2ZU4A

Complex structure of sars-cov 3cl protease with tg-0204998
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A02
2FYRA 2OINA 1Z8RA 2ZDVH 4VGCB 1O0DH 4U2WA 4LZ4B 4FU9A 3P8GA 1AWFH 4IC6A 3AAUA 3GOVB 1GVZA 1TBQH 2BDIA 5A8YA 1EAXA 2Q6DA 1QBNA 2PGQB 2ZGHA 1GHZA 2HWLB 1ABJH 1OX1A 4Y7AA 1PPZA 1AKSA 4YOGA 1QTFA 2VIQA 4BXWA 3BEUA 1PJPA 5J4SA 2A45B 1A0HB 1AFEH 4U30A 1MBMA 1KXFA 3SUDA 2Z6BD 3MI4A 3ZZ7A 1YP9A 1HJ9A 7KMEH 1O33A 3NUMA 2R2MB 2TIOA 3IITA 3RXFA 2OXSA 1NS3A 1RIWB 3PROA 4NIYA 2Y80A 5TJXA 1O2JA 2ZGCA 3CS0A 5T6GA 2ZFRH 2XRCA 2WPIS 5I25A 4DJZB 1P03A 2XNIA 1MTUA 4O3UA 1B5GH 3Q77A 4CRAA 3PO1C 4HI3A 1O5DH 3U69H 1GJ8B 4Z0KA 5C2ZA 1D3QB 1TYNA 4KTCA 1HAZB 4HGCA 2FESH 1ZLRA 3LC3A 1NFUA 7GCHF 1J15A 3UWIA 4Y8YA 2ZKSA 1IOEA 1MD7A 5E0JA 1DM4B 1LHGH 1ELTA 1P2JA 2OC7A 4AG2A 2BD8A 1K1NA 1MAYA 2JETB 1O32A 1O3OA 1QR3E 1T7CA 3SNEA 4WXIA 1O30A 1V2MT 5HXFA 1HLTH 1T4UH 2WPMS 2XC4A 1FIWA 1DWCH 3ATKA 5ABWA 3F1SB 1C2IA 2CMYA 2Y7XA 1O2RA 3PWBA 3EAJA 4OS5A 3EE0B 3UIRA 4Y71A 2C4FH 2OLGA 1ELGA 3GY5A 5EOKA 1HXEH 1SQAA 2B7DH 1T8MA 2B9LA 2ZU3A 4PROA 5DKMA 3BTDE 1G3DA 2G81E 4K1SA 2BVXH 4O97A 1DSUA 5GCHG 3DD2H 2PSXA 1RS0A 1S6FA 2OCVB 5HM9A 1XKBC 1AE8H 4JZFH 3PO1B 1EZXC 1JRTA 2B8OH 1QA7A 5FPTA 1O2GH 1O35A 4ISOA 3CP7A 1T8LA 2ANKH 1MKWK 1QQ4A 3TGJE 4XDEA 1QY6A 2ZDLA 1KDQB 3BTFE 1F5KU 2FI3E 4CRFA 1FAXA 1DXPA 5AFYH 1PPHE 1EZSC 1UTOA 2A4GA 1SQTA 3ESTA 3OY6U 3O8BA 4YLQH 1YPEH 2BYAX 2BM2A 2OBQA 1CHOG 1J14A 1LHEH 2GT7A 1QIXB 3RXVA 2O8TA 3QGNB 3LPRA 2G55A 1ELDE 1Z6EA 1AVWA 4K1EA 1FI8A 1KDQA 1GI3A 1LVBA 1QJ7B 2ZQ1A 4AORA 4CHAC 2VINA 1GJDB 2J38A 3LKWA 3RXQA 3VXFH 2ZQ2A 2OBOA 1UK3A 1PQAA 2FOBA 1H8IH 5JB9S 1C2LA 1C4U2 2PSYA 3LJJA 4E05H 1C1OA 1P2QA 2WUCA 3IWMA 1K28D 3FVFB 4OGXA 4AFZA 1EUFA 2F83A 2BD2A 1GJBB 1GBIA 3ZVDA 3SV7A 2ZHWH 2ASUB 1BUIA 4H6SB 4THNH 6CHAC 3TNTA 1EJMA 2A7JA 3ENSB 1GBMA 1L0ZA 1VCQA 4INHA 5DPAA 1GBFA 3FP8E 4OS6A 1HAXB 4GLYA 1CT0E 4BTIB 5PTPA 1SL3A 1Z8GA 5A0BA 1GHVH 1O5EH 1O3EA 2CN0H 5LPEA 4NA7A 2BX4A 3GY8A 4YLUA 1NPMA 4GHTA 3VPKA 1OWJA 3V13A 2UWPA 2DE8A 1CGIE 3SJKA 3RXLA 4WVPE 4Y6DA 4I31A 3TH2H 1K1IA 1G37A 3GISB 5GWZA 3P95A 2A7CA 3UY9A 8KME2 3MTYA 3SU4A 2AFQB 3P17H 4CHAB 2AYWA 1PPFE 2FS9A 4AZ2B 4XBCA 3EYDA 1VJAU 2GD4B 1Z1IA 1HAHH 2VGCC 4AYVB 3MYWA 3BV9B 1W0YH 1BJVA 4X0WU 1EP5A 2DE9A 1LKAA 3ZV9A 1NO9H 1O31A 1RD3B 1SGDE 1JMOH 5EG4A 4FUHA 2ZPRA 2Q6GA 2B5TB 1Y3VA 3BTEE 4Y8ZA 1A5GH 1W13U 2A7HA 2QAAA 1ANEA 1GDQA 2FOFA 1E0FD 3ATIA 1AZZA 6CHAB 1N8OC 4YT6H 2TGPZ 2G00A 3SQHE 3E1XB 3FAOA 1FY4A 1GJ5H 2BOKA 2Z94A 3O8DA 1AE5A 3L3TA 5BPEA 3U1JB 4AGJA 5FBIA 2Y5FA 4TY7A 1VCPA 4DOQA 3RXCA 5CHAC 4Q2KA 4UFEH 4UEHH 2ALVA 1TGSZ 4E06H 3UQVA 1ETSH 1LHCH 2H5CA 1H8DH 5FX6A 5EPNA 4CRGA 1AD8H 2J92A 2P3FH 1PPGE 3Q3YA 4NG9H 2Z3EA 1A0JA 1W12U 2PR3A 8GCHG 1TRNA 1ZSJA 1C5YB 2VU8E 2P95A 3LGYA 1TGBA 1WU1A 1SSXA 1Z6JH 5B6OA 5E2PA 2QF3A 4FUIA 3RXPA 3ZVFA 4JYTA 2EI8A 5L2ZH 3QX5H 2ZGBH 2J34A 4BOHA 5LPFA 1MTNC 3UWJH 3LOXA 1C2DA 1HAOH 1VITH 3STIA 1NN6A 4JZDH 1WTHD 2ANYA 5DP9A 3QGJA 3GDVA 4ABEA 1G3EA 3CENA 1S83A 2Y81A 2C8YB 2PFEA 3PTBA 1TMBH 3CS7A 4OGYA 1ZOMA 1HDTH 1YC0A 3A82A 1DLKB 1C5MD 1AIXH 1D4PB 1KSNA 2EC9H 1MU8B 2P8OC 1X7AC 1HV7A 4F4OC 5FHTA 1TNJA 1O3FA 2F9VA 2XC5A 2Y6TA 1O2SA 2NU4E 3B9FH 2Z3CA 1EP6A 1A0LA 1FN6A 3D65E 1EAIA 3BTGE 1O2PA 3K65B 4MNXA 4Q80A 1PQ7A 2KAIB 5CHAB 1V2VT 1YBWA 4ZH8A 2FOHA 1ELAA 3ZVBA 1PPBH 3PMBB 2A4QA 1V2JT 4O3TA 4ZROA 1P57B 1AGJA 3GY4A 1MAXA 2J2UA 1ESAA 1O39A 2PHBA 4GAWA 2FX6A 1MTNB 4ISIH 3U9AH 3MH4A 1FDPA 1WUNH 4Y10E 1TOMH 3DUXH 3I29A 3RU4E 1EOLA 1UTLM 1C5QA 5FPSA 1F5LA 4B2BA 1O2UA 1TGCA 1Y8TA 4YOIA 4YESB 1O3PB 3LDXH 2Z9LA 4AFQA 1GPZA 1GMCG 1WCZA 6GCHF 2ODQA 5L6NH 1T32A 2LPRA 1W7GH 3S7KB 1GHAG 2XWBI 3GCTG 3ZVAA 1YF4A 4XBBA 1DXWA 3HK6B 1P2IA 1SFQB 2ZHQH 3E0PB 2FXRA 3BTME 4B1TA 1BTWA 3ZZ4A 3QN7A 3RXIA 3NKKA 1JBUH 1HIAA 1G3BA 1O2XA 4E7NA 2STBE 3GICB 1CU1A 3RXUA 2FOGA 8GCHF 2GVFA 1GVKB 3PLKA 4GUXA 5CMXH 5LPRA 2GTBA 4GCHG 2F9NA 4DGJA 2BD7A 3NZIA 4YZUA 1UCYH 2GX4A 1GJ6A 3RMMH 1OP2A 4NIXA 3SGBE 3SU3A 3M7QA 1GBJA 1SMFE 1F0SA 1FNIA 1ID5H 1OWEA 4IN1A 2HNTF 5C1XA 3BEIB 3SO3A 3SI3H 4IS5A 2H9TH 1ABIH 1GI8B 3UTUH 1TBZH 1IQFA 4NFFA 1UTJA 1RTKA 2CF8H 3KNXA 3TITA 3RP2A 3NWUA 5JB8S 1Y3YA 1UTMA 1C2HA 4I8KA 3ZZ6A 3UPEA 1HJ8A 4OS7A 4X6OA 1THRH 1ETRH 1MZDA 3M3TA 3KHVA 2A1DB 2BLOA 1INCA 1AVGH 1ESBA 2PTNA 3NK8A 1FXYA 1P2NA 4CBNA 1C5ZB 1T31A 3IG6B 3ZZCA 1DANH 2PW8H 3A7WA 1FQ3A 1TPAE 3P92A 5ESBA 3SJ9A 2GV7A 1OSSA 5IYTA 2O8WA 1EB2A 1MZAA 2W7UA 3O8RA 1RJXB 4A1XA 2VH0A 5DG6A 3OYPA 4NWLA 1ELEE 1GI0A 4RSPA 4CREA 1LMWB 1KXCA 1UVOA 1Q3XA 2Q6FA 3E8LA 5DP6A 1PFXC 1TX6A 3O8CA 2GKVE 2FWWA 1A46H 2NWNA 4AX9H 1DLEA 3BTHE 3SOSA 3U8OH 3LJOA 3TVJB 3B8JA 3M7TA 1G30B 5F8TA 3UUZA 2XXLA 5L2YH 5TCCA 1SGTA 4B2AA 1TB6H 4AB9A 2HALA 1UVSH 3A8CA 3EGKH 2C8ZB 1DDJA 1UMAH 1H9IE 4JK6A 1S84A 2LNCA 1PYTC 1DX5M 1BTUA 2UUFB 3KQBA 2PLXA 1Y3UA 1LDTT 1SOZA 3HK3B 1HAVA 1F5RA 6LPRA 4GPGA 3LGWA 1KXAA 3GCTF 4FUGA 2NU1E 2P16A 3T2NA 3R3GB 2J95A 1BQYA 6ESTA 1ACBE 2FM2A 1QL7A 5TCAA 