1Z8RA

2a cysteine proteinase from human coxsackievirus b4 (strain jvb / benschoten / new york / 51)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
150
Chain Sequence
GPYGHQSGAVYVGNYKVVNRHLATHVDWQNCVWEDYNRDLLVSTTTAHGCDTIARCQCTTGVYFCASKSKHYPVSFEGPGLVEVQESEYYPKRYQSHVLLATGFSEPGDAGGILRCEHGVIGLVTMGGEGVVGFADVRDLLWLEDDAMEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus B4 polyprotein
publication title Structure and dynamics of coxsackievirus B4 2A proteinase, an enyzme involved in the etiology of heart disease.
pubmed doi rcsb
source organism Human coxsackievirus b4
molecule tags Hydrolase
total genus 24
structure length 150
sequence length 150
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA01
1ESAA 1MQ6A 1OS8A 4NA8A 5C5NA 6LPRA 4GVUA 3ZZAA 1C1MA 2FS8A 1VITG 4I8HA 4NA7A 3GCHB 1O2VA 1BTYA 4BANB 3NKKA 1CGJE 1O3NA 2ZDVH 1IQJA 3DFLA 1C9PA 2BQ7B 1K1JA 3MWIU 1W10U 2XRCA 3TNSA 3E91A 4GUXA 2CN0H 1UTNA 3GDUA 3QTVH 4OS4A 1VITH 4IBLH 2B9LA 1O3IA 2ZGHA 3A8AA 1WQVH 3DUXH 4ABHA 1JOUB 1ARBA 1KXBA 1ZGIA 3KF2A 4AOQA 2BDYA 7ESTE 1HFDA 1ZLRA 4NWLA 1G36A 3LJOA 1ZTLA 3ZYEA 1GBMA 3M36A 4OS6A 2BDCA 3UIRA 2GZ7A 1Z8IB 1UVUH 1VITF 2ZG0H 3BEUA 3Q3YA 1A4WH 1WTHD 5FAHA 1RFNA 2HALA 3RXTA 1EX3A 2IPHA 1EP6A 4GHTA 2BXUH 1TQ0B 4Y79A 2HWLB 3Q00A 1SGPE 5ESTE 1TGBA 1AE8H 1EAIA 1P2IA 1AE5A 2FOHA 4ZKRU 2R0LA 3KN2A 5L6NH 1EAUA 1HAZB 1O30A 2CV3A 5FBIA 4AFUA 4K5ZA 3DA9B 3VB4A 1HIAB 4MPVA 3SV6A 1NRRH 2AGEX 1C1NA 3RP2A 2OTVA 1XUFA 1ELGA 2ZHDA 2ZA5A 4AB8A 1SLUB 1VCQA 2H9HA 4X1RU 2GZ9A 3RMLH 1ELBA 2C3SA 1J16A 1QA7A 4UFDH 1LVMA 5ESBA 1NU9A 1IQFA 4AYYB 3RMNH 3TK6A 1L1GA 3FZZA 1KTTB 1O5AB 5K0HA 3PB1E 2BLQA 1N1LA 2RDLA 4ZUHA 1GDNA 1P03A 1DLEA 4AB9A 1O3DA 3VGCC 1S6FA 1GBAA 1G3DA 1ZZZA 5GXPA 3RU4T 1CA0C 1QQUA 2FOGA 4IMZA 3RM2H 1PYTD 1YPHC 2CMYA 5CHAB 3K6YA 4B2CA 2QY0B 2FI3E 1FPCH 4HI3A 3B9FH 2VIQA 1V2WT 2FX6A 4CRBA 1O32A 5HM2A 3VXFH 2BM2A 2K1QA 3SU1A 3U8RH 2BDBA 1C2KA 3M37A 3FP7E 3GYMA 2FMJA 1CA0B 1ARCA 1SGYE 3G01A 4AX9H 3LH1A 3QWCH 1LHGH 4MPUA 3Q76A 1HBTH 1UTKA 1H4WA 4H42U 4OS2A 1DS2E 2A2XH 1TLDA 4OS5A 3P8GA 2ZKSA 3BTKE 4ISNA 3VEQB 3A80A 3AW0A 2P94A 2KAIA 3M61U 1DDJA 1LHEH 1LO6A 2A5AA 1F0UA 1UTQA 5L2ZH 2GKVE 1YF4A 1UHBB 1P0SH 4WVPE 1G37A 1GVLA 2B0FA 3H7TA 2NWNA 2O8LA 4ISIH 4OS7A 4Y11E 2R3UA 3LGUA 4MPXA 3SI4H 2ZPQA 3BSQA 1P2QA 1NM6A 4ASHA 1GL0E 4A1XA 1DT2A 1QY6A 5FBEA 3QK1A 3RXOA 4AGJA 1N6XA 3M3TA 1EPTA 4ABBA 1VZQH 2VIVA 3MI4A 3M7UA 1BTHH 2ANWA 2A4QA 3ZVEA 5GPIB 3MNXA 4NIVA 1GHAG 2VGCB 5ETXA 2SGAA 2Q6DA 3LGYA 4Z0KA 1C2IA 1FDPA 4IGDA 1H8DH 4KKDA 6ESTA 1TBZH 1INCA 1QL7A 1TGSZ 1SPJA 1Y59T 1L4ZA 3ENSB 3RXEA 1C1QA 2ZHEH 1ZHPA 4ZXXH 1KXEA 5A0BA 1K1MA 3F9HA 1ELEE 2R2MB 4A5TS 1MTWA 1WQSA 3A8DA 1L2EA 1GWAA 3SW2B 3PV4A 3MH4A 3O8BA 4FUEA 1TMUH 1XXDA 2BY7X 1T4UH 3VB5A 3MU1A 1Y3XA 1AVGH 1EB1H 4ESTE 4BAMB 3UQVA 1GMHG 2A32A 1CSOE 3HKJB 5T3HA 4R8TB 3BTHE 2XXLA 1O3CA 3ESTA 3PWCA 1GJ6A 4LZ1H 1F5RA 3IITA 4DY7B 5EG4A 4BTUB 4J1YA 2GZ8A 3GCOA 1UVSH 1X7AC 2XCNA 4INHA 5DJ7A 1XVOA 2AIPA 3HK3B 1Y3UA 3LC3A 1QL9A 1TBRH 2PGBB 4YESB 3LH3A 3E8LA 3MH5A 3OU0A 3MH6A 3UTUH 2QF3A 2Y7XA 1IQLA 2OXSA 4X6MA 1O2KA 3LGTA 5SGAE 3TPIZ 2J9NA 4NIXA 1ELVA 5C1UA 2VJ1A 1GBLA 4CR9A 2G4TA 1O2JA 1AZZA 2Y81A 4INLA 2UWOA 3STJA 2ANMH 3I77A 1FONA 1GMHF 5GIBA 4CBNA 3IWMA 5A8XA 3TH2H 5A0AE 3EA7A 1AUJA 2ODYB 1OKXA 1P06A 5DKMA 3W94A 1IQEA 1O2YA 3PROA 1OX1A 4X8TH 1T8MA 1W13U 2F9UA 2ZU4A 4YO9A 1CHGA 1O3EA 2VWMA 1TNIA 2V0BA 4DOQA 1GI8B 2QAAA 2Z3EA 3BTQE 3AW1A 5F03A 4MNVA 1BITA 3ATWA 1XUHA 4BTIB 1ELDE 1TX8A 1BT7A 1O3KA 2Z9JA 1A5GH 2BY9X 3P8FA 4UONA 1TRYA 2FPZA 1ELTA 2C8XB 1AFEH 4NIYA 3ATIA 3Q3KA 1VGCB 1EASA 1O3HA 1ZGVA 1KTSB 2UUKB 4Y8YA 1K1LA 2ZTXA 1KY9A 1BHXF 2Z9LA 5FCKA 1SGFA 1C5XB 1C5ZB 2DE8A 3OX7U 3P17H 3MOCA 4LZ4B 1OP8A 4YTAA 2Z3CA 3AAUA 1QJ7B 2GVFA 4YOGA 1KDQA 2ZDAH 1O2GH 3EE0B 1FY4A 3HPTB 4HGCA 1TABE 2BD8A 1O3FA 1C5TA 1BZXE 1L4DA 4DG4A 2BDGA 1TOMH 3UNQA 2QA9E 4JYUH 5J4SA 1C9TA 1MBQA 3UQOA 4KGAA 2XTTB 4ISLA 2ZHQH 4ABEA 1OWKA 2I6SA 5CMXH 3ELAH 3QLPH 2QN5T 4WMEA 2FDAA 2PTNA 3A89A 3LGWA 3RMOH 1GBIA 2H5DA 2OUAA 2ZGCA 1W14U 2A4GA 1FN6A 1SHYA 4BAHB 1K1NA 4MTBA 1TGTA 2FXRA 3PTNA 3TVJB 5C1YA 1T32A 1AB9B 3GY8A 1GI4A 3HATH 1YCPH 3T5FH 1LMWB 1QB1A 1C5QA 1Z1JA 5I46H 3SOSA 4X1SU 1UK3A 2THFB 4B1TA 5L30H 5EQSA 1P2JA 1XUJA 2HGTH 2FO9A 1SFQB 1F7ZA 3F1SB 3RLWH 1HAVA 1TNKA 3BN9A 3S7KB 3SNBA 2ZU3A 4CRCA 5JBBS 1DITH 1LTOA 4JZIA 4WY3A 3LC5A 3SJ9A 1HLTH 1NROH 2ZCKP 1FAKH 2ZQ2A 5DO4H 1BOQA 3RXBA 1CVWH 3ODDA 1GCDA 2VU8E 3QGNB 1GHBG 1C2FA 1RIWB 1KYNA 2C8YB 1QBOA 2R0KA 1NRQH 1CQQA 5JBTA 4I8GA 2BQWB 1OPHB 2Z7FE 4DW2U 2VNTA 3KQEA 4IS5A 1DVAH 1MU8B 2QYIA 1D3QB 2A4RA 5C3NA 1PQ8A 1JWTA 2OC1A 2FI4E 4MLFB 1AI8H 2PKAA 1DLKB 2P16A 1B5GH 5C2ZA 2V3OH 1P2NA 1TQ7B 2VIDA 4JMYA 2G5NA 1QJ6B 2GMTB 1FLEE 2QXIA 3A7YA 3PWBA 1OOKB 2OC7A 2QIQA 2ZWLH 4WXIA 3PM3A 3SJOA 1MTUA 3TGIE 1O39A 1V2OT 1GHBF 5C5OA 5DP5A 1GHVH 4LOYH 5GJ4B 1SR5C 3P70B 1TPSA 2ZC9H 4Z6AH 2VIWA 2OBQA 4K1EA 5EU8A 2HRVA 1C5VA 3M7TA 4K60A 1O3BA 1ZPBA 3RC4A 1NT1A 1F5KU 1YGCH 2ZHWH 1AGJA 1TA6A 3T26A 2FODA 4E7RG 2P3FH 2W3IA 2GV6A 4AZ2B 