2ZU4A

Complex structure of sars-cov 3cl protease with tg-0204998
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
source organism Sars coronavirus
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu4A02
1O5DH 4X6NA 1HJ8A 2STBE 3RXMA 1HJAB 3AASA 2H9HA 4K69A 4NIWA 1GBKA 4K1SA 5E0JA 4SGBE 5F6MA 1AVGH 2Y5HA 3NZIA 2PSYA 3SHCH 1UTNA 2OINA 1G2MA 1Z6JH 2D8WA 1P3EA 2XC0A 2ZF0H 2Q6DA 1C1RA 1YP9A 3G01A 3UY9A 1JRTA 1DDJA 2ZDKA 1PQ8A 1Y3WA 3FP7E 4JK6A 4I8HA 2C8XB 2ANKH 1W3CA 4NFEA 1O3MA 5FXLA 3IG6B 4ZH8A 4AYVB 2HNTF 5HM2A 2VWOA 5IDKA 1UK4A 1P06A 4R0IA 1K2I1 1C1VH 2XBXA 1WOFA 4OS5A 5ESBA 1TX8A 4BXWA 3A7ZA 3SUFA 1AUTC 1Y59T 1NC6A 2VIWA 4X6MA 2ZFFH 1QNJA 2BDBA 1C5RA 3SQEE 2VVUA 2G52A 1K1PA 1PPGE 4NWKA 3ZZAA 1AQ7A 2O8WA 1GI8B 1CHOF 1GGDB 4BNRA 1UTJA 2ZGHA 2G51A 1H1BA 2BD8A 3MMGA 1TRNA 4H4FA 1UK2A 3TK9A 4B76A 1SHYA 2BMGB 3Q3XA 2XC4A 3TNTA 4K1TA 1TE0A 6GCHF 4I31A 2VIDA 1ZMJA 2Q1JA 1JMOH 7KMEH 3E91A 1F0TA 2ZDVH 5JPMH 4JZFH 6GCHG 1KXAA 3BEFB 3GDSA 1C1SA 2CF8H 3RXKA 4GPGA 1TNHA 2A7CA 1GJDB 5E8EH 2ZIQH 1LTOA 1HAIH 1JIRA 4IC6A 2O9QA 3A89A 2QV1A 2ZU2A 1TMUH 3TH2H 3TJUA 2A5AA 1MBMA 4A5TS 1IQEA 4MPWA 2H5DA 1GHVH 2PLXA 2ZTXA 2FO9A 1TGCA 1L1NA 4HTCH 1CQQA 1RS0A 2BDYA 1WBGB 1O3AA 1QTFA 2B9LA 2BY8X 1E37B 2PR3A 3ITIA 2Z3CA 3RXDA 3ZYEA 1MUEB 1U6QA 1OKXA 1YPGH 3A81A 2FTMA 2AIQA 1T8LA 1S84A 2GV7A 1GI0A 1ZTJA 1ELVA 2WV5A 3M5OA 1OSSA 1EXFA 5DP7A 1EUFA 1SLWB 1KDQB 1W12U 1TNGA 1O2NA 2XBVA 1D6WA 1GGDC 5HGGA 1SFQB 1A46H 2H9TH 1GHZA 3S7HB 5F8XA 4Y7AA 3ZZ7A 3MU4A 2FI3E 3E90B 1GPZA 3UTUH 4BOHA 1GI1A 3ZVCA 4B73A 1TGTA 1J14A 2QYIA 1IOEA 3L3TA 2J4IA 2M5TA 4DT7B 4HFPB 2HNTE 2ZU1A 4DY7B 1TQ7B 1NRQH 1V2PT 1PPEE 1HGTH 1ZMLA 1WSSH 3Q00A 3T29A 1FY8E 4Q7YA 2ZKSA 1THPB 2CXVA 4WH6A 4DGJA 1AB9B 1XUFA 2Y80A 5FCRA 1LHEH 4AFSA 2GCHF 1CO7E 1ELEE 2C8WB 3E6PH 4J2YB 1KTSB 1LVMA 3QLPH 3PLBA 1EAIA 1P11E 4QT8C 2AMPA 2ZZUH 1LMWB 4ZKSU 2WYGA 3SV2H 4KTUA 1SB1H 3VXEH 5JDUB 4IN2A 4FU9A 4DJZB 1OXGA 1EPTC 6LPRA 2FX6A 3SI4H 1BJUA 1HLTH 2QN5T 3UWIA 1E34B 1MKWK 2A4OA 1V2TT 1E36B 1GBBA 2ZGBH 3E0NB 3RXJA 6CHAB 3SV8A 1S0RA 1O3CA 2ZCKP 3MNSA 1O2QA 1A2CH 4XBDA 1T8MA 2ODPA 4YZUA 4ZUHA 3SNDA 1LO6A 1QBOA 2OXSA 2SGQE 2WV4A 3HGNA 1F0UA 1AVXA 3KN2A 3GOVB 3F68H 3OX7U 3SGAE 4NSYA 1TPSA 4Q80A 1O30A 4H42U 3OSYA 1CA0C 5IYTA 2VWMA 3F9EA 3LJOA 2CMYA 1EJNA 3TH3H 3KIDU 2P8OB 4ISIH 4IS5A 2QXIA 1LHGH 2C4FH 3FZZA 2Y5GA 3MH4A 1AB9C 1AFQC 1S6HA 1MMJN 2FOGA 3PMHB 1YKTA 2AGGX 1LVOA 7ESTE 1ZLRA 1KXBA 3HKIB 1O3LA 1DY8A 2P93A 4RKJB 4YTAA 1BRUP 3A88A 1YPLH 3JZ2B 3RLYH 5AHGH 1O2RA 1AD8H 5K0HA 1FY3A 1MKXH 4BAOB 3TNSA 1MBQA 3BN9A 4GHTA 5TCAA 1CT0E 2UWOA 3D62A 5AFZH 1Z8IB 2Y81A 4WVPE 4B1TA 1P02A 3C27B 3L33A 4CH8B 2JETC 3ZYDA 1P0SH 1HRTH 3T27A 6CHAC 1FJSA 4K3JA 5TJXA 1Y3YA 2DUCA 2TBSA 1HV7A 2V3OH 1MCTA 1G3CA 1P2JA 3GDUA 3KGPA 1O2WA 9LPRA 5FPTA 4CR9A 1DUEA 1ELFA 1VJ9U 3ATWA 1MQ5A 3MH5A 3QK1A 4E05H 1A7SA 4ISLA 1L4DA 1OP8A 1PPCE 2A32A 4IN1A 5HMAA 1L4ZA 1QRZA 1VR1H 4AG2A 1TLDA 5DG6A 1O5EH 4NIXA 4ZHMU 1GJAB 1OOKB 4ZAEA 1MU8B 2TGAA 2BVXH 1XKAC 2K1QA 4NGAH 1SR5C 1Q2WA 2K7XA 1TBZH 3VB6A 2BVSH 2FOBA 2J92A 3QGNB 4KKDA 4Q7ZA 4XBBA 5EODA 2OBOA 4NA8A 2HVXA 3OY5U 1BITA 2TIOA 2HLCA 2PGBB 4JZEH 1FN8A 3SNAA 3E16B 3MO9A 1C5XB 1IQIA 1FQ3A 1AKSA 1C5TA 3VB4A 2FOMB 4I8LA 3RXLA 2YNBA 1TA6A 3ZVEA 4YOGA 3SU2A 4JYUH 3BTHE 4K2YA 4CRAA 4IGDA 5DP6A 2QCYA 2WINI 1QB9A 1XVOA 2AMQA 2XNIA 1DUAA 2BYAX 3RMMH 2Z3EA 1ELCA 2LPRA 3RUOA 3BV9B 1HIAA 2TGTA 3AW1A 3RM2H 2OCVB 2GT7A 1F92A 1LVYA 4ZKRU 3O8DA 1YPMH 1Z1JA 2W5EA 2GTBA 1DX5M 3PMBB 2OC7A 1C1TA 1V2UT 3LGTA 2QAAA 1JBUH 1NFWA 1TABE 1WTGH 1O3IA 1SGFG 1TALA 3EDXB 1KIGH 1V3XA 2H2ZA 1AU8A 1NRPH 1A5HA 2BD7A 2GZ7A 1ZRKA 1EP5A 3UQOA 3LJJA 3STIA 1SVPA 1Q31A 2J34A 3FFGA 1NRNH 1MCVA 1LCYA 2PHBA 3P8NA 2ZECA 1FV9A 3KQCA 3SV9A 1O2KA 1Z8JB 3GCNA 1ANDA 1GI7B 3RXGA 3ZZ5A 4FVDA 3A7XA 1JWTA 1ZHMA 2Z9IA 1F5KU 3BG8A 1RIWC 1ESTA 3NKKA 4AG1A 1GHWH 1S5SA 1UVPA 4AZ2B 1GG6B 5FAHA 3UNQA 1D3PB 3SHAH 2UUKB 1EP6A 4FU7A 2FTLE 4ABIA 1ELBA 1XUHA 1T4UH 3DUXH 4D76A 2AFQB 2ALPA 1NM6A 1A0JA 5EQQA 1QQUA 4D7FA 2GP9B 1HCGA 3MU5A 8KME2 4KP0A 1W2KH 3M3VA 1AZ8A 1HNEE 4Y11E 1S6FA 1V2NT 2A4GA 1KLTA 3LT3A 1SGQE 2AYWA 1A5GH 2FODA 1DANH 2G55A 2GD4B 2IN2A 2ESTE 1Z8RA 1V6DA 4AN7A 5CE1A 1C4Y2 2O8LA 1XKBC 1MD7A 2WPIS 5E2PA 1ZRBA 1B0FA 1SOZA 4NSVA 2ZPRA 3UFAA 4OS4A 4ZXXH 1YPKH 1UTLM 1K9OE 3PM3A 1UCYH 2J95A 2C8YB 3RXCA 5DJ7A 4IMQA 3V13A 3TGKE 2OC0A 5FX6A 3M5LA 1O3HA 2SNWA 3DA9B 2H5CA 1D9IA 2ZDMA 1BJVA 2DE9A 2F9PA 4A1XA 3SU0A 1ZPZA 4I8GA 2A2QH 1P2KA 1ESAA 4BANB 1O5CB 4LK4A 1UTMA 2R2WU 2Y82A 2BY7X 1FDPA 1C1NA 1L1JA 4H6SB 1EX3A 3TITA 3RC6A 1TNLA 1ANBA 3P6ZB 1OWHA 2SFAA 3K6YA 2J2UA 2TGPZ 3LDXH 1BUIA 1GG6C 3A7VA 1SBWA 1P2NA 3H5CB 2P3TB 1Y3VA 5AFYH 1DWBH 1GBJA 1UHBA 1ZMNA 1NY22 5L30H 3PYHA 1ZR0A 1MKWH 1OPHB 5FCKA 2EI6A 3RP2A 2AS9A 1MKXK 1YBWA 1FUJA 3TGJE 1RTKA 2W7SA 1THSH 3T62A 1CBWB 3U98H 1VGCB 3TJVA 1BIOA 4NA9H 1GDQA 2XW9A 2UWPA 2VNTA 1GVKB 1LDTT 4FVBA 4Y8ZA 3RXIA 3KEEA 3SQHE 2O8MA 1QRXA 4MTBA 1TX7A 2ZEBA 1EOLA 3PB1E 2QY0B 2OP9A 4YESB 