2ZU4A

Complex structure of sars-cov 3cl protease with tg-0204998
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A02
1GG6B 2H2ZA 2BD3A 3UOUA 5C5OA 2A5KA 4MPVA 1QHRB 3RXRA 1WAYB 3LH3A 4YOIA 4GLYA 3TJNA 4X6NA 1TRNA 3A85A 1NRRH 3RXUA 3SN8A 1EB1H 3I77A 2J94A 1SGRE 1TALA 2ZFFH 3TH2H 3FZDA 1Y5AT 4DJZB 1OWEA 2M5TA 2ZQ1A 3TH3H 1HAHH 3DA9B 1GHAG 5JDUB 1ETRH 1DUEA 2C4FH 3L6PA 3ZZ9A 2H9EH 1LTOA 1YLCA 2J9NA 4UFGH 3GDSA 2FOEA 3Q76A 1O5CB 5T6DA 3UFAA 5H4IB 1IQEA 1FUJA 3LIWA 1QL8A 3MU1A 3KGPA 1QURH 2G51A 2XXLA 2VH0A 5EQQA 1GJ6A 2W26A 1IHTH 3VXFH 1OP2A 1P2MA 3FZZA 2QC2A 3VEQB 4ABEA 1KXFA 3PMBB 1S5SA 1A5GH 1DFPA 2QGRA 2QV1A 1IQMA 5EXLA 7ESTE 3ATMA 5I25A 1UK3A 3SJ9A 1PFXC 6CHAC 1IQKA 1O5AB 4ZKSU 1PYTD 2A7JA 4AORA 1ZMNA 4ISHH 5EG4A 4CRGA 2AGEX 1C5QA 4RKOB 1NM6A 1GJCB 1P3EA 1SFIA 1TA6A 2IJOB 4NWLA 1AZ8A 2FM2A 3EGKH 2Z7FE 2QY0B 2AEIH 3E0PB 1MBQA 2BLWA 3AAUA 3GCHB 3FP8E 2F9PA 4WMEA 1ELVA 1K21H 3UREA 1ZMLA 1ZHRA 1TX7A 3F9FA 2ZPSA 4UD9H 3TPIZ 1ANDA 1O5FH 3VGCB 1HRTH 4Y0ZE 1FJSA 6LPRA 4Y10E 4AYYB 3SJKA 3SNAA 1O2RA 1HYLA 3UQOA 1A3EH 4TYDA 3PLKA 3U1JB 3P6ZB 2SGFE 1T4VH 2ANWA 1GVZA 2HALA 3SOSA 2HOBA 4TWWA 3STIA 3SZNA 1ZOMA 2ZHDA 1ESAA 3TK5A 2YNBA 3P92A 5CE1A 3HATH 1O3CA 3TITA 2AFQB 1TIOA 1OWDA 2G00A 1VITF 3OU0A 4Q2KA 2BD2A 3GY2A 2BQWB 1FQ3A 1AY6H 4X6PA 3LGWA 2C8YB 2GX4A 2QCYA 1XKBC 5C3NA 4J1YA 3ZZ8A 1H8IH 2W3IA 3S9AA 2HLCA 4XBDA 1GVLA 1HBTH 2BTCE 1DX5M 1FIWA 1O5DH 4YOJA 2ZNKH 3KCGH 1AKSA 1G36A 3EBNA 3RLWH 1VGCB 2AS9A 3RXVA 3RMLH 3SQHE 1SGIB 4I33A 4DGJA 3DUXH 2F9NA 1O2ZA 4FUJA 1MD7A 2BVSH 2ZO3H 3STJA 3QZQA 5DJ7A 3A8CA 2AGIX 1PPHE 1DS2E 1EUFA 4XBCA 1UTNA 1V2PT 2A1DB 5C1UA 5K7RA 5FBIA 1ZTJA 4FU8A 5HM2A 4K5ZA 1O2OA 4ZXYH 9ESTA 1H4WA 3RXBA 3RMOH 3TGKE 1K1NA 1O0DH 4GHQA 4H4FA 4AG1A 2G5VA 1XUHA 3PM3A 2HGTH 5G4BA 3LC3A 3A86A 4B73A 4Y79A 1O2HA 2PTNA 1RFNA 1SGQE 2PW8H 1BMAA 3Q3YA 4HI3A 4JK5A 4BAOB 3DD2H 3RU4E 1O2SA 3TJOA 2VIPA 3A84A 1FONA 4ABGA 1BA8B 2AH4X 3PO1B 5IYTA 4A5TS 2FOGA 4DURA 1CO7E 2ESTE 3TU7H 3R0FA 2XC0A 4NFEA 1SOZA 2BM2A 4ZHAA 1GMDF 1O2YA 1HAPH 3HKJB 3GCTF 1U6QA 2ZECA 4MTBA 2FLBH 2JH0D 5FCRA 4JYUH 2B5TB 5E0HA 3SU0A 1TRYA 1V2KT 1YBWA 2BY9X 2P95A 3A7YA 2Z6BD 3RXFA 2RCEA 5FX5A 1O2LA 4YZUA 5JBBS 1YPHC 3RXAA 1JIRA 3L3TA 1KIGH 4ABIA 3LONA 4PROA 1Y8TA 1FZZA 5HM9A 2GD4B 2ZHWH 3LJJA 1N6YA 3BN9A 4TWYA 1C2JA 1P03A 4TY7A 4KTCA 1Z7KA 1J9CH 2ZWLH 3NK8A 1B7XB 1ETTH 2ZFSA 1J16A 4GCHF 4E7RG 1HB0B 1TFXA 2ZGCA 1O36A 2VWLA 3KL6A 1DLEA 1GDQA 4MG3A 5L2ZH 1DSUA 2ANMH 2RA0A 2ZDNA 1NZQH 2FTMA 1ELTA 1PPCE 2P8OC 1ESTA 1HXEH 1P8VC 2GV6A 2H5CA 2W3KA 3O8BA 2WUCA 3KNXA 4WWYA 4NIWA 1EATA 7LPRA 3M7QA 1CGJE 1A0HB 3E1XB 2PWXA 1P01A 1ARBA 1DLKB 1ZPCA 3Q3XA 4ABAA 2FZZA 1KXEA 3ESTA 5TCAA 2HWLB 2JETC 5BPEA 2ZFQH 1Y5UT 2BDBA 3LGVA 3FANA 2TRMA 1GMDG 1RTFB 4XBBA 2XTTB 4IGDA 1Z71A 3UY9A 3RDZA 2GCHF 1P09A 1ARCA 2RDLA 1TAWA 3M5OA 2SNVA 1QRZA 1A5HA 1CT0E 1RGQA 2BLQA 3HPTB 1LVMA 3TJVA 1MD8A 1ZPBA 2G81E 1F2SE 1AHTH 5ETXA 1O2TA 1FAXA 1P06A 2ODQA 1EJMA 1GBCA 2AMPA 4BAMB 4CRFA 3RXIA 4NSYA 4D9RA 1YC0A 3I78A 1BUIA 1S83A 3E16B 1CBWB 1DSTA 1S0QA 2W5EA 3MU5A 1K1PA 1KXAA 3RUOA 1SLVB 1EP5A 2ODPA 3CS7A 1PQ7A 4YOGA 3ZZ4A 3M3SA 5T6GA 1B5GH 3BIVH 3EA8A 2QXGA 4IW4E 1JXPA 2CMYA 1OYTH 6GCHF 2GZ9A 5HYOA 1MBMA 3RXEA 4IBLH 5C2ZA 2HNTC 2J92A 3MYWA 3ATLA 4I31A 2TGPZ 1O2GH 4DVAU 1O2QA 1OS8A 2SNWA 3OY5U 2BX3A 4NIXA 2BY7X 1QIXB 2C8XB 1YCPM 3CP7A 1HNEE 1BT7A 1ZSJA 5E2OA 1ELCA 2ZCLP 1C1UH 3BF6H 1J15A 1CA8B 2EC9H 1C1WH 1E35B 1SOTA 1GHWH 2UUJB 1ETSH 1QB9A 1YM0A 4TPYA 1W11U 3VB4A 4JZEH 3MH6A 4MQAA 4WXIA 3RXTA 4AB9A 2DUCA 1C5NH 5GCHG 4A6LA 1JRTA 4DIHH 1YYY1 2D26C 2VWOA 4HZHA 3QGJA 2ZCKP 3LOXA 3O8CA 3RLYH 2WPKS 4LOYH 4K69A 1EPTB 4FUIA 2GT7A 1ZZZA 1UHBA 1V2UT 1XM1A 4JK6A 1MZAA 3ZZ5A 3P8OA 2HNTE 3ATIA 1A7SA 5A8YA 1BMLA 2JKHA 2OC7A 3S7KB 2SGAA 1AVXA 1QBVH 2VU8E 2GCTC 1ELDE 1P2QA 1RTLA 1GHZA 3ATKA 4NFFA 1BTUA 1BOQA 2WYGA 1LQDB 1W10U 3UR6A 2F3CE 4FUCA 4A1VA 3SV8A 3OX7U 4YT7H 3DFJA 4H42U 4AOQA 2LIZA 4FVDA 1YPJH 4AGJA 1FNIA 1V2VT 3RXCA 5F8ZA 1AB9B 1C2LA 3U9AH 2XWBI 2HVXA 1GBLA 2UUKB 5CHAB 1BJUA 4R0IA 2XRCA 1SGYE 1C1RA 8GCHG 1UTMA 2EEKA 1G30B 1HJAC 5LH8A 1TBRH 2A4RA 1IQHA 2CHAC 1A3BH 3DHKH 1CU1A 3F9HA 2VGCC 3V7TA 4Q80A 3QZRA 1IQIA 4FXGH 4D7GA 5JYIA 1AFEH 1P12E 2B0FA 2IPHA 2OD3B 1TOCB 3SNDA 1UVTH 1Y5BT 4IC6A 5HXFA 1TB6H 3T28A 1GI4A 1H1BA 1LCYA 4IN2A 1Y3WA 3MNCA 2JETB 1Y3UA 2A5IA 1NT1A 2J2UA 2Y80A 2A32A 1JRSA 5LGOA 1D3PB 1SGNE 1XUFA 1V2JT 3SJ8A 1Y3XA 1LKAA 3GCOA 3RC6A 3RXMA 3GY4A 4INHA 2QF0A 3U8RH 1LQEA 3KQEA 5JBCS 4MPWA 1ANEA 2A0QB 3BTKE 2P93A 1PPZA 2ZDKA 4UE7H 1OYQA 1UVOA 4Q7ZA 3V0XA 2A31A 1MKWH 2PKSC 1GCTC 4VGCC 2QA9E 1S84A 2DE9A 1XXDA 5PTPA 4KTUA 4JZ1A 2J4IA 3S69A 1AIXH 1TA2A 4RSPA 1O3NA 1W7XH 3E6PH 1SHYA 2Q6DA 2GKVE 4YLQH 1EZSC 1P04A 3CENA 1G32B 1NRQH 4ZH8A 3GDUA 4K1EA 3A8BA 1OOKB 4XOJA 1MTNC 3MU0A 1T7CA 1D3QB 1HAIH 1Q3XA 4X2YA 2Q6GA 3A7XA 3NWUA 1BTHH 1O37A 2A2QH 4JCNA 1V2QT 4ZMAH 1IQJA 5LPEA 1F0UA 1GGDC 3RMMH 4R8TB 3RXKA 1L1NA 3BTME 2BB4A 3K6YA 4AFZA 2ZQ2A 4CBOA 1ANBA 1CHGA 3BV9B 