3GDVA 2H9TH 4Y8XA 3U98H 1CHOG 1CO7E 1KLIH 5HGGA 2GCTC 4UFEH 1C1UH 3KL6A 3SGQE 4E05H 1MTVA 1ABIH 1O2RA 5FPTA 3GY4A 1EJNA 4DURA 1RJXB 1SB1H 4XSKU 3ZV9A 1NRSH 3F9EA 1O38A 3STIA 1Y3VA 1A46H 1HXFH 2J95A 3RXKA 3RLYH 2GCTB 1ETTH 4U01A 1P9UA 1H9IE 3P95A 2BY8X 3RXPA 1SLVB 4Y10E 8GCHG 2VVVA 2H2ZA 2WV5A 2XBWA 1TPAE 4Q7YA 2ULLA 3A7VA 4GHQA 1YCPK 1ZJKA 3EA9A 4JZDH 4OS1A 3SUGA 1W7XH 3KNXA 1MBMA 1HUTH 2CHAC 3QUMP 2PGQB 4ISHH 2FM2A 3FFGA 1NC6A 1NN6A 2J4IA 4ZHMU 3SU0A 3HGPA 1AO5A 1CHOF 4I32A 3D49H 3M5NA 3RXHA 1QBNA 2VIOA 2AGGX 1NO9H 2LPRA 2VWNA 1QR3E 1ETSH 1UTOA 1RTFB 2F3CE 3OY6U 3D65E 4ZMAH 3SGAE 3SUFA 2TGPZ 1PQAA 1C2DA 8GCHF 3UPEA 2V3HH 5DP8A 3U9AH 1P09A 3LDXH 1QFKH 5FHTA 1DFPA 3QZRA 2XC0A 3EGKH 1KIGH 1ZMJA 4GSOA 2ZEBA 3TH4H 1QB9A 2BOHB 1LKAA 2TGAA 1CA8B 2A2QH 1GI5A 2ASUB 1HDTH 4X2WA 8ESTE 2A7JA 1E38B 2Z3DA 3SU6A 2BD3A 3SNAA 3B8JA 3GCHC 3SHCH 2CGAA 1C2GA 4XBBA 2GP9B 1O3OA 5FX5A 2PW8H 2ZFRH 1A0HB 1GDQA 2HNTC 1P01A 4B2AA 4BOHA 4AN7A 3BF6H 4H4FA 4JZ1A 3S9BA 2RA3A 5FPYA 4CR5A 2LNCA 3ZZ6A 3LOXA 2FTLE 2WPIS 4UE7H 3ZZ3A 2BVXH 4MQAA 4ZH8A 4X2XA 1O5BB 3RM0H 3SUDA 4K69A 1ELAA 1HXEH 1FJSA 1BJUA 1XKAC 1HAXB 3P6ZB 5DP3A 1MKXH 2WINI 3L3TA 1H1BA 1SG8B 2ZFPH 3I29A 1MD8A 3F68H 1JMOH 3NK8A 2F9BH 2BD7A 3A7ZA 2Y7ZA 3PLBA 4D8NA 1P11E 1C1VH 2PUXB 1QJ1B 2A4OA 4MNYA 1GI7B 2AERH 3FANA 3TK9A 1EQ9A 3UY9A 4X2VA 1LVBA 1QL8A 1TGNA 2A7HA 3A8CA 3V3MA 2J2UA 4M7GA 2VH0A 1DANH 1V2MT 2SGFE 2P59A 2ZNKH 4O9VA 1V2JT 1TOCB 1G2LA 2R2WU 3ZZDA 3JZ1B 3OTJE 1PFXC 4TPIZ 2BLVA 4AORA 1SGNE 1GBBA 4O3TA 1IHSH 2BD9A 4TY6A 1O3AA 1CGHA 4FU7A 2BDAA 5A0CA 3ZVBA 4DCDA 2B7DH 4X0WU 5JB8S 1DOJA 1EZUC 1UK4A 1FY8E 4YT7H 1W11U 1AKSB 1D6WA 2P8OC 1FIWA 3UOPA 3BTEE 2ZECA 5C1XA 3KIDU 1EOJA 1MAYA 1O2ZA 3SQEE 1ELFA 4B71A 1HPGA 1A7SA 1O2MA 2FZZA 1GGDB 5CHAC 2P8OB 5A2MH 1MZAA 4IMQA 3FP8E 3MO6A 1PPCE 2PKSC 2BLOA 3SU3A 2A7CA 1YC0A 3HKIB 1AWFH 3E16B 2QV1A 2W26A 2JETB 2G55A 1C5PA 1A1RA 2DUCA 4DT7B 1AMHA 2G51A 2PKSB 2STBE 1G3CA 1YBWA 1IQIA 1QHRB 1GJ4H 3D23A 1GJDB 2ZF0H 1P8VC 2HNTE 2QXJA 1O33A 1YYY1 4X8UH 3BG4C 1BBRH 3SI3H 3TH3H 1BTZA 3T2NA 1EB2A 4RKJB 1SSXA 3NXPA 4FUDA 2HPPH 2Y80A 3LGVA 4X8VH 3UR9A 1LQEA 1O37A 1GJAB 4Y8ZA 3BG4B 1C1SA 5A8ZA 1MKXK 1FV9A 1ID5H 1RTLA 2FEQH 5EOKA 1OP0A 3GYLB 4AG2A 1TONA 4X1QU 1HRTH 4Y7BA 1DY9A 1V2NT 2VGCC 4DVAU 1IQKA 1W12U 3WY8A 2AFQB 2BX4A 3HGNA 1DE7H 1GI3A 3T62A 4AFQA 4MVNA 4X6OA 1LHFH 1Z6JH 3ZVDA 3MFJA 1E37B 5JBAS 1RD3B 1FZZA 2WV4A 1GVZA 2AYWA 2V35A 4RSPA 1FY1A 3ZZ5A 3SQHE 4HZHA 1GBCA 1T31A 1V2UT 1Y3YA 3V12A 2XYAA 1UVTH 2H9EH 2O8MA 1SLWB 5C67A 1SL3A 1AVXA 1UCYH 3KHVA 2PLXA 1TBQH 4WH8A 1ETRH 1UTMA 3LIWA 2BZAA 1ZTKA 5ABWA 3ZZ4A 1Y3WA 3E6PH 1YLDA 1S0RA 4VGCB 5TCAA 1PPEE 3FZDA 3KGPA 1NFUA 5G4BA 2AGIX 3S7HB 1DWDH 2Y82A 3SJ8A 3TNTA 4TYDA 3MTYA 1T7CA 2ZO3H 1LCYA 1QCPA 1G32B 1VCPA 1P04A 2A5IA 4KTCA 2BXTH 1SGFG 3BV9B 5GCHG 4CRFA 1SGEE 1V2RT 2QF0A 2QXGA 3I78A 1GJCB 2BD4A 1G3EA 4J2YB 5F6MA 1O3LA 2EA3A 5A09A 1WAYB 1NZQH 3MMGA 1O5EH 3EAJA 1QTFA 5F8XA 3ZVGA 1ZR0A 2BQ6B 5LPFA 2TPIZ 1HJ9A 2AEIH 1HAGE 2O9QA 1AY6H 2D1JA 3A84A 3O8DA 4THNH 4RN6A 3DD2H 3N7OA 3PYHA 1KXAA 4NZLA 4DGJA 5EODA 1VGCC 4GCHF 3OY5U 1YLCA 4TPYA 5HMAA 1IOEA 1GDUA 1THRH 1TNGA 3MO9A 2C93B 5EXLA 3UFAA 2UWPA 3AASA 5GCHF 1O2HA 3EQ0H 1EUFA 1O5CB 1S82A 1F5LA 5B6OA 5EPYA 1YPLH 4DIIH 4UFFH 3RXCA 3ITIA 1YP9A 4D9RA 1K9OE 3RXGA 1AIXH 5JBCS 4Y71A 4BNRA 3NUMA 4K3JA 1UVPA 1Z71A 1BMMH 1C1OA 2J92A 1BRCE 1KXDA 2IN2A 3UNSA 3MU8A 4JK5A 5T6GA 1MD7A 1HAPH 1WBGB 2WPJS 1KXFA 2ZCLP 3F6UH 2EI8A 1DSUA 4XBCA 3H5CB 2EI7A 3DT0H 1DPOA 1SBWA 3RXAA 4D76A 1O2QA 2O8UA 4A6LA 1ESTA 1A5IA 2KAIB 1SQOA 4OGYA 3GY3A 1GJBB 1DWCH 1HAYB 5BPEA 4SGBE 1BMLA 2M5TA 2XBYA 1MU6B 4IN2A 3SHAH 3MNCA 1O2WA 3BIUH 3RXJA 1C5UA 1BCUH 1AB9C 1K1PA 1QURH 1TPOA 2NU1E 4O03A 2XNIA 1LPGB 3F9GA 3EDXB 2I6QA 5JYIA 1FY5A 3M3SA 3SNEA 5HYOA 3A81A 2ZTZA 3RXDA 4XDEA 1HYLA 3KQCA 1EPTB 4FUCA 3FP6E 1FMGA 1RTKA 1V2LT 3RU4E 9LPRA 4NSYA 6GCHG 3UREA 1GI2A 4UD9H 5AFZH 5A8YA 4Q7XA 3CP7A 3R3GB 1P2KA 4JCNA 3VB3A 2ILNA 1ANDA 2W3KA 1DWEH 1MZDA 2GDDA 3AAVA 1KSNA 1PJPA 5AVDA 2VINA 3RDZA 3TGJE 2CF8H 3ZZ8A 3SBKA 1F0TA 2FOBA 3MO3A 1RIWC 1P3EA 2JH6D 1SGQE 1UTJA 2J94A 1OSSA 1D6RA 4E06H 2O8TA 2Y5GA 1CGIE 5EW2H 1FNIA 2OP9A 3M5OA 2PFEA 3PLKA 1SQAA 2C8ZB 1A61H 2BDHA 4ZKNU 2GCHG 1XUIA 4ZHLU 2FLRH 3P8NA 6GCHF 4ISOA 3BG8A 2AH4X 2AMDA 4NSVA 1S5SA 4X6NA 1WTGH 2ZFFH 1GG6C 4Y76A 3S9AA 4TWYA 2GT8A 1VCWA 1RGQA 1O3MA 1SVPA 3QZQA 3UWIA 3SV2H 2GMTC 3FVFB 1O3JA 1EJAA 2ANYA 3IG6B 3UNRA 4IC6A 1PQ5A 1AZ8A 1C2HA 1GG6B 4PROA 3RXSA 5JB9S 1J8AA 4AG1A 1TYNA 5IYTA 2P3TB 1RS0A 1SOTA 1OWEA 3QTOH 1UTPA 3RXVA 1A0JA 2FS9A 4K1TA 3RC6A 3AVZA 2B5TB 1BA8B 3A8BA 3CENA 9ESTA 1C2JA 2ZPRA 1SHHB 2GCHF 3ODFA 2Y6TA 1OWJA 4I33A 3GCNA 2XW9A 3V7TA 1JRTA 1TE0A 2Y5FA 1TWXB 3LU9B 1THSH 1AFQB 1WV7H 4F49A 4X1PU 1NFYA 3OSYA 4JZFH 1DUEA 1QA0A 1AN1E 4B75A 3ZZ9A 1BTPA 1YKTA 1Q3XA 1NESE 1DM4B 1DY8A 1ZMLA 1C1TA 1P12E 3ZZBA 2ZGBH 3RXRA 4WWYA 1LVOA 2ZQ1A 4RKOB 1QGFA 1XM1A 3BTGE 2G00A 5DP6A 2Q1JA 1V2KT 1JBUH 1BTUA 1GCTC 5EQQA 2ZPSA 5LGOA 3RMMH 3BTDE 3D62A 1XX9A 1ANBA 2C8WB 1BJVA 1KDQB 2B8OH 4HFPB 1EZQA 4A1VA 