5F8ZA 1GHBF 2HPQH 2BVRH 4TWYA 2HGTH 5L6NH 3N7OA 4OS2A 4GSOA 1C5NH 1SGNE 2GGVB 2FYQA 3PMAB 2VWLA 4HZHA 3H7OA 4CREA 2ZHEH 1MZDA 4NIYA 4X2YA 4X1QU 2V0BA 1DS2E 2XBYA 2HRVA 2ZHDA 2FOFA 5C1XA 1FLEE 1ZGIA 1VCQA 4DURA 2Z94A 3CS0A 1ELDE 1SPJA 4BAHB 1KTTB 5J4QA 1C2GA 1Y3XA 1OWEA 4BAMB 5A8YA 4JYTA 1C9PA 2V6NA 3PROA 3LH1A 1ARCA 5I46H 3FP6E 1C2MA 3SGQE 2FMJA 2BY9X 3M7TA 2BX4A 3A86A 3RU4E 1BMLA 1E38B 2BD9A 3D65E 2ANYA 3LU9B 5EOKA 3H7TA 1TGBA 2J38A 2BB4A 2VINA 1GI6A 1RGQA 3LH3A 4A7IB 3ZVGA 3DT0H 1CBWC 3LGIA 3RMOH 1VGCC 3K65B 3QGJA 4TYDA 3STJA 1ZHPA 2Z9JA 1EZQA 5ETXA 2F83A 1VITH 4Y0ZE 1C5ZB 1P2IA 2FOHA 1K1NA 2PGQB 4KELA 5JBCS 1UVUH 4NG9H 3BTEE 1EZXC 4CR5A 2I6SA 3PMJA 2FYRA 4ABHA 4GLYA 3KQBA 2SGAA 2ZU5A 2QGRA 5C20A 2JH0D 1CGJE 1KLJH 2GKVE 1GI2A 2G5VA 2FESH 1P3CA 3ESTA 2ILNA 1O38A 4XSKU 3ODFA 1O31A 3A87A 2SNVA 1FY4A 2BOHB 1C2HA 1ID5H 4B2BA 2R2MB 1SC8U 3A80A 3RXSA 2QXHA 3TJNA 3V12A 3VEQB 1ANCA 3D23A 5EPYA 1FN6A 1QB6A 2W3KA 1P2QA 3Q3YA 2YNAA 1KLIH 3GCHB 4INLA 2UUYA 1WV7H 1GMDG 1J16A 4A6LA 2SGPE 1CVWH 2G8TA 2O8UA 1WYKA 1GJ8B 2AMDA 2ZHWH 1NROH 3UNSA 2D26C 1O3JA 1OP2A 1A3EH 2BD5A 1BRCE 2GT8A 3IWMA 1DOJA 1SGRE 1FI8A 2BDCA 4XFQA 1SGDE 1IQHA 1D3DB 1GMCF 1GI5A 2STAE 2VVVA 1DM4B 1EPTB 1P8VC 2FIRH 1HAVA 4XBCA 3F9FA 3SU3A 1N6YA 1SLUB 3RXOA 1WUNH 5JBTA 1HJ9A 1T4VH 4OS1A 1MTVA 1C2FA 2ULLA 3M7QA 1GMCG 1GWAA 2ZPSA 1QA0A 1O36A 1HUTH 4AB9A 1GJ9B 1EQ9A 2PTNA 3T5FH 1IHTH 1HAYB 3RXRA 1QURH 2H6MA 3K9XB 1GJ4H 1TFXA 1UO6A 1O2YA 1FXYA 1ZHRA 4AB8A 3VPKA 4MPXA 4FUFA 3D49H 1GBDA 2RA3A 2I6QA 3CS7A 1A61H 4Y76A 2BLQA 3SNEA 3SNBA 2GMTB 1CA0B 2W3IA 2V3HH 3ZVFA 4Y71A 3QTOH 4ZKOU 3MYWA 1CU1A 3RXHA 2AGIX 2F9UA 1HFDA 3GCHC 1UCYK 2ZI2H 2BLVA 3U9AH 4WXVA 1TAWA 1BTHH 1V2MT 1AFQB 2XC5A 4U30A 5BPEA 1BHXF 4CRDA 2R0KA 1HXFH 1CA8B 1CT2E 1O2MA 3W94A 1P9SA 4WWYA 1BOQA 1A1RA 1HAPH 1HYLA 2BD4A 1TNKA 3GY5A 2ZPQA 1OP0A 2BDAA 1TBQH 1Y3UA 1DVAH 4TWWA 4X6PA 4AFQA 1S83A 1DY9A 1SGPE 1C2IA 4OS7A 1NZQH 1ZJDA 1DLKB 2R3YA 1J15A 1FMGA 1H9LB 2BM2A 1Z8GA 3CENA 2A4QA 1TPOA 2JETB 1JOUB 1W11U 5FPYA 1C1QA 1AN1E 2JH6D 1O2UA 4J1YA 1O3FA 2C3SA 1GI3A 1RTLA 2JKHA 1AKSB 2FX4A 1SOTA 3TLOA 1O2IA 3PTNA 1TNIA 5C1YA 1P10A 2XWAA 3E8LA 1KY9A 3ATKA 7GCHG 4HI3A 1DITH 4ZHAA 3C1KA 3ZV9A 3LC5A 1EAXA 2ZC9H 2A7JA 2GMTC 2Q6GA 1KXEA 4RSPA 2UUFB 1WU1A 4D9RA 5HM9A 5J4SA 4NIVA 4CRBA 3SUGA 1HIAB 1ABIH 1XUIA 4DG4A 1O3DA 1UMAH 1QIXB 3M7UA 2DE8A 4ISNA 5DPAA 3S9CA 1G37A 2F3CE 1O2GH 2C90B 1TBRH 1YPHE 3T2NA 1O2XA 2EA3A 1GI4A 3V3MA 3SO3A 1PPFE 1P12E 7LPRA 1GHXH 3QDZB 3UR6A 3F1SB 4NA7A 1W10U 3RXQA 3OU0A 1AVWA 1UTKA 1PPHE 3GISB 1KSNA 3QTVH 3VFEA 3QZQA 1C1OA 1PQAA 1OWKA 4BAKB 2NU3E 1NU7B 2XCNA 4CBNA 5A0CA 1N8OC 5FX5A 2ZA5A 4CRGA 1HAGE 1LPKB 3FANA 4Z0KA 2WUCA 2Q6FA 1ARBA 1P03A 3U8TH 1VZQH 4MDSA 1D3TB 2R0LA 2PKAA 8GCHG 1AE5A 3RXFA 1AWFH 1BRBE 4GAWA 1QRWA 1KXCA 3LGYA 2A45B 2FZZA 5GPIB 1ZYOA 2FXRA 1MU6B 2BY5X 4X2VA 2FOEA 1V2RT 3TVJB 4I33A 1SGCA 3MTYA 5CMXH 5HXFA 1VCPA 1C2DA 3NXPA 4K5ZA 4O9VA 2CGAA 2ZO3H 1ZPBA 4DCDA 4Y6DA 5A09A 5H4IB 4FU8A 3GY2A 3V7TA 4Y79A 2OTVA 1QHRB 2FPZA 2F9VA 2GDEH 1HAHH 1YCPH 1MD8A 2QF3A 4D8NA 2RDLA 1GBTA 1BBRE 5T3HA 1ANEA 1FIZA 4WH8A 1KXDA 1FPHH 2GV6A 1G32B 2BQ7B 2ZDLA 1KXFA 5A8XA 1SMFE 1UTPA 3GCTG 1RIWB 2J9NA 3GICB 1P01A 3RXVA 2B5TB 1C5PA 1QY6A 2GCTC 2D2DA 2FM2A 1FAXA 1B5GH 5CHAB 4ABFA 5A0AE 1BTWA 1Y5AT 3B8JA 5L2YH 4ASHA 3VB7A 3B23B 4X8SH 1XM1A 2Y7ZA 2BDIA 1GBHA 4UEHH 3BEIB 3SN8A 4ZXYH 4I7YH 5DKMA 2AGEX 1F0SA 1TQ0B 1AI8H 5AVDA 1DXPA 4MG3A 1SGTA 1QR3E 2A31A 1XVMA 1WTHD 1EB1H 1F5RA 2Y5FA 1SG8B 3RMNH 3DFJA 2B0FA 5C5NA 3VB3A 2JH5D 3BTME 1GJBB 2VVCA 4JZ1A 1GDNA 4MNXA 3NWUA 2Z9KA 3QZRA 3RXAA 3TK5A 1J8AA 2XRCA 1HAOH 1UHBB 1SGEE 4AGJA 1PQ5A 4LZ4B 1SQOA 4Q2KA 4WMEA 2Z9LA 2KAIA 3GDVA 1UK3A 3GCOA 4D9QA 1O3GA 1CE5A 1Y8TA 3RC5A 3RU4T 3SU1A 1NT1A 1O5FH 4AOQA 2TRMA 1O3OA 3LGVA 2G4UA 3CP7A 1GJ6A 3M5MA 1QL9A 3A84A 2BTCE 1SI5H 3QN7A 4O03A 1TGSZ 3SBKA 3MU0A 3P17H 1O3PB 1S82A 1RXPA 1HAXB 5CHAC 2Z3DA 3LIWA 1QBNA 5EQRA 2BLWA 1P57B 2P16A 1NTPA 1THRH 3DFLA 3ZVBA 2SGFE 4IW4E 3RLWH 1RFNA 5HYOA 1A4WH 1UVSH 4RN6A 1J9CH 1DSUA 1OWIA 4UFEH 4U01A 3A82A 2C8ZB 2ZDAH 4K8BA 2VH0A 1VITG 2GX4A 1G2LA 1XXDA 1IQMA 1C1WH 3UPEA 2PV9B 1DPOA 1AIXH 3E0PB 2CF9H 1EATA 3E1XB 1ELGA 3MOCA 2NU1E 1DWDH 2BXTH 2ODYB 4UONA 2SGDE 3ZZDA 2BD3A 1V2WT 2ZTZA 5JYIA 1O2LA 2FEQH 1JRSA 4ZROA 4X1SU 2OD3B 4NZLA 3GYLB 3RXTA 5SGAE 1MTUA 2BDHA 1IQNA 4Y10E 1GI9B 2ZU3A 4NCYA 3EYDA 2RG3A 1ZSJA 4FUBA 3RM0H 1MTNB 1TPAE 3S0NA 3DHKH 3R3GB 1YF4A 2OQUA 1TWXB 1QFKH 4OS6A 1CHGA 3BTTE 3S7KB 4BTTB 1QJ6B 2EI8A 4MLFB 1ZOMA 3VXFH 1BTUA 4UDWH 4LZ1H 2F9OA 3K6ZA 5DK1A 1A0LA 1DLEA 3W95A 3ATMA 2J94A 2XBWA 1SL3A 2O8TA 4MNYA 2UUJB 3UOUA 2B8OH 3SJKA 3A8BA 3P8FA 4FUGA 2VB0A 3NUMA 2XWBI 2G5NA 1GBCA 1C5VA 3SUDA 1BMAA 1EJMA 4X8VH 4Y8YA 1C4V2 5DP5A 1B0EA 1MAXA 1YYY1 2P3FH 1V2QT 3SZNA 2FI4E 3BG4B 1BB0B 5DP8A 4E7RG 4GCHG 4X1NU 1O2HA 4X1RU 3EE0B 4PROA 1VCWA 3ZZ8A 4B75A 3TPIZ 1MZAA 4GHQA 2ZNKH 1TIOA 3M61U 3M35A 3MO3A 4GUXA 1ZJKA 3URCA 4WY3A 3RXUA 1ETRH 2TGDA 1H8IH 5F03A 3ZZCA 1O2PA 1ZSLA 3ENSB 