2V35A 1WSSH 3TGKE 5FPYA 1IQGA 2UUJB 1LCYA 4A6LA 2W3KA 4K69A 3ODFA 1MCTA 1Y5AT 2UUKB 1P9SA 3KQCA 2ZDMA 5EXMA 3NXPA 1Y3XA 3LONA 4WH8A 2M5TA 1C2FA 2O8UA 1N6YA 3MH7A 5CE1A 1E38B 1AKSB 5DP4A 1GBAA 1FV9A 2TGTA 2CHAC 1S5SA 1D3TB 1UCYE 2PUXB 2QIQA 4TY6A 5EQQA 2R9PA 3A7TA 4ZXXH 2YNBA 3MOCA 3ZVEA 2ZIQH 1A3BH 1Z8IB 1WYKA 3SBKA 3T62A 2JETC 1OP0A 4FUDA 2XCNA 1QCPA 2C8XB 2TGAA 3BN9A 3MO3A 1GG6C 4JCNA 1F0UA 2STAE 2FX4A 2VWMA 2BY6X 4NA9H 3QTVH 2OD3B 5HMAA 4FUFA 1O3DA 2IOTA 3RXEA 5E0HA 1XVMA 3A84A 3SU6A 1NRNH 2QF0A 1GL0E 3ELAH 1HGTH 3A87A 2TPIZ 1QHRB 1HFDA 2R3YA 1QA0A 1AZ8A 4A7IB 1ZSLA 2FOCA 2IN2A 1GBLA 3A81A 2PTCE 2OQ5A 4WXVA 2BD3A 3MFJA 4YO9A 4X1NU 3Q3XA 4RKOB 3F6UH 3A83A 1EZQA 4E7RG 1IQLA 1DUAA 1NTPA 2ZPSA 4CRDA 1SG8B 1VITF 2ZCLP 3MO6A 1A4WH 1ZZZA 1ZGIA 4YT7H 3A89A 5AFZH 5G4BA 2ZU4A 2BXUH 3KL6A 5K7RA 4ABDA 2ZG0H 2FLBH 4BAQB 2ZPQA 4CBOA 1V2ST 2CHAB 2G52A 3AW1A 2GZ8A 1CGJE 1DE7H 3SN8A 2GCHG 4D8NA 3FP7E 4CR9A 1MQ5A 1LPGB 1BMMH 1UO6A 3RXHA 3TK9A 1ZJDA 1HBTH 4DCDA 3KCGH 3TIUA 1BITA 2A4OA 1L1JA 4INLA 1ANCA 4X8UH 3RXTA 3C1KA 2EA3A 1O3HA 3DA9B 1GVLA 2AGGX 1TA6A 3UQOA 1GG6B 1TMUH 1LO6A 5JDUB 3ZYEA 4MPWA 3A86A 3SHAH 3SGAE 1MTVA 1O3MA 3F9EA 1V2RT 1O2QA 4BAHB 3M36A 4I8LA 5EQRA 1THSH 3RMNH 1C2EA 2CGAA 1FONA 1TOCB 1Z7KA 3BG8A 1C1UH 2P3UB 4BTUB 4B75A 3E6PH 1SBWA 1O2IA 4I33A 2GZ9A 4UD9H 4X2VA 1D9IA 1FZZA 1GWAA 1BTZA 5FCKA 2QXIA 3HGNA 3RXBA 1LPZB 1UHBA 1BMNH 1EAWA 5E8EH 2RCEA 1RXPA 2C8WB 1O2LA 2HRVA 4QT8C 4SGBE 3D23A 1GJ4H 4BAOB 5E0GA 1V2TT 1U6QA 3SUEA 3K6YA 3M35A 2BLVA 3TNSA 4ZKRU 1FY8E 1Z8JB 1TNGA 1MKWH 2BDHA 3RC4A 3WY8A 3E0NB 3LGTA 1KY9A 1QB6A 1OKXA 1QBOA 2BY7X 4DVAU 1H1BA 1AUJA 1CT4E 1BRAA 1AY6H 1GI6A 1K2I1 1MKXK 4UONA 3SJOA 3HKJB 1GBDA 2VIOA 4XE4A 2RDLA 2GDDA 3UFAA 5DP5A 1ELFA 3VB4A 2BQWB 2PKSC 4D76A 1T8OA 1EOJA 1WAYB 1BB0B 1C5PA 4X6NA 2VWOA 1SGQE 2HNTC 4WY3A 3M5LA 1MD8A 2ZU1A 3ZV8A 1GMHG 1V2QT 1SGFG 1W14U 2H9EH 2ZA5A 1HAYB 1HB0B 4X8TH 4IMQA 1UTQA 1AO5A 2NU2E 3AVZA 1ZR0A 3M3VA 4TYDA 3SW2B 3RC6A 1D3DB 4X1SU 4A92A 4FU8A 1GGDC 3AASA 1QL8A 1K1LA 1TPOA 2AS9A 1QB9A 2VIWA 5A0AE 4IGDA 4KKDA 3PMAB 3ZZ9A 2OC1A 1NFXA 3S7HB 4X1QU 3RXAA 4Q7XA 3MU8A 2ZHDA 1C5SA 2BQ6B 1JRSA 2FYQA 2H6MA 1XXDA 2A31A 2WPHS 1IQEA 4XFQA 1ZHMA 1C4V2 2BY5X 1IQKA 2XBXA 4U01A 3E90B 5FXLA 1C9TA 3ZZBA 2A2QH 1P8VC 2Z9KA 4AGKA 1QB1A 1M9UA 5T3HA 3RC5A 2PKSB 4AFUA 1F0RA 4ZKNU 3I78A 1MBQA 2FOAA 2HPPH 1UVPA 2QA9E 1PPCE 1ZTLA 3QLPH 2ZZUH 2WV4A 3Q76A 1Y5BT 3SNDA 3RXRA 2BY9X 3TU7H 2W3IA 3SQEE 2P93A 1IQNA 1FLEE 3BG4C 3NPSA 4JK5A 1O2ZA 3LU9B 5GCHF 1W10U 3GDSA 1KXBA 1ZRKA 4XSKU 2H2ZA 1GJ7B 1GGDB 2P3TB 2GCTC 4UE7H 3BTQE 3PYHA 2Y7ZA 5T6FA 1O2NA 1SGEE 1YPHC 3M5MA 2QC2A 2A5AA 4UFGH 2HNTE 4X6MA 4BANB 2ZI2H 2GDEH 4J2YB 5AF9H 1S85A 1GHBG 4H4FA 1P12E 5T6DA 2O8MA 4AG1A 1P09A 4DT7B 2V3OH 3GY3A 2OTVA 1GBHA 4NIVA 3UREA 1C5RA 5I46H 5FBEA 2ZU2A 1CQQA 1DICA 1S6HA 3U98H 1J8AA 2FDAA 1CHOF 1K1OA 2F9OA 4OS1A 3PV4A 1O37A 3TH4H 5DP7A 2XCFA 2G4TA 2FIRH 3MWIU 3MU0A 1KYNA 3TJNA 3F68H 1GMHF 1HNEE 5A8XA 1YPLH 3PWCA 3QWCH 2VJ1A 1LTOA 1MU6B 1NESE 1O3KA 1GJAB 1DPOA 2V3HH 3GYLB 1ZMLA 1N1LA 2XTTB 5GPIB 1AN1E 1QL9A 2ZWLH 1TNHA 4TWYA 1OWDA 3SZNA 4IN2A 3BG4B 4AFSA 1CVWH 1A1RA 1SPJA 2HVXA 3PM3A 3EA7A 4K1TA 2ZDNA 3ZZ3A 4A1TA 1RTFB 1FPHH 2F91A 2ZFSA 2GCTB 3S0NA 2QXJA 4I7YH 1YLDA 3PLBA 5DO4H 3SGQE 4M7GA 4NZQA 2WUBA 2ZO3H 4D9RA 1GHWH 4NSVA 2GT8A 1XM1A 4ESTE 1TX7A 1YCPM 1Y3WA 1KLIH 1S82A 3VFEA 3H7OA 1W7XH 1CE5A 3EA8A 1OOKB 3SV6A 1NRQH 1JXPA 1TNLA 3H5CB 3QZQA 3Q00A 3GCOA 1W8BH 1XUGA 1ZTKA 2B0FA 3BIUH 1XKAC 1G2MA 3LGIA 1C5TA 2FO9A 3S9AA 3P8FA 1EPTA 1YPHE 1TBRH 3MU1A 5F6MA 2BOHB 1G32B 1MTSA 2P94A 3TLOA 2BXTH 3MHWU 1WBGB 3I77A 1E36B 1J17T 1BA8B 4NSYA 1BHXB 2YNAA 1AHTH 5EGMA 2BZAA 1KLTA 1F7ZA 4RN6A 5C67A 4K5ZA 1F92A 4FXGH 4NA8A 1BBRK 9ESTA 3U8TH 1O2MA 1KXEA 1HIAB 1E37B 3OTJE 1C5WB 3SNBA 4ZKSU 1YPGH 1C2JA 1JWTA 1EB1H 1O2YA 2ZFTA 2BD9A 1QQUA 2WPKS 4D7GA 1FUJA 1C2GA 1TONA 3F9FA 4WMFA 3F9HA 1CT2E 1GL1A 1Y5UT 1HAPH 1A7SA 1GHBF 1DITH 3HATH 1EAUA 3KIDU 5FX5A 4HZHA 3RXKA 1QRZA 5EPYA 3VEQB 1Q2WA 2FEQH 2ODYB 3STJA 1MTWA 1LHDH 7LPRA 1E34B 1F0TA 4I8JA 3OX7U 2ZFFH 2XW9A 1C2MA 1WQSA 2SNVA 5GJ4B 1AFQC 1DWDH 3SU2A 4ISHH 4B73A 1TNIA 2AMPA 1GBBA 5F8ZA 1EQ9A 1SGPE 2EI6A 1NFYA 1YGCH 4UFFH 1FY3A 5DGJA 2IPHA 2Q1JA 4Q7YA 1SLXB 1BMAA 4LXBH 3TH3H 1O3LA 2EEKA 1OWIA 5C5OA 1BIOA 3HGPA 4LK4A 2SGAA 1ANBA 5JPMH 1ZJKA 1DY8A 1XVOA 2O8LA 1V2NT 2J94A 4BAMB 3E91A 1IHTH 2WYGA 1LVOA 2ZU5A 3BEFB 4Y79A 3VXEH 1AVXA 2PV9B 2SGQE 1ZMJA 4D9QA 2W7SA 5GDSH 3KF2A 4DY7B 3MU4A 1P3EA 3MMGA 1D6RA 5C20A 5GXPA 5ETXA 2DUCA 4HFPB 2ZECA 4SGAE 1A2CH 1GI9B 2FP7B 2D26C 1NRRH 1DY9A 1P2KA 1GBTA 2AGIX 2ZHEH 1AMHA 2BY8X 3BF6H 2SGPE 4WJG2 1LQEA 1KTTB 3ZYDA 2PKAB 2VB0A 1AFQB 3SJIA 3K2UA 1KXDA 1NY22 3MU5A 3H7TA 3ZVCA 1OS8A 1TQ0B 3GY7A 1HAVB 3A7VA 5C1YA 3S9BA 1SFIA 1O5FH 1O5CB 1JIRA 1S0QA 5E2OA 2YOLA 4FVBA 5A0CA 4K2YA 1XUJA 4CRBA 2BDCA 2XBWA 1HAIH 2LIZA 3SV2H 1O36A 3KQDA 2PKAA 1GMCF 3ZZDA 1XUIA 4TWWA 3T5FH 1UK2A 3BTWE 2OC8A 7GCHG 1ORFA 1YKTA 1GHAF 2FMJA 5EODA 2CJIA 3KEEA 