5EGMA 1BHXB 1GBKA 5T6FA 1HIAA 1GCTB 4A92A 3L33A 3TU7H 2OC0A 1NFWA 1MMJN 3ZV8A 2JH0D 3CS0A 3O8CA 2F9OA 1AKSA 2UUJB 3RC5A 1MCTA 1XXFA 2F91A 1TX7A 2XCFA 4GLYA 1QQ4A 2H1UA 2ZIQH 4MNWA 4FUFA 3E3TA 1P05A 5FCRA 1BMAA 4BXSA 4XFQA 4GPGA 4FUHA 1FIZA 1JXPA 4K8YA 1EAXA 1ZSKA 5LPRA 1O2LA 1BIOA 2FYQA 1O5FH 2ALPA 5I25A 3ZVAA 1O35A 2HLCA 4X1NU 7KMEH 1O3PB 1TFXA 1AWHB 3NPSA 1MUEB 1Z6EA 2F9PA 3GCTG 1GBFA 4U32A 3A88A 1V6DA 1NY22 2QXHA 2R3YA 4CBOA 5BRRE 1HAVB 1O5GH 2W7SA 2XBVA 2WPMS 1DWBH 1AQ7A 2DE9A 4MDSA 1DSTA 1GI0A 1GHYH 1B0EA 1WOFA 5JDUB 4FU9A 1TMTH 3M3VA 3T27A 3TIUA 1MKWH 4ABFA 1GMCG 1E36B 4AYVB 1DUAA 3SJKA 4R0IA 1ZSJA 4NFEA 1ORFA 1K28D 3E90B 3NWUA 3ZVFA 1J17T 3BEIB 3LONA 1YM0A 5E0JA 4IN1A 1THPB 1UHBA 3MHWU 1OP2A 5E2PA 3DHKH 3GCTF 1ZHRA 3PMBB 5DGJA 2ZI2H 1YPKH 2P93A 1LVYA 3DFJA 1DICA 4D7GA 2PKAB 1HCGA 2Q6FA 1FUJA 2TRMA 1CU1A 3RXLA 1MAXA 1JIMA 1XKBC 1YPEH 2BOKA 3JZ2B 1G2MA 3U8TH 1GMCF 3SJIA 1O36A 1AD8H 1OWHA 2CJIA 3MU4A 4B73A 1HV7A 1QNJA 2ODPA 1C1WH 1C1RA 2AMPA 4XOJA 1ZOMA 3SO3A 1P3CA 2NU2E 1P9SA 2GDEH 4JYVH 2BMGB 1V2TT 2XC5A 1F92A 3RXQA 3EA8A 2TBSA 2VIPA 4CHAC 1M9UA 2ZCHP 4H6SB 1LDTT 3MYWA 3P8OA 2GD4B 2IOTA 3M7QA 1OXGA 3SN8A 2XWAA 3SU4A 3TLOA 4JK6A 3VFEA 1TB6H 2FYRA 2TIOA 1S0QA 4NWKA 2VVUA 1AHTH 4MPWA 2YNAA 1P2MA 2BB4A 3PMHB 4CHAB 1VJ9U 1UJ1A 1CBWC 4INKA 3BTME 5FPSA 4B76A 1GMDG 1T8LA 4ABGA 1GJ7B 2BVSH 4YOJA 1ZPCA 1ZSLA 2ODQA 2J34A 3L6PA 5GDSH 1IQNA 2IJOB 3GY6A 1GGDC 2W5EA 1Y8TA 2BTCE 4CH2B 1D3TB 7GCHG 1CBWB 4DIHH 3URCA 2Z9KA 3GICB 1KXCA 2R9PA 2ZHFH 3QX5H 4WXVA 5EXNA 2PWXA 1A0LA 1EZXC 1VJAU 2EC9H 2QGRA 2ZFSA 2OBOA 3ZZ7A 2JETC 5H4IB 1KLJH 1XMNB 1BTXA 2V6NA 4D7FA 2O8WA 1LPZB 1L0ZA 5E0HA 1GI6A 2PSXA 1D3DB 2SGPE 1GMDF 2VH6A 2WUBA 2UUYA 1C5NH 4FXGH 5K7RA 2JH5D 1OWDA 3NZIA 3VPKA 2Y5HA 1UVOA 3A85A 4WF8A 1IHTH 3O8RA 4X6PA 1J9CH 4DJZB 1MKWK 1W0ZU 1NRPH 7GCHF 4ZHAA 5DPAA 3ZYDA 3BEFB 5AFYH 3A83A 2D26C 1AVWA 1T8NA 1S84A 2Z94A 1O2IA 1ZMNA 1W0YH 1N6YA 3SNDA 1GVKB 1O3GA 5EQRA 1SGIB 5LPEA 4I7YH 2ZFQH 4WMDA 1UK2A 2WPLS 1P57B 2BLWA 4Y6DA 1GJ5H 5DG6A 1P02A 1NS3A 4FUGA 2FOFA 4GAWA 1F2SE 1GBTA 1C5SA 4IW4E 3BIVH 3VGCB 1ELCA 4ABJA 1UMAH 1H9LB 4XE4A 1G3BA 1LPKB 1O2OA 1NPMA 2FWWA 3A7XA 3KQDA 1ABJH 1N8OC 6CHAC 2FP7B 3K6ZA 4JYTA 4KTSA 1GI9B 4UFGH 4I31A 5C20A 3ZZCA 1GI1A 1Z7KA 2BY6X 5TCCA 4A7IB 3RUOA 2C90B 3PMJA 3T25A 1O31A 1A3BH 4Y0YE 2ANKH 3RXUA 2VB0A 4NZQA 5DP7A 1N8OB 6CHAB 1Z8RA 2NU4E 4ABAA 1QRXA 2NU0E 2SFAA 2PHBA 2ZGJA 4B2BA 2WUCA 1YPGH 2OQ5A 4BAKB 2OCVB 5F8ZA 3GY2A 2SNWA 2GTBA 4F4OC 1F0SA 1TRNA 1QBVH 3QN7A 3P92A 8KME2 1W3CA 1TPPA 1CT0E 1O34A 1XUGA 5DP4A 4VGCC 2G4UA 2ZTYA 3LT3A 4X2YA 1K21H 1WYKA 2EEKA 1WSSH 4O97A 2A1DB 4Q80A 1JRSA 3VB6A 2XWBI 3S69A 2VWLA 5EW1H 1SGRE 4XBDA 3U8OH 1CT4E 3BTWE 4AGKA 3SU5A 1Y5AT 4K2YA 3TJNA 3A82A 2YOLA 2ESTE 1O2SA 1FXYA 4WJG2 2H5CA 1IQGA 1CE5A 2FX4A 4YLQH 4GCHG 3PO1C 2ALVA 2WPKS 3M5LA 4BAOB 1H9HE 4NIWA 1BQYA 1SGCA 1C5OH 2VVCA 3K9XB 4BTTB 4YLUA 3W95A 1O2TA 1ZTJA 1GBHA 1GBJA 3TJOA 1EATA 3LGIA 2ZFTA 1V2QT 1GHAF 2FOEA 3UR6A 2JKHA 3PO1B 1QIXB 3LJJA 4A1TA 4KELA 3RXMA 3A7WA 1GPZA 4YM9A 1ZJDA 3EYDA 2ZGXH 4QT8C 1K2I1 1C5YB 4O3UA 4IC5A 1IQMA 3KQBA 4WMFA 4FVDA 1P10A 5AF9H 1DXWA 1BRBE 1EZSC 2ZDMA 3A86A 1BBRK 2A31A 1Y5UT 4ZKSU 3OYPA 1YPHE 1T4VH 2BYAX 4ZXYH 3TJUA 2ZU1A 1MTNC 1AUTC 3FAOA 3SU2A 3C1KA 1V2VT 3VXEH 3U1JB 4ABDA 1TA2A 3PTBA 3E0NB 4I8KA 3ZVCA 1TGCA 1TIOA 1S85A 1TRMA 1MTNB 3URDA 2STAE 1EKBB 1D4PB 3B23B 4YOIA 4I8JA 2GT7A 4H6TA 2XC4A 1O2PA 1L1NA 1SOZA 1TMBH 2BVRH 1G9IE 1ACBE 2AMQA 4FUBA 3LKWA 1FY3A 3T28A 1C1PA 1JIRA 4FVBA 2BX3A 2UWLA 1K22H 4CH8B 1C2EA 5T6DA 1NFXA 1C4Y2 4NCYA 1UO6A 2FI5E 5EPNA 2BDIA 3GISB 4ZROA 1EPTC 1Q2WA 4HTCH 1NU7B 1GBDA 5TJXA 3GY5A 2GX4A 1C5WB 1BDAA 1OWIA 2FLBH 2QCYA 3SV9A 4SGAE 4MG3A 1W7GH 2SGEE 1EJMA 1LHDH 3UWJH 1QRZA 1UCYK 1GBEA 1TNJA 2YNBA 1Z8GA 2OINA 2ZDKA 3LPRA 4FUIA 2BY5X 4LXBH 1O2XA 4UDWH 5L2YH 1EP5A 1SGDE 1TNLA 1BMNH 5AHGH 5FXLA 2WPHS 3GY7A 1HB0B 2FIRH 1FQ3A 1H8IH 3SV7A 3A7TA 1U6QA 2Q6GA 1VR1H 3U1IB 2XBXA 2GGVB 2GV7A 4I8LA 2QC2A 1FAXA 3PLPA 3MU0A 4TY7A 2PUQH 3ATKA 1WUNH 1MTSA 4WH6A 2D8WA 4BAQB 5IDKA 1C5LH 5PTPA 4X8SH 1XUKA 1KLTA 3ATLA 1EOLA 4OGXA 3TK5A 1EXFA 1FPHH 1WU1A 1MQ5A 4ABIA 1C2MA 4MNXA 4NFFA 1NRNH 4Y7AA 1G30B 2BD5A 3QGJA 2WYGA 3QDZB 2EI6A 1PPBH 5FX6A 3SZNA 2A0QB 4U2WA 2A45B 1ZRBA 2W7UA 1YPMH 2BZ6H 1PPZA 4U30A 3RU4D 1C4U2 3TITA 2G5VA 1GHWH 3MNBA 3QO6A 1V2ST 1OYTH 1HJAC 2PSYA 3NCLA 1IAUA 3CS7A 2OQUA 4BXWA 1O5DH 1GJ8B 1ZPZA 2HNTF 2ZDNA 5GWZA 1SLXB 2D2DA 4FU8A 1C5MD 4CREA 3S9CA 4JZEH 1E35B 3H7OA 3E1XB 1HGTH 3SV8A 1AFQC 3F9FA 5HM9A 1HJAB 2RG3A 1GHZA 2Z6BD 5E8EH 3RXIA 1TAWA 2G8TA 2PV9B 1FI8A 1HAIH 2SGDE 4Q7ZA 1LQDB 2F83A 2SNVA 5LH8A 1TX6A 1SFIA 3K65B 4ZKOU 2G52A 1ANCA 1ZYOA 1BRAA 5E2OA 1J15A 1GJ9B 3E0PB 3SNCA 5JPMH 1QB6A 3KCGH 1J14A 3SGBE 1F0RA 1LHCH 1SC8U 1K1OA 5F8TA 1PPHE 4CRAA 1L1JA 2ZDLA 2H6MA 2P95A 2VWOA 3UOUA 4K1SA 4NGAH 5E0GA 1GHXH 1BUIA 2ZZUH 1LKBA 2UUFB 1SI5H 2CXVA 3U69H 4FUJA 1ZRKA 1CT2E 1OYQA 3MNSA 3V13A 2OC8A 2G81E 1BRUP 3UUZA 1A2CH 1HAHH 2WYJA 3VB7A 2AIQA 1V2PT 3PMAB 1O2UA 1O2NA 2TGDA 3BTFE 2P3UB 2ZU5A 5DP9A 2RCEA 1D3PB 1BBRE 