1Z8RA

2a cysteine proteinase from human coxsackievirus b4 (strain jvb / benschoten / new york / 51)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
150
Chain Sequence
GPYGHQSGAVYVGNYKVVNRHLATHVDWQNCVWEDYNRDLLVSTTTAHGCDTIARCQCTTGVYFCASKSKHYPVSFEGPGLVEVQESEYYPKRYQSHVLLATGFSEPGDAGGILRCEHGVIGLVTMGGEGVVGFADVRDLLWLEDDAMEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coxsackievirus B4 polyprotein
publication title Structure and dynamics of coxsackievirus B4 2A proteinase, an enyzme involved in the etiology of heart disease.
pubmed doi rcsb
source organism Human coxsackievirus b4
total genus 24
structure length 150
sequence length 150
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA01
3PLKA 1BIOA 2J34A 1P06A 1W14U 3ESTA 1MZAA 2QAAA 3V12A 1C5XB 4A1XA 1C5YB 1E35B 2XC0A 2HALA 2J95A 3T27A 2A2XH 3VB6A 1ORFA 4UDWH 1AVXA 1EAUA 2STBE 1EP6A 3F68H 5JBTA 1HJ8A 4GHQA 4XSKU 1GBBA 3QUMP 1KY9A 2QXGA 1BRBE 1F5RA 2G00A 1ELBA 4CR9A 3P8NA 2RA3A 1FZZA 2BLWA 1O3GA 1C1UH 2W7UA 3ZYDA 3EAJA 1K2I1 1QL8A 3MYWA 5JBAS 1ELCA 2ZTZA 3DHKH 1YBWA 3P70B 4INHA 4NCYA 2UUKB 1F7ZA 1T32A 1UHBB 5FBIA 1O2KA 1UTQA 2OXSA 3Q00A 3C27B 3D49H 1YCPK 2C8WB 4TY7A 2FWWA 2BD7A 1PPFE 2ZU2A 3DA9B 3PM3A 1O5CB 2XBVA 1QRXA 2ZGHA 4FVDA 3RXRA 4BAQB 2BDHA 1NRSH 1BJUA 3OTJE 4D9QA 5EPNA 3MU0A 3RM2H 4ISIH 3URCA 1IQNA 3AW1A 5GCHF 3V0XA 2FX6A 1G3EA 2BY9X 2B8OH 2ZF0H 2CN0H 1LQDB 3CENA 4JYVH 2XBWA 4Y76A 4GAWA 3G01A 1GJCB 1O3KA 4ZXYH 1UCYH 1XKBC 1QTFA 3JZ2B 3QGJA 4ZUHA 2VWLA 2XYAA 2BM2A 1GL0E 3PMHB 3SW2B 3LPRA 4ZKNU 1EAIA 3F9EA 4Y8YA 1XUIA 3P8GA 2SGFE 2GCTB 1XUJA 1ZYOA 3ZZDA 4B71A 2FOAA 2D1JA 2ANYA 1S0QA 3CS0A 3DFLA 4KP0A 4H6SB 2HOBA 2ALPA 2R0LA 2PTNA 1EJNA 4YM9A 1Z8RA 4LXBH 2XWBI 2GX4A 3RU4D 2GZ7A 4HFPB 3D62A 1MUEB 5EQRA 1HAHH 2ZIQH 1O31A 1LHCH 1ZTLA 4B1TA 1OPHB 1Z6EA 1L1JA 1MAYA 4YOJA 2C4FH 3SU2A 1HB0B 1TRMA 2ZGJA 3M3SA 4D76A 1EZUC 4X1RU 4IC5A 2Q6GA 4ISNA 1O2PA 2J4IA 1BMMH 2ZU1A 5IDKA 2JH5D 1C5QA 1GHBG 1ZRBA 1QB6A 1BRCE 1D3PB 1UTLM 4AFZA 6ESTA 1AMHA 1H1BA 3E91A 3P92A 2NU2E 1PPGE 1Y3UA 4RKJB 8GCHG 2ZHEH 1DX5M 1O37A 3ITIA 2ZDKA 3S9AA 2FI4E 3U8RH 5K0HA 2FO9A 1WTGH 3T62A 3O8BA 1C4U2 2OTVA 1L4ZA 3M5OA 1A3BH 4BAOB 5DJ7A 2WUBA 4NA8A 1UK3A 3U98H 3UIRA 1GBKA 1TGNA 1VITG 1FAXA 1DICA 1TGSZ 3HKIB 1IQGA 1HFDA 2VGCC 4DVAU 4E7RG 1O2LA 4WVPE 1UK2A 3A7XA 1HXEH 1XXFA 1G2LA 1QBVH 3AVZA 1M9UA 3MWIU 5HXFA 1VCPA 2ZA5A 2DE8A 1CHGA 4DY7B 5TCAA 1OS8A 2FOGA 1F5KU 3BV9B 2ZQ1A 2XXLA 3BF6H 3TK9A 2PW8H 3QN7A 3ZVDA 2KAIB 2ODQA 4HTCH 1NRNH 1O5FH 4KTSA 5DP3A 3A7ZA 2ZP0H 1O34A 3MU4A 2Z94A 3GY7A 3BTGE 1A0JA 1E36B 2QXJA 2PV9B 3ATKA 5GXPA 1DT2A 3RXKA 4ABBA 3P6ZB 1CU1A 3BTEE 3A88A 1O30A 3RXVA 4K60A 2XBYA 3PMBB 4WH6A 2I6QA 1MD8A 3KF2A 4Y7BA 6CHAC 1QY6A 2VIOA 5T6FA 2ZDAH 4IC6A 3LGUA 3MHWU 1LHDH 4K1EA 1FIZA 1QB1A 1C5OH 1O3DA 3VB5A 1QCPA 4I31A 3SUFA 1C2MA 1JIRA 2A2QH 1ESBA 1UCYE 2G51A 2EC9H 2OP9A 3FZZA 3FFGA 3E16B 3PROA 1QA7A 1O2HA 5CMXH 5BRRE 1V2MT 1C2JA 4YZUA 1V2KT 4FUIA 1T8LA 2B5TB 1K21H 1QA0A 2J2UA 3MNXA 2VIQA 1EZSC 1ZMJA 1HXFH 4MPXA 1XUGA 1BDAA 1BJVA 3SJOA 1JXPA 1A5IA 3KQCA 2P93A 1OWKA 4AGJA 2EEKA 3SZNA 2G4TA 3OX7U 2A4OA 2XCNA 2NWNA 2BHGA 2VIDA 1FAKH 2W7SA 4GHTA 1QL7A 1PYTD 4JZEH 3BTQE 3RXTA 1ELGA 4VGCB 3EYDA 2GD4B 1GJAB 1TNGA 1V2OT 1K9OE 3TJOA 4I33A 1P09A 2HRVA 2SGQE 1VGCB 3MTYA 1MU8B 1CE5A 3L33A 2F9NA 3BEUA 4GCHF 1C5TA 2QC2A 1DM4B 1T8NA 4Z6AH 4CREA 1FIWA 3LJJA 3VB7A 2RA0A 2OCVB 4INKA 1K1PA 1CHOG 3SUGA 1ELFA 3TH2H 2HVXA 3RXPA 1D3DB 4B2CA 9ESTA 1XKAC 2ZFPH 1GPZA 3PMAB 2F83A 4D7FA 1DXWA 1FNIA 1RJXB 1W0ZU 3HGNA 3M7UA 5FX5A 1K1NA 1OWHA 2BDGA 2BD9A 3E90B 3BG8A 1Y5BT 1MQ5A 1ELEE 1TE0A 2H2ZA 5HM2A 1V2LT 2W5EA 7GCHG 1LPGB 4AYVB 4CRCA 5TJXA 4PROA 1V2QT 5DP8A 3SV9A 6GCHF 2C93B 1OKXA 1RTKA 4BNRA 1RTFB 3PO1C 1BTHH 2THFB 2RCEA 3Q77A 3UR9A 1G3CA 1YM0A 4E06H 3MNBA 3T26A 4X2WA 1C5NH 3EDXB 2OC1A 1TAWA 1SGEE 2PSYA 1P11E 2BX4A 1FJSA 1F0UA 2FP7B 3GYLB 4BAHB 1UVOA 1AUTC 1F0SA 4I8KA 3MH4A 4ABGA 1L2EA 3RXHA 2H9HA 1AO5A 1SGYE 1YLDA 4JMYA 3NKKA 5C3NA 5E8EH 2Y81A 1TBZH 3SU6A 1QBNA 2O8UA 1YPLH 1FY4A 2WV5A 1W7GH 2A31A 5HMAA 4K69A 3SQHE 4E05H 3UOUA 3K2UA 3MI4A 2Z9JA 3A8CA 4YT7H 2BQ7B 1S83A 1GGDC 5LGOA 1NM6A 1T8OA 2OINA 1RIWC 2HNTC 2EA3A 3A7WA 2ZFQH 1GCTC 1K1OA 4X8TH 1TB6H 1UTNA 4H4FA 1G3DA 1PPZA 1MTVA 1Q31A 4A5TS 1AIXH 2ANWA 1SOZA 1O3NA 1GMHF 4YT6H 1W0YH 2TRMA 1HGTH 3M7TA 1XMNB 1TPPA 4X1PU 4NG9H 2FTLE 4YOIA 3RC4A 2FOCA 1AZZA 1PYTC 1GHWH 1QQ4A 3T2NA 1H8DH 2G81E 2VNTA 1U6QA 3GDUA 1FY3A 2AMDA 1GI1A 1Y3XA 2IN2A 4O3UA 3OU0A 2HPQH 1W7XH 1TYNA 4U32A 4CH8B 1K1MA 2BYAX 2GGVB 1FY1A 2HPPH 3R3GB 3SGQE 2AGIX 3H5CB 2PUQH 1IQIA 4K3JA 4Y79A 1WUNH 5AVDA 2H6MA 3QGNB 1NFWA 2V35A 1KXFA 2FOFA 1O2GH 3A8DA 4THNH 3PB1E 2GCHF 2D2DA 4JZFH 1JBUH 1L1NA 3GY2A 1O39A 5AHGH 4I8HA 4FU7A 1VJAU 4ASHA 1P05A 2K1QA 6LPRA 2BMGB 1F0TA 3KL6A 4ZKOU 1EUFA 3OY5U 5FPTA 1V2RT 5FCRA 4GUXA 1IHSH 1O3PB 1DLKB 1C5PA 2EI8A 1BHXB 3LGYA 2GT7A 2FYQA 1BRUP 1ETTH 3RMLH 3S7HB 2VB0A 1C1TA 3NCLA 5C20A 3SUDA 2P94A 5LPEA 1O0DH 1CT0E 2G52A 3GCOA 2SNVA 3HATH 1GDQA 1EATA 1WCZA 3A8BA 3MO9A 1SHHB 3TPIZ 1J14A 3HKJB 2VH6A 2QXHA 2UUYA 2UUFB 