4A92A

Full-length hcv ns3-4a protease-helicase in complex with a macrocyclic protease inhibitor.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
639
structure length
639
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Macrocyclic Hcv Ns3/4A Protease Inhibitor Interacts with Protease and Helicase Residues in the Complex with its Full- Length Target.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
total genus 200
structure length 639
sequence length 639
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4a92A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a92A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4a92A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a92A03
1RJ9A 3QKUA 2ZDNA 3DM5A 3QN7A 2GP9B 2O8DA 4JLAA 4BLRA 2WPMS 1EB2A 2PEYA 1ZMJA 2MSDB 2O8BB 2ZUDA 2ZHEH 4PZLA 2P0EA 3A7VA 4ABGA 3GY3A 1XMIA 4C7OA 3VGCC 5IF9A 4JYUH 1K1PA 2PCJA 421PA 5H8WA 1ETUA 4QRHA 1AFQB 3FZDA 2OXCA 1ACBE 2ZETA 4X8UH 3O8BA 1V2KT 5TY0A 3SGQE 3MO6A 3H09A 2QTHA 4NCIA 4XIGS 4JVSB 4Q9JA 4LRWA 2ASEA 2F91A 5EXSA 2ZDKA 1IAQA 1NL3A 3VNVA 1GBKA 3U8RH 1QHHB 3MFYA 2FFAA 3IHWA 4YDHB 1YZUA 2FNAA 2OCPA 1GI3A 1DM4B 2ZO3H 1GNRA 1WU1A 2BDCA 2W00A 4PO9A 2QRZA 2PX3A 1RFNA 3DHKH 4WJG2 5E2OA 3DZ8A 4QM6A 1EAUA 5FL7A 3P95A 3TSWA 5BN4A 1WYKA 3AVZA 1KI9A 4LYAA 2C93B 1MO5A 1V43A 2ANKH 1V2OT 4CRWB 2HYIC 3IDQA 1MRNA 2P8OC 4Y8XA 1CHOG 1M7HA 2PKAB 3LFUA 5JRJA 3MJHA 3CBQA 1II8B 4AORA 3SN6A 4DG4A 4CBOA 2BKEA 5H4IB 1Y59T 2JLRA 3KZ1E 1R7RA 1TX6A 1Y3YA 5C5OA 2ZGCA 1FMGA 1WBDA 3M7QA 3L6PA 4CRFA 5A0AE 3GCTG 2ZIQH 2A1DB 1EP5A 3ATWA 3CS7A 3ICQB 4MPXA 1AN1E 2C3SA 5B57C 1VECA 4YM9A 1BJVA 1II9A 2WM9B 3BTHE 5H68A 3WYAA 1NRJB 1VG1A 4ZI3A 1XUIA 1T3SA 3JZAA 5HCIA 3TUZC 4DSOA 2PKAA 1X8LA 1DBSA 4ISHH 4HZUA 4M21A 1XZQA 4C0QC 3GFPA 4MRRA 1DWCH 4WH8A 2X2FA 1TU4A 1NVUQ 1PQ7A 1O2GH 1IOZA 2NU3E 3K9LA 2ZE7A 4FN5A 1XU4A 3QNUA 3ENSB 1PLLA 3MMGA 1V2NT 1JOUB 3P17H 1QHHA 8LPRA 4HB2A 5EQSA 4PROA 3RAPR 1NN5A 3F6UH 2SGEE 4KSCA 4M9FA 1P9UA 4MUBA 3TJNA 2P2LA 1UKYA 2ERXA 3P92A 1T7CA 4JJZA 1IHTH 5L3QB 3VX3A 2P5SA 1GJ4H 2AD1A 3SNCA 1N5LA 1C5ZB 2AXNA 4IBLH 4DOQA 1N1LA 1BBRK 3QKRA 3F3YA 4JYBA 4GL2A 1XB2A 3T25A 2F4LA 4O25A 5HM2A 1KMHB 4TYNA 2WIAA 2J0SA 1KY2A 5BYJA 1NFXA 2VLIA 3L2OB 1TUEA 3QXCA 5TV2A 3ATIA 2XNDD 3P26A 3THWA 3NBXX 3IITA 4Q1BA 2O8BA 1YLCA 5FFMA 2QPAA 2RGNC 1C2MA 2J9RA 2OFWA 1E0FD 4MYTA 4P33A 3GOVB 3KKNA 2QAAA 1J8MF 5DH9A 3T5FH 1W3CA 2ZRPA 3UWOA 2OUAA 1ZLRA 4C3ZA 1GI1A 3P4YA 4RCZA 5G3ZA 2X2EA 4NSYA 4Q4HA 2LPRA 2XC5A 2WJIA 4B2LA 2H92A 1JAHA 4PC7A 4NGAH 3C27B 3PEWA 1LB1B 4JBYA 2JDID 1SPJA 4UFEH 2AMQA 4X1NU 1O5CB 1GUAA 2VO1A 2Q6DA 3U1IB 4EIWA 4DB4A 1ELCA 1UVOA 1YM0A 1FI8A 2VF7A 2IT1A 1ZD1A 1BTYA 2XCNA 1NMXA 4TSFA 3BIFA 2HVXA 4ITRC 7GCHG 1E37B 4LJ7A 3RVBA 3UNSA 1P04A 3AF1A 3W3AA 2GVFA 3RU4T 1KNQA 5I25A 1H8HA 5CIQA 2D06A 5AUNB 2F9BH 5FOUA 1OXVA 2F83A 2RGEA 2RGCA 2B8WA 1VCIA 1E9BA 1F2UA 1LHEH 3DOFA 4D4LA 1Y3VA 5KOYA 1YBWA 4C30A 1FZZA 3T35A 1Q3XA 1EKBB 1LKBA 3ZYDA 3X1XA 3QPVA 2JH6D 3GPLA 4MH0R 3OZXA 2YYZA 1M8PA 2PLFA 2FMJA 821PA 1DPOA 4DDWA 4CHAC 3UMSA 3DMDA 1K28D 1G3IA 1YPGH 4D26A 1Z8FA 3PEUA 2WV5A 4DC9A 1ZUNB 4YOJA 4A0HA 3TH4H 4KV9A 2YINC 3SJCA 1DG3A 2ERYA 2ZQ5A 2JCSA 5G3YA 5IT5A 3ZZ6A 4BXSA 1J15A 4Y0AA 1JAIA 3RRYA 1A4RA 3A89A 2FN4A 4CR9A 1SVWA 1P2IA 4MGZR 3W6OA 7LPRA 5EXTA 4OYHA 4LGMA 3ADDA 2ZUCA 4INLA 4DT7B 4O3TA 3AKEA 4A0GA 1TGBA 4ZKSU 2ZI3A 1NSFA 1K8RA 5CDFE 2JASA 2GEUA 4M1MA 1GILA 2J3EA 5L2ZH 4WVPE 1YR8A 2D74A 2FEMA 2Q6GA 4HUQB 4HLCA 2BX3A 2ZXUA 1EZQA 3U3KA 5FBIA 2A5JA 2WAYA 4EPVA 5HMAA 4Z0KA 3CM0A 1RYFA 1O3YA 2BDTA 2REXB 1L4DA 2XNIA 4IMZA 1NN0A 4HDOB 2ZREA 3P8NA 2GF0A 2KJQA 1KTTB 1N8OB 3A6PC 2QROA 3SHWA 2FYRA 3OIUA 2FI5E 1G21E 1A2KC 3HU2A 3G01A 1H9LB 3WXMA 4A5TS 1J70A 1W0JA 2WHXA 2HALA 4JLKA 4XTCS 1QBVH 1KHTA 4R9UC 3FP8E 3X1WA 1SL3A 4Q7XA 2PTCE 5JECA 2VP6A 2ZRCA 4I8LA 1SXJD 2YNMA 2GJ9A 1NFYA 2UUYA 4TPIZ 1DADA 1KXBA 3A7TA 1GBTA 2NO7A 2UUJB 3BTQE 4EPRA 1VYVA 3KL6A 3KCGH 2BLVA 5KNBA 3GDVA 1W7GH 1QRWA 1BOFA 4D81A 2BCJQ 4Q7ZA 1HDTH 5FOTA 2WKQA 1BBRH 1JJ7A 3U8TH 4KTCA 221PA 2V9PA 2C8VA 2ZITA 1UK2A 2ZHWH 2VYFA 2OUKA 2GTPA 4E06H 1ZW6A 3W8NA 3KQLA 1V2MT 3SUGA 2J0VA 5J5CA 3KJIA 4D2IA 1W36D 1D4PB 1MTVA 4WWYA 3PLPA 1GTVA 5JJKA 1W4BA 2ZR0A 2RCEA 4QBGB 4BFSA 4FWTA 1J9CH 2F43B 4HLUC 1PPEE 1CE5A 1ARCA 2GRJA 1Q21A 3BB4A 3CRQA 3GJXC 1JIMA 3SHCH 3RXKA 4AKGA 4LJ6A 1DAMA 1E96A 3JVUA 5FOWA 4G1UC 2Y5GA 4ZKDA 4MG3A 5IK2D 1VCPA 1MKYA 721PA 5LPEA 1X6VA 4IOKA 2JLYA 2JLZA 2CGAA 1MU6B 2J7PD 2F7SA 4HATA 3ZZ7A 2PL3A 3U6BA 2ZU3A 1UHBB 1G2LA 5EP3A 4B1TA 2HT6A 4HAZA 4DLSA 3H86A 2XAUA 3EARA 1A4WH 1XJ0A 3VXFH 1TNHA 3IKJA 5CE1A 1K1IA 3T26A 2B92A 5K8TA 3RS0A 4DCSA 5GPIB 3IBGA 3AVUA 5M04A 1CBUA 1N5IA 2H7VA 1V2ST 1KOFA 3KQCA 1RRFA 2GZ8A 3L0PA 2O8MA 1T3HA 5FX6A 3GQBA 3QVVA 4WA7A 2FWRA 4Y71A 3P8GA 1O31A 1TMUH 3K1JA 5TARA 1XTSA 3UKDA 3SN8A 5KDOA 1GBLA 5JFGA 4ERNA 1HLTH 4XSHA 3AVVA 1R5OA 3FDIA 4N3NA 1NMZA 1HYLA 3CUEF 1UCYH 1GBFA 2BTCE 4DGJA 3NWUA 3EA7A 3MMPA 1C5RA 2V7QA 1G8YA 2WPKS 3VQTA 1THRH 3RRMA 1UEJA 1N8OC 1FNNA 1G7RA 3R0FA 3BTFE 