1T8OA 5DK1A 3Q77A 2PTCE 1WCZA 2J38A 4CRDA 3R0FA 4B74A 1RXPA 1B7XB 4NA9H 4K8BA 1FN8A 2CF9H 2OD3B 2BD2A 1TNHA 2HOBA 3SORA 4KP0A 5CE1A 1W2KH 5EXMA 1HAOH 1ANEA 1Z8JB 4Y0ZE 1A3EH 7LPRA 2SGQE 3T29A 2F9VA 1E34B 1HJ8A 1D9IA 3KEEA 4NG9H 3M35A 3TGKE 1PPFE 4AFZA 5J4QA 4TWWA 1BB0B 1Y5BT 1QRWA 2ZU2A 3GOVB 4AFSA 2C4FH 8LPRA 3K2UA 2BHGA 1AU8A 3V0XA 2HVXA 3S0NA 1A5HA 4YZUA 1PYTC 2FOAA 2Z9IA 1YCPM 4ZAEA 1RRKA 2FOCA 1SGTA 4UEHH 1S6HA 1SMFE 1Z1IA 1S83A 2TGTA 2AS9A 3SUEA 1S81A 4LK4A 3RXFA 2FTMA 3MU5A 3Q3XA 1MCVA 2FOMB 2NU3E 2RA0A 3TJVA 2CHAB 3BTTE 1BTWA 1UCYE 1DX5M 1EAWA 1DXPA 1W8BH 4Q2KA 1E0FD 2PR3A 4D9QA 1P2OA 1IQHA 2HPQH 3HK6B 1Q31A 3M5MA 5HXFA 1PPGE 1NTPA 1O0DH 2ZP0H 3MH7A 1C5RA 3GDSA 1PQ7A 4CRGA 1MH0A 4KTUA 3ATMA 1V3XA 1B0FA 2OLGA 1XVMA 1ESBA 1GL1A 3A87A 1HNEE 1UTLM 1K1IA 1TALA 1YPJH 2A5KA 2FESH 1C4V2 3C27B 1SQTA 4E7NA 1C2LA 2F9NA 4YT6H 2Z9GA 1ZHMA
chains in the Genus database with same CATH superfamily
1ESAA 1MQ6A 1OS8A 4NA8A 5C5NA 6LPRA 4GVUA 3ZZAA 1YY3A 1C1MA 2FS8A 1VITG 4I8HA 4NA7A 3GCHB 1O2VA 1BTYA 4BANB 3NKKA 1CGJE 1O3NA 2ZDVH 3SZEA 1IQJA 3DFLA 1C9PA 2BQ7B 1K1JA 3MWIU 1W10U 2XRCA 3TNSA 3E91A 4GUXA 2CN0H 1UTNA 3GDUA 3QTVH 4OS4A 1VITH 4IBLH 2B9LA 1O3IA 2ZGHA 3A8AA 5C17A 1WQVH 3DUXH 4ABHA 1JOUB 1ARBA 1KXBA 1ZGIA 3KF2A 4AOQA 2BDYA 7ESTE 5FL7D 2HVYB 1HFDA 1ZLRA 4NWLA 1G36A 3LJOA 1ZTLA 3ZYEA 1GBMA 3M36A 4OS6A 2BDCA 3UIRA 2GZ7A 1Z8IB 1UVUH 1VITF 2ZG0H 3BEUA 3Q3YA 1A4WH 1WTHD 5FAHA 1RFNA 2HALA 3RXTA 1EX3A 2IPHA 1EP6A 4GHTA 2BXUH 1TQ0B 4Y79A 2HWLB 3Q00A 1SGPE 5ESTE 1TGBA 1H8ED 1AE8H 1EAIA 1P2IA 1AE5A 2FOHA 4ZKRU 2R0LA 3KN2A 2IPQX 5L6NH 1EAUA 1HAZB 1O30A 2CV3A 5FBIA 4AFUA 4K5ZA 2K8IA 3DA9B 3VB4A 1HIAB 4MPVA 3SV6A 1NRRH 2AGEX 1C1NA 3RP2A 2OTVA 1XUFA 1ELGA 2ZHDA 2ZA5A 4AB8A 1SLUB 1VCQA 2H9HA 4X1RU 2GZ9A 3RMLH 1ELBA 2C3SA 1J16A 1QA7A 4UFDH 1LVMA 5ESBA 1NU9A 1IQFA 4AYYB 3RMNH 3TK6A 1L1GA 3FZZA 1SQRA 1KTTB 1O5AB 5K0HA 3PB1E 2BLQA 1N1LA 2RDLA 4ZUHA 1GDNA 1P03A 1DLEA 2KCAA 4AB9A 1O3DA 3VGCC 1S6FA 1GBAA 1G3DA 1ZZZA 5GXPA 3RU4T 1CA0C 1QQUA 2FOGA 4IMZA 3RM2H 1PYTD 1YPHC 2CMYA 5CHAB 2QE7D 3K6YA 4B2CA 2QY0B 2FI3E 1FPCH 4HI3A 3B9FH 2VIQA 5KGOA 1V2WT 2FX6A 4CRBA 1O32A 5HM2A 3VXFH 2BM2A 2K1QA 3SU1A 3U8RH 2BDBA 1C2KA 3M37A 3FP7E 3GYMA 2FMJA 1CA0B 1ARCA 1SGYE 3G01A 4AX9H 3LH1A 3QWCH 1LHGH 4MPUA 3Q76A 1HBTH 1UTKA 1H4WA 4H42U 4OS2A 1DS2E 2A2XH 1TLDA 4OS5A 3P8GA 2ZKSA 3BTKE 4ISNA 3VEQB 3A80A 3AW0A 2P94A 2KAIA 3M61U 2JDID 1DDJA 1LHEH 1LO6A 2A5AA 1F0UA 1UTQA 5L2ZH 2L6OA 2GKVE 1YF4A 1UHBB 1P0SH 4WVPE 1G37A 1GVLA 2B0FA 2LELA 2NWNA 3H7TA 2O8LA 4ISIH 3F3BA 4OS7A 4Y11E 2R3UA 3LGUA 4MPXA 3SI4H 2ZPQA 3BSQA 1P2QA 1NM6A 4ASHA 1GL0E 4A1XA 5HKKD 1DT2A 1QY6A 5FBEA 3QK1A 3RXOA 4AGJA 1N6XA 3M3TA 1EPTA 4ABBA 1VZQH 2VIVA 3MI4A 3M7UA 1BTHH 2ANWA 2A4QA 3W1EA 3ZVEA 5GPIB 3MNXA 4NIVA 1GHAG 2VGCB 5ETXA 2SGAA 2Q6DA 3LGYA 4Z0KA 1C2IA 1FDPA 4IGDA 1H8DH 4KKDA 6ESTA 1TBZH 1INCA 1QL7A 1TGSZ 1SPJA 1Y59T 1L4ZA 3ENSB 3RXEA 1C1QA 2ZHEH 1ZHPA 4ZXXH 1KXEA 5A0BA 1K1MA 3F9HA 1ELEE 2R2MB 4A5TS 1MTWA 1WQSA 3A8DA 4B6EA 1L2EA 1GWAA 3SW2B 3PV4A 3MH4A 3O8BA 4FUEA 1TMUH 3F2GA 1XXDA 2BY7X 1T4UH 3VB5A 3MU1A 1Y3XA 1AVGH 1EB1H 4ESTE 4BAMB 3UQVA 1GMHG 2A32A 1CSOE 3HKJB 4XRNA 4R8TB 5T3HA 3BTHE 2XXLA 1O3CA 3ESTA 3PWCA 1GJ6A 4LZ1H 1F5RA 3IITA 4DY7B 5EG4A 4BTUB 4J1YA 3DSGA 2GZ8A 3GCOA 1UVSH 1X7AC 2XCNA 4INHA 5DJ7A 1XVOA 2AIPA 2KCYA 1Y3UA 2JJ1D 3HK3B 3LC3A 1QL9A 1TBRH 2PGBB 4YESB 3LH3A 3E8LA 3MH5A 3OU0A 3MH6A 3UTUH 2QF3A 2Y7XA 1IQLA 2OXSA 4X6MA 1O2KA 3LGTA 5SGAE 3TPIZ 2J9NA 4NIXA 1ELVA 5C1UA 2VJ1A 1GBLA 4CR9A 2G4TA 1O2JA 1AZZA 4I86A 2Y81A 4INLA 2UWOA 3STJA 2ANMH 3WWBA 3I77A 1FONA 1GMHF 5GIBA 4CBNA 3IWMA 4DT4A 5A8XA 3TH2H 2KCPA 5A0AE 3EA7A 1AUJA 2ODYB 1OKXA 1P06A 2WPDD 5DKMA 3W94A 1IQEA 2WV9A 1O2YA 3PROA 1OX1A 4X8TH 1T8MA 1W13U 2F9UA 2ZU4A 4YO9A 1CHGA 1O3EA 2VWMA 1TNIA 2V0BA 4DOQA 1GI8B 2QAAA 2Z3EA 3BTQE 3AW1A 2GJGA 5F03A 4MNVA 1BITA 3ATWA 1XUHA 4BTIB 1ELDE 1TX8A 1BT7A 1O3KA 2Z9JA 1A5GH 2BY9X 3P8FA 4UONA 1TRYA 2FPZA 1ELTA 2C8XB 1AFEH 4NIYA 3ATIA 3Q3KA 1VGCB 1EASA 1O3HA 1ZGVA 1KTSB 2UUKB 4Y8YA 1K1LA 2ZTXA 1KY9A 2L74A 1BHXF 2Z9LA 5FCKA 1SGFA 1C5XB 1C5ZB 2DE8A 3OX7U 3P17H 3MOCA 4LZ4B 1OP8A 4YTAA 2Z3CA 3AAUA 1QJ7B 2GVFA 4YOGA 2JIZD 1KDQA 2ZDAH 1O2GH 3EE0B 1FY4A 2RFKC 3HPTB 4HGCA 1TABE 2BD8A 1O3FA 1C5TA 1BZXE 1L4DA 4DG4A 2BDGA 1TOMH 3UNQA 2QA9E 4JYUH 5J4SA 1C9TA 1MBQA 3UQOA 4KGAA 2XTTB 4TT3D 4ISLA 2ZHQH 4ABEA 1OWKA 2I6SA 5CMXH 3ELAH 3QLPH 2QN5T 3OE7D 4WMEA 2FDAA 2PTNA 3A89A 5HIYA 3LGWA 3RMOH 1GBIA 2H5DA 2OUAA 2ZGCA 1W14U 2A4GA 2LP6A 1FN6A 1SHYA 4BAHB 1K1NA 4MTBA 1TGTA 2FXRA 3PTNA 3TVJB 5C1YA 1T32A 1AB9B 3GY8A 1GI4A 3HATH 1YCPH 3T5FH 1LMWB 1QB1A 1C5QA 1Z1JA 4Q63A 5I46H 3SOSA 4X1SU 5DSFA 1UK3A 2THFB 4B1TA 5L30H 5EQSA 1P2JA 1XUJA 2HGTH 2FO9A 1SFQB 1F7ZA 3F1SB 3RLWH 1HAVA 1TNKA 2XOKD 3BN9A 3S7KB 3SNBA 2ZU3A 4CRCA 2EY4C 5JBBS 1DITH 1LTOA 4JZIA 4WY3A 3LC5A 3SJ9A 1HLTH 1NROH 2ZCKP 1FAKH 2ZQ2A 5DO4H 1BOQA 3RXBA 1CVWH 3ODDA 1GCDA 2VU8E 3QGNB 1GHBG 1C2FA 1RIWB 1KYNA 2C8YB 1QBOA 2R0KA 1NRQH 1CQQA 5JBTA 4I8GA 2BQWB 1OPHB 2Z7FE 4FOUC 4DW2U 2VNTA 3KQEA 4IS5A 1DVAH 