1Z8RA

2a cysteine proteinase from human coxsackievirus b4 (strain jvb / benschoten / new york / 51)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
150
Chain Sequence
GPYGHQSGAVYVGNYKVVNRHLATHVDWQNCVWEDYNRDLLVSTTTAHGCDTIARCQCTTGVYFCASKSKHYPVSFEGPGLVEVQESEYYPKRYQSHVLLATGFSEPGDAGGILRCEHGVIGLVTMGGEGVVGFADVRDLLWLEDDAMEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of coxsackievirus B4 2A proteinase, an enyzme involved in the etiology of heart disease.
pubmed doi rcsb
source organism Human coxsackievirus b4
molecule tags Hydrolase
molecule keywords Coxsackievirus B4 polyprotein
total genus 24
structure length 150
sequence length 150
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8rA01
5EPYA 3ZV9A 4D76A 3GY5A 1QB1A 1YM0A 3V13A 8LPRA 2OBOA 1ZPBA 2EEKA 2ZCKP 1LHFH 2BHGA 3B23B 5DPAA 1P02A 4MVNA 3P70B 1BTYA 4OGXA 1O3CA 1AZZA 4GUXA 3UPEA 1N6YA 3TU7H 1TYNA 4I7YH 5BRRE 3UIRA 3B9FH 1A5IA 1TA2A 4ISHH 4U32A 1AVXA 2WPMS 1AY6H 3A7VA 2P3TB 3PTBA 3PLPA 2BLOA 1L4ZA 4I8GA 1CGHA 3SJ9A 4ABJA 5T6GA 3LU9B 2ZPRA 1EAWA 2P3FH 1P12E 2BDBA 2SFAA 1QJ1B 2B8OH 4FUDA 3KGPA 1RGQA 1AD8H 5FBEA 4LZ4B 3ATLA 1LQDB 1VITF 7LPRA 2GX4A 3A7ZA 1K21H 3P92A 1O3IA 4X2VA 4K60A 3BTKE 1TPOA 1XUIA 2FTLE 2BTCE 3RXEA 1C1RA 1GMDG 1WCZA 3RXQA 2RDLA 1AUTC 1O2OA 3H7TA 1BMLA 1GG6B 1KXCA 1KYNA 1O3FA 2FOGA 4E7RG 2AMDA 3CS0A 4NCYA 5SGAE 4GCHF 1CO7E 5FPYA 1LHCH 3F9FA 1P2KA 4ASHA 1BTWA 1SGNE 3SV8A 1MTUA 1ELFA 1F7ZA 2Q6DA 1G37A 3HGPA 1O36A 1AB9C 1BMMH 3E3TA 2J94A 3E6PH 1P04A 5L2YH 2GZ7A 1TGTA 3PLKA 2H9HA 1UCYH 4BAKB 2VH6A 2AEIH 1ZOMA 2F9PA 4KKDA 1CE5A 3ZYEA 4AFUA 1WTGH 2FWWA 4ZHLU 1O3GA 1O2MA 4Y7AA 1GWAA 3GY3A 2KAIA 2ZTXA 3URCA 4DOQA 1HFDA 3STJA 3A80A 4XE4A 2FDAA 2QXJA 3E91A 3MOCA 5FPTA 3MO9A 1C2IA 4JZEH 1KXEA 2Y80A 3R0FA 4GVUA 5E2PA 2ZHEH 2EI7A 5AFYH 2GGVB 2BDYA 1SQOA 4CRCA 3GY7A 3ENSB 1WQSA 1G2LA 2JETB 3ZZDA 3SUGA 4WH8A 1HIAB 3TNSA 1C5UA 4K2YA 4KP0A 2ZHWH 1ORFA 2VGCC 3SHAH 2Y5FA 5GPIB 4GHTA 2ILNA 1A3BH 4NZLA 1XUFA 4IN2A 3UOUA 3LGYA 1W14U 1HLTH 4RKJB 1S0QA 1ZHMA 4Q7YA 1FN8A 3HK6B 4FUFA 3RXOA 4RN6A 1G32B 4JK5A 2RA0A 4B2CA 3TNTA 1YGCH 5F8TA 2CF9H 3K9XB 1TA6A 4DG4A 2UUFB 1GBFA 2A2QH 1V2NT 4A1TA 3U8OH 4BTIB 2BOHB 2OXSA 4AZ2B 1EQ9A 3T26A 3BTQE 4BANB 1FV9A 5EXNA 1P57B 4BNRA 1CSOE 4MPXA 2ZWLH 1GHAG 4E7NA 2BX3A 1O3PB 2FI4E 1C2MA 1NRSH 1PYTC 3V3MA 3SOSA 1SGFG 3RDZA 3EE0B 4WVPE 1CBWB 2Y7XA 1ELAA 2LNCA 1QBVH 1AKSA 1PPCE 3KF2A 4MNWA 4IMZA 2A5IA 2VU8E 3L33A 3TK9A 5FCKA 2BZ6H 1LVMA 2A5AA 1O5BB 2G51A 1DWCH 2XC5A 2AGGX 2W3KA 1UVSH 2GCTB 1TGBA 3ZVBA 4KTUA 1S81A 1GI5A 4Y79A 2ZO3H 3BTGE 2CXVA 2C3SA 1IHTH 2WUCA 3A7WA 2W7UA 3KEEA 3QDZB 1HIAA 3AASA 1O2UA 1UTOA 1BHXB 2A2XH 1MD8A 4K1EA 3ZZ3A 6CHAB 1HAVB 1Q3XA 4ISLA 3A8CA 1FPCH 3NKKA 2Y82A 1KTTB 1Z8IB 2Y7ZA 1UTPA 2BDCA 1G2MA 1Q31A 2ALPA 1MUEB 1FQ3A 4ZUHA 1OP8A 1TFXA 4JZIA 2ZA5A 4MNYA 3UWJH 2GTBA 2J4IA 5J4QA 3AW1A 2Y81A 5F8ZA 4AOQA 1XXDA 1O2IA 1SB1H 2NU1E 2ZG0H 5DK1A 3TIUA 4H42U 1PQAA 1GBTA 3PMBB 2UUJB 3NXPA 2FEQH 2ZGHA 1FJSA 1L4DA 2XBXA 3D62A 3S9AA 4NA8A 2P16A 3FAOA 1ZPCA 1D3PB 5HXFA 2VINA 2ZU5A 1IQNA 2OUAA 2VH0A 1ELEE 1OP0A 1BRUP 4IC5A 4O3TA 3ZZ9A 4CHAC 5T3HA 3BTTE 3KL6A 1P2NA 2ZTYA 3RM2H 4JMYA 4ABEA 4WF8A 1IQGA 3RXPA 1GGDB 5JB8S 4Q7XA 2CHAB 1GBMA 3GCTF 3UREA 1BT7A 2B9LA 1TNKA 2QYIA 1NU9A 3UFAA 4ESTE 1RTKA 1Z1IA 1MKXK 2J9NA 5K0HA 1THSH 3WY8A 3DFLA 2W7SA 2G00A 2P94A 3U8TH 2HPQH 1GBJA 1NFXA 1NM6A 3RXHA 3QUMP 4KGAA 3E0NB 3SNAA 2VIQA 4AG2A 4FUBA 2A4GA 3K6YA 1YPKH 1O34A 1GBDA 3SU4A 2PHBA 3FFGA 4Y76A 1NFWA 1OSSA 3P8OA 2BD9A 1TX8A 1S6HA 4Q2KA 1C2DA 4YTAA 1EJMA 2XYAA 3AW0A 3M7UA 1EZUC 1GVZA 1K1NA 3HK3B 1XX9A 1BMNH 3GY4A 3EA8A 3U1JB 1CQQA 2HLCA 2XRCA 1SGQE 1YPLH 4Q7ZA 1QHRB 2FO9A 1BTPA 2CHAC 1N8OB 2Z9LA 1XUKA 2UWPA 4WMFA 3OTJE 1LVYA 2ZHQH 1SHHB 5FPSA 4X6PA 4KELA 2IPHA 1VGCB 2PFEA 2ZU3A 2C93B 1A4WH 1QB6A 2ZPSA 2C8XB 2QXIA 2H6MA 1QY6A 2CMYA 4ZHMU 2ANKH 1ZTLA 4A1XA 1E34B 2JETC 1HAXB 3F6UH 1V2WT 2BM2A 2GZ8A 2BX4A 1H4WA 1O39A 4Y8XA 1E36B 1LPKB 5F6MA 3PO1C 3V12A 3QWCH 1O3JA 1V2JT 4GCHG 4B73A 1RIWB 1TMBH 1ZGIA 1TAWA 2SGFE 3RXSA 1OWJA 1BUIA 4NIYA 2LPRA 4Z6AH 4ISIH 2BDHA 1AHTH 1LKAA 2TPIZ 2EI6A 2VB0A 1UTMA 2BY8X 1A7SA 4WXIA 1GJBB 1K9OE 4ZXXH 1O32A 