4NA7A 3VXEH 4FUHA 2VJ1A 4ISNA 1GJDB 3UIRA 1JBUH 5AHGH 3A83A 1C9PA 8LPRA 2ZFTA 3TJUA 5GWZA 1NPMA 4UFDH 1JMOH 2QIQA 1BRUP 2HPQH 3F1SB 2H1UA 2PSXA 4Y7AA 1EOLA 1ZSKA 3SGBE 1C1SA 2XNIA 1AFQC 1V2LT 4D8NA 1B0EA 1C2IA 2V0BA 1E36B 1C5XB 1PPBH 4D76A 5FPTA 2A4QA 4SGBE 1ANCA 2ZF0H 3GISB 2BD8A 1O3PB 3SGQE 3P17H 2O8UA 1K1JA 1O3GA 2ZI2H 1LHCH 1GI8B 1ZTLA 4AFQA 3EA9A 4X2WA 4ZKOU 4OS1A 1WV7H 1YKTA 2ZTXA 1W3CA 1VITH 1TGSZ 2HRVA 3A82A 5C1XA 2FEQH 1KDQA 3TK6A 2W7UA 4Y11E 1F7ZA 1Z6EA 1C5RA 2WV5A 2A45B 4ABDA 5AFYH 2FOFA 3BTGE 1DY9A 1F5LA 2XC4A 3P8NA 4X6MA 4BNRA 1AGJA 4CBNA 1EP6A 3MNXA 1W0YH 2Q6FA 1HAVA 2AMQA 1UO6A 5AFZH 1ZPZA 1C1TA 1N1LA 1G3CA 1JWTA 4AFUA 4X1NU 7KMEH 1CT4E 3T2NA 1FY5A 2D1JA 1OWHA 1J8AA 4GCHG 2ZZUH 1NU7B 3M37A 1YP9A 5GCHF 3KHVA 3MU8A 1EAIA 2Z3EA 2OLGA 1CA0C 1ZMJA 3LPRA 3NKKA 3SU1A 4RN6A 1H9HE 2FYQA 1EJAA 1TGTA 1QQUA 4XE4A 3A7ZA 1O2IA 3OSYA 2PGQB 2NWNA 4DG4A 2O8WA 1AD8H 2V35A 2ZCHP 2STAE 2AYWA 2V3HH 2BDAA 2P3TB 4FU9A 1ZYOA 1SGDE 1SC8U 3SUFA 1A5IA 2Y7XA 1TE0A 2CGAA 1N8OC 2ZGHA 1YCPH 2ZDLA 3GOVB 2W7SA 2ZFRH 4HTCH 4B2CA 1S82A 1NROH 2Z9GA 1TABE 1SLWB 1VJ9U 3PV4A 1W7GH 4WMFA 4NIVA 2PKSB 1XVMA 3EAJA 2FMJA 5EODA 2B9LA 3SHCH 1C5VA 3GY7A 1E38B 2A7CA 3MNSA 1AKSB 2GMTB 3E90B 1P2NA 2FTLE 1V2ST 1GMCG 2ZDMA 2RG3A 2R9PA 5F8TA 5DPAA 3RC4A 1EB2A 4INLA 1QRXA 1GHBG 1DXWA 2WV4A 3A87A 1GBEA 2PFEA 1C1QA 1O34A 2R0LA 2BHGA 2FIRH 4Y0YE 1O2NA 2GV7A 1O3OA 1MKWK 1OP0A 1JIMA 1AU8A 1EZQA 4X2XA 2F9VA 2FOAA 1WTGH 2ZC9H 3FAOA 4X8UH 1WOFA 2GCHG 2FXRA 5EXNA 1YF4A 3W94A 1THPB 1SQAA 3RXJA 4DT7B 1TGCA 4E05H 1DITH 2QXHA 1BTWA 4YLUA 3S0NA 1C1NA 2O8TA 3AW0A 4IC5A 1GJAB 1Y3YA 3HGPA 1BBRE 4NZQA 3GY5A 1T8LA 3BG4B 3V3MA 3QLPH 1GI2A 3M5LA 8ESTE 2BMGB 2PHBA 1C4V2 1PPEE 4Y71A 3LH1A 2OC1A 1T32A 2BQ7B 3BTWE 3ZZ6A 1AE8H 1THSH 1A4WH 2Y82A 1K1MA 1IOEA 2CXVA 4UONA 2OINA 1BTXA 1FY4A 2H9TH 1UVPA 3LGYA 2FPZA 1GI7B 3EQ0H 2G4TA 1AI8H 3LJOA 3S9BA 1GBTA 3PB1E 4UFFH 3TIUA 2EI7A 5CMXH 4MLFB 2FS8A 4Y8ZA 2VIWA 1F0RA 4GPGA 1DWEH 4ZHMU 2HNTF 5TJXA 3SBKA 8GCHF 1C1VH 1O3KA 4JZDH 1OWIA 1EX3A 1Z1IA 1F5RA 1LHFH 1O31A 3RXSA 3GCNA 2FODA 1MUEB 1G3EA 1GJ5H 4ZHLU 3P70B 1TLDA 2G55A 3C1KA 1PPFE 6CHAB 1SBWA 3K9XB 1FN8A 2BY8X 2SGDE 1YPKH 3ZVFA 3A81A 2ZPQA 3HKIB 5DP3A 4KELA 3QK1A 5EQRA 3RC5A 1C1MA 2ZHEH 4ZAEA 3SU3A 1CVWH 1QFKH 4OS7A 3SUDA 2AMDA 3ZZ7A 1LDTT 2BD7A 3TK9A 2Z9IA 2VB0A 1FY1A 5F03A 3AVZA 1CT2E 4WH6A 1C5UA 2G5NA 2SGQE 1S6FA 2F91A 1O30A 1C2KA 4Y8XA 4CRDA 1IQFA 1TPPA 1MKXH 5A09A 1OP8A 1C5ZB 1C5PA 3VGCC 3NXPA 1TBQH 3M5MA 1OXGA 5T3HA 4E06H 3VB7A 2FOMB 1LVYA 2GTBA 1K22H 2CV3A 4AYVB 1P3CA 3SU6A 2ZFPH 1RJXB 2KAIB 1DE7H 1TQ0B 4ISOA 5J4SA 3B9FH 2CF9H 1C2GA 2ZGXH 5C1YA 3SI4H 1RS0A 4K8BA 1DUAA 2ZDVH 1GHYH 1UMAH 1QNJA 3SV7A 1BBRK 4CRBA 4ABBA 2B8OH 1LKBA 2TBSA 1QJ1B 3QDZB 1MAYA 1O5GH 3NUMA 2GMTC 1GI1A 1TPSA 2ULLA 3LGIA 2BOKA 3ZZDA 2FI4E 1PJPA 1NRSH 2BD5A 1X7AC 4TY6A 1S0RA 1QB1A 4AB8A 2A4OA 1T8OA 3L33A 1FPHH 5F6MA 3C27B 4M7GA 1C5LH 3MO6A 2Z3CA 3P8FA 2XCFA 4MNXA 1BBRH 2WPIS 4A1XA 2K7XA 1FPCH 1DWBH 2G52A 1CSOE 3A88A 1TNIA 2FWWA 4KTSA 2FOHA 1PQ5A 2BDIA 2ODYB 2UWLA 2SGEE 1QY6A 5DP5A 4YO9A 1DWDH 1QL9A 4YM9A 2WPLS 3G01A 4B75A 3UOPA 1FV9A 1G2MA 3ZV8A 1TONA 3KIDU 1AN1E 1NFWA 1WBGB 2FO9A 4WVPE 1IQNA 1GBFA 5CHAC 5GXPA 1AVWA 3LGTA 1C4U2 1FI8A 1ZRKA 2ANYA 3SNBA 1C1OA 1NRNH 3M7UA 4B1TA 1ACBE 1T31A 2TGDA 3ZZ3A 1V6DA 1WYKA 5JBTA 3BTHE 4CH8B 3ELAH 1W13U 3A7WA 3UNQA 1MMJN 2C3SA 2J38A 3M35A 5E0GA 3OYPA 3PMHB 4A1TA 5JBAS 1QA0A 4INKA 1MZDA 3VPKA 2Z3DA 1EOJA 2O8LA 2B7DH 3Q77A 1KY9A 1DY8A 1ELFA 1ID5H 1CHOG 3LDXH 1EAUA 3TGJE 1MCTA 3I29A 5EQSA 1GBDA 2GVFA 1L0ZA 4Q7YA 3UWIA 3PWCA 2XBYA 1K1IA 1HCGA 4MPXA 2ALVA 2AERH 1O5EH 3K65B 4GAWA 2ALPA 3VB3A 1L4DA 3H7OA 4ZROA 2ZA5A 1W2KH 1BZXE 5C5NA 5FXLA 1GJBB 3PWBA 1A0LA 2BLOA 1VR1H 4Y6DA 2OQUA 3GYMA 3EYDA 4NA9H 4O3TA 1GMCF 1QBOA 3B23B 1OWKA 2VIOA 2VNTA 2BD9A 1O3AA 3ZVAA 5E8EH 1GL1A 3UTUH 2OBQA 1OX1A 4U30A 1GHBF 1W0ZU 1V3XA 5DP6A 1TRMA 2PV9B 8KME2 3S9CA 1AUJA 4ABFA 1MTVA 2H9HA 4X8SH 3TNSA 1D3TB 4U01A 2EI8A 3ZVEA 4X2VA 3RXGA 1MAXA 2QXJA 1EKBB 3GDVA 1N6XA 1O33A 3KEEA 1GBAA 2V3OH 5JPMH 2BY5X 3Q3KA 2EI6A 4B2BA 1GCDA 1GI0A 1RTKA 4FUFA 2FX4A 2WINI 1KXCA 3PMAB 4ZXXH 2BVRH 2NU4E 4OGXA 1Z8RA 2Q1JA 1WUNH 1Y3VA 3U98H 4JYTA 2AGGX 1BIOA 5C20A 3O8DA 5DKMA 2A7HA 3D23A 1OSSA 1K1OA 1CA0B 2C8ZB 5EW1H 1UK4A 2ZU3A 1TPAE 1T4UH 1XXFA 5LPRA 3JZ2B 1O38A 2A2XH 2PKAA 1F0SA 1VJAU 4CRAA 1FY3A 1V2NT 1P2OA 2QXIA 3FP6E 1N8OB 5A0BA 3E3TA 3K6ZA 1FAKH 1SLXB 4I8GA 4IMZA 1AE5A 3URCA 1EPTC 2Z94A 3TGIE 3RXOA 1T8NA 1LHEH 2SGPE 1GBIA 1TGNA 2VWNA 2ZU2A 1FY8E 1XMNB 4LZ4B 1VITG 4JZIA 4DY7B 1AQ7A 3BG8A 2LPRA 4QT8C 1GMHG 1WTHD 1SGFA 5GJ4B 1LPZB 3SI3H 3PLPA 1GI6A 1TX8A 1TX6A 3UQVA 1GHXH 1SG8B 1Z6JH 2JH6D 2R3YA 4MVNA 2O9QA 1G3BA 3SUGA 1QA7A 3URDA 3GICB 4UEHH 2PGBB 1BRBE 1MKXK 1WU1A 2BDCA 2I6QA 1O2KA 5L30H 1RXPA 1P11E 1TMTH 4K60A 3VB6A 1KLIH 1L2EA 2D2DA 1QBNA 4X1PU 3MH4A 3LC5A 1XVOA 4NSVA 1TYNA 4Z6AH 3BTDE 3T62A 2GT8A 1GJ8B 3ZVDA 4UFEH 4FUDA 2F83A 2CHAB 1TWXB 2VINA 2P16A 2UUYA 4O97A 1AB9C 3QWCH 1P2KA 2OXSA 