3ATIA 5ESTE 1DFPA 2H9EH 3U8OH 1D3QB 1IQFA 1MTNC 2ALVA 5F8TA 4YOJA 1NN6A 2FLBH 1HAVB 3ODDA 3MO6A 1OWDA 1GCDA 1GL0E 9ESTA 1FZZA 1SLXB 2QXGA 2VGCC 3HK6B 4K1EA 3RXEA 1T32A 2A4RA 1P04A 4MNWA 1TA2A 4WXIA 1QCPA 1C5QA 1DXWA 2VIQA 1GVLA 2LNCA 3ZZ6A 1S81A 4JZDH 1YCPK 1VJAU 4O97A 1W13U 2CV3A 4MPVA 4UFGH 2ZFQH 2NU0E 3OY6U 1PYTD 4CRFA 1D4PB 3A7WA 1O2SA 3KHVA 3M3SA 4U2WA 3HK3B 4AX9H 2A7HA 2HALA 2WPMS 1XMNB 1WCZA 1G9IE 3AVZA 3BG4C 4WJG2 3A8DA 4NZQA 3TU7H 1LHCH 2ZGJA 5T6FA 1CGHA 1BZXE 1WAYB 3LC3A 1QL8A 2Y7XA 5TCCA 3BTFE 3U69H 1J17T 1TGNA 1AUJA 1Z6EA 4TY7A 4ZHLU 1BDAA 3GY6A 5LH8A 4IMZA 1T8NA 3BSQA 1IAUA 1W0ZU 3Q76A 4THNH 1W7XH 1O5GH 2BLOA 2ZWLH 3FAOA 4O3TA 2ODQA 3KQEA 4AGKA 2AERH 4XE4A 4FUIA 4Z6AH 1DT2A 3HGPA 8ESTE 2BX3A 3PO1C 3UOPA 1MTWA 3PWBA 1IQJA 1HDTH 1P05A 1Z7KA 2WPJS 2BZAA 1TRMA 3EBNA 5LPRA 1TYNA 4LOYH 3UUZA 3PTBA 1FY5A 1W14U 1GMDF 3EA8A 1L0ZA 1N6XA 2EI7A 1M9UA 2AIPA 3P8GA 1BBRK 4JZIA 4ABEA 1CHOG 1T8OA 3S9AA 4A92A 1ELTA 1NFUA 1EZSC 4K8YA 1BTYA 4RKOB 4X1PU 3GY3A 1YCPM 2BQ6B 3GY8A 1C5YB 1F7ZA 1AGJA 1HJAC 1P2OA 3I78A 1ZTKA 3AW0A 1LVBA 2R9PA 1RJXB 3BTGE 2LIZA 4X2WA 5T6DA 1PJPA 2Z6BD 3ZZ3A 3VGCB 1TMTH 2NU4E 1QQ4A 1EB2A 1H8DH 2ZHFH 3NK8A 2FLRH 1GMHF 3T25A 1BT7A 1KYNA 2FS8A 3A83A 5GXPA 1BMMH 4ISHH 1GMHG 3BTWE 3ZVAA 2FP7B 4ESTE 1UTQA 3KNXA 2VIOA 3EA7A 4MVNA 3VB5A 1FONA 1L2EA 5I25A 1BMNH 1TNJA 3SV7A 1FIWA 2D1JA 4I8JA 2FDAA 1H9IE 2ZG0H 1EAWA 1TPPA 3A7TA 3MHWU 5C5OA 1YPEH 5AF9H 2BD2A 3SU4A 3NCLA 1Y5UT 3JZ1B 3KF2A 1ZGVA 3F6UH 1GVZA 1TX6A 1SFIA 3OYPA 3BTKE 4DOQA 1BCUH 1A3BH 1O5BB 3ZZ4A 1TOMH 2OC8A 1N1LA 3GYMA 1AO5A 1S85A 1UJ1A 1IQGA 1GJ7B 1EAUA 3KQDA 1ESBA 2PKAB 2TPIZ 4E7NA 3P70B 1C2JA 2PKSB 1TOCB 5EU8A 1SGYE 1C5WB 2ZGCA 5GIBA 1YGCH 1P09A 2A2XH 1HPGA 3VGCC 4BTUB 2A1DB 4X2XA 1CSOE 3V0XA 2PWXA 1DWCH 1G3BA 1NRRH 1O2ZA 4MNVA 2VH6A 2OLGA 1LPZB 1GHAF 4B71A 1F2SE 1AHTH 1UVTH 5FBIA 1GJ5H 2WYJA 1N8OB 1YLCA 5GWZA 1QA7A 2PUQH 2G81E 3ELAH 4Q7XA 1RRKA 3E3TA 4JMYA 1LKAA 2GCHG 1W8BH 2FOCA 1GHAG 3HKJB 1AWHB 3R0FA 1T7CA 5C67A 1SQTA 1K28D 7GCHF 1S0QA 1RD3B 3QO6A 2ZCHP 4NWLA 1PQ7A 2Y6TA 2P3UB 4FUHA 4VGCB 1E0FD 1O3KA 3SORA 5DP4A 1INCA 1K1LA 4CHAB 5FPSA 4FUDA 2C93B 1O0DH 3P92A 4TPYA 1JXPA 3BIVH 5G4BA 4UE7H 1HXEH 4CH2B 4KTCA 1P9UA 5K7RA 2BOKA 4AORA 1GHYH 1C5LH 1LHDH 3M37A 2G4TA 2OBQA 4YOIA 2G00A 1O2VA 4BAQB 3GY7A 2A5KA 3HATH 4K60A 1L1GA 1PPZA 3EQ0H 2BDGA 2QXJA 4INKA 3SNCA 3MH7A 2GZ9A 3SI3H 2FWWA 1CT4E 2PKSC 1G30B 1UTOA 4U32A 4OGYA 3FVFB 1GBAA 1GBLA 2VU8E 3FZDA 4WMDA 2ZTYA 3LGWA 1O35A 1QL7A 3EA9A 1AMHA 1K22H 2OQ5A 1NESE 3T26A 2BZ6H 1C2KA 2BY6X 3M3TA 3PV4A 2GCTB 1EPTA 5JB9S 4CRCA 2KAIB 6ESTA 1SGIB 1KDQA 1O2JA 1LPGB 4HGCA 1C5SA 4KGAA 1NFYA 4F4OC 1WQVH 3RXBA 2GVFA 3AAVA 4ABBA 1C2LA 1BRAA 1K1MA 2CJIA 1NPMA 4LXBH 8GCHF 2HOBA 1Z71A 1V2OT 3KCGH 1NRSH 1ELAA 2P59A 5C3NA 2QC2A 1A0HB 3Q77A 5JB8S 1GCTB 1SGFA 1XUGA 4VGCC 5E2OA 4CHAC 4DIIH 2OC1A 3TIUA 1Y5BT 4DVAU 1UVOA 3SOSA 4X8UH 3T28A 4JK5A 8LPRA 1BTZA 3QWCH 4WF8A 1K1IA 1WQSA 1O3BA 3WY8A 1K1JA 1EKBB 2ZQ2A 3SJ8A 1QB1A 1C1MA 2VIPA 3EGKH 3UNRA 1XX9A 1GL1A 1SSXA 3MU8A 1BQYA 1NO9H 4UFFH 4ABJA 4BTIB 3GCTF 2V35A 1ACBE 3A7YA 1ABJH 3PLKA 4FUEA 5EW2H 1O5AB 1TMBH 5C2ZA 2PW8H 2W7UA 3F9GA 2XXLA 4R8TB 1D6RA 4YLUA 1AZZA 2RCEA 2P8OC 1YPJH 1AE8H 1HAZB 4YO9A 1OYTH 4FXGH 5E0HA 3MH6A 3ZV8A 3SU5A 3MNCA 1GJCB 1O37A 1O3EA 3MWIU 5DP3A 3MFJA 1DSTA 1AY6H 1FPCH 3M36A 1BTXA 5DGJA 1GBIA 2IJOB 4A1TA 4Y0YE 2NU2E 3A8AA 3BTQE 4ABAA 2SGEE 1H4WA 3I29A 1O2TA 2QIQA 3PWCA 2IPHA 1EASA 4JYVH 2B7DH 1DWEH 4TY6A 2XYAA 4FUCA 3SU6A 1W7GH 3RMLH 3SJ9A 2QF0A 2PFEA 2CN0H 1GCTC 1H9HE 1OWJA 3URDA 2A5IA 1FY1A 2PUXB 4X0WU 3TH4H 3UREA 2ZCLP 3Q3KA 3U1JB 4H6TA 3M5NA 2ZFSA 1V2JT 1FAKH 2ZQ1A 4TPIZ 1YM0A 4XOJA 2XCFA 1JIMA 3LOXA 3RXPA 1IQLA 1F0RA 3UQVA 3IITA 2GDDA 2PSXA 1G3DA 1EJAA 1OS8A 1V2ST 2BXUH 1QGFA 1NFXA 3BIUH 3L6PA 1BBRH 1DE7H 2A0QB 1NS3A 4FUJA 2BHGA 2F91A 4M7GA 4Y8XA 3AAUA 1IQKA 3O8RA 1ETSH 1MH0A 4KTSA 4ZKNU 1CGIE 1QJ1B 2FI5E 1T31A 1HB0B 1QBVH 2ZFRH 4X8TH 2Z7FE 4ZMAH 4OGXA 2ZDNA 1V2VT 2YOLA 2F9BH 1X7AC 4AFZA 3OTJE 3SJIA 1G36A 1C1PA 1C9TA 2VJ1A 1C1UH 1FNIA 5DP9A 2F9NA 5LPEA 2HPPH 4YT6H 4JCNA 1O33A 3TK6A 1GBMA 4UFDH 1UCYE 3PLPA 1TB6H 4CBOA 1NU9A 5DO4H 3BTDE 3ZZBA 1C4U2 3BEUA 1VITF 2BQWB 2P95A 3QX5H 2R3UA 1EOJA 4I8KA 3U1IB 4MPUA 2WPHS 1E35B 3K2UA 5BRRE 2RA0A 1ZTLA 4IC5A 2EEKA 3UR9A 4B2AA 5EXNA 3TJOA 2IOTA 3RU4D 5ABWA 5FHTA 1LHFH 1C5UA 3LONA 4DIHH 4NFFA 2ANWA 2ZP0H 1G3EA 4UD9H 2VIVA 1Q3XA 1HBTH 4B2CA 2ZU4A 1TRYA 3F9HA 1K1OA 2PTCE 3SUEA 1TONA 2HNTC 1QJ7B 1PYTC 3DD2H 4D7GA 1LQEA 1V2KT 2NWNA 4O3UA 5EW1H 3EAJA 2ZFPH 1C2EA 3A8CA 4A1VA 1W0YH 1ZZZA 5E0GA 3I77A 5EXMA 2HWLB 5JBAS 1PPBH 2H1UA 5C1UA 5PTPA 2Z9GA 2W26A 5EXLA 4GVUA 1C5OH 2AH4X 1B7XB 4MQAA 2ZHQH 1ZSKA 5EGMA 5FBEA 1IHSH 2AEIH 4SGAE 2VGCB 5EPNA 3RC4A 3UWJH 1ZPCA 1A5IA 1DICA 2P94A 1BA8B 3KL6A 3HPTB 1OX1A 3TGIE 3UIRA 1EZUC 3GY4A 1LQDB 2CHAB 3U8RH 1GBFA 4XDEA 4WMFA 3LKWA 1RTFB 3P8OA 4B74A 2FS9A 1XXFA 1OYQA 4GCHF 3SJOA 1Z1IA 4I32A 1LKBA 1XUKA 4ABDA 3MNBA 1XUJA 5A8ZA 3SGBE 3ZZ9A 3P95A 1BTPA 5LPFA 4AFUA 1O34A 3SW2B 1AFEH 2THFB 4E06H 1MQ6A 1ETTH 2QA9E 1O39A 4YT7H 2OUAA 5GCHF 3SV6A 3MU1A 1O2OA 2VWNA 2FOAA 2UWLA 3B9FH 1YLDA 4INHA 3BF6H 2XTTB 4ISOA 3S69A 5EQSA 2WUBA 3MNXA 5L2ZH 1BHXB 2ZFTA 5GCHG 5A2MH 3RDZA 2GZ8A 1MAYA 1F5LA 1O32A 5LGOA 3A85A 1C5MD 4YLQH 4Y7BA 4DW2U 3NPSA 1SQAA 1YC0A 3MI4A 2WPKS 4X6OA 4F49A 5GJ4B 3S9BA 1ORFA 4IBLH 1PFXC 3ATLA 3PO1B 1P2MA 3O8BA 1SLVB 2ASUB 3ZVDA 5B6OA 1O3NA 3LGUA 5GDSH 5A0BA 3QUMP 4AYYB 1YPHC 2WPLS 3O8CA 1GBEA 5T6GA 1SHHB 2ANMH 4BXSA 4ABGA 2EC9H 1GHBG 1K21H 1V2LT 1MTSA 3FP8E 4YM9A 1GDUA 5JBBS 2CHAC 2ZGXH 5EG4A 3LPRA