3UWJH 2ZHDA 3NK8A 3PTNA 1ZJDA 3EA8A 3RXBA 1C2EA 1WOFA 4IMQA 4CHAB 4E7NA 2ZTXA 5DGJA 3MMGA 4FU8A 2CHAB 1ZSKA 3ZVAA 4DCDA 4J1YA 5L6NH 2W3IA 1C9TA 3ZVFA 1C5MD 1GI8B 1OX1A 2ZNKH 1Z8JB 2CJIA 1TX8A 2R9PA 3FP8E 3RXEA 2Z3CA 1ID5H 1O36A 2ZPQA 1SL3A 1GBJA 1UTKA 2YNAA 2IOTA 3FZDA 1TMTH 1AE8H 1AZ8A 2ZKSA 1A0LA 1JOUB 3SJ9A 4ZHMU 3RXUA 1EP5A 3NPSA 3FP7E 3ZV9A 1AFEH 3RC5A 3VXEH 2OC7A 1C1NA 3GISB 5A8XA 1AFQB 5B6OA 4FUFA 1IQKA 4MQAA 2Z9LA 1PQ7A 2ZU3A 1QFKH 2TGTA 5ESTE 4HI3A 1Y3WA 2ZTYA 3UNRA 2BY8X 4H6TA 1BBRK 2ZO3H 4YLUA 3ZZ6A 3RMMH 1FI8A 1BMNH 1MZDA 1E37B 1ETRH 1UVTH 1GBTA 2FI5E 5A0BA 1NFYA 4DGJA 1NRPH 3AAVA 1THSH 4ZXXH 4B74A 1QL9A 3BTME 4NGAH 3SJ8A 1JRTA 2GZ9A 4DIHH 2AYWA 1AWHB 1O3LA 2CV3A 4R8TB 1LO6A 1F0RA 4LZ4B 3TK5A 4LOYH 4Y7AA 4BOHA 1S0RA 3VEQB 2WINI 2Z3DA 3Q76A 4JYUH 1TNLA 1N6YA 2ZHFH 4OS1A 5A8ZA 1N1LA 3V3MA 4BXSA 1CA0C 1CBWB 1O3BA 2CF8H 1O3MA 1IOEA 2ZHWH 1GHAF 2HNTE 1UVUH 3MFJA 2WV4A 2SGEE 2XWAA 1ZZZA 1Z7KA 2FEQH 2ALVA 3UPEA 1B7XB 5FXLA 3TH3H 1SQTA 1GI5A 2NU1E 1KXBA 1O2NA 4ESTE 1KLTA 1A2CH 4NSYA 3TJVA 1AI8H 1HBTH 8KME2 2GMTC 3F1SB 1KTTB 2GV7A 1JRSA 1ANDA 1A46H 1EAWA 3UNQA 3PTBA 3VB4A 1QJ7B 3GCNA 4FUCA 5HYOA 2BQWB 5JB9S 3I77A 1GJ4H 1VITH 3RLWH 5C67A 3A81A 3FP6E 1ACBE 2AMQA 2XNIA 3BG4C 2EI6A 3H7OA 2AFQB 4WXIA 1SBWA 1QNJA 1Z6JH 1Q3XA 2F3CE 2QCYA 1EJMA 1HIAB 1P3EA 5EXMA 3AW0A 1P12E 2QF3A 1BTXA 4ABEA 2A0QB 1D4PB 1W3CA 4KTCA 4X6NA 2JETB 4M7GA 1NFXA 1O2OA 2QN5T 2A45B 2F9UA 1NU7B 1C2KA 4H42U 2VIPA 5DPAA 3SU0A 1GMDF 1TNHA 1TONA 1P2JA 4X6MA 1ANCA 5C1UA 1A5GH 1ZMLA 3EGKH 3TNSA 3BTFE 4ABIA 1V2VT 1YPEH 5DG6A 1O5BB 1C9PA 2ZPRA 4ZMAH 4X6PA 4CRGA 4I8JA 2XBXA 1G32B 1GDUA 1DUEA 1GVZA 2ULLA 3STIA 4ABJA 2PHBA 1ZLRA 1ZSLA 3GY6A 4WMFA 5CHAB 4CH2B 3QX5H 1Z8IB 2ZFFH 1K1JA 3MH5A 2P3TB 5DP7A 1VZQH 3O8RA 1CGJE 1AB9B 5F03A 3TU7H 1V2TT 1EZXC 1W11U 1BHXF 2CMYA 3UOPA 5GCHG 1DDJA 1GG6B 1ZMNA 1H9IE 3LC3A 5FCKA 2D26C 4I8LA 1TOCB 1GHZA 1UJ1A 3PYHA 4HZHA 3M3VA 2HWLB 3GCTF 2W3KA 2TGDA 2UWOA 1O2MA 1TFXA 1CT4E 1HJ9A 3MNCA 1O3HA 4OS7A 1TALA 3FANA 5FHTA 1DXPA 4Z0KA 2AIPA 3BSQA 1GI7B 4WMDA 3ATMA 4FUHA 1SSXA 1XX9A 3GICB 1QJ1B 1UCYK 1Z8GA 1EOJA 2R3YA 1A5HA 5LPFA 2VINA 1QJ6B 1CGIE 2B9LA 1QHRB 2AS9A 1C5LH 4ABFA 1MU6B 3F9HA 1S85A 5EXLA 1NESE 4X6OA 3A87A 4AFSA 2LNCA 1GJ5H 2GV6A 2STAE 1OSSA 3U1IB 1J8AA 4IS5A 3I29A 1B5GH 1A1RA 1BA8B 1P10A 4X8VH 3SU1A 3GY5A 8ESTE 1DY8A 2QIQA 5AFYH 4LK4A 4UFEH 2XCFA 1O3EA 1GI9B 3LU9B 1D9IA 3MO6A 1C4V2 1GVLA 2BZ6H 1AN1E 1RFNA 2A7JA 1TBQH 2BB4A 1Y5AT 5F8ZA 1TBRH 1UHBA 2AGGX 1O3JA 3QDZB 1OP8A 5A09A 3M3TA 3TGKE 4IMZA 1A3EH 1WTHD 3EA7A 3SNCA 5GIBA 3SJIA 2FX4A 4CRDA 2ESTE 1MTWA 1ZPBA 3T28A 1KSNA 3MNSA 2GCTC 1C5VA 2ZPSA 1TIOA 4K5ZA 4MVNA 1MBMA 1CT2E 1LTOA 2ZDVH 3L3TA 3O8DA 3ZVGA 2PKAB 2DE9A 5A8YA 5EXNA 1YPMH 3GY4A 3T25A 1BTPA 1XUFA 1BT7A 4XBDA 1H4WA 2GDDA 4MG3A 1PPHE 4FUGA 3ZZ4A 1YP9A 2VVUA 1NPMA 4A7IB 1DUAA 3ATIA 5T6GA 3TJNA 8LPRA 2SFAA 2J9NA 2OC0A 3V13A 1TNJA 3OSYA 3E0NB 5DP5A 1CGHA 4JZIA 4XE4A 1MCVA 4FUJA 1CHOF 4XFQA 1G36A 1HAVB 4AGKA 1TGBA 4AN7A 3HGPA 1LVOA 3MO3A 1IQMA 1HCGA 4AOQA 5EU8A 3KQBA 4DG4A 2DUCA 1P2IA 1ZTKA 3FVFB 1YLCA 4XOJA 2RG3A 3LJOA 1MKWH 2ZHQH 5EQSA 4JZ1A 5L2YH 2G5NA 1Z71A 2BOKA 2BDCA 2VWOA 3D23A 1TRYA 1PQ8A 1AKSB 3URDA 4CRFA 3SN8A 1BTWA 1EZQA 1T4VH 1HRTH 3B9FH 4CR5A 1EQ9A 3TH4H 3RXOA 1HAGE 3UWIA 5ABWA 1QQUA 3SGBE 5E0GA 1IQLA 1GGDB 3P8FA 1C1MA 3GCHB 1GBLA 2O8TA 1KDQB 1FV9A 4NSVA 1GCTB 5J4SA 1C2LA 4A1TA 5DK1A 1EPTB 1LVYA 1ZR0A 1L1GA 2BXUH 1DOJA 2TIOA 4WXVA 1OYTH 3KN2A 1ZPZA 2C3SA 2AMPA 2BDYA 4NIVA 3AASA 1TNIA 4MLFB 3VB3A 2WPLS 1TLDA 2BVSH 3RMNH 3H7TA 1RD3B 1VCWA 2IJOB 2C8YB 1L4DA 3QZRA 3HPTB 2SGAA 1FPCH 3MU5A 1S84A 5F8XA 1SGDE 2ZFTA 3Q3XA 1FN8A 1P03A 1C2HA 3HK3B 4OS6A 1LPZB 2V0BA 1TQ7B 4U2WA 3M5NA 2ZZUH 4TWYA 1H9HE 4MDSA 1SLUB 3GDSA 1BMLA 3M5LA 3GDVA 3HK6B 3E1XB 3ENSB 3A82A 1K1LA 4GCHG 1VJ9U 3LGWA 2ZGBH 2VWMA 2NU4E 3SU5A 2ANMH 1MKWK 1O33A 4ABDA 1MTNB 3ODDA 1OWEA 2P95A 2B0FA 1MKXH 4DW2U 2M5TA 2GKVE 1TABE 4O03A 2TPIZ 2KAIA 1GJ6A 1D3TB 1H8IH 1DWEH 2SGPE 3GOVB 3BTKE 1TPOA 1S6HA 3RC6A 2BDBA 3SU3A 4DOQA 1H9LB 1TMBH 3NUMA 3SV2H 1TA6A 1T4UH 4RN6A 3LIWA 3ODFA 1AU8A 5LH8A 4WWYA 1WV7H 1ZGVA 3UNSA 3KCGH 2PKSB 3TGJE 1ZSJA 1BTYA 6GCHG 5EOKA 2VWNA 1LDTT 2ZDMA 4VGCC 4GSOA 3ZVEA 1O3AA 1IQEA 1J16A 4K1TA 3N7OA 1O2IA 3RLYH 4NZLA 1OP2A 1V2JT 2ZU4A 3T5FH 1YCPM 4WH8A 4AYYB 3P8OA 2C8ZB 1AUJA 3EA9A 1T31A 4NIWA 4XBCA 2R2MB 4D8NA 2A4GA 1P2OA 5G4BA 1GI3A 3B8JA 3NZIA 1P2KA 3RXGA 2ZQ2A 1O2JA 1LVBA 3DD2H 1NROH 3UREA 2A1DB 1Q2WA 1FPHH 2G55A 1C2IA 1AHTH 4DIIH 3PWCA 1E0FD 1GJ9B 4NA9H 1YGCH 1ZHMA 1P01A 1HPGA 1NO9H 1ELAA 1P04A 1N8OB 1O2QA 2PUXB 4X2YA 1UTPA 2A32A 1AY6H 1MKXK 1THRH 2ZCKP 1NC6A 1O3OA 1UTOA 2P8OB 2FM2A 1LHFH 1E34B 2GDEH 9LPRA 1HAXB 3RMOH 1AE5A 1J15A 3BTWE 4TYDA 2FMJA 4NWKA 1O35A 2BY7X 3T29A 1XUKA 2JH0D 3QLPH 4BAMB 4K8YA 2WUCA 5FPYA 1UK4A 3BIUH 2F91A 2H5DA 2QXIA 2NU0E 2VVCA 1QGFA 4FVBA 1CA8B 2ZDNA 4MTBA 1GBAA 4OGXA 3PMJA 1DSTA 2C8XB 1C2FA 1KDQA 1G37A 2PFEA 4INLA 3ZZ7A 1P0SH 3GY3A 2OLGA 4X8SH 1GMHG 1BZXE 3M36A 1ELVA 3SI4H 5H4IB 5FPSA 1INCA 7ESTE 1HAPH 1P3CA 2FS9A 4UONA 2F9PA 2J94A 2UWLA 