1MU8B 2QYIA 1COWD 1D3QB 2A4RA 5C3NA 1PQ8A 1JWTA 2OC1A 2FI4E 4MLFB 1AI8H 2PKAA 1DLKB 2P16A 1B5GH 3F0OA 5C2ZA 2V3OH 1P2NA 1TQ7B 2VIDA 4JMYA 2G5NA 1QJ6B 2GMTB 1FLEE 2QXIA 3A7YA 3PWBA 1OOKB 3UAIC 2OC7A 2QIQA 2ZWLH 4WXIA 3PM3A 3SJOA 1MTUA 3TGIE 1O39A 1V2OT 1GHBF 5C5OA 2K0QA 5DP5A 1GHVH 4LOYH 5GJ4B 1SR5C 3P70B 1TPSA 2ZC9H 4Z6AH 2VIWA 2OBQA 4ZCNA 4K1EA 5EU8A 2HRVA 5EIYA 1C5VA 3M7TA 1UW7A 4K60A 1O3BA 1ZPBA 3RC4A 1NT1A 1F5KU 1YGCH 2ZHWH 1AGJA 1TA6A 3T26A 2FODA 4E7RG 2P3FH 2W3IA 2GV6A 4AZ2B 3GDVA 2H9TH 4Y8XA 3U98H 1CHOG 1CO7E 1KLIH 5HGGA 2GCTC 4UFEH 1C1UH 3KL6A 3SGQE 4E05H 1MTVA 1ABIH 1O2RA 5FPTA 3GY4A 1EJNA 4DURA 1RJXB 1SB1H 4XSKU 3ZV9A 1NRSH 3F9EA 1O38A 3STIA 1Y3VA 1A46H 1HXFH 2J95A 3RXKA 3RLYH 2GCTB 1ETTH 4U01A 1E1RD 1P9UA 4FETA 1H9IE 3P95A 2BY8X 3RXPA 1SLVB 4Y10E 8GCHG 2VVVA 4M9FA 2H2ZA 2WV5A 2XBWA 1TPAE 4Q7YA 2ULLA 2YMSD 3A7VA 4GHQA 1YCPK 1ZJKA 3EA9A 4JZDH 4OS1A 3SUGA 2IJD1 1W7XH 3KNXA 1MBMA 1HUTH 2CHAC 3QUMP 2PGQB 4ISHH 2FM2A 3FFGA 1NC6A 1NN6A 4F55A 2J4IA 4ZHMU 3SU0A 3HGPA 1AO5A 1CHOF 4I32A 3D49H 3M5NA 3RXHA 1QBNA 2VIOA 2AGGX 1NO9H 2LPRA 3PV2A 2VWNA 4OM9A 1QR3E 1ETSH 1UTOA 1RTFB 2F3CE 3OY6U 3D65E 4ZMAH 3SGAE 3SUFA 2TGPZ 1PQAA 1C2DA 8GCHF 3UPEA 4ACAA 2V3HH 5DP8A 3U9AH 1P09A 3LDXH 1QFKH 5FHTA 1DFPA 3QZRA 2XC0A 3EGKH 1KIGH 1ZMJA 4GSOA 2ZEBA 3TH4H 1QB9A 4RT0A 2BOHB 1LKAA 2TGAA 1CA8B 2A2QH 1GI5A 2ASUB 1HDTH 4X2WA 8ESTE 2A7JA 1E38B 2Z3DA 3SU6A 2BD3A 3SNAA 3B8JA 3GCHC 3SHCH 4F48B 2CGAA 1C2GA 4XBBA 2GP9B 1O3OA 5FX5A 2PW8H 2ZFRH 1A0HB 1GDQA 2HNTC 1P01A 4B2AA 2VBCA 4BOHA 4AN7A 2WHXA 3BF6H 4H4FA 4JZ1A 3S9BA 2RA3A 5FPYA 4CR5A 2LNCA 3ZZ6A 3LOXA 2FTLE 2WPIS 4UE7H 3ZZ3A 2BVXH 4MQAA 4ZH8A 2QF4A 4X2XA 1O5BB 3RM0H 3SUDA 3FOAA 4K69A 1ELAA 1HXEH 1FJSA 1BJUA 1W0JD 1XKAC 1HAXB 3P6ZB 5DP3A 1MKXH 1H8HD 2WINI 1H1BA 3L3TA 1SG8B 2ZFPH 3I29A 1MD8A 3F68H 1JMOH 5C0TA 3NK8A 2F9BH 2BD7A 3A7ZA 2Y7ZA 3PLBA 4D8NA 1P11E 4ACBA 1C1VH 2PUXB 1QJ1B 2A4OA 4MNYA 1GI7B 2AERH 3FANA 3TK9A 3AK5A 1EQ9A 3UY9A 4X2VA 1LVBA 1QL8A 1TGNA 2A7HA 3A8CA 3V3MA 2J2UA 4M7GA 2VH0A 1DANH 1V2MT 2SGFE 2P59A 2ZNKH 4O9VA 1V2JT 1TOCB 1G2LA 2R2WU 3ZZDA 3JZ1B 3OTJE 1PFXC 4TPIZ 2BLVA 4AORA 1SGNE 1GBBA 4O3TA 1IHSH 2BD9A 4TY6A 1O3AA 1CGHA 4FU7A 2BDAA 2CK3D 5A0CA 3ZVBA 4DCDA 2B7DH 4X0WU 3OEHD 5JB8S 1DOJA 1EZUC 1UK4A 1FY8E 4YT7H 1W11U 1AKSB 1D6WA 2P8OC 1FIWA 3UOPA 3BTEE 2ZECA 5C1XA 3KIDU 1EOJA 1MAYA 1O2ZA 3SQEE 1ELFA 4B71A 2KFWA 1HPGA 1A7SA 1O2MA 2FZZA 1GGDB 5CHAC 3ZIAD 2P8OB 5A2MH 1MZAA 4IMQA 3FP8E 3MO6A 1PPCE 2PKSC 2BLOA 3SU3A 2A7CA 1YC0A 3HKIB 1AWFH 3E16B 2QV1A 2W26A 2JETB 2G55A 1C5PA 1A1RA 3KYGA 2DUCA 4DT7B 1AMHA 2G51A 2PKSB 2STBE 1G3CA 1YBWA 1IQIA 1QHRB 1GJ4H 3D23A 1GJDB 2ZF0H 1P8VC 2HNTE 2QXJA 3PRBA 1O33A 1YYY1 4X8UH 3BG4C 1BBRH 3SI3H 3TH3H 1BTZA 3T2NA 1EB2A 4RKJB 1SSXA 4P00A 3NXPA 4FUDA 2HPPH 2Y80A 3LGVA 4X8VH 3UR9A 1LQEA 1O37A 1GJAB 4Y8ZA 3BG4B 1C1SA 5A8ZA 1MKXK 1FV9A 1ID5H 1RTLA 3EE7A 2FEQH 5EOKA 1OP0A 3GYLB 4AG2A 1TONA 4X1QU 1HRTH 4Y7BA 1DY9A 1V2NT 2VGCC 4DVAU 1IQKA 1W12U 3WY8A 2AFQB 2BX4A 3HGNA 1DE7H 1GI3A 3T62A 4AFQA 4MVNA 4X6OA 1LHFH 1Z6JH 1NBME 3ZVDA 3MFJA 1E37B 5JBAS 1RD3B 1FZZA 2WV4A 1GVZA 2AYWA 2V35A 4RSPA 1FY1A 3ZZ5A 3SQHE 3OTPA 4HZHA 1GBCA 1T31A 1V2UT 1Y3YA 3V12A 2XYAA 1UVTH 2H9EH 2O8MA 1SLWB 5C67A 1SL3A 1AVXA 3H09A 1UCYH 3KHVA 1E1QD 2PLXA 1TBQH 4Z1MD 4WH8A 1ETRH 1UTMA 4ASUD 2KZ4A 3LIWA 2BZAA 1ZTKA 5ABWA 3ZZ4A 1Y3WA 3E6PH 1YLDA 1S0RA 4VGCB 5TCAA 1PPEE 3FZDA 3KGPA 1NFUA 5G4BA 5DN6D 2AGIX 3S7HB 1DWDH 2Y82A 3SJ8A 3TNTA 4TYDA 3MTYA 3F0PA 1T7CA 2ZO3H 1LCYA 1QCPA 1G32B 1VCPA 1P04A 2A5IA 4KTCA 4Q4LA 3WW7A 2BXTH 1SGFG 3BV9B 5GCHG 4CRFA 1SGEE 1V2RT 2QF0A 2QXGA 3I78A 1GJCB 2BD4A 1G3EA 4J2YB 5F6MA 1O3LA 2EA3A 5A09A 1WAYB 1NZQH 3MMGA 1O5EH 3EAJA 1QTFA 1SKYE 5F8XA 3ZVGA 1ZR0A 2BQ6B 5LPFA 2TPIZ 1S6LA 1HJ9A 2AEIH 1HAGE 2O9QA 1AY6H 2D1JA 3A84A 3O8DA 4THNH 4RN6A 3DD2H 3N7OA 3PYHA 1KXAA 4NZLA 4DGJA 1BMFD 1VGCC 5EODA 2W6ID 4GCHF 3OY5U 1YLCA 4TPYA 4XD7D 5HMAA 1IOEA 1GDUA 1THRH 1TNGA 3MO9A 5KEDA 2C93B 5EXLA 3UFAA 2UWPA 3AASA 5GCHF 1O2HA 3EQ0H 1EUFA 1O5CB 1S82A 1F5LA 5B6OA 5EPYA 1YPLH 1YWUA 3KQ5A 4DIIH 4UFFH 3RXCA 3ITIA 1YP9A 4D9RA 3PRDA 1K9OE 3RXGA 1AIXH 5JBCS 4Y71A 4BNRA 3NUMA 4K3JA 1UVPA 1Z71A 1BMMH 1C1OA 2J92A 1BRCE 1KXDA 2IN2A 3UNSA 3MU8A 4JK5A 5T6GA 1MD7A 1HAPH 1WBGB 2WPJS 1KXFA 2ZCLP 3F6UH 2EI8A 1DSUA 4XBCA 3H5CB 2EI7A 3NRLA 1OHHD 3DT0H 1DPOA 1SBWA 3RXAA 4D76A 1O2QA 2O8UA 4A6LA 1ESTA 1A5IA 2KAIB 1SQOA 4OGYA 3GY3A 1GJBB 1DWCH 1HAYB 5BPEA 4SGBE 1BMLA 2M5TA 2XBYA 1MU6B 4IN2A 3SHAH 3MNCA 3SYJA 1O2WA 3BIUH 3RXJA 1C5UA 1BCUH 1AB9C 1K1PA 1QURH 1TPOA 2NU1E 4O03A 2JJ2D 2XNIA 1LPGB 2EQNA 3F9GA 3EDXB 2I6QA 5JYIA 1FY5A 3M3SA 3SNEA 5HYOA 3A81A 2ZTZA 3RXDA 4XDEA 1HYLA 3KQCA 1EPTB 4FUCA 3FP6E 1FMGA 1RTKA 1V2LT 3RU4E 9LPRA 4NSYA 6GCHG 3UREA 1GI2A 4UD9H 3GS9A 5AFZH 5A8YA 4Q7XA 3CP7A 3R3GB 1P2KA 4JCNA 3VB3A 2ILNA 1ANDA 2W3KA 1DWEH 1MZDA 2GDDA 3AAVA 1KSNA 1PJPA 5AVDA 2VINA 3RDZA 3TGJE 2CF8H 3ZZ8A 3SBKA 1F0TA 2FOBA 3MO3A 1RIWC 1P3EA 2JH6D 1SGQE 1UTJA 2J94A 5CHBA 1OSSA 1D6RA 4E06H 2O8TA 2Y5GA 1CGIE 5EW2H 2J5UA 1FNIA 2OP9A 3M5OA 2PFEA 3PLKA 1SQAA 