5GIBA 1SGTA 1EASA 1KLTA 2UWPA 4XDEA 1SQOA 5B6OA 5AVDA 1EQ9A 1ORFA 1TNKA 3BTFE 5E0JA 3SQEE 2RA3A 1GVKB 1NFXA 1C5WB 1G37A 1SGFG 1QB6A 1SVPA 3RMNH 3RXQA 1OPHB 2ZPRA 1ELBA 3U69H 2EA3A 1V2WT 1VZQH 2OC0A 2F9OA 1D6RA 1UTPA 1A1RA 1B0FA 1QR3E 1HJ8A 3MH5A 1CGIE 2WYJA 1AMHA 1G2LA 1LMWB 6GCHG 4NGAH 4U32A 1YPEH 4ASHA 1O5BB 1VCWA 2QN5T 2XWAA 1P05A 3UNSA 2ILNA 1RIWB 1TOMH 1QRWA 2Z9JA 1AO5A 1DPOA 3BTQE 1ZSLA 5BRRE 1PPGE 1SQTA 2P8OB 3LKWA 1UTKA 2OBOA 1CBWC 3SU2A 4B74A 3LGUA 5A0CA 3OTJE 1L4ZA 1Y59T 1EXFA 3KQDA 1ZGVA 1NRPH 4ISLA 2SFAA 5L2YH 1V2RT 1JOUB 1J14A 2FI3E 1HAXB 3UPEA 1O2VA 1TNGA 1L1JA 3ZZAA 1GL0E 1DVAH 4NCYA 1P02A 2FP7B 2ZKSA 4NIYA 1FDPA 3HGNA 1TQ7B 3UWJH 3NZIA 3ZZCA 1YLDA 1NESE 3T25A 3F9GA 3SV2H 2AIQA 3BG4C 4HFPB 5DG6A 2XBXA 3TNTA 4BTIB 4NG9H 2Z9KA 3GYLB 3K2UA 5A8XA 3A7TA 4YTAA 4B2AA 2BD4A 1UTJA 4GVUA 2UWOA 4I8HA 5FBEA 1EPTA 1O3JA 1O2JA 1O2PA 6ESTA 5C67A 1MU6B 1SI5H 1KYNA 3MTYA 5DK1A 1WCZA 5DP9A 3FFGA 3FP7E 1RRKA 4OS2A 4O9VA 1XX9A 1GGDB 1YPGH 5DP8A 1PQAA 1D6WA 1KXBA 3M61U 4CHAC 3BEFB 3QTOH 3ODDA 4BAHB 1CE5A 1EAWA 3QGNB 4X1QU 4AGKA 3ZYEA 4BTUB 1HUTH 3MOCA 5A2MH 2PKAB 4D9QA 3TLOA 1IAUA 1TNHA 1C4Y2 3VFEA 2VIQA 2CJIA 3T27A 4CH2B 2P94A 1HV7A 2FS9A 2H5DA 4DOQA 2GCTB 3H7TA 4CREA 3SV9A 5F8XA 2TIOA 2FESH 2C93B 3PO1C 3D65E 3SJOA 1UTOA 3SV6A 1GHVH 2BZ6H 1P2IA 1KXDA 1DM4B 2GDDA 3A8AA 1FN6A 2JH5D 4I8KA 4X6OA 3V13A 1O32A 2YNAA 3PTNA 1GBJA 1KLJH 7GCHG 1UTLM 3KQBA 4ZKRU 1FMGA 4K8YA 3PROA 2CF8H 1BHXB 1O3IA 2PSYA 1UCYH 1MCVA 3ZV9A 1HAGE 1TNJA 4K1TA 4WXVA 4WMDA 3IITA 1D3DB 3ODFA 4MNVA 1AVGH 1GHAF 2ZP0H 4WH8A 4X1SU 2ZTYA 2WPMS 2P3UB 1P9SA 3BIUH 1AZZA 1ZJKA 3SU4A 1WQVH 1SGPE 1UK2A 1GBKA 1NN6A 1O3LA 3BTTE 1G9IE 2OUAA 2WPJS 4H6TA 1BTYA 3NCLA 2OQ5A 1D9IA 1O39A 1A61H 5FPYA 4AN7A 4BAKB 3MO9A 3P95A 1P10A 2ANKH 4IN1A 5EGMA 1TMBH 3AASA 1LPGB 2Y5FA 4XSKU 1T8MA 1TGBA 3DT0H 2J34A 5J4QA 2J95A 1NU9A 4DCDA 1C5SA 1HJAB 2FI5E 3RXPA 3ZZBA 2Y81A 1V2TT 2LNCA 1GBMA 1SFQB 2QF3A 3A80A 1GI5A 1MTUA 1XUIA 1ELGA 1HDTH 1O3HA 2O8MA 2TPIZ 3ZVBA 3AAVA 1QCPA 2VGCB 3F9EA 2ZIQH 5FCKA 4MNWA 2F9BH 4AFSA 4AG2A 1THRH 1GCTB 4VGCB 1KSNA 4KKDA 5L6NH 1UVSH 2D8WA 2OCVB 2FYRA 1Z8IB 1LPKB 3QTVH 4RKJB 5TCCA 3M3TA 4GHTA 1NFUA 2VVVA 4E7NA 1GDUA 5K0HA 1DOJA 1XUKA 2QYIA 5I46H 2ZHFH 2CN0H 4BTTB 3BEUA 3MO3A 1SSXA 3UNRA 2VIVA 2NU1E 1BMNH 3MFJA 2ZGJA 2ZHQH 1NS3A 1C5TA 3JZ1B 3Q00A 5DP4A 1INCA 1AWFH 4Y8YA 2XC5A 3HK3B 1GMHF 5EU8A 1O35A 4ABJA 2GZ8A 1S85A 4KP0A 2OP9A 1O2XA 1BDAA 1UVUH 3U8OH 1TPOA 4NA8A 3SGAE 5EXMA 2GZ7A 1C2HA 1LVOA 2R0KA 4U2WA 1YPMH 1GDNA 1BRAA 2BX4A 1HLTH 3A89A 1P0SH 4K2YA 3SUEA 1XKAC 1HIAB 1HJ9A 2ZGBH 2PUXB 3PTBA 4MPUA 1FXYA 4BAQB 1C2EA 5JB9S 4JYVH 1OKXA 4WF8A 3D49H 1UCYE 2A4GA 4CHAB 1A2CH 2UUFB 2BXUH 2KAIA 1AFQB 1IHSH 1NY22 3KQCA 1M9UA 1V2OT 1ZRBA 4Y7BA 1C5MD 1PYTC 2R2WU 2ZG0H 2VWMA 2AIPA 4OS5A 1Q2WA 1Q31A 2P59A 3F68H 1O2MA 3PYHA 4ABHA 4A92A 1ZTKA 3UR9A 1VGCC 4DW2U 5ABWA 1CHOF 1GPZA 3MMGA 5GPIB 2Y7ZA 1OWJA 3N7OA 2XBWA 5DP7A 1F5KU 1NO9H 1LHGH 4GSOA 5EPNA 1SPJA 3RXDA 1ELEE 2THFB 3T26A 5FPSA 1V2MT 5SGAE 1IQLA 4BANB 1MTSA 3UUZA 1EZUC 4OS6A 4A7IB 2Y5GA 3V12A 1W14U 2WUBA 5HMAA 2ZTZA 3A7VA 4K1SA 2G8TA 4D7FA 1ZR0A 2BDYA 1GJ4H 4WY3A 3S7HB 4OS4A 4X1RU 3MHWU 1QGFA 1P2JA 1QTFA 5DO4H 1YCPK 3RP2A 4BXWA 3QUMP 2FX6A 3PMJA 1BB0B 1K2I1 2G4UA 3LT3A 1C9TA 1BJVA 1GBHA 1K1LA 3P8GA 1UCYK 1C5OH 4Y76A 1J17T 1E34B 2ZU1A 1ESBA 2BZAA 1S81A 4LZ1H 4LK4A 1YPLH 4KGAA 3IWMA 3GY3A 3MWIU 3PLBA 3KF2A 1ZJDA 2BY6X 2ASUB 2STBE 2XBVA 1XUGA 1WQSA 2GP9B 1AUTC 2H6MA 3RU4D 3CS0A 4ESTE 3GCTG 2ZEBA 5GDSH 5AF9H 2BLVA 4WJG2 1E0FD 2Y5HA 4ZUHA 1A46H 2R2MB 9LPRA 4K3JA 1L1GA 1DICA 1EJNA 3SW2B 1W12U 3ITIA 4TPIZ 5EOKA 1C1PA 2F9UA 4FUBA 1O3EA 4MNYA 1SGEE 2C8WB 1YPHE 1MTWA 2VVCA 4CR9A 3QX5H 1CGHA 4I8JA 1ZGIA 1EAXA 5A0AE 2VIDA 1ZHPA 1D4PB 4THNH 5E2PA 4YESB 3EDXB 3MU4A 1TNLA 1RIWC 5FAHA 1ELAA 1HAYB 2XYAA 3R3GB 2FOCA 3GY6A 5HGGA 1DDJA 1GI9B 1HIAA 1UHBB 4I7YH 3D62A 4BOHA 3RXHA 1XUJA 2QAAA 1SLUB 1MU8B 4FU7A 4AX9H 3T29A 1DWCH 3SO3A 4CRCA 5EPYA 2BDHA 4FUEA 2I6SA 1BQYA 4IS5A 3BEIB 3GY8A 1H8DH 3W95A 1MTNB 1K28D 3QO6A 3KN2A 3AW1A 1P9UA 3RU4T 3SNCA 4XFQA 2PUQH 1DXPA 2WPHS 1BHXF 1VCQA 3OY6U 1AWHB 2GGVB 3B8JA 1QJ7B 2PLXA 1S6HA 5FX6A 4X8TH 3F6UH 1HAVB 1KTSB 3RXLA 1FLEE 5ESTE 2BYAX 3SNEA 2ZU5A 4F4OC 2C90B 1CQQA 1SHHB 2NU3E 4JMYA 1SL3A 1HPGA 1BITA 1IQGA 1K9OE 4X8VH 1C2MA 1QJ6B 5A8ZA 1TBZH 3A8DA 3ZVGA 3E0NB 1O3BA 4BXSA 1C2FA 3MNBA 2FOBA 1BTZA 3IG6B 2ZDAH 1GWAA 3EE0B 4Z0KA 3BSQA 3SJIA 3M5NA 1G3DA 1PQ8A 1LO6A 2V6NA 3SU5A 7GCHF 1YGCH 1ZHMA 5LPFA 2BQ6B 1VCPA 1UJ1A 1C2DA 2BVXH 1TMUH 1BRCE 3LU9B 3HK6B 1LVBA 4SGAE 3WY8A 1ZLRA 5FHTA 3U1IB 1O2UA 2VVUA 2PTCE 1KTTB 1GI3A 1HXFH 2Y6TA 5ESBA 4IMQA 4HGCA 4FUGA 3MI4A 2R3UA 3U8TH 4B76A 1SGCA 4NWKA 2DE8A 3GCHC 4J2YB 4I32A 4CR5A 2IN2A 3VB5A 2K1QA 2TGTA 3ZVCA 1SMFE 5DGJA 1MH0A 1DT2A 1H9LB 1LHDH 3E91A 4DIIH 3H5CB 1BCUH 1O2WA 1MQ6A 4Q7XA 4MDSA 1GJ7B 1ABIH 1MQ5A 2ZU4A 1SB1H 4ISIH 2OTVA 4ZKNU 4O3UA 1O3MA 3DFLA 1WSSH 1QL7A 1SR5C 1Z8JB 2GDEH 2XCNA 4O03A 2VH6A 3BTEE 3EA7A 2BXTH 3ENSB 3RM2H 3RM0H 2BOHB 1HFDA 1Z8GA 1O3FA 5T6FA 1NC6A 2BDGA 2FDAA 3T5FH 4UDWH 2A5AA 1O3DA 1H9IE 5JB8S 3TH4H 2P3FH 3FVFB 1GJ9B 1W8BH 4JZFH 5IDKA 3M36A 2Z9LA 1F92A 2OC8A 4X0WU 4I8LA 3M7TA 1NFYA 1HGTH 4FVBA 3O8RA 1C5YB 4AZ2B 1FIZA 3ZYDA 1BMMH 1P57B 1RD3B 1QQ4A 4F49A 2HPPH 4B71A 1A0JA 3SORA 4LXBH 4GUXA 2NU0E 2XW9A 1UTQA 1GBBA 3ATWA 3NPSA 1DANH 1GG6C 1EZXC 1NTPA 4H6SB 4YT6H 2FLRH 2IOTA 3SHAH 3MH7A 2TGAA 3TVJB 2NU2E 5EW2H 1HAOH 2PR3A 4OGYA 1Z1JA 3E8LA 2YOLA 4NZLA 1KDQB 1HAZB 1E37B 1F0TA 3M3VA 1BTPA 1ABJH 3QN7A