4AD8A 1FJSA 4G3XA 4OBEA 4WVFA 4Q21A 1SZPA 2OG2A 1DVRA 1O3MA 1AFQC 5EPNA 3QZRA 2W6JD 1YPJH 2ZI2H 4KFUA 1LVBA 3OEHA 1B0EA 2A78A 3DMNA 3BEIB 4D4KA 3H1TA 1ARBA 5GJVC 2G1KA 3BERA 2Y80A 1NJFA 1ZSJA 4Q4JA 3W95A 1DAKA 2CL7X 1WQVH 1OX1A 1F2TB 3RHFA 2ZCLP 5B30A 3BJIC 3UANA 3CR8A 1ELFA 5C4GB 2HCBA 2Y5FA 4LDJA 3TR0A 2PV9B 2G52A 4GOXA 2V0BA 1T6NA 2DBYA 2FMXA 3VKWA 4W5HA 4RZXA 3U3JA 1ESMA 1BCUH 3FHTA 2P3TB 4GDFA 1F7ZA 3SJ8A 4X1SU 2IEYA 2ZFPH 4ABEA 4NHOA 1O38A 1ETRH 2G6BA 5A09A 4BLTA 4O3UA 3ZZUA 1YPHE 4YQFA 2CLDX 2FFBA 1NRQH 1E36B 1HIAA 1TRNA 3MWIU 4LC1A 5EE0A 1GCDA 2JLSA 3HPTB 1GI9B 1W44A 3BTKE 2IYXA 4FUCA 1CT0E 2GV7A 2ZE5A 4DLWA 3Q00A 4E03A 1EFUA 1I4TD 1EATA 5FUVA 2A7HA 2ONJA 2ZSEA 4XE4A 2PKSC 5FOSA 1BITA 1KLTA 3K9NA 1HGTH 1KXEA 2ZUBA 2X19A 1JBUH 3CF2A 1G6OA 1SQOA 2J2UA 4YT7H 1RIFA 4OGYA 4H6SB 3BTGE 2N1BA 1GCTB 4GI7A 4WMFA 4IN2A 2CEAA 2ONKA 3LNCA 3PUZA 1Q1ZA 3A84A 1SVOA 2KAIA 1SVLA 4JLDA 3RXPA 5JYIA 4M4SA 1FY4A 2YOHA 2PFEA 4AYVB 1IN6A 3Q9LA 1ELEE 4URXR 4M9QA 4AG6A 2B5TB 4QKQA 1IN7A 1GDQA 1FPMA 1OF1A 3AVXA 1VJAU 1N25A 4NKRA 5F6MA 1GBIA 4K2YA 3N70A 1KXFA 1E38B 2HT1A 2A2XH 3D49H 2Z3CA 1EWRA 3LH1A 3CONA 2O8FB 1EESA 2HXSA 2WYJA 1Z1IA 3FHCB 3CH4B 5LD2C 3K2UA 5KUTA 2ZIAA 1ANEA 4OI1A 3D65E 2R6CA 3SNHA 3D31A 2MMCA 4CZ2A 1OWEA 4CIDA 1EXMA 1NMYA 1HYQA 3S7HB 1TALA 1Z0AA 1KIGH 1ZMNA 2QORA 4UJ3A 3U4QB 3NK8A 1OPHB 4BANB 1A2BA 2XGJA 2EEKA 2ZFFH 4WXPA 3GLFE 1NVVQ 1FY8E 3FOZA 1Z6EA 3BAFA 5KHOC 3QI2A 1KXAA 4JL5A 1BBRE 2ZR9A 1S6HA 1X8KA 5HM9A 4Q1AA 4WH6A 4ABDA 1ZHMA 5J4KA 1FTSA 2IS4A 2DB3A 2VHQA 3BFKA 1NRNH 3PUXA 1Z6YA 4IW3B 1CF4A 4KVAA 1BYUA 5C1XA 2VTKA 2C8WB 1C5NH 1Y8TA 1G8FA 4AGKA 4DCTA 1QCPA 5EODA 3W3ZB 3A8CA 5C67A 1VCOA 3TJOA 1PLKA 2OCVB 1GG6C 1BMLA 1TF2A 1U6QA 2C78A 4C0KA 2PT7A 3VU9A 1T8UA 1CKEA 2G83A 1P05A 4A6PA 3U9AH 2Z3EA 4AK9A 1O2YA 3RXGA 2ZSBA 3RS3A 1GMDF 2A5FA 3IPYA 1XPOA 2FJUA 2FZ4A 4E5UA 5ESTE 3GY6A 2C98A 5GCHF 2FI4E 1D3TB 1QRAA 4NP6A 1AU8A 4CEIA 4I8JA 3A1UA 1OKXA 2HLDA 4C2TA 4S35A 4IC6A 1N6RA 1JPJA 4OK6A 4B43A 5HXFA 2GCNA 3GCOA 2VVCA 2B6HA 3IUYA 1MTSA 2ZCKP 4E22A 4ZDWA 2YKGA 1VYUA 4HLUA 3UWJH 4K81B 1XD2A 2IXGA 3ZYCA 1P4SA 3FFGA 2EYQA 2RKOA 3TSZA 2VH5R 4D7GA 3E0PB 2AKAB 5ELXA 5HZHA 2C77A 2XTTB 3KUCA 1GBDA 3A7YA 1VKJA 1UDXA 2J38A 5G41A 1GITA 4R8TB 4NCKA 2RGAA 2V1UA 3E3TA 1Z22A 3T1QA 1NNEA 1THSH 5I46H 621PA 2GDEH 4Q2KA 2CCJA 4B2AA 1TNDA 1AZZA 1C1VH 1TOCB 1KO4A 1SHKA 2V3CC 2ODYB 1JWTA 4HI3A 3LH3A 4EPTA 2O8EB 1E2DA 1RZ3A 1Z6XA 1TEXA 1RW4A 2O0JA 4Q1FA 1LPZB 4UXHA 1L4YA 4LBVA 1BUIA 4WAUA 4P32A 2CHGA 1SI5H 2QN6A 3BTME 1PVOA 2GEVA 1X3SA 1GL0E 1ZYOA 5LGOA 4YOIA 4PC1A 1AZTA 3LX5A 3SQHE 2IYZA 3U7GA 4GZLA 3ND8A 1CR0A 1G291 3A36A 4AC9A 2W2TA 1TONA 3SJAA 3PMBB 1M1YE 1GGDC 2HLCA 2FOFA 3LWNA 2R65A 2WKRA 2IS1A 3RXUA 1RVDA 1R8SA 1LPKB 2D7DA 1U9IA 5BRRE 2BDBA 4K69A 1GCTC 1CHGA 4DIHH 4TWZA 2Y81A 1M6NA 2IJD1 3RXMA 4MPWA 1W7XH 3T5DA 3H5CB 1AHTH 3ZGXA 3LXRA 1ZR0A 1MR3F 3P6ZB 1AKSB 1F2SE 1TA6A 1XX6A 3PV5A 1BTZA 5GJWC 1ELOA 1OH7A 4JZFH 5EOKA 2CHVA 1V2WT 1S6FA 1OSNA 1H1BA 1XTQA 2DR3A 2VHCA 3B23B 4BLQA 3AVQA 1E2GA 3A86A 4LJYA 3ZD6A 3RXQA 2VIOA 1HE8B 2IUTA 2DFNA 2OBQA 1QHRB 4NIVA 1G5TA 2GKVE 1SLVB 3OTPA 3M1IA 1IJEA 4PHFA 5FHTA 4IOJA 4Y0VA 2LKDA 1GFIA 5EP4A 1ONBA 2ZDMA 4OKSA 3ITIA 2CLSA 3KFVA 2ANCA 2BQWB 4JL6A 3LONA 2BVSH 3N7OA 1SGCA 3UFAA 2W6ID 2Y7XA 1F5KU 5EXXA 3DOEA 5DN6D 5L3SA 3S69A 1A5TA 1KY3A 5HE8A 2IHBA 3PXGA 2GZ7A 3SNEA 2R2AA 4FMDF 3GCHB 3MGCA 2CVHA 2YOFA 121PA 3I72A 4US0R 3QF4B 2GCTC 3A87A 2AMDA 1UPTA 3U3MA 2XNDA 5CHAB 4DVGA 5LB2A 2XJ4A 4QGHA 4A6LA 4B6FA 1P12E 3QIAA 2FZLA 2XXLA 4OI2A 3QVUA 4AURA 2PCLA 4A7IB 3AUYA 2WJGA 4B33A 4OS7A 4GBMA 1KI2A 4GNKA 1VR1H 3RUOA 1N0WA 1QA0A 2BY8X 1DPFA 5ETXA 2QG6A 3LX8A 1OXTA 4DT1A 2JEOA 2JLQA 3EZ9A 1SVSA 4C9BA 1N5KA 2FLBH 2A4RA 1ZRKA 4BFWA 4W9MC 1NZQH 2ZRNA 3AV0B 1SC8U 2GGVB 3P20A 4LBWA 2P59A 1DLKB 4DJZB 1AGPA 1DAIA 1D3DB 1NFUA 1AN0A 4XD7D 2AR7A 2FH5B 4DWJA 1R10A 3RXCA 3T1TA 1BIFA 4E05H 1TU3A 3AVYA 1WRBA 4V02A 2V8OA 2DWQA 2GJSA 3M35A 3SZRA 4ABBA 3LW7A 3ZV8A 4RD3A 2FOAA 4EAQA 1B23P 3ZZ3A 4NL4H 1O2TA 4HI0E 1MABA 1YCPH 4TLBA 4DDUA 1Q3HA 1NY5A 2GZDA 3AGQA 3U69H 1ELAA 4LCBA 3TNTA 2EI6A 3ATKA 4DSNA 4AFZA 4V0ME 1GJ6A 1T0JB 2BDYA 2PSXA 2ZEBA 1US8B 4A8JA 1S5SA 3GLIA 1GIAA 2IWHA 4INKA 1DWDH 3B2EA 2GVDC 3RSOA 4NH0A 5EZ5A 3HYTA 2OXSA 2VH6A 1AVXA 1ZMLA 3TNFA 2O8CA 5GVSA 5KPJA 1ABIH 3ZZAA 2GJ8A 2BY7X 1YJ5A 4NFFA 2YV5A 4OM9A 1XUGA 2LCFA 4GHTA 4BECA 2VB0A 2FA9A 4MYHA 5BWMA 5DNYB 4JIMA 5A4JA 1E2JA 3CP7A 1S9DA 3NEYA 6ESTA 3ZVRA 8OHMA 1X86B 3CZPA 3H84A 1LHFH 4M9XA 1G32B 3TQCA 2BB4A 1ZC4A 5BN3A 4NIXA 1C9PA 1TPAE 1W2GA 3TGKE 2OD3B 1M2OB 4AN7A 2GCHG 2ZANA 4OQXA 3RXBA 3LOXA 1SGEE 3TK5A 3M3TA 4EJSC 4ISLA 4BE7B 4OQNA 4WMEA 1BH2A 3SZEA 1P75A 4UONA 2OCAA 2QA9E 4X6MA 1XEXB 5C46F 1P3CA 3QGJA 4Q19A 4ARZA 1K6MA 1BRUP 4TWYA 2JJ8A 5FBLB 2BOKA 2GMTB 1CR2A 2OC0A 1ZM7A 4QNMA 1ELBA 4NCJA 1E0AA 1NT1A 3TSOA 3EZ6A 1EZUC 2BMDA 4KYIB 1MBMA 1JPNA 2VSFA 2WWFA 1F0UA 4F92B 3BK7A 4POAA 1GI8B 3PB1E 1O3NA 2CE2X 1EX7A 5E7MA 1W0KD 3OF5A 4A0FA 3OHMA 2AHOA 1TBRH 1NRPH 1VMAA 1P3EA 1SGTA 1KO7A 4LOYH 3AKYA 