4TY6A 1O2UA 4Q7ZA 2Z9GA 4U30A 1Y8TA 2WPIS 1MCTA 1KYNA 4LZ1H 1G30B 3M7QA 1D6RA 1QURH 3E6PH 1MH0A 1NT1A 1O2RA 2WPKS 2H9TH 3SV7A 3SBKA 3MH6A 1MQ6A 1XVMA 1FONA 2A5KA 3IWMA 1KTSB 2BD3A 2FXRA 3R0FA 3UQOA 1V6DA 3BTTE 1Z1IA 1WQSA 1GMCG 3S7KB 3SI3H 2SGDE 1QR3E 2BLQA 2GCHG 1FDPA 2YNBA 5F8TA 2F9OA 1O5EH 1RS0A 2BTCE 4O97A 1YKTA 3BN9A 3RXIA 1IQFA 3RXMA 4SGAE 1WQVH 2WYJA 4D7GA 2ASUB 4UEHH 3U69H 2J92A 3QTVH 1ABIH 4ISHH 1DPOA 1NFUA 4U01A 4O3TA 4NZQA 3F9FA 2Y5FA 1SGIB 3C1KA 1SGQE 2HLCA 2P3FH 5SGAE 1C1VH 1ETSH 1SLVB 3ZVCA 2FOHA 1DWDH 4MPUA 1BTUA 1QRZA 3A7VA 4MNXA 4Y10E 5F6MA 1V2UT 1DVAH 5C1XA 1W12U 1C1PA 1RGQA 2VIWA 3RXCA 1MAXA 3A7YA 3A84A 2PGBB 4X8UH 1GBEA 1P2QA 4ABAA 2ZU5A 3SGAE 5JBCS 1P2NA 3RXDA 2ODPA 1C5ZB 1YPGH 1GBDA 1LQEA 5JB8S 1OWDA 1FMGA 4JYTA 3SV6A 5EODA 1SR5C 1TGCA 3A83A 4NWLA 5GWZA 3NWUA 3RXJA 3ZYEA 3BIVH 1UTMA 1TOMH 1ZOMA 2BX3A 4X1SU 4AFQA 3CS7A 2AERH 5HGGA 3SHAH 1NS3A 2GP9B 1S81A 4CBOA 1O3CA 2G4UA 1FLEE 4ZHAA 3VGCC 1NRQH 1ZTJA 1TNKA 2ZFSA 1GWAA 1P8VC 2UWPA 1TPAE 1V2WT 4R0IA 3QZQA 1BOQA 1UTJA 5GPIB 4BXWA 5GJ4B 1TWXB 1ELDE 1F92A 1OWJA 1SQOA 5DP4A 1PPEE 1WBGB 2TGPZ 1P2MA 4Q80A 3U8OH 3SORA 2O8MA 4AX9H 4DURA 4CHAC 2J38A 2V3OH 4JK5A 4YTAA 1O2WA 1ARCA 1CO7E 1YPHC 3KGPA 2CHAC 2TBSA 1GL1A 1O2YA 4IN1A 1W8BH 4ISOA 1TPSA 1P02A 1GBFA 1HNEE 1YC0A 1DS2E 1GI2A 4FUDA 1DWCH 5FBEA 1MD7A 3M61U 3KQDA 1HJAC 1SFIA 2VGCB 1AVGH 1BBRE 3MU8A 3A85A 2BQ6B 1GHAG 2Y5GA 4CRAA 1B0EA 1O3IA 4WJG2 4WY3A 2Q1JA 5DKMA 5ESBA 5C5NA 2A4QA 3U9AH 1AFQC 1BCUH 4Q7YA 4X2VA 1L0ZA 1GBHA 3D65E 4YESB 3W94A 1F2SE 1G3BA 1GHBF 1QIXB 3SNBA 5C2ZA 3BEIB 3BTDE 3SNEA 1C5RA 7KMEH 4SGBE 2AIQA 1YF4A 2O9QA 3DFJA 3QK1A 1C2GA 1EKBB 3SV8A 2Y80A 2XC4A 8GCHF 3MH7A 3DT0H 1SGRE 2A7HA 2CXVA 2A5AA 3PWBA 2BXTH 3SJKA 4RSPA 3FAOA 4YO9A 6CHAB 1DLEA 1S82A 1KIGH 5JPMH 1EAXA 2HGTH 2QV1A 1K28D 2PTCE 2XW9A 2ZECA 1SMFE 4A1VA 1VITF 2BY6X 2BD8A 1YPJH 2BZAA 3TK6A 3QO6A 1HAYB 3PV4A 1WU1A 4NFFA 5PTPA 3KNXA 1C4Y2 5DO4H 1S6FA 3UY9A 1ZRKA 4YLQH 5E2OA 1CBWC 3TVJB 1GDNA 1WYKA 3M35A 1FY5A 2PSXA 2Q6FA 4X1QU 4UFDH 1Y3VA 1NN6A 1KXCA 1C2DA 1GMDG 3TITA 1HUTH 5HM9A 4X2XA 1THPB 3K6YA 3A80A 1XM1A 3KHVA 3F9GA 3IITA 4X1NU 1T8MA 1V2PT 2BLOA 1GHYH 1VR1H 1QRWA 3ZZAA 3RXFA 2R3UA 1DY9A 1WSSH 2A5IA 2Q6DA 2V6NA 3KIDU 2OC8A 4K1SA 2Y82A 2BOHB 5K7RA 3NXPA 1GI0A 3MOCA 4ZKRU 4I32A 1LCYA 2CF9H 4WMEA 1O5AB 4WF8A 2OD3B 4FUBA 1MTSA 4A6LA 1C1RA 1PPBH 1GCDA 2W26A 4TPYA 5A0AE 1C5WB 4F4OC 2ZGCA 5GDSH 4AB9A 2JETC 1IHTH 2Y7ZA 2FDAA 4Y8XA 3GCTG 4O9VA 1TA2A 3GY8A 1XUHA 2BVXH 1O2ZA 4OGYA 2BD5A 1AQ7A 4UE7H 1LVMA 2F9VA 3ELAH 2FYRA 1AVWA 4A92A 1ZJKA 1D6WA 3ATWA 4B73A 2OBQA 3TIUA 1O32A 4IGDA 3SNDA 1BB0B 1D3QB 2WPMS 3RUOA 4AZ2B 1O38A 1HAOH 1SOTA 1OYQA 1HIAA 3PO1B 5CHAC 3OYPA 1A61H 3DUXH 2JH6D 4OS4A 1MBQA 2OQUA 3M37A 1A7SA 2GZ8A 1HAIH 1XXDA 2VJ1A 3SOSA 2WPJS 2EI7A 3ZZ5A 3UQVA 1GVKB 1AB9C 4HGCA 1J9CH 4ZH8A 1Z1JA 1YPHE 1JIMA 1GG6C 1RXPA 3LT3A 4MPWA 1O5GH 4XBBA 4CRBA 2P16A 1RTLA 3TNTA 1AD8H 1RRKA 4KKDA 4GLYA 4OS5A 2Y7XA 5E0JA 1NRRH 1LKBA 2GTBA 3Q3YA 2Y6TA 3ZZ8A 1OWIA 2OQ5A 2Z3EA 2LPRA 4AG1A 5EW1H 2IPHA 3RXAA 2FI3E 7GCHF 1O2VA 1C1QA 4IW4E 1AGJA 2PLXA 2ZI2H 2FODA 1V3XA 1BTZA 5JDUB 3RP2A 1DFPA 3GYMA 1ZPCA 4NA7A 4YOGA 1EASA 1HLTH 1N6XA 2BVRH 1FUJA 1G9IE 7LPRA 2FZZA 3RXSA 2SNWA 4OS2A 1RIWB 5L2ZH 2BDAA 1SG8B 1E38B 5FAHA 2FLRH 1GHXH 4XDEA 5EGMA 3L6PA 2XTTB 1SFQB 3TGIE 3ATLA 5E2PA 4Y8ZA 2XC5A 1W10U 1VCQA 1TRNA 2GVFA 1DITH 1CVWH 1C1WH 3U8TH 3S9BA 2QGRA 2JKHA 1CSOE 1FXYA 2UUJB 2Z9IA 2FLBH 4Y0YE 5AFZH 1V2NT 2FS8A 1T7CA 2VIVA 2A7CA 1TX6A 1ZGIA 1C5SA 4UD9H 1BUIA 3BTHE 4AFUA 3ZV8A 1SC8U 2R2WU 3SU4A 5C5OA 3B23B 1HAZB 3I78A 4KTUA 4Q7XA 2B7DH 1QB9A 1GBIA 1LMWB 1P9UA 1SGNE 2QF0A 5DP6A 3LGVA 5CE1A 4GPGA 1HV7A 2OUAA 2I6SA 1PPCE 2VVVA 4BAKB 1BQYA 1GHVH 3E3TA 1V2ST 1EB1H 1SGFA 1O3FA 5I46H 3RXQA 4ZAEA 4FXGH 1MTUA 1SLXB 4UFGH 1SQAA 4KELA 4DJZB 1TQ0B 1MMJN 2G5VA 3K65B 1SLWB 4BTTB 1ESTA 1O2SA 2VU8E 4MNVA 2OBOA 1BMAA 1ABJH 2BLVA 4BTIB 2G8TA 1NY22 4MNYA 4D9RA 4IBLH 3V7TA 1ESAA 2FPZA 5T3HA 1W13U 5BPEA 3STJA 1X7AC 3VFEA 3UTUH 3LOXA 2PKAA 1C1OA 4ZHLU 1ARBA 5A2MH 3QWCH 3OY6U 1GBCA 2C90B 1B0FA 4AG2A 3UFAA 1IQJA 1VGCC 1C5UA 2QY0B 4MPVA 3RU4T 1KXDA 1GJ7B 2R0KA 1DWBH 1PFXC 2H5CA 1LHGH 5JBBS 1SHYA 2Y5HA 3SQEE 3PLPA 5FX6A 2Z6BD 2AH4X 3ZZCA 1NU9A 5EQQA 3EQ0H 2GT8A 1WAYB 2PR3A 5ETXA 3AAUA 2YOLA 5EPYA 1PQAA 3GCHC 3KEEA 2Z7FE 1C1SA 2ZG0H 4FUEA 3LGIA 1ZHPA 1HAVA 1KXEA 3MU1A 2ZWLH 5T6DA 2AGEX 3A89A 3M5MA 4Q2KA 1EPTC 3P17H 2QA9E 3S0NA 2H1UA 4Y11E 3UR6A 2ZCHP 3U1JB 1SPJA 1J17T 2ZEBA 1FY8E 4TPIZ 3LDXH 1UO6A 1EXFA 5EG4A 1BRAA 1K1IA 2WPHS 2H9EH 1JMOH 3KQEA 1IQHA 1FN6A 2A4RA 3S9CA 2ODYB 2V3HH 2D8WA 3LKWA 1ZHRA 1AKSA 1P57B 2VH0A 1K22H 1DANH 4AB8A 3TLOA 2BD2A 3BEFB 3F6UH 1P9SA 3IG6B 1QBOA 2FOEA 3RDZA 1EB2A 4KGAA 1A4WH 3S69A 4I7YH 2ZFRH 2FESH 1TMUH 4Y6DA 2BY5X 2ZGXH 1KLIH 3K6ZA 1GI4A 3CP7A 4GVUA 3ZZ9A 2ILNA 5I25A 4B76A 1EPTA 4AORA 1F5LA 1NTPA 4B2BA 1MTNC 5E0HA 1SGFG 2P3UB 4X0WU 4K2YA 1LPKB 1DE7H 1KXAA 1GJ8B 2ZCLP 4BANB 1BITA 1GMCF 2QYIA 2RDLA 3VXFH 1Y59T 4JCNA 4JK6A 4Y0ZE 3WY8A 1LHEH 3EE0B 1XVOA 4IN2A 3ZZBA 1SGTA 5L30H 2FTMA 5LPRA 1PQ5A 1GJDB 