chains in the Genus database with same CATH superfamily
2AHME 1GG6B 2H2ZA 2BD3A 3UOUA 5C5OA 2A5KA 4MPVA 1QHRB 3RXRA 1WAYB 3LH3A 4YOIA 4GLYA 3TJNA 4X6NA 1TRNA 3A85A 1NRRH 3RXUA 3SN8A 1EB1H 3I77A 2J94A 1SGRE 1TALA 2ZFFH 3TH2H 3FZDA 1Y5AT 4DJZB 1OWEA 2M5TA 2ZQ1A 3TH3H 1HAHH 3DA9B 2KCOA 4B6EA 1GHAG 5JDUB 1ETRH 1DUEA 5FL7D 2C4FH 3L6PA 3ZZ9A 2H9EH 1LTOA 1YLCA 2J9NA 4UFGH 3GDSA 2FOEA 3Q76A 1O5CB 5T6DA 3UFAA 5H4IB 1IQEA 1FUJA 3LIWA 1QL8A 3MU1A 3KGPA 1QURH 4I86A 2G51A 2XXLA 2VH0A 5EQQA 1GJ6A 2W26A 1IHTH 3VXFH 1OP2A 1P2MA 3FZZA 2QC2A 3VEQB 4ABEA 1KXFA 3PMBB 1S5SA 1A5GH 1DFPA 2QGRA 2QV1A 1IQMA 5EXLA 7ESTE 1OHHD 3ATMA 4F48B 5I25A 1UK3A 3SJ9A 1PFXC 6CHAC 1IQKA 1O5AB 4ZKSU 1PYTD 2A7JA 4AORA 1ZMNA 4ISHH 5EG4A 4CRGA 2AGEX 1C5QA 4RKOB 1NM6A 1GJCB 1P3EA 1SFIA 1TA6A 2IJOB 4NWLA 1AZ8A 2FM2A 3EGKH 2Z7FE 2QY0B 2AEIH 3E0PB 1MBQA 2BLWA 3AAUA 3GCHB 3FP8E 2F9PA 4WMEA 1ELVA 1K21H 3UREA 1ZMLA 1ZHRA 1TX7A 3F9FA 2ZPSA 4UD9H 3TPIZ 1ANDA 1O5FH 3VGCB 1HRTH 4Y0ZE 1FJSA 6LPRA 4Y10E 4AYYB 3SJKA 3SNAA 1O2RA 1HYLA 3UQOA 1A3EH 4TYDA 3PLKA 3U1JB 3P6ZB 3QN7A 2OK5A 2SGFE 1T4VH 2ANWA 1GVZA 2HALA 3SOSA 2HOBA 4TWWA 3STIA 3SZNA 1NBMD 1ZOMA 2W6JD 2ZHDA 1ESAA 3TK5A 2YNBA 3P92A 5CE1A 3HATH 1O3CA 3TITA 2AFQB 1TIOA 1OWDA 2G00A 1VITF 3OU0A 4Q2KA 2BD2A 3GY2A 2BQWB 1FQ3A 1AY6H 4X6PA 3LGWA 2C8YB 2GX4A 2QCYA 1XKBC 5C3NA 4J1YA 3ZZ8A 1H8IH 2W3IA 3S9AA 2HLCA 4XBDA 1GVLA 1HBTH 2BTCE 1DX5M 1FIWA 1WXRA 1O5DH 4YOJA 2ZNKH 3KCGH 1AKSA 1H8ED 1G36A 3EBNA 1YWUA 2J98A 3RLWH 1VGCB 2AS9A 3RXVA 5CHBA 3RMLH 3SQHE 1SGIB 4I33A 4DGJA 3DUXH 2F9NA 1O2ZA 4FUJA 1MD7A 2BVSH 5HIYA 2ZO3H 3STJA 3QZQA 5DJ7A 3A8CA 3PV5A 2AGIX 1PPHE 1DS2E 1EUFA 4XBCA 1UTNA 1V2PT 2A1DB 5C1UA 5K7RA 5FBIA 1ZTJA 4FU8A 5HM2A 4K5ZA 1O2OA 4ZXYH 9ESTA 1H4WA 3RXBA 3RMOH 3TGKE 1K1NA 1O0DH 4GHQA 4H4FA 4AG1A 2G5VA 5T1VA 1XUHA 3PM3A 2HGTH 5G4BA 3LC3A 3A86A 4B73A 4Y79A 1O2HA 2PTNA 1RFNA 1SGQE 2PW8H 1BMAA 3Q3YA 4HI3A 4JK5A 4BAOB 3DD2H 3RU4E 1O2SA 1VKYA 3TJOA 2VIPA 3A84A 1FONA 4ABGA 1BA8B 2AH4X 3PO1B 5IYTA 4A5TS 2FOGA 4DURA 1CO7E 2WZQA 2ESTE 3TU7H 3R0FA 2XC0A 4NFEA 1SOZA 2BM2A 4ZHAA 1GMDF 1O2YA 1HAPH 3HKJB 3GCTF 1U6QA 4AC9A 2ZECA 4MTBA 2FLBH 2JH0D 5FCRA 1E1QD 4JYUH 2B5TB 5E0HA 3SU0A 1TRYA 1V2KT 1YBWA 2BY9X 2P95A 3A7YA 2Z6BD 3RXFA 2RCEA 5FX5A 1O2LA 4YZUA 5JBBS 1YPHC 3RXAA 1JIRA 3L3TA 1KIGH 4ABIA 3LONA 4PROA 1Y8TA 1FZZA 5HM9A 2GD4B 2ZHWH 3LJJA 1N6YA 3BN9A 4TWYA 1C2JA 1P03A 4TY7A 4KTCA 1Z7KA 1J9CH 2ZWLH 3NK8A 1B7XB 1ETTH 2ZFSA 1J16A 3W1EA 4GCHF 4E7RG 1HB0B 1TFXA 2ZGCA 1O36A 2VWLA 3KL6A 2J5UA 1DLEA 1GDQA 4MG3A 5L2ZH 1DSUA 2VBCA 2ANMH 2RA0A 2ZDNA 1NZQH 2FTMA 1ELTA 1PPCE 2P8OC 1ESTA 1HXEH 1P8VC 2GV6A 2H5CA 2W3KA 3O8BA 2WUCA 3KNXA 4WWYA 4NIWA 1EATA 7LPRA 3M7QA 1CGJE 1A0HB 3E1XB 2PWXA 1P01A 1ARBA 1DLKB 1ZPCA 3Q3XA 4ABAA 2FZZA 1KXEA 3ESTA 5TCAA 2HWLB 2JETC 5BPEA 2ZFQH 1Y5UT 2BDBA 3LGVA 3FANA 2TRMA 1GMDG 1RTFB 4XBBA 2XTTB 4IGDA 2JDID 1Z71A 3UY9A 3RDZA 2GCHF 1P09A 1ARCA 2RDLA 1TAWA 1KMHB 3M5OA 2SNVA 1QRZA 1A5HA 1WDIA 1CT0E 1RGQA 2BLQA 3HPTB 1LVMA 3TJVA 1MD8A 1ZPBA 2G81E 1F2SE 1AHTH 5ETXA 1O2TA 1SQRA 1FAXA 1P06A 2ODQA 1EJMA 1GBCA 2AMPA 4BAMB 4CRFA 3RXIA 4NSYA 4D9RA 1YC0A 3I78A 1BUIA 1NBME 1S83A 3E16B 1CBWB 4RT1A 1DSTA 1S0QA 2W5EA 3MU5A 1K1PA 1KXAA 3RUOA 1SLVB 1EP5A 2ODPA 3CS7A 1PQ7A 4YOGA 3ZZ4A 3M3SA 1W0JD 5T6GA 1B5GH 3BIVH 3EA8A 2QXGA 4IW4E 1JXPA 2CMYA 1OYTH 6GCHF 2GZ9A 5HYOA 1MBMA 3RXEA 4IBLH 5C2ZA 2HNTC 2J92A 3MYWA 3ATLA 4I31A 2TGPZ 1O2GH 4DVAU 1O2QA 1OS8A 2SNWA 3OY5U 2BX3A 4NIXA 2BY7X 1QIXB 2C8XB 1YCPM 3CP7A 1HNEE 1BT7A 1ZSJA 5E2OA 1ELCA 2ZCLP 1C1UH 3BF6H 1J15A 1CA8B 2EC9H 1C1WH 1E35B 1SOTA 1GHWH 4B6FA 2UUJB 1ETSH 1QB9A 1YM0A 4TPYA 1W11U 3VB4A 4JZEH 3MH6A 4MQAA 4WXIA 3RXTA 4AB9A 2DUCA 1C5NH 5GCHG 4A6LA 1JRTA 4DIHH 1YYY1 2D26C 2VWOA 4HZHA 3QGJA 2ZCKP 3LOXA 3O8CA 3RLYH 2WPKS 4LOYH 4K69A 1EPTB 4FUIA 2GT7A 1ZZZA 3ZIAD 1UHBA 1V2UT 1XM1A 2EY4C 4JK6A 1MZAA 3ZZ5A 3P8OA 2HNTE 3ATIA 1A7SA 5A8YA 1BMLA 3OFND 2JKHA 2OC7A 3S7KB 2SGAA 1AVXA 1QBVH 2VU8E 2GCTC 1ELDE 1P2QA 1RTLA 1GHZA 5F53A 3ATKA 4NFFA 1BTUA 1BOQA 2WYGA 1LQDB 1W10U 3UR6A 2F3CE 4FUCA 4A1VA 3SV8A 3OX7U 4YT7H 3DFJA 4H42U 4AOQA 2LIZA 4FVDA 1YPJH 4AGJA 1FNIA 1V2VT 3RXCA 5F8ZA 1AB9B 1C2LA 3U9AH 2XWBI 2HVXA 1GBLA 2UUKB 5CHAB 1BJUA 4R0IA 2XRCA 1SGYE 1C1RA 8GCHG 1UTMA 2EEKA 1G30B 1HJAC 5LH8A 1TBRH 2WPDD 2A4RA 1IQHA 2CHAC 1A3BH 3DHKH 1CU1A 3F9HA 2VGCC 3V7TA 4Q80A 3QZRA 1IQIA 4FXGH 4D7GA 5JYIA 1AFEH 3OEHD 1P12E 2B0FA 2IPHA 2OD3B 3FO8D 1TOCB 3SNDA 1UVTH 1Y5BT 4IC6A 4M9FA 5HXFA 1TB6H 3T28A 