2AGIX 1MCVA 4INHA 3GCHC 2F9VA 4I8HA 2FSHA 1LO6A 1ESAA 1OXXK 4TZ0A 1JB1A 1E1QD 1HV8A 3F9GA 5L6NH 1P2UA 2OK5A 3QBVA 2HDNB 3VB7A 2NWNA 4K60A 2QXGA 3V9PA 3KJEA 2XYAA 3RS5A 4MGKR 2UWPA 1BKDR 3UIEA 4WZAE 1TB6H 3BEUA 5HTKA 1Z6AA 2QEQA 1QBNA 2J45A 3CX6A 2ZYWX 2KBEA 2F55A 1GZSA 4D80A 2FDAA 3SU8A 3K9HA 3MWKA 2HGTH 5L8VA 1PZNA 1SGQE 3RRZA 5AJVB 5D3MA 1UBCA 4GOKA 1W49A 1D9XA 4Y79A 4X6PA 5KSYA 3ZZ0A 2F3RA 3ADBA 3M36A 3C1KA 2D1JA 4YLGA 1B7XB 1XPRA 1WQSA 1J14A 2GCOA 3DKVA 4UXIA 3C41J 3ATLA 4JZEH 1XXHE 3QE0A 3BFVA 3IQWA 4ZDJA 4MNVA 4D6PA 2BLWA 4RN6A 1FNIA 2ZJ5A 1MMJN 5B2ZA 1NVWQ 1O2MA 1TUIA 3ZD7A 4LZZA 3QF7A 1V6DA 3K09A 1X1SA 2WICA 2IYVA 4WZ6A 4Q9LA 3VEQB 3TITA 1OT3A 3AP2A 4BRWA 4JZDH 1NM6A 1KSJA 1FX0A 1NRRH 5JBCS 1LS6A 1ZUIA 4KAXA 3S0NA 2R0LA 3SOPA 4LK4A 2P95A 4QG7A 2MSCB 1E32A 1W12U 5HGGA 4ZHMU 4N0DA 1PPZA 4F49A 1TQDA 4B71A 1C5TA 1XBTA 2FIRH 1O3HA 5EU8A 1TQ7B 3LA6A 1ZM3A 2HJGA 1KI1A 1XTIA 1OP0A 4Y8YA 1GBEA 1QJ7B 4A92A 1L1JA 5C2ZA 2BLQA 1IONA 2QXJA 1DWBH 2DWOA 4XOJA 2ZRJA 4L8GA 5BN5A 1Y5BT 3MCAA 3IO3A 3SGAE 2IYRA 3AK5A 5SZKB 4DCNA 1QG4A 3ELAH 1F6BA 1BRBE 1T4GA 1DFPA 4HB4A 2R2MB 1C2JA 1H8DH 3WNCA 1FIWA 3P32A 2JJ2D 2ODPA 2IYUA 1TAWA 1YR6A 2XWAA 3LGWA 2ZGHA 3HPRA 4OI4A 5EQRA 1IQJA 4Q7MB 5C1UA 2GWHA 2H1UA 3A7ZA 1Z6GA 4GCHG 4IDQA 1GMHF 5HCNA 4AYWA 1P62B 5F9FA 3SV2H 3AAVA 5AUOB 1VITF 1C5WB 2JETC 2XJ9A 5A8YA 1V2UT 4Q7KA 3TR5A 4EFMA 1TIOA 1FY3A 1IM2A 1TAGA 1XXHB 2J59A 4FVDA 4B75A 5P21A 4PHGA 4LPSA 2C8YB 4OJQA 2VL7A 1OLOA 5EPYA 2PWXA 2PUQH 3A37A 4NIYA 1UMAH 2B0FA 3RXTA 3S1AA 3GLHA 1OIWA 3KTAB 4FUFA 2A0QB 1AO5A 1GSIA 2B8TA 4QHTA 2IX3A 3E1XB 4ASUA 2YWGA 5A2MH 1BMFA 3THXA 1O3GA 4FIDA 3B1WA 3FMPB 2PJRA 1C5VA 3FANA 3B1XA 4XVQA 5T6DA 4ZCMA 4HAXA 1SMFE 4WBSA 3A81A 4B73A 4BLPA 1TQ4A 4ESVA 4CRAA 4U02A 4AOQA 2BD4A 4U00A 4PPGA 1G18A 3CX8A 1ZSLA 3ZVDA 2Z7FE 1G9IE 5EE5B 2HF9A 3P8FA 4B76A 1HQYE 1XMJA 5FR1A 1XZPA 1IQIA 1GPZA 2ZPRA 4EJSA 3SV6A 2OM2A 2G0NA 1L2EA 2BY9X 2ZR7A 2ESTE 4GFDA 1RJXB 1P60A 3SNAA 3TJUA 1GJDB 3WYGA 1YP9A 3QXHA 4LX0A 1AWHB 2ZSDA 4BLOA 1LVGA 5T6FA 3ZVNA 4NONA 1O87A 3A8BA 3AF4A 521PA 4ZO4A 1C5YB 3CO5A 1WE2A 2IN2A 1KDRA 3SU0A 3NZIA 2CLCX 4AB9A 2BXTH 1TBZH 5AJWA 1EUFA 4M53A 1Y3UA 3N2IA 3R8FA 1GL1A 5T6GA 4QOSA 3FKSD 1DARA 5AK0A 2J7PA 5DGJA 1EFHA 1F5NA 3BH0A 3LKWA 4DIIH 4A8JC 5JWOA 1GG2A 2CN0H 3NXSA 2TGPZ 1G17A 5CLLA 1DO2A 3U61B 2WPDA 4R71A 1MTNB 2KE5A 3ASZA 1RRGA 1LV7A 2QBYB 1RIWC 1JRTA 2LWIA 5DYIA 1AZSC 4JVMA 2ZHFH 3TGPA 4Q4AB 1WBBA 1ZRHA 4HDQB 3MHWU 3ESTA 3K0EA 1T4UH 1CA8B 3B9QA 4DCDA 5B6LA 4HYYA 3O47A 2FPMA 2BY6X 1VITG 2C96A 3V7TA 4QC2A 1PJRA 2UWOA 4TL8A 3LO5A 3R7WA 3M4YA 2XWBI 2VIWA 4GCHF 4BPBA 5CB6A 5FH9A 3ASYA 1WV7H 2JATA 2ZS9A 2UWLA 3WMFA 3WMEA 1OYWA 2WWWA 2NO9A 3U3OA 2ANYA 4MGIR 3DT0H 2VBCA 2VA8A 2VIVA 2Q3HA 3BXZA 2GT7A 2J0QA 3OEHD 4AKIA 5GJBA 4LJ5A 3GMTA 3A1VA 3HDTA 4CRCA 3IEUA 3BIVH 7ESTE 4KTUA 1L8QA 5KO2A 3CF0A 2D4HA 3TQFA 4JL8A 4UNRA 3GLFB 4H42U 1UTPA 3SU4A 2ATVA 3B60A 5CB8A 2OBOA 2XITA 3TH2H 4V03A 1EX6A 1GHAG 2A7JA 3I61A 4FINA 4ZAEA 2ALVA 1SKYE 1DAEA 1D3PB 3RLYH 2PMKA 4F38A 1VHLA 5FOXA 1C1OA 2TRMA 2ZI9A 2ZU4A 1TF5A 1GI7B 3K0AB 2CNWA 1N6NA 3GFOA 1E9FA 4ASHA 1T8NA 4LUCA 3K8YA 2OSBA 4KFTA 1EAIA 4L16A 2OXRA 1O3FA 1SHYA 3ND9A 2QAJA 1MKXK 4Y8ZA 2QXIA 1J90A 3HR7A 4U2WA 1GG6B 1XMSA 1AUTC 3W9YA 4DJTA 1EFRA 4X6OA 2N46A 4X8HA 1TMBH 1T9HA 4KKDA 3EPHA 1T0HB 1Z0IA 4NYMR 4CH8B 1PJPA 1KK0A 2FGJA 3MI4A 4IEIA 3LGTA 3CW2A 3QXJA 4C0JA 5DO9A 1SQAA 2AFIE 2FP7B 3OYPA 3LLUA 2J5XA 1HTWA 1KTSB 1P9SA 1N0UA 2FZZA 3H4MA 3TIFA 4BFXA 2QPOA 1JECA 1OHHA 3VB6A 1JQJC 4ZIRA 4A1TA 4RD1A 4PHTA 1NS3A 2WJYA 5K7RA 2PX0A 3BD9A 4U01A 4FUBA 1KI6B 4PHHA 2RG3A 4JLJA 2STBE 1OFUX 3AH8A 1ETTH 1G8GA 4D25A 1S1MA 4WXRA 1XUFA 2WUBA 4A2PA 1HJ9A 1UTLM 4AG1A 2IW3A 2XZOA 1VITH 2BWJA 1PFXC 4TN1A 2FODA 1IQKA 1XJQA 1YZLA 1KTVA 5KNDA 3KXLA 3TRFA 3VHXA 2ZYVX 2BLOA 2ZTZA 1RS0A 1UJ2A 4IFBA 1O2PA 1AS0A 4KGAA 3SE0A 1Q31A 3RDZA 2ODNA 3K70B 3HK3B 2X1VA 4X1QU 1GBJA 1KDOA 1C2GA 1BMFD 2RGBA 1A0HB 1TNIA 4LHXA 1CT4E 3GYLB 3CLVA 1QFKH 3DDCA 4MNXA 1BHXF 1O2UA 2W2VA 1FL9A 4FD2A 4G5GA 4Z1MA 5CLQA 6LPRA 4IDNA 1G41A 1JR3A 3BG8A 4K1SA 1A3EH 1O2LA 3PCRB 1OJLA 2VP5A 1NU9A 1G2MA 2JIZD 4GMXA 3ODFA 1C5PA 1CXZA 3F9FA 4J1YA 5L30H 2A2QH 5DHFA 2BD8A 5C4MA 2AX4A 1P73A 2VHUA 3PWCA 1W4RA 2IBMA 2BD5A 1W0KA 1YYY1 2W2XA 1N6IA 3BF6H 3CIOA 2IYWA 3NVAA 5CDFA 2XXAB 2WWIA 2W26A 1O3CA 2C95A 2AYWA 2VIPA 3OAAA 1AIPA 3GLHE 3MH5A 1ZNXA 1IQEA 3FMIA 3EPJA 4BOHA 1AZ8A 2TIOA 3T1OA 2H5EA 3RMOH 4DLZA 2R0KA 3Q76A 2ZGXH 5CK5A 4FCWA 2GA8A 1KLJH 3FE2A 1OB2A 5CJ2A 4MPUA 4X0WU 3B13B 4ABYA 1AFEH 4X2YA 1O3LA 1O30A 2F6RA 2QUZA 1IQPA 3WP0A 2XC4A 2YOLA 4YMVA 1VZQH 1VCWA 1QHXA 1BRCE 5DP9A 2W6IA 3EA8A 1W2HA 3N2EA 2FOMB 2ZGJA 3NUMA 3MH7A 4TLCA 5FXLA 3AKCA 3U44B 1D5CA 5HR5A 4WIAA 2QC2A 3QY0A 2GMTC 4JS0A 4XH9B 4MRPA 1Z28A 1SVMA 1O2RA 2GTBA 3KHVA 4CEJB 1G64A 3RC6A 2WMOB 4IMQA 2I1QA 2OFXA 4OHVA 3K53A 1TX7A 3WRYC 4YLUA 1VPLA 1QJ1B 2CCKA 1C5LH 5LD2B 3WHKA 5FPTA 3ZS9A 3LDXH 3EAQA 5AFYH 1Q0UA 3ZJYA 4UEHH 2VWMA 3T62A 2Z43A 1KYIA 1JQLB 1Z06A 1LHCH 1E1RD 3GLGB 4Q18A 3RS4A 2Q3MA 4B3DA 