4NG9H 1P2MA 2PUXB 3M7QA 2WPLS 2R3UA 5CHAC 3PO1B 1SOZA 5DKMA 2Z3CA 2ZIQH 1BHXF 3F9HA 3PMHB 3Q3YA 2B5TB 1Y8TA 1P05A 1AO5A 3RXCA 1GHYH 4PROA 1TRMA 4B2AA 1QB9A 1AB9B 1D9IA 1O2RA 1TGSZ 1GJ5H 3UUZA 3PMJA 2FP7B 2ODQA 1F0SA 4KTSA 1OWKA 1QQ4A 3QLPH 1O5FH 4B75A 4SGAE 3MU8A 4IS5A 3TPIZ 1D4PB 1UTNA 4ZHAA 5J4SA 1GMHF 3T2NA 1SPJA 2QXGA 3UWIA 3MMGA 2NU3E 5A8XA 4RSPA 1CHOF 1WSSH 3LT3A 2Y5HA 1DWEH 4X1QU 1KXAA 1MD7A 1J15A 1A5GH 1VZQH 3L6PA 1NO9H 5T6FA 1TOMH 4DT7B 2BXTH 2FOAA 4B76A 1N1LA 6GCHF 2G55A 1BZXE 3PROA 5EPNA 4X8UH 4KTCA 2WPIS 2BLVA 1EX3A 2ESTE 5I25A 2SGDE 3S7KB 5LPRA 1O3BA 1S0RA 3BF6H 3SU1A 3LC5A 4E05H 1C1OA 4I31A 2PSXA 4CBOA 5DP7A 1LVOA 2PV9B 1T8OA 2P8OC 2P93A 2HPPH 2O8TA 3TK5A 2TGTA 3W95A 1GL0E 5A8ZA 2FODA 1SI5H 2Z7FE 3PM3A 4D7GA 1LHEH 3F9EA 1C1VH 2FOFA 3A81A 1ESAA 2HNTE 5DP6A 3SBKA 1FLEE 1P10A 1GDQA 1EJNA 1FPHH 4WMEA 1W7GH 3ODFA 4Y11E 3RUOA 2QV1A 4DCDA 1C1TA 5JBAS 4AG1A 2HOBA 3FP8E 4UEHH 1XMNB 3ATIA 2PKSB 2WYJA 2RCEA 3RXRA 2OC7A 1GPZA 2IN2A 2OD3B 1F0RA 1ELBA 2UUKB 1S5SA 3TITA 2D2DA 3VXEH 3MH6A 1WQVH 4NWLA 1ELCA 1GCTB 4JK6A 4IW4E 3RLWH 5A0CA 1JOUB 2BD2A 1QCPA 2FXRA 2K1QA 3GICB 4NWKA 5BPEA 2BOKA 1NFYA 1QGFA 3BIUH 3SUDA 3U8RH 2QXHA 2XC0A 5LPFA 2VGCB 1ZMJA 2EA3A 4ZKNU 3M35A 1BBRK 1QL9A 1SVPA 3MH5A 1W2KH 4UE7H 4NGAH 3EYDA 2Z9JA 1M9UA 3LIWA 3OSYA 8GCHF 1C5QA 2H5CA 1MKWK 4WH6A 3D49H 4X8TH 4YESB 1Z6EA 1PPHE 3RXBA 5JBCS 3A8AA 3BIVH 1Z7KA 3GDUA 3PWCA 1KLJH 1MU6B 3TJVA 1A5HA 4A92A 2FLRH 2ZGXH 4NSYA 1A61H 3ZZ7A 4WWYA 1C5TA 1GI0A 1YKTA 1W13U 4XOJA 2OC0A 1YP9A 3MU1A 1O2WA 1C5ZB 4VGCC 5EXLA 3P8GA 3LONA 3Q77A 1Y5AT 5A0BA 1IQFA 3LH3A 3OYPA 2ZEBA 1NY22 3HATH 1KSNA 1TNLA 5C1YA 1ZSJA 1V2KT 3FANA 2HGTH 4F4OC 4X0WU 3RLYH 2G5VA 2P8OB 2FIRH 1D3QB 1TQ7B 3E90B 4H4FA 3ZZ5A 1KLIH 1C2EA 1ZJKA 3IG6B 2JKHA 1XKAC 2FOEA 1UVPA 1EJAA 5TCAA 1DSTA 5EQRA 1GG6C 3I78A 4UD9H 2NU0E 1WUNH 2P59A 4UFEH 4Y6DA 1SSXA 2Z9IA 2J95A 4O97A 2HRVA 2XWAA 1ETTH 1J16A 3OX7U 5AFZH 5E0JA 4YT6H 1BRAA 1GMHG 3HPTB 1YPHC 3D23A 4GAWA 1HAZB 1RFNA 4CH2B 1GHXH 2V0BA 1F2SE 3AVZA 3PV4A 3TH2H 2ZDKA 1LKBA 1ZHRA 1C1QA 2H1UA 1P9UA 3VGCC 1AE8H 3RXGA 3V0XA 5L6NH 1PQ5A 2Z3DA 2ZGBH 3GY6A 1OX1A 2R0KA 3DUXH 4XDEA 1JMOH 1TBQH 1C2HA 2STAE 1LTOA 2ALVA 1B5GH 1L0ZA 3U1IB 3P6ZB 4CR9A 2F9UA 4DIHH 1O5DH 3LGWA 4DW2U 2OQUA 2FPZA 1HAGE 1UHBB 1K1IA 3SQHE 6CHAC 1YPMH 1BJVA 2ZFQH 4ABDA 2A1DB 5C20A 3Q76A 1YF4A 1NT1A 2WUBA 2ZECA 1THRH 7ESTE 3UY9A 1P2JA 1S85A 1AUJA 1E37B 2BB4A 3SHCH 1RIWC 4FXGH 1K2I1 4JZDH 3SV7A 1YPGH 2FESH 5I46H 2BQ6B 4NFEA 3EA7A 4NA9H 3O8DA 1EAXA 5FXLA 4FU7A 4INKA 2G5NA 3BTFE 4Y7BA 5PTPA 4X1SU 4K5ZA 1K28D 1HB0B 3P8FA 4H6SB 2EC9H 1QA7A 1C1MA 1K22H 4K1SA 5EW2H 4WJG2 1V2PT 1DY9A 1TONA 1SQAA 5FBIA 2Z6BD 1MCVA 4ZH8A 1OXGA 2SGQE 3GCHB 4OS6A 1QL7A 2Q6FA 1VGCC 1NESE 1FNIA 1LCYA 1O2NA 5DG6A 2AGIX 1V2ST 4B2BA 1BTXA 1RRKA 1MTNC 1YLCA 1C5OH 1QRZA 1CT2E 3MH4A 3UQOA 1VJAU 2ZU4A 2R2MB 3C1KA 1A0JA 4B74A 1BBRE 5DP4A 2P95A 4TYDA 2XBWA 4K69A 1MKXH 1BRCE 3SW2B 4Y8ZA 1KY9A 1GVLA 3Q3XA 1GJDB 5LPEA 1G9IE 4YZUA 2FYRA 1XUHA 2FOCA 4CRGA 2BDIA 1GI8B 1YPEH 2VWMA 4X8SH 1QTFA 3DT0H 1SL3A 4XBBA 4HI3A 3ZVGA 3GISB 1B7XB 1Y59T 1PJPA 4BOHA 1SFIA 1TNGA 3KN2A 5HYOA 5EQQA 2VWNA 1KXBA 1V2TT 4R8TB 3A82A 4CR5A 4TPYA 1V3XA 1XVMA 4GLYA 3R3GB 4BTUB 2ZFSA 1QRWA 1EZSC 2O8LA 1O3NA 3RXDA 4LOYH 3ZYDA 4OS2A 1KTSB 4UFFH 4ABFA 2Z94A 2KAIB 4ISOA 1T4UH 1YYY1 3N7OA 5EOKA 1Y5BT 4X6OA 2STBE 1UVUH 1UHBA 3UQVA 5HGGA 3LJOA 1FY8E 1TWXB 1Y3XA 1LHDH 3A86A 2VJ1A 1G3DA 1BOQA 4LK4A 1KLTA 4Y8YA 1O2JA 5GWZA 2AERH 1DUEA 1JRSA 4AGJA 4XSKU 4ABHA 1J8AA 3BEIB 1TE0A 1P9SA 2GT7A 1C5XB 1X7AC 1K1PA 4UDWH 3SV9A 1G36A 1FY4A 3RXMA 3T25A 2VIWA 1CA0B 3I29A 2BD5A 2J2UA 2FS8A 4CRAA 1ACBE 1UTLM 2ZC9H 3A7YA 1FIWA 2XCNA 3SV2H 1O3AA 1AI8H 1DSUA 1GBHA 1C5LH 1LVBA 3MNXA 1AVWA 2BVSH 3LC3A 5FX6A 1BITA 1UVOA 2FMJA 1ABIH 1P0SH 3A88A 2PSYA 1UCYE 2ZFPH 4INHA 3GDVA 4JYUH 1C2GA 1EP6A 7KMEH 1H9IE 5JB9S 1ELTA 4X1PU 5C5NA 3ZZAA 4JZFH 2H9TH 1GHVH 1T8LA 2V3HH 1P3CA 1ZGVA 1TBRH 1H8DH 2V35A 2ULLA 4AYVB 2GD4B 1OS8A 1P03A 2BXUH 3ZVCA 2GDEH 1Y3UA 4ISNA 5DJ7A 4Q80A 5H4IB 4HGCA 2A4OA 3SU2A 1OP2A 4Y10E 1D6WA 4O3UA 4HFPB 1ETRH 3O8RA 1UMAH 1LMWB 5GJ4B 1UK4A 3C27B 2GT8A 2BD3A 1A2CH 4E06H 1DOJA 4GSOA 4MNXA 