2C8ZB 1A61H 2BDHA 4ZKNU 2GCHG 1XUIA 4ZHLU 2FLRH 3P8NA 6GCHF 3MQKC 4ISOA 3BG8A 2AH4X 2AMDA 4NSVA 1S5SA 4X6NA 1WTGH 2ZFFH 1GG6C 4Y76A 3S9AA 4TWYA 2GT8A 1VCWA 1RGQA 1O3MA 1SVPA 3QZQA 3UWIA 3SV2H 2GMTC 3FVFB 4AC9A 1O3JA 1EJAA 2ANYA 3IG6B 3UNRA 4IC6A 1PQ5A 1AZ8A 1FX0B 1C2HA 1GG6B 4PROA 3RXSA 5JB9S 1J8AA 4AG1A 1TYNA 5IYTA 2P3TB 1RS0A 1SOTA 5HIZA 1OWEA 3QTOH 1UTPA 3RXVA 1A0JA 2FS9A 4K1TA 3RC6A 3AVZA 2B5TB 1BA8B 3A8BA 3CENA 3FN8A 1C2JA 2ZPRA 1SHHB 9ESTA 2GCHF 3ODFA 2Y6TA 1OWJA 4I33A 3GCNA 2XW9A 3V7TA 1JRTA 1TE0A 2Y5FA 1TWXB 3LU9B 1THSH 1AFQB 1WV7H 4F49A 4X1PU 1NFYA 3OSYA 4JZFH 1DUEA 1QA0A 1AN1E 3FKSD 4B75A 2V7QD 3ZZ9A 1BTPA 1YKTA 1Q3XA 1NESE 1DM4B 1DY8A 1ZMLA 1C1TA 1P12E 3ZZBA 2ZGBH 3RXRA 4WWYA 1LVOA 2ZQ1A 4RKOB 1QGFA 1XM1A 3BTGE 2G00A 5DP6A 2Q1JA 1E79D 1KMHB 1V2KT 1JBUH 1BTUA 1GCTC 5EQQA 2ZPSA 2QF5A 5KECA 3RMMH 5LGOA 1MABB 3BTDE 3D62A 3F2HA 1XX9A 1ANBA 3UB0A 2C8WB 1BJVA 1KDQB 2B8OH 4HFPB 1EZQA 4A1VA 5EGMA 1BHXB 1GBKA 5T6FA 1HIAA 1GCTB 4A92A 3DSPA 3L33A 3TU7H 2OC0A 1NFWA 1MMJN 3ZV8A 2JH0D 3CS0A 3O8CA 2F9OA 1AKSA 2UUJB 3RC5A 1MCTA 1XXFA 2F91A 1TX7A 2XCFA 4YXWD 4GLYA 1QQ4A 2H1UA 2ZIQH 4MNWA 4FUFA 3E3TA 1P05A 5FCRA 1BMAA 4BXSA 4XFQA 4GPGA 4FUHA 1FIZA 1JXPA 4K8YA 1EAXA 1ZSKA 5LPRA 1O2LA 1BIOA 2FYQA 1O5FH 2ALPA 5I25A 3ZVAA 1VKYA 1O35A 2HLCA 3N99A 4X1NU 7KMEH 1O3PB 3KYFA 1TFXA 1AWHB 3NPSA 2PP6A 1MUEB 1WDIA 1Z6EA 2F9PA 2KM0A 3GCTG 1GBFA 3N7EA 4U32A 3A88A 1V6DA 1NY22 2QXHA 2R3YA 3N7DA 4CBOA 5BRRE 1HAVB 1O5GH 2W7SA 2XBVA 2WPMS 1DWBH 1AQ7A 2DE9A 4MDSA 1DSTA 1GI0A 1GHYH 1B0EA 1WOFA 5JDUB 4FU9A 1TMTH 3M3VA 5B6LA 3T27A 3TIUA 1MKWH 4ABFA 1GMCG 2HLDD 1E36B 4AYVB 4RT1A 1DUAA 3SJKA 4R0IA 1ZSJA 4NFEA 1ORFA 2OK5A 1K28D 3E90B 3NWUA 3ZVFA 1J17T 3BEIB 3LONA 3DSOA 1YM0A 5E0JA 4IN1A 2WSSD 1THPB 1UHBA 3MHWU 1OP2A 5E2PA 3DHKH 3GCTF 1ZHRA 3PMBB 5DGJA 2ZI2H 1YPKH 2P93A 1LVYA 3DFJA 1DICA 4D7GA 2PKAB 1HCGA 2Q6FA 1FUJA 2TRMA 1CU1A 3RXLA 1MAXA 1JIMA 1XKBC 1YPEH 2BOKA 3JZ2B 3OFND 1G2MA 3OAAD 3U8TH 1GMCF 3SJIA 1O36A 1AD8H 1OWHA 2CJIA 3MU4A 4B73A 1HV7A 1QNJA 2ODPA 1C1WH 1C1RA 2AMPA 4XOJA 1ZOMA 3SO3A 1P3CA 2NU2E 1P9SA 2GDEH 4JYVH 2BMGB 1V2TT 2XC5A 1F92A 3RXQA 3EA8A 2TBSA 2VIPA 4CHAC 1M9UA 2ZCHP 4H6SB 1LDTT 3MYWA 3P8OA 2GD4B 2IOTA 3M7QA 1OXGA 3SN8A 2XWAA 3SU4A 3TLOA 4JK6A 3VFEA 1TB6H 2FYRA 2W6JD 2TIOA 1S0QA 4NWKA 2VVUA 1AHTH 4MPWA 4HG6A 1WXRA 2YNAA 1P2MA 2BB4A 3PMHB 4CHAB 1VJ9U 1UJ1A 1CBWC 4INKA 3BTME 5FPSA 4B76A 1GMDG 1T8LA 4ABGA 1GJ7B 2J98B 2BVSH 4YOJA 1ZPCA 1ZSLA 2ODQA 2J34A 3L6PA 5GDSH 1IQNA 2IJOB 3GY6A 1GGDC 2W5EA 1Y8TA 2BTCE 4CH2B 1D3TB 7GCHG 5C0UA 1CBWB 4DIHH 3URCA 2Z9KA 3GICB 1KXCA 2R9PA 2ZHFH 3QX5H 4WXVA 5EXNA 2PWXA 1A0LA 1EZXC 1VJAU 2EC9H 2QGRA 2ZFSA 2OBOA 3ZZ7A 2JETC 2AHME 5H4IB 1KLJH 1XMNB 1BTXA 2V6NA 4D7FA 2O8WA 1LPZB 1L0ZA 5E0HA 1GI6A 2PSXA 1D3DB 2SGPE 1GMDF 2VH6A 2WUBA 2V3MA 2UUYA 1C5NH 4FXGH 5T1VA 5K7RA 2JH5D 1OWDA 3NZIA 3VPKA 2Y5HA 1UVOA 3A85A 4WF8A 1IHTH 3O8RA 4X6PA 1J9CH 4DJZB 1MKWK 1W0ZU 1NRPH 5EJZA 7GCHF 4ZHAA 5DPAA 3ZYDA 3BEFB 5AFYH 3A83A 2D26C 1AVWA 1T8NA 1S84A 2Z94A 1O2IA 1ZMNA 1W0YH 1N6YA 3SNDA 1GVKB 1O3GA 5EQRA 1SGIB 5LPEA 4I7YH 2ZFQH 3F2FA 4WMDA 1UK2A 2WPLS 1P57B 2BLWA 4Y6DA 1GJ5H 5DG6A 1P02A 1NS3A 4FUGA 2FOFA 4GAWA 3FO8D 1F2SE 1GBTA 1C5SA 4IW4E 3BIVH 3VGCB 1ELCA 4ABJA 1UMAH 1H9LB 4XE4A 2XNDD 1G3BA 1LPKB 1O2OA 1NPMA 2FWWA 3A7XA 3KQDA 1ABJH 1N8OC 6CHAC 2FP7B 3K6ZA 4JYTA 4KTSA 1GI9B 4UFGH 4I31A 5C20A 3ZZCA 1GI1A 1Z7KA 2BY6X 5TCCA 4A7IB 3RUOA 2C90B 3PMJA 3T25A 1O31A 1A3BH 4Y0YE 3CNRA 2ANKH 3RXUA 2VB0A 4NZQA 5DP7A 1N8OB 6CHAB 1Z8RA 2NU4E 4ABAA 1QRXA 2NU0E 2SFAA 2PHBA 2ZGJA 4B2BA 2WUCA 1YPGH 2OQ5A 4BAKB 2OCVB 5F8ZA 3GY2A 2SNWA 2GTBA 4F4OC 1F0SA 1TRNA 1QBVH 3QN7A 3P92A 8KME2 1W3CA 4B6FA 1TPPA 1CT0E 1O34A 1XUGA 5DP4A 4VGCC 2G4UA 2ZTYA 3LT3A 4X2YA 1K21H 1WYKA 2EEKA 1WSSH 4O97A 2A1DB 4Q80A 1JRSA 3VB6A 2XWBI 3S69A 2VWLA 2RDEA 5EW1H 1YLNA 1SGRE 4XBDA 3U8OH 1CT4E 3BTWE 4AGKA 3SU5A 1Y5AT 4K2YA 3TJNA 3A82A 2YOLA 2ESTE 1O2SA 1FXYA 4WJG2 2H5CA 1IQGA 1CE5A 2FX4A 4YLQH 2KX4A 4GCHG 5EJ1A 3PO1C 2ALVA 2WPKS 3M5LA 4BAOB 1H9HE 1NBMD 4NIWA 1BQYA 1SGCA 1C5OH 2VVCA 3K9XB 4BTTB 4YLUA 3W95A 3PV5A 1O2TA 1ZTJA 1GBHA 2KR7A 1GBJA 3TJOA 1EATA 3LGIA 2ZFTA 1V2QT 1GHAF 2FOEA 3UR6A 2JKHA 3PO1B 1QIXB 3LJJA 4A1TA 4KELA 3RXMA 5C94A 3A7WA 1GPZA 4YM9A 1ZJDA 3EYDA 2ZGXH 4QT8C 1K2I1 1C5YB 4O3UA 4IC5A 1IQMA 3KQBA 4WMFA 4FVDA 1P10A 5AF9H 1DXWA 1BRBE 1EZSC 2ZDMA 3A86A 1BBRK 2A31A 1Y5UT 4ZKSU 1EFRD 3OYPA 1YPHE 1T4VH 2BYAX 4ZXYH 5IK2D 3TJUA 2ZU1A 1MTNC 1AUTC 3FAOA 3SU2A 3C1KA 1V2VT 3VXEH 3U1JB 1K0HA 4ABDA 1TA2A 3PTBA 3E0NB 4I8KA 3ZVCA 1TGCA 1TIOA 1S85A 1TRMA 1MTNB 3URDA 2STAE 1EKBB 1D4PB 3B23B 4YOIA 4I8JA 2GT7A 4H6TA 2XC4A 1O2PA 1L1NA 1SOZA 1TMBH 2J97A 2BVRH 1G9IE 1ACBE 2AMQA 4FUBA 3LKWA 1FY3A 3T28A 1C1PA 1JIRA 4FVBA 2BX3A 2UWLA 1K22H 4CH8B 1C2EA 5T6DA 1NFXA 1C4Y2 2YMSC 4NCYA 1UO6A 2FI5E 5EPNA 2BDIA 3GISB 4ZROA 1EPTC 1Q2WA 4HTCH 1NU7B 1GBDA 5TJXA 3GY5A 2GX4A 1C5WB 1BDAA 1OWIA 2FLBH 2QCYA 3WWFA 4SGAE 3SV9A 4MG3A 1W7GH 2SGEE 1EJMA 2YMSB 1LHDH 3UWJH 1QRZA 1UCYK 1GBEA 1TNJA 2YNBA 1Z8GA 2OINA 2ZDKA 3LPRA 4FUIA 2BY5X 4LXBH 