2HPPH 3DD2H 4BGDA 3UG6A 4HEJA 1C5XB 5C18A 1GKIA 4MKHA 4VGCB 4QXAA 2XZPA 1ANCA 5F2EA 1CRPA 3U3RA 1IN4A 4BAKB 2ZTXA 5FPYA 4KITB 4JT2A 1UBFA 2FX3A 1R0WA 1P2OA 4LOAA 2JKHA 2ZU1A 2GXQA 1O2NA 5JCPA 3C4JA 1HFDA 4NYIQ 2N42A 2EFGA 4KTSA 1S82A 3NEJA 1HAYB 1N3BA 2AK2A 2WPHS 5ABWA 4NMMA 2FXRA 4BASA 1G3DA 5BQ5A 3PUVA 1MZDA 1Y5AT 1QNJA 3NIBA 1G7SA 2ZRKA 4ACBA 5JHGB 3V00A 1UAAA 2KWIA 2ZFTA 1HH4A 1C1WH 1P7CA 3QBTA 1DE0A 3V4FA 3QTOH 2SNWA 3LLMA 1XEWY 5CM8B 1HAPH 3F5FA 4LZ1H 3EE0B 2BDAA 2GJKA 3V4RA 1CP2A 4L15A 2FI3E 2CDNA 2NZ8A 1IQNA 1LHDH 2BVRH 1UVTH 4VGCC 3U44A 2F1IA 5SZIA 2ZGBH 4A9AA 2P67A 1W11U 4PC2A 3PROA 3CPEA 2PT5A 3MNXA 1IQHA 4D0LB 1SXJB 1O3DA 3A7WA 4KELA 2GAOA 1BHXB 4X8LA 4E07A 5C1YA 5JI3E 1QIXB 3V3MA 4AKEA 1BTXA 5EP1A 1CA0C 3H7TA 1VCMA 4IHQA 1T8LA 4Y10E 4O3MA 2FGKA 3WHLA 1XM1A 1QL7A 3KL4A 1SGFG 3SHFA 2OQ5A 5SZHB 1TX8A 2QAGB 1DS6A 2ZWLH 3QGNB 2J46A 3U7FB 4PZYA 1DWEH 3Q7PA 2ORVA 1YQTA 3GEIA 5JI2E 1QZXA 1II0A 1FQJA 3STJA 1E79A 1E9CA 1AS2A 4AG2A 1XCPA 4OS4A 4CRBA 1A2CH 2WJHA 4Q01A 4P4UA 5G53C 5DP3A 2Q6FA 2JIZA 2BCGY 2DFKB 3OSYA 4X2VA 4MITA 3LGUA 4NYMQ 1PQAA 2W3IA 2ZRAA 3SI7A 3GJ0A 5FAHA 3PTNA 4URWR 1P8VC 1N0VC 4I8KA 3G82C 1DEKA 2PLRA 3QKSA 1KAGA 3DUXH 5A0FA 1LQDB 4I1SA 1NBME 2MMGA 4NWLA 3GY2A 3RM2H 3SFVA 3RXLA 1J16A 3OX7U 3CRMA 4DUGD 1MO4A 4FCVA 1E2IA 4BRUA 2OEPA 2ZRBA 2ZG0H 3ZZTA 1DY8A 2XSZA 1TNGA 3I62A 1MO6A 1YZTA 1ZMXA 1IXSB 2ZDVH 1D6RA 2O0KA 3FB4A 4B47A 1KK3A 3K0CA 3RU4D 2A5AA 2P93A 4PPNA 4DKXA 1C1MA 3BRWD 1FN6A 1R0XA 1TADA 3AGPA 3EW9A 5TJXA 1RE0A 2GDJA 3ZYEA 3THYA 1BS1A 4W7SA 1NN3A 1OKKA 3A4NA 5BYKA 2KB0A 1S3GA 1SXJE 1C5UA 3OIYA 1MQ6A 1P06A 1KI6A 3E6PH 1XMVA 2QMEA 2WSSD 3LH5A 4JKYA 3Q5EA 2A5IA 2GCHF 4GP7A 4K5ZA 3W5JA 2ZS8A 2KI5A 1ZU4A 3OU0A 1XJCA 5FBRB 2P6UA 4PX9A 4G5SA 2H5CA 2NQ2C 1HT2E 4KFRA 2E1RA 5TCAA 1BMNH 3KQBA 1P72A 1S0UA 1UADA 1T8TA 1MAXA 3EYDA 3JZ1B 1TRMA 1W13U 4FUHA 4F4CA 1KXDA 5EJEA 2PBRA 2J0UA 2UZ3A 3DL0A 1MTUA 4MPVA 5E4FA 2DE9A 1O2KA 2FO9A 3Q3YA 1Q57A 2QMHA 1L4ZA 2QTVB 2JH5D 1BO6A 5DG6A 2IXFA 3AEZA 1KDQB 1YC0A 1AWFH 1AA9A 4DSTA 3OY5U 4GUXA 4JBXA 2SFAA 4ZUHA 4MGYR 4ISOA 4KODA 1FN8A 3L8YA 4X8VH 8GCHG 5KU1A 2Z3DA 2IF2A 1CRQA 2YOGA 1G3CA 2UZIR 4MVNA 3PQCA 1ZINA 3L3TA 3SBKA 2JLVA 5AJYA 3K9XB 5JBBS 1XVMA 2R9PA 1UM8A 3TU7H 3LXXA 1KSHA 5EG4A 4IC5A 5DI3A 2FOBA 1O35A 2GZAA 5G4BA 2QT1A 3I8XA 4L9SA 1DX5M 3Q85A 1ZRBA 4IVPA 2BZ6H 2FM2A 2G0TA 3I73A 3I4LA 1UFQA 1ZUHA 2HLDD 4V0MA 1MTNC 4QM7A 1JIRA 3NBYC 3LRPA 2WZQA 1VG8A 1L2TA 4GHQA 1UCYE 3LQRA 2GK6A 1JRSA 2TPIZ 1P9NA 1P0SH 1M74A 2LKCA 1BA8B 4BTTB 2CF8H 2A3RA 1KJWA 1GJAB 4ZDIA 1ZYUA 2ODEA 2QV1A 1S85A 1KO5A 5B6OA 2ZU6A 2ZFSA 1FUKA 1AQUA 1BRAA 3M6AA 3Q7QA 5AJZA 3GFTA 1FIZA 5E8EH 1XNJA 4LI0A 1GI2A 1TNJA 2GT8A 4A1FA 4LYFA 1V5WA 1YKSA 4IJMA 2JAQA 1CLUA 2ZRGA 4E7RG 1S1CA 2RHMA 2C4FH 1P2QA 1GVLA 1KI7A 2IXEA 1OYQA 4K3JA 4D0NA 1WA5A 3CX7A 2XB4A 2G4TA 2ZTYA 4B2IA 3SW2B 1O2VA 3K0FA 3ZS8A 3ZH9B 4Q9IA 3NC1C 1WBGB 4H4FA 2ZU0C 5IHPA 4Q00A 4QHYA 1QHYA 3TNSA 2ANBA 3TH5A 4DLTA 1E2KA 5FUYA 2QPTA 2R3UA 1KMQA 2QM8A 3Q3KA 4X2WA 3U7HB 2IS2A 3EIHA 3CKLA 3KJHA 1PQ5A 1K5GA 4GOJA 2H17A 1C1YA 3X1YA 4R2IA 1GDUA 1FUJA 2Z94A 1TNKA 1FOEB 4FUGA 1DS2E 2ILNA 8GCHF 2SGFE 3LJJA 3GLGA 1NVVR 1SGNE 2QT0A 4M7GA 1A1VA 1P2NA 3VB4A 3DKPA 4LV8B 4CF7A 2XB2A 1G5PA 5FL3A 1QF9A 2ZEJA 2Y5HA 4AYXA 2XSZD 4K8OA 3EIQA 1YPLH 1Z0DA 3K6ZA 4ZKEA 4OHYA 4NBSA 4JSYA 2RA0A 4WF8A 3VX4A 3MH6A 3O8RA 3UR9A 1E2FA 4Q7JB 2P5TB 1HAZB 3T1VA 2RAPA 4X8OA 3LU9B 4BTUB 1KSNA 2Q9AA 3RC4A 4K1EA 4O2RA 3ETLA 3HP1A 3KUDA 3TMKA 2WWHA 2SGDE 4XBCA 1UK4A 3BFXA 4G01B 1C5MD 3QUSA 3ZZBA 2EU8A 3SNDA 3TJVA 1E34B 1GGDB 2P3UB 1CVWH 4YXWA 4EJSB 4TMTA 5FCRA 3RXEA 2QMOA 3A1SA 1SFQB 2IL1A 1IN5A 2CF9H 4DRZA 2H5DA 3ZVFA 4P4SA 1F5RA 4GMDA 1BIOA 3ATMA 1UBEA 1OE0A 2QP3A 3TH3H 3MRSA 1S96A 3SU5A 4LC0A 2ZI4A 2ZYUX 1HA3A 1XTJA 1WF3A 1A7SA 3ZVEA 4TQ9A 2ZRIA 1SHHB 1ZJDA 4RD4A 4TT3D 3WYFA 1OYTH 2NOAA 1KYNA 4LYHA 3M5LA 3AW0A 2HUPA 3MAAC 1W10U 3H0KA 4P4SB 3GLHB 4FWIB 5TVKA 2IA5A 3KKMA 3FTQA 2YWEA 3I32A 4XBDA 4AYYB 2WPJS 3G5UA 1XXHA 1YF4A 2QCYA 4JZIA 1HJ8A 2NPFA 2WPLS 2OCYC 1NF3A 2SNVA 1IOEA 4LYJA 1KAOA 2VIDA 4I8GA 3PUYA 2IUUA 1C5SA 3EX7C 1EQ9A 1QVAA 5K0HA 1YZNA 1Q12A 4DIDA 3TUJC 5C2JB 4GP6A 2JLWA 1WDTA 1G37A 1NLYA 2A5GA 3TVJB 3E8LA 1SKQA 4L5BA 2QGNA 1OS8A 1E0KA 4PQRA 3F68H 2VINA 3ZVCA 4WOPA 3QKTA 3B9PA 3BS4A 3WMGA 2Z9GA 3W34A 3IILA 1DT2A 2FDCA 4WMDA 2H9TH 9ESTA 1GHZA 3ECCA 3BN9A 2VRWA 1K1LA 2HV8A 4JYCA 3U98H 3ZV9A 2HOBA 5J4LA 3ZZDA 1WB9A 3U7EB 1U98A 3PFIA 2WMNB 1UTKA 4HUTA 1O5EH 2FYQA 1K1MA 1WSSH 3UG7A 4ZIRB 4UE7H 2CK3D 3CNNA 5FPKA 5EQQA 3NTUA 4PAQA 3LIWA 4OI0A 4DIEA 4PO8A 1E2HA 4GPTA 4M9ZA 4DHEA 1JJVA 4H1VA 4AKHA 4EUNA 3OTJE 3RM0H 4JLPA 2FFQA 1EFRD 4IDHA 2QI9C 4PANA 3B1VA 1EX3A 4FU8A 2A45B 4K8YA 3PM3A 4TYDA 3K0FB 3KB1A 2A7QA 1EWQA 1F0TA 1R8QA 1UTMA 4BFYA 2QGRA 2ZRHA 1NSTA 3TK1A 2ALPA 4GVUA 4FXGH 1TGSZ 4O97A 1ZGVA 1JXPA 3EA0A 5F98A 5ESBA 2SHKA 1D9IA 4RSGA 3SUEA 4I1UA 2KBFA 1PPFE 1OXGA 5KSPA 2W58A 3U60B 1U0LA 5FCKA 5D3MB 2AGEX 3LAWA 1JXMA 3PWBA 3NH9A 1U8YA 1C5OH 4NYJQ 4FW9A 1EPTB 5KPDA 2BD7A 1NY6A 1L7VC 1O3BA 2O8TA 