chains in the Genus database with same CATH superfamily
1O5DH 3SYJA 4X6NA 1HJ8A 2STBE 3RXMA 1HJAB 3AASA 2H9HA 4K69A 4NIWA 1GBKA 4K1SA 5E0JA 4SGBE 5F6MA 1AVGH 2Y5HA 3NZIA 2PSYA 3SHCH 1UTNA 2OINA 1G2MA 1Z6JH 2D8WA 1P3EA 2XC0A 2ZF0H 2Q6DA 1C1RA 1YP9A 3G01A 3UY9A 1OHHD 1JRTA 1DDJA 2ZDKA 1PQ8A 1Y3WA 3FP7E 4JK6A 4I8HA 2C8XB 2ANKH 1W3CA 4NFEA 1O3MA 5FXLA 3IG6B 4ZH8A 4AYVB 2HNTF 5HM2A 2VWOA 2KCPA 5IDKA 1UK4A 1P06A 4R0IA 1K2I1 1C1VH 2XBXA 1WOFA 2W6JD 4OS5A 1NBME 5ESBA 1TX8A 4BXWA 3A7ZA 3SUFA 1AUTC 1Y59T 2LELA 1NC6A 2VIWA 4X6MA 2ZFFH 1QNJA 2BDBA 1C5RA 3SQEE 2VVUA 2G52A 1K1PA 1PPGE 4NWKA 3ZZAA 1AQ7A 2O8WA 1GI8B 1CHOF 1GGDB 4BNRA 1UTJA 2ZGHA 2G51A 1H1BA 2BD8A 3MMGA 1TRNA 4H4FA 1UK2A 3TK9A 4B76A 1SHYA 2BMGB 3Q3XA 3F3BA 2XC4A 3TNTA 4K1TA 1TE0A 6GCHF 4I31A 2VIDA 4Z1MD 1ZMJA 4F55A 2Q1JA 1JMOH 7KMEH 3E91A 1F0TA 2ZDVH 2RDEA 5JPMH 4JZFH 6GCHG 1KXAA 3BEFB 3GDSA 1C1SA 2HLDD 2CF8H 3RXKA 4GPGA 1TNHA 4Q4LA 2A7CA 1GJDB 5E8EH 2ZIQH 1LTOA 1HAIH 1JIRA 4IC6A 2O9QA 3A89A 2QV1A 2ZU2A 1TMUH 3TH2H 3TJUA 2A5AA 1MBMA 4A5TS 1IQEA 4MPWA 2H5DA 1GHVH 2PLXA 2ZTXA 2FO9A 1TGCA 1L1NA 2IPQX 4HTCH 1CQQA 1EFRD 1RS0A 2BDYA 1WBGB 1O3AA 1QTFA 2B9LA 2BY8X 1E37B 2PR3A 3ITIA 2Z3CA 3RXDA 3ZYEA 1MUEB 5C94A 1U6QA 1OKXA 1YPGH 3A81A 2FTMA 2AIQA 1T8LA 1S84A 2GV7A 1GI0A 1ZTJA 1ELVA 2WV5A 3M5OA 1OSSA 1EXFA 5DP7A 1EUFA 1SLWB 1KDQB 1W12U 1TNGA 1O2NA 2XBVA 1D6WA 1GGDC 5HGGA 1SFQB 1A46H 2H9TH 4ASUD 1GHZA 3S7HB 5F8XA 4Y7AA 3ZZ7A 3MU4A 2FI3E 3E90B 2WV9A 1GPZA 3UTUH 4BOHA 1GI1A 3ZVCA 4B73A 1TGTA 1J14A 2QYIA 1IOEA 3L3TA 2J4IA 2M5TA 4DT7B 4HFPB 2HNTE 2ZU1A 4DY7B 1TQ7B 1NRQH 3F2FA 1V2PT 1PPEE 1HGTH 1ZMLA 1WSSH 3Q00A 3T29A 4B6FA 1FY8E 4Q7YA 2ZKSA 1THPB 2CXVA 4WH6A 4DGJA 1AB9B 1XUFA 2Y80A 5FCRA 1LHEH 4AFSA 2GCHF 1CO7E 1ELEE 2C8WB 3E6PH 4J2YB 1KTSB 1LVMA 3QLPH 3PLBA 1EAIA 1P11E 4QT8C 2AMPA 2ZZUH 1LMWB 3VG8A 4ZKSU 2WYGA 5C0TA 3SV2H 4KTUA 1SB1H 1H8HD 3VXEH 5JDUB 4IN2A 4FU9A 4DJZB 1OXGA 1EPTC 6LPRA 3F0PA 5EJZA 2FX6A 3SI4H 1BJUA 1HLTH 2QN5T 3UWIA 1E34B 1E1QD 1MKWK 2A4OA 1V2TT 1E36B 1GBBA 2ZGBH 3E0NB 3RXJA 6CHAB 3SV8A 1S0RA 1O3CA 2ZCKP 3MNSA 1O2QA 1A2CH 4XBDA 1T8MA 2ODPA 4YZUA 4ZUHA 3SNDA 1LO6A 1QBOA 2OXSA 2SGQE 2WV4A 3HGNA 1F0UA 2QE7D 1AVXA 3KN2A 3GOVB 3F68H 3OX7U 3SGAE 4NSYA 1TPSA 4Q80A 1O30A 4H42U 3OSYA 1CA0C 5IYTA 2VWMA 3F9EA 3LJOA 2CMYA 1EJNA 3TH3H 3KIDU 2P8OB 4ISIH 4IS5A 2QXIA 1LHGH 2C4FH 3FZZA 2Y5GA 3MH4A 1AB9C 1AFQC 2L74A 1S6HA 3DSPA 1MMJN 2FOGA 3PMHB 1YKTA 2AGGX 1LVOA 7ESTE 1ZLRA 1KXBA 3HKIB 1O3LA 1DY8A 2P93A 4RKJB 4YTAA 1BRUP 3A88A 1YPLH 3JZ2B 3RLYH 5AHGH 1O2RA 1AD8H 5K0HA 1FY3A 1MKXH 4BAOB 3TNSA 1MBQA 3BN9A 4GHTA 5TCAA 3ZIAD 1CT0E 2UWOA 5DSFA 3D62A 5AFZH 1Z8IB 2Y81A 4WVPE 4B1TA 1P02A 3C27B 3L33A 4CH8B 2JETC 3ZYDA 1P0SH 1HRTH 3T27A 6CHAC 1FJSA 4K3JA 5TJXA 1Y3YA 2DUCA 2TBSA 1HV7A 2V3OH 1MCTA 1G3CA 1P2JA 3GDUA 3KGPA 1O2WA 9LPRA 5FPTA 4CR9A 1DUEA 1ELFA 1VJ9U 3ATWA 1MQ5A 3KQ5A 3MH5A 3QK1A 4E05H 1A7SA 4ISLA 1L4DA 1OP8A 1PPCE 2A32A 4IN1A 5HMAA 1L4ZA 1QRZA 1VR1H 4AG2A 1TLDA 5DG6A 1O5EH 4NIXA 4ZHMU 1GJAB 1OOKB 4ZAEA 1MU8B 2TGAA 2BVXH 1XKAC 2K1QA 4NGAH 1SR5C 1Q2WA 2K7XA 1TBZH 3VB6A 2BVSH 2FOBA 2J92A 3QGNB 4KKDA 4Q7ZA 4XBBA 5EODA 2OBOA 4NA8A 2HVXA 3OY5U 1BITA 2TIOA 2HLCA 2PGBB 4JZEH 1FN8A 3SNAA 3E16B 3MO9A 1C5XB 1IQIA 1FQ3A 1AKSA 1C5TA 3VB4A 2FOMB 4I8LA 3RXLA 2YNBA 1TA6A 3ZVEA 4YOGA 3SU2A 4JYUH 3BTHE 1W0JD 4K2YA 4CRAA 4IGDA 5DP6A 2QCYA 2WINI 1QB9A 1XVOA 2AMQA 2XNIA 1FX0B 1DUAA 2BYAX 3RMMH 2Z3EA 1ELCA 2LPRA 2CK3D 3RUOA 3BV9B 1HIAA 2TGTA 3AW1A 3RM2H 2OCVB 2GT7A 1F92A 1LVYA 4ZKRU 3O8DA 1YPMH 1Z1JA 2W5EA 2GTBA 1DX5M 3PMBB 2OC7A 1C1TA 1V2UT 3LGTA 5KGOA 2QAAA 1JBUH 1NFWA 1TABE 1WTGH 1O3IA 1SGFG 1TALA 2JIZD 3EDXB 1KIGH 1V3XA 3WWBA 2H2ZA 1AU8A 1NRPH 1A5HA 5IK2D 2BD7A 2GZ7A 1ZRKA 1EP5A 2J97A 3LJJA 3UQOA 3STIA 1SVPA 1Q31A 2J34A 3FFGA 1NRNH 1MCVA 1LCYA 2PHBA 3P8NA 2ZECA 1FV9A 3KQCA 3SV9A 1O2KA 1Z8JB 3GCNA 1ANDA 1GI7B 3RXGA 3PRDA 3ZZ5A 4FVDA 2F4LA 3A7XA 1JWTA 1ZHMA 2Z9IA 1F5KU 3BG8A 1RIWC 1ESTA 3NKKA 4AG1A 1GHWH 1YLNA 1S5SA 1UVPA 4AZ2B 1GG6B 5FAHA 3UNQA 1D3PB 3SHAH 2UUKB 1EP6A 4FU7A 2FTLE 4ABIA 1ELBA 1XUHA 1T4UH 3DUXH 4D76A 2AFQB 2ALPA 1NM6A 1A0JA 5EQQA 2L6OA 1QQUA 4D7FA 2GP9B 1HCGA 3MU5A 8KME2 4KP0A 1W2KH 3M3VA 1AZ8A 1HNEE 4Y11E 1S6FA 1V2NT 2A4GA 1KLTA 3LT3A 1SGQE 2AYWA 1A5GH 2FODA 1DANH 2G55A 3NRLA 2GD4B 2WZQA 2IN2A 2ESTE 1Z8RA 1V6DA 4AN7A 5CE1A 2W6ID 1C4Y2 2O8LA 1XKBC 1MD7A 2WPIS 5E2PA 1ZRBA 1B0FA 1SOZA 4NSVA 1NBMD 2ZPRA 3UFAA 4OS4A 4ZXXH 