2G4UA 2J4IA 5HGGA 5JBBS 5A2MH 4YOJA 1H4WA 3TK5A 1QBVH 2ZCKP 4Y76A 2A5KA 3SU1A 2BLQA 1Y59T 1D3PB 4JYUH 3SUFA 4GCHF 1BTYA 1BDAA 4MVNA 3RXMA 2FODA 1K9OE 1V6DA 4KELA 3UNSA 3F9GA 1EJAA 2F9UA 3GY2A 3EDXB 3MNBA 3E3TA 4Y0ZE 3FP6E 1O3AA 5L30H 2FPZA 4MPUA 3URDA 1XUKA 3TJUA 3RXDA 3A85A 1B0FA 1WOFA 4B76A 3FZDA 2BDBA 1BHXF 1ZHRA 1GJ9B 2O9QA 5LGOA 2GMTB 2VVVA 1SGRE 2FZZA 1FY1A 1V2UT 1W3CA 2GP9B 2SGFE 3TGIE 3U8RH 1XUHA 4I8HA 1PPEE 4MQAA 1SI5H 4X8VH 1GMDG 4TPYA 5HM2A 4JYVH 5AHGH 3MH5A 2BHGA 2BD5A 1C2KA 1A5IA 1ZHPA 1VJ9U 5ESTE 4MLFB 4BNRA 4ZKOU 3KN2A 2XBYA 1FIZA 2A32A 3DT0H 2QN5T 1P04A 4BTTB 2QXGA 1THPB 3A80A 1ZTJA 1TPSA 3RXJA 5DP8A 4AB8A 1A61H 3SU5A 2EI7A 2XBVA 1CBWC 1P9UA 1EATA 1IAUA 1H9HE 3KQEA 4R0IA 2R3UA 3U1IB 2ODPA 1C5OH 2TBSA 2ANMH 2VIDA 5C5NA 3ATLA 1AUTC 1ARBA 2R0KA 1ELVA 1MH0A 2J9NA 2IJOB 4UDWH 2G5NA 3GCNA 3URCA 3MNXA 4B71A 3RXOA 1O2HA 2THFB 3B23B 3E16B 1XXFA 2FLRH 4OS4A 1ELBA 3RXSA 1UK4A 2Z9JA 1LVMA 1K1JA 3QK1A 4MTBA 3V3MA 1O5GH 1GHYH 3PMHB 1TGTA 3ZZ8A 1SLUB 5GIBA 1MMJN 2W26A 1UHBB 2ESTE 3OSYA 1OWHA 2SGDE 2VNTA 1NC6A 2BB4A 1DT2A 2Y5HA 1C1VH 3QO6A 4X1PU 1AWHB 2ZTXA 1CA0C 5EW1H 4BXSA 4A5TS 3DHKH 2ZTZA 2A0QB 2BZ6H 1P11E 3A7ZA 1DUEA 1QRXA 2ZF0H 1XMNB 4ABJA 1ZYOA 2R0LA 3UR6A 3KGPA 1GI7B 8ESTE 5AVDA 2ZP0H 1NT1A 1TMTH 3T26A 4GVUA 1QRWA 2FI5E 1CBWB 1PYTD 2Z7FE 4K60A 2P59A 3RXGA 4NZLA 1CA8B 4Y0YE 1SOTA 4JMYA 1SGFA 4ABFA 2QYIA 3AAVA 1H9LB 1C1TA 4Z6AH 1SGIB 4GHQA 3L6PA 4H42U 1EKBB 5A09A 4DIHH 1DOJA 3UR9A 4KTSA 2AEIH 4KTUA 3OU0A 1HUTH 1TX8A 3A8AA 2Z9IA 1P01A 2H9HA 2ZDKA 1C5NH 1MKXH 2I6SA 4Y11E 3JZ2B 4U32A 1L2EA 3RUOA 3PTNA 3ITIA 1GMDF 3GCHC 3BTKE 1BRCE 3UNQA 4Y8XA 1Z71A 4ABHA 2BLWA 2CXVA 1O3GA 4R8TB 1JIMA 4CH8B 1CA0B 3BIVH 2AGEX 1UVUH 4X8SH 4AOQA 1NZQH 1FY5A 4CR5A 2GGVB 4YM9A 1C1MA 2BQ7B 1YYY1 2RA3A 1A3EH 1NROH 3RDZA 1SHHB 1O2OA 4HTCH 3M7UA 1AU8A 1FJSA 3UNRA 2A4RA 1IQMA 4ASHA 4JZIA 1TIOA 5C1UA 1TPPA 5FAHA 1AI8H 3L33A 4K8YA 2ZFQH 5K0HA 9LPRA 1UTKA 1JOUB 1ZMNA 2TGDA 4X2WA 2OP9A 3ZZ5A 4CRCA 2RA0A 1O3NA 2VWLA 2GCHF 1T8NA 1V2KT 4FUEA 3QDZB 1OYQA 2Z9GA 1UJ1A 1ARCA 1EXFA 3GYMA 1TFXA 1RFNA 4MPVA 1C1NA 3TJVA 1NU9A 2ILNA 2FOEA 4ZHMU 2ZFPH 3V7TA 1EASA 2NU0E 1O2TA 1GCDA 1GJCB 1IQJA 4NFEA 1P02A 1V3XA 1P10A 2V6NA 3GCHB 1K1PA 4WWYA 1ZGVA 4D7FA 1G3CA 1C4Y2 1UTPA 2BVSH 1TABE 3T28A 1KTSB 3ATWA 3D49H 3TPIZ 4X6PA 2AERH 1ZPBA 2QGRA 4Y7BA 1SQOA 1VGCC 3EQ0H 3A8DA 4MNWA 2FS8A 5J4QA 1FMGA 5JBAS 3A7XA 1OXGA 3LH1A 1SGNE 2I6QA 1NU7B 3SUGA 2SNWA 1CO7E 1FPCH 4ABIA 2FOMB 8LPRA 1EPTC 1IQHA 1TRMA 1WQVH 2ZNKH 1N6XA 1C5VA 5DP3A 2H5DA 1SLWB 2VVCA 3PMJA 1BCUH 1MUEB 2A2XH 3W94A 1BMLA 1CHGA 5SGAE 1V2OT 3OY5U 2CF9H 1TALA 1GI1A 1NRSH 2ZC9H 3LC5A 3T29A 2PGBB 2D8WA 2GZ7A 1SR5C 2JKHA 2ULLA 5EXNA 1WV7H 1V2PT 2ZCHP 3K9XB 1ZPCA 1QFKH 2Y82A 3LT3A 1IQIA 6GCHG 1OP8A 1BZXE 1DWBH 1K22H 4KP0A 4B74A 2HOBA 3VB6A 3NCLA 1GI4A 1C1WH 1SC8U 4WH6A 5BRRE 2F3CE 2F9PA 4FU7A 2WPJS 3SHCH 4H6TA 1TE0A 3P8NA 4FUBA 1YPKH 2AMDA 1K1MA 2W5EA 1VGCB 1G36A 1V2WT 1VCWA 2VIPA 3G01A 1TNKA 5EU8A 1Z1JA 1ZRBA 4ZAEA 3SU0A 3VB7A 5A8ZA 5EW2H 4IBLH 1VR1H 2PUQH 1AB9C 1UVTH 3A88A 3R0FA 1TA2A 3QUMP 1E35B 3GY6A 4JZ1A 1GBCA 4ZUHA 1EPTB 4MNVA 1C1QA 3BTTE 2K1QA 3P70B 2ALPA 4X1RU 1TAWA 1W2KH 1A5HA 2F9BH 3VGCC 1EZUC 2VWNA 4ZHLU 2VGCB 3A7YA 2HGTH 4J1YA 1RRKA 1LQDB 5JBTA 1YPMH 1QGFA 7ESTE 3TJOA 2QCYA 3RMLH 2UWLA 4A1VA 3SI4H 2BD4A 4INKA 1BRBE 1SB1H 2NU3E 2FTMA 1CSOE 4I8GA 4X2XA 1GBEA 1N8OB 4NGAH 2ZTYA 2UUYA 2ZHFH 2WINI 3MH6A 2QXHA 1L1GA 1LKBA 2BDYA 4WF8A 1RTLA 3LIWA 3RM2H 2WPLS 1BTXA 1XUFA 3SV9A 3M37A 2A5IA 1BT7A 4TPIZ 3P6ZB 4IW4E 4ABBA 1UTNA 1BBRH 1O2VA 1YCPK 1P2MA 1YCPH 2D1JA 3LGUA 4YTAA 2BX3A 1G9IE 1B0EA 1QJ1B 1P3CA 2WV5A 1GDUA 1W0ZU 1NRPH 1AB9B 4UFDH 1GCTC 3FZZA 2GV6A 4ZMAH 1LPKB 3RLWH 3VB3A 1ZPZA 3RU4T 1TWXB 2XWAA 3QZRA 1C1PA 2KAIA 4DIIH 4F49A 1YM0A 1KLJH 1O3JA 4MG3A 3A8BA 3VGCB 2HPQH 4ZXYH 2JH0D 3LH3A 3GDUA 1DSTA 3SV8A 3EA9A 2R2WU 1G2LA 1BTHH 1RGQA 3SNCA 1NM6A 2WYJA 2C90B 1HPGA 2JH5D 1ETTH 3V12A 1SHYA 1EJNA 3BSQA 1J9CH 3K6ZA 2P8OB 1SVPA 1S81A 1O34A 5IDKA 2VH6A 1XX9A 3S69A 1W11U 1O3IA 3QTOH 4NIWA 1B7XB 3N7OA 3M5OA 4NCYA 1SGYE 3AW0A 2PWXA 5HYOA 4FUCA 1LVYA 1O2KA 4XOJA 3LGVA 2XC0A 2UWOA 3UOPA 4RKJB 4AN7A 1WTGH 1CGHA 2ZGJA 2JH6D 4FUJA 2C3SA 1EX3A 5F8XA 2QV1A 1OWKA 2ANWA 1L4DA 3FFGA 3RMOH 3PB1E 2AMQA 1UCYK 1C1RA 1HXFH 1ELCA 1MCVA 3MO9A 1O38A 3RU4D 3ZVGA 1GCTB 3ODDA 3UOUA 5EXLA 1TRYA 3DFJA 3C27B 4I32A 3T25A 5H4IB 2BTCE 2BMGB 3DFLA 1L4ZA 2G8TA 3JZ1B 2VVUA 4BAKB 3HKIB 1HRTH 4ISLA 1AQ7A 2G5VA 2VIVA 1NFWA 2FTLE 1FN8A 4MPXA 1P05A 1QNJA 3M61U 3HPTB 4K3JA 5C3NA 1P0SH 3FANA 1OYTH 1LHFH 2K7XA 3MNSA 4NWKA 4DW2U 2BDGA 1TGNA 2XYAA 1V2LT 2AIQA 1GBKA 5F03A 1SLVB 2Y5GA 4ABAA 3EBNA 5JBCS 1D6WA 2G51A 2HLCA 1IHSH 1ANDA 2BVRH 4MDSA 1C5UA 5JYIA 2CV3A 4Q7ZA 2BDAA 1HYLA 1HCGA 1YPJH 2FI4E 4ISNA 2ZGXH 3SJ8A 3VB5A 4FVDA 1TLDA 1O3CA 1PQ5A 2GMTC 1VITG 4LOYH 2QY0B 4OS2A 3S9CA 4K8BA 3W95A 1BBRE 3RM0H 3V0XA 2TRMA 1P2OA 1HJAC 2AIPA 1GI5A 1PQ8A 1QURH 1C9PA 1BOQA 4B2CA 3PLPA 1GI2A 1C1SA 2OQUA 4VGCC 1BJUA 1YLCA 4CH2B 1ESTA 3MNCA 1FAKH 1DVAH 1SGCA 4GSOA 1VZQH 1C5LH 4JZEH 1KIGH 1GDNA 4ABGA 3RLYH 1O2WA 2C93B 2V0BA 3ZZAA 1BTPA 1QJ6B 1DFPA 4ZHAA 3SORA 4MNYA 3P8OA 4O03A 4WMEA 1J16A 2OC0A 1S0RA 5DK1A 1Q31A 4DURA 4LZ1H 2ZDAH 1RIWC 2OUAA 1DS2E 2Z3DA 2SFAA 4IMZA 5EQSA 4AYYB 3M5NA 2SGEE 1F2SE 1HAGE 4IC5A 1TQ7B 1C5XB 1BRUP 1O5BB 1O5AB 4WMDA 5DJ7A 5FCRA 4X2YA 2ZEBA 3SNAA 3ATMA 1GHXH 2H1UA 1DWEH 1P06A 2RG3A 1K21H 1ZSKA 1HJAB 4DG4A 4O9VA 4XBDA 3TK6A 3T27A 1T4VH 1O3BA 4KGAA 2D2DA 3Q3KA 1OPHB 3M3SA 3D62A 1L1NA 2AH4X 5LH8A 1MQ6A