1HXFH 4KCGA 2WKPA 2R6DA 1P2TA 1K1JA 3P70B 2ZYTX 1UVSH 5IK2A 1P9WA 1A5HA 1YVDA 3I3SR 1ELDE 2VSXA 3SYLA 4FU9A 1C2IA 3IBYA 1ZJKA 2QP4A 1TMTH 4D9QA 3VTKA 1Z8RA 1EPTA 1V2RT 4GSOA 3EZ2A 2K1QA 4QJ3A 3GLFA 1VYTA 1D9ZA 1AQYA 1DAFA 4IDOA 5F9HA 1ELGA 1SB1H 4JSTA 1A0JA 5HZKA 1MH1A 1GOTA 2Z4SA 5DP8A 3HGNA 4EFLA 3HWSA 2VPPA 1K9OE 2IJOB 3REFA 3ZVBA 2ECKA 3UK6A 2FEQH 1U0HC 3MG9A 1A82A 2QN5T 2YC4C 2VVUA 1MV5A 3L33A 1KDQA 1YHNA 4O9VA 1J7KA 4IOMA 1GHYH 1TGNA 1KZ7B 4QHSA 5LPRA 2ANMH 2VIIA 2OILA 2BOVA 3VKHA 2J87A 1GBCA 1V3XA 3GJ5A 5AUPB 2P3SA 1P2MA 5BPEA 3N5CA 4UFDH 4TLAA 4ARZB 4LY6A 2D3WA 1WXRA 1OIXA 4RJLA 3ICEA 1Q3TA 3M5NA 5LPFA 3PG5A 3SYJA 1FQ3A 2VP2A 1FPHH 1TGCA 1T4VH 2YWHA 1O34A 1QJ6B 4Q4AA 4M1SA 1QHSA 1EAXA 2JGNA 2UKDA 3QXXA 1EPTC 4RD0A 1MQ5A 5E95A 1FUUA 2FG5A 2ZJZA 1CULC 1E2MA 5EXLA 1YZGA 2HNTE 1G16A 5F3WB 4Y76A 2OO7A 3AKDA 4XWOA 1KI3A 3RANA 1AB9B 4MRVA 4LJ8A 5CIWA 3PITA 4BEBA 3M3VA 2O52A 1ZP6A 4TL9A 1Z0JA 3QO6A 4FMBB 1V2QT 1TE0A 2EI7A 4II7A 4IFEA 1XEFA 2LNCA 2DFTA 4AYTA 5K8UA 4HLQB 1S0RA 4KYUA 4PSVA 1QA7A 3DFJA 2RGXA 1GJ7B 3A83A 3Q77A 4ABFA 1GDNA 4A8JB 2F9NA 5DSZA 2I4IA 1AVGH 2NO0A 4A4DA 4UJ5A 4M9SA 3NDBB 4FI3C 2R6GA 3KB2A 2QTFA 3KN2A 3A88A 3QPWA 1R2QA 5EE9A 4PPQA 3SJBA 1P2KA 5J4VA 5A8XA 1IXRC 4D4JA 1OOKB 2WOJA 3GJ7A 3W6PA 3AF2A 3NXPA 1C1NA 1SVPA 3LV8A 1XD9A 4CW7A 4R2HA 3QSYA 3ZZ4A 1TQ0B 1AGRA 2YVUA 1O2WA 2BOHB 4P3YA 2O8LA 3PEYA 2EQBA 3UREA 1Z63A 1DOJA 3FMFA 3MFJA 3RMLH 1AQ7A 4UDWH 1FY1A 5A8ZA 1YRAA 4M2LA 3HU1A 2GBLA 1KSFX 1CR1A 1U94A 3CWQA 1JALA 4URYR 3TBKA 3BB1A 1FDPA 1SGIB 1B5GH 1H65A 4JZKA 1LY1A 2WV4A 4IS5A 4HAUA 1BJUA 3SU2A 2WPDD 3ZDQA 3OAAD 1LW7A 1CQQA 2GF9A 3KTAA 5FBEA 4C2UA 1AVWA 1M34E 4X1PU 1GL7A 3BC1A 1A46H 4BEJA 2I3BA 1I2MA 3C5HA 1L1GA 1ZM2A 2HXYA 1KK2A 4YLQH 1OP2A 2OT3B 1FAKH 2BX4A 1S2MA 5AWFC 4EPWA 2Q0HA 2Q9BA 1QR3E 3C16C 2IYTA 3PENA 2BKUA 4QBHA 2ZFRH 4X2XA 4IXNA 2JLUA 2IPHA 4XSKU 1G5RA 1ZNWA 1HE1C 4MYUA 3KDSE 4IEEA 4DCUA 2ZP0H 1QBOA 2FOHA 3FGNA 3KX2A 1UTQA 1P5ZB 1SR5C 3TAHA 3CWZA 2YNBA 1OPXA 1ID5H 3KKOA 1H4WA 4I7YH 3BWDD 3O8DA 5EQTA 1S0QA 4JZ1A 3CR7A 2TGDA 2P3FH 5DN6A 3PLKA 2ZJYA 4B74A 3I78A 1IQGA 4NZQA 2F9MA 1N6YA 4LHVA 4B3FX 2G4UA 3U5ZB 1Z1JA 4OQMA 3HPQA 5EP2A 2G5VA 2PH1A 3EZFA 1ZD8A 4Q02A 3S9BA 1ZU5A 3P27A 2XW9A 1X8JA 3BBPA 4X8MA 2AFQB 1WTHD 3RNLA 1DAGA 4LHWA 2FF7A 4URUR 3PEVA 5T1VA 2FWWA 4OQFA 3MD0A 2QL6A 4Y11E 5EUQB 1BTUA 4F93B 3WRXC 1C2LA 2Z4RA 4MTBA 2O8UA 1GHAF 5AFZH 1W46A 2REBA 4NCHA 3RRNA 1E9DA 3C7KA 2F9UA 1Z83A 5E0HA 4BFTA 1BDAA 2AS9A 5LDDC 5C20A 3EG5A 2BXUH 3FKQA 4I1OA 2XC0A 3V0XA 5FTKA 3JZMA 4AI6A 2NIPA 2QY0B 2AIQA 5FBVB 3ZVLA 2AH4X 4LHZA 2QY9A 2C90B 1YR7A 2JJ1A 1W1WA 3OFND 1DXWA 3GCTF 1P02A 1HAOH 2TGTA 2GCOB 1OSSA 3QOFA 3GCNA 3ZIAA 1DUEA 1NU7B 1FQKA 1AJEA 3OIVA 5AUQA 1OB5A 3MOCA 2R9VA 3GEEA 4A82A 4Q1CA 2B7CA 3SU6A 3GICB 3SV8A 3VR2A 5LH8A 3AVTA 1T91A 4TZ6A 2H8KA 3RMMH 1AUJA 4D7FA 1XKAC 1E69A 4CDGA 3ZZ9A 1L4UA 3TW4A 3RLWH 1TOMH 5E0GA 3I77A 3AP1A 5LB4A 1N6OA 2A30A 1F48A 1IN8A 3VXEH 3M5MA 3FAOA 3KXKA 2Z0MA 2W0MA 1IY2A 4JLBA 5IDKA 1A1RA 1DUAA 2Q6TA 1DY9A 1TGTA 2QMUA 4QBIA 5HKKD 5DI3B 5C1BA 4TQAA 1O3PB 1CGJE 1OWHA 3RXIA 3HU3A 1KK1A 4BLSA 2JETB 1GHVH 1PYTD 1ZIPA 3K65B 3VR5A 1G3RA 5EE3A 3NKKA 2PZEA 5EXMA 1R4AA 4KI0A 3RXOA 3MSXA 1G3EA 3GDSA 1GAJA 1HT1E 2WSMA 4JK5A 2Q1JA 5FUWA 4HB0A 2F3TA 3RXHA 1FV9A 3SJOA 2B8OH 2V1XA 1TL7C 3K9GA 4DURA 4LBYA 3KKQA 3MH4A 1YZQA 3MNBA 4UNSA 2WAXA 2FOCA 2C9CA 4FXPA 2BVXH 3DZDA 2ZE6A 3DFLA 2V4ZA 4NA8A 5H70A 2HWLB 3PO1B 4MUAA 1GKYA 1Z71A 1XD2B 4D0GA 3BTWE 4MDSA 5FOVA 3T12A 1U2RA 2IYQA 3C5CA 1HNEE 1XEXA 2J0UB 2OESA 3VR6A 2PLXA 1HAXB 5DYGA 1DXPA 2D7CA 1F0SA 2GZ9A 3FFAA 2BC9A 1EOJA 2BQ6B 4DLYA 3KQUA 4HFPB 4FUEA 2REOA 5DHAA 2FS8A 2D8WA 2J41A 2R44A 3EPKA 1GVZA 4DVAU 2OE2A 3TVDA 4EPXA 4JLOA 2OAQ1 2ZJOA 3S9AA 1S9HA 2QQEA 3B6EA 3THOA 4TY7A 3P8OA 3MU0A 2VJ1A 3B78A 2ZF0H 3B1ZA 4M1YA 1MUEB 1W5SA 3OFNA 3THYB 3IHLA 1U8AA 2QSZA 5JS7A 1O2IA 2P65A 1RXPA 1OKKD 1P03A 1CR4A 1K1NA 1BOQA 6GCHG 4FMDB 3R8CA 2D2DA 2GX4A 2VU8E 5DI9A 1TPSA 3A80A 1ANBA 4AFSA 1DG1G 3GLIB 1PQ8A 2CK3A 4YMSA 3ZVAA 1US8A 3GLGE 1VIAA 4JVLA 2VP4A 5TMPA 2ZJ2A 5F8XA 1CBWC 4YXWD 2ODQA 1MOZA 1NPMA 2YWFA 1MABB 3QKSB 2BMJA 1V2PT 2FLRH 4AZ2B 1V2LT 5C3NA 3IG6B 3SI3H 3T28A 1ODFA 3TK9A 1C1QA 3VHLB 3BTTE 2WINI 1UBGA 2HPQH 3U2QA 1KNXA 1QY6A 3HATH 1QHNA 2P16A 3LPRA 2I6SA 3LT3A 5DPAA 2ZCHP 5FTMA 4PPFA 3WY8A 2XX3A 2O9QA 4KLNA 1W2KH 2PW8H 5FTJA 1YPEH 4XFQA 2C8XB 3RSLA 3GJ8A 2BVNA 1CJTC 1Q1EA 4H9GA 1IBRA 2VP9A 2BY5X 4DBLC 2QAGA 2WWGA 2HCJB 1MKWH 2JDIA 5TXGA 4BNRA 4BZPA 4LV6A 2QF0A 1M7BA 2IS6A 1S81A 3IQXA 5KNCA 2EW1A 3K0AA 4C0LA 1JXOA 3GY8A 2G00A 1UTOA 1FMLA 1SLUB 3HGPA 4NA7A 3UQVA 5DJ7A 6Q21A 1G3BA 5DE3A 2BMFA 3G0HA 2ZDLA 2ZU5A 4MA4A 2OV2A 1SXJA 3RC5A 5AR1A 2NG1A 2FSGA 3T5GA 2VF8A 4IDPA 4P31A 3DA9B 1HJAB 4NYIR 4NCNA 1HY3A 2NTYC 1K5DA 2Q21A 3C14C 2GEDA 4LZ4B 4ZV4A 2GV6A 2GHIA 4DY7B 1EZSC 4NPHA 2X8AA 1T5LA 1E2EA 1FZQA 2B21A 4RKFA 3VMFA 3F8TA 4TMXA 1DE7H 3WBJA 4IVQA 1SLXB 1RFLA 4PAOA 1GHXH 3HKIB 4URZR 2IYSA 3NPSA 1XD8A 1TQ2A 2AD5A 5BXQC 1ZVQA 2G3YA 4DUGA 2OC8A 3BH6A 2NMVA 1IQMA 5DGXA 