1G2MA 2PWXA 4I8GA 2P59A 1CA0B 2TGAA 5C1YA 3A8AA 3ZZ3A 2WYGA 3O8CA 1ANEA 4Y71A 3RU4E 2Z9KA 1EX3A 4JZDH 1UVSH 4B75A 1EJAA 3TJUA 3VGCB 1LKAA 3LH1A 1BBRH 2PKSC 3LC5A 1YPKH 4TWWA 5IYTA 3UUZA 2FOBA 1SGCA 2XRCA 2NU3E 3E0PB 1O5DH 2O8LA 1DSUA 3LH3A 1HYLA 3RM0H 2GMTB 4CBNA 2BD4A 2FOMB 1TX7A 4NFEA 2F9BH 1OXGA 4ISLA 1GBMA 2HNTF 4K8BA 4ZROA 4ABHA 1O2TA 4F49A 1SGPE 1S5SA 4NIYA 1Y3YA 1ELTA 3BG4B 4NIXA 3A7TA 1GJBB 1TGTA 3E8LA 1OP0A 2ZC9H 1YYY1 3LONA 3VPKA 1GI6A 4QT8C 1O2XA 2BDIA 1CQQA 1NZQH 4ZKSU 5TCCA 1HJAB 1SI5H 1N8OC 2ANKH 3SO3A 3SNAA 3ZVBA 5JYIA 1IAUA 3W95A 4RKOB 1EOLA 3SUEA 5DP9A 4B2AA 1SVPA 2PGQB 4J2YB 1W2KH 5A0CA 2P8OC 3K9XB 3QTOH 2CGAA 2FIRH 1UMAH 1Y5UT 1UVPA 1OOKB 4DT7B 4UFFH 2O8WA 3LGTA 1YCPH 1SB1H 4BTUB 1JWTA 1HDTH 1A0HB 1ANBA 3JZ1B 3SHCH 1FQ3A 5AF9H 5J4QA 3PLBA 2AEIH 1PJPA 1KLJH 1AWFH 4MNWA 4FU9A 2ZDLA 5EW2H 3A86A 3Q3KA 3P95A 3RXLA
chains in the Genus database with same CATH superfamily
3PLKA 1BIOA 2J34A 1P06A 1W14U 3ESTA 1MZAA 2QAAA 3V12A 1C5XB 4A1XA 1C5YB 1E35B 2XC0A 2HALA 2J95A 3T27A 2A2XH 3VB6A 1ORFA 3AK5A 4UDWH 1AVXA 4FOUC 3N7DA 1EAUA 2JIZD 2STBE 1EP6A 3F68H 5JBTA 1HJ8A 4GHQA 4XSKU 1GBBA 3QUMP 1KY9A 2QXGA 1BRBE 1F5RA 2G00A 1ELBA 4CR9A 3P8NA 2RA3A 3H09A 1FZZA 2BLWA 1O3GA 1C1UH 2W7UA 3ZYDA 3EAJA 1K2I1 1QL8A 3MYWA 5JBAS 1ELCA 2ZTZA 5KGOA 3DHKH 2YMSD 1YBWA 3P70B 4INHA 4NCYA 2UUKB 1F7ZA 1T32A 1UHBB 5FBIA 1O2KA 1UTQA 2OXSA 3Q00A 3C27B 3D49H 1YCPK 2C8WB 4YXWD 4TY7A 2FWWA 2BD7A 1PPFE 2ZU2A 3DA9B 3PM3A 1WXRA 1O5CB 2XBVA 1QRXA 2ZGHA 4FVDA 3RXRA 4BAQB 2BDHA 1NRSH 2M2AA 1BJUA 3OTJE 4D9QA 5EPNA 3MU0A 3RM2H 4ISIH 3URCA 1IQNA 3AW1A 5GCHF 3V0XA 2FX6A 1G3EA 2BY9X 2B8OH 2ZF0H 2CN0H 1LQDB 3CENA 4JYVH 2XBWA 4Y76A 4GAWA 3G01A 1GJCB 2QF5A 1O3KA 4ZXYH 1UCYH 1XKBC 1QTFA 3JZ2B 3QGJA 4ZUHA 3F0OA 2VWLA 2XYAA 1BMFD 2BM2A 1GL0E 3PMHB 3SW2B 3LPRA 4ZKNU 1EAIA 3F9EA 4Y8YA 1XUIA 3P8GA 2SGFE 2GCTB 1XUJA 1ZYOA 3ZZDA 4B71A 2FOAA 2D1JA 2ANYA 1S0QA 3CS0A 3DFLA 4KP0A 4H6SB 2HOBA 2ALPA 2R0LA 2PTNA 1EJNA 4YM9A 1Z8RA 4LXBH 2XWBI 2GX4A 4RT0A 3RU4D 2GZ7A 4HFPB 3D62A 1MUEB 5EQRA 1HAHH 2ZIQH 1O31A 5F53A 1LHCH 1ZTLA 4B1TA 1OPHB 1Z6EA 2J98A 1L1JA 1MAYA 4YOJA 2C4FH 3SU2A 1HB0B 1TRMA 2ZGJA 3M3SA 4D76A 1EZUC 4X1RU 4IC5A 2Q6GA 4ISNA 1O2PA 3KQ5A 2J4IA 1BMMH 2ZU1A 5IDKA 2JH5D 1C5QA 1GHBG 1ZRBA 1QB6A 1BRCE 1D3PB 1UTLM 3GS9A 4AFZA 6ESTA 1AMHA 1H1BA 3E91A 3P92A 2NU2E 1PPGE 1Y3UA 4RKJB 8GCHG 2ZHEH 1DX5M 1O37A 3ITIA 2ZDKA 3S9AA 2FI4E 3U8RH 5K0HA 2FO9A 1WTGH 3T62A 3O8BA 1C4U2 2OTVA 1L4ZA 2KM0A 1A3BH 3M5OA 4BAOB 2W6ID 5DJ7A 3WWBA 2WUBA 4NA8A 1UK3A 3U98H 3UIRA 1GBKA 1TGNA 1VITG 1FAXA 1DICA 1TGSZ 3HKIB 1IQGA 1HFDA 2VGCC 4DVAU 4E7RG 1O2LA 3OTPA 1UK2A 3A7XA 4WVPE 1HXEH 1XXFA 1G2LA 1QBVH 3AVZA 1M9UA 3MWIU 5HXFA 1VCPA 2ZA5A 2DE8A 1CHGA 4DY7B 5TCAA 1OS8A 2FOGA 1F5KU 3BV9B 2ZQ1A 2XXLA 3BF6H 3TK9A 2PW8H 3QN7A 3ZVDA 2KAIB 2ODQA 4HTCH 1NRNH 2YMSC 1O5FH 4KTSA 5DP3A 3A7ZA 2ZP0H 1O34A 3MU4A 2Z94A 3GY7A 3BTGE 1A0JA 1E36B 4F55A 2QXJA 2PV9B 3ATKA 5GXPA 1DT2A 3RXKA 4ABBA 3P6ZB 1CU1A 3BTEE 3A88A 1O30A 2V3MA 3RXVA 4K60A 2XBYA 3PMBB 4WH6A 2I6QA 1MD8A 3KF2A 4Y7BA 6CHAC 1QY6A 2VIOA 5T6FA 2ZDAH 4IC6A 3LGUA 3MHWU 1LHDH 4K1EA 1FIZA 1QB1A 1C5OH 1O3DA 3VB5A 1QCPA 4I31A 3SUFA 1C2MA 1JIRA 2A2QH 1ESBA 1UCYE 2G51A 2EC9H 2OP9A 3FZZA 3FFGA 3E16B 3PROA 1QA7A 1O2HA 5CMXH 5BRRE 1V2MT 1C2JA 4YZUA 3OAAD 1V2KT 4FUIA 1T8LA 2B5TB 1K21H 1QA0A 2W6JD 2J2UA 3MNXA 2VIQA 1EZSC 1ZMJA 1HXFH 4MPXA 1XUGA 1BDAA 1BJVA 3SJOA 1JXPA 1A5IA 3KQCA 2P93A 1OWKA 4AGJA 2EEKA 3SZNA 2G4TA 3OX7U 2A4OA 2XCNA 2NWNA 2BHGA 2VIDA 1FAKH 2W7SA 4GHTA 1QL7A 1PYTD 4JZEH 3BTQE 3RXTA 1ELGA 4TT3D 4VGCB 3EYDA 2GD4B 1GJAB 4B6FA 1TNGA 1V2OT 1K9OE 3TJOA 4I33A 1P09A 2HRVA 2SGQE 1VGCB 3MTYA 1MU8B 1CE5A 3L33A 2F9NA 3BEUA 4GCHF 1C5TA 2QC2A 1DM4B 1T8NA 4Z6AH 4CREA 1FIWA 3LJJA 3VB7A 2RA0A 2OCVB 4INKA 1K1PA 1CHOG 3SUGA 1ELFA 3TH2H 2HVXA 3RXPA 1D3DB 4B2CA 9ESTA 1XKAC 2ZFPH 1GPZA 3PMAB 2F83A 4D7FA 1DXWA 1FNIA 1RJXB 1W0ZU 3HGNA 3M7UA 5FX5A 1K1NA 1OWHA 2BDGA 2BD9A 3E90B 3BG8A 1Y5BT 1MQ5A 1ELEE 1TE0A 2H2ZA 5HM2A 1V2LT 2W5EA 3DCLA 7GCHG 1LPGB 4AYVB 4CRCA 5TJXA 4PROA 4ZCNA 1V2QT 5DP8A 3SV9A 6GCHF 2C93B 1OKXA 1RTKA 1H8ED 4BNRA 1RTFB 3PO1C 1BTHH 2THFB 2RCEA 3Q77A 3EE7A 3UR9A 1G3CA 1YM0A 4E06H 3MNBA 3T26A 4X2WA 1C5NH 3EDXB 2OC1A 1TAWA 1SGEE 2PSYA 1P11E 2BX4A 1FJSA 1F0UA 2FP7B 3GYLB 4BAHB 1UVOA 1AUTC 1F0SA 4I8KA 3MH4A 4ABGA 1L2EA 3RXHA 2H9HA 1AO5A 1SGYE 1YLDA 4JMYA 3NKKA 5C3NA 5E8EH 2Y81A 1TBZH 3SU6A 1QBNA 2O8UA 3PV5A 1YPLH 4B6EA 1FY4A 5IK2D 2WV5A 1W7GH 2A31A 5HMAA 4K69A 3SQHE 4E05H 3UOUA 3K2UA 3NRLA 3MI4A 2Z9JA 3A8CA 4YT7H 2BQ7B 1S83A 1GGDC 5B6LA 1NM6A 5LGOA 1T8OA 2OINA 1RIWC 2HNTC 2EA3A 3A7WA 2ZFQH 1GCTC 1K1OA 4X8TH 1TB6H 1UTNA 4H4FA 1G3DA 1PPZA 1MTVA 1Q31A 4A5TS 3F2HA 4ACAA 1AIXH 2ANWA 1SOZA 1O3NA 1GMHF 4YT6H 1W0YH 2TRMA 1HGTH 3M7TA 1XMNB 1TPPA 4X1PU 2OK5A 4NG9H 2FTLE 4YOIA 3RC4A 2FOCA 1AZZA 2KCAA 1PYTC 1GHWH 1QQ4A 3T2NA 1H8DH 2G81E 2VNTA 1U6QA 3GDUA 1FY3A 2AMDA 1GI1A 1Y3XA 2IN2A 3OE7D 4O3UA 3OU0A 2HPQH 1W7XH 1TYNA 4U32A 4CH8B 1K1MA 2BYAX 2GGVB 1FY1A 2HPPH 3R3GB 3SGQE 1EFRD 2AGIX 3H5CB 2PUQH 1IQIA 4K3JA 4Y79A 