1YPKH 1UTLM 1K9OE 3PM3A 1UCYH 2J95A 2C8YB 3RXCA 5DJ7A 4IMQA 3V13A 3TGKE 2OC0A 5FX6A 3M5LA 1O3HA 2SNWA 3DA9B 2H5CA 1D9IA 2ZDMA 1BJVA 2DE9A 2F9PA 4ZCNA 5EJ1A 4A1XA 3SU0A 1ZPZA 4I8GA 2A2QH 1P2KA 1ESAA 4BANB 1O5CB 4LK4A 1UTMA 1SQRA 2R2WU 2Y82A 2BY7X 1FDPA 1C1NA 1L1JA 4H6SB 1EX3A 3TITA 3RC6A 1TNLA 1ANBA 3P6ZB 1OWHA 2SFAA 3K6YA 2J2UA 2TGPZ 3LDXH 1BUIA 1GG6C 3A7VA 1SBWA 1P2NA 3H5CB 2P3TB 1Y3VA 5AFYH 1DWBH 1GBJA 1UHBA 1ZMNA 1NY22 5L30H 3PYHA 1ZR0A 1MKWH 1OPHB 5FCKA 2EI6A 3RP2A 2AS9A 1MKXK 1YBWA 1FUJA 3TGJE 1RTKA 2W7SA 1THSH 3T62A 1CBWB 3U98H 1VGCB 3TJVA 1BIOA 4NA9H 1GDQA 2XW9A 2UWPA 2VNTA 1GVKB 1LDTT 4FVBA 4Y8ZA 3RXIA 3KEEA 3SQHE 1MABB 5KEDA 2O8MA 1QRXA 4MTBA 1TX7A 2ZEBA 1EOLA 2AHME 3PB1E 2QY0B 2OP9A 4YESB 1E1RD 1GHBF 5F8ZA 2WSSD 2HPQH 2BVRH 4TWYA 2HGTH 5L6NH 3N7OA 4OS2A 4GSOA 1C5NH 1SGNE 2GGVB 2FYQA 3PMAB 2VWLA 4HZHA 3H7OA 4CREA 1BMFD 2ZHEH 1MZDA 4NIYA 4X2YA 4X1QU 2V0BA 3N7EA 1DS2E 2XBYA 2HRVA 2ZHDA 2FOFA 3PRBA 5C1XA 1FLEE 1ZGIA 1VCQA 5DN6D 4DURA 2Z94A 3CS0A 1ELDE 1SPJA 2HVYB 4BAHB 1KTTB 5J4QA 1C2GA 1Y3XA 1OWEA 4BAMB 5A8YA 4JYTA 1C9PA 2V6NA 3PROA 3LH1A 1ARCA 5F53A 5I46H 3FP6E 1C2MA 3SGQE 2FMJA 2BY9X 3M7TA 2BX4A 3A86A 3RU4E 1BMLA 1E38B 2BD9A 3D65E 2ANYA 3W1EA 3LU9B 3OEED 3H7TA 5EOKA 1TGBA 2J38A 2BB4A 2VINA 1GI6A 1RGQA 3LH3A 4A7IB 3ZVGA 3DT0H 1CBWC 3LGIA 3RMOH 1VGCC 3K65B 3QGJA 4TYDA 3STJA 1ZHPA 2Z9JA 1EZQA 2K8IA 5ETXA 2F83A 1VITH 4Y0ZE 1C5ZB 1P2IA 2FOHA 1K1NA 2PP6A 2PGQB 4KELA 5JBCS 1UVUH 4NG9H 3BTEE 1EZXC 1W0KD 4CR5A 2I6SA 3PMJA 2FYRA 4ABHA 4GLYA 3KQBA 2SGAA 2ZU5A 2QGRA 5C20A 2JH0D 1CGJE 1KLJH 2GKVE 1GI2A 2G5VA 2FESH 1P3CA 3ESTA 2GJGA 2ILNA 1O38A 4XSKU 3ODFA 1O31A 3A87A 2SNVA 1FY4A 1YWUA 2BOHB 1C2HA 1ID5H 4B2BA 2R2MB 4ACBA 1SC8U 3A80A 3RXSA 2QXHA 3TJNA 3V12A 3VEQB 1ANCA 3D23A 5EPYA 1FN6A 1QB6A 2W3KA 1P2QA 1YY3A 3Q3YA 2YNAA 1KLIH 3GCHB 4INLA 2UUYA 4RI0A 1QZ8A 1WV7H 2KCYA 1GMDG 1J16A 4A6LA 2SGPE 1CVWH 2G8TA 2O8UA 1WYKA 1GJ8B 2AMDA 2ZHWH 1NROH 3UNSA 2D26C 1O3JA 1OP2A 1A3EH 2BD5A 3DSOA 1BRCE 2GT8A 3IWMA 1DOJA 1SGRE 2WHXA 1FI8A 2BDCA 4XFQA 1SGDE 1IQHA 1D3DB 1GMCF 1GI5A 2STAE 2VVVA 1DM4B 1EPTB 1P8VC 2FIRH 1HAVA 2J98A 4XBCA 3F9FA 3SU3A 2KCAA 1N6YA 1SLUB 3RXOA 1WUNH 5JBTA 1HJ9A 1T4VH 3U28C 4OS1A 1MTVA 1C2FA 2ULLA 3M7QA 1GMCG 1GWAA 2ZPSA 1QA0A 1O36A 1HUTH 4AB9A 1GJ9B 1EQ9A 2PTNA 3T5FH 1IHTH 1HAYB 3RXRA 1QURH 2H6MA 3K9XB 1GJ4H 1TFXA 1UO6A 1O2YA 1FXYA 1ZHRA 4AB8A 2JDID 3VPKA 4MPXA 4FUFA 3D49H 1GBDA 2RA3A 2I6QA 3CS7A 1A61H 4Y76A 2BLQA 3SNEA 3SNBA 2GMTB 1CA0B 2W3IA 2V3HH 3ZVFA 4Y71A 3QTOH 4ZKOU 3MYWA 1CU1A 3RXHA 2AGIX 2F9UA 1HFDA 3GCHC 1UCYK 2ZI2H 2BLVA 3U9AH 4WXVA 1TAWA 1BTHH 1V2MT 1AFQB 2XC5A 4U30A 5BPEA 1BHXF 4CRDA 2R0KA 1HXFH 1CA8B 1CT2E 1O2MA 3W94A 1P9SA 4WWYA 1BOQA 1A1RA 1H8ED 1HAPH 1HYLA 2BD4A 1TNKA 3GY5A 2ZPQA 2YMSD 1OP0A 2BDAA 1VKYA 1TBQH 1Y3UA 1DVAH 4TWWA 4X6PA 4AFQA 1S83A 1DY9A 1SGPE 1C2IA 4OS7A 1NZQH 1ZJDA 1DLKB 2R3YA 1J15A 1FMGA 1H9LB 2BM2A 1Z8GA 3PV2A 2WPDD 2A4QA 3CENA 1TPOA 2JETB 4RT1A 1JOUB 1W11U 5FPYA 1C1QA 1AN1E 2JH6D 1O2UA 4J1YA 1O3FA 2C3SA 1GI3A 1RTLA 2JKHA 1AKSB 2FX4A 1SOTA 3TLOA 1O2IA 3PTNA 1TNIA 5C1YA 1P10A 2XWAA 3E8LA 1KY9A 3ATKA 7GCHG 4HI3A 1DITH 4ZHAA 1KMHB 3C1KA 3ZV9A 3LC5A 1EAXA 2ZC9H 2A7JA 2GMTC 2Q6GA 1KXEA 4RSPA 2UUFB 1WU1A 2KCOA 4D9RA 5HM9A 5J4SA 4NIVA 4CRBA 3SUGA 1HIAB 3GS9A 1ABIH 1XUIA 4DG4A 1O3DA 1UMAH 1QIXB 3M7UA 2DE8A 4ISNA 5DPAA 3S9CA 1G37A 2F3CE 1O2GH 2C90B 1TBRH 1YPHE 3T2NA 1O2XA 2EA3A 1GI4A 3V3MA 3SO3A 2IJD1 1PPFE 1P12E 7LPRA 1GHXH 3QDZB 3UR6A 3F1SB 4NA7A 1W10U 3RXQA 3OU0A 1AVWA 1UTKA 1PPHE 3GISB 1KSNA 3QTVH 3VFEA 3QZQA 1C1OA 1PQAA 1OWKA 4BAKB 2NU3E 1NU7B 2XCNA 4CBNA 5A0CA 1N8OC 5FX5A 2ZA5A 4CRGA 1HAGE 1LPKB 3FANA 3DCLA 4Z0KA 2WUCA 3F0OA 2Q6FA 1ARBA 1P03A 3U8TH 4TT3D 1VZQH 4AC9A 4MDSA 1D3TB 2R0LA 2PKAA 8GCHG 4DT4A 1AE5A 3RXFA 1AWFH 1BRBE 4GAWA 1QRWA 1KXCA 3LGYA 2A45B 2FZZA 5GPIB 1ZYOA 2FXRA 1MU6B 2BY5X 4X2VA 2FOEA 1V2RT 3TVJB 4I33A 1SGCA 3MTYA 5CMXH 5HXFA 1VCPA 1C2DA 3NXPA 4K5ZA 4O9VA 2CGAA 2ZO3H 1ZPBA 4DCDA 4Y6DA 5A09A 5H4IB 4FU8A 3GY2A 3V7TA 4Y79A 2OTVA 1QHRB 2FPZA 2F9VA 2GDEH 1HAHH 1YCPH 1MD8A 2QF3A 4D8NA 2RDLA 1GBTA 1BBRE 5T3HA 1ANEA 1FIZA 2LP6A 4WH8A 1KXDA 1FPHH 2GV6A 1G32B 2BQ7B 2ZDLA 1KXFA 5A8XA 1SMFE 1UTPA 3GCTG 1RIWB 2J9NA 3GICB 1P01A 3RXVA 2B5TB 1C5PA 1QY6A 2GCTC 2D2DA 2FM2A 1FAXA 1B5GH 5CHAB 4ABFA 5A0AE 1BTWA 1Y5AT 3B8JA 5L2YH 4ASHA 3VB7A 3B23B 4X8SH 1XM1A 2Y7ZA 2BDIA 1GBHA 4UEHH 3BEIB 3SN8A 4ZXYH 4I7YH 5DKMA 2AGEX 1F0SA 1TQ0B 1AI8H 5AVDA 1DXPA 4MG3A 1SGTA 1QR3E 2A31A 1XVMA 1WTHD 1EB1H 1F5RA 2Y5FA 1SG8B 3RMNH 3DFJA 2B0FA 5C5NA 3VB3A 2JH5D 3BTME 1GJBB 2VVCA 4JZ1A 1GDNA 4MNXA 3NWUA 2Z9KA 3QZRA 3RXAA 3TK5A 1J8AA 2XRCA 1HAOH 1UHBB 1SGEE 4AGJA 1PQ5A 4LZ4B 1SQOA 4Q2KA 4WMEA 2Z9LA 2KAIA 3GDVA 1UK3A 3GCOA 4D9QA 1O3GA 1CE5A 1Y8TA 3RC5A 3RU4T 3SU1A 1NT1A 1O5FH 4AOQA 2TRMA 1O3OA 5HIZA 3LGVA 2G4UA 3CP7A 1GJ6A 3M5MA 1QL9A 3A84A 2BTCE 1SI5H 3QN7A 4O03A 1TGSZ 3SBKA 3MU0A 3P17H 1O3PB 1S82A 3N99A 1RXPA 1HAXB 5CHAC 2K0QA 2Z3DA 3LIWA 1QBNA 5EQRA 2BLWA 1P57B 2P16A 2OK5A 1NTPA 1THRH 