4WY3A 2C03A 3UPUA 1G1MA 1TX4B 1ELVA 1MD8A 4MNYA 5GADl 3NG1A 3SI4H 2F9PA 2V3OH 5HYOA 3QEJA 3MNSA 5GWZA 1XTRA 3AASA 3VNUA 4DLUA 2TMKA 1UEIA 3QG5A 5E7IA 1E9RA 4ISNA 1E2LA 2R3YA 3D6TB 2EFEB 3SJKA 2H16A 3CPHA 2QBYA 3NBZC 1L0ZA 3HJNA 4MRNA 3LC3A 1N2CE 2Q3FA 4JLNA 1ZHPA 3OEEA 2VQSA 3SR0A 4XVUA 3VB3A 1O5GH 4CH2B 3D3QA 3RU4E 1G3MA 3WNDA 3M7UA 3PMAB 3GEHA 4LBZA 3PV2A 1LHGH 1TNLA 1P01A 4CEJA 3LQQA 4ABHA 5GNDA 1IQFA 4KO8A 4UXJA 1NP6A 1OXSC 4X8SH 1GMCG 1FTNA 1AY6H 4IKEA 2G77B 3DO6A 2YHSA 2GDDA 2DHRA 2W0SA 1Y3XA 1J2JA 4A2QA 3CS0A 5EW2H 1GNPA 1YKTA 2JJ2A 3LBHA 1XF9A 4B3CA 4M1KA 4Q80A 1MD7A 1XXDA 1CEEA 1GVNB 4M1WA 5GCHG 4YC7A 1O2XA 1Y63A 2AKYA 1MRSA 1NIPA 4LJ9A 2NGRA 2WJVA 2A4OA 2ZJAA 2WV9A 3LY5A 2Z6VA 2DCUA 3SJIA 5E3HA 3CPJB 3OE7A 1KDPA 1OH6A 2P94A 2Z9KA 4B34A 2XXAA 1UTJA 2H57A 1ABJH 1OP8A 1W0JD 3THXB 2OLJA 2ZE8A 1IJFA 2GVZC 1E35B 1LNZA 3ZIAD 1EJMA 1TBQH 2OBMA 3BEFB 1PUJA 1NJGA 1D2MA 3VPKA 4UKDA 3U6KA 4C0SA 3TW8B 2P6RA 1COWA 1B0FA 4AFQA 3S1AB 4F91B 1GBHA 1JEDA 1M7GA 2IYYA 4NCYA 2QSYA 1NG1A 1WCV1 1SVIA 1PPHE 4UFFH 1P61B 1P3JA 2GILA 5JB8S 5D3QA 5EZ6B 4PZZA 2GD4B 3NBFA 1ZZZA 4CRDA 3QWCH 2FU5C 2FOLA 4CEIB 1HPGA 5DISB 3IO5A 2BD3A 1SOZA 1BZXE 3TE6A 3NWJA 1XUKA 4N0EA 2PMDA 2O5VA 4CREA 3AVOA 1QHGA 4K46A 3UATA 3K70D 1S4QA 4PR0A 4YMTA 1NLZA 5JB9S 3ZZCA 1DDJA 1JR3E 2D26C 4OHXA 1Z7KA 3D7MA 2XEXA 4OS1A 2HRVA 5GDSH 3A8AA 1J8AA 1G36A 1GKUB 4PQFA 1RRCA 1AGJA 4OK3A 4XSGA 1MTWA 1A3BH 1YZKA 2CMYA 4NZLA 2NU4E 4D76A 3SU3A 1WCZA 1QBKC 4H1UA 4W5JA 2ZJBA 4TTRA 4ASUD 2A7CA 2G9NA 1D2NA 1AS3A 1YPMH 2EVWX 4AX9H 3F0TA 4PTLA 4AWXA 3QLPH 1ZCAA 1A0LA 4XDEA 1O36A 3QG1A 1WAYB 2DWPA 1QB1A 1T8OA 1RRPA 2VSOA 2SGQE 4RZUA 3GISB 4YMWA 1LMWB 2WUCA 1GL9B 1I2DA 4BZQA 5K8LA 1SQTA 3CRRA 2NO6A 3MTYA 5JWHA 2GCTB 3IEVA 5JPMH 1G7TA 3UR6A 1QQUA 3BE4A 3REGA 1BMAA 2XOKD 5JWRA 2ZKSA 3UQOA 5TCCA 2ZTSA 1L1NA 4G5QA 1XMNB 2C04A 4B3GA 4R7ZA 2NU2E 1JR6A 2A32A 9LPRA 1N6XA 3BTDE 2Z9JA 1CBWB 3TLXA 4OS6A 1R5NA 5IDVA 2FPZA 3FYHA 4HTCH 2FTMA 4JBWA 1KY9A 1LF0A 2F1HA 4IW4E 4C0AC 1SQ5A 4IOLA 1QB9A 1PPGE 4K1TA 1BB0B 2OBNA 3UWKA 2C8ZB 2FSIA 1XRJA 3L8ZA 3RXJA 3EGKH 1KI4A 4Q4LA 3LW8A 3GJ6A 2UVQA 3MO3A 2EWWA 4LJ4A 3NCLA 3GY4A 2IF0A 4LK2A 2A4QA 2KAIB 1XP8A 2NZJA 4PC3A 2H6MA 1WQ1R 3J81k 1IY0A 5E0JA 1ZPZA 3EAJA 4BWYA 3L82B 4QJ5A 2GK7A 2ZSFA 4PO1A 2WJJA 3LBNA 1Z0KA 2JLXA 2ZAMA 1PUIA 5JBTA 5E7JA 1GJ8B 1NTPA 2AGGX 2CMKA 2YZ2A 5A5GA 1QRXA 1FP7A 2OC7A 4YESB 5C5NA 2J95A 3E5HA 2ZZUH 1W48A 4LXBH 3PO1C 4AY2A 1UKVY 1YCPK 1CJUC 4XOIA 8KME2 3A4LA 1C1PA 1F2UB 4MQAA 4ZROA 1E98A 1AKYA 1VTKA 1JBKA 3R7WB 5FI1B 4XBBA 3B1YA 4PXAA 2BJWA 5CYOA 1NC6A 1WUNH 4YOGA 2V35A 1VCNA 4ZMAH 5IYTA 3MYWA 3URDA 1MKXH 3GY7A 1KDTA 1NESE 2H2ZA 3DM9B 2ZA5A 4US2R 2W5EA 1G7CA 2AEIH 2AERH 4KJZA 1F2TA 1A61H 3RXDA 1Z47A 3EIEA 3TK6A 4DDVA 2DE8A 1XKBC 3C15C 1AIXH 3GYMA 4DLVA 3MU4A 1ZM9A 4JKIA 4GPGA 1VG9B 2FX4A 2L0XA 5SGAE 1GHBG 1O3IA 2ODWA 1GI5A 3F9EA 3MO9A 1RPZA 3KEEA 4A36A 1CJVC 2RHDA 3PJRA 1QG2A 2PUXB 3LJOA 3ODDA 1KO1A 4TYQA 2MSEB 2O8CB 5JLJA 1KI8A 3L0IB 4P4TA 1G8HA 1H8EA 1NO9H 4LHYA 1KIMA 1FMJA 1GI4A 3OESA 4QBFA 3EA9A 2JA1A 1H8HD 5F8ZA 2QIQA 4CT4B 2WPIS 1X1RA 3Q5DA 3QENA 2FEOA 4TL6A 4TTQA 4LPKA 3JVVA 4XWKA 2WSSA 4E7NA 3KQNA 4GLYA 1P57B 2M5TA 3RS2A 4QT8C 3K70C 3AF0A 1NLFA 2ZDAH 4CRGA 1TEVA 4ABIA 4O2LA 5K8IA 3RXSA 3LBIA 2IUSA 4YTAA 1SSXA 3IPXA 2VWNA 1D8TA 1QRZA 1E4VA 4Q7YA 2C99A 3X1ZA 1AM4D 2QNRA 4HGCA 3S7KB 3QKRB 2GXUA 4AGJA 2BBOA 5DO4H 1YCPM 3A58B 2ATXA 2XTZA 4AG5A 2ZM5A 3LGVA 2GXSA 1C2FA 4CVNA 2XZLA 1NBMA 3EXAA 1DSUA 4KFSA 3A1WA 3PLBA 2HJVA 1UVPA 1FNMA 4MLFB 5PTPA 1FPCH 1NKTA 2OLKA 4ZKRU 4I99A 4MKIA 4TMZA 4B3XA 1G30B 4E09A 2VIQA 1M9UA 2Y7ZA 2Z9LA 1EJAA 3TGJE 1P2JA 1CS4C 3L43A 2CL6X 2CXXA 4WZBE 2H18A 1DLEA 1OHHD 4MKFA 1GI0A 1CIPA 1SGFA 2HNTF 3KQDA 1SLWB 4A1VA 4BAOB 2FFHA 1G3QA 1O3EA 1H9HE 5J4QA 3M37A 1KJYA 4SGAE 1C2EA 4BTIB 1TA2A 1IY1A 1VHTA 5KDLA 1TTTA 3AP3A 1W7AA 4Z54A 4D4MA 3AF3A 2SGAA 2EWVA 3A7XA 3B8HA 4RCYA 1SG8B 4HZUB 2BZAA 1WXQA 2F3CE 4FCTA 1VDZA 1GMCF 3QX5H 1VCQA 3IIJA 3EASA 2HEIA 1VG0B 4PSAA 3BORA 1R0YA 5LBIA 2GAAA 3T2NA 1OW3B 2BBWA 5JEDA 2ORIA 4Y7AA 1E2PA 1O32A 4C0HA 3B82A 1ESTA 4ZI2A 5KTYA 4FUDA 2QGZA 3UNRA 2XTMA 1C4OA 4TL7A 3KIDU 1F3OA 2BDGA 2G1JA 3EC2A 4MKGA 1XCMA 3EZ7A 3Q72A 1E0JA 1GJBB 1MH0A 1FP6A 1GJCB 1H8IH 4A1XA 1NVXQ 3LD9A 2GNOA 1ZGIA 1XPUA 1AE8H 1O3OA 1G20E 1BMMH 5E2PA 3PMHB 1C2DA 4Z51A 5GJ4B 3IIKA 4JLMA 2FTLE 1Z8GA 2FOEA 5JCZA 3B8JA 1DSTA 3SFZA 2YJTD 1QURH 2VVVA 4DDTA 3T06B 5J4HA 1Z08A 2BM2A 5ANRB 1GM5A 1P10A 2CJIA 1O3AA 4RKJB 5F8TA 2WWXA 3KKPA 4D9RA 4Z8YA 3RXRA 5CYPA 2ZU2A 4NIWA 3BB3A 4YMUA 1AKSA 1GL6A 1KGDA 1FX0B 1LVOA 1P6XA 1SBWA 1BTHH 3SQWA 4FU7A 2D2EA 1QQ4A 2HNTC 3URCA 3RC3A 1WP9A 1XXFA 3PUWA 3T34A 1QHIA 2XOKA 2NU1E 4RI0A 1C9TA 3SS8A 1Z2AA 4ZXYH 1OWIA 2CCGA 1CT2E 1QL9A 1SGWA 4Q9KA 4YONB 1CSOE 4HUQA 3X1DA 1T5IA 1TF7A 2XBXA 1P9RA 1X7AC 4CHAB 1ZD9A 3GP8A 3T29A 1CTQA 1W47A 1AE5A 2I6QA 1PLJA 3ZZ8A 1J99A 4QJ4A 2VNTA 4XVRA 2ODBA 1C4Y2 4UFGH 2IEZA 2VHTA 2QAGC 3KQEA 5AJXA 4UQOA 1EOLA 1CHOF 4FUIA 1XEWX 2ZECA 2G55A 1PPCE 2G88A 4R98A 4AFUA 2O8EA 2ZS7A 5B58C 