1WUNH 2XNDD 5AVDA 2H6MA 3QGNB 1NFWA 2V35A 1KXFA 2FOFA 1O2GH 3A8DA 4THNH 3PB1E 2GCHF 2D2DA 4JZFH 1JBUH 1L1NA 3GY2A 1O39A 5AHGH 3KYGA 4I8HA 4FU7A 1VJAU 4ASHA 1P05A 2K1QA 6LPRA 2BMGB 1F0TA 3KL6A 4ZKOU 1EUFA 3OY5U 5FPTA 1V2RT 5FCRA 4GUXA 1IHSH 1O3PB 1DLKB 1C5PA 2EI8A 1BHXB 3LGYA 2GT7A 2FYQA 1BRUP 1ETTH 3FN8A 3RMLH 2VB0A 3S7HB 1C1TA 3NCLA 5C20A 3SUDA 2P94A 5LPEA 1O0DH 1CT0E 2G52A 3OEED 3GCOA 2SNVA 3HATH 1GDQA 1EATA 1WCZA 3A8BA 3MO9A 1SHHB 3TPIZ 1J14A 3HKJB 2VH6A 2QXHA 2UUYA 2UUFB 3UWJH 2ZHDA 3NK8A 3PTNA 1ZJDA 3EA8A 3RXBA 1C2EA 1WOFA 4IMQA 4CHAB 2K8IA 4E7NA 2ZTXA 5DGJA 3MMGA 4FU8A 2CHAB 1ZSKA 3ZVAA 4DCDA 4J1YA 5L6NH 2W3IA 1C9TA 3ZVFA 1C5MD 1GI8B 1OX1A 2ZNKH 1Z8JB 2CJIA 1TX8A 2R9PA 3FP8E 3RXEA 2Z3CA 1ID5H 1O36A 2ZPQA 1SL3A 1GBJA 1UTKA 2YNAA 2IOTA 3DSGA 1TMTH 3FZDA 1AE8H 2HLDD 1AZ8A 2ZKSA 1A0LA 1JOUB 3SJ9A 5CDFE 4ZHMU 3RXUA 1EP5A 3NPSA 3FP7E 3ZV9A 1AFEH 3RC5A 3VXEH 2OC7A 1C1NA 3GISB 5A8XA 1AFQB 5B6OA 4FUFA 1IQKA 4Z1MD 4MQAA 2Z9LA 1PQ7A 2ZU3A 1QFKH 2TGTA 5ESTE 4HI3A 1Y3WA 1E1QD 2ZTYA 3UNRA 2BY8X 4H6TA 1BBRK 2ZO3H 4YLUA 3ZZ6A 3RMMH 1FI8A 1BMNH 1MZDA 1E37B 1ETRH 1UVTH 1GBTA 2FI5E 3N99A 5A0BA 1NFYA 4DGJA 1NRPH 3AAVA 1THSH 4ZXXH 4B74A 1QL9A 3BTME 4NGAH 3SJ8A 1JRTA 2GZ9A 4DIHH 2AYWA 1AWHB 1O3LA 2CV3A 4R8TB 1LO6A 1F0RA 4LZ4B 3TK5A 4LOYH 4Y7AA 4BOHA 1S0RA 3VEQB 2WINI 2Z3DA 3Q76A 4JYUH 2WZQA 1TNLA 1N6YA 2ZHFH 4OS1A 5A8ZA 1N1LA 3V3MA 4BXSA 1CA0C 1CBWB 1O3BA 2CF8H 1O3MA 1IOEA 2ZHWH 1GHAF 2HNTE 5C94A 1UVUH 3MFJA 2WV4A 2SGEE 2XWAA 1ZZZA 1Z7KA 2FEQH 2ALVA 3UPEA 1B7XB 5FXLA 3TH3H 1SQTA 1GI5A 2NU1E 3FO8D 1KXBA 1O2NA 4ESTE 1KLTA 1SKYE 1A2CH 4NSYA 3TJVA 1AI8H 1HBTH 8KME2 2GMTC 3F1SB 1KTTB 2GV7A 1JRSA 1ANDA 1A46H 1EAWA 3UNQA 3PTBA 3VB4A 1QJ7B 3GCNA 4FUCA 5HYOA 2BQWB 5JB9S 3I77A 1GJ4H 1VITH 3RLWH 5C67A 3A81A 3FP6E 1ACBE 2AMQA 2XNIA 3BG4C 2EI6A 3H7OA 2AFQB 4WXIA 1SBWA 1QNJA 1Z6JH 1Q3XA 2F3CE 2QCYA 1EJMA 1HIAB 1P3EA 2KCYA 5EXMA 3AW0A 1P12E 2QF3A 1BTXA 4Q63A 4ABEA 2A0QB 1D4PB 1W3CA 4KTCA 4X6NA 2JETB 4M7GA 1YWUA 1NFXA 1O2OA 2QN5T 2A45B 2F9UA 1NU7B 1C2KA 2EQNA 4H42U 2VIPA 5DPAA 3SU0A 1GMDF 1TNHA 1TONA 1P2JA 4X6MA 1ANCA 5C1UA 1A5GH 1ZMLA 3EGKH 3TNSA 3BTFE 4ABIA 1V2VT 1YPEH 5DG6A 5DSFA 1O5BB 1C9PA 2ZPRA 4ZMAH 4X6PA 4CRGA 5C17A 4I8JA 2XBXA 1G32B 1GDUA 1DUEA 1GVZA 2ULLA 3STIA 4ABJA 2PHBA 1ZLRA 1ZSLA 3GY6A 4WMFA 5CHAB 4CH2B 3QX5H 1Z8IB 2LELA 2ZFFH 1K1JA 3MH5A 2P3TB 5DP7A 1VZQH 3O8RA 1CGJE 1AB9B 5F03A 3TU7H 3MQKC 1V2TT 1EZXC 1W11U 1BHXF 2CMYA 3UOPA 5GCHG 1DDJA 1GG6B 1ZMNA 2JDID 1H9IE 3LC3A 5FCKA 2D26C 4I8LA 1TOCB 1GHZA 1UJ1A 3PYHA 4HZHA 2K0QA 3M3VA 2HWLB 3GCTF 2W3KA 2TGDA 2UWOA 1O2MA 1TFXA 1CT4E 1HJ9A 3MNCA 1O3HA 4OS7A 1TALA 3FANA 5FHTA 1DXPA 4Z0KA 2AIPA 3BSQA 2J97A 1GI7B 4WMDA 3ATMA 4FUHA 1SSXA 1XX9A 3GICB 1QJ1B 1UCYK 1Z8GA 1EOJA 2R3YA 1A5HA 5LPFA 2VINA 5EJLA 1QJ6B 1CGIE 2B9LA 1QHRB 2AS9A 1W0KD 1C5LH 4ABFA 1MU6B 5EIYA 3F9HA 1S85A 5EXLA 1NESE 4X6OA 3A87A 3UB0A 2LNCA 4AFSA 1GJ5H 2GV6A 2STAE 1OSSA 3U1IB 1J8AA 4IS5A 3I29A 1B5GH 1A1RA 4Q4LA 1BA8B 1P10A 4X8VH 3SU1A 3GY5A 8ESTE 1DY8A 2QIQA 5AFYH 4LK4A 4UFEH 2XCFA 1O3EA 1GI9B 3LU9B 1D9IA 3MO6A 1C4V2 1GVLA 2BZ6H 1AN1E 1RFNA 2A7JA 1TBQH 2BB4A 1Y5AT 5F8ZA 1TBRH 1UHBA 2AGGX 1O3JA 3QDZB 3DSPA 1OP8A 5A09A 3M3TA 3TGKE 4IMZA 1A3EH 1WTHD 3EA7A 3SNCA 5GIBA 3SJIA 2FX4A 4CRDA 2ESTE 1MTWA 1ZPBA 3T28A 1KSNA 3MNSA 2GCTC 1C5VA 2ZPSA 1TIOA 4K5ZA 4MVNA 1MBMA 1CT2E 1LTOA 2ZDVH 3L3TA 3O8DA 3ZVGA 2PKAB 5EJ1A 2DE9A 5A8YA 5EXNA 1YPMH 3GY4A 3T25A 1BTPA 1XUFA 1BT7A 4XBDA 1H4WA 2GDDA 4MG3A 1PPHE 3SZEA 2LP6A 4FUGA 3SYJA 3ZZ4A 1YP9A 2J5UA 2VVUA 1NPMA 4A7IB 1DUAA 3ATIA 5T6GA 3TJNA 8LPRA 2SFAA 1COWD 2J9NA 2OC0A 3V13A 1TNJA 3OSYA 3E0NB 5DP5A 1CGHA 4JZIA 4XE4A 1MCVA 4FUJA 1CHOF 4XFQA 1G36A 1HAVB 4AGKA 1TGBA 4AN7A 3HGPA 1LVOA 3MO3A 1IQMA 1HCGA 4AOQA 5EU8A 3KQBA 4DG4A 2DUCA 1P2IA 1ZTKA 4ACBA 3FVFB 1YLCA 4XOJA 2RG3A 3LJOA 1MKWH 2ZHQH 5EQSA 1S6LA 4JZ1A 1E79D 5L2YH 2G5NA 1Z71A 2BOKA 2BDCA 2VWOA 3D23A 1TRYA 1PQ8A 1UW7A 1AKSB 3URDA 4CRFA 3SN8A 1BTWA 1EZQA 1T4VH 1HRTH 3B9FH 4CR5A 1EQ9A 3TH4H 3RXOA 1HAGE 3UWIA 5ABWA 2KCOA 1QQUA 3SGBE 5E0GA 1IQLA 1GGDB 3P8FA 1C1MA 3GCHB 1GBLA 2O8TA 1KDQB 1FV9A 4NSVA 1GCTB 5J4SA 1C2LA 4A1TA 5DK1A 4DT4A 1EPTB 1LVYA 1ZR0A 3PV2A 1L1GA 2BXUH 1DOJA 2TIOA 4WXVA 1OYTH 3KN2A 1ZPZA 2C3SA 2AMPA 2BDYA 4NIVA 3AASA 1TNIA 4MLFB 3VB3A 2WPLS 1TLDA 2BVSH 3RMNH 3H7TA 1RD3B 1H8HD 1VCWA 2IJOB 2C8YB 1L4DA 3QZRA 3HPTB 2SGAA 1FPCH 3MU5A 1S84A 5F8XA 1SGDE 2ZFTA 3Q3XA 1FN8A 1P03A 1C2HA 3HK3B 4OS6A 1LPZB 2V0BA 1TQ7B 4U2WA 3M5NA 2ZZUH 4TWYA 1H9HE 4MDSA 1SLUB 3GDSA 1BMLA 2JJ1D 3M5LA 3GDVA 3HK6B 3E1XB 3ENSB 3A82A 1K1LA 4GCHG 1VJ9U 3LGWA 2ZGBH 2VWMA 2NU4E 3SU5A 5C0UA 2ANMH 1MKWK 1O33A 4ABDA 1MTNB 3ODDA 1OWEA 2P95A 2B0FA 1MKXH 4DW2U 2M5TA 2GKVE 1TABE 4O03A 2TPIZ 2KAIA 1GJ6A 1D3TB 1H8IH 1DWEH 2SGPE 3GOVB 1NBMD 3BTKE 1TPOA 3F3BA 1S6HA 3CNRA 3RC6A 2BDBA 3SU3A 4DOQA 1H9LB 1TMBH 3NUMA 3SV2H 1TA6A 1T4UH 4RN6A 3LIWA 3ODFA 1AU8A 5LH8A 4WWYA 1WV7H 4RT1A 1ZGVA 3UNSA 3KCGH 2PKSB 3TGJE 1ZSJA 1BTYA 6GCHG 5EOKA 2VWNA 1LDTT 2ZDMA 4VGCC 4GSOA 3ZVEA 1O3AA 1IQEA 1J16A 4K1TA 3N7OA 1O2IA 3RLYH 4NZLA 1OP2A 