3DFLA 3ZVBA 2SGFE 4IW4E 3RLWH 1RFNA 3CNRA 5HYOA 1A4WH 1UVSH 4RN6A 3FKSD 1J9CH 1DSUA 1OWIA 4UFEH 4U01A 3A82A 2C8ZB 2ZDAH 4K8BA 1COWD 1VITG 2GX4A 2VH0A 1G2LA 1XXDA 1IQMA 1C1WH 3UPEA 2PV9B 1DPOA 1AIXH 3WW7A 3E0PB 2CF9H 1EATA 3E1XB 1ELGA 3MOCA 2NU1E 1DWDH 2BXTH 2ODYB 4UONA 2SGDE 3ZZDA 2BD3A 1V2WT 2ZTZA 5JYIA 1O2LA 2FEQH 1JRSA 4ZROA 4X1SU 2OD3B 4NZLA 3GYLB 3RXTA 5SGAE 1MTUA 2BDHA 1IQNA 4Y10E 3F2HA 1GI9B 2ZU3A 4NCYA 3EYDA 2RG3A 1ZSJA 4FUBA 3RM0H 5CDFE 1MTNB 1TPAE 3S0NA 3DHKH 3R3GB 1YF4A 4OM9A 2OQUA 1TWXB 1QFKH 4OS6A 1CHGA 3BTTE 3S7KB 4BTTB 1QJ6B 2EI8A 4MLFB 1ZOMA 1WXRA 3VXFH 1BTUA 4UDWH 4LZ1H 2F9OA 3K6ZA 5DK1A 1A0LA 1DLEA 3W95A 3ATMA 2J94A 4RT0A 2XBWA 1SL3A 2O8TA 4MNYA 2UUJB 3UOUA 2B8OH 3DSGA 3A8BA 3SJKA 3P8FA 4FUGA 2VB0A 3NUMA 2XWBI 2G5NA 1GBCA 1C5VA 3SUDA 1BMAA 1EJMA 2QF4A 4X8VH 2JJ2D 4Y8YA 1C4V2 5DP5A 1B0EA 1MAXA 5C17A 1YYY1 2P3FH 1V2QT 3SZNA 2FI4E 3BG4B 1BB0B 5DP8A 4E7RG 4GCHG 4X1NU 1O2HA 3OEHD 4X1RU 3EE0B 4PROA 1VCWA 3ZZ8A 4B75A 3TPIZ 1MZAA 4GHQA 3N7DA 2ZNKH 1TIOA 3M61U 3M35A 3MO3A 4GUXA 1ZJKA 3URCA 4WY3A 3RXUA 1ETRH 2TGDA 1H8IH 5F03A 2KZ4A 3ZZCA 1O2PA 1ZSLA 2JJ1D 3ENSB 3ATIA 5ESTE 1DFPA 2H9EH 3U8OH 2YMSB 1D3QB 3EE7A 1IQFA 1MTNC 2ALVA 5F8TA 4YOJA 1NN6A 2FLBH 1HAVB 2J98B 3ODDA 3MO6A 1OWDA 1GCDA 1GL0E 9ESTA 1FZZA 1SLXB 2QXGA 2VGCC 3HK6B 4K1EA 3RXEA 1T32A 2A4RA 1P04A 4MNWA 1TA2A 4WXIA 1QCPA 1C5QA 1DXWA 2VIQA 1GVLA 2LNCA 3ZZ6A 1S81A 4JZDH 1YCPK 1VJAU 4O97A 1W13U 2CV3A 4MPVA 4UFGH 2ZFQH 2NU0E 3OY6U 1PYTD 4CRFA 1D4PB 3A7WA 1O2SA 3KHVA 3PV5A 3M3SA 4U2WA 3HK3B 4AX9H 2A7HA 2HALA 2WPMS 1XMNB 1WCZA 5KECA 1G9IE 3AVZA 3BG4C 4WJG2 3A8DA 4NZQA 4I86A 3TU7H 1LHCH 2ZGJA 5T6FA 1CGHA 1BZXE 1WAYB 3LC3A 1QL8A 2Y7XA 5TCCA 3BTFE 3U69H 1J17T 1TGNA 1AUJA 1Z6EA 4TY7A 4ZHLU 1BDAA 3GY6A 5LH8A 4IMZA 1T8NA 3BSQA 2F43B 1IAUA 1W0ZU 3Q76A 2QF5A 1W7XH 4THNH 1O5GH 2BLOA 2ZWLH 3FAOA 3KYFA 4O3TA 2ODQA 3KQEA 4AGKA 4XD7D 2AERH 4XE4A 4FUIA 4Z6AH 2YMSC 1DT2A 3HGPA 8ESTE 2BX3A 3PO1C 3UOPA 1MTWA 3PWBA 1IQJA 1HDTH 1P05A 1Z7KA 2WPJS 2BZAA 1TRMA 3EBNA 5LPRA 1TYNA 4LOYH 4TSFD 3UUZA 3UB0A 3PTBA 1FY5A 1W14U 1GMDF 3EA8A 1L0ZA 1N6XA 2EI7A 1M9UA 2AIPA 3P8GA 1BBRK 4JZIA 4ABEA 1CHOG 1T8OA 3S9AA 4A92A 1ELTA 1NFUA 1EZSC 4K8YA 1BTYA 4RKOB 4X1PU 3GY3A 1YCPM 2BQ6B 3GY8A 1C5YB 1F7ZA 1AGJA 1HJAC 1P2OA 3I78A 1ZTKA 3AW0A 1LVBA 2R9PA 1RJXB 3BTGE 2LIZA 4X2WA 5T6DA 1PJPA 2Z6BD 3ZZ3A 3VGCB 1WDIA 1TMTH 2NU4E 1QQ4A 5HKKD 1EB2A 1H8DH 2ZHFH 3NK8A 2FLRH 1GMHF 3T25A 1BT7A 1KYNA 2FS8A 3A83A 5GXPA 1BMMH 4ISHH 1GMHG 2KR7A 3BTWE 3ZVAA 2FP7B 4ESTE 1UTQA 3KNXA 2VIOA 3EA7A 4MVNA 3VB5A 1FONA 1L2EA 5I25A 1BMNH 1TNJA 3SV7A 1FIWA 2D1JA 4I8JA 2FDAA 5FL7D 1H9IE 2ZG0H 1EAWA 1TPPA 3A7TA 3MHWU 5C5OA 1YPEH 5AF9H 2BD2A 3SU4A 3NCLA 1Y5UT 3JZ1B 3KF2A 1ZGVA 3F6UH 1GVZA 1TX6A 1SFIA 3OYPA 3BTKE 4DOQA 1BCUH 1A3BH 1O5BB 3ZZ4A 1TOMH 2OC8A 1N1LA 5T1VA 3GYMA 1AO5A 1S85A 1UJ1A 1IQGA 1GJ7B 1EAUA 3KQDA 1ESBA 2PKAB 2TPIZ 4E7NA 3P70B 1C2JA 2PKSB 1TOCB 5GNDA 5EU8A 1SGYE 1C5WB 2ZGCA 5GIBA 1YGCH 1P09A 2A2XH 1HPGA 3VGCC 4BTUB 2A1DB 4X2XA 1CSOE 3V0XA 2RFKC 2PWXA 1DWCH 1SKYE 1G3BA 1NRRH 1O2ZA 4MNVA 2VH6A 2OLGA 1LPZB 5C0UA 1GHAF 4B71A 1F2SE 1AHTH 1UVTH 5FBIA 1GJ5H 2WYJA 1N8OB 1YLCA 5GWZA 1QA7A 2PUQH 2G81E 3ELAH 4Q7XA 1RRKA 3E3TA 4JMYA 1LKAA 2GCHG 1W8BH 2FOCA 1GHAG 3HKJB 1AWHB 3R0FA 1T7CA 5C67A 1SQTA 1K28D 7GCHF 1S0QA 2XOKD 1RD3B 3H09A 3QO6A 2ZCHP 4NWLA 1PQ7A 2Y6TA 2P3UB 4FUHA 4VGCB 1E0FD 1O3KA 3SORA 5DP4A 1INCA 1K1LA 4CHAB 5FPSA 4FUDA 2C93B 1O0DH 3P92A 4TPYA 4FOUC 1JXPA 3BIVH 5G4BA 4UE7H 3OTPA 1HXEH 4CH2B 4KTCA 1P9UA 5K7RA 2BOKA 4AORA 2VBCA 3OE7D 1GHYH 1C5LH 1LHDH 3M37A 2G4TA 2OBQA 2M2AA 4YOIA 2G00A 1O2VA 1S6LA 4BAQB 3GY7A 4F48B 2A5KA 3HATH 4K60A 5HIYA 1L1GA 1PPZA 3EQ0H 2BDGA 2QXJA 4INKA 4B6EA 3SNCA 3MH7A 2GZ9A 3SI3H 2FWWA 1CT4E 2PKSC 1G30B 1UTOA 4U32A 4OGYA 3FVFB 1GBAA 1GBLA 2VU8E 3FZDA 4WMDA 2ZTYA 3LGWA 1O35A 1QL7A 3EA9A 1AMHA 3AK5A 1K22H 2OQ5A 1NESE 3T26A 2BZ6H 1C2KA 2BY6X 3M3TA 5B6LA 3PV4A 2GCTB 1EPTA 5JB9S 4CRCA 2KAIB 3OAAD 6ESTA 1SGIB 1KDQA 1O2JA 1LPGB 4FETA 1C5SA 4HGCA 4KGAA 1NFYA 4F4OC 1WQVH 2V7QD 3RXBA 2GVFA 3AAVA 3FN8A 4ABBA 1C2LA 1BRAA 1K1MA 2CJIA 1NPMA 4LXBH 8GCHF 2HOBA 1Z71A 1V2OT 3KCGH 1NRSH 1ELAA 2P59A 5C3NA 2QC2A 1A0HB 3Q77A 5JB8S 1GCTB 1SGFA 1XUGA 4VGCC 5E2OA 4CHAC 4DIIH 2OC1A 3TIUA 1Y5BT 4DVAU 1UVOA 3SOSA 4X8UH 3T28A 4JK5A 8LPRA 1BTZA 3QWCH 1UW7A 4WF8A 1K1IA 1WQSA 1O3BA 3WY8A 1K1JA 1EKBB 2ZQ2A 3SJ8A 1QB1A 1C1MA 2VIPA 3EGKH 3UNRA 1XX9A 1GL1A 1SSXA 3MU8A 1BQYA 1NO9H 4UFFH 4ABJA 4BTIB 2XNDD 3GCTF 2V35A 1ACBE 3A7YA 1ABJH 2EQNA 3PLKA 4FUEA 5EW2H 1O5AB 1TMBH 5C2ZA 2PW8H 5EIYA 2W7UA 3F9GA 2XXLA 4R8TB 1D6RA 4YLUA 1AZZA 2RCEA 2P8OC 1YPJH 1AE8H 1HAZB 4YO9A 1OYTH 4FXGH 5E0HA 3MH6A 3ZV8A 3SU5A 3MNCA 1GJCB 1O37A 1O3EA 3MWIU 5DP3A 3MFJA 1DSTA 1AY6H 1FPCH 2V3MA 3M36A 1BTXA 5DGJA 1GBIA 2IJOB 4A1TA 4Y0YE 2NU2E 3A8AA 3BTQE 4ABAA 2SGEE 1H4WA 3I29A 1O2TA 2QIQA 3PWCA 2IPHA 1EASA 4JYVH 2B7DH 1DWEH 4TY6A 2XYAA 4FUCA 3SU6A 1W7GH 3RMLH 3SJ9A 2QF0A 2PFEA 2CN0H 1GCTC 1H9HE 1OWJA 3URDA 2A5IA 1FY1A 2PUXB 4X0WU 3TH4H 