1GI4A 1H1BA 1LCYA 4IN2A 1Y3WA 3MNCA 2JETB 1Y3UA 2A5IA 1NT1A 2M2AA 2J2UA 2Y80A 2A32A 1JRSA 5LGOA 1D3PB 1SGNE 1XUFA 1V2JT 3NRLA 3SJ8A 1Y3XA 1LKAA 3GCOA 3RC6A 3RXMA 3GY4A 4INHA 2QF0A 3N99A 3U8RH 1LQEA 3KQEA 5JBCS 4MPWA 1ANEA 2A0QB 3BTKE 2P93A 1PPZA 2ZDKA 4UE7H 1OYQA 1UVOA 4Q7ZA 3V0XA 5C0UA 3F2FA 2A31A 1W0KD 1MKWH 2PKSC 1GCTC 4VGCC 2QA9E 1S84A 2DE9A 1XXDA 5PTPA 4KTUA 4JZ1A 2J4IA 3S69A 1AIXH 1TA2A 4RSPA 1O3NA 1W7XH 3E6PH 1SHYA 2Q6DA 2GKVE 4YLQH 4TT3D 1EZSC 1P04A 3CENA 1G32B 1NRQH 4ZH8A 3U28C 3GDUA 4K1EA 3A8BA 1OOKB 4XOJA 1MTNC 3MU0A 1T7CA 1D3QB 1HAIH 1Q3XA 4X2YA 2Q6GA 3A7XA 3NWUA 1BTHH 1O37A 2A2QH 4JCNA 1V2QT 4ZMAH 1IQJA 5LPEA 1F0UA 1GGDC 3RMMH 4R8TB 3RXKA 1L1NA 3BTME 2BB4A 3K6YA 2KCYA 4AFZA 2ZQ2A 4CBOA 1ANBA 1CHGA 3BV9B 4NA7A 3VXEH 4FUHA 2VJ1A 4ISNA 1GJDB 3UIRA 1JBUH 5AHGH 3A83A 1C9PA 8LPRA 2ZFTA 3TJUA 5GWZA 1NPMA 4UFDH 1JMOH 2QIQA 1BRUP 2HPQH 3F1SB 2H1UA 2PSXA 4Y7AA 1EOLA 1ZSKA 3SGBE 1C1SA 2XNIA 1AFQC 1V2LT 4D8NA 1B0EA 1C2IA 2V0BA 1E36B 1C5XB 1PPBH 4D76A 5FPTA 2A4QA 4SGBE 1ANCA 2ZF0H 3GISB 2BD8A 1O3PB 3SGQE 3P17H 2O8UA 1K1JA 1O3GA 2ZI2H 1LHCH 1GI8B 1ZTLA 2IPQX 4AFQA 3EA9A 4X2WA 4ZKOU 4OS1A 1WV7H 1YKTA 2ZTXA 1W3CA 3WW7A 1VITH 1TGSZ 2HRVA 3A82A 5C1XA 2FEQH 1KDQA 3TK6A 2W7UA 4Y11E 1F7ZA 1Z6EA 1C5RA 2WV5A 2A45B 4ABDA 5AFYH 2FOFA 3BTGE 1DY9A 1F5LA 2XC4A 3P8NA 4X6MA 4BNRA 1AGJA 4CBNA 1EP6A 1SKYE 3MNXA 1W0YH 2Q6FA 1HAVA 2AMQA 1UO6A 5AFZH 1ZPZA 3FKSD 1C1TA 1N1LA 1G3CA 1JWTA 4AFUA 3CNRA 3F3BA 4X1NU 7KMEH 2XNDD 1CT4E 3T2NA 1FY5A 2D1JA 1OWHA 1J8AA 4GCHG 2KR7A 2ZZUH 1NU7B 3M37A 1YP9A 5GCHF 3KHVA 3MU8A 1EAIA 2Z3EA 2OLGA 1CA0C 1ZMJA 3LPRA 3NKKA 3SU1A 4RN6A 1H9HE 2FYQA 1EJAA 1TGTA 1QQUA 4HG6A 4XE4A 3A7ZA 1O2IA 3OSYA 2PGQB 2NWNA 3PRBA 4DG4A 2O8WA 1AD8H 2V35A 2ZCHP 2STAE 2AYWA 2V3HH 2BDAA 5KECA 2P3TB 4FU9A 1ZYOA 1SGDE 1SC8U 3SUFA 1A5IA 1QZ8A 2Y7XA 1TE0A 2CGAA 2KCAA 1N8OC 2ZGHA 1YCPH 2ZDLA 3GOVB 2W7SA 2ZFRH 4HTCH 5C0TA 4B2CA 1S82A 1NROH 2Z9GA 1TABE 1SLWB 1VJ9U 3PV4A 3SZEA 1W7GH 4WMFA 4NIVA 2PKSB 1XVMA 3DSPA 3EAJA 4F55A 2FMJA 5EODA 2B9LA 3SHCH 1C5VA 3GY7A 1E38B 2A7CA 3MNSA 1AKSB 2GMTB 3E90B 1P2NA 2FTLE 1V2ST 1GMCG 2ZDMA 2RG3A 2R9PA 5F8TA 5DPAA 3RC4A 1EB2A 4INLA 1QRXA 1GHBG 3DSGA 1DXWA 2WV4A 3A87A 1GBEA 2PFEA 1C1QA 1O34A 2R0LA 3OEED 2BHGA 2FIRH 4Y0YE 1O2NA 2GV7A 1O3OA 1MKWK 1OP0A 1JIMA 1AU8A 1EZQA 4X2XA 2F9VA 2FOAA 1WTGH 2ZC9H 3FAOA 4X8UH 1WOFA 2GCHG 2FXRA 5EXNA 1YF4A 3W94A 1THPB 1SQAA 3RXJA 4DT7B 1TGCA 4E05H 1DITH 4RI0A 2QXHA 1BTWA 4YLUA 3S0NA 1C1NA 2O8TA 3AW0A 4IC5A 1GJAB 1Y3YA 3HGPA 1BBRE 4NZQA 3GY5A 1T8LA 3BG4B 3V3MA 2W6ID 3QLPH 1GI2A 3M5LA 2XOKD 8ESTE 2BMGB 2PHBA 1C4V2 1PPEE 4Y71A 3LH1A 2OC1A 1T32A 2BQ7B 3BTWE 3ZZ6A 1AE8H 1THSH 1A4WH 2Y82A 1K1MA 1IOEA 2CXVA 4XRNA 4UONA 2OINA 1BTXA 1FY4A 2H9TH 1UVPA 3LGYA 2FPZA 1GI7B 3EQ0H 2G4TA 1AI8H 3LJOA 3S9BA 1GBTA 3PB1E 4UFFH 3TIUA 2EI7A 5CMXH 4MLFB 2FS8A 4Y8ZA 2VIWA 1F0RA 4GPGA 1DWEH 4ZHMU 2HNTF 5TJXA 3SBKA 8GCHF 1C1VH 1O3KA 4JZDH 1OWIA 1EX3A 1Z1IA 1F5RA 1LHFH 1O31A 3RXSA 4RT0A 3GCNA 2FODA 1MUEB 1G3EA 1GJ5H 4ZHLU 3P70B 1TLDA 2G55A 3C1KA 1PPFE 6CHAB 1SBWA 3K9XB 1FN8A 2BY8X 2SGDE 1YPKH 3ZVFA 3A81A 2ZPQA 3HKIB 5DP3A 4KELA 3QK1A 5EQRA 3RC5A 1C1MA 2ZHEH 4OM9A 2LP6A 4ZAEA 3SU3A 1CVWH 1QFKH 4OS7A 3SUDA 2AMDA 3ZZ7A 1LDTT 2BD7A 3TK9A 2Z9IA 2VB0A 1FY1A 5F03A 3AVZA 1CT2E 4WH6A 1C5UA 2G5NA 2SGQE 3PV2A 1S6FA 2F91A 1O30A 1C2KA 4Y8XA 4CRDA 1IQFA 1TPPA 1MKXH 5A09A 1OP8A 1C5ZB 1C5PA 5DN6D 3VGCC 3NXPA 1TBQH 3M5MA 1OXGA 3EE7A 5T3HA 5GNDA 4E06H 3VB7A 2FOMB 1LVYA 2GTBA 1K22H 2CV3A 3SYJA 4AYVB 1P3CA 3SU6A 2ZFPH 1RJXB 2KAIB 1DE7H 1TQ0B 4ISOA 5J4SA 3B9FH 2CF9H 1C2GA 1UW7A 2ZGXH 5C1YA 3SI4H 1RS0A 4K8BA 1DUAA 2ZDVH 1GHYH 1UMAH 1QNJA 3SV7A 1BBRK 4CRBA 4ABBA 2B8OH 1LKBA 2TBSA 1QJ1B 3QDZB 1MAYA 1O5GH 3NUMA 2GMTC 1GI1A 5DSFA 1TPSA 2ULLA 3LGIA 2BOKA 3ZZDA 2FI4E 1PJPA 1NRSH 2BD5A 1X7AC 4TY6A 1S0RA 1QB1A 4AB8A 2A4OA 1T8OA 3L33A 1FPHH 5F6MA 3C27B 5IK2D 4M7GA 1C5LH 3MO6A 2Z3CA 3P8FA 2XCFA 4MNXA 1BBRH 2WPIS 3F2HA 4A1XA 2K7XA 1FPCH 1E79D 1DWBH 4P02A 2G52A 1CSOE 3A88A 1TNIA 2FWWA 4KTSA 2FOHA 1PQ5A 2BDIA 2ODYB 2UWLA 2SGEE 1QY6A 5DP5A 4YO9A 1DWDH 1QL9A 4YM9A 2WPLS 3G01A 4B75A 3UOPA 1FV9A 1G2MA 3ZV8A 1K0HA 1TONA 3KIDU 1AN1E 1NFWA 1WBGB 2FO9A 4WVPE 1IQNA 1GBFA 5CHAC 5GXPA 1AVWA 3LGTA 1C4U2 1FI8A 1ZRKA 1COWD 2ANYA 3SNBA 1C1OA 1NRNH 3M7UA 4B1TA 1ACBE 1T31A 2TGDA 3ZZ3A 1V6DA 1WYKA 5JBTA 3BTHE 4CH8B 3ELAH 1W13U 3A7WA 3UNQA 1MMJN 2C3SA 2J38A 3M35A 1E1RD 4YXWD 5E0GA 3OYPA 3PMHB 4A1TA 5JBAS 1QA0A 4INKA 4ZCNA 1MZDA 3VPKA 2Z3DA 1EOJA 2O8LA 2B7DH 3Q77A 1KY9A 1DY8A 1ELFA 2J98B 1ID5H 3MQKC 1CHOG 3LDXH 1EAUA 3TGJE 1MCTA 3I29A 5EQSA 3AK5A 1GBDA 2GVFA 1L0ZA 4Q7YA 3UWIA 3PWCA 2XBYA 1K1IA 1HCGA 4MPXA 2ALVA 2AERH 1O5EH 3K65B 4GAWA 2ALPA 3VB3A 2J97A 4ASUD 1L4DA 3H7OA 4ZROA 2ZA5A 1W2KH 1BZXE 5C5NA 5FXLA 1GJBB 3PWBA 1A0LA 2BLOA 2QE7D 1VR1H 3KYGA 2CK3D 2OQUA 4Y6DA 3GYMA 2WHXA 2WV9A 3EYDA 3VG8A 4NA9H 4O3TA 4XD7D 1GMCF 3H09A 1QBOA 3B23B 1OWKA 2VIOA 2VNTA 2BD9A 1O3AA 3ZVAA 5E8EH 1GL1A 3UTUH 2OBQA 1OX1A 4U30A 1GHBF 1W0ZU 1V3XA 