1MZDA 3M37A 3I77A 2F83A 1YCPH 3MH7A 3ITIA 3E8LA 1S83A 4ZKRU 1O3KA 1IHSH 1K1LA 3JZ2B 3ODDA 2PGQB 2OQ5A 2V3OH 1F5KU 2ODPA 9LPRA 3SUEA 1MTVA 2OBQA 5HM2A 1S6FA 5GCHF 1DITH 9ESTA 1C5VA 1UCYK 1ZYOA 1CBWC 3PLBA 3ZZCA 1ARBA 3EA9A 1ZMNA 2SNWA 3RXAA 1G3EA 4FUGA 4TPIZ 1NRQH 5GIBA 4THNH 3M3SA 4Z0KA 1J17T 1LPGB 4AX9H 3LOXA 2TIOA 1TNHA 2TGPZ 1TX7A 2BY5X 3FZZA 3SN8A 4AORA 1YCPK 2XWBI 4YLQH 4LXBH 4A7IB 5A09A 5DO4H 2VNTA 1KXDA 1GMCG 2A31A 1BRBE 2Y6TA 4U2WA 1PQ8A 1HGTH 3TJOA 5DP9A 4NIXA 2ANWA 1MTSA 1MMJN 2ZI2H 4H6TA 4ABAA 1JIMA 1CHOG 3BTWE 4YOGA 1WU1A 1TGNA 3S9CA 1ZJDA 1O38A 1QBNA 1V2OT 2H2ZA 1LHGH 3TH3H 1O3LA 4X2YA 1HBTH 6GCHG 2WV4A 3VB7A 3RC5A 2CGAA 1GJAB 1ANDA 4DY7B 2TBSA 7GCHF 1HJAB 1P06A 1HAYB 4Y0ZE 3VB3A 3T29A 1ZPZA 1EATA 1V2LT 1UTJA 1UO6A 3MWIU 1GI1A 2ZFFH 1CT4E 3A89A 3AAVA 1T32A 1EOJA 2ZTZA 2DE8A 1QBOA 4MQAA 4I8JA 3A85A 2ZCHP 2F9NA 2I6SA 3RU4T 3O8BA 3Q00A 2XBVA 3DD2H 3EQ0H 3LGUA 2F91A 1O30A 2G4UA 1L2EA 1SQTA 1Z8JB 1HJAC 1BDAA 3TGKE 2F9BH 5EGMA 2GP9B 1FY3A 2O8UA 1TABE 2VIOA 3F1SB 3FVFB 1NS3A 1AIXH 3G01A 2ZHDA 4AN7A 1IQIA 1GVKB 1IQHA 3MU5A 2BVXH 1C9TA 3MFJA 1GI4A 1OKXA 3OY6U 2YOLA 4K1TA 3QTOH 2HALA 3LPRA 4YT7H 1GBAA 1Z6JH 3T27A 4NZQA 1IQKA 4J2YB 2VVVA 3SO3A 1W7XH 1EPTB 1GBKA 4FUJA 3K2UA 3CP7A 2F9VA 4M7GA 2VIPA 5F8XA 1EP5A 3S0NA 1O0DH 2Z9GA 1EOLA 5ABWA 2IOTA 1MBQA 4K3JA 3MNSA 1PPEE 1AU8A 1S82A 1KDQB 3MNCA 1AFQB 2J34A 4CH8B 2OP9A 1W10U 1LO6A 1YBWA 3NCLA 3SUFA 2D8WA 2PKAA 1O2PA 1TRYA 2UWOA 3KQEA 4Y0YE 3TVJB 5AF9H 1AWFH 1DXPA 1W0ZU 2WYGA 3M36A 1D6RA 2AMPA 3HGNA 4XBDA 2JH5D 5A2MH 1CHGA 1NROH 3TJNA 5JPMH 1SHYA 3Q3KA 2HNTF 3GY8A 1THPB 3P8NA 3VB5A 2D26C 1FY5A 3HKIB 3QTVH 4B71A 1C5NH 1O5AB 1QNJA 1ZRBA 2TGAA 2ZNKH 1DVAH 2BD7A 1AE5A 5GCHG 3JZ1B 1GI2A 2AS9A 1HAOH 4JYTA 3GCTG 1A0LA 1W12U 3SNDA 4D9QA 1NU7B 4TY7A 1QIXB 1MQ5A 1LPZB 3A84A 5E0HA 3ZVAA 1O2HA 3FP7E 1QJ7B 1MAXA 3SNEA 1GJ8B 1C2JA 3PB1E 1C4V2 3URDA 3S69A 5EQSA 4NIWA 4X1RU 3D65E 3SORA 4F49A 2ZDLA 2Z3EA 3TGIE 2PTCE 1PFXC 2GMTB 1DWDH 1P2QA 3RMLH 1HV7A 5ETXA 3PWBA 2F9OA 2RG3A 1FAXA 1PPBH 4X2XA 1V6DA 1U6QA 5A0AE 1JIRA 3LDXH 1MQ6A 1YCPM 3SU3A 1HXEH 2B0FA 1DICA 1JRTA 4AFQA 3U69H 3VPKA 3M7TA 2DE9A 2ANMH 2QIQA 1ANEA 2UUYA 1XVOA 1TQ0B 4FUIA 5A8YA 5TJXA 5EG4A 3SI3H 1O5CB 1HYLA 1EASA 1ZHPA 1RJXB 2B7DH 3BG4B 3KQDA 3RXFA 3SZNA 1DLKB 3ESTA 4HZHA 4ABBA 1SGTA 2O9QA 1HRTH 4FUHA 1AFQC 1H1BA 3BG4C 4X6MA 4CHAB 3O8CA 3MU0A 3VEQB 5C2ZA 1AGJA 3PTNA 1GBCA 2VVCA 2AMQA 1FI8A 2BY7X 4O9VA 1RXPA 1Y5UT 1FMGA 3A87A 2AIPA 2FLBH 2ZF0H 5C3NA 3EDXB 1MU8B 1NN6A 1VCWA 1HUTH 2CN0H 1C5PA 1CA8B 3QN7A 3DHKH 2PLXA 2ZHFH 3ZZ6A 5AVDA 1HXFH 1GCTC 3KQBA 3KQCA 3BTDE 3SJIA 1AVGH 1XKBC 2BDGA 1DXWA 3UR6A 1WOFA 2ZGCA 3VGCB 1ESTA 4MLFB 3STIA 4TWWA 3E16B 4AB9A 1BMAA 3BV9B 1CU1A 1GBBA 1ESBA 4WMDA 5FHTA 5ESBA 1DWBH 1DUAA 1D3DB 4TY6A 2J92A 1LDTT 1NZQH 1QJ6B 5LH8A 1NC6A 1O2LA 1UTKA 2BD8A 3RU4D 1IOEA 1T7CA 2ZCLP 2PUQH 1AMHA 3SU5A 1O3DA 5JBBS 2ANYA 2O8MA 3RM0H 3RP2A 6LPRA 1DM4B 1PPZA 3ATKA 2VWOA 2GCTC 1BA8B 1OWIA 1DS2E 3VB4A 1GBLA 3GOVB 3IITA 1WYKA 2OLGA 3BSQA 1Z8GA 5E8EH 1TPAE 1XUGA 3TGJE 1HAHH 1PYTD 1ZTJA 1SR5C 1FUJA 1YPHE 4FU9A 1O2QA 2H9EH 2SGEE 1J9CH 2XW9A 2AYWA 2PGBB 4U01A 1ANBA 5E0GA 2AFQB 1DX5M 1CVWH 3VXFH 1H8IH 1EAUA 4MTBA 3SGAE 1GMCF 1GJ7B 1O2VA 4DGJA 3NWUA 2ZU1A 4BAHB 1TALA 3S7HB 2PW8H 4VGCB 1MAYA 3T62A 4MDSA 1O2SA 3TH4H 3RC6A 2A7CA 1N6XA 4A1VA 4I33A 1EKBB 2GCHF 1BJUA 1AKSB 1C1SA 3K6ZA 3MO6A 5K7RA 2A7HA 1E0FD 5G4BA 4BAOB 1O5GH 2BQ7B 4YM9A 1SGPE 3RXIA 1SGEE 1SG8B 2BLQA 5EW1H 2XC4A 2PWXA 2A45B 1Z8RA 5LGOA 3T28A 4OS4A 7GCHG 1EAIA 1BTHH 1TNIA 3QZQA 3ZVFA 1A46H 5DGJA 5GDSH 5EXMA 1FAKH 2QN5T 3ZZBA 1O2GH 4D8NA 3P17H 4X6NA 1VR1H 3MNBA 1WV7H 2ZFTA 1SLXB 2HVXA 1UVTH 4UONA 1KIGH 1NRNH 1TOCB 1QFKH 1O33A 4ZKSU 2W5EA 2F3CE 4I8HA 4X2WA 4IBLH 3ZZ4A 2CF8H 2WV5A 4OS7A 4NSVA 1SLVB 1K1JA 3MHWU 3QO6A 4ZROA 4OS5A 1TGCA 4O03A 1W8BH 2H5DA 4YLUA 1IAUA 2M5TA 3RMMH 2FX6A 1C4Y2 2VIDA 2VVUA 1GJ6A 2ZKSA 1H9LB 1EPTA 1DDJA 1MCTA 1EUFA 5DP5A 1SGCA 1Z71A 5DP3A 3SJKA 1W3CA 5ESTE 3UNRA 1YLDA 3SNCA 2IJOB 4AB8A 5C1UA 4MNVA 1NRRH 4AYYB 2QF3A 8GCHG 1HDTH 1OYQA 4FUEA 4AFSA 2C90B 1VITG 3GYLB 2EI8A 2YNBA 1TLDA 4MPUA 2GKVE 3LGVA 1D3TB 1EB2A 1ARCA 4A6LA 3ATWA 1TB6H 3M61U 2RA3A 