3UREA 2ZCLP 3Q3KA 3U1JB 4H6TA 3M5NA 2ZFSA 1V2JT 1FAKH 2ZQ1A 4TPIZ 1YM0A 4XOJA 2XCFA 1JIMA 3OFND 3LOXA 3RXPA 1IQLA 1F0RA 3UQVA 3IITA 2GDDA 4P00A 2PSXA 2EY4C 1G3DA 1EJAA 1OS8A 1V2ST 2BXUH 1QGFA 1NFXA 2J5UA 3BIUH 3L6PA 1BBRH 1DE7H 2A0QB 1NS3A 4FUJA 2BHGA 2F91A 4M7GA 4Y8XA 3AAUA 1IQKA 3O8RA 1ETSH 1MH0A 4KTSA 4ZKNU 1CGIE 1QJ1B 2FI5E 1T31A 1HB0B 1QBVH 2ZFRH 4X8TH 2Z7FE 4ZMAH 4OGXA 2ZDNA 1V2VT 2YOLA 2F9BH 1X7AC 4AFZA 3OTJE 3SJIA 1G36A 1C1PA 1C9TA 2VJ1A 1C1UH 1FNIA 5DP9A 2F9NA 2KM0A 5LPEA 2HPPH 4YT6H 4JCNA 3FO8D 1O33A 3TK6A 1GBMA 4UFDH 1UCYE 3PLPA 1TB6H 4CBOA 1NU9A 5DO4H 3BTDE 3ZZBA 1C4U2 3BEUA 1VITF 2BQWB 2P95A 3QX5H 2R3UA 1EOJA 4I8KA 3U1IB 4MPUA 1K0HA 2WPHS 1E35B 3K2UA 5BRRE 3WWFA 2RA0A 1ZTLA 4IC5A 2EEKA 3UR9A 4B2AA 5EXNA 3TJOA 2IOTA 3RU4D 5ABWA 5FHTA 1LHFH 1C5UA 3LONA 4DIHH 4NFFA 2ANWA 4ACAA 2ZP0H 1G3EA 4UD9H 4Q63A 2VIVA 1Q3XA 4P02A 1HBTH 4B2CA 2ZU4A 1TRYA 3F9HA 1K1OA 2PTCE 3SUEA 1TONA 2HNTC 1QJ7B 1PYTC 4M9FA 3DD2H 3MQKC 4D7GA 1LQEA 1V2KT 2NWNA 4HG6A 4O3UA 3SZEA 5EW1H 3EAJA 2ZFPH 1C2EA 3A8CA 4A1VA 1W0YH 1ZZZA 5E0GA 3FOAA 3I77A 5EXMA 2HWLB 5JBAS 1PPBH 2H1UA 5C1UA 5PTPA 2Z9GA 2W26A 5EXLA 4GVUA 1C5OH 2AH4X 1B7XB 4MQAA 2ZHQH 1ZSKA 5EGMA 5FBEA 1IHSH 2AEIH 4SGAE 2VGCB 5EPNA 3RC4A 3UWJH 1ZPCA 1A5IA 1DICA 2P94A 1BA8B 3KL6A 3HPTB 1OX1A 3TGIE 3UIRA 1EZUC 3GY4A 1LQDB 2CHAB 3U8RH 1GBFA 4XDEA 4WMFA 3LKWA 1RTFB 3P8OA 4B74A 2FS9A 1XXFA 1OYQA 4GCHF 3SJOA 1Z1IA 4I32A 1LKBA 1XUKA 4ABDA 3MNBA 1XUJA 5A8ZA 3SGBE 3ZZ9A 3P95A 1BTPA 5LPFA 2KFWA 4AFUA 1O34A 3SW2B 1AFEH 2THFB 4E06H 1MQ6A 1ETTH 5EJLA 2QA9E 1O39A 4YT7H 4YXWD 2OUAA 5GCHF 3SV6A 3MU1A 1O2OA 2VWNA 2FOAA 2UWLA 3B9FH 3KYGA 1YLDA 4INHA 3UAIC 3BF6H 2XTTB 4ISOA 3S69A 5EQSA 2WUBA 3MNXA 5L2ZH 1BHXB 2ZFTA 5GCHG 5A2MH 3RDZA 2GZ8A 1MAYA 1F5LA 1O32A 5LGOA 2KX4A 3A85A 1C5MD 4YLQH 4Y7BA 4XRNA 3NPSA 4DW2U 1E79D 1SQAA 1YC0A 3MI4A 2WPKS 4X6OA 4F49A 5GJ4B 3S9BA 1ORFA 4IBLH 1PFXC 3ATLA 3PO1B 1P2MA 3O8BA 1SLVB 3F2GA 2ASUB 3ZVDA 5B6OA 5CHBA 1O3NA 3LGUA 5GDSH 5A0BA 3QUMP 4AYYB 1YPHC 2WPLS 3O8CA 1GBEA 5T6GA 1SHHB 2ANMH 4BXSA 4ABGA 2EC9H 1GHBG 1K21H 1V2LT 1MTSA 3FP8E 4YM9A 1GDUA 5JBBS 2CHAC 2ZGXH 5EG4A 3LPRA
chains in the Genus database with same CATH topology
1O5DH 4X6NA 1HJ8A 2STBE 3RXMA 1HJAB 3AASA 2H9HA 4K69A 4NIWA 1GBKA 4K1SA 5E0JA 4SGBE 5F6MA 1AVGH 2Y5HA 3NZIA 2PSYA 3SHCH 1UTNA 2OINA 1G2MA 1Z6JH 2D8WA 1P3EA 2XC0A 2ZF0H 2Q6DA 1C1RA 1YP9A 3G01A 3UY9A 1JRTA 1DDJA 2ZDKA 1PQ8A 1Y3WA 3FP7E 4JK6A 4I8HA 2C8XB 2ANKH 1W3CA 4NFEA 1O3MA 5FXLA 3IG6B 4ZH8A 4AYVB 2HNTF 5HM2A 2VWOA 5IDKA 1UK4A 1P06A 4R0IA 1K2I1 1C1VH 2XBXA 1WOFA 4OS5A 5ESBA 1TX8A 4BXWA 3A7ZA 3SUFA 1AUTC 1Y59T 1NC6A 2VIWA 4X6MA 2ZFFH 1QNJA 2BDBA 1C5RA 3SQEE 2VVUA 2G52A 1K1PA 1PPGE 4NWKA 3ZZAA 1AQ7A 2O8WA 1GI8B 1CHOF 1GGDB 4BNRA 1UTJA 2ZGHA 2G51A 1H1BA 2BD8A 3MMGA 1TRNA 4H4FA 1UK2A 3TK9A 4B76A 1SHYA 2BMGB 3Q3XA 2XC4A 3TNTA 4K1TA 1TE0A 6GCHF 4I31A 2VIDA 1ZMJA 2Q1JA 1JMOH 7KMEH 3E91A 1F0TA 2ZDVH 5JPMH 4JZFH 6GCHG 1KXAA 3BEFB 3GDSA 1C1SA 2CF8H 3RXKA 4GPGA 1TNHA 2A7CA 1GJDB 5E8EH 2ZIQH 1LTOA 1HAIH 1JIRA 4IC6A 2O9QA 3A89A 2QV1A 2ZU2A 1TMUH 3TH2H 3TJUA 2A5AA 1MBMA 4A5TS 1IQEA 4MPWA 2H5DA 1GHVH 2PLXA 2ZTXA 2FO9A 1TGCA 1L1NA 4HTCH 1CQQA 1RS0A 2BDYA 1WBGB 1O3AA 1QTFA 2B9LA 2BY8X 1E37B 2PR3A 3ITIA 2Z3CA 3RXDA 3ZYEA 1MUEB 1U6QA 1OKXA 1YPGH 3A81A 2FTMA 2AIQA 1T8LA 1S84A 2GV7A 1GI0A 1ZTJA 1ELVA 2WV5A 3M5OA 1OSSA 1EXFA 5DP7A 1EUFA 1SLWB 1KDQB 1W12U 1TNGA 1O2NA 2XBVA 1D6WA 1GGDC 5HGGA 1SFQB 1A46H 2H9TH 1GHZA 3S7HB 5F8XA 4Y7AA 3ZZ7A 3MU4A 2FI3E 3E90B 1GPZA 3UTUH 4BOHA 1GI1A 3ZVCA 4B73A 1TGTA 1J14A 2QYIA 1IOEA 3L3TA 2J4IA 2M5TA 4DT7B 4HFPB 2HNTE 2ZU1A 4DY7B 1TQ7B 1NRQH 1V2PT 1PPEE 1HGTH 1ZMLA 1WSSH 3Q00A 3T29A 1FY8E 4Q7YA 2ZKSA 1THPB 2CXVA 4WH6A 4DGJA 1AB9B 1XUFA 2Y80A 5FCRA 1LHEH 4AFSA 2GCHF 1CO7E 1ELEE 2C8WB 3E6PH 4J2YB 1KTSB 1LVMA 3QLPH 3PLBA 1EAIA 1P11E 4QT8C 2AMPA 2ZZUH 1LMWB 4ZKSU 2WYGA 3SV2H 4KTUA 1SB1H 3VXEH 5JDUB 4IN2A 4FU9A 4DJZB 1OXGA 1EPTC 6LPRA 2FX6A 3SI4H 1BJUA 1HLTH 2QN5T 3UWIA 1E34B 1MKWK 2A4OA 1V2TT 1E36B 1GBBA 2ZGBH 3E0NB 3RXJA 6CHAB 3SV8A 1S0RA 1O3CA 2ZCKP 3MNSA 1O2QA 1A2CH 4XBDA 1T8MA 2ODPA 4YZUA 4ZUHA 3SNDA 1LO6A 1QBOA 2OXSA 2SGQE 2WV4A 3HGNA 1F0UA 1AVXA 3KN2A 3GOVB 3F68H 3OX7U 3SGAE 4NSYA 1TPSA 4Q80A 1O30A 4H42U 3OSYA 1CA0C 5IYTA 2VWMA 3F9EA 3LJOA 2CMYA 1EJNA 3TH3H 3KIDU 2P8OB 4ISIH 4IS5A 2QXIA 1LHGH 2C4FH 3FZZA 2Y5GA 3MH4A 1AB9C 1AFQC 1S6HA 1MMJN 2FOGA 3PMHB 1YKTA 2AGGX 1LVOA 7ESTE 1ZLRA 1KXBA 3HKIB 1O3LA 1DY8A 2P93A 4RKJB 4YTAA 1BRUP 3A88A 1YPLH 3JZ2B 3RLYH 5AHGH 1O2RA 1AD8H 5K0HA 1FY3A 1MKXH 4BAOB 3TNSA 1MBQA 3BN9A 4GHTA 5TCAA 1CT0E 2UWOA 3D62A 5AFZH 1Z8IB 2Y81A 4WVPE 4B1TA 1P02A 3C27B 3L33A 4CH8B 2JETC 3ZYDA 1P0SH 1HRTH 3T27A 6CHAC 1FJSA 4K3JA 5TJXA 1Y3YA 2DUCA 2TBSA 1HV7A 2V3OH 1MCTA 1G3CA 1P2JA 3GDUA 3KGPA 1O2WA 9LPRA 5FPTA 4CR9A 1DUEA 1ELFA 1VJ9U 3ATWA 1MQ5A 3MH5A 3QK1A 4E05H 1A7SA 4ISLA 1L4DA 1OP8A 1PPCE 2A32A 4IN1A 5HMAA 1L4ZA 1QRZA 1VR1H 4AG2A 1TLDA 5DG6A 1O5EH 4NIXA 4ZHMU 1GJAB 1OOKB 4ZAEA 1MU8B 2TGAA 2BVXH 1XKAC 