2O8DB 3JZ2B 1RYHA 4DEYA 1GJ9B 4HB3A 4OGXA 5DIFA 3SQXA 3CRVA 4JYTA 2G5NA 3AQ4A 2ZSAA 3M0EA 1E6CA 3DPUA 5AHGH 3B9FH 1ZSKA 2AFHE 1OH5A 2Z6BD 1EXFA 1XUHA 3C8UA 1R0ZA 3QQ5A 1C4U2 2FSFA 2G8TA 1XCGB 1INCA 3KJGA 2R6AA 4Q1EA 3ZVMA 1HAVB 3R9XA 3QJYA 2JH0D 1ORFA 4RVCA 3FPAA 3SJ9A 1DO0A 4P0TA 5GXPA 4RFVA 2RGNA 4KBFA 4ZPXA 1IQLA 3QDZB 4O0MA 1V2JT 2V55B 1YLDA 4AIIA 3SEAA 1DOAA 1YPKH 1R6BX 1HQCA 1JR3D 2J9NA 2W7SA 4LWZA 1O33A 4JCNA 5JBQA 3SOSA 1LPGB 3O8CA 3ZVGA 1H8ED 4X1RU 3MWJA 4D8NA 3UNQA 1NN6A 1SGDE 2C9OA 2ZRFA 1S84A 1CU1A 1JI0A 3T15A 4RFSA 2PR3A 2C5LA 2GZHA 3EQ0H 1THPB 2AL7A 3PIRA 3TJZA 2ZJ8A 3IIMA 1OYYA 5FX5A 2GCPA 2QM7A 1Y3WA 3A82A 1ZTJA 2TBSA 1BTWA 4US1R 4PQYA 1GJ5H 3S9CA 2X77A 1AK2A 1EFCA 2FE4A 3V13A 5JDUB 4I1VA 4DEXA 2F1JA 5CJPA 3ZQJA 4UNNA 2OLGA 1E1QA 2QENA 2TGAA 4F4OC 1ZTKA 1O3KA 4X8TH 2G51A 2QQ0A 4ABAA 1Z8IB 1KXCA 2QF3A 3RABA 2H9EH 2BJVA 1C1UH 1F92A 2IYLD 2UUFB 4Q4HB 3RXVA 4TT3A 2A5KA 7GCHF 3W94A 1E2QA 2A2ZA 2J34A 4XTRA 3SYKA 1K21H 2GESA 3I5XA 1E79D 2FESH 1XUJA 1V2VT 4ILEA 1XTKA 2FV8A 1Y3AA 2Y6TA 1HBTH 3UIRA 1OWJA 1Z07A 3THWB 2EFDB 4AB8A 1Q20A 4BZXA 4PAMA 1OFIA 3ONWA 1SXJC 1MU8B 3UOPA 3Q3XA 1KMHA 3K0CC 2Y8EA 1S8FA 1QGFA 1FLEE 2PEZA 5J4SA 5JZVA 3WP1B 4XJXA 3I92A 2ZC9H 3LGIA 3SBEA 4OQLA 2E9SA 3Q8XB 1C1RA 2CHQA 4UNPA 1SGPE 1GBBA 4F7WA 2Z9IA 4MNWA 4B2PA 5JEEA 3AM1A 4NWKA 1XX9A 3FMOB 2ZI6A 4Z8XA 1O5AB 3MJRA 3FVFB 3PTBA 5A0CA 4DT1B 4TWWA 1W0YH 1WTGH 4K8BA 2EI8A 1IAUA 1TPPA 4RD6A 4ABJA 3MU8A 3VR1A 3KGPA 1E0SA 1NROH 1W36C 4UD9H 4QNRA 2CV3A 4CGZA 1G4UR 1Z29A 2ZHQH 5FL7D 2OTVA 1DTSA 1ZNZA 2A31A 5EGMA 1C2HA 5TB5A 5FTLA 4G5RA 4JJKA 4Z6AH 4BQSA 1NN1A 3I1FA 4HLDA 2PZGA 3T27A 4FUJA 3BIUH 3GCGA 3QF4A 5KSZA 4BXWA 2IWRA 5DK1A 6CHAC 1T32A 2R6FA 3F1SB 4BAMB 2BM1A 5FI0B 4G5OA 3ADCA 1YGCH 1VGCC 3F9HA 1TLDA 3VAAA 1ZTLA 3CZQA 1BYIA 5L3SB 1KKMA 1OFHA 3ZZ5A 3MU5A 2OC1A 1F5LA 5SZJA 3D62A 2XBYA 4L4UA 1J17T 3FWYA 1RIWB 1LKAA 1Q1QA 3UOUA 1HIAB 3GDUA 2GJAA 3SHAH 4PSKA 2EA3A 1Z6JH 4M1OA 2FS9A 4V0KA 1Q22A 1II8A 3WY9A 2FX6A 1HUQA 2OZEA 1Z0FA 2ZAOA 5JJLA 5HE9A 4X6NA 1NG9A 1HAGE 3BG4C 4J0QA 3VKGA 3HK6B 5T3HA 3E70C 4ON9A 1ZC3A 1NBMD 1LTQA 3RWOA 1HV7A 3E90B 2NU0E 3BH7A 1G3UA 4NTZA 1ZBDA 3E1SA 3KFXA 4TLDA 4DB2A 1G6HA 3TUIC 2WOOA 4M0LA 1NI3A 3CRW1 1U0JA 1HJAC 3MWLA 2QYIA 3FKSA 4EQ6A 3R9WA 1DANH 1KKLA 5G40A 4BFUA 4ZCLA 1LTOA 1E2NA 5FPHA 4N1AA 1AB9C 2PGBB 2BV3A 4NDZA 5KSOA 2VWLA 4PC6A 3SYNA 3CB4A 3PMJA 4TYPA 3TIUA 1IHSH 1K22H 1E9SA 4C0BA 1CA0B 2THFB 2IK8A 4HAYA 4TQUS 5JBAS 1E4YA 4F4IA 2OBLA 4QL3A 4HAWA 5EXNA 2A9KA 3HKJB 1RTLA 3VB5A 2GETA 3V12A 5HKKA 4I33A 1MAYA 3PYHA 2OCBA 1OXUA 4DZZA 2VHJA 1Z3IX 2W7UA 4NFEA 3P1JA 5JSZB 1T8MA 1GMDG 2VEDA 2BEJA 2BM0A 2K5UA 1UVUH 2CJWA 4WW0A 4V0OA 2B7DH 3HYRA 4A6XA 1SVKA 4IRUB 2XTNA 4EDHA 2BBTA 1TFXA 2V6IA 3B7GA 1Y5UT 5TDHA 2CHAC 2D62A 1UO6A 4RZ3A 3LC5A 1GMHG 3RXFA 4NSVA 5DP4A 1OWDA 1EK0A 1EGAA 3QUMP 4ACAA 4A0RA 4JYVH 4V0LA 1ANKA 3TKLA 2BDIA 3PV4A 1FXYA 3RMNH 1GWAA 1CJMA 4ZCIA 5BW8A 4WXVA 4BUJA 1G4AE 1F60A 4M1TA 3SV7A 3TGIE 3QTVH 1C4V2 1ZIOA 1UHBA 4OS5A 1G8PA 3SJZA 1O2OA 4LSGA 2XBWA 1TRYA 3OY6U 1EG7A 1ZAKA 1JMOH 1BTPA 2HYDA 1P2SA 1MKWK 1XFAA 3A8TA 1W8BH 5CITA 3NHAA 3UY9A 2V7QD 4QGGA 1W4AA 1GRRA 3KNXA 1O2ZA 4OS2A 2AK3A 2WYGA 2F43A 4DLXA 1K2I1 3VGCB 1SFIA 4JMPA 5L3VA 4Q47A 3BV9B 3VU9B 3U1JB 1YRBA 1MCTA 1O3JA 4EKDA 1U9IC 3H7OA 1AKEA 3BG4B 1RGQA 4XD7A 3WBKA 1EASA 2D2FA 1C2KA 2V6NA 1IXZA 2ZNKH 2Z5FA 2GKSA 1EZXC 1C9KA 4FMCF 3PR1A 4GAWA 1LVYA 3QPUA 4ZDKA 5EXPA 4JT4A 3AAUA 2V54A 1TPOA 1W5TA 4OJKA 4TYYA 1JEEA 1GBAA 3R9IA 2ZQ2A 3SGBE 5FBQB 2FPLA 1CGIE 4KBGA 1RTFB 5KYKA 2R8RA 3MNCA 2V6JA 3SDZA 3LVRE 4SGBE 4TMVA 3R3GB 4V0NA 2ZRLA 1DAHA 3SUFA 2B7BA 2F1RA 4CYMA 1SGRE 3BSQA 5GVRA 2W6JA 1VGCB 1OH8A 3RLFA 5DKMA 2NPIA 4TYWA 3RS7A 3U4QA 1GBMA 4ISIH 3RC8A 3AVWA 1YE8A 4HZIA 3W90A 2EYUA 1ZNYA 1EB1H 2OAP1 1NIJA 3UXMA 3ZQ6A 3I8SA 3NC0C 1CO7E 1KO8A 3RWMB 2AMPA 3KQHA 2O8FA 4U7DA 2EFCB 2G81E 1DICA 3AVPA 4CEHA 1Q44A 2EFHB 1BT7A 1COWD 3FP7E 2IOTA 2CHAB 4YO9A 1N6HA 4QGFA 2AIPA 1WOFA 5FPSA 3A1TA 2F9LA 3T61A 2CXVA 3P4XA 2ANWA 2R2WU 2ULLA 2XCFA 4HZHA 1UDWA 4Z1MD 1O2SA 1Z6TA 1AI8H 3UMFA 3STIA 3BTEE 3CH5A 3IWMA 2CBZA 4Y0ZE 1AD8H 5CM9C 1SOTA 3CF6R 1T3LA 2J92A 2PTNA 4NA9H 1B0UA 1GNQA 5LPNA 2STAE 2P8OB 1JNYA 2C2HA 5L2YH 5HPYB 2BHRA 3KXIA 1YPHC 3E16B 3TVTA 2AXPA 4Y7BA 3RP2A 2P6NA 2VGCB 4G0NA 2CL0X 4C4PA 2W83A 1P11E 1Q1BA 3QK1A 3VR4A 2H9HA 2CE7A 2RB4A 1MT0A 4HSEA 3FP6E 1LF5A 1QTFA 4B32A 6GCHF 1TPZA 4TLEA 5B64A 3VFEA 1ZPCA 2XNSA 1NRSH 4IGDA 1OWKA 3EC1A 1EFTA 3UTUH 1MBQA 2QXHA 1PYTC 4BFVA 2ASUB 4DW2U 2PKSB 2H1LA 1O5FH 1QB6A 2VH0A 4UNQA 1HEIA 1FW6A 4MQBA 1O0DH 3FHOA 2C9YA 3L0OA 3B85A 1T31A 2QZ4A 4DXAA 2AN9A 6CHAB 3EPLA 4YT6H 2WIBA 4Q03A 5CHAC 3MU1A 1I4LD 2CVFA 5F03A 2BHGA 3L0SA 1CJKC 1GHWH 3BGWA 4J2YB 2BD9A 4HDCA 1G9XA 4JVNA 2YC2C 4U32A 5FR2A 5DLQC 2GXAA 1NY22 4CBNA 3SZNA 3EDXB 1E9EA 1W36B 3EWSA 5EW1H 4Q4JB 1OFTA 1PPBH 3H2YA 4NG9H 4M8NE 1TYNA 1HUTH 2VGCC 3ZLJA 4ESTE 4IVRA 4BAHB 2BYAX 2ZPTX 3UMRA 1UK3A 3LDAA 1D3QB 1AMHA 1H9IE 1HRTH 2XBVA 5EUMA 2ZPQA 1W4CA 3R20A 4FVBA 1YR9A 2QRNA 2RGGA 4GSYA 4XWAA 5L3RA 