1G3CA 4QT8C 3K65B 1W11U 2FX4A 1FN6A 1ZSKA 2R9PA 3QGJA 1VCQA 2OC1A 2WPHS 5L2ZH 5FX5A 1C4U2 4INLA 1A0HB 2AGEX 4SGBE 2HNTC 2OTVA 2OCVB 3NUMA 3A7TA 2WPJS 2BDAA 3NPSA 3KHVA 1CGJE 1SGYE 2GVFA 3M3VA 2A4QA 5C5OA 3V7TA 3S9BA 1GGDC 1HCGA 3ZVEA 1NFUA 1QA0A 2GV7A 5EODA 2V6NA 5EU8A 3W94A 1G3BA 5JYIA 2BMGB 2C8ZB 1ZR0A 2P3UB 4BTTB 1SLUB 3SU0A 2G8TA 1ZLRA 3CS7A 2WINI 4R0IA 3F68H 1C1WH 1F5RA 3TLOA 2ZDVH 4BAQB 1HAPH 2HWLB 1A3EH 5CMXH 4IC6A 1ZMLA 2J38A 3ZV8A 1P11E 1GI7B 1E35B 1GHWH 2SGAA 3BG8A 1C1PA 4RKOB 1A1RA 5CE1A 2I6QA 3UTUH 1O3HA 1S84A 1F0UA 3RXUA 3DFJA 1Z1JA 2ZFRH 1GHBF 1QURH 1DPOA 5CHAB 2ZQ2A 2A0QB 5IYTA 1PPFE 3RXJA 3M5LA 4GHQA 1HAIH 2BZAA 3PYHA 1GDNA 3SJOA 2PKSC 1QRXA 3U98H 4IN1A 1T31A 4AGKA 1P09A 1O3MA 4K8BA 1H9HE 1O2TA 3QGNB 1GI9B 1SGDE 3EGKH 2A7JA 1NTPA 1QQUA 2YNAA 3H5CB 1Y3WA 2G52A 2ZU2A 3BEUA 3BTME 1EPTC 1RD3B 3NK8A 5B6OA 1W0YH 1YC0A 1QL8A 1GJ9B 1TNJA 2THFB 1DT2A 3RU4E 3SNBA 3MTYA 2C8WB 1L1NA 1WBGB 1RTFB 1C5YB 1SLWB 1SFQB 1HAVA 4BAMB 3UNQA 1BCUH 1MTNB 2ZP0H 2Y5GA 1VJ9U 3QX5H 4ZXYH 1PQ7A 3NZIA 1ABJH 2FZZA 1GJCB 4FU8A 1MH0A 2R3YA 1F0TA 4CBNA 1C9PA 2XCFA 1NPMA 1IQMA 4FVDA 4DURA 1UK2A 1GHZA 5FCRA 3SGQE 1JBUH 2O8WA 3OU0A 6ESTA 1DLEA 1ZZZA 3MU4A 1CA0C 3PMAB 8ESTE 3KIDU 2GMTC 3ZZ8A 4TWYA 1F5LA 2GZ9A 3M5NA 3TJUA 1OWEA 3RXLA 1C5WB 1INCA 3T5FH 1ELGA 4NIVA 3SQEE 2QGRA 3M5MA 2ASUB 1WAYB 1NRPH 2FOMB 3BEFB 5JBTA 4IMQA 3U9AH 1FY1A 1UK3A 5GXPA 2NU4E 1G30B 1CGIE 4ZAEA 4Y71A 2W3IA 1MTWA 4B1TA 4MPVA 1O2YA 2CJIA 5FAHA 2FOBA 1E38B 1L1GA 1BIOA 3EAJA 2VIVA 3KNXA 3FZDA 4XFQA 4XBCA 2DUCA 8KME2 1TX6A 4LZ1H 1JXPA 4I8KA 2AIQA 4JYVH 4MG3A 3UR9A 1TMTH 2C4FH 1WTHD 3OY5U 1HJ9A 1K1MA 1C5MD 1VCPA 4YOJA 4K8YA 3LH1A 3RXTA 2PR3A 4ZMAH 5IDKA 2R0LA 1SGFA 1KXFA 1GBEA 2QCYA 2AH4X 3LGTA 3QZRA 1K1OA 4UFGH 3UNSA 5HM9A 4J1YA 4JZ1A 2FOHA 3F9GA 3P95A 3A83A 2CV3A 4HTCH 1OWHA 1MKWH 1V2MT 1T8NA 3BN9A 4DJZB 5JDUB 3SGBE 1SOTA 2Z9KA 2FYQA 3RXVA 2R2WU 2A4RA 4CRDA 2BY9X 1MZAA 1O2ZA 4WY3A 4YOIA 4I8LA 4ZKOU 3M3TA 2ZDAH 3A7XA 1AFEH 1IQEA 1O3EA 3ELAH 4BXWA 4NA7A 1ZSLA 3A8DA 3GCNA 5E2OA 3ZVDA 2C8YB 2G4TA 2BY6X 1O37A 1GDUA 3HKJB 1FZZA 3MO3A 1FIZA 1O35A 1AWHB 1IQJA 1TIOA 1F92A 1V2RT 1IQLA 5T6DA 1OYTH 1P2OA 1Y3VA 2OC8A 1UTQA 3SI4H 2W26A 4IGDA 1DE7H 2QY0B 3E1XB 1O2XA 4MPWA 4CRBA 1T8MA 4CREA 1JWTA 2XTTB 3B8JA 1GI6A 1VITH 1SGIB 2XBYA 4ABGA 1T4VH 1C1UH 1BQYA 1TPSA 1SMFE 3LKWA 1CT0E 2BQWB 2QF0A 1SC8U 4JCNA 3GYMA 2QC2A 1V2QT 3M5OA 1ZTKA 1DY8A 1QR3E 1BBRH 1V2UT 2GV6A 2XNIA 2PKAB 3RMOH 4U30A 2TRMA 1TMUH 1SBWA 3BTEE 1GHAF 3UOPA 1AQ7A 1KDQA 2FM2A 4BXSA 1OOKB 4I32A 1P01A 2NU2E 4WXVA 2SGPE 2BLWA 3SU6A 1ZRKA 4CRFA 2JH6D 1UJ1A 2SNVA 1GMDF 3DA9B 3RC4A 2NWNA 4NFFA 2OINA 1V2VT 1SGRE 1FDPA 1GI3A 3KCGH 2FI5E 2JH0D 3VFEA 1EXFA 1P2IA 1N8OC 5L30H 1C5SA 1BTZA 2ZQ1A 1BB0B 1XXFA 4OS1A 1RTLA 2A5KA 1HPGA 1FXYA 2QAAA 1O2KA 1C2LA 1Q2WA 3FP6E 2BD4A 1P8VC 4ABIA 3H7OA 1C1NA 2UWLA 1EZXC 1EZQA 1C2KA 2WPKS 1ELVA 1ETSH 1TRNA 4FUCA 1GCDA 2ODYB 5AHGH 1ELDE 1O5EH 3LGIA 1DANH 1RS0A 4GPGA 1C2FA 4OGYA 4A5TS 2FS9A 1XUJA 2BYAX 1Y3YA 1ANCA 2ZZUH 1GJ4H 3TK6A 3MYWA 1O31A 2ZDMA 3GCHC 4DIIH 1ID5H 3GY2A 3SV6A 1PPGE 4D7FA 1P3EA 1AZ8A 5TCCA 1LQEA 1AN1E 1L1JA 4X1NU 3QK1A 1B0FA 1BTUA 5C1XA 3GCOA 1DFPA 4FVBA 3AAUA 1FONA 1TBZH 1TPPA 2TGDA 2G81E 2XXLA 5C67A 4DVAU 2ZDNA 5F03A 1YPJH 3GDSA 2Q1JA 1HJ8A 1MBMA 2ZPQA 4D9RA 2GCHG 3MI4A 4YO9A 1OWDA 3VB6A 1GHBG 2BVRH 1B0EA 2A32A 5HMAA 2ZGJA 3RMNH 1GL1A 1OPHB 3L3TA 2VWLA 2D1JA 4AFZA 3BTHE 3CENA 1C5RA 3E0PB 2QA9E 3IWMA 4UFDH 1EB1H 1XM1A 4X8VH 5DP8A 3ATMA 3A8BA 2Q6GA 3RXKA 2FI3E 2FTMA 1O3OA 2GDDA 3SJ8A 2PTNA 3LJJA 1J14A 1HNEE 1GBIA
chains in the Genus database with same CATH superfamily
