAH 3PHBE 1VHTA 3G2NA 2RHTA 4DV1B 1C1SA 3D7MA 1GZSA 1I3OA 3B6KA 4KNWA 3FYUA 4IINA 1Y8QA 5KGOA 5DK6A 1DIGA 2OGSA 4NZLA 2R2MB 3GUYA 1BCRA 4L07A 1EAYA 4JL6A 4ED9A 1AN9A 1NKVA 3RANA 1P4SA 3RHTA 1EBFA 1N9GA 4WLVA 4F6RB 4KP7A 3F68H 1X1DA 1W9MA 3L1JA 5IULC 3ZW8A 1BFUA 2AEMA 1CUXA 4X63A 2RGAA 1K2I1 2ZU2A 4KDEA 1JR3A 4QUDA 3BRCA 1NX6A 3OZBA 4KXWA 2CB9A 2RAUA 5DHRA 3L4EA 4YCAA 4GBJA 3PC6A 1P5FA 4E0BA 1KWGA 2BOVA 4OQXA 5FOXA 1KXEA 2Y3IA 5CFOA 5AW2A 1YCPM 2ZU3A 4TN5A 1SEVA 1UWLA 3ZWBA 3BT7A 4NDZA 3BEFB 1DSTA 4BAGA 2I7CA 2DKNA 3GDOA 4L95C 2EV9A 1JEAA 5FUQA 2X0DA 4O1MA 3I73A 2G4TA 1ZH6A 4P7GA 3DVAA 1Z5PA 1TCCA 2H5IA 4JBLA 3O75A 1A8SA 3UUEA 1NC6A 5JNTA 3F1SB 3AWIA 3GYBA 4CXMA 4DDMA 1ENYA 4HYQA 1FX0B 3RXOA 3A4IA 1GA6A 3HR4A 4W5QA 1AKUA 2ZYSA 1GJ9B 3ZJYA 4NU5A 2FOAA 3RYFB 4AMUA 1RLJA 4E51A 4GXRA 3CTMA 1XU9A 4V0MA 2BLOA 1QR6A 5B57C 1E1CB 6ABPA 3X1XA 4M7WA 4AZ0B 3WISA 1O2VA 4ITVA 4C0HA 1ZD5A 2XBYA 4Z4EA 4N4AA 4WOPA 4H3HB 1YL5A 2FS9A 4A1VA 2A0WA 1P9WA 4ZYWA 1JB1A 1P57B 1A8QA 1YR2A 3RK0A 4M1YA 4JYZA 1ZMTA 1C2FA 5DTEA 4TPKA 5B6OA 2R1UA 2FN3A 2QPTA 5DTJA 4PCAA 2ZB8A 4FGJA 3MD0A 4QT4A 2K2WA 3I3OA 1E4YA 5HJ7A 3KKNA 3MWJA 5IZCA 1DT3A 2E4AA 3KVYA 4KIWA 2AXQA 2D2DA 1EHIA 2QYHA 2JI4A 1DWBH 4JU8A 5JQGF 1DE0A 1NBOA 1E5DA 2Q4EA 5CVJA 3ZWQA 3GNTA 4R6WA 4R3NA 3ODGA 1TLFA 1O95A 3TZBA 2ZSDA 2VQFB 2WFMA 1TM5E 4EJSA 2WKPA 1DRVA 1H8DH 1MH1A 1DV2A 1BVYF 4AMBA 3T54A 1F0KA 1LSUA 3EK2A 4NULA 1DY9A 2YMSC 2AEEA 3LJOA 2FF5A 4L3OA 4IQ4A 1KMCA 2P75A 1CZKA 4WECA 2NO6A 3UWJH 1SELA 1O2IA 4G1UC 4OY3A 2OORC 4YLYA 1MFZA 2QNRA 5B2ZA 2I4LA 3NVAA 2ZWVA 4ZI3A 4DWOA 4I1UA 4YMVA 4DCPA 4X6YA 2YN2A 4NS1A 2Z94A 4X3OA 1CTQA 2G0NA 2EKDA 2FW1A 2DFNA 3AUYA 3GY0A 1E3IA 1QH1A 2NU7B 4TPIZ 4TMZA 1U3WA 5JR3A 2CK3D 3W8NA 3FTPA 3TVYA 3PFBA 1VXRA 3VXKA