1V2JT 2ZU4A 3T5FH 1YCPM 4WH8A 4AYYB 3P8OA 2C8ZB 1AUJA 3EA9A 1T31A 4NIWA 4XBCA 2R2MB 4D8NA 2A4GA 1P2OA 5G4BA 1GI3A 3B8JA 3NZIA 1P2KA 3RXGA 2ZQ2A 1O2JA 1LVBA 3DD2H 1NROH 3UREA 2A1DB 1Q2WA 1FPHH 2G55A 1C2IA 1AHTH 4DIIH 3PWCA 1E0FD 1GJ9B 3VG8A 4NA9H 1YGCH 2KZ4A 2VBCA 1ZHMA 1P01A 1HPGA 1NO9H 1ELAA 1P04A 1N8OB 1O2QA 2PUXB 4X2YA 1UTPA 2A32A 1AY6H 1MKXK 1THRH 2KX4A 2ZCKP 1NC6A 1O3OA 1UTOA 2P8OB 3WW7A 2FM2A 1LHFH 1E34B 2GDEH 9LPRA 1HAXB 3RMOH 1AE5A 1J15A 3BTWE 4TYDA 2FMJA 4NWKA 1O35A 2BY7X 3T29A 1XUKA 2JH0D 3QLPH 3ZIAD 4BAMB 4K8YA 2WUCA 5FPYA 1UK4A 3BIUH 2F91A 2H5DA 2QXIA 2NU0E 2VVCA 1QGFA 4FVBA 1CA8B 2WPDD 2ZDNA 1W0JD 4MTBA 1GBAA 4OGXA 3PMJA 1DSTA 2C8XB 1C2FA 1KDQA 1G37A 2PFEA 4INLA 3ZZ7A 1P0SH 3GY3A 3PRDA 2OLGA 4X8SH 1GMHG 1BZXE 3M36A 1ELVA 3SI4H 2L6OA 5H4IB 5FPSA 1INCA 7ESTE 1HAPH 1P3CA 2FS9A 4UONA 2F9PA 2J94A 3OEHD 2UWLA 4TY6A 1O2UA 4Q7ZA 2Z9GA 4U30A 1Y8TA 2WPIS 1MCTA 3KYFA 1KYNA 4LZ1H 1G30B 3M7QA 1D6RA 1QURH 3E6PH 2EY4C 1MH0A 1NT1A 1O2RA 4ASUD 2WPKS 2H9TH 3SV7A 3SBKA 2L74A 3MH6A 1MQ6A 1XVMA 1FONA 2A5KA 3IWMA 1KTSB 2BD3A 2FXRA 3R0FA 3UQOA 1V6DA 3BTTE 1Z1IA 1WQSA 1GMCG 3S7KB 3F0PA 3SI3H 2SGDE 1QR3E 2BLQA 2GCHG 1FDPA 2YNBA 5F8TA 2F9OA 1O5EH 1RS0A 2BTCE 4O97A 1YKTA 3BN9A 3RXIA 1IQFA 3RXMA 4SGAE 4XD7D 1WQVH 2WYJA 4D7GA 2ASUB 4UEHH 3U69H 2J92A 3QTVH 1ABIH 4ISHH 1DPOA 1NFUA 4U01A 4O3TA 4NZQA 3F9FA 2Y5FA 1SGIB 3C1KA 5HKKD 1SGQE 2HLCA 2P3FH 5SGAE 1C1VH 1ETSH 1SLVB 2XOKD 3ZVCA 2FOHA 1DWDH 4MPUA 1BTUA 1QRZA 3A7VA 4MNXA 4Y10E 5F6MA 1V2UT 1DVAH 2J98B 5C1XA 1W12U 1C1PA 1RGQA 2VIWA 3RXCA 1MAXA 3A7YA 3A84A 2PGBB 4X8UH 1GBEA 2RFKC 1P2QA 4ABAA 2ZU5A 3SGAE 5JBCS 3N7EA 1P2NA 3RXDA 2ODPA 5DN6D 1C5ZB 1YPGH 1GBDA 1LQEA 5JB8S 1OWDA 1FMGA 4JYTA 3SV6A 5EODA 1SR5C 1TGCA 3A83A 2IPQX 4NWLA 5GWZA 3NWUA 3RXJA 3ZYEA 3BIVH 1UTMA 1TOMH 1ZOMA 2BX3A 4X1SU 4AFQA 3CS7A 2AERH 5HGGA 3SHAH 1NS3A 2GP9B 1S81A 4CBOA 1O3CA 2G4UA 1FLEE 4ZHAA 3VGCC 1NRQH 1ZTJA 1TNKA 2ZFSA 1GWAA 1P8VC 2UWPA 1TPAE 1V2WT 4R0IA 3QZQA 1BOQA 1UTJA 5GPIB 4BXWA 5GJ4B 1TWXB 1ELDE 1F92A 1OWJA 3PRBA 1SQOA 5DP4A 1PPEE 1WBGB 2TGPZ 1P2MA 4Q80A 3U8OH 3SORA 2O8MA 4AX9H 4DURA 4CHAC 2J38A 2V3OH 4JK5A 4YTAA 1O2WA 1ARCA 1CO7E 1YPHC 3KGPA 2CHAC 2TBSA 1GL1A 1O2YA 4IN1A 1W8BH 4ISOA 1TPSA 1P02A 1GBFA 1HNEE 1YC0A 1DS2E 1GI2A 4FUDA 1DWCH 5FBEA 1MD7A 3M61U 3KQDA 1HJAC 1SFIA 2VGCB 1AVGH 1BBRE 3MU8A 3A85A 2BQ6B 1GHAG 2Y5GA 4CRAA 1B0EA 4RI0A 1O3IA 4WJG2 4WY3A 3FKSD 2Q1JA 5DKMA 5ESBA 5C5NA 1OHHD 2A4QA 3U9AH 1AFQC 2QE7D 1BCUH 4Q7YA 4X2VA 1L0ZA 1GBHA 2YMSB 3D65E 4YESB 3W94A 2CK3D 1F2SE 1G3BA 1GHBF 1QIXB 3SNBA 5C2ZA 3BEIB 3BTDE 3SNEA 1C5RA 7KMEH 4SGBE 2AIQA 1YF4A 2O9QA 3DFJA 3QK1A 1C2GA 1EKBB 3SV8A 2Y80A 2XC4A 8GCHF 3MH7A 3DT0H 1SGRE 2A7HA 2CXVA 2A5AA 3PWBA 2BXTH 3SJKA 4RSPA 3FAOA 4YO9A 6CHAB 1DLEA 1S82A 1KIGH 5JPMH 1EAXA 2HGTH 2F43B 2QV1A 1MABB 1K28D 2PTCE 2XW9A 2ZECA 1SMFE 4A1VA 1VITF 2BY6X 2BD8A 1YPJH 2BZAA 3TK6A 3DSOA 3QO6A 1HAYB 3PV4A 1WU1A 4NFFA 2PP6A 5PTPA 5T1VA 3KNXA 1C4Y2 5DO4H 1S6FA 3UY9A 1ZRKA 4YLQH 5E2OA 1CBWC 3TVJB 2JJ2D 1GDNA 1WYKA 3M35A 1FY5A 2PSXA 2Q6FA 2GJGA 4X1QU 4UFDH 1Y3VA 1NBME 1NN6A 1KXCA 1C2DA 1GMDG 3TITA 1HUTH 5HM9A 4X2XA 1THPB 3K6YA 3A80A 1XM1A 3KHVA 3F9GA 3IITA 4I86A 4X1NU 1FX0B 1T8MA 1V2PT 2BLOA 4XRNA 1GHYH 1VR1H 1QRWA 3ZZAA 3RXFA 2R3UA 1DY9A 1WSSH 2KR7A 2A5IA 2Q6DA 2V6NA 3KIDU 2OC8A 3F2GA 4K1SA 2Y82A 2BOHB 5K7RA 3NXPA 1GI0A 3MOCA 4ZKRU 4I32A 1LCYA 2CF9H 4WMEA 1O5AB 4WF8A 2OD3B 4FUBA 1MTSA 4A6LA 1C1RA 1PPBH 1GCDA 2W26A 4TPYA 5A0AE 1C5WB 4M9FA 4F4OC 2ZGCA 5GDSH 4AB9A 2JETC 1IHTH 2Y7ZA 1QZ8A 2FDAA 4Y8XA 3GCTG 4O9VA 1TA2A 3GY8A 1XUHA 2BVXH 1O2ZA 4OGYA 2BD5A 1AQ7A 4UE7H 1LVMA 2F9VA 3ELAH 2FYRA 1AVWA 4A92A 1ZJKA 1D6WA 3ATWA 4B73A 2OBQA 3TIUA 1O32A 4IGDA 3SNDA 1BB0B 2WHXA 1D3QB 2WPMS 3RUOA 4AZ2B 1O38A 1HAOH 1SOTA 1OYQA 1HIAA 3PO1B 5CHAC 3OYPA 1A61H 3DUXH 2JH6D 4OS4A 1MBQA 2OQUA 3M37A 1A7SA 2GZ8A 1HAIH 1XXDA 2VJ1A 3SOSA 2WPJS 2EI7A 3ZZ5A 3UQVA 1GVKB 1AB9C 2AHME 4HGCA 1J9CH 4ZH8A 1Z1JA 1YPHE 1JIMA 4OM9A 1GG6C 2WSSD 1RXPA 3LT3A 4MPWA 1O5GH 4XBBA 4CRBA 2P16A 1RTLA 3TNTA 1AD8H 1RRKA 4KKDA 4GLYA 4OS5A 2Y7XA 5E0JA 1NRRH 1LKBA 2GTBA 3Q3YA 2Y6TA 3ZZ8A 1OWIA 2OQ5A 2Z3EA 2LPRA 4AG1A 5EW1H 2IPHA 3RXAA 2FI3E 7GCHF 1O2VA 1C1QA 4IW4E 1AGJA 2PLXA 2ZI2H 2FODA 1V3XA 1BTZA 5JDUB 3RP2A 1DFPA 3GYMA 1ZPCA 4NA7A 4YOGA 1EASA 1HLTH 1N6XA 2BVRH 1FUJA 1G9IE 7LPRA 2FZZA 3RXSA 2SNWA 4OS2A 1RIWB 5L2ZH 2BDAA 1SG8B 1E38B 5FAHA 2FLRH 1GHXH 4XDEA 5EGMA 3L6PA 2XTTB 1SFQB 3TGIE 3ATLA 5E2PA 4Y8ZA 2XC5A 1W10U 1VCQA 1TRNA 2GVFA 1DITH 1CVWH 1C1WH 3U8TH 2QF4A 3S9BA 2QGRA 2JKHA 1CSOE 1FXYA 2UUJB 2Z9IA 2FLBH 4Y0YE 5AFZH 1V2NT 3WWFA 2FS8A 1T7CA 2VIVA 2A7CA 1TX6A 1ZGIA 1C5SA 4UD9H 1BUIA 3BTHE 4AFUA 3ZV8A 1SC8U 2R2WU 3SU4A 5C5OA 3B23B 1HAZB 3I78A 4KTUA 2IJD1 4Q7XA 2B7DH 1QB9A 1GBIA 1LMWB 5CHBA 1P9UA 1SGNE 4P00A 2QF0A 5DP6A 3LGVA 5CE1A 4GPGA 1HV7A 2OUAA 2I6SA 4HG6A 1PPCE 2VVVA 4BAKB 1BQYA 1GHVH 3E3TA 1V2ST 1EB1H 1SGFA 1O3FA 5I46H 3RXQA 4ZAEA 4FXGH 1MTUA 1SLXB 4UFGH 1SQAA 4KELA 4DJZB 1TQ0B 1MMJN 2G5VA 5KEDA 3K65B 1SLWB 4BTTB 1ESTA 1O2SA 2VU8E 4MNVA 2OBOA 1BMAA 1ABJH 2BLVA 4BTIB 