chains in the Genus database with same CATH superfamily
2FYRA 2OINA 1Z8RA 2ZDVH 4RT1A 4VGCB 1O0DH 4U2WA 4LZ4B 4FU9A 3P8GA 1AWFH 2WV9A 2J97A 4IC6A 3AAUA 3GOVB 1GVZA 1TBQH 2BDIA 5A8YA 1EAXA 2Q6DA 1QBNA 2PGQB 2ZGHA 1GHZA 2HWLB 1ABJH 1OX1A 4Y7AA 1PPZA 1AKSA 4YOGA 1QTFA 2VIQA 4BXWA 3BEUA 1PJPA 5J4SA 2A45B 1A0HB 1AFEH 4U30A 1MBMA 1KXFA 3SUDA 5EIYA 2Z6BD 3MI4A 3ZZ7A 1YP9A 1HJ9A 7KMEH 1O33A 3NUMA 2R2MB 2TIOA 3IITA 3RXFA 2OXSA 1NS3A 1RIWB 3PROA 4NIYA 2Y80A 5TJXA 1O2JA 2ZGCA 3CS0A 5T6GA 2ZFRH 2XRCA 2WPIS 5I25A 2QF5A 1P03A 2XNIA 4DJZB 1MTUA 4O3UA 1B5GH 3Q77A 4CRAA 3PO1C 4HI3A 1O5DH 3U69H 1GJ8B 4Z0KA 5C2ZA 1D3QB 1TYNA 4KTCA 5C17A 1HAZB 2XNDD 4HGCA 2FESH 1ZLRA 3LC3A 1NFUA 7GCHF 1J15A 3UWIA 4M9FA 4Y8YA 1COWD 2ZKSA 1IOEA 1MD7A 5E0JA 1DM4B 1LHGH 1ELTA 1P2JA 2OC7A 4AG2A 2BD8A 1K1NA 1MAYA 2JETB 1O32A 1O3OA 1QR3E 1T7CA 3SNEA 4WXIA 1O30A 1V2MT 5HXFA 1HLTH 1YWUA 1T4UH 2WPMS 4XRNA 2XC4A 1FIWA 1DWCH 3ATKA 5ABWA 3F1SB 1C2IA 2CMYA 2Y7XA 1O2RA 3PWBA 3EAJA 4OS5A 3EE0B 3UIRA 1W0JD 4Y71A 2C4FH 2OLGA 1ELGA 3GY5A 5EOKA 1HXEH 1SQAA 2B7DH 1T8MA 2B9LA 2ZU3A 4PROA 3KQ5A 5DKMA 3BTDE 1G3DA 2G81E 4K1SA 2BVXH 4O97A 1DSUA 5GCHG 3GS9A 3DD2H 2PSXA 1RS0A 1S6FA 2OCVB 5HM9A 1XKBC 1AE8H 4JZFH 3PO1B 1EZXC 1JRTA 2B8OH 1QA7A 5FPTA 1O2GH 1O35A 4ISOA 3CP7A 1T8LA 2ANKH 1MKWK 1E79D 1QQ4A 2RDEA 3TGJE 4XDEA 1QY6A 2ZDLA 1KDQB 3BTFE 1F5KU 2FI3E 4CRFA 1FAXA 4ASUD 1DXPA 5AFYH 1PPHE 1EZSC 1UTOA 2A4GA 1SQTA 3ESTA 3OY6U 3O8BA 4YLQH 1YPEH 2BYAX 2BM2A 2OBQA 1CHOG 1J14A 1LHEH 2GT7A 1QIXB 3RXVA 2O8TA 3QGNB 3LPRA 2G55A 1ELDE 1Z6EA 1AVWA 4K1EA 1FI8A 1KDQA 1GI3A 1LVBA 1QJ7B 2ZQ1A 4AORA 4CHAC 2VINA 1GJDB 2J38A 3LKWA 3RXQA 3VXFH 2ZQ2A 2OBOA 1UK3A 1PQAA 2FOBA 1H8IH 5JB9S 1C2LA 1C4U2 2PSYA 3LJJA 4E05H 1C1OA 1P2QA 2WUCA 3IWMA 1K28D 3FVFB 4ACAA 4OGXA 4AFZA 1EUFA 2F83A 2BD2A 1GJBB 1GBIA 3ZVDA 3SV7A 2ZHWH 2ASUB 1BUIA 4H6SB 4THNH 6CHAC 3TNTA 1EJMA 2A7JA 3ENSB 1GBMA 1L0ZA 1VCQA 4INHA 5DPAA 1GBFA 3FP8E 4OS6A 1HAXB 4GLYA 1CT0E 4BTIB 5PTPA 1SL3A 2JDID 1Z8GA 2WZQA 5A0BA 4Q63A 1GHVH 1O5EH 1O3EA 2CN0H 5LPEA 2L6OA 4NA7A 2BX4A 3GY8A 4YLUA 1NPMA 4GHTA 3VPKA 1OWJA 3V13A 2UWPA 2DE8A 1CGIE 3SJKA 3RXLA 4WVPE 4Y6DA 4I31A 3TH2H 1K1IA 3VG8A 3N99A 1G37A 3GISB 3PV5A 5GWZA 3P95A 2A7CA 3UY9A 8KME2 3MTYA 3SU4A 2AFQB 3P17H 4CHAB 2AYWA 1PPFE 2FS9A 4AZ2B 4XBCA 3EYDA 5IK2D 1VJAU 2GD4B 1Z1IA 1HAHH 2VGCC 4AYVB 3MYWA 3BV9B 1W0YH 1BJVA 4X0WU 1EP5A 2DE9A 1LKAA 3ZV9A 2QF4A 1NO9H 2VBCA 1O31A 1RD3B 1SGDE 1JMOH 5EG4A 4FUHA 2ZPRA 2Q6GA 2B5TB 1Y3VA 3BTEE 4Y8ZA 1A5GH 1W13U 2A7HA 2QAAA 1ANEA 1GDQA 4RI0A 2FOFA 5T1VA 1E0FD 3ATIA 1AZZA 6CHAB 1N8OC 2J5UA 4YT6H 2TGPZ 2G00A 3SQHE 3E1XB 3FAOA 2M2AA 1FY4A 1GJ5H 2BOKA 2Z94A 3O8DA 1SKYE 1AE5A 1W0KD 3L3TA 5BPEA 3U1JB 4AGJA 5FBIA 2Y5FA 4TY7A 1VCPA 4DOQA 3RXCA 5CHAC 4Q2KA 4UFEH 4UEHH 2ALVA 1TGSZ 2AHME 4E06H 3UQVA 1ETSH 1LHCH 2H5CA 1H8DH 5FX6A 5EPNA 4B6EA 4CRGA 4P02A 1AD8H 2J92A 2P3FH 1PPGE 3Q3YA 4NG9H 3W1EA 2Z3EA 1A0JA 1W12U 2PR3A 8GCHG 1TRNA 1ZSJA 1C5YB 2VU8E 2P95A 3LGYA 1TGBA 1WU1A 1SSXA 1Z6JH 4F48B 5B6OA 5E2PA 2QF3A 4FUIA 3RXPA 3ZVFA 4JYTA 2EI8A 5L2ZH 3QX5H 2ZGBH 2J34A 4BOHA 5LPFA 1MTNC 3UWJH 3LOXA 1C2DA 1HAOH 1VITH 3STIA 1NN6A 4JZDH 1WTHD 2ANYA 5DP9A 3QGJA 3GDVA 4ABEA 1G3EA 3CENA 1S83A 2Y81A 2C8YB 2PFEA 3PTBA 1TMBH 3CS7A 3N7EA 4OGYA 1ZOMA 1HDTH 1YC0A 3A82A 1DLKB 1C5MD 1AIXH 1D4PB 1KSNA 2EC9H 1MU8B 2P8OC 1X7AC 1HV7A 4F4OC 5FHTA 1TNJA 1O3FA 2F9VA 2XC5A 2Y6TA 1O2SA 2NU4E 3B9FH 2Z3CA 1EP6A 1A0LA 1FN6A 3D65E 5C0UA 1EAIA 3BTGE 1O2PA 3K65B 4MNXA 4Q80A 3SYJA 1PQ7A 2KAIB 5CHAB 1V2VT 1YBWA 4ZH8A 2FOHA 1ELAA 3ZVBA 2KCAA 1PPBH 3PMBB 2A4QA 1V2JT 3OE7D 4O3TA 4ZROA 1P57B 1AGJA 3GY4A 2CK3D 1MAXA 2J2UA 1ESAA 1O39A 2PHBA 4GAWA 2FX6A 1MTNB 4ISIH 3U9AH 3MH4A 1FDPA 1WUNH 4Y10E 1TOMH 3DUXH 3I29A 3RU4E 1EOLA 1UTLM 1C5QA 5FPSA 1F5LA 4B2BA 1O2UA 1TGCA 1Y8TA 4YOIA 4YESB 2W6JD 1O3PB 3LDXH 2Z9LA 4AFQA 1GPZA 1GMCG 1WCZA 6GCHF 2ODQA 5L6NH 3FO8D 1T32A 2LPRA 1W7GH 3S7KB 1GHAG 2XWBI 3GCTG 3ZVAA 1YF4A 4XBBA 1DXWA 3HK6B 1P2IA 1SFQB 2ZHQH 3E0PB 2FXRA 1S6LA 3BTME 4B1TA 1BTWA 3ZZ4A 3QN7A 3RXIA 3NKKA 1JBUH 1HIAA 1G3BA 1O2XA 4E7NA 2STBE 3GICB 1CU1A 3RXUA 2FOGA 8GCHF 2GVFA 1GVKB 3PLKA 4GUXA 5CMXH 5LPRA 2GTBA 4GCHG 2F9NA 4DGJA 2BD7A 3NZIA 4YZUA 1UCYH 2GX4A 1GJ6A 3RMMH 1OP2A 4NIXA 3SGBE 3SU3A 3M7QA 1GBJA 1SMFE 1VKYA 1F0SA 1FNIA 1ID5H 1OWEA 4IN1A 3UB0A 2HNTF 5C1XA 3BEIB 3SO3A 3SI3H 4IS5A 2H9TH 1ABIH 1GI8B 3UTUH 1TBZH 1IQFA 4NFFA 1UTJA 1RTKA 2CF8H 3KNXA 3TITA 1YLNA 3RP2A 3NWUA 2XOKD 5JB8S 1Y3YA 1UTMA 1C2HA 4I8KA 3ZZ6A 