5EPYA 3ZV9A 4D76A 3GY5A 1QB1A 1YM0A 3V13A 8LPRA 2OBOA 1ZPBA 2EEKA 2ZCKP 1LHFH 2BHGA 3B23B 5DPAA 1P02A 4MVNA 3P70B 1BTYA 4OGXA 1O3CA 1AZZA 4GUXA 3UPEA 1N6YA 3TU7H 1TYNA 4I7YH 5BRRE 1E79D 3UIRA 3B9FH 4HG6A 1A5IA 1TA2A 4ISHH 2KFWA 2M2AA 4U32A 1AVXA 2WPMS 1AY6H 3A7VA 2P3TB 3PTBA 3PLPA 2BLOA 1L4ZA 4I8GA 1CGHA 3SJ9A 4ABJA 5T6GA 3LU9B 2ZPRA 1EAWA 2P3FH 1P12E 2BDBA 2SFAA 2KCOA 1QJ1B 2B8OH 4FUDA 3KGPA 1RGQA 1AD8H 5FBEA 4LZ4B 3ATLA 1LQDB 1VITF 7LPRA 2GX4A 3A7ZA 1K21H 3P92A 1O3IA 4X2VA 4K60A 3BTKE 1TPOA 1XUIA 2FTLE 2BTCE 2JDID 2AHME 3RXEA 1C1RA 1GMDG 1WCZA 3RXQA 2RDLA 1AUTC 1O2OA 3H7TA 1BMLA 1GG6B 1KXCA 1KYNA 1O3FA 2FOGA 4E7RG 2AMDA 3CS0A 4NCYA 3OFND 5SGAE 4GCHF 1CO7E 5FPYA 1LHCH 3F9FA 1P2KA 4ASHA 1BTWA 1SGNE 3SV8A 1MTUA 1ELFA 1F7ZA 2Q6DA 1G37A 4B6FA 3HGPA 1O36A 1AB9C 1BMMH 3E3TA 2J94A 3E6PH 1P04A 5L2YH 2GZ7A 1TGTA 3PLKA 2H9HA 1UCYH 4BAKB 2VH6A 2AEIH 1ZOMA 2F9PA 4KKDA 1CE5A 3ZYEA 4AFUA 1BMFD 1WTGH 2FWWA 4ZHLU 3H09A 1O3GA 1O2MA 4Y7AA 1GWAA 3GY3A 2KAIA 2ZTXA 3URCA 5C0UA 4DOQA 1HFDA 3STJA 3A80A 4XE4A 2FDAA 2QXJA 3E91A 3MOCA 5FPTA 3MO9A 1C2IA 4JZEH 1KXEA 2Y80A 3R0FA 4GVUA 5E2PA 2ZHEH 2EI7A 5AFYH 2GGVB 2BDYA 1SQOA 4CRCA 3GY7A 3ENSB 1WQSA 1G2LA 2JETB 3ZZDA 3SUGA 4WH8A 1HIAB 1UW7A 3TNSA 1C5UA 4K2YA 4F55A 4KP0A 2ZHWH 1ORFA 2VGCC 3SHAH 2Y5FA 5GPIB 4GHTA 2ILNA 1A3BH 4NZLA 1XUFA 4IN2A 3UOUA 3LGYA 1W14U 1HLTH 4RKJB 1S0QA 1ZHMA 4Q7YA 1FN8A 3HK6B 4FUFA 3RXOA 2XOKD 4RN6A 2YMSD 1G32B 4JK5A 2RA0A 4B2CA 3TNTA 1YGCH 5F8TA 2CF9H 3K9XB 1TA6A 4DG4A 2UUFB 4Q63A 1GBFA 2A2QH 1V2NT 4A1TA 3U8OH 4BTIB 2BOHB 2OXSA 4AZ2B 1EQ9A 3T26A 3BTQE 4BANB 1KMHB 1FV9A 5EXNA 1P57B 4BNRA 1CSOE 4MPXA 2ZWLH 1GHAG 4E7NA 2BX3A 1O3PB 2FI4E 1C2MA 1NRSH 1PYTC 3V3MA 3SOSA 1SGFG 3RDZA 3EE0B 4WVPE 1CBWB 2Y7XA 1ELAA 2LNCA 1QBVH 1AKSA 1PPCE 5CHBA 3KF2A 4MNWA 4IMZA 2A5IA 2VU8E 3L33A 3TK9A 5FCKA 2BZ6H 1MABB 1LVMA 2A5AA 1O5BB 2G51A 1DWCH 2XC5A 2AGGX 2W3KA 1UVSH 2GCTB 1TGBA 3ZVBA 4KTUA 1S81A 1GI5A 4Y79A 2ZO3H 3BTGE 2CXVA 2C3SA 1IHTH 2WUCA 3A7WA 2W7UA 3KEEA 3QDZB 1HIAA 3AASA 1O2UA 1UTOA 1BHXB 2A2XH 1MD8A 4K1EA 3ZZ3A 6CHAB 1HAVB 1Q3XA 4ISLA 3A8CA 1FPCH 3NKKA 2Y82A 1KTTB 1Z8IB 2Y7ZA 1UTPA 2BDCA 1G2MA 1Q31A 2ALPA 1MUEB 1FQ3A 4ZUHA 1OP8A 1TFXA 4JZIA 2ZA5A 4MNYA 3UWJH 2GTBA 2J4IA 5J4QA 3AW1A 2Y81A 5F8ZA 4AOQA 1XXDA 1O2IA 1SB1H 3UB0A 2NU1E 2ZG0H 5DK1A 2QF4A 3TIUA 4H42U 1PQAA 1GBTA 3PMBB 2UUJB 3NXPA 2FEQH 2ZGHA 1FJSA 1L4DA 2XBXA 3D62A 3S9AA 4NA8A 2P16A 3FAOA 1ZPCA 1D3PB 5HXFA 2VINA 2ZU5A 1IQNA 2OUAA 1ELEE 1OP0A 2VH0A 1BRUP 4IC5A 4O3TA 3ZZ9A 4CHAC 5T3HA 2JJ1D 3BTTE 3KL6A 1P2NA 2ZTYA 3RM2H 4JMYA 4ABEA 4WF8A 1IQGA 3RXPA 1GGDB 5JB8S 4Q7XA 2CHAB 1GBMA 3GCTF 3UREA 1BT7A 2B9LA 1TNKA 2QYIA 1NU9A 3UFAA 2KX4A 1RTKA 1Z1IA 4ESTE 1MKXK 5DN6D 2J9NA 4Z1MD 5K0HA 1THSH 3WY8A 5B6LA 1SKYE 3DFLA 2W7SA 2G00A 2P94A 3U8TH 2HPQH 1GBJA 1NFXA 1NM6A 3RXHA 3QUMP 4KGAA 3E0NB 3SNAA 2VIQA 4AG2A 4FUBA 2A4GA 3K6YA 1YPKH 1O34A 1GBDA 3SU4A 2PHBA 3FFGA 4Y76A 1NFWA 1OSSA 3P8OA 2BD9A 1TX8A 1S6HA 4Q2KA 1C2DA 4YTAA 1EJMA 2XYAA 3AW0A 3M7UA 4FOUC 1EZUC 1GVZA 5FL7D 1K1NA 3HK3B 1XX9A 1BMNH 3GY4A 3EA8A 3U1JB 1CQQA 2HLCA 2XRCA 1SGQE 1YPLH 4Q7ZA 1QHRB 2FO9A 1BTPA 2CHAC 1N8OB 2Z9LA 1XUKA 2UWPA 3OTPA 4WMFA 3OTJE 1LVYA 2ZHQH 1SHHB 5FPSA 4X6PA 4KELA 2IPHA 2WHXA 1VGCB 2PFEA 2ZU3A 1WDIA 2C93B 2HLDD 1A4WH 1QB6A 2ZPSA 4F48B 2C8XB 2QXIA 2H6MA 1QY6A 2CMYA 4ZHMU 2ANKH 1ZTLA 4A1XA 1E34B 2JETC 1HAXB 3F6UH 2F43B 1V2WT 2BM2A 2GZ8A 2BX4A 1H4WA 1O39A 3WWFA 4Y8XA 1E36B 1LPKB 5F6MA 3PO1C 3V12A 3QWCH 1O3JA 1V2JT 4GCHG 4B73A 1RIWB 1TMBH 1ZGIA 1TAWA 2SGFE 3RXSA 1OWJA 1BUIA 4NIYA 2LPRA 4Z6AH 4ISIH 2BDHA 1AHTH 1LKAA 2TPIZ 2EI6A 2VB0A 1UTMA 2BY8X 1A7SA 4WXIA 1GJBB 1K9OE 4ZXXH 1O32A 4NG9H 3OEED 1P2MA 2PUXB 3M7QA 2WPLS 2K0QA 2IJD1 2R3UA 5CHAC 3PO1B 1SOZA 5DKMA 2Z3CA 2ZIQH 1BHXF 3F9HA 3PMHB 3Q3YA 2B5TB 1Y8TA 1P05A 3PV5A 1AO5A 3RXCA 5KECA 1GHYH 4PROA 1TRMA 4B2AA 1QB9A 1AB9B 5EJLA 1E1QD 1D9IA 1O2RA 1TGSZ 1GJ5H 4XD7D 3UUZA 3PMJA 2FP7B 2ODQA 1F0SA 4KTSA 1OWKA 1QQ4A 3QLPH 1O5FH 4B75A 4SGAE 3SZEA 2J98A 3MU8A 4IS5A 3TPIZ 1D4PB 1UTNA 4ZHAA 5J4SA 1GMHF 3T2NA 1SPJA 2QXGA 3UWIA 3MMGA 3ZIAD 2NU3E 4TSFD 3W1EA 4RSPA 1CHOF 5A8XA 1WSSH 3LT3A 2Y5HA 1DWEH 4X1QU 1KXAA 1MD7A 1J15A 1A5GH 1VZQH 3L6PA 1NO9H 5T6FA 1TOMH 4DT7B 2BXTH 2FOAA 4B76A 1N1LA 6GCHF 2G55A 1BZXE 3PROA 5EPNA 4X8UH 4KTCA 2WPIS 2BLVA 1EX3A 2ESTE 3N99A 5I25A 2SGDE 3S7KB 5LPRA 1O3BA 1S0RA 3BF6H 3SU1A 3LC5A 4E05H 1C1OA 4I31A 2PSXA 4CBOA 5DP7A 1LVOA 2PV9B 1T8OA 2P8OC 2P93A 2HPPH 2O8TA 3TK5A 2TGTA 3N7DA 3W95A 1GL0E 5A8ZA 2FODA 1SI5H 4ZCNA 2Z7FE 3CNRA 3PM3A 4D7GA 1LHEH 1FX0B 3F9EA 1C1VH 2FOFA 3A81A 1ESAA 2HNTE 5DP6A 3SBKA 1FLEE 1P10A 1GDQA 1EJNA 1FPHH 4WMEA 1W7GH 3ODFA 4Y11E 3RUOA 2QV1A 4DCDA 1C1TA 5JBAS 4AG1A 2HOBA 3FP8E 4UEHH 1XMNB 