2K1QA 4NGAH 1SR5C 1Q2WA 2K7XA 1TBZH 3VB6A 2BVSH 2FOBA 2J92A 3QGNB 4KKDA 4Q7ZA 4XBBA 5EODA 2OBOA 4NA8A 2HVXA 3OY5U 1BITA 2TIOA 2HLCA 2PGBB 4JZEH 1FN8A 3SNAA 3E16B 3MO9A 1C5XB 1IQIA 1FQ3A 1AKSA 1C5TA 3VB4A 2FOMB 4I8LA 3RXLA 2YNBA 1TA6A 3ZVEA 4YOGA 3SU2A 4JYUH 3BTHE 4K2YA 4CRAA 4IGDA 5DP6A 2QCYA 2WINI 1QB9A 1XVOA 2AMQA 2XNIA 1DUAA 2BYAX 3RMMH 2Z3EA 1ELCA 2LPRA 3RUOA 3BV9B 1HIAA 2TGTA 3AW1A 3RM2H 2OCVB 2GT7A 1F92A 1LVYA 4ZKRU 3O8DA 1YPMH 1Z1JA 2W5EA 2GTBA 1DX5M 3PMBB 2OC7A 1C1TA 1V2UT 3LGTA 2QAAA 1JBUH 1NFWA 1TABE 1WTGH 1O3IA 1SGFG 1TALA 3EDXB 1KIGH 1V3XA 2H2ZA 1AU8A 1NRPH 1A5HA 2BD7A 2GZ7A 1ZRKA 1EP5A 3UQOA 3LJJA 3STIA 1SVPA 1Q31A 2J34A 3FFGA 1NRNH 1MCVA 1LCYA 2PHBA 3P8NA 2ZECA 1FV9A 3KQCA 3SV9A 1O2KA 1Z8JB 3GCNA 1ANDA 1GI7B 3RXGA 3ZZ5A 4FVDA 3A7XA 1JWTA 1ZHMA 2Z9IA 1F5KU 3BG8A 1RIWC 1ESTA 3NKKA 4AG1A 1GHWH 1S5SA 1UVPA 4AZ2B 1GG6B 5FAHA 3UNQA 1D3PB 3SHAH 2UUKB 1EP6A 4FU7A 2FTLE 4ABIA 1ELBA 1XUHA 1T4UH 3DUXH 4D76A 2AFQB 2ALPA 1NM6A 1A0JA 5EQQA 1QQUA 4D7FA 2GP9B 1HCGA 3MU5A 8KME2 4KP0A 1W2KH 3M3VA 1AZ8A 1HNEE 4Y11E 1S6FA 1V2NT 2A4GA 1KLTA 3LT3A 1SGQE 2AYWA 1A5GH 2FODA 1DANH 2G55A 2GD4B 2IN2A 2ESTE 1Z8RA 1V6DA 4AN7A 5CE1A 1C4Y2 2O8LA 1XKBC 1MD7A 2WPIS 5E2PA 1ZRBA 1B0FA 1SOZA 4NSVA 2ZPRA 3UFAA 4OS4A 4ZXXH 1YPKH 1UTLM 1K9OE 3PM3A 1UCYH 2J95A 2C8YB 3RXCA 5DJ7A 4IMQA 3V13A 3TGKE 2OC0A 5FX6A 3M5LA 1O3HA 2SNWA 3DA9B 2H5CA 1D9IA 2ZDMA 1BJVA 2DE9A 2F9PA 4A1XA 3SU0A 1ZPZA 4I8GA 2A2QH 1P2KA 1ESAA 4BANB 1O5CB 4LK4A 1UTMA 2R2WU 2Y82A 2BY7X 1FDPA 1C1NA 1L1JA 4H6SB 1EX3A 3TITA 3RC6A 1TNLA 1ANBA 3P6ZB 1OWHA 2SFAA 3K6YA 2J2UA 2TGPZ 3LDXH 1BUIA 1GG6C 3A7VA 1SBWA 1P2NA 3H5CB 2P3TB 1Y3VA 5AFYH 1DWBH 1GBJA 1UHBA 1ZMNA 1NY22 5L30H 3PYHA 1ZR0A 1MKWH 1OPHB 5FCKA 2EI6A 3RP2A 2AS9A 1MKXK 1YBWA 1FUJA 3TGJE 1RTKA 2W7SA 1THSH 3T62A 1CBWB 3U98H 1VGCB 3TJVA 1BIOA 4NA9H 1GDQA 2XW9A 2UWPA 2VNTA 1GVKB 1LDTT 4FVBA 4Y8ZA 3RXIA 3KEEA 3SQHE 2O8MA 1QRXA 4MTBA 1TX7A 2ZEBA 1EOLA 3PB1E 2QY0B 2OP9A 4YESB 5F8ZA 1GHBF 2HPQH 2BVRH 4TWYA 2HGTH 5L6NH 3N7OA 4OS2A 4GSOA 1C5NH 1SGNE 2GGVB 2FYQA 3PMAB 2VWLA 4HZHA 3H7OA 4CREA 2ZHEH 1MZDA 4NIYA 4X2YA 4X1QU 2V0BA 1DS2E 2XBYA 2HRVA 2ZHDA 2FOFA 5C1XA 1FLEE 1ZGIA 1VCQA 4DURA 2Z94A 3CS0A 1ELDE 1SPJA 4BAHB 1KTTB 5J4QA 1C2GA 1Y3XA 1OWEA 4BAMB 5A8YA 4JYTA 1C9PA 2V6NA 3PROA 3LH1A 1ARCA 5I46H 3FP6E 1C2MA 3SGQE 2FMJA 2BY9X 3M7TA 2BX4A 3A86A 3RU4E 1BMLA 1E38B 2BD9A 3D65E 2ANYA 3LU9B 5EOKA 3H7TA 1TGBA 2J38A 2BB4A 2VINA 1GI6A 1RGQA 3LH3A 4A7IB 3ZVGA 3DT0H 1CBWC 3LGIA 3RMOH 1VGCC 3K65B 3QGJA 4TYDA 3STJA 1ZHPA 2Z9JA 1EZQA 5ETXA 2F83A 1VITH 4Y0ZE 1C5ZB 1P2IA 2FOHA 1K1NA 2PGQB 4KELA 5JBCS 1UVUH 4NG9H 3BTEE 1EZXC 4CR5A 2I6SA 3PMJA 2FYRA 4ABHA 4GLYA 3KQBA 2SGAA 2ZU5A 2QGRA 5C20A 2JH0D 1CGJE 1KLJH 2GKVE 1GI2A 2G5VA 2FESH 1P3CA 3ESTA 2ILNA 1O38A 4XSKU 3ODFA 1O31A 3A87A 2SNVA 1FY4A 2BOHB 1C2HA 1ID5H 4B2BA 2R2MB 1SC8U 3A80A 3RXSA 2QXHA 3TJNA 3V12A 3VEQB 1ANCA 3D23A 5EPYA 1FN6A 1QB6A 2W3KA 1P2QA 3Q3YA 2YNAA 1KLIH 3GCHB 4INLA 2UUYA 1WV7H 1GMDG 1J16A 4A6LA 2SGPE 1CVWH 2G8TA 2O8UA 1WYKA 1GJ8B 2AMDA 2ZHWH 1NROH 3UNSA 2D26C 1O3JA 1OP2A 1A3EH 2BD5A 1BRCE 2GT8A 3IWMA 1DOJA 1SGRE 1FI8A 2BDCA 4XFQA 1SGDE 1IQHA 1D3DB 1GMCF 1GI5A 2STAE 2VVVA 1DM4B 1EPTB 1P8VC 2FIRH 1HAVA 4XBCA 3F9FA 3SU3A 1N6YA 1SLUB 3RXOA 1WUNH 5JBTA 1HJ9A 1T4VH 4OS1A 1MTVA 1C2FA 2ULLA 3M7QA 1GMCG 1GWAA 2ZPSA 1QA0A 1O36A 1HUTH 4AB9A 1GJ9B 1EQ9A 2PTNA 3T5FH 1IHTH 1HAYB 3RXRA 1QURH 2H6MA 3K9XB 1GJ4H 1TFXA 1UO6A 1O2YA 1FXYA 1ZHRA 4AB8A 3VPKA 4MPXA 4FUFA 3D49H 1GBDA 2RA3A 2I6QA 3CS7A 1A61H 4Y76A 2BLQA 3SNEA 3SNBA 2GMTB 1CA0B 2W3IA 2V3HH 3ZVFA 4Y71A 3QTOH 4ZKOU 3MYWA 1CU1A 3RXHA 2AGIX 2F9UA 1HFDA 3GCHC 1UCYK 2ZI2H 2BLVA 3U9AH 4WXVA 1TAWA 1BTHH 1V2MT 1AFQB 2XC5A 4U30A 5BPEA 1BHXF 4CRDA 2R0KA 1HXFH 1CA8B 1CT2E 1O2MA 3W94A 1P9SA 4WWYA 1BOQA 1A1RA 1HAPH 1HYLA 2BD4A 1TNKA 3GY5A 2ZPQA 1OP0A 2BDAA 1TBQH 1Y3UA 1DVAH 4TWWA 4X6PA 4AFQA 1S83A 1DY9A 1SGPE 1C2IA 4OS7A 1NZQH 1ZJDA 1DLKB 2R3YA 1J15A 1FMGA 1H9LB 2BM2A 1Z8GA 3CENA 2A4QA 1TPOA 2JETB 1JOUB 1W11U 5FPYA 1C1QA 1AN1E 2JH6D 1O2UA 4J1YA 1O3FA 2C3SA 1GI3A 1RTLA 2JKHA 1AKSB 2FX4A 1SOTA 3TLOA 1O2IA 3PTNA 1TNIA 5C1YA 1P10A 2XWAA 3E8LA 1KY9A 3ATKA 7GCHG 4HI3A 1DITH 4ZHAA 3C1KA 3ZV9A 3LC5A 1EAXA 2ZC9H 2A7JA 2GMTC 2Q6GA 1KXEA 4RSPA 2UUFB 1WU1A 4D9RA 5HM9A 5J4SA 4NIVA 4CRBA 3SUGA 1HIAB 1ABIH 1XUIA 4DG4A 1O3DA 1UMAH 1QIXB 3M7UA 2DE8A 4ISNA 5DPAA 3S9CA 1G37A 2F3CE 1O2GH 2C90B 1TBRH 1YPHE 3T2NA 1O2XA 2EA3A 1GI4A 3V3MA 3SO3A 1PPFE 1P12E 7LPRA 1GHXH 3QDZB 3UR6A 3F1SB 4NA7A 1W10U 3RXQA 3OU0A 1AVWA 1UTKA 1PPHE 3GISB 1KSNA 3QTVH 3VFEA 3QZQA 1C1OA 1PQAA 1OWKA 4BAKB 2NU3E 1NU7B 2XCNA 4CBNA 5A0CA 1N8OC 5FX5A 2ZA5A 4CRGA 1HAGE 1LPKB 3FANA 4Z0KA 2WUCA 2Q6FA 1ARBA 1P03A 3U8TH 1VZQH 4MDSA 1D3TB 2R0LA 2PKAA 8GCHG 1AE5A 3RXFA 1AWFH 1BRBE 4GAWA 1QRWA 1KXCA 3LGYA 2A45B 2FZZA 5GPIB 1ZYOA 2FXRA 1MU6B 2BY5X 4X2VA 2FOEA 1V2RT 3TVJB 4I33A 1SGCA 3MTYA 5CMXH 5HXFA 1VCPA 1C2DA 3NXPA 4K5ZA 4O9VA 2CGAA 2ZO3H 1ZPBA 4DCDA 4Y6DA 5A09A 5H4IB 4FU8A 3GY2A 3V7TA 4Y79A 2OTVA