5DP6A 1TRMA 2PV9B 8KME2 3WWBA 3S9CA 1AUJA 4ABFA 1YLNA 1MTVA 2H9HA 4X8SH 3TNSA 1D3TB 4U01A 2EI8A 3ZVEA 4X2VA 3RXGA 1MAXA 2QXJA 2JJ2D 1EKBB 3GDVA 1N6XA 1O33A 3KEEA 1GBAA 2V3OH 5JPMH 2BY5X 3Q3KA 2EI6A 4B2BA 1GCDA 1GI0A 1RTKA 4FUFA 2FX4A 2WINI 1KXCA 3PMAB 4ZXXH 2BVRH 2NU4E 4OGXA 1Z8RA 2Q1JA 1WUNH 1Y3VA 3U98H 4JYTA 2AGGX 1BIOA 5C20A 3O8DA 5DKMA 2A7HA 3D23A 1OSSA 1K1OA 1CA0B 2C8ZB 5EW1H 1UK4A 2ZU3A 1TPAE 1T4UH 1XXFA 5LPRA 3JZ2B 1O38A 2A2XH 2PKAA 1F0SA 1VJAU 4CRAA 1FY3A 2KCPA 1V2NT 1P2OA 2QXIA 2KZ4A 3FP6E 1N8OB 5A0BA 3E3TA 3K6ZA 1FAKH 1SLXB 4I8GA 4IMZA 1AE5A 3URCA 1EPTC 5KGOA 2Z94A 3TGIE 3RXOA 1T8NA 1LHEH 2SGPE 1GBIA 1TGNA 2V7QD 2VWNA 2ZU2A 1FY8E 1XMNB 4LZ4B 1VITG 4JZIA 4DY7B 1AQ7A 3BG8A 2LPRA 4QT8C 3OTPA 1GMHG 1WTHD 1SGFA 5GJ4B 1LPZB 3SI3H 3PLPA 1GI6A 1TX8A 1TX6A 3UQVA 1GHXH 1SG8B 1Z6JH 2JH6D 2R3YA 4MVNA 2O9QA 1G3BA 3SUGA 1QA7A 3URDA 2L6OA 3GICB 4UEHH 2PGBB 1BRBE 1MKXK 1WU1A 2BDCA 2I6QA 1O2KA 5L30H 1RXPA 1P11E 1TMTH 4K60A 3VB6A 1KLIH 1L2EA 2D2DA 1MABB 1QBNA 4X1PU 3MH4A 3LC5A 1FX0B 1XVOA 4NSVA 1TYNA 4Z6AH 3BTDE 3T62A 2GT8A 1GJ8B 3ZVDA 4UFEH 4FUDA 2F83A 2CHAB 1TWXB 2VINA 2P16A 2UUYA 4O97A 1AB9C 3QWCH 1P2KA 2OXSA 5GIBA 1SGTA 1EASA 1KLTA 2UWPA 4XDEA 1SQOA 2HLDD 5B6OA 5AVDA 1EQ9A 1ORFA 1TNKA 3BTFE 5E0JA 3SQEE 2RA3A 1GVKB 1NFXA 1C5WB 1G37A 1SGFG 1QB6A 1SVPA 3RMNH 4FETA 1OPHB 3RXQA 2ZPRA 1ELBA 3U69H 2EA3A 1V2WT 1VZQH 2OC0A 2F9OA 1D6RA 1UTPA 1A1RA 1B0FA 1QR3E 3UAIC 1HJ8A 3MH5A 1CGIE 2WYJA 1AMHA 1G2LA 1LMWB 3WWFA 6GCHG 4NGAH 4U32A 1YPEH 4ASHA 1O5BB 1VCWA 2QN5T 2XWAA 1P05A 3UNSA 2ILNA 1RIWB 1TOMH 1QRWA 2Z9JA 1AO5A 1DPOA 3BTQE 1ZSLA 5BRRE 1PPGE 1SQTA 2P8OB 3LKWA 1UTKA 2OBOA 1CBWC 3SU2A 4B74A 3LGUA 5A0CA 3OTJE 1L4ZA 1Y59T 1EXFA 3KQDA 1ZGVA 1NRPH 4ISLA 2SFAA 5L2YH 1V2RT 1JOUB 2WSSD 1J14A 2FI3E 1HAXB 3UPEA 1O2VA 1TNGA 1L1JA 3ZZAA 1GL0E 2JJ1D 1DVAH 4NCYA 1P02A 2FP7B 2ZKSA 5KEDA 4NIYA 1FDPA 3HGNA 1TQ7B 3UWJH 3NZIA 3ZZCA 1YLDA 1NESE 3T25A 3F9GA 3SV2H 2AIQA 3BG4C 4HFPB 5HKKD 5DG6A 2XBXA 3TNTA 4BTIB 4NG9H 2Z9KA 3GYLB 3K2UA 5A8XA 3A7TA 1YY3A 4YTAA 4B2AA 2BD4A 1UTJA 4GVUA 2UWOA 4I8HA 5FBEA 1EPTA 1O3JA 1O2JA 1O2PA 2V3MA 6ESTA 5C67A 1MU6B 1SI5H 1KYNA 3MTYA 5DK1A 4ACBA 1WCZA 5DP9A 3FFGA 3FP7E 4DT4A 1RRKA 4OS2A 4O9VA 1XX9A 1GGDB 1YPGH 5DP8A 1PQAA 1D6WA 1KXBA 4FOUC 3M61U 4CHAC 3BEFB 3QTOH 3ODDA 4BAHB 1CE5A 1EAWA 3QGNB 4X1QU 4AGKA 3ZYEA 4BTUB 1HUTH 3MOCA 5A2MH 2PKAB 4D9QA 3TLOA 1IAUA 1TNHA 1C4Y2 3VFEA 2VIQA 2CJIA 3T27A 2KFWA 4CH2B 2P94A 1HV7A 2FS9A 2H5DA 4DOQA 2GCTB 3FN8A 3H7TA 4CREA 3SV9A 5F8XA 2TIOA 2FESH 2C93B 3PO1C 3D65E 3SJOA 1UTOA 5EIYA 2L74A 3SV6A 1GHVH 2BZ6H 1P2IA 1KXDA 1DM4B 2GDDA 3A8AA 1FN6A 2JH5D 4I8KA 4X6OA 3V13A 1O32A 2YNAA 3PTNA 1GBJA 1KLJH 7GCHG 1UTLM 3KQBA 4ZKRU 1FMGA 4K8YA 1H8HD 3PROA 2CF8H 1BHXB 5C94A 1O3IA 2PSYA 1UCYH 1MCVA 3ZV9A 1HAGE 1TNJA 4K1TA 4WXVA 4WMDA 3IITA 2KM0A 1D3DB 3ODFA 4MNVA 1AVGH 1GHAF 2ZP0H 4WH8A 4X1SU 2ZTYA 2WPMS 2P3UB 1P9SA 3BIUH 1AZZA 1ZJKA 3SU4A 1WQVH 4P00A 1SGPE 1UK2A 1GBKA 1NN6A 1O3LA 3BTTE 1G9IE 1EFRD 2OUAA 2WPJS 4H6TA 3F0OA 1BTYA 3NCLA 2OQ5A 1D9IA 1O39A 1A61H 5FPYA 4AN7A 4BAKB 3MO9A 3P95A 1P10A 2ANKH 4IN1A 5EGMA 1TMBH 3AASA 1LPGB 2Y5FA 4XSKU 1T8MA 1TGBA 3DT0H 2J34A 5J4QA 2J95A 1NU9A 2KX4A 4DCDA 1C5SA 1HJAB 2FI5E 3RXPA 3ZZBA 2Y81A 1V2TT 2LNCA 1GBMA 1SFQB 2QF3A 3A80A 1GI5A 1MTUA 1XUIA 1ELGA 1HDTH 1O3HA 2O8MA 2TPIZ 3ZVBA 3AAVA 1QCPA 2VGCB 3F9EA 2ZIQH 5FCKA 4MNWA 2F9BH 4AFSA 4AG2A 1THRH 1GCTB 4VGCB 1KSNA 4KKDA 5L6NH 1UVSH 2D8WA 2OCVB 4Z1MD 2FYRA 1Z8IB 2QF4A 1LPKB 3QTVH 4RKJB 5TCCA 3M3TA 4GHTA 1NFUA 2VVVA 4E7NA 1GDUA 5K0HA 1DOJA 1XUKA 2QYIA 5I46H 2ZHFH 2CN0H 1S6LA 4BTTB 3BEUA 3MO3A 1SSXA 3UNRA 2VIVA 2NU1E 1BMNH 3MFJA 2ZGJA 2ZHQH 1NS3A 1C5TA 3JZ1B 3DSOA 3Q00A 5DP4A 2K0QA 5HIZA 1INCA 1AWFH 4Y8YA 2XC5A 3HK3B 1GMHF 5EU8A 1O35A 4ABJA 2GZ8A 1S85A 4KP0A 2OP9A 1O2XA 1BDAA 1UVUH 3U8OH 1TPOA 4NA8A 3SGAE 5EXMA 2GZ7A 1C2HA 1LVOA 2R0KA 2GJGA 4U2WA 1YPMH 1GDNA 1BRAA 2BX4A 1HLTH 3A89A 1P0SH 4K2YA 3SUEA 1XKAC 1HIAB 1HJ9A 2ZGBH 2PUXB 3PTBA 4MPUA 1FXYA 4BAQB 1C2EA 5JB9S 4JYVH 1OKXA 4WF8A 3D49H 1UCYE 2A4GA 4CHAB 1A2CH 2UUFB 2BXUH 2RDEA 2F4LA 2KAIA 1AFQB 1IHSH 1NY22 3KQCA 1M9UA 1V2OT 1ZRBA 4Y7BA 1C5MD 1PYTC 2R2WU 2ZG0H 2VWMA 2AIPA 4OS5A 1Q2WA 1Q31A 2P59A 3F68H 1O2MA 3PYHA 4ABHA 4A92A 1ZTKA 3UR9A 1VGCC 4DW2U 5ABWA 1CHOF 1GPZA 3MMGA 5GPIB 2YMSB 2Y7ZA 1OWJA 2RFKC 3N7OA 3OE7D 2XBWA 5DP7A 1F5KU 1NO9H 1LHGH 5EJZA 3N7DA 2K8IA 4GSOA 1SPJA 5EPNA 3RXDA 1ELEE 2THFB 3T26A 5FPSA 1V2MT 5SGAE 1IQLA 4BANB 1MTSA 3UUZA 1EZUC 4OS6A 4A7IB 2Y5GA 4Q4LA 2YMSC 3V12A 1W14U 2WUBA 5HMAA 2ZTZA 3A7VA 4K1SA 2G8TA 4D7FA 1ZR0A 2BDYA 1GJ4H 4WY3A 3S7HB 4OS4A 4X1RU 3MHWU 1QGFA 1P2JA 1QTFA 5DO4H 1YCPK 3RP2A 4BXWA 3QUMP 2FX6A 3GS9A 3PMJA 3KYFA 1BB0B 1K2I1 2G4UA 3LT3A 1C9TA 1BJVA 1GBHA 1K1LA 3P8GA 1UCYK 1C5OH 4Y76A 1J17T 1E34B 2ZU1A 4Q63A 1ESBA 2BZAA 1S81A 4LZ1H 4LK4A 1YPLH 4KGAA 3IWMA 3GY3A 3MWIU 3PLBA 3KF2A 1ZJDA 2BY6X 2ASUB 2STBE 2XBVA 2YMSD 1XUGA 1WQSA 2GP9B 1AUTC 2H6MA 3RU4D 3CS0A 4ESTE 3GCTG 2ZEBA 5EJLA 5GDSH 3OAAD 5AF9H 2BLVA 