3ATIA 2PKSB 2WYJA 2RCEA 3RXRA 2OC7A 1GPZA 2IN2A 2OD3B 1F0RA 1ELBA 2UUKB 1S5SA 3TITA 2D2DA 3VXEH 3MH6A 1WQVH 4NWLA 1ELCA 1GCTB 1COWD 4IW4E 4JK6A 3RLWH 1JOUB 2BD2A 5A0CA 1QCPA 2FXRA 2K1QA 3GICB 4NWKA 5BPEA 2BOKA 1NFYA 1QGFA 3BIUH 3SUDA 3U8RH 2QXHA 2XC0A 5LPFA 2VGCB 1ZMJA 2EA3A 4ZKNU 3M35A 1BBRK 1QL9A 1SVPA 3MH5A 1W2KH 4UE7H 4NGAH 3EYDA 2Z9JA 1M9UA 3LIWA 3OSYA 8GCHF 1C5QA 2H5CA 2L6OA 1MKWK 4WH6A 3D49H 4X8TH 4YESB 1Z6EA 1PPHE 3RXBA 5JBCS 3A8AA 3BIVH 1Z7KA 3GDUA 3PWCA 1KLJH 1MU6B 3TJVA 2LP6A 1A5HA 4A92A 2FLRH 2ZGXH 4NSYA 1A61H 3ZZ7A 4WWYA 1C5TA 1GI0A 1YKTA 1W13U 4XOJA 2OC0A 1YP9A 3MU1A 1O2WA 1C5ZB 4VGCC 5EXLA 3P8GA 3LONA 3Q77A 1Y5AT 5A0BA 1IQFA 3LH3A 3OYPA 2ZEBA 1NY22 3HATH 1KSNA 1TNLA 5C1YA 1ZSJA 1V2KT 3FANA 2HGTH 4F4OC 4X0WU 3RLYH 2G5VA 2P8OB 2FIRH 1D3QB 1TQ7B 3E90B 4H4FA 3ZZ5A 1KLIH 1C2EA 1ZJKA 2W6JD 3IG6B 2JKHA 1XKAC 2FOEA 2J5UA 1UVPA 1EJAA 5TCAA 1DSTA 5EQRA 1GG6C 3I78A 4UD9H 2NU0E 1WUNH 2P59A 4UFEH 4Y6DA 1SSXA 2Z9IA 2J95A 4O97A 2HRVA 2XWAA 1ETTH 3FKSD 1J16A 3OX7U 5AFZH 5E0JA 4YT6H 1BRAA 1GMHG 3HPTB 1YPHC 2PP6A 5CDFE 3D23A 4GAWA 3UAIC 1HAZB 1RFNA 5HIZA 4CH2B 1GHXH 2V0BA 2WZQA 1F2SE 3AVZA 3PV4A 3TH2H 2ZDKA 1LKBA 1ZHRA 1C1QA 2H1UA 1P9UA 3VGCC 1AE8H 3RXGA 3V0XA 5L6NH 1PQ5A 2Z3DA 2ZGBH 3GY6A 1OX1A 2R0KA 3DUXH 4XDEA 1JMOH 1TBQH 1C2HA 2STAE 1LTOA 2ALVA 1B5GH 1L0ZA 3U1IB 3P6ZB 4CR9A 2F9UA 4DIHH 1O5DH 3LGWA 4DW2U 2OQUA 2FPZA 1HAGE 1UHBB 1K1IA 3SQHE 6CHAC 1YPMH 1BJVA 2ZFQH 2OK5A 4ABDA 2A1DB 5C20A 3Q76A 1YF4A 1NT1A 2WUBA 2ZECA 1THRH 7ESTE 3UY9A 1P2JA 1S85A 1AUJA 1E37B 2BB4A 3SHCH 1RIWC 4FXGH 1K2I1 4JZDH 4P02A 3SV7A 1YPGH 2FESH 5I46H 2BQ6B 4NFEA 3EA7A 4NA9H 3O8DA 1EAXA 5FXLA 4FU7A 4INKA 2G5NA 3BTFE 4Y7BA 5PTPA 4X1SU 4K5ZA 1K28D 1HB0B 3P8FA 4H6SB 2EC9H 3OEHD 1QA7A 3OAAD 5EJ1A 1C1MA 5HKKD 1K22H 4K1SA 5EW2H 4WJG2 1V2PT 1DY9A 1TONA 1SQAA 5IK2D 5FBIA 2Z6BD 1MCVA 4ZH8A 1OXGA 2SGQE 3GCHB 4OS6A 1QL7A 2Q6FA 1VGCC 1NESE 1FNIA 1LCYA 1O2NA 5DG6A 2AGIX 1V2ST 4B2BA 1BTXA 1RRKA 1MTNC 1YLCA 1C5OH 1QRZA 1CT2E 3MH4A 3UQOA 1VJAU 2ZU4A 2R2MB 3C1KA 1A0JA 4B74A 1BBRE 5DP4A 2P95A 4TYDA 2XBWA 4K69A 1MKXH 1BRCE 3SW2B 4Y8ZA 1KY9A 1GVLA 3Q3XA 1GJDB 5LPEA 1G9IE 4YZUA 2FYRA 1XUHA 2FOCA 4CRGA 2BDIA 1GI8B 1YPEH 2VWMA 4X8SH 1QTFA 3DT0H 1SL3A 4XBBA 4HI3A 3ZVGA 2IPQX 3GISB 1B7XB 1Y59T 1PJPA 4BOHA 1SFIA 1TNGA 3KN2A 5HYOA 5EQQA 2VWNA 1KXBA 1V2TT 4R8TB 3A82A 4CR5A 4TPYA 1V3XA 1XVMA 4GLYA 3R3GB 4BTUB 2ZFSA 1QRWA 1EZSC 2O8LA 1O3NA 3RXDA 4LOYH 3ZYDA 4OS2A 1KTSB 4UFFH 5DSFA 4ABFA 2Z94A 2KAIB 3F2FA 4ISOA 1T4UH 1YYY1 3N7OA 5EOKA 1Y5BT 4X6OA 2STBE 1UVUH 1UHBA 3UQVA 5HGGA 4Q4LA 3LJOA 1FY8E 1TWXB 1Y3XA 1LHDH 3A86A 2VJ1A 1G3DA 1BOQA 4LK4A 1KLTA 4Y8YA 1O2JA 5GWZA 2AERH 1DUEA 1JRSA 4AGJA 4XSKU 4ABHA 1J8AA 3BEIB 1TE0A 1P9SA 2GT7A 1C5XB 1X7AC 1K1PA 4UDWH 3SV9A 1G36A 1FY4A 3RXMA 3T25A 2VIWA 1CA0B 3I29A 2BD5A 2J98B 2J2UA 2FS8A 4CRAA 4RI0A 1ACBE 1UTLM 2ZC9H 3A7YA 1FIWA 2XCNA 2F4LA 3SV2H 1O3AA 1AI8H 1DSUA 1GBHA 1C5LH 1LVBA 3MNXA 1AVWA 2BVSH 3F0OA 3LC3A 2LELA 5FX6A 1BITA 1UVOA 2FMJA 1ABIH 1P0SH 1W0KD 3A88A 3U28C 2PSYA 1UCYE 2ZFPH 4INHA 3GDVA 4JYUH 1C2GA 1EP6A 7KMEH 1H9IE 5JB9S 1ELTA 4X1PU 5C5NA 2GJGA 3ZZAA 4JZFH 2H9TH 1GHVH 1T8LA 2V3HH 1P3CA 1YLNA 1ZGVA 1TBRH 1H8DH 2V35A 2ULLA 4AYVB 2GD4B 1OS8A 1P03A 2BXUH 3ZVCA 2GDEH 1Y3UA 4ISNA 5DJ7A 4Q80A 5H4IB 4HGCA 2A4OA 3SU2A 1OP2A 4Y10E 1D6WA 5C0TA 4O3UA 4HFPB 1ETRH 3O8RA 1UMAH 1LMWB 5GJ4B 1UK4A 3C27B 2GT8A 2BD3A 1A2CH 4E06H 1DOJA 4GSOA 4MNXA 1MZDA 3M37A 3I77A 2F83A 1YCPH 3MH7A 3ITIA 3E8LA 1S83A 4ZKRU 1O3KA 1IHSH 1K1LA 3JZ2B 3ODDA 2PGQB 2OQ5A 2V3OH 3OE7D 1F5KU 2ODPA 2W6ID 2KCPA 9LPRA 3SUEA 1MTVA 2OBQA 5HM2A 1S6FA 5GCHF 1DITH 9ESTA 1C5VA 1UCYK 1ZYOA 1CBWC 4DT4A 3PLBA 3ZZCA 1ARBA 3EA9A 1ZMNA 2SNWA 2XNDD 3F3BA 3RXAA 1G3EA 4FUGA 4TPIZ 1NRQH 5GIBA 4THNH 3M3SA 4Z0KA 1J17T 1LPGB 4AX9H 3LOXA 2TIOA 1TNHA 2TGPZ 1TX7A 3GS9A 2BY5X 2KM0A 3PV2A 3FZZA 3SN8A 4AORA 1YCPK 2XWBI 4YLQH 4LXBH 4A7IB 2WPDD 5A09A 5DO4H 2VNTA 1KXDA 1GMCG 2A31A 1BRBE 2Y6TA 4U2WA 1PQ8A 1HGTH 3TJOA 5DP9A 4NIXA 2ANWA 1MTSA 1MMJN 2ZI2H 4H6TA 4ABAA 1JIMA 1CHOG 3BTWE 4YOGA 3NRLA 1WU1A 1TGNA 3S9CA 1ZJDA 1O38A 1QBNA 1V2OT 2H2ZA 1LHGH 3TH3H 1O3LA 4X2YA 1HBTH 6GCHG 2WV4A 3VB7A 3RC5A 2WV9A 