3UPEA 1HJ8A 4OS7A 4X6OA 1THRH 1ETRH 1MZDA 3M3TA 3KHVA 2A1DB 2BLOA 1UW7A 1INCA 1AVGH 1ESBA 2PTNA 3NK8A 1FXYA 1P2NA 4CBNA 1C5ZB 1T31A 3IG6B 3ZZCA 1DANH 2PW8H 3A7WA 1FQ3A 1TPAE 3P92A 5ESBA 3SJ9A 2GV7A 1OSSA 5IYTA 2O8WA 1EB2A 1MZAA 2W7UA 3O8RA 1RJXB 4A1XA 2VH0A 5DG6A 3OYPA 4NWLA 1ELEE 1GI0A 4RSPA 4CREA 4RT0A 1LMWB 1KXCA 1UVOA 1Q3XA 2Q6FA 3E8LA 4P00A 5DP6A 2PP6A 1PFXC 1TX6A 3O8CA 2GKVE 2FWWA 1A46H 2NWNA 4AX9H 1DLEA 3BTHE 3SOSA 3U8OH 3LJOA 3TVJB 3B8JA 3M7TA 1G30B 4ZCNA 5F8TA 3UUZA 2WSSD 2XXLA 5L2YH 5TCCA 1SGTA 4B2AA 1TB6H 4AB9A 2HALA 1UVSH 3A8CA 3EGKH 2C8ZB 1DDJA 1UMAH 1H9IE 4JK6A 1S84A 2LNCA 1PYTC 1DX5M 1BTUA 2UUFB 3KQBA 2PLXA 1Y3UA 1LDTT 1SOZA 3HK3B 1HAVA 1F5RA 6LPRA 4GPGA 3LGWA 1KXAA 3GCTF 4FUGA 2NU1E 2K8IA 2P16A 3T2NA 2WPDD 3R3GB 2J95A 2LELA 1BQYA 6ESTA 1ACBE 2FM2A 1QL7A 5TCAA 2V35A 5GNDA 1WSSH 3TGKE 5FPYA 1IQGA 2UUJB 1LCYA 4A6LA 2W3KA 4K69A 3ODFA 1MCTA 2KCOA 1Y5AT 2UUKB 1P9SA 3KQCA 2ZDMA 5EXMA 3NXPA 1Y3XA 3LONA 4WH8A 2M5TA 1C2FA 2O8UA 1N6YA 3MH7A 5CE1A 1E38B 2IJD1 1AKSB 5DP4A 1GBAA 1FV9A 2TGTA 2CHAC 1S5SA 1D3TB 1UCYE 2PUXB 2QIQA 4TY6A 5EQQA 2R9PA 3A7TA 4ZXXH 2YNBA 3MOCA 3ZVEA 2ZIQH 1A3BH 1Z8IB 1WYKA 3SBKA 3T62A 2JETC 1OHHD 1OP0A 4FUDA 2XCNA 1QCPA 2C8XB 2TGAA 3BN9A 3MO3A 1GG6C 4JCNA 1F0UA 2STAE 2FX4A 2VWMA 2BY6X 4NA9H 3QTVH 2OD3B 5HMAA 1E1RD 4FUFA 1O3DA 2IOTA 3RXEA 5E0HA 1XVMA 3A84A 3SU6A 1NRNH 2QF0A 1GL0E 3ELAH 1HGTH 3A87A 2TPIZ 1QHRB 1HFDA 2R3YA 1QA0A 1AZ8A 4A7IB 1ZSLA 2FOCA 2IN2A 1GBLA 3A81A 2PTCE 2OQ5A 4B6FA 4WXVA 2V3MA 2BD3A 3MFJA 4YO9A 4X1NU 3Q3XA 4RKOB 3F6UH 3A83A 1EZQA 4E7RG 1IQLA 1DUAA 1NTPA 2ZPSA 4CRDA 1SG8B 1VITF 2ZCLP 3MO6A 1A4WH 1H8HD 1ZZZA 1ZGIA 4YT7H 3A89A 5AFZH 5G4BA 2ZU4A 2BXUH 3KL6A 5K7RA 4ABDA 3DSPA 2ZG0H 2FLBH 4BAQB 2ZPQA 4CBOA 1V2ST 2CHAB 2G52A 3AW1A 2GZ8A 1CGJE 1DE7H 4I86A 3SN8A 3WWFA 2GCHG 4D8NA 3FP7E 4CR9A 1MQ5A 1LPGB 1BMMH 1UO6A 3RXHA 3TK9A 1ZJDA 1HBTH 4DCDA 3KCGH 3TIUA 1BITA 2A4OA 1L1JA 4INLA 1ANCA 4X8UH 3RXTA 3C1KA 2EA3A 1NBME 1O3HA 1GVLA 3DA9B 2AGGX 1TA6A 3UQOA 1GG6B 1TMUH 1LO6A 5JDUB 3ZYEA 4MPWA 3A86A 3OTPA 3SHAH 3SGAE 1MTVA 1O3MA 3F9EA 1V2RT 1O2QA 4BAHB 2YMSD 3M36A 4I8LA 5EQRA 1THSH 3RMNH 1C2EA 2CGAA 1FONA 1TOCB 1Z7KA 3BG8A 5HKKD 1C1UH 2IPQX 2P3UB 4BTUB 4B75A 3E6PH 1SBWA 1O2IA 4I33A 2GZ9A 4UD9H 4X2VA 1D9IA 1FZZA 1GWAA 1BTZA 2V7QD 5FCKA 2QXIA 3HGNA 3RXBA 1LPZB 1UHBA 1BMNH 1EAWA 5E8EH 2RCEA 1RXPA 2C8WB 1O2LA 2HRVA 4QT8C 4SGBE 3D23A 1GJ4H 4BAOB 5E0GA 1V2TT 1U6QA 3SUEA 3K6YA 3M35A 2BLVA 3TNSA 4ZKRU 1FY8E 1Z8JB 1TNGA 1MKWH 2BDHA 3RC4A 3WY8A 3E0NB 3LGTA 1KY9A 1QB6A 1OKXA 1QBOA 2BY7X 4DVAU 1H8ED 1H1BA 1AUJA 1CT4E 1BRAA 1AY6H 1GI6A 1K2I1 1MKXK 4UONA 3SJOA 3HKJB 1GBDA 2VIOA 4XE4A 3WW7A 2RDLA 2GDDA 3UFAA 5DP5A 1ELFA 3VB4A 2BQWB 2PKSC 4D76A 1T8OA 3CNRA 1EOJA 1WAYB 1BB0B 1C5PA 4X6NA 2VWOA 1SGQE 4TSFD 2HNTC 4WY3A 3M5LA 1MD8A 2ZU1A 3ZV8A 1GMHG 1V2QT 1SGFG 2KCYA 1W14U 2H9EH 2ZA5A 1HAYB 1HB0B 4X8TH 4IMQA 1UTQA 1AO5A 2NU2E 5FL7D 3AVZA 1ZR0A 3M3VA 4TYDA 3SW2B 3RC6A 1D3DB 4X1SU 4A92A 4FU8A 3ZIAD 1GGDC 3AASA 1QL8A 1K1LA 1TPOA 2AS9A 1QB9A 5DSFA 2VIWA 5A0AE 4IGDA 4KKDA 3PMAB 3ZZ9A 2OC1A 1NFXA 2W6ID 3S7HB 4X1QU 3RXAA 4Q7XA 3MU8A 2ZHDA 1C5SA 2BQ6B 1JRSA 2FYQA 2H6MA 1XXDA 2A31A 2WPHS 1IQEA 4XFQA 1ZHMA 2KX4A 1C4V2 2BY5X 1IQKA 2XBXA 4U01A 3E90B 5FXLA 1C9TA 3ZZBA 2A2QH 1P8VC 2Z9KA 4AGKA 1QB1A 1M9UA 5T3HA 3RC5A 2PKSB 4AFUA 1F0RA 4ZKNU 3I78A 1MBQA 2FOAA 2HPPH 1UVPA 2QA9E 1PPCE 1ZTLA 3QLPH 2ZZUH 2WV4A 3Q76A 1Y5BT 3SNDA 3OAAD 3RXRA 2BY9X 3TU7H 2W3IA 3SQEE 2P93A 1IQNA 1FLEE 3BG4C 1QZ8A 3NPSA 4JK5A 1O2ZA 3LU9B 5GCHF 1W10U 5C0TA 3GDSA 1KXBA 1ZRKA 4XSKU 2H2ZA 1GJ7B 1GGDB 2P3TB 2GCTC 4UE7H 3BTQE 3PYHA 2Y7ZA 5T6FA 1O2NA 3PV2A 2HLDD 1SGEE 1YPHC 3M5MA 2QC2A 2A5AA 4UFGH 2HNTE 4X6MA 4BANB 2ZI2H 2GDEH 4J2YB 5AF9H 1S85A 1GHBG 4H4FA 1P12E 5T6DA 2O8MA 4DT4A 3F2HA 4AG1A 3F3BA 3DSGA 3OEED 2EQNA 1P09A 4DT7B 2V3OH 3GY3A 2OTVA 1GBHA 2JJ1D 4NIVA 3UREA 1C5RA 5I46H 5FBEA 2ZU2A 1CQQA 1DICA 1S6HA 3U98H 1J8AA 2FDAA 1CHOF 1K1OA 2F9OA 4OS1A 3PV4A 1O37A 3TH4H 5DP7A 2XCFA 2G4TA 3OEHD 2FIRH 3MWIU 3MU0A 1KYNA 3TJNA 3F68H 1GMHF 1HNEE 5A8XA 1YPLH 3PWCA 3QWCH 2VJ1A 1LTOA 1MU6B 1NESE 1O3KA 1GJAB 1DPOA 2V3HH 3GYLB 1ZMLA 1N1LA 2XTTB 5GPIB 1AN1E 1QL9A 2ZWLH 1TNHA 4TWYA 1OWDA 3SZNA 4IN2A 3BG4B 4AFSA 2KCPA 1CVWH 1A1RA 1SPJA 2HVXA 3PM3A 3EA7A 4K1TA 2ZDNA 3ZZ3A 4A1TA 1RTFB 4AC9A 1FPHH 2F91A 2ZFSA 2GCTB 3S0NA 2QXJA 4FETA 4I7YH 1YLDA 3PLBA 5DO4H 3SGQE 4M7GA 4NZQA 2WUBA 2ZO3H 4D9RA 1GHWH 4NSVA 2GT8A 1XM1A 4ESTE 3FOAA 1TX7A 1YCPM 5EJLA 1Y3WA 1KLIH 1S82A 3VFEA 3H7OA 1W7XH 1CE5A 3EA8A 1OOKB 3SV6A 1NRQH 1JXPA 1TNLA 3H5CB 3QZQA 3Q00A 3GCOA 1W8BH 1XUGA 1ZTKA 2B0FA 3BIUH 1XKAC 1G2MA 3LGIA 1C5TA 2FO9A 3S9AA 3P8FA 1EPTA 1YPHE 1TBRH 5C94A 3MU1A 5F6MA 2BOHB 1G32B 1MTSA 2P94A 3TLOA 2BXTH 3MHWU 1WBGB 3I77A 1E36B 1J17T 1BA8B 4NSYA 1BHXB 2YNAA 1AHTH 5EGMA 2BZAA 3DCLA 1KLTA 1F7ZA 4RN6A 5C67A 4K5ZA 3SZEA 1F92A 4FXGH 4NA8A 1BBRK 9ESTA 3U8TH 1O2MA 1KXEA 1MABB 1HIAB 1E37B 3OTJE 1C5WB 3SNBA 4ZKSU 3EE7A 1YPGH 1C2JA 1JWTA 1EB1H 3U28C 1O2YA 2ZFTA 2BD9A 