4WJG2 1E0FD 2Y5HA 4ZUHA 1A46H 2R2MB 9LPRA 4K3JA 1L1GA 1DICA 1EJNA 3SW2B 1W12U 3ITIA 4TPIZ 5EOKA 1C1PA 2F9UA 2LELA 3DCLA 1O3EA 4FUBA 4MNYA 1SGEE 2C8WB 1YPHE 1MTWA 2VVCA 4CR9A 5CDFE 3QX5H 1CGHA 4I8JA 1ZGIA 1EAXA 5A0AE 2VIDA 1ZHPA 1D4PB 4THNH 5E2PA 4YESB 3EDXB 3MU4A 1TNLA 1RIWC 5FAHA 1ELAA 1HAYB 2XYAA 3R3GB 2FOCA 3GY6A 5HGGA 1DDJA 1GI9B 1HIAA 2IJD1 1UHBB 4I7YH 3D62A 4BOHA 3RXHA 1XUJA 2QAAA 1SLUB 1MU8B 4FU7A 4AX9H 3T29A 1DWCH 3SO3A 4CRCA 5EPYA 2BDHA 4FUEA 2I6SA 1BQYA 4IS5A 3BEIB 3GY8A 1H8DH 3W95A 1MTNB 1K28D 3QO6A 3KN2A 3AW1A 1P9UA 3RU4T 3SNCA 4XFQA 2PUQH 1DXPA 2WPHS 5B6LA 3F2GA 1BHXF 1VCQA 3OY6U 1AWHB 2GGVB 3B8JA 1QJ7B 1S6HA 2PLXA 5FX6A 4X8TH 3F6UH 1HAVB 1KTSB 3RXLA 1FLEE 5ESTE 2BYAX 3SNEA 2ZU5A 4F4OC 2C90B 1CQQA 2JIZD 1SHHB 2NU3E 4JMYA 1SL3A 1HPGA 1BITA 1IQGA 1K9OE 4X8VH 1C2MA 1QJ6B 5A8ZA 2F43B 1TBZH 3A8DA 3ZVGA 3E0NB 1O3BA 4BXSA 1C2FA 3MNBA 2FOBA 1BTZA 3IG6B 2ZDAH 1GWAA 3EE0B 4Z0KA 3BSQA 3SJIA 3M5NA 3PRDA 1G3DA 1PQ8A 1LO6A 2V6NA 3SU5A 7GCHF 1YGCH 1ZHMA 5LPFA 2BQ6B 1VCPA 1UJ1A 1C2DA 3FOAA 2BVXH 1TMUH 3N7EA 1BRCE 3LU9B 3HK6B 1LVBA 4SGAE 4ACAA 3WY8A 2PP6A 1ZLRA 5FHTA 3U1IB 1O2UA 2VVUA 2PTCE 1KTTB 1GI3A 1HXFH 2Y6TA 5ESBA 4IMQA 4HGCA 4FUGA 3MI4A 2R3UA 3U8TH 4B76A 1SGCA 4NWKA 2DE8A 3GCHC 4J2YB 4I32A 4CR5A 2IN2A 3VB5A 2K1QA 2TGTA 3ZVCA 1SMFE 5DGJA 1MH0A 1DT2A 1H9LB 1LHDH 3E91A 4DIIH 3H5CB 1BCUH 1O2WA 1MQ6A 4Q7XA 4MDSA 1GJ7B 1ABIH 1MQ5A 2ZU4A 1SB1H 4ISIH 2OTVA 4ZKNU 4O3UA 1O3MA 3DFLA 2HVYB 1WSSH 1QL7A 1SR5C 1Z8JB 2GDEH 2XCNA 4O03A 2VH6A 3BTEE 5EJ1A 2QF5A 3EA7A 3UB0A 2BXTH 3ENSB 3RM2H 3RM0H 2BOHB 1HFDA 1Z8GA 1O3FA 5T6FA 1NC6A 2BDGA 2FDAA 1BMFD 3F0PA 3T5FH 4UDWH 2A5AA 1O3DA 1H9IE 5JB8S 3TH4H 2P3FH 3FVFB 1GJ9B 1W8BH 4JZFH 5IDKA 3KQ5A 3M36A 2Z9LA 1F92A 2OC8A 4X0WU 4I8LA 3M7TA 1NFYA 1HGTH 4FVBA 3O8RA 1C5YB 4AZ2B 1FIZA 3ZYDA 1BMMH 1P57B 1RD3B 1QQ4A 4F49A 2HPPH 4B71A 1A0JA 3SORA 4LXBH 4GUXA 2NU0E 2XW9A 1UTQA 1GBBA 3ATWA 3NPSA 1DANH 1GG6C 1EZXC 1NTPA 4H6SB 4YT6H 2FLRH 2IOTA 4TSFD 3SHAH 3MH7A 2TGAA 3TVJB 5C17A 2NU2E 5EW2H 1HAOH 2PR3A 4OGYA 1Z1JA 3E8LA 2YOLA 4NZLA 1KDQB 1HAZB 1E37B 1F0TA 3M3VA 1BTPA 1ABJH 2EQNA
chains in the Genus database with same CATH topology
1GG6B 2H2ZA 2BD3A 3UOUA 5C5OA 2A5KA 4MPVA 1QHRB 3RXRA 1WAYB 3LH3A 4YOIA 4GLYA 3TJNA 4X6NA 1TRNA 3A85A 1NRRH 3RXUA 3SN8A 1EB1H 3I77A 2J94A 1SGRE 1TALA 2ZFFH 3TH2H 3FZDA 1Y5AT 4DJZB 1OWEA 2M5TA 2ZQ1A 3TH3H 1HAHH 3DA9B 1GHAG 5JDUB 1ETRH 1DUEA 2C4FH 3L6PA 3ZZ9A 2H9EH 1LTOA 1YLCA 2J9NA 4UFGH 3GDSA 2FOEA 3Q76A 1O5CB 5T6DA 3UFAA 5H4IB 1IQEA 1FUJA 3LIWA 1QL8A 3MU1A 3KGPA 1QURH 2G51A 2XXLA 2VH0A 5EQQA 1GJ6A 2W26A 1IHTH 3VXFH 1OP2A 1P2MA 3FZZA 2QC2A 3VEQB 4ABEA 1KXFA 3PMBB 1S5SA 1A5GH 1DFPA 2QGRA 2QV1A 1IQMA 5EXLA 7ESTE 3ATMA 5I25A 1UK3A 3SJ9A 1PFXC 6CHAC 1IQKA 1O5AB 4ZKSU 1PYTD 2A7JA 4AORA 1ZMNA 4ISHH 5EG4A 4CRGA 2AGEX 1C5QA 4RKOB 1NM6A 1GJCB 1P3EA 1SFIA 1TA6A 2IJOB 4NWLA 1AZ8A 2FM2A 3EGKH 2Z7FE 2QY0B 2AEIH 3E0PB 1MBQA 2BLWA 3AAUA 3GCHB 3FP8E 2F9PA 4WMEA 1ELVA 1K21H 3UREA 1ZMLA 1ZHRA 1TX7A 3F9FA 2ZPSA 4UD9H 3TPIZ 1ANDA 1O5FH 3VGCB 1HRTH 4Y0ZE 1FJSA 6LPRA 4Y10E 4AYYB 3SJKA 3SNAA 1O2RA 1HYLA 3UQOA 1A3EH 4TYDA 3PLKA 3U1JB 3P6ZB 2SGFE 1T4VH 2ANWA 1GVZA 2HALA 3SOSA 2HOBA 4TWWA 3STIA 3SZNA 1ZOMA 2ZHDA 1ESAA 3TK5A 2YNBA 3P92A 5CE1A 3HATH 1O3CA 3TITA 2AFQB 1TIOA 1OWDA 2G00A 1VITF 3OU0A 4Q2KA 2BD2A 3GY2A 2BQWB 1FQ3A 1AY6H 4X6PA 3LGWA 2C8YB 2GX4A 2QCYA 1XKBC 5C3NA 4J1YA 3ZZ8A 1H8IH 2W3IA 3S9AA 2HLCA 4XBDA 1GVLA 1HBTH 2BTCE 1DX5M 1FIWA 1O5DH 4YOJA 2ZNKH 3KCGH 1AKSA 1G36A 3EBNA 3RLWH 1VGCB 2AS9A 3RXVA 3RMLH 3SQHE 1SGIB 4I33A 4DGJA 3DUXH 2F9NA 1O2ZA 4FUJA 1MD7A 2BVSH 2ZO3H 3STJA 3QZQA 5DJ7A 3A8CA 2AGIX 1PPHE 1DS2E 1EUFA 4XBCA 1UTNA 1V2PT 2A1DB 5C1UA 5K7RA 5FBIA 1ZTJA 4FU8A 5HM2A 4K5ZA 1O2OA 4ZXYH 9ESTA 1H4WA 3RXBA 3RMOH 3TGKE 1K1NA 1O0DH 4GHQA 4H4FA 4AG1A 2G5VA 1XUHA 3PM3A 2HGTH 5G4BA 3LC3A 3A86A 4B73A 4Y79A 1O2HA 2PTNA 1RFNA 1SGQE 2PW8H 1BMAA 3Q3YA 4HI3A 4JK5A 4BAOB 3DD2H 3RU4E 1O2SA 3TJOA 2VIPA 3A84A 1FONA 4ABGA 1BA8B 2AH4X 3PO1B 5IYTA 4A5TS 2FOGA 4DURA 1CO7E 2ESTE 3TU7H 3R0FA 2XC0A 4NFEA 1SOZA 2BM2A 4ZHAA 1GMDF 1O2YA 1HAPH 3HKJB 3GCTF 1U6QA 2ZECA 4MTBA 2FLBH 2JH0D 5FCRA 4JYUH 2B5TB 5E0HA 3SU0A 1TRYA 1V2KT 1YBWA 2BY9X 2P95A 3A7YA 2Z6BD 3RXFA 2RCEA 5FX5A 1O2LA 4YZUA 5JBBS 1YPHC 3RXAA 1JIRA 3L3TA 1KIGH 4ABIA 3LONA 4PROA 1Y8TA 1FZZA 5HM9A 2GD4B 2ZHWH 3LJJA 1N6YA 3BN9A 4TWYA 1C2JA 1P03A 4TY7A 4KTCA 1Z7KA 1J9CH 2ZWLH 3NK8A 1B7XB 1ETTH 2ZFSA 1J16A 4GCHF 4E7RG 1HB0B 1TFXA 2ZGCA 1O36A 2VWLA 3KL6A 1DLEA 1GDQA 4MG3A 5L2ZH 1DSUA 2ANMH 2RA0A 2ZDNA 1NZQH 2FTMA 1ELTA 1PPCE 2P8OC 1ESTA 1HXEH 1P8VC 2GV6A 2H5CA 2W3KA 3O8BA 2WUCA 3KNXA 4WWYA 4NIWA 1EATA 7LPRA 3M7QA 1CGJE 1A0HB 3E1XB 2PWXA 1P01A 1ARBA 1DLKB 1ZPCA 3Q3XA 4ABAA 2FZZA 1KXEA 3ESTA 5TCAA 2HWLB 2JETC 5BPEA 2ZFQH 1Y5UT 2BDBA 3LGVA 3FANA 2TRMA 1GMDG 1RTFB 4XBBA 2XTTB 4IGDA 1Z71A 3UY9A 3RDZA 2GCHF 1P09A 1ARCA 2RDLA 1TAWA 3M5OA 2SNVA 1QRZA 1A5HA 1CT0E 1RGQA 2BLQA 3HPTB 1LVMA 3TJVA 1MD8A 1ZPBA 2G81E 1F2SE 1AHTH 5ETXA 1O2TA 