2CGAA 1GJAB 1ANDA 4DY7B 2TBSA 3DSGA 7GCHF 1HJAB 1P06A 1WXRA 1HAYB 4Y0ZE 3VB3A 3T29A 1ZPZA 1EATA 1V2LT 1UTJA 1UO6A 3MWIU 1GI1A 2ZFFH 1CT4E 3A89A 3AAVA 1T32A 1EOJA 2ZTZA 2DE8A 1QBOA 4MQAA 4I8JA 3A85A 2ZCHP 2F9NA 2I6SA 3RU4T 3O8BA 3Q00A 2XBVA 3DD2H 3EQ0H 3LGUA 2F91A 2YMSB 4I86A 1O30A 2G4UA 1L2EA 1SQTA 1Z8JB 1HJAC 1BDAA 2L74A 3TGKE 2F9BH 5EGMA 2GP9B 1FY3A 2O8UA 2V3MA 1TABE 2VIOA 3F1SB 3FVFB 1NS3A 1AIXH 3G01A 2ZHDA 4AN7A 1IQIA 3DCLA 1GVKB 1IQHA 3MU5A 2BVXH 1C9TA 3MFJA 1GI4A 1OKXA 3OY6U 2YOLA 4K1TA 3QTOH 2QE7D 2HALA 3LPRA 4YT7H 1GBAA 1Z6JH 3T27A 4NZQA 1IQKA 4J2YB 2VVVA 3SO3A 1W7XH 1EPTB 1GBKA 4FUJA 3K2UA 3CP7A 2F9VA 4M7GA 2VIPA 5F8XA 1EP5A 1YY3A 3S0NA 1O0DH 5KGOA 2Z9GA 1EOLA 5ABWA 2IOTA 1MBQA 4K3JA 3MNSA 1PPEE 1AU8A 2YMSC 1S82A 1KDQB 3MNCA 1AFQB 2J34A 4CH8B 2OP9A 1W10U 1LO6A 1YBWA 3NCLA 3SUFA 2D8WA 2PKAA 3PRDA 1O2PA 1TRYA 2UWOA 3KQEA 4Y0YE 3TVJB 5AF9H 1AWFH 1DXPA 1W0ZU 2WYGA 3M36A 1D6RA 2AMPA 3HGNA 4XBDA 2JH5D 5A2MH 1CHGA 1NROH 3TJNA 5JPMH 1SHYA 3Q3KA 2HNTF 3GY8A 2V7QD 3PRBA 1THPB 3P8NA 5EIYA 2VBCA 3VB5A 2D26C 1FY5A 3HKIB 4P00A 3QTVH 4B71A 1C5NH 1O5AB 1QNJA 1ZRBA 2TGAA 2ZNKH 1DVAH 2BD7A 1AE5A 5GCHG 3JZ1B 1GI2A 2AS9A 1HAOH 4JYTA 3GCTG 1A0LA 1W12U 3SNDA 4D9QA 1NU7B 4TY7A 1QIXB 1MQ5A 1LPZB 3A84A 5E0HA 3ZVAA 1O2HA 3FOAA 3FP7E 1QJ7B 1MAXA 3SNEA 1GJ8B 1C2JA 3PB1E 1C4V2 3URDA 3S69A 5EQSA 4NIWA 4X1RU 3D65E 3SORA 4F49A 2ZDLA 2Z3EA 3TGIE 2PTCE 1PFXC 2GMTB 3KYGA 1DWDH 1P2QA 3RMLH 1HV7A 5ETXA 3PWBA 2F9OA 2RG3A 1VKYA 1FAXA 1PPBH 4X2XA 3VG8A 1V6DA 1U6QA 5A0AE 1JIRA 3LDXH 1MQ6A 1YCPM 3SU3A 1HXEH 2B0FA 1DICA 1JRTA 4AFQA 3U69H 3VPKA 3M7TA 2DE9A 2ANMH 2QIQA 4YXWD 1ANEA 2UUYA 4M9FA 1XVOA 1TQ0B 4FUIA 5A8YA 5TJXA 5EG4A 3SI3H 1O5CB 1HYLA 1EASA 1ZHPA 1RJXB 2B7DH 3BG4B 3KQDA 3RXFA 3SZNA 1DLKB 3ESTA 4HZHA 2QF5A 5HIYA 4ABBA 1SGTA 2O9QA 1HRTH 4FUHA 5F53A 1AFQC 1H1BA 3BG4C 4X6MA 1W0JD 4CHAB 3O8CA 3MU0A 3VEQB 5C2ZA 1AGJA 3PTNA 1GBCA 2VVCA 2AMQA 1FI8A 2BY7X 4O9VA 1RXPA 1Y5UT 1FMGA 3A87A 2AIPA 2FLBH 2ZF0H 5C3NA 3EDXB 1MU8B 1NN6A 1VCWA 1HUTH 2CN0H 1C5PA 1CA8B 3QN7A 3DHKH 2PLXA 2ZHFH 3ZZ6A 5AVDA 1HXFH 1GCTC 3KQBA 3KQCA 3BTDE 3SJIA 1AVGH 1XKBC 2BDGA 1DXWA 3UR6A 1WOFA 2ZGCA 3VGCB 1ESTA 1NBMD 4MLFB 3STIA 4AC9A 4TWWA 3E16B 4AB9A 1BMAA 3BV9B 1CU1A 1GBBA 1ESBA 4WMDA 5FHTA 5ESBA 1DWBH 1DUAA 1D3DB 4TY6A 1H8ED 2J92A 2RDEA 2HVYB 1LDTT 1NZQH 1QJ6B 5LH8A 1NC6A 1O2LA 1UTKA 2BD8A 3RU4D 1IOEA 1T7CA 2ZCLP 2PUQH 1AMHA 3SU5A 1O3DA 5JBBS 2ANYA 2O8MA 3RM0H 3RP2A 6LPRA 1DM4B 1PPZA 3ATKA 2VWOA 3F2GA 2GCTC 1BA8B 1OWIA 1DS2E 3VB4A 1GBLA 4RT1A 3GOVB 3IITA 1WYKA 2OLGA 3BSQA 1Z8GA 1H8HD 2J97A 5E8EH 1TPAE 2JIZD 1XUGA 3TGJE 1HAHH 1PYTD 1ZTJA 1SR5C 1FUJA 1YPHE 4FU9A 1O2QA 2H9EH 2SGEE 1J9CH 2AYWA 2XW9A 2PGBB 4U01A 1ANBA 5E0GA 2AFQB 1DX5M 1CVWH 3VXFH 1H8IH 1EAUA 4MTBA 3SGAE 1GMCF 1GJ7B 1O2VA 4DGJA 3NWUA 2ZU1A 4BAHB 1TALA 3S7HB 2PW8H 4VGCB 1MAYA 3T62A 4MDSA 1O2SA 3TH4H 3RC6A 2A7CA 1N6XA 4A1VA 4I33A 1EKBB 2GCHF 1BJUA 1AKSB 1C1SA 3K6ZA 3MO6A 5K7RA 2A7HA 1E0FD 5G4BA 4BAOB 1O5GH 2BQ7B 4YM9A 1SGPE 3RXIA 1SGEE 1SG8B 2BLQA 5EW1H 1SQRA 2XC4A 4TT3D 2PWXA 2A45B 1Z8RA 5LGOA 3T28A 4OS4A 7GCHG 1EAIA 1BTHH 1TNIA 3QZQA 3ZVFA 1A46H 5DGJA 5GDSH 5EXMA 1FAKH 2QN5T 3ZZBA 1O2GH 4D8NA 3P17H 4X6NA 1VR1H 3MNBA 1WV7H 2ZFTA 1SLXB 2HVXA 1UVTH 4UONA 1KIGH 1NRNH 1TOCB 1QFKH 1O33A 4ZKSU 2W5EA 3F2HA 2F3CE 4I8HA 4X2WA 4IBLH 3ZZ4A 2CF8H 1OHHD 2WV5A 4OS7A 4NSVA 1SLVB 1K1JA 3MHWU 3QO6A 4ZROA 4OS5A 1TGCA 4O03A 1W8BH 2H5DA 4YLUA 1IAUA 2M5TA 3RMMH 2FX6A 2RFKC 1C4Y2 2VIDA 2VVUA 1E1RD 1GJ6A 2ZKSA 1H9LB 1EPTA 1DDJA 1MCTA 1EUFA 3DSPA 5DP5A 1SGCA 1Z71A 5DP3A 3SJKA 1W3CA 5ESTE 3UNRA 1YLDA 3SNCA 1QZ8A 2IJOB 4AB8A 5C1UA 4MNVA 1NRRH 4AYYB 2QF3A 8GCHG 1HDTH 2CK3D 1OYQA 4FUEA 4AFSA 2C90B 1VITG 3GYLB 2EI8A 2YNBA 1TLDA 4MPUA 2GKVE 3LGVA 1D3TB 1EB2A 1ARCA 4A6LA 3ATWA 1TB6H 4ACAA 3M61U 2RA3A 1G3CA 4QT8C 3K65B 1W11U 2FX4A 1FN6A 1ZSKA 2R9PA 3QGJA 1VCQA 2OC1A 2WPHS 5L2ZH 5FX5A 1C4U2 1K0HA 4INLA 1A0HB 2AGEX 4SGBE 2HNTC 2OTVA 2OCVB 3NUMA 3SYJA 3A7TA 2WPJS 2BDAA 3KQ5A 3NPSA 3KHVA 1CGJE 1SGYE 2GVFA 3M3VA 2A4QA 5C5OA 3V7TA 3S9BA 1GGDC 1HCGA 3ZVEA 5C94A 1NFUA 4ACBA 1QA0A 2GV7A 5EODA 2V6NA 5EU8A 3W94A 1G3BA 5JYIA 2BMGB 2C8ZB 1ZR0A 2P3UB 4BTTB 