1O2XA 4UDWH 5L2YH 1EP5A 1SGDE 3DCLA 1TNLA 1BMNH 5AHGH 5FXLA 2WPHS 3GY7A 1HB0B 2FIRH 1FQ3A 1H8IH 3SV7A 3A7TA 1U6QA 2Q6GA 1VR1H 2M2AA 2XBXA 3U1IB 2GGVB 2GV7A 4I8LA 2QC2A 1FAXA 3PLPA 3MU0A 4TY7A 2PUQH 3ATKA 1QZ8A 1WUNH 1MTSA 4WH6A 2D8WA 4BAQB 5IDKA 1C5LH 5PTPA 4X8SH 1XUKA 1KLTA 3ATLA 1EOLA 4OGXA 3TK5A 1EXFA 1FPHH 1WU1A 1MQ5A 4ABIA 1C2MA 4MNXA 4NFFA 1NRNH 4Y7AA 1G30B 2BD5A 3QGJA 2WYGA 3QDZB 2EI6A 1PPBH 5FX6A 3SZNA 2A0QB 4U2WA 2A45B 1ZRBA 2W7UA 1YPMH 2BZ6H 1PPZA 4U30A 3RU4D 1C4U2 3TITA 2G5VA 1GHWH 3MNBA 5CDFE 3QO6A 2F43B 1V2ST 1OYTH 1HJAC 2PSYA 3NCLA 1IAUA 3CS7A 2OQUA 4BXWA 1O5DH 1GJ8B 1ZPZA 2HNTF 2ZDNA 5GWZA 5GNDA 1SLXB 2D2DA 4FU8A 1C5MD 4CREA 3S9CA 4JZEH 1E35B 3H7OA 3E1XB 1HGTH 3SV8A 1AFQC 3F9FA 5HM9A 1HJAB 2RG3A 1GHZA 2Z6BD 5E8EH 3RXIA 1TAWA 2G8TA 2PV9B 1FI8A 1HAIH 2SGDE 4Q7ZA 1LQDB 2F83A 2SNVA 5LH8A 1TX6A 1SFIA 3K65B 4RI0A 4ZKOU 2G52A 1ANCA 1ZYOA 1BRAA 5E2OA 1J15A 1GJ9B 3E0PB 3SNCA 5JPMH 1QB6A 3KCGH 1J14A 3SGBE 1F0RA 1LHCH 1SC8U 1K1OA 5F8TA 1PPHE 4CRAA 1L1JA 2ZDLA 2H6MA 2P95A 2VWOA 3UOUA 4K1SA 3OEED 4NGAH 5E0GA 1GHXH 5EJLA 1BUIA 2ZZUH 1LKBA 2UUFB 1SI5H 2CXVA 3U69H 4FUJA 1ZRKA 1CT2E 1OYQA 3MNSA 3V13A 2G81E 1BRUP 2OC8A 2WZQA 3UUZA 1A2CH 1HAHH 2WYJA 3VB7A 2AIQA 1V2PT 3VG8A 3PMAB 1O2UA 1O2NA 2TGDA 3BTFE 2P3UB 2ZU5A 5DP9A 2RCEA 1D3PB 1BBRE 1T8OA 5DK1A 3Q77A 2PTCE 1WCZA 2J38A 4CRDA 3R0FA 4B74A 1RXPA 1B7XB 4NA9H 4K8BA 1FN8A 2CF9H 2OD3B 2BD2A 1TNHA 2HOBA 3SORA 4KP0A 5CE1A 1W2KH 5EXMA 1HAOH 1ANEA 4P02A 1Z8JB 4Y0ZE 1A3EH 7LPRA 2J98A 2SGQE 3T29A 2KCOA 2F9VA 1E34B 1HJ8A 1D9IA 3U28C 3KEEA 4NG9H 3M35A 3TGKE 1PPFE 4AFZA 5J4QA 4TWWA 1BB0B 1Y5BT 1QRWA 2ZU2A 3GOVB 4AFSA 2C4FH 8LPRA 3K2UA 2BHGA 1AU8A 3V0XA 2HVXA 3S0NA 2F4LA 1A5HA 4YZUA 1PYTC 2FOAA 2Z9IA 1YCPM 4ZAEA 1RRKA 2FOCA 1SGTA 4UEHH 1S6HA 1SMFE 5F53A 1Z1IA 1S83A 2TGTA 2AS9A 3SUEA 1S81A 4LK4A 3RXFA 2FTMA 3MU5A 3Q3XA 1MCVA 2FOMB 2NU3E 2RA0A 3TJVA 2CHAB 3BTTE 1BTWA 1UCYE 1W0KD 1DX5M 1EAWA 1DXPA 1W8BH 4Q2KA 1E0FD 2PR3A 4D9QA 1P2OA 1IQHA 2HPQH 3HK6B 1Q31A 3M5MA 5HXFA 1PPGE 1NTPA 1O0DH 2ZP0H 3MH7A 1C5RA 3GDSA 1PQ7A 4CRGA 1MH0A 4KTUA 3ATMA 1V3XA 1B0FA 2OLGA 1XVMA 1ESBA 1GL1A 3A87A 1HNEE 1UTLM 1K1IA 1TALA 1YPJH 2A5KA 2FESH 1C4V2 3C27B 1SQTA 4E7NA 1C2LA 2F9NA 4YT6H 4TSFD 2Z9GA 1ZHMA
chains in the Genus database with same CATH topology
1ESAA 1MQ6A 1OS8A 4NA8A 5C5NA 6LPRA 4GVUA 3ZZAA 1C1MA 2FS8A 1VITG 4I8HA 4NA7A 3GCHB 1O2VA 1BTYA 4BANB 3NKKA 1CGJE 1O3NA 2ZDVH 1IQJA 3DFLA 1C9PA 2BQ7B 1K1JA 3MWIU 1W10U 2XRCA 3TNSA 3E91A 4GUXA 2CN0H 1UTNA 3GDUA 3QTVH 4OS4A 1VITH 4IBLH 2B9LA 1O3IA 2ZGHA 3A8AA 1WQVH 3DUXH 4ABHA 1JOUB 1ARBA 1KXBA 1ZGIA 3KF2A 4AOQA 2BDYA 7ESTE 1HFDA 1ZLRA 4NWLA 1G36A 3LJOA 1ZTLA 3ZYEA 1GBMA 3M36A 4OS6A 2BDCA 3UIRA 2GZ7A 1Z8IB 1UVUH 1VITF 2ZG0H 3BEUA 3Q3YA 1A4WH 1WTHD 5FAHA 1RFNA 2HALA 3RXTA 1EX3A 2IPHA 1EP6A 4GHTA 2BXUH 1TQ0B 4Y79A 2HWLB 3Q00A 1SGPE 5ESTE 1TGBA 1AE8H 1EAIA 1P2IA 1AE5A 2FOHA 4ZKRU 2R0LA 3KN2A 5L6NH 1EAUA 1HAZB 1O30A 2CV3A 5FBIA 4AFUA 4K5ZA 3DA9B 3VB4A 1HIAB 4MPVA 3SV6A 1NRRH 2AGEX 1C1NA 3RP2A 2OTVA 1XUFA 1ELGA 2ZHDA 2ZA5A 4AB8A 1SLUB 1VCQA 2H9HA 4X1RU 2GZ9A 3RMLH 1ELBA 2C3SA 1J16A 1QA7A 4UFDH 1LVMA 5ESBA 1NU9A 1IQFA 4AYYB 3RMNH 3TK6A 1L1GA 3FZZA 1KTTB 1O5AB 5K0HA 3PB1E 2BLQA 1N1LA 2RDLA 4ZUHA 1GDNA 1P03A 1DLEA 4AB9A 1O3DA 3VGCC 1S6FA 1GBAA 1G3DA 1ZZZA 5GXPA 3RU4T 1CA0C 1QQUA 2FOGA 4IMZA 3RM2H 1PYTD 1YPHC 2CMYA 5CHAB 3K6YA 4B2CA 2QY0B 2FI3E 1FPCH 4HI3A 3B9FH 2VIQA 1V2WT 2FX6A 4CRBA 1O32A 5HM2A 3VXFH 2BM2A 2K1QA 3SU1A 3U8RH 2BDBA 1C2KA 3M37A 3FP7E 3GYMA 2FMJA 1CA0B 1ARCA 1SGYE 3G01A 4AX9H 3LH1A 3QWCH 1LHGH 4MPUA 3Q76A 1HBTH 1UTKA 1H4WA 4H42U 4OS2A 1DS2E 2A2XH 1TLDA 4OS5A 3P8GA 2ZKSA 3BTKE 4ISNA 3VEQB 3A80A 3AW0A 2P94A 2KAIA 3M61U 1DDJA 1LHEH 1LO6A 2A5AA 1F0UA 1UTQA 5L2ZH 2GKVE 1YF4A 1UHBB 1P0SH 4WVPE 1G37A 1GVLA 2B0FA 3H7TA 2NWNA 2O8LA 4ISIH 4OS7A 4Y11E 2R3UA 3LGUA 4MPXA 3SI4H 2ZPQA 3BSQA 1P2QA 1NM6A 4ASHA 1GL0E 4A1XA 1DT2A 1QY6A 5FBEA 3QK1A 3RXOA 4AGJA 1N6XA 3M3TA 1EPTA 4ABBA 1VZQH 2VIVA 3MI4A 3M7UA 1BTHH 2ANWA 2A4QA 3ZVEA 5GPIB 3MNXA 4NIVA 1GHAG 2VGCB 5ETXA 2SGAA 2Q6DA 3LGYA 4Z0KA 1C2IA 1FDPA 4IGDA 1H8DH 4KKDA 6ESTA 1TBZH 1INCA 1QL7A 1TGSZ 1SPJA 1Y59T 1L4ZA 3ENSB 3RXEA 1C1QA 2ZHEH 1ZHPA 4ZXXH 1KXEA 5A0BA 1K1MA 3F9HA 1ELEE 2R2MB 4A5TS 1MTWA 1WQSA 3A8DA 1L2EA 1GWAA 3SW2B 3PV4A 3MH4A 3O8BA 4FUEA 1TMUH 1XXDA 2BY7X 1T4UH 3VB5A 3MU1A 1Y3XA 1AVGH 1EB1H 4ESTE 4BAMB 3UQVA 1GMHG 2A32A 1CSOE 3HKJB 5T3HA 4R8TB 3BTHE 2XXLA 1O3CA 3ESTA 3PWCA 1GJ6A 4LZ1H 1F5RA 3IITA 4DY7B 5EG4A 4BTUB 4J1YA 2GZ8A 3GCOA 1UVSH 1X7AC 2XCNA 4INHA 5DJ7A 1XVOA 2AIPA 3HK3B 1Y3UA 3LC3A 1QL9A 1TBRH 2PGBB 4YESB 3LH3A 3E8LA 3MH5A 3OU0A 3MH6A 3UTUH 2QF3A 2Y7XA 1IQLA 2OXSA 4X6MA 1O2KA 3LGTA 5SGAE 3TPIZ 2J9NA 4NIXA 1ELVA 5C1UA 2VJ1A 1GBLA 4CR9A 2G4TA 1O2JA 1AZZA 2Y81A 4INLA 2UWOA 3STJA 2ANMH 3I77A 1FONA 1GMHF 5GIBA 4CBNA 3IWMA 5A8XA 3TH2H 5A0AE 3EA7A 1AUJA 2ODYB 1OKXA 1P06A 5DKMA 3W94A 1IQEA 1O2YA 3PROA 1OX1A 4X8TH 1T8MA 1W13U 2F9UA 2ZU4A 4YO9A 1CHGA 1O3EA 2VWMA 1TNIA 2V0BA 4DOQA 1GI8B 2QAAA 2Z3EA 3BTQE 3AW1A 5F03A 4MNVA 1BITA 3ATWA 1XUHA 4BTIB 1ELDE 