1QQUA 2WPKS 4D7GA 1FUJA 1C2GA 1TONA 3F9FA 4WMFA 2KM0A 2F43B 3F9HA 1CT2E 1GL1A 1Y5UT 1HAPH 1A7SA 1GHBF 1DITH 3HATH 5CHBA 1EAUA 3KIDU 5FX5A 4HZHA 3RXKA 1QRZA 5EPYA 3VEQB 1Q2WA 2FEQH 2ODYB 3STJA 1MTWA 1LHDH 7LPRA 1E34B 1F0TA 4I8JA 3OX7U 2ZFFH 2XW9A 5EJZA 1C2MA 1WQSA 2SNVA 3N7DA 5GJ4B 1AFQC 1DWDH 3SU2A 4ISHH 4B73A 1TNIA 2RFKC 2AMPA 1GBBA 5F8ZA 1EQ9A 1SGPE 2EI6A 1NFYA 1YGCH 2JJ2D 4UFFH 1FY3A 5DGJA 2IPHA 2Q1JA 4Q7YA 1SLXB 1BMAA 4LXBH 3TH3H 1O3LA 2EEKA 1OWIA 5C5OA 1BIOA 3HGPA 4LK4A 2SGAA 1ANBA 5JPMH 1ZJKA 1DY8A 1XVOA 2O8LA 1V2NT 2J94A 4BAMB 3E91A 1IHTH 2WYGA 1LVOA 2ZU5A 3BEFB 4Y79A 3VXEH 1AVXA 2QE7D 4TT3D 2PV9B 2SGQE 1ZMJA 4D9QA 2W7SA 5GDSH 3KF2A 4DY7B 3MU4A 1P3EA 3MMGA 1D6RA 5C20A 5GXPA 5ETXA 2DUCA 4HFPB 2ZECA 4SGAE 1A2CH 1GI9B 2FP7B 2D26C 1NRRH 1DY9A 1P2KA 1GBTA 2AGIX 2ZHEH 1AMHA 5F53A 2BY8X 3BF6H 2SGPE 4WJG2 1LQEA 1KTTB 3ZYDA 2PKAB 2VB0A 1AFQB 3SJIA 3K2UA 1KXDA 1NY22 3MU5A 3H7TA 3ZVCA 1OS8A 1TQ0B 3GY7A 1HAVB 3A7VA 5C1YA 3S9BA 1SFIA 1O5FH 1O5CB 1JIRA 1S0QA 5E2OA 2YOLA 4FVBA 5A0CA 4K2YA 1XUJA 4CRBA 2BDCA 2XBWA 1HAIH 2LIZA 3SV2H 1O36A 3KQDA 2PKAA 1GMCF 3ZZDA 1XUIA 4TWWA 3T5FH 1UK2A 3BTWE 2OC8A 7GCHG 1ORFA 1YKTA 1GHAF 2FMJA 5EODA 2CJIA 3KEEA 2G4UA 3AK5A 2J4IA 5HGGA 5JBBS 5A2MH 4YOJA 1H4WA 3TK5A 1QBVH 2ZCKP 4Y76A 2A5KA 3SU1A 2BLQA 1Y59T 1D3PB 4JYUH 3SUFA 4GCHF 1BTYA 1BDAA 4MVNA 3RXMA 2FODA 1K9OE 1V6DA 4KELA 3UNSA 3F9GA 1EJAA 2F9UA 3GY2A 3EDXB 3MNBA 3E3TA 4Y0ZE 3FP6E 1O3AA 5L30H 2FPZA 4MPUA 3URDA 1XUKA 3TJUA 3RXDA 3A85A 2WHXA 1B0FA 1WOFA 4B76A 3FZDA 2BDBA 1BHXF 1ZHRA 1GJ9B 2O9QA 5LGOA 2GMTB 2VVVA 1SGRE 2FZZA 1FY1A 1V2UT 1W3CA 2GP9B 2SGFE 3TGIE 3U8RH 1XUHA 5EJ1A 4I8HA 1PPEE 4MQAA 1SI5H 4X8VH 1GMDG 4TPYA 2YMSB 5HM2A 4JYVH 2OK5A 5AHGH 3MH5A 2BHGA 2BD5A 1C2KA 1A5IA 1ZHPA 1VJ9U 5ESTE 4MLFB 4BNRA 4ZKOU 3KN2A 2J98A 1FIZA 2JIZD 2XBYA 3DSOA 2A32A 3DT0H 2QN5T 1P04A 4BTTB 2QXGA 1THPB 3KYGA 3A80A 1ZTJA 1TPSA 3RXJA 5DP8A 4Z1MD 4AB8A 1A61H 3SU5A 2EI7A 2XBVA 1CBWC 1P9UA 1EATA 1IAUA 1H9HE 3KQEA 4R0IA 2R3UA 3U1IB 2ODPA 1C5OH 3F0OA 2TBSA 2ANMH 2VIDA 5C5NA 3ATLA 1AUTC 1ARBA 2R0KA 1ELVA 1MH0A 5HIZA 2J9NA 2IJOB 4UDWH 2G5NA 3GCNA 3URCA 3MNXA 4B71A 3RXOA 3F0PA 1O2HA 2THFB 1BMFD 3B23B 3E16B 1XXFA 2FLRH 4OS4A 3FN8A 1ELBA 3RXSA 1UK4A 2Z9JA 1LVMA 1K1JA 3QK1A 4MTBA 3V3MA 1O5GH 1GHYH 3PMHB 2GJGA 1TGTA 3ZZ8A 1SLUB 5GIBA 1MMJN 2W26A 1UHBB 2ESTE 3OSYA 1OWHA 3NRLA 2SGDE 2VNTA 1NC6A 2BB4A 1DT2A 2Y5HA 1C1VH 3QO6A 4X1PU 1AWHB 2ZTXA 1CA0C 5EW1H 4BXSA 4A5TS 3DHKH 2ZTZA 2A0QB 2BZ6H 1P11E 3A7ZA 1DUEA 1QRXA 2ZF0H 1XMNB 4ABJA 1ZYOA 2R0LA 3UR6A 3KGPA 1GI7B 8ESTE 5AVDA 2ZP0H 1NT1A 1TMTH 3T26A 4GVUA 1QRWA 2HVYB 4YXWD 2FI5E 1CBWB 1PYTD 2Z7FE 4K60A 2P59A 3RXGA 4NZLA 1CA8B 4Y0YE 1SOTA 4JMYA 1SGFA 2F4LA 4ABFA 1K0HA 2QYIA 3AAVA 1H9LB 1C1TA 4Z6AH 1SGIB 4GHQA 3L6PA 4H42U 1EKBB 5A09A 4DIHH 1DOJA 3UR9A 4KTSA 2AEIH 4KTUA 3OU0A 1HUTH 1TX8A 3A8AA 2Z9IA 1P01A 2H9HA 1E1QD 4FOUC 2ZDKA 1C5NH 1MKXH 2I6SA 4Y11E 3JZ2B 4U32A 1L2EA 1NBMD 3RUOA 3PTNA 3ITIA 1GMDF 3GCHC 3BTKE 1BRCE 3UNQA 4Y8XA 1Z71A 4ABHA 2BLWA 2CXVA 1O3GA 4R8TB 1JIMA 4CH8B 1CA0B 3BIVH 2AGEX 1UVUH 4X8SH 4AOQA 1NZQH 1FY5A 4CR5A 2GGVB 4YM9A 1C1MA 2BQ7B 1YYY1 2RA3A 1A3EH 1NROH 4Q4LA 3RDZA 1SHHB 1O2OA 1WDIA 4HTCH 3M7UA 1AU8A 1FJSA 3UNRA 2A4RA 1IQMA 4ASHA 4JZIA 1TIOA 5C1UA 1TPPA 5FAHA 1AI8H 3L33A 4K8YA 2ZFQH 5K0HA 9LPRA 1UTKA 1JOUB 1ZMNA 2TGDA 4X2WA 2OP9A 3ZZ5A 4CRCA 2RA0A 1O3NA 2VWLA 2GCHF 1T8NA 1V2KT 4FUEA 3QDZB 1OYQA 2Z9GA 1UJ1A 1ARCA 1EXFA 3GYMA 1TFXA 1RFNA 4MPVA 1C1NA 3TJVA 1NU9A 2ILNA 2FOEA 4ZHMU 2ZFPH 3PRDA 1EASA 3V7TA 2NU0E 1O2TA 1GCDA 1GJCB 1IQJA 4NFEA 1P02A 1V3XA 1P10A 2V6NA 3GCHB 1K1PA 4WWYA 1ZGVA 4D7FA 1G3CA 1C4Y2 1UTPA 2BVSH 1TABE 3T28A 1KTSB 3ATWA 3D49H 3TPIZ 4X6PA 2AERH 1ZPBA 2QGRA 4Y7BA 1SQOA 1VGCC 3EQ0H 3A8DA 2KFWA 2FS8A 2L74A 4MNWA 5J4QA 1FMGA 5JBAS 3A7XA 1OXGA 3LH1A 1SGNE 2I6QA 1NU7B 3SUGA 2SNWA 1CO7E 1FPCH 4ABIA 2FOMB 3H09A 8LPRA 1EPTC 1IQHA 1TRMA 1WQVH 3UAIC 2ZNKH 1N6XA 1C5VA 5DN6D 5DP3A 2H5DA 1SLWB 2VVCA 3PMJA 1BCUH 1MUEB 2A2XH 3W94A 1BMLA 1CHGA 5SGAE 1V2OT 3OY5U 2CF9H 1TALA 1GI1A 1NRSH 2ZC9H 3LC5A 3T29A 2PGBB 2D8WA 2GZ7A 1SR5C 2JKHA 2ULLA 5EXNA 1WV7H 1V2PT 2ZCHP 3K9XB 1ZPCA 1QFKH 2Y82A 3LT3A 1IQIA 6GCHG 1OP8A 1BZXE 1DWBH 1K22H 4KP0A 4B74A 2HOBA 3VB6A 3NCLA 1GI4A 1C1WH 1SC8U 4WH6A 5KECA 5BRRE 2F3CE 3MQKC 2F9PA 4FU7A 3FKSD 2WPJS 3SHCH 4H6TA 1TE0A 3OFND 3P8NA 4FUBA 1YPKH 2AMDA 1K1MA 2W5EA 1VGCB 1G36A 1V2WT 1VCWA 2VIPA 3G01A 1TNKA 5EU8A 1Z1JA 1ZRBA 4ZAEA 3SU0A 3VB7A 5A8ZA 5EW2H 4IBLH 1VR1H 2PUQH 1AB9C 1UVTH 3A88A 3R0FA 1TA2A 3QUMP 1E35B 3GY6A 4JZ1A 1GBCA 4ZUHA 1EPTB 4MNVA 1C1QA 3BTTE 2K1QA 3P70B 2ALPA 4X1RU 1TAWA 1W2KH 1A5HA 2F9BH 3VGCC 1EZUC 2VWNA 4ZHLU 2VGCB 3A7YA 2HGTH 4J1YA 1RRKA 1LQDB 5JBTA 1YPMH 1QGFA 7ESTE 3TJOA 2QCYA 5HIYA 3RMLH 2UWLA 4A1VA 3SI4H 2BD4A 4INKA 5KEDA 1BRBE 1SB1H 2NU3E 2FTMA 1CSOE 4I8GA 4X2XA 1GBEA 1N8OB 4NGAH 2ZTYA 2UUYA 2ZHFH 2WINI 3MH6A 2QXHA 1L1GA 1LKBA 2BDYA 4WF8A 1RTLA 3LIWA 3RM2H 2WPLS 1BTXA 1XUFA 3SV9A 3M37A 2A5IA 1BT7A 4TPIZ 3P6ZB 4IW4E 4ABBA 1UTNA 