1SLUB 3SU0A 2G8TA 1ZLRA 3CS7A 2WINI 4R0IA 3F68H 1C1WH 1F5RA 3TLOA 2ZDVH 4BAQB 1HAPH 2HWLB 1A3EH 5CMXH 4IC6A 1ZMLA 2J38A 3ZV8A 1P11E 1GI7B 1E35B 1GHWH 2SGAA 3BG8A 1C1PA 4RKOB 1S6LA 1A1RA 5CE1A 2I6QA 3UTUH 1O3HA 1S84A 1F0UA 3RXUA 3DFJA 1Z1JA 2ZFRH 1GHBF 1QURH 1DPOA 5CHAB 2ZQ2A 2A0QB 5IYTA 1PPFE 3RXJA 3M5LA 4GHQA 1HAIH 2BZAA 3PYHA 1GDNA 3SJOA 2PKSC 2EY4C 1QRXA 3U98H 4IN1A 1T31A 4AGKA 1P09A 1O3MA 4K8BA 1H9HE 1O2TA 3QGNB 1GI9B 1SGDE 3EGKH 2A7JA 1NTPA 1QQUA 2YNAA 3H5CB 1Y3WA 2G52A 2ZU2A 3BEUA 3BTME 1EPTC 1RD3B 3NK8A 5B6OA 1W0YH 1YC0A 1QL8A 1GJ9B 1TNJA 2THFB 1DT2A 3RU4E 3SNBA 3MTYA 2C8WB 1L1NA 1WBGB 1RTFB 1C5YB 1SLWB 1SFQB 1HAVA 4BAMB 3WW7A 3UNQA 1BCUH 1MTNB 2ZP0H 2Y5GA 1VJ9U 2K8IA 3QX5H 4ZXYH 1PQ7A 3NZIA 1ABJH 2FZZA 1GJCB 4FU8A 1MH0A 2R3YA 1F0TA 4CBNA 1C9PA 2XCFA 1NPMA 1IQMA 4FVDA 4DURA 1UK2A 1GHZA 5FCRA 3SGQE 1JBUH 2O8WA 3OU0A 6ESTA 1DLEA 1ZZZA 3MU4A 1CA0C 3PMAB 8ESTE 3KIDU 2GMTC 3ZZ8A 4TWYA 1F5LA 2GZ9A 3M5NA 3TJUA 1OWEA 3RXLA 5GNDA 1C5WB 1INCA 3T5FH 1ELGA 4NIVA 3SQEE 2QGRA 3M5MA 2ASUB 1WAYB 1NRPH 2FOMB 3BEFB 3DSOA 1YWUA 5JBTA 4IMQA 3U9AH 1FY1A 1UK3A 3N7EA 5GXPA 2NU4E 1G30B 1CGIE 4ZAEA 4Y71A 2W3IA 1MTWA 3FO8D 4B1TA 4MPVA 1O2YA 2CJIA 5FAHA 2FOBA 1EFRD 1E38B 1L1GA 1BIOA 3WWBA 3EAJA 5C17A 2VIVA 3KNXA 3FZDA 4XFQA 4XBCA 2DUCA 8KME2 1TX6A 4LZ1H 1JXPA 4I8KA 2AIQA 4JYVH 4MG3A 2KR7A 3UR9A 1TMTH 2C4FH 1WTHD 3OY5U 1HJ9A 1K1MA 1C5MD 1VCPA 4YOJA 4K8YA 3LH1A 3RXTA 2PR3A 4ZMAH 5T1VA 2R0LA 1SGFA 5IDKA 3EE7A 1KXFA 1GBEA 2QCYA 2AH4X 3LGTA 3QZRA 1K1OA 4UFGH 3UNSA 5HM9A 4J1YA 4JZ1A 2FOHA 3F9GA 3P95A 2EQNA 3A83A 2CV3A 4HTCH 1OWHA 1MKWH 1V2MT 1T8NA 3BN9A 4DJZB 5JDUB 3SGBE 1SOTA 5KEDA 2Z9KA 2FYQA 3RXVA 2R2WU 2A4RA 4CRDA 2BY9X 1MZAA 4OM9A 1O2ZA 4WY3A 4YOIA 4I8LA 4ZKOU 3M3TA 4B6EA 2ZDAH 3A7XA 1AFEH 1IQEA 1O3EA 3ELAH 4BXWA 4NA7A 1ZSLA 3A8DA 3GCNA 5E2OA 3ZVDA 2C8YB 2G4TA 2BY6X 1O37A 1GDUA 3HKJB 1FZZA 3MO3A 1FIZA 1O35A 1AWHB 1IQJA 1TIOA 1F92A 1V2RT 1IQLA 5T6DA 1OYTH 1P2OA 1Y3VA 2OC8A 1UTQA 3SI4H 2W26A 4IGDA 3AK5A 1DE7H 2QY0B 3E1XB 1O2XA 4MPWA 4CRBA 1T8MA 4CREA 4FETA 1JWTA 2XTTB 3B8JA 1GI6A 1VITH 1SGIB 2XBYA 4ABGA 1T4VH 1C1UH 1BQYA 1TPSA 1SMFE 3LKWA 1CT0E 2BQWB 2QF0A 1SC8U 4JCNA 3GYMA 2QC2A 1V2QT 3M5OA 1ZTKA 1DY8A 1QR3E 1BBRH 1V2UT 2GV6A 2XNIA 2PKAB 3RMOH 4U30A 2TRMA 1TMUH 1SBWA 4ASUD 3BTEE 1GHAF 3UOPA 1AQ7A 1KDQA 2FM2A 4BXSA 1OOKB 4I32A 1P01A 3MQKC 2NU2E 4WXVA 2SGPE 2BLWA 3SU6A 1ZRKA 4CRFA 2JH6D 1UJ1A 2SNVA 1GMDF 3DA9B 3RC4A 2NWNA 4NFFA 2OINA 1V2VT 1SGRE 1FDPA 1GI3A 3KCGH 2FI5E 2JH0D 3VFEA 1EXFA 1P2IA 1N8OC 5L30H 1C5SA 1BTZA 2ZQ1A 1BB0B 1XXFA 4OS1A 1RTLA 2A5KA 1HPGA 1FXYA 2QAAA 1O2KA 1C2LA 1Q2WA 3FP6E 2BD4A 1P8VC 4ABIA 3H7OA 1C1NA 2UWLA 1EZXC 2WSSD 1EZQA 1C2KA 2WPKS 1ELVA 1ETSH 1TRNA 4FUCA 1GCDA 2ODYB 5AHGH 1ELDE 1O5EH 3LGIA 1DANH 1RS0A 4GPGA 1C2FA 2KCAA 4OGYA 4A5TS 2FS9A 1XUJA 5EJZA 2BYAX 1Y3YA 2KZ4A 1ANCA 2ZZUH 1GJ4H 3TK6A 2KCYA 3MYWA 1O31A 2ZDMA 3GCHC 4DIIH 1ID5H 3GY2A 3SV6A 1PPGE 4D7FA 1P3EA 1AZ8A 5TCCA 1LQEA 1AN1E 1L1JA 4X1NU 3QK1A 1B0FA 1BTUA 5C1XA 3GCOA 1DFPA 3F0PA 3AAUA 4FVBA 1FONA 1TBZH 1TPPA 2TGDA 2G81E 3FN8A 2XXLA 5C67A 4DVAU 2ZDNA 5F03A 1YPJH 3GDSA 2Q1JA 1HJ8A 1MBMA 2ZPQA 4D9RA 2GCHG 3MI4A 4YO9A 1OWDA 3VB6A 1GHBG 2BVRH 1B0EA 2A32A 5HMAA 2ZGJA 3RMNH 1GL1A 1OPHB 3KYFA 3L3TA 2VWLA 2D1JA 4AFZA 3BTHE 3CENA 1C5RA 3E0PB 2QA9E 3IWMA 4UFDH 1EB1H 1XM1A 4X8VH 4XRNA 5DP8A 3ATMA 3A8BA 2Q6GA 3RXKA 2FI3E 2FTMA 1O3OA 2GDDA 3SJ8A 2PTNA 2JJ2D 4RT0A 3LJJA 1J14A 1HNEE 1NBME 1GBIA
chains in the Genus database with same CATH topology
5EPYA 3ZV9A 4D76A 3GY5A 1QB1A 1YM0A 3V13A 8LPRA 2OBOA 1ZPBA 2EEKA 2ZCKP 1LHFH 2BHGA 3B23B 5DPAA 1P02A 4MVNA 3P70B 1BTYA 4OGXA 1O3CA 1AZZA 4GUXA 3UPEA 1N6YA 3TU7H 1TYNA 4I7YH 5BRRE 3UIRA 3B9FH 1A5IA 1TA2A 4ISHH 4U32A 1AVXA 2WPMS 1AY6H 3A7VA 2P3TB 3PTBA 3PLPA 2BLOA 1L4ZA 4I8GA 1CGHA 3SJ9A 4ABJA 5T6GA 3LU9B 2ZPRA 1EAWA 2P3FH 1P12E 2BDBA 2SFAA 1QJ1B 2B8OH 4FUDA 3KGPA 1RGQA 1AD8H 5FBEA 4LZ4B 3ATLA 1LQDB 1VITF 7LPRA 2GX4A 3A7ZA 1K21H 3P92A 1O3IA 4X2VA 4K60A 3BTKE 1TPOA 1XUIA 2FTLE 2BTCE 3RXEA 1C1RA 1GMDG 1WCZA 3RXQA 2RDLA 1AUTC 1O2OA 3H7TA 1BMLA 1GG6B 1KXCA 1KYNA 1O3FA 2FOGA 4E7RG 2AMDA 3CS0A 4NCYA 5SGAE 4GCHF 1CO7E 5FPYA 1LHCH 3F