1FAXA 1P06A 2ODQA 1EJMA 1GBCA 2AMPA 4BAMB 4CRFA 3RXIA 4NSYA 4D9RA 1YC0A 3I78A 1BUIA 1S83A 3E16B 1CBWB 1DSTA 1S0QA 2W5EA 3MU5A 1K1PA 1KXAA 3RUOA 1SLVB 1EP5A 2ODPA 3CS7A 1PQ7A 4YOGA 3ZZ4A 3M3SA 5T6GA 1B5GH 3BIVH 3EA8A 2QXGA 4IW4E 1JXPA 2CMYA 1OYTH 6GCHF 2GZ9A 5HYOA 1MBMA 3RXEA 4IBLH 5C2ZA 2HNTC 2J92A 3MYWA 3ATLA 4I31A 2TGPZ 1O2GH 4DVAU 1O2QA 1OS8A 2SNWA 3OY5U 2BX3A 4NIXA 2BY7X 1QIXB 2C8XB 1YCPM 3CP7A 1HNEE 1BT7A 1ZSJA 5E2OA 1ELCA 2ZCLP 1C1UH 3BF6H 1J15A 1CA8B 2EC9H 1C1WH 1E35B 1SOTA 1GHWH 2UUJB 1ETSH 1QB9A 1YM0A 4TPYA 1W11U 3VB4A 4JZEH 3MH6A 4MQAA 4WXIA 3RXTA 4AB9A 2DUCA 1C5NH 5GCHG 4A6LA 1JRTA 4DIHH 1YYY1 2D26C 2VWOA 4HZHA 3QGJA 2ZCKP 3LOXA 3O8CA 3RLYH 2WPKS 4LOYH 4K69A 1EPTB 4FUIA 2GT7A 1ZZZA 1UHBA 1V2UT 1XM1A 4JK6A 1MZAA 3ZZ5A 3P8OA 2HNTE 3ATIA 1A7SA 5A8YA 1BMLA 2JKHA 2OC7A 3S7KB 2SGAA 1AVXA 1QBVH 2VU8E 2GCTC 1ELDE 1P2QA 1RTLA 1GHZA 3ATKA 4NFFA 1BTUA 1BOQA 2WYGA 1LQDB 1W10U 3UR6A 2F3CE 4FUCA 4A1VA 3SV8A 3OX7U 4YT7H 3DFJA 4H42U 4AOQA 2LIZA 4FVDA 1YPJH 4AGJA 1FNIA 1V2VT 3RXCA 5F8ZA 1AB9B 1C2LA 3U9AH 2XWBI 2HVXA 1GBLA 2UUKB 5CHAB 1BJUA 4R0IA 2XRCA 1SGYE 1C1RA 8GCHG 1UTMA 2EEKA 1G30B 1HJAC 5LH8A 1TBRH 2A4RA 1IQHA 2CHAC 1A3BH 3DHKH 1CU1A 3F9HA 2VGCC 3V7TA 4Q80A 3QZRA 1IQIA 4FXGH 4D7GA 5JYIA 1AFEH 1P12E 2B0FA 2IPHA 2OD3B 1TOCB 3SNDA 1UVTH 1Y5BT 4IC6A 5HXFA 1TB6H 3T28A 1GI4A 1H1BA 1LCYA 4IN2A 1Y3WA 3MNCA 2JETB 1Y3UA 2A5IA 1NT1A 2J2UA 2Y80A 2A32A 1JRSA 5LGOA 1D3PB 1SGNE 1XUFA 1V2JT 3SJ8A 1Y3XA 1LKAA 3GCOA 3RC6A 3RXMA 3GY4A 4INHA 2QF0A 3U8RH 1LQEA 3KQEA 5JBCS 4MPWA 1ANEA 2A0QB 3BTKE 2P93A 1PPZA 2ZDKA 4UE7H 1OYQA 1UVOA 4Q7ZA 3V0XA 2A31A 1MKWH 2PKSC 1GCTC 4VGCC 2QA9E 1S84A 2DE9A 1XXDA 5PTPA 4KTUA 4JZ1A 2J4IA 3S69A 1AIXH 1TA2A 4RSPA 1O3NA 1W7XH 3E6PH 1SHYA 2Q6DA 2GKVE 4YLQH 1EZSC 1P04A 3CENA 1G32B 1NRQH 4ZH8A 3GDUA 4K1EA 3A8BA 1OOKB 4XOJA 1MTNC 3MU0A 1T7CA 1D3QB 1HAIH 1Q3XA 4X2YA 2Q6GA 3A7XA 3NWUA 1BTHH 1O37A 2A2QH 4JCNA 1V2QT 4ZMAH 1IQJA 5LPEA 1F0UA 1GGDC 3RMMH 4R8TB 3RXKA 1L1NA 3BTME 2BB4A 3K6YA 4AFZA 2ZQ2A 4CBOA 1ANBA 1CHGA 3BV9B 4NA7A 3VXEH 4FUHA 2VJ1A 4ISNA 1GJDB 3UIRA 1JBUH 5AHGH 3A83A 1C9PA 8LPRA 2ZFTA 3TJUA 5GWZA 1NPMA 4UFDH 1JMOH 2QIQA 1BRUP 2HPQH 3F1SB 2H1UA 2PSXA 4Y7AA 1EOLA 1ZSKA 3SGBE 1C1SA 2XNIA 1AFQC 1V2LT 4D8NA 1B0EA 1C2IA 2V0BA 1E36B 1C5XB 1PPBH 4D76A 5FPTA 2A4QA 4SGBE 1ANCA 2ZF0H 3GISB 2BD8A 1O3PB 3SGQE 3P17H 2O8UA 1K1JA 1O3GA 2ZI2H 1LHCH 1GI8B 1ZTLA 4AFQA 3EA9A 4X2WA 4ZKOU 4OS1A 1WV7H 1YKTA 2ZTXA 1W3CA 1VITH 1TGSZ 2HRVA 3A82A 5C1XA 2FEQH 1KDQA 3TK6A 2W7UA 4Y11E 1F7ZA 1Z6EA 1C5RA 2WV5A 2A45B 4ABDA 5AFYH 2FOFA 3BTGE 1DY9A 1F5LA 2XC4A 3P8NA 4X6MA 4BNRA 1AGJA 4CBNA 1EP6A 3MNXA 1W0YH 2Q6FA 1HAVA 2AMQA 1UO6A 5AFZH 1ZPZA 1C1TA 1N1LA 1G3CA 1JWTA 4AFUA 4X1NU 7KMEH 1CT4E 3T2NA 1FY5A 2D1JA 1OWHA 1J8AA 4GCHG 2ZZUH 1NU7B 3M37A 1YP9A 5GCHF 3KHVA 3MU8A 1EAIA 2Z3EA 2OLGA 1CA0C 1ZMJA 3LPRA 3NKKA 3SU1A 4RN6A 1H9HE 2FYQA 1EJAA 1TGTA 1QQUA 4XE4A 3A7ZA 1O2IA 3OSYA 2PGQB 2NWNA 4DG4A 2O8WA 1AD8H 2V35A 2ZCHP 2STAE 2AYWA 2V3HH 2BDAA 2P3TB 4FU9A 1ZYOA 1SGDE 1SC8U 3SUFA 1A5IA 2Y7XA 1TE0A 2CGAA 1N8OC 2ZGHA 1YCPH 2ZDLA 3GOVB 2W7SA 2ZFRH 4HTCH 4B2CA 1S82A 1NROH 2Z9GA 1TABE 1SLWB 1VJ9U 3PV4A 1W7GH 4WMFA 4NIVA 2PKSB 1XVMA 3EAJA 2FMJA 5EODA 2B9LA 3SHCH 1C5VA 3GY7A 1E38B 2A7CA 3MNSA 1AKSB 2GMTB 3E90B 1P2NA 2FTLE 1V2ST 1GMCG 2ZDMA 2RG3A 2R9PA 5F8TA 5DPAA 3RC4A 1EB2A 4INLA 1QRXA 1GHBG 1DXWA 2WV4A 3A87A 1GBEA 2PFEA 1C1QA 1O34A 2R0LA 2BHGA 2FIRH 4Y0YE 1O2NA 2GV7A 1O3OA 1MKWK 1OP0A 1JIMA 1AU8A 1EZQA 4X2XA 2F9VA 2FOAA 1WTGH 2ZC9H 3FAOA 4X8UH 1WOFA 2GCHG 2FXRA 5EXNA 1YF4A 3W94A 1THPB 1SQAA 3RXJA 4DT7B 1TGCA 4E05H 1DITH 2QXHA 1BTWA 4YLUA 3S0NA 1C1NA 2O8TA 3AW0A 4IC5A 1GJAB 1Y3YA 3HGPA 1BBRE 4NZQA 3GY5A 1T8LA 3BG4B 3V3MA 3QLPH 1GI2A 3M5LA 8ESTE 2BMGB 2PHBA 1C4V2 1PPEE 4Y71A 3LH1A 2OC1A 1T32A 2BQ7B 3BTWE 3ZZ6A 1AE8H 1THSH 1A4WH 2Y82A 1K1MA 1IOEA 2CXVA 4UONA 2OINA 1BTXA 1FY4A 2H9TH 1UVPA 3LGYA 2FPZA 1GI7B 3EQ0H 2G4TA 1AI8H 3LJOA 3S9BA 1GBTA 3PB1E 4UFFH 3TIUA 2EI7A 5CMXH 4MLFB 2FS8A 4Y8ZA 2VIWA 1F0RA 4GPGA 1DWEH 4ZHMU 2HNTF 5TJXA 3SBKA 8GCHF 1C1VH 1O3KA 4JZDH 1OWIA 1EX3A 1Z1IA 1F5RA 1LHFH 1O31A 3RXSA 3GCNA 2FODA 1MUEB 1G3EA 1GJ5H 4ZHLU 3P70B 1TLDA 2G55A 3C1KA 1PPFE 6CHAB 1SBWA 3K9XB 1FN8A 2BY8X 2SGDE 1YPKH 3ZVFA 3A81A 2ZPQA 3HKIB 5DP3A 4KELA 3QK1A 5EQRA 3RC5A 1C1MA 2ZHEH 4ZAEA 3SU3A 1CVWH 1QFKH 4OS7A 3SUDA 2AMDA 3ZZ7A 1LDTT 2BD7A 3TK9A 2Z9IA 2VB0A 1FY1A 5F03A 3AVZA 1CT2E 4WH6A 1C5UA 2G5NA 2SGQE 1S6FA 2F91A 1O30A 1C2KA 4Y8XA 4CRDA 1IQFA 1TPPA 1MKXH 5A09A 1OP8A 1C5ZB 1C5PA 3VGCC 3NXPA 1TBQH 3M5MA 1OXGA 5T3HA 4E06H 3VB7A 2FOMB 1LVYA 2GTBA 1K22H 2CV3A 4AYVB 1P3CA 3SU6A 2ZFPH 1RJXB 2KAIB 1DE7H 1TQ0B 4ISOA 5J4SA 3B9FH 2CF9H 1C2GA 2ZGXH 5C1YA 3SI4H 1RS0A 4K8BA 1DUAA 2ZDVH 1GHYH 1UMAH 1QNJA 3SV7A 1BBRK 4CRBA 4ABBA 2B8OH 1LKBA 2TBSA 1QJ1B 3QDZB 1MAYA 1O5GH 3NUMA 2GMTC 1GI1A 1TPSA 2ULLA 3LGIA 2BOKA 3ZZDA 2FI4E 1PJPA 1NRSH 2BD5A 1X7AC 4TY6A 1S0RA 1QB1A 4AB8A 2A4OA 1T8OA 3L33A 1FPHH 5F6MA 3C27B 4M7GA 1C5LH 3MO6A 2Z3CA 3P8FA 2XCFA