1TX8A 1BT7A 1O3KA 2Z9JA 1A5GH 2BY9X 3P8FA 4UONA 1TRYA 2FPZA 1ELTA 2C8XB 1AFEH 4NIYA 3ATIA 3Q3KA 1VGCB 1EASA 1O3HA 1ZGVA 1KTSB 2UUKB 4Y8YA 1K1LA 2ZTXA 1KY9A 1BHXF 2Z9LA 5FCKA 1SGFA 1C5XB 1C5ZB 2DE8A 3OX7U 3P17H 3MOCA 4LZ4B 1OP8A 4YTAA 2Z3CA 3AAUA 1QJ7B 2GVFA 4YOGA 1KDQA 2ZDAH 1O2GH 3EE0B 1FY4A 3HPTB 4HGCA 1TABE 2BD8A 1O3FA 1C5TA 1BZXE 1L4DA 4DG4A 2BDGA 1TOMH 3UNQA 2QA9E 4JYUH 5J4SA 1C9TA 1MBQA 3UQOA 4KGAA 2XTTB 4ISLA 2ZHQH 4ABEA 1OWKA 2I6SA 5CMXH 3ELAH 3QLPH 2QN5T 4WMEA 2FDAA 2PTNA 3A89A 3LGWA 3RMOH 1GBIA 2H5DA 2OUAA 2ZGCA 1W14U 2A4GA 1FN6A 1SHYA 4BAHB 1K1NA 4MTBA 1TGTA 2FXRA 3PTNA 3TVJB 5C1YA 1T32A 1AB9B 3GY8A 1GI4A 3HATH 1YCPH 3T5FH 1LMWB 1QB1A 1C5QA 1Z1JA 5I46H 3SOSA 4X1SU 1UK3A 2THFB 4B1TA 5L30H 5EQSA 1P2JA 1XUJA 2HGTH 2FO9A 1SFQB 1F7ZA 3F1SB 3RLWH 1HAVA 1TNKA 3BN9A 3S7KB 3SNBA 2ZU3A 4CRCA 5JBBS 1DITH 1LTOA 4JZIA 4WY3A 3LC5A 3SJ9A 1HLTH 1NROH 2ZCKP 1FAKH 2ZQ2A 5DO4H 1BOQA 3RXBA 1CVWH 3ODDA 1GCDA 2VU8E 3QGNB 1GHBG 1C2FA 1RIWB 1KYNA 2C8YB 1QBOA 2R0KA 1NRQH 1CQQA 5JBTA 4I8GA 2BQWB 1OPHB 2Z7FE 4DW2U 2VNTA 3KQEA 4IS5A 1DVAH 1MU8B 2QYIA 1D3QB 2A4RA 5C3NA 1PQ8A 1JWTA 2OC1A 2FI4E 4MLFB 1AI8H 2PKAA 1DLKB 2P16A 1B5GH 5C2ZA 2V3OH 1P2NA 1TQ7B 2VIDA 4JMYA 2G5NA 1QJ6B 2GMTB 1FLEE 2QXIA 3A7YA 3PWBA 1OOKB 2OC7A 2QIQA 2ZWLH 4WXIA 3PM3A 3SJOA 1MTUA 3TGIE 1O39A 1V2OT 1GHBF 5C5OA 5DP5A 1GHVH 4LOYH 5GJ4B 1SR5C 3P70B 1TPSA 2ZC9H 4Z6AH 2VIWA 2OBQA 4K1EA 5EU8A 2HRVA 1C5VA 3M7TA 4K60A 1O3BA 1ZPBA 3RC4A 1NT1A 1F5KU 1YGCH 2ZHWH 1AGJA 1TA6A 3T26A 2FODA 4E7RG 2P3FH 2W3IA 2GV6A 4AZ2B 3GDVA 2H9TH 4Y8XA 3U98H 1CHOG 1CO7E 1KLIH 5HGGA 2GCTC 4UFEH 1C1UH 3KL6A 3SGQE 4E05H 1MTVA 1ABIH 1O2RA 5FPTA 3GY4A 1EJNA 4DURA 1RJXB 1SB1H 4XSKU 3ZV9A 1NRSH 3F9EA 1O38A 3STIA 1Y3VA 1A46H 1HXFH 2J95A 3RXKA 3RLYH 2GCTB 1ETTH 4U01A 1P9UA 1H9IE 3P95A 2BY8X 3RXPA 1SLVB 4Y10E 8GCHG 2VVVA 2H2ZA 2WV5A 2XBWA 1TPAE 4Q7YA 2ULLA 3A7VA 4GHQA 1YCPK 1ZJKA 3EA9A 4JZDH 4OS1A 3SUGA 1W7XH 3KNXA 1MBMA 1HUTH 2CHAC 3QUMP 2PGQB 4ISHH 2FM2A 3FFGA 1NC6A 1NN6A 2J4IA 4ZHMU 3SU0A 3HGPA 1AO5A 1CHOF 4I32A 3D49H 3M5NA 3RXHA 1QBNA 2VIOA 2AGGX 1NO9H 2LPRA 2VWNA 1QR3E 1ETSH 1UTOA 1RTFB 2F3CE 3OY6U 3D65E 4ZMAH 3SGAE 3SUFA 2TGPZ 1PQAA 1C2DA 8GCHF 3UPEA 2V3HH 5DP8A 3U9AH 1P09A 3LDXH 1QFKH 5FHTA 1DFPA 3QZRA 2XC0A 3EGKH 1KIGH 1ZMJA 4GSOA 2ZEBA 3TH4H 1QB9A 2BOHB 1LKAA 2TGAA 1CA8B 2A2QH 1GI5A 2ASUB 1HDTH 4X2WA 8ESTE 2A7JA 1E38B 2Z3DA 3SU6A 2BD3A 3SNAA 3B8JA 3GCHC 3SHCH 2CGAA 1C2GA 4XBBA 2GP9B 1O3OA 5FX5A 2PW8H 2ZFRH 1A0HB 1GDQA 2HNTC 1P01A 4B2AA 4BOHA 4AN7A 3BF6H 4H4FA 4JZ1A 3S9BA 2RA3A 5FPYA 4CR5A 2LNCA 3ZZ6A 3LOXA 2FTLE 2WPIS 4UE7H 3ZZ3A 2BVXH 4MQAA 4ZH8A 4X2XA 1O5BB 3RM0H 3SUDA 4K69A 1ELAA 1HXEH 1FJSA 1BJUA 1XKAC 1HAXB 3P6ZB 5DP3A 1MKXH 2WINI 3L3TA 1H1BA 1SG8B 2ZFPH 3I29A 1MD8A 3F68H 1JMOH 3NK8A 2F9BH 2BD7A 3A7ZA 2Y7ZA 3PLBA 4D8NA 1P11E 1C1VH 2PUXB 1QJ1B 2A4OA 4MNYA 1GI7B 2AERH 3FANA 3TK9A 1EQ9A 3UY9A 4X2VA 1LVBA 1QL8A 1TGNA 2A7HA 3A8CA 3V3MA 2J2UA 4M7GA 2VH0A 1DANH 1V2MT 2SGFE 2P59A 2ZNKH 4O9VA 1V2JT 1TOCB 1G2LA 2R2WU 3ZZDA 3JZ1B 3OTJE 1PFXC 4TPIZ 2BLVA 4AORA 1SGNE 1GBBA 4O3TA 1IHSH 2BD9A 4TY6A 1O3AA 1CGHA 4FU7A 2BDAA 5A0CA 3ZVBA 4DCDA 2B7DH 4X0WU 5JB8S 1DOJA 1EZUC 1UK4A 1FY8E 4YT7H 1W11U 1AKSB 1D6WA 2P8OC 1FIWA 3UOPA 3BTEE 2ZECA 5C1XA 3KIDU 1EOJA 1MAYA 1O2ZA 3SQEE 1ELFA 4B71A 1HPGA 1A7SA 1O2MA 2FZZA 1GGDB 5CHAC 2P8OB 5A2MH 1MZAA 4IMQA 3FP8E 3MO6A 1PPCE 2PKSC 2BLOA 3SU3A 2A7CA 1YC0A 3HKIB 1AWFH 3E16B 2QV1A 2W26A 2JETB 2G55A 1C5PA 1A1RA 2DUCA 4DT7B 1AMHA 2G51A 2PKSB 2STBE 1G3CA 1YBWA 1IQIA 1QHRB 1GJ4H 3D23A 1GJDB 2ZF0H 1P8VC 2HNTE 2QXJA 1O33A 1YYY1 4X8UH 3BG4C 1BBRH 3SI3H 3TH3H 1BTZA 3T2NA 1EB2A 4RKJB 1SSXA 3NXPA 4FUDA 2HPPH 2Y80A 3LGVA 4X8VH 3UR9A 1LQEA 1O37A 1GJAB 4Y8ZA 3BG4B 1C1SA 5A8ZA 1MKXK 1FV9A 1ID5H 1RTLA 2FEQH 5EOKA 1OP0A 3GYLB 4AG2A 1TONA 4X1QU 1HRTH 4Y7BA 1DY9A 1V2NT 2VGCC 4DVAU 1IQKA 1W12U 3WY8A 2AFQB 2BX4A 3HGNA 1DE7H 1GI3A 3T62A 4AFQA 4MVNA 4X6OA 1LHFH 1Z6JH 3ZVDA 3MFJA 1E37B 5JBAS 1RD3B 1FZZA 2WV4A 1GVZA 2AYWA 2V35A 4RSPA 1FY1A 3ZZ5A 3SQHE 4HZHA 1GBCA 1T31A 1V2UT 1Y3YA 3V12A 2XYAA 1UVTH 2H9EH 2O8MA 1SLWB 5C67A 1SL3A 1AVXA 1UCYH 3KHVA 2PLXA 1TBQH 4WH8A 1ETRH 1UTMA 3LIWA 2BZAA 1ZTKA 5ABWA 3ZZ4A 1Y3WA 3E6PH 1YLDA 1S0RA 4VGCB 5TCAA 1PPEE 3FZDA 3KGPA 1NFUA 5G4BA 2AGIX 3S7HB 1DWDH 2Y82A 3SJ8A 3TNTA 4TYDA 3MTYA 1T7CA 2ZO3H 1LCYA 1QCPA 1G32B 1VCPA 1P04A 2A5IA 4KTCA 2BXTH 1SGFG 3BV9B 5GCHG 4CRFA 1SGEE 1V2RT 2QF0A 2QXGA 3I78A 1GJCB 2BD4A 1G3EA 4J2YB 5F6MA 1O3LA 2EA3A 5A09A 1WAYB 1NZQH 3MMGA 1O5EH 3EAJA 1QTFA 5F8XA 3ZVGA 1ZR0A 2BQ6B 5LPFA 2TPIZ 1HJ9A 2AEIH 1HAGE 2O9QA 1AY6H 2D1JA 3A84A 3O8DA 4THNH 4RN6A 3DD2H 3N7OA 3PYHA 1KXAA 4NZLA 4DGJA 5EODA 1VGCC 4GCHF 3OY5U 1YLCA 4TPYA 5HMAA 1IOEA 1GDUA 1THRH 1TNGA 3MO9A 2C93B 5EXLA 3UFAA 2UWPA 3AASA 5GCHF 1O2HA 3EQ0H 1EUFA 1O5CB 1S82A 1F5LA 5B6OA 5EPYA 1YPLH 4DIIH 4UFFH 3RXCA 3ITIA 1YP9A 4D9RA 1K9OE 3RXGA 1AIXH 5JBCS 4Y71A 4BNRA 3NUMA 4K3JA 1UVPA 1Z71A 1BMMH 1C1OA 2J92A 1BRCE 1KXDA 2IN2A 3UNSA 3MU8A 4JK5A 5T6GA 1MD7A 1HAPH 1WBGB 2WPJS 1KXFA 2ZCLP 3F6UH 2EI8A 1DSUA 4XBCA 3H5CB 2EI7A 3DT0H 1DPOA