1BBRH 3KYFA 1O2VA 1YCPK 1P2MA 1YCPH 2D1JA 3LGUA 4YTAA 2BX3A 1G9IE 1B0EA 1QJ1B 1P3CA 2WV5A 1GDUA 1W0ZU 3F2GA 1NRPH 1AB9B 4F55A 4UFDH 1GCTC 3FZZA 2GV6A 4ZMAH 1LPKB 3RLWH 3VB3A 1ZPZA 3RU4T 1TWXB 2XWAA 3QZRA 1C1PA 2KAIA 4DIIH 4F49A 1YM0A 1KLJH 1O3JA 4MG3A 3A8BA 3VGCB 2HPQH 4ZXYH 2JH0D 3LH3A 3GDUA 1DSTA 3SV8A 3EA9A 2R2WU 1G2LA 1BTHH 1RGQA 3SNCA 1NM6A 2WYJA 2C90B 1HPGA 2JH5D 1ETTH 3V12A 1SHYA 1EJNA 3BSQA 1J9CH 3K6ZA 2P8OB 5B6LA 1SVPA 1S81A 1O34A 5IDKA 2VH6A 1XX9A 3S69A 1W11U 1O3IA 3QTOH 4NIWA 1B7XB 3N7OA 3M5OA 4NCYA 1SGYE 3AW0A 2PWXA 5HYOA 4FUCA 1LVYA 1O2KA 4XOJA 3LGVA 2XC0A 2UWOA 3UOPA 4RKJB 4AN7A 1WTGH 1CGHA 2ZGJA 2JH6D 4FUJA 2C3SA 1EX3A 5F8XA 2QV1A 1OWKA 2ANWA 1L4DA 3FFGA 3RMOH 3PB1E 2AMQA 1UCYK 1C1RA 1HXFH 1ELCA 1MCVA 2LP6A 1O38A 3MO9A 2KZ4A 3RU4D 1SQRA 3ZVGA 1GCTB 3ODDA 3UOUA 5EXLA 1TRYA 3DFJA 3C27B 4I32A 3T25A 5H4IB 2BTCE 2BMGB 3DFLA 1L4ZA 2G8TA 1FX0B 2VVUA 3JZ1B 4BAKB 3HKIB 1HRTH 4ISLA 1AQ7A 2G5VA 2VIVA 1NFWA 2FTLE 1FN8A 4MPXA 1P05A 1QNJA 3M61U 3HPTB 4K3JA 5C3NA 1P0SH 3FANA 1OYTH 1LHFH 2K7XA 3MNSA 4NWKA 4DW2U 2BDGA 1TGNA 2XYAA 1V2LT 2AIQA 1GBKA 5F03A 1SLVB 2Y5GA 1KMHB 4ABAA 3EBNA 3PRBA 5JBCS 1D6WA 2G51A 2HLCA 1IHSH 1ANDA 2BVRH 4MDSA 4HG6A 1C5UA 5JYIA 2CV3A 4Q7ZA 2BDAA 1HYLA 1HCGA 1YPJH 2FI4E 4ISNA 2ZGXH 3SJ8A 3VB5A 4FVDA 1TLDA 1O3CA 1PQ5A 2GMTC 1VITG 4LOYH 2QY0B 4OS2A 3S9CA 4K8BA 3W95A 3WWBA 1BBRE 3RM0H 3V0XA 2TRMA 1P2OA 3F2FA 1HJAC 1WXRA 1EFRD 2AIPA 1GI5A 1PQ8A 1QURH 1C9PA 1BOQA 2YMSC 4B2CA 3PLPA 1GI2A 1C1SA 2OQUA 4VGCC 1BJUA 1YLCA 4ACBA 4CH2B 1ESTA 3MNCA 1FAKH 1DVAH 1SGCA 4GSOA 1VZQH 1C5LH 4JZEH 1KIGH 1GDNA 4OM9A 3RLYH 4ABGA 1O2WA 2C93B 2V0BA 3ZZAA 1BTPA 1QJ6B 1DFPA 4ZHAA 3SORA 4MNYA 4XD7D 1YY3A 3P8OA 4O03A 4WMEA 1J16A 2OC0A 1S0RA 5DK1A 1Q31A 5CDFE 4DURA 4LZ1H 2ZDAH 1RIWC 2OUAA 1DS2E 2Z3DA 2K0QA 2SFAA 4IMZA 5EQSA 4AYYB 3M5NA 2SGEE 2EY4C 5KGOA 1F2SE 1HAGE 2J98B 4IC5A 1TQ7B 1C5XB 1BRUP 1O5BB 1O5AB 4WMDA 5DJ7A 5FCRA 4X2YA 2ZEBA 3SNAA 3ATMA 1GHXH 2H1UA 1DWEH 2KR7A 1P06A 2RG3A 1K21H 1ZSKA 1HJAB 4DG4A 4O9VA 4XBDA 3TK6A 3T27A 1T4VH 1O3BA 4KGAA 2D2DA 3Q3KA 1OPHB 3M3SA 3D62A 1L1NA 2AH4X 5LH8A 1MQ6A
chains in the Genus database with same CATH topology
2FYRA 2OINA 1Z8RA 2ZDVH 4VGCB 1O0DH 4U2WA 4LZ4B 4FU9A 3P8GA 1AWFH 4IC6A 3AAUA 3GOVB 1GVZA 1TBQH 2BDIA 5A8YA 1EAXA 2Q6DA 1QBNA 2PGQB 2ZGHA 1GHZA 2HWLB 1ABJH 1OX1A 4Y7AA 1PPZA 1AKSA 4YOGA 1QTFA 2VIQA 4BXWA 3BEUA 1PJPA 5J4SA 2A45B 1A0HB 1AFEH 4U30A 1MBMA 1KXFA 3SUDA 2Z6BD 3MI4A 3ZZ7A 1YP9A 1HJ9A 7KMEH 1O33A 3NUMA 2R2MB 2TIOA 3IITA 3RXFA 2OXSA 1NS3A 1RIWB 3PROA 4NIYA 2Y80A 5TJXA 1O2JA 2ZGCA 3CS0A 5T6GA 2ZFRH 2XRCA 2WPIS 5I25A 4DJZB 1P03A 2XNIA 1MTUA 4O3UA 1B5GH 3Q77A 4CRAA 3PO1C 4HI3A 1O5DH 3U69H 1GJ8B 4Z0KA 5C2ZA 1D3QB 1TYNA 4KTCA 1HAZB 4HGCA 2FESH 1ZLRA 3LC3A 1NFUA 7GCHF 1J15A 3UWIA 4Y8YA 2ZKSA 1IOEA 1MD7A 5E0JA 1DM4B 1LHGH 1ELTA 1P2JA 2OC7A 4AG2A 2BD8A 1K1NA 1MAYA 2JETB 1O32A 1O3OA 1QR3E 1T7CA 3SNEA 4WXIA 1O30A 1V2MT 5HXFA 1HLTH 1T4UH 2WPMS 2XC4A 1FIWA 1DWCH 3ATKA 5ABWA 3F1SB 1C2IA 2CMYA 2Y7XA 1O2RA 3PWBA 3EAJA 4OS5A 3EE0B 3UIRA 4Y71A 2C4FH 2OLGA 1ELGA 3GY5A 5EOKA 1HXEH 1SQAA 2B7DH 1T8MA 2B9LA 2ZU3A 4PROA 5DKMA 3BTDE 1G3DA 2G81E 4K1SA 2BVXH 4O97A 1DSUA 5GCHG 3DD2H 2PSXA 1RS0A 1S6FA 2OCVB 5HM9A 1XKBC 1AE8H 4JZFH 3PO1B 1EZXC 1JRTA 2B8OH 1QA7A 5FPTA 1O2GH 1O35A 4ISOA 3CP7A 1T8LA 2ANKH 1MKWK 1QQ4A 3TGJE 4XDEA 1QY6A 2ZDLA 1KDQB 3BTFE 1F5KU 2FI3E 4CRFA 1FAXA 1DXPA 5AFYH 1PPHE 1EZSC 1UTOA 2A4GA 1SQTA 3ESTA 3OY6U 3O8BA 4YLQH 1YPEH 2BYAX 2BM2A 2OBQA 1CHOG 1J14A 1LHEH 2GT7A 1QIXB 3RXVA 2O8TA 3QGNB 3LPRA 2G55A 1ELDE 1Z6EA 1AVWA 4K1EA 1FI8A 1KDQA 1GI3A 1LVBA 1QJ7B 2ZQ1A 4AORA 4CHAC 2VINA 1GJDB 2J38A 3LKWA 3RXQA 3VXFH 2ZQ2A 2OBOA 1UK3A 1PQAA 2FOBA 1H8IH 5JB9S 1C2LA 1C4U2 2PSYA 3LJJA 4E05H 1C1OA 1P2QA 2WUCA 3IWMA 1K28D 3FVFB 4OGXA 4AFZA 1EUFA 2F83A 2BD2A 1GJBB 1GBIA 3ZVDA 3SV7A 2ZHWH 2ASUB 1BUIA 4H6SB 4THNH 6CHAC 3TNTA 1EJMA 2A7JA 3ENSB 1GBMA 1L0ZA 1VCQA 4INHA 5DPAA 1GBFA 3FP8E 4OS6A 1HAXB 4GLYA 1CT0E 4BTIB 5PTPA 1SL3A 1Z8GA 5A0BA 1GHVH 1O5EH 1O3EA 2CN0H 5LPEA 4NA7A 2BX4A 3GY8A 4YLUA 1NPMA 4GHTA 3VPKA 1OWJA 3V13A 2UWPA 2DE8A 1CGIE 3SJKA 3RXLA 4WVPE 4Y6DA 4I31A 3TH2H 1K1IA 1G37A 3GISB 5GWZA 3P95A 2A7CA 3UY9A 8KME2 3MTYA 3SU4A 2AFQB 3P17H 4CHAB 2AYWA 1PPFE 2FS9A 4AZ2B 4XBCA 3EYDA 1VJAU 2GD4B 1Z1IA 1HAHH 2VGCC 4AYVB 3MYWA 3BV9B 1W0YH 1BJVA 4X0WU 1EP5A 2DE9A 1LKAA 3ZV9A 1NO9H 1O31A 1RD3B 1SGDE 1JMOH 5EG4A 4FUHA 2ZPRA 2Q6GA 2B5TB 1Y3VA 3BTEE 4Y8ZA 1A5GH 1W13U 2A7HA 2QAAA 1ANEA 1GDQA 2FOFA 1E0FD 3ATIA 1AZZA 6CHAB 1N8OC 4YT6H 2TGPZ 2G00A 3SQHE 3E1XB 3FAOA 1FY4A 1GJ5H 2BOKA 2Z94A 3O8DA 1AE5A 3L3TA 5BPEA 3U1JB 4AGJA 5FBIA 2Y5FA 4TY7A 1VCPA 4DOQA 3RXCA 5CHAC 4Q2KA 4UFEH 4UEHH 2ALVA 1TGSZ 4E06H 3UQVA 1ETSH 1LHCH 2H5CA 1H8DH 5FX6A 5EPNA 4CRGA 1AD8H 2J92A 2P3FH 1PPGE 3Q3YA 4NG9H 2Z3EA 1A0JA 1W12U 2PR3A 8GCHG 1TRNA 1ZSJA 1C5YB 2VU8E 2P95A 3LGYA 1TGBA 1WU1A 1SSXA 1Z6JH 5B6OA 5E2PA 2QF3A 4FUIA 3RXPA 3ZVFA 4JYTA 2EI8A 5L2ZH 3QX5H 2ZGBH 2J34A 4BOHA 5LPFA 1MTNC 3UWJH 3LOXA 