2G8TA 1NY22 5EJZA 4MNYA 4D9RA 4IBLH 3V7TA 1ESAA 2FPZA 5T3HA 1W13U 3UAIC 5BPEA 3STJA 1X7AC 3VFEA 3UTUH 3LOXA 2PKAA 1C1OA 4ZHLU 1ARBA 5A2MH 3QWCH 3OY6U 1GBCA 2C90B 1B0FA 4AG2A 3UFAA 5HIYA 1IQJA 1VGCC 5FL7D 1C5UA 2QY0B 4MPVA 3RU4T 1KXDA 1GJ7B 2R0KA 5KECA 1K0HA 1DWBH 1PFXC 2H5CA 1LHGH 5JBBS 3FOAA 1SHYA 2Y5HA 3SQEE 3PLPA 5FX6A 2Z6BD 2V7QD 2AH4X 3ZZCA 1NU9A 5EQQA 3EQ0H 2GT8A 1WAYB 2PR3A 5ETXA 3AAUA 2YOLA 5EPYA 1PQAA 3GCHC 3KEEA 2Z7FE 1C1SA 2ZG0H 4FUEA 3LGIA 1ZHPA 1HAVA 1KXEA 3MU1A 2ZWLH 5T6DA 4TSFD 2AGEX 1WDIA 3A89A 3M5MA 4Q2KA 1EPTC 3P17H 2QA9E 3S0NA 1YLNA 2H1UA 4Y11E 3UR6A 2ZCHP 3U1JB 1SPJA 1J17T 2ZEBA 1FY8E 4TPIZ 3LDXH 1UO6A 1EXFA 5EG4A 1BRAA 1K1IA 2WPHS 2H9EH 1JMOH 3KQEA 1IQHA 1FN6A 2A4RA 3S9CA 2ODYB 2V3HH 2D8WA 3LKWA 1ZHRA 1AKSA 1P57B 2KCPA 2VH0A 5C0TA 1K22H 1DANH 4AB8A 3TLOA 2BD2A 3BEFB 3F6UH 1P9SA 3IG6B 1QBOA 2FOEA 3RDZA 1EB2A 4KGAA 1A4WH 3S69A 4I7YH 2ZFRH 2FESH 1TMUH 4Y6DA 2BY5X 2ZGXH 1KLIH 3K6ZA 1GI4A 2KFWA 3CP7A 4GVUA 3ZZ9A 2ILNA 5I25A 4B76A 1EPTA 4AORA 1F5LA 1NTPA 1VKYA 4B2BA 4AC9A 1MTNC 5E0HA 1SGFG 2P3UB 4X0WU 4K2YA 1LPKB 1DE7H 1KXAA 1GJ8B 2ZCLP 4BANB 1BITA 1GMCF 2QYIA 2RDLA 4FETA 1YY3A 3VXFH 1Y59T 4JCNA 4JK6A 4Y0ZE 3WY8A 1LHEH 3EE0B 1XVOA 4IN2A 3ZZBA 1SGTA 5L30H 2FTMA 5LPRA 1PQ5A 1GJDB 1G2MA 2PWXA 4I8GA 2P59A 1CA0B 2TGAA 5C1YA 3A8AA 3ZZ3A 2WYGA 3O8CA 1ANEA 4Y71A 3RU4E 2Z9KA 1EX3A 4JZDH 1UVSH 4B75A 1EJAA 3TJUA 5GNDA 3VGCB 1LKAA 3LH1A 1BBRH 2PKSC 3LC5A 1YPKH 4TWWA 5IYTA 3UUZA 4F48B 2FOBA 1SGCA 2XRCA 2NU3E 3E0PB 1O5DH 2O8LA 1DSUA 3LH3A 1HYLA 3RM0H 2GMTB 4CBNA 4P02A 2BD4A 2FOMB 1TX7A 4NFEA 2F9BH 1E1RD 1OXGA 1GBMA 4ISLA 2HNTF 2HVYB 2WV9A 4K8BA 4ZROA 4ABHA 1O2TA 4F49A 1SGPE 1S5SA 4NIYA 3OFND 1Y3YA 3W1EA 1ELTA 3BG4B 4NIXA 1KMHB 3A7TA 1GJBB 1TGTA 3E8LA 1OP0A 2ZC9H 1YYY1 3LONA 3VPKA 1GI6A 4QT8C 3F2FA 1O2XA 2BDIA 1CQQA 1NZQH 4ZKSU 5TCCA 1HJAB 1SQRA 1SI5H 1N8OC 2ANKH 3SO3A 3SNAA 3U28C 3ZVBA 5JYIA 1IAUA 3W95A 4RKOB 1EOLA 3SUEA 5DP9A 4B2AA 1SVPA 2PGQB 4J2YB 1W2KH 5A0CA 2P8OC 3K9XB 3QTOH 2CGAA 2FIRH 1UMAH 1Y5UT 1UVPA 1OOKB 4DT7B 4UFFH 2O8WA 3LGTA 1YCPH 1SB1H 4BTUB 1JWTA 2F4LA 1HDTH 1A0HB 1ANBA 3JZ1B 3SHCH 1FQ3A 5AF9H 5J4QA 3PLBA 2AEIH 2RDEA 1PJPA 1KLJH 1AWFH 4MNWA 4FU9A 2ZDLA 5HIZA 5EW2H 3A86A 3Q3KA 3P95A 3RXLA
chains in the Genus database with same CATH topology
3PLKA 1BIOA 2J34A 1P06A 1W14U 3ESTA 1MZAA 2QAAA 3V12A 1C5XB 4A1XA 1C5YB 1E35B 2XC0A 2HALA 2J95A 3T27A 2A2XH 3VB6A 1ORFA 4UDWH 1AVXA 1EAUA 2STBE 1EP6A 3F68H 5JBTA 1HJ8A 4GHQA 4XSKU 1GBBA 3QUMP 1KY9A 2QXGA 1BRBE 1F5RA 2G00A 1ELBA 4CR9A 3P8NA 2RA3A 1FZZA 2BLWA 1O3GA 1C1UH 2W7UA 3ZYDA 3EAJA 1K2I1 1QL8A 3MYWA 5JBAS 1ELCA 2ZTZA 3DHKH 1YBWA 3P70B 4INHA 4NCYA 2UUKB 1F7ZA 1T32A 1UHBB 5FBIA 1O2KA 1UTQA 2OXSA 3Q00A 3C27B 3D49H 1YCPK 2C8WB 4TY7A 2FWWA 2BD7A 1PPFE 2ZU2A 3DA9B 3PM3A 1O5CB 2XBVA 1QRXA 2ZGHA 4FVDA 3RXRA 4BAQB 2BDHA 1NRSH 1BJUA 3OTJE 4D9QA 5EPNA 3MU0A 3RM2H 4ISIH 3URCA 1IQNA 3AW1A 5GCHF 3V0XA 2FX6A 1G3EA 2BY9X 2B8OH 2ZF0H 2CN0H 1LQDB 3CENA 4JYVH 2XBWA 4Y76A 4GAWA 3G01A 1GJCB 1O3KA 4ZXYH 1UCYH 1XKBC 1QTFA 3JZ2B 3QGJA 4ZUHA 2VWLA 2XYAA 2BM2A 1GL0E 3PMHB 3SW2B 3LPRA 4ZKNU 1EAIA 3F9EA 4Y8YA 1XUIA 3P8GA 2SGFE 2GCTB 1XUJA 1ZYOA 3ZZDA 4B71A 2FOAA 2D1JA 2ANYA 1S0QA 3CS0A 3DFLA 4KP0A 4H6SB 2HOBA 2ALPA 2R0LA 2PTNA 1EJNA 4YM9A 1Z8RA 4LXBH 2XWBI 2GX4A 3RU4D 2GZ7A 4HFPB 3D62A 1MUEB 5EQRA 1HAHH 2ZIQH 1O31A 1LHCH 1ZTLA 4B1TA 1OPHB 1Z6EA 1L1JA 1MAYA 4YOJA 2C4FH 3SU2A 1HB0B 1TRMA 2ZGJA 3M3SA 4D76A 1EZUC 4X1RU 4IC5A 2Q6GA 4ISNA 1O2PA 2J4IA 1BMMH 2ZU1A 5IDKA 2JH5D 1C5QA 1GHBG 1ZRBA 1QB6A 1BRCE 1D3PB 1UTLM 4AFZA 6ESTA 1AMHA 1H1BA 3E91A 3P92A 2NU2E 1PPGE 1Y3UA 4RKJB 8GCHG 2ZHEH 1DX5M 1O37A 3ITIA 2ZDKA 3S9AA 2FI4E 3U8RH 5K0HA 2FO9A 1WTGH 3T62A 3O8BA 1C4U2 2OTVA 1L4ZA 3M5OA 1A3BH 4BAOB 5DJ7A 2WUBA 4NA8A 1UK3A 3U98H 3UIRA 1GBKA 1TGNA 1VITG 1FAXA 1DICA 1TGSZ 3HKIB 1IQGA 1HFDA 2VGCC 4DVAU 4E7RG 1O2LA 4WVPE 1UK2A 3A7XA 1HXEH 1XXFA 1G2LA 1QBVH 3AVZA 1M9UA 3MWIU 5HXFA 1VCPA 2ZA5A 2DE8A 1CHGA 4DY7B 5TCAA 1OS8A 2FOGA 1F5KU 3BV9B 2ZQ1A 2XXLA 3BF6H 3TK9A 2PW8H 3QN7A 3ZVDA 2KAIB 2ODQA 4HTCH 1NRNH 1O5FH 4KTSA 5DP3A 3A7ZA 2ZP0H 1O34A 3MU4A 2Z94A 3GY7A 3BTGE 1A0JA 1E36B 2QXJA 2PV9B 3ATKA 5GXPA 1DT2A 3RXKA 4ABBA 3P6ZB 1CU1A 3BTEE 3A88A 1O30A 3RXVA 4K60A 2XBYA 3PMBB 4WH6A 2I6QA 1MD8A 3KF2A 4Y7BA 6CHAC 1QY6A 2VIOA 5T6FA 2ZDAH 4IC6A 3LGUA 3MHWU 1LHDH 4K1EA 1FIZA 1QB1A 1C5OH 1O3DA 3VB5A 1QCPA 4I31A 3SUFA 1C2MA 1JIRA 2A2QH 1ESBA 1UCYE 2G51A 2EC9H 2OP9A 3FZZA 3FFGA 3E16B 3PROA 1QA7A 1O2HA 5CMXH 5BRRE 1V2MT 1C2JA 4YZUA 1V2KT 4FUIA 1T8LA 2B5TB 1K21H 1QA0A 2J2UA 3MNXA 2VIQA 1EZSC 1ZMJA 1HXFH 4MPXA 1XUGA 1BDAA 1BJVA 3SJOA 1JXPA 1A5IA 3KQCA 2P93A 1OWKA 4AGJA 2EEKA 3SZNA 2G4TA 3OX7U 2A4OA 2XCNA 2NWNA 2BHGA 2VIDA 1FAKH 2W7SA 4GHTA 1QL7A 1PYTD 4JZEH 3BTQE 3RXTA 1ELGA 4VGCB 3EYDA 2GD4B 1GJAB 1TNGA 1V2OT 1K9OE 3TJOA 4I33A 1P09A 2HRVA 2SGQE 1VGCB 3MTYA 1MU8B 1CE5A 3L33A 2F9NA 3BEUA 4GCHF 1C5TA 2QC2A 1DM4B 1T8NA 4Z6AH 4CREA 1FIWA 3LJJA 3VB7A 2RA0A 2OCVB 4INKA 1K1PA 1CHOG 3SUGA 1ELFA 3TH2H 2HVXA 3RXPA 1D3DB 4B2CA 9ESTA 1XKAC 2ZFPH 1GPZA 3PMAB 2F83A 4D7FA 