2WTUA 3Q3JB 1F0RA 1R5BA 2ZRDA 1NFWA 2DYKA 4DCVA 4O03A 1HXEH 2ZQ1A 1A5IA 3TLOA 5UKDA 2ZI7A 5JSZA 1ESNA 2W3KA 2ZI5A 3M3SA 1U81A 3RXAA 1WMSA 2DFLA 1MZAA 3PVSA 3M61U 3UPEA 4ZHAA 2QE7D 4B2CA 4KXFB 1SGYE 1UKZA 1S83A 4FMCB 4L9WA 1ETSH 1DVAH 1RTKA 1QVRA 1ZOMA 4JMYA 1E3MA 3OEED 4OL0A 2BMGB 2J7KA 3GLIE 3W8RA 2UUKB 1UKEA 4RD2A 3AUXA 1J8YF 3E0NB 2V3HH 1KSGA 4MDEA 1SKYB 2A5DA 1QL8A 1ESBA 4I4LA 4MRSA 5L3QA 1ANDA 4RSPA 5JS8A 4I32A 4KVGA 1KZGB 4DSUA 4TMKA 4Q48A 2RDLA 1GI6A 4EQ6B 3TAUA 3K0SA 4ZXXH 3QZQA 3FFBA 1Z5ZA 1Z2CA 2IC5A 4JLVA 4WXIA 3E2IA 4RZ2A 5J47A 2YNAA 2BDHA 4M22A 3FZZA 4U5XA 4B35A 3UUZA 3MLEA 3HR8A 1QDEA 4KU4A 2OQUA 4Q7LA 3NDPA 2B9LA 2R62A 1UCYK 8ESTE 1OIVA 3SNBA 1HAIH 3FVQA 1UTNA 1A5GH 2JJ1D 1NKSA 2QP9X 4NZYA 3A8DA 3NKVA 1N6PA 5FBWB 2DUCA 2ZHDA 2J1LA 3E91A 4YZUA 1TQ6A 1O37A 2E87A 4TY6A 1TMKA 5J40A 2OFOA 1RKBA 3RYTC 4BAQB 2ZFQH 4KP0A 4Q9HA 3DVLA 1N6LA 1EJNA 3AB3A 4OHZA 1VJ9U 1IHUA 1KJZA 2ZVPX 2WWYA 2PSYA 4I31A 2BBSA 3CENA 4MDFA 4YDSA 3BOSA 1E1RA 4EPYA 4TPYA 1ZPBA 5FUXA 1E9AA 3RDPA 2AWOA 4BFZA 1S3SA 2PGQB 1A7JA 2RA3A 4B48A 3VFDA 4GRAA 1YU9A 4TMWA 4CR5A 1EAWA 4OK5A 4TSFD 2Y82A 4Y6DA 1N6KA 4B2BA 2BMEA 1ZJ6A 3K6YA 3GY5A 1O2JA 1VIYA 4KSBA 1XDBA 4HAVA 3KQKA 3A85A 3QXSA 1MO3A 3PV0A 1N5JA 4I81A 1TWXB 4F4JA 1HURA 1UJ1A 3B5JA 4Q5IA 2Z83A 4Q66C 2WVJA 2PHBA 4EFNA 1BQYA 5DP6A 1ELTA 3GJ3A 2ZRMA 5DP5A 4NE2A 5CK4A 1HCGA 4B3BA 3GJ4A 1OV4A 1O2QA 2QA5A 4A2WA 2HF8A 2O8WA 1GDDA 3NH6A 1P2VA 5H1YA 4B6EA 4THNH 1O39A 1C1TA 1I4DD 4CEHB 1LQEA 3M5OA 2Q9CA 1FY5A 2RGDA 3M7TA 2J4IA 5J4YA 4RKOB 1XVOA 3SBDA 4MYCA 2QE7A 5FTNA 2PJZA 1GP2A 1E99A 5EE1A 3SU1A 3TPIZ 1SULA 5JMTA 3K09C 2OP9A 1LDTT 2RMKA 1DITH 1DELA 3EWAA 2ZVQX 4C7OB 4GZMA 3QEOA 5KDDA 3OIWA 1RRKA 1LS1A 3LVQE 4A15A 1FONA 1E94E 1RJ9B 4LV5B 2KSQA 3GD7A 1W0ZU 3SV9A 1O5DH 4PFSA 3MWYW 3SQEE 1D6WA 4U30A 3SORA 2I1VB 4OHWA 1Q2WA 2RCNA 4JK6A 1LFDB 1FFHA 5JHHB 4D82A 4ZH8A 2BEKA 2NO1A 1CGHA 3KF2A 1K1OA 4W5WA 2AWNA 2BD2A 1U99A 2CNWD 4QFMA 2BQ7B 5AVDA 2PZFA 2ZROA 3SO3A 5IRCD 4RY2A 1ZM4A 4KLZA 1EP6A 1O5BB 4IN1A 1D2EA 3I29A 5GIBA 2ZPSA 2VWOA 2SGPE 3ADKA 3VR3A 1HB0B 2WBLC 2BIFA 2O0HA 5DP7A 3NHBA 1HAHH 4LJAA 3W6NA 2OHFA 4GT1A 4DLRA 2F9OA 1SHZA 1ZCBA 5JRZA 4ESHA 3I5YA 4RFSB 1LVMA 3DEFA 2A4GA 1GVKB 1LCYA 1O2HA 1U90A 4Y0YE 3UWIA 1W14U 3W5IA 3IGFA 5GJCA 3CNLA 2DPXA 4URVR 2EC9H 4NU0A 4KHZA 3OE7D 1P09A 3CNOA 4S2EA 1FAXA 4ZHLU 1RC8A 1C1SA 4ZKOU 3AW1A 3X2SA 2DY1A 2VP0A 1Z8JB 7KMEH 4ZKNU 3D23A 3SC3A 4H6TA 1GWNA 3LGYA 4Q1DA 2GBLC 2IHYA 2QU8A 1V2TT 1TABE 1UF9A 4TTPA 2FPKA 1G19A 3U8OH 5AF9H 3DHWC 1HAVA 2RH5A 2J94A 1GRQA 3WNBA 2XRCA 2FOGA 4NYJR 3SUDA 5CMXH 2A5YB 4R0IA 1GHBF 1PV4A 4B44A 1D6JA 5A0BA 4RKEA 4CT5A 1RD3B 4QGAA 2ORWA 4IXMA 1XWIA 2OINA 1KLIH 1C5QA 3MUFA 3A4MA 1GRNA 1U8ZA 3EA5A 3D8BA 5JJIA 1ZHRA 2CJWB
chains in the Genus database with same CATH superfamily
1RJ9A 1Y5MA 1B15A 2FPGA 2WF8A 3QKUA 4LCEA 4X1YA 4OQDA 2R8PA 2ZDNA 3ZEAA 1SRQA 1W1IA 3DM5A 3MXOA 4G23A 1HGXA 1E3JA 4LC9A 2BFEA 3GAAA 3QN7A 1RAEA 1EHIA 2GP9B 3L5KA 4D8YA 5F4ZA 5JC8A 2PYIA 2W2NA 4JLAA 4BLRA 2WPMS 5CB4A 2O8DA 2BFNA 4EJMA 1EB2A 2PEYA 1ZMJA 2MSDB 2OENG 1S4MA 1WU7A 2CHUA 2TECE 2ZUDA 3L8FA 5BQ3A 2ZHEH 1EBFA 1JDVA 4PZLA 1YL5A 4RF5A 2P0EA 4MTCA 1RPJA 4BV3A 3A7VA 4ABGA 2OQRA 5IJ9A 3GY3A 1XMIA 4FGZA 3JQGB 4E94A 1FLAA 1J06A 2YS6A 4DF3A 4B9EA 4C7OA 1V0JA 2P78A 3SMQA 3VGCC 5IF9A 4IXWA 4CHTA 4JYUH 3RK0A 1H2WA 4RH0A 1K1PA 2PCJA 1DRWA 5AVKA 421PA 5H8WA 3VO8A 1SHTX 2XQGA 3UHFA 1ETUA 3G0BA 4L0CA 4GUDA 4JN6B 4B80A 4PLZA 3QEAZ 4H1WA 5G0VA 1CV2A 5C1IA 2O3UA 4D3ZA 1LLUA 4PG4A 3I6BA 4QRHA 4YGXB 4OYYA 5ENVA 4ZCQA 3C3CA 1AFQB 4OP2A 2QRPA 1Q2UA 3AW8A 1N3IA 2C2WA 2V6GA 3PQ4A 5KWVA 3FZDA 2OXCA 2QVCA 2Y0PA 1IBKB 3QX8A 1QG0A 1WTCA 3AL3A 1NDUA 1ACBE 2ZETA 4EG7A 4Y9SA 4RJIA 2ZZKA 3ZC3A 4X8UH 5CTAA 1DI0A 3O8BA 4ZANA 1VLVA 1F4VA 1DV2A 1Q1GA 3PRYA 1V2KT 2KYRA 4DGQA 3FLMA 5TY0A 4CUJA 3SGQE 4I2VA 4Z1OA 1YJQA 3H09A 3MO6A 2QTHA 2B0CA 4YCAA 1UH5A 2ZUTA 3I39X 1RD4A 4NCIA 3ZH2A 1C30B 2JFZA 3QEMB 4IIVA 4XIGS 4JVSB 4MA0A 3HXTA 3LYUA 3MTBA 3P0JA 4CIVA 1KJQA 4Q9JA 3HI6A 1IY8A 1QAQA 1JXAA 4NX2A 1V1RB 4HQOA 4LRWA 2ASEA 2NYVA 1L5RA 2FLKA 4OHRA 3RVQA 2F91A 2WUEA 4R9NA 3I04M 5EXSA 3PRHA 3LU1A 2ZDKA 4NDAA 5FIUA 1JQ5A 1IAQA 3TDKA 4XWOA 5FI3A 1XTVA 4TUYF 1NL3A 1VE6A 3SSMA 1CCWA 3VNVA 1GBKA 3U8RH 1QHHB 1XL0A 3MFYA 2RCYA 4TVSA 4R16A 2O6HA 3FB1A 3GPBA 2F8SA 2FFAA 1DFGA 2OECA 1WEHA 1KVSA 2ZATA 3IHWA 4YDHB 1GGFA 1YZUA 2B0JA 2FNAA 2OCPA 1GI3A 1DM4B 1N4DA 2ZO3H 2NAPA 3L3BA 4BO5A 5GZ6A 3GOQA 1GNRA 5IU6A 1WU1A 1MB0A 1E1CA 2BDCA 4AJLA 3COPA 1C8KA 1WHSA 2GN9A 2HA5A 2AJDA 1TFUA 2W00A 3NM6B 4LOHA 3M4XA 4OHBA 2QRZA 4PO9A 5AO9A 2PX3A 3R3WA 5LA6A 5AKYA 2JHPA 4UEKA 1ARZA 1LVHA 1RFNA 3DHKH 4WJG2 5E2OA 3DZ8A 4QM6A 3QE9Y 1NXVA 5C37A 1EAUA 1DC4A 1B16A 4RM2A 3G6WA 5FL7A 3IOMA 5LVAA 3P95A 1K0FA 1TA0A 4MVJM 1WYKA 1KI9A 3AVZA 4LYAA 3TSWA 3TTUA 5BN4A 5CA0F 2QW1A 2C93B 4O6VA 1Z2OX 1G2QA 1QGAA 4H7IA 4HJRA 5E8JA 1MO5A 3I09A 1V43A 2ANKH 1IZ0A 1V2OT 1VCHA 3O5AA 4CRWB 2AZXA 3FCAA 2HYIC 5JZSA 3L40A 3GARA 3IDQA 3K92A 3NX4A 1MRNA 2P8OC 2C94A 4WCVA 5IAKA 4Y8XA 3GQVA </