1C2DA 1HAOH 1VITH 3STIA 1NN6A 4JZDH 1WTHD 2ANYA 5DP9A 3QGJA 3GDVA 4ABEA 1G3EA 3CENA 1S83A 2Y81A 2C8YB 2PFEA 3PTBA 1TMBH 3CS7A 4OGYA 1ZOMA 1HDTH 1YC0A 3A82A 1DLKB 1C5MD 1AIXH 1D4PB 1KSNA 2EC9H 1MU8B 2P8OC 1X7AC 1HV7A 4F4OC 5FHTA 1TNJA 1O3FA 2F9VA 2XC5A 2Y6TA 1O2SA 2NU4E 3B9FH 2Z3CA 1EP6A 1A0LA 1FN6A 3D65E 1EAIA 3BTGE 1O2PA 3K65B 4MNXA 4Q80A 1PQ7A 2KAIB 5CHAB 1V2VT 1YBWA 4ZH8A 2FOHA 1ELAA 3ZVBA 1PPBH 3PMBB 2A4QA 1V2JT 4O3TA 4ZROA 1P57B 1AGJA 3GY4A 1MAXA 2J2UA 1ESAA 1O39A 2PHBA 4GAWA 2FX6A 1MTNB 4ISIH 3U9AH 3MH4A 1FDPA 1WUNH 4Y10E 1TOMH 3DUXH 3I29A 3RU4E 1EOLA 1UTLM 1C5QA 5FPSA 1F5LA 4B2BA 1O2UA 1TGCA 1Y8TA 4YOIA 4YESB 1O3PB 3LDXH 2Z9LA 4AFQA 1GPZA 1GMCG 1WCZA 6GCHF 2ODQA 5L6NH 1T32A 2LPRA 1W7GH 3S7KB 1GHAG 2XWBI 3GCTG 3ZVAA 1YF4A 4XBBA 1DXWA 3HK6B 1P2IA 1SFQB 2ZHQH 3E0PB 2FXRA 3BTME 4B1TA 1BTWA 3ZZ4A 3QN7A 3RXIA 3NKKA 1JBUH 1HIAA 1G3BA 1O2XA 4E7NA 2STBE 3GICB 1CU1A 3RXUA 2FOGA 8GCHF 2GVFA 1GVKB 3PLKA 4GUXA 5CMXH 5LPRA 2GTBA 4GCHG 2F9NA 4DGJA 2BD7A 3NZIA 4YZUA 1UCYH 2GX4A 1GJ6A 3RMMH 1OP2A 4NIXA 3SGBE 3SU3A 3M7QA 1GBJA 1SMFE 1F0SA 1FNIA 1ID5H 1OWEA 4IN1A 2HNTF 5C1XA 3BEIB 3SO3A 3SI3H 4IS5A 2H9TH 1ABIH 1GI8B 3UTUH 1TBZH 1IQFA 4NFFA 1UTJA 1RTKA 2CF8H 3KNXA 3TITA 3RP2A 3NWUA 5JB8S 1Y3YA 1UTMA 1C2HA 4I8KA 3ZZ6A 3UPEA 1HJ8A 4OS7A 4X6OA 1THRH 1ETRH 1MZDA 3M3TA 3KHVA 2A1DB 2BLOA 1INCA 1AVGH 1ESBA 2PTNA 3NK8A 1FXYA 1P2NA 4CBNA 1C5ZB 1T31A 3IG6B 3ZZCA 1DANH 2PW8H 3A7WA 1FQ3A 1TPAE 3P92A 5ESBA 3SJ9A 2GV7A 1OSSA 5IYTA 2O8WA 1EB2A 1MZAA 2W7UA 3O8RA 1RJXB 4A1XA 2VH0A 5DG6A 3OYPA 4NWLA 1ELEE 1GI0A 4RSPA 4CREA 1LMWB 1KXCA 1UVOA 1Q3XA 2Q6FA 3E8LA 5DP6A 1PFXC 1TX6A 3O8CA 2GKVE 2FWWA 1A46H 2NWNA 4AX9H 1DLEA 3BTHE 3SOSA 3U8OH 3LJOA 3TVJB 3B8JA 3M7TA 1G30B 5F8TA 3UUZA 2XXLA 5L2YH 5TCCA 1SGTA 4B2AA 1TB6H 4AB9A 2HALA 1UVSH 3A8CA 3EGKH 2C8ZB 1DDJA 1UMAH 1H9IE 4JK6A 1S84A 2LNCA 1PYTC 1DX5M 1BTUA 2UUFB 3KQBA 2PLXA 1Y3UA 1LDTT 1SOZA 3HK3B 1HAVA 1F5RA 6LPRA 4GPGA 3LGWA 1KXAA 3GCTF 4FUGA 2NU1E 2P16A 3T2NA 3R3GB 2J95A 1BQYA 6ESTA 1ACBE 2FM2A 1QL7A 5TCAA 2V35A 1WSSH 3TGKE 5FPYA 1IQGA 2UUJB 1LCYA 4A6LA 2W3KA 4K69A 3ODFA 1MCTA 1Y5AT 2UUKB 1P9SA 3KQCA 2ZDMA 5EXMA 3NXPA 1Y3XA 3LONA 4WH8A 2M5TA 1C2FA 2O8UA 1N6YA 3MH7A 5CE1A 1E38B 1AKSB 5DP4A 1GBAA 1FV9A 2TGTA 2CHAC 1S5SA 1D3TB 1UCYE 2PUXB 2QIQA 4TY6A 5EQQA 2R9PA 3A7TA 4ZXXH 2YNBA 3MOCA 3ZVEA 2ZIQH 1A3BH 1Z8IB 1WYKA 3SBKA 3T62A 2JETC 1OP0A 4FUDA 2XCNA 1QCPA 2C8XB 2TGAA 3BN9A 3MO3A 1GG6C 4JCNA 1F0UA 2STAE 2FX4A 2VWMA 2BY6X 4NA9H 3QTVH 2OD3B 5HMAA 4FUFA 1O3DA 2IOTA 3RXEA 5E0HA 1XVMA 3A84A 3SU6A 1NRNH 2QF0A 1GL0E 3ELAH 1HGTH 3A87A 2TPIZ 1QHRB 1HFDA 2R3YA 1QA0A 1AZ8A 4A7IB 1ZSLA 2FOCA 2IN2A 1GBLA 3A81A 2PTCE 2OQ5A 4WXVA 2BD3A 3MFJA 4YO9A 4X1NU 3Q3XA 4RKOB 3F6UH 3A83A 1EZQA 4E7RG 1IQLA 1DUAA 1NTPA 2ZPSA 4CRDA 1SG8B 1VITF 2ZCLP 3MO6A 1A4WH 1ZZZA 1ZGIA 4YT7H 3A89A 5AFZH 5G4BA 2ZU4A 2BXUH 3KL6A 5K7RA 4ABDA 2ZG0H 2FLBH 4BAQB 2ZPQA 4CBOA 1V2ST 2CHAB 2G52A 3AW1A 2GZ8A 1CGJE 1DE7H 3SN8A 2GCHG 4D8NA 3FP7E 4CR9A 1MQ5A 1LPGB 1BMMH 1UO6A 3RXHA 3TK9A 1ZJDA 1HBTH 4DCDA 3KCGH 3TIUA 1BITA 2A4OA 1L1JA 4INLA 1ANCA 4X8UH 3RXTA 3C1KA 2EA3A 1O3HA 3DA9B 1GVLA 2AGGX 1TA6A 3UQOA 1GG6B 1TMUH 1LO6A 5JDUB 3ZYEA 4MPWA 3A86A 3SHAH 3SGAE 1MTVA 1O3MA 3F9EA 1V2RT 1O2QA 4BAHB 3M36A 4I8LA 5EQRA 1THSH 3RMNH 1C2EA 2CGAA 1FONA 1TOCB 1Z7KA 3BG8A 1C1UH 2P3UB 4BTUB 4B75A 3E6PH 1SBWA 1O2IA 4I33A 2GZ9A 4UD9H 4X2VA 1D9IA 1FZZA 1GWAA 1BTZA 5FCKA 2QXIA 3HGNA 3RXBA 1LPZB 1UHBA 1BMNH 1EAWA 5E8EH 2RCEA 1RXPA 2C8WB 1O2LA 2HRVA 4QT8C 4SGBE 3D23A 1GJ4H 4BAOB 5E0GA 1V2TT 1U6QA 3SUEA 3K6YA 3M35A 2BLVA 3TNSA 4ZKRU 1FY8E 1Z8JB 1TNGA 1MKWH 2BDHA 3RC4A 3WY8A 3E0NB 3LGTA 1KY9A 1QB6A 1OKXA 1QBOA 2BY7X 4DVAU 1H1BA 1AUJA 1CT4E 1BRAA 1AY6H 1GI6A 1K2I1 1MKXK 4UONA 3SJOA 3HKJB 1GBDA 2VIOA 4XE4A 2RDLA 2GDDA 3UFAA 5DP5A 1ELFA 3VB4A 2BQWB 2PKSC 4D76A 1T8OA 1EOJA 1WAYB 1BB0B 1C5PA 4X6NA 2VWOA 1SGQE 2HNTC 4WY3A 3M5LA 1MD8A 2ZU1A 3ZV8A 1GMHG 1V2QT 1SGFG 1W14U 2H9EH 2ZA5A 1HAYB 1HB0B 4X8TH 4IMQA 1UTQA 1AO5A 2NU2E 3AVZA 1ZR0A 3M3VA 4TYDA 3SW2B 3RC6A 1D3DB 4X1SU 4A92A 4FU8A 1GGDC 3AASA 1QL8A 1K1LA 1TPOA 2AS9A 1QB9A 2VIWA 5A0AE 4IGDA 4KKDA 3PMAB 3ZZ9A 2OC1A 1NFXA 3S7HB 4X1QU 3RXAA 4Q7XA 3MU8A 2ZHDA 1C5SA 2BQ6B 1JRSA 2FYQA 2H6MA 1XXDA 2A31A 2WPHS 1IQEA 4XFQA 1ZHMA 1C4V2 2BY5X 1IQKA 2XBXA 4U01A 3E90B 5FXLA 1C9TA 3ZZBA 2A2QH 1P8VC 2Z9KA 4AGKA 1QB1A 1M9UA 5T3HA 3RC5A 2PKSB 4AFUA 1F0RA 4ZKNU 3I78A 1MBQA 2FOAA 2HPPH 1UVPA 2QA9E 1PPCE 1ZTLA 3QLPH 2ZZUH 2WV4A 3Q76A 1Y5BT 3SNDA 3RXRA 2BY9X 3TU7H 2W3IA 3SQEE 2P93A 1IQNA 1FLEE 3BG4C 3NPSA 4JK5A 1O2ZA 3LU9B 5GCHF 1W10U 3GDSA 1KXBA 1ZRKA 4XSKU 2H2ZA 1GJ7B 1GGDB 2P3TB 2GCTC 4UE7H 3BTQE 3PYHA 2Y7ZA 5T6FA 1O2NA 1SGEE 1YPHC 3M5MA 2QC2A 2A5AA 4UFGH 2HNTE 4X6MA 4BANB 2ZI2H 2GDEH 4J2YB 5AF9H 1S85A 1GHBG 4H4FA 1P12E 5T6DA 2O8MA 4AG1A 1P09A 4DT7B 2V3OH 3GY3A 2OTVA 1GBHA 4NIVA 3UREA 1C5RA 5I46H 5FBEA 2ZU2A 1CQQA 1DICA 1S6HA 3U98H 1J8AA 2FDAA 1CHOF 1K1OA 2F9OA 4OS1A 3PV4A 1O37A 3TH4H 5DP7A 2XCFA 2G4TA 2FIRH 3MWIU 3MU0A