1DXWA 1FNIA 1RJXB 1W0ZU 3HGNA 3M7UA 5FX5A 1K1NA 1OWHA 2BDGA 2BD9A 3E90B 3BG8A 1Y5BT 1MQ5A 1ELEE 1TE0A 2H2ZA 5HM2A 1V2LT 2W5EA 7GCHG 1LPGB 4AYVB 4CRCA 5TJXA 4PROA 1V2QT 5DP8A 3SV9A 6GCHF 2C93B 1OKXA 1RTKA 4BNRA 1RTFB 3PO1C 1BTHH 2THFB 2RCEA 3Q77A 3UR9A 1G3CA 1YM0A 4E06H 3MNBA 3T26A 4X2WA 1C5NH 3EDXB 2OC1A 1TAWA 1SGEE 2PSYA 1P11E 2BX4A 1FJSA 1F0UA 2FP7B 3GYLB 4BAHB 1UVOA 1AUTC 1F0SA 4I8KA 3MH4A 4ABGA 1L2EA 3RXHA 2H9HA 1AO5A 1SGYE 1YLDA 4JMYA 3NKKA 5C3NA 5E8EH 2Y81A 1TBZH 3SU6A 1QBNA 2O8UA 1YPLH 1FY4A 2WV5A 1W7GH 2A31A 5HMAA 4K69A 3SQHE 4E05H 3UOUA 3K2UA 3MI4A 2Z9JA 3A8CA 4YT7H 2BQ7B 1S83A 1GGDC 5LGOA 1NM6A 1T8OA 2OINA 1RIWC 2HNTC 2EA3A 3A7WA 2ZFQH 1GCTC 1K1OA 4X8TH 1TB6H 1UTNA 4H4FA 1G3DA 1PPZA 1MTVA 1Q31A 4A5TS 1AIXH 2ANWA 1SOZA 1O3NA 1GMHF 4YT6H 1W0YH 2TRMA 1HGTH 3M7TA 1XMNB 1TPPA 4X1PU 4NG9H 2FTLE 4YOIA 3RC4A 2FOCA 1AZZA 1PYTC 1GHWH 1QQ4A 3T2NA 1H8DH 2G81E 2VNTA 1U6QA 3GDUA 1FY3A 2AMDA 1GI1A 1Y3XA 2IN2A 4O3UA 3OU0A 2HPQH 1W7XH 1TYNA 4U32A 4CH8B 1K1MA 2BYAX 2GGVB 1FY1A 2HPPH 3R3GB 3SGQE 2AGIX 3H5CB 2PUQH 1IQIA 4K3JA 4Y79A 1WUNH 5AVDA 2H6MA 3QGNB 1NFWA 2V35A 1KXFA 2FOFA 1O2GH 3A8DA 4THNH 3PB1E 2GCHF 2D2DA 4JZFH 1JBUH 1L1NA 3GY2A 1O39A 5AHGH 4I8HA 4FU7A 1VJAU 4ASHA 1P05A 2K1QA 6LPRA 2BMGB 1F0TA 3KL6A 4ZKOU 1EUFA 3OY5U 5FPTA 1V2RT 5FCRA 4GUXA 1IHSH 1O3PB 1DLKB 1C5PA 2EI8A 1BHXB 3LGYA 2GT7A 2FYQA 1BRUP 1ETTH 3RMLH 3S7HB 2VB0A 1C1TA 3NCLA 5C20A 3SUDA 2P94A 5LPEA 1O0DH 1CT0E 2G52A 3GCOA 2SNVA 3HATH 1GDQA 1EATA 1WCZA 3A8BA 3MO9A 1SHHB 3TPIZ 1J14A 3HKJB 2VH6A 2QXHA 2UUYA 2UUFB 3UWJH 2ZHDA 3NK8A 3PTNA 1ZJDA 3EA8A 3RXBA 1C2EA 1WOFA 4IMQA 4CHAB 4E7NA 2ZTXA 5DGJA 3MMGA 4FU8A 2CHAB 1ZSKA 3ZVAA 4DCDA 4J1YA 5L6NH 2W3IA 1C9TA 3ZVFA 1C5MD 1GI8B 1OX1A 2ZNKH 1Z8JB 2CJIA 1TX8A 2R9PA 3FP8E 3RXEA 2Z3CA 1ID5H 1O36A 2ZPQA 1SL3A 1GBJA 1UTKA 2YNAA 2IOTA 3FZDA 1TMTH 1AE8H 1AZ8A 2ZKSA 1A0LA 1JOUB 3SJ9A 4ZHMU 3RXUA 1EP5A 3NPSA 3FP7E 3ZV9A 1AFEH 3RC5A 3VXEH 2OC7A 1C1NA 3GISB 5A8XA 1AFQB 5B6OA 4FUFA 1IQKA 4MQAA 2Z9LA 1PQ7A 2ZU3A 1QFKH 2TGTA 5ESTE 4HI3A 1Y3WA 2ZTYA 3UNRA 2BY8X 4H6TA 1BBRK 2ZO3H 4YLUA 3ZZ6A 3RMMH 1FI8A 1BMNH 1MZDA 1E37B 1ETRH 1UVTH 1GBTA 2FI5E 5A0BA 1NFYA 4DGJA 1NRPH 3AAVA 1THSH 4ZXXH 4B74A 1QL9A 3BTME 4NGAH 3SJ8A 1JRTA 2GZ9A 4DIHH 2AYWA 1AWHB 1O3LA 2CV3A 4R8TB 1LO6A 1F0RA 4LZ4B 3TK5A 4LOYH 4Y7AA 4BOHA 1S0RA 3VEQB 2WINI 2Z3DA 3Q76A 4JYUH 1TNLA 1N6YA 2ZHFH 4OS1A 5A8ZA 1N1LA 3V3MA 4BXSA 1CA0C 1CBWB 1O3BA 2CF8H 1O3MA 1IOEA 2ZHWH 1GHAF 2HNTE 1UVUH 3MFJA 2WV4A 2SGEE 2XWAA 1ZZZA 1Z7KA 2FEQH 2ALVA 3UPEA 1B7XB 5FXLA 3TH3H 1SQTA 1GI5A 2NU1E 1KXBA 1O2NA 4ESTE 1KLTA 1A2CH 4NSYA 3TJVA 1AI8H 1HBTH 8KME2 2GMTC 3F1SB 1KTTB 2GV7A 1JRSA 1ANDA 1A46H 1EAWA 3UNQA 3PTBA 3VB4A 1QJ7B 3GCNA 4FUCA 5HYOA 2BQWB 5JB9S 3I77A 1GJ4H 1VITH 3RLWH 5C67A 3A81A 3FP6E 1ACBE 2AMQA 2XNIA 3BG4C 2EI6A 3H7OA 2AFQB 4WXIA 1SBWA 1QNJA 1Z6JH 1Q3XA 2F3CE 2QCYA 1EJMA 1HIAB 1P3EA 5EXMA 3AW0A 1P12E 2QF3A 1BTXA 4ABEA 2A0QB 1D4PB 1W3CA 4KTCA 4X6NA 2JETB 4M7GA 1NFXA 1O2OA 2QN5T 2A45B 2F9UA 1NU7B 1C2KA 4H42U 2VIPA 5DPAA 3SU0A 1GMDF 1TNHA 1TONA 1P2JA 4X6MA 1ANCA 5C1UA 1A5GH 1ZMLA 3EGKH 3TNSA 3BTFE 4ABIA 1V2VT 1YPEH 5DG6A 1O5BB 1C9PA 2ZPRA 4ZMAH 4X6PA 4CRGA 4I8JA 2XBXA 1G32B 1GDUA 1DUEA 1GVZA 2ULLA 3STIA 4ABJA 2PHBA 1ZLRA 1ZSLA 3GY6A 4WMFA 5CHAB 4CH2B 3QX5H 1Z8IB 2ZFFH 1K1JA 3MH5A 2P3TB 5DP7A 1VZQH 3O8RA 1CGJE 1AB9B 5F03A 3TU7H 1V2TT 1EZXC 1W11U 1BHXF 2CMYA 3UOPA 5GCHG 1DDJA 1GG6B 1ZMNA 1H9IE 3LC3A 5FCKA 2D26C 4I8LA 1TOCB 1GHZA 1UJ1A 3PYHA 4HZHA 3M3VA 2HWLB 3GCTF 2W3KA 2TGDA 2UWOA 1O2MA 1TFXA 1CT4E 1HJ9A 3MNCA 1O3HA 4OS7A 1TALA 3FANA 5FHTA 1DXPA 4Z0KA 2AIPA 3BSQA 1GI7B 4WMDA 3ATMA 4FUHA 1SSXA 1XX9A 3GICB 1QJ1B 1UCYK 1Z8GA 1EOJA 2R3YA 1A5HA 5LPFA 2VINA 1QJ6B 1CGIE 2B9LA 1QHRB 2AS9A 1C5LH 4ABFA 1MU6B 3F9HA 1S85A 5EXLA 1NESE 4X6OA 3A87A 4AFSA 2LNCA 1GJ5H 2GV6A 2STAE 1OSSA 3U1IB 1J8AA 4IS5A 3I29A 1B5GH 1A1RA 1BA8B 1P10A 4X8VH 3SU1A 3GY5A 8ESTE 1DY8A 2QIQA 5AFYH 4LK4A 4UFEH 2XCFA 1O3EA 1GI9B 3LU9B 1D9IA 3MO6A 1C4V2 1GVLA 2BZ6H 1AN1E 1RFNA 2A7JA 1TBQH 2BB4A 1Y5AT 5F8ZA 1TBRH 1UHBA 2AGGX 1O3JA 3QDZB 1OP8A 5A09A 3M3TA 3TGKE 4IMZA 1A3EH 1WTHD 3EA7A 3SNCA 5GIBA 3SJIA 2FX4A 4CRDA 2ESTE 1MTWA 1ZPBA 3T28A 1KSNA 3MNSA 2GCTC 1C5VA 2ZPSA 1TIOA 4K5ZA 4MVNA 1MBMA 1CT2E 1LTOA 2ZDVH 3L3TA 3O8DA 3ZVGA 2PKAB 2DE9A 5A8YA 5EXNA 1YPMH 3GY4A 3T25A 1BTPA 1XUFA 1BT7A 4XBDA 1H4WA 2GDDA 4MG3A 1PPHE 4FUGA 3ZZ4A 1YP9A 2VVUA 1NPMA 4A7IB 1DUAA 3ATIA 5T6GA 3TJNA 8LPRA 2SFAA 2J9NA 2OC0A 3V13A 1TNJA 3OSYA 3E0NB 5DP5A 1CGHA 4JZIA 4XE4A 1MCVA 4FUJA 1CHOF 4XFQA 1G36A 1HAVB 4AGKA 1TGBA 4AN7A 3HGPA 1LVOA 3MO3A 1IQMA 1HCGA 4AOQA 5EU8A 3KQBA 4DG4A 2DUCA 1P2IA 1ZTKA 3FVFB 1YLCA 4XOJA 2RG3A 3LJOA 1MKWH 2ZHQH 5EQSA 4JZ1A 5L2YH 2G5NA 1Z71A 2BOKA 2BDCA 2VWOA 3D23A 1TRYA 1PQ8A 1AKSB 3URDA 4CRFA 3SN8A 1BTWA 1EZQA 1T4VH 1HRTH 3B9FH 4CR5A 1EQ9A 3TH4H 3RXOA 1HAGE 3UWIA 5ABWA 1QQUA 3SGBE 5E0GA 1IQLA 1GGDB 3P8FA 1C1MA 3GCHB 1GBLA 2O8TA 1KDQB 1FV9A 4NSVA 1GCTB 5J4SA 1C2LA 4A1TA 5DK1A 1EPTB 1LVYA 1ZR0A 1L1GA 2BXUH 1DOJA 2TIOA 4WXVA 1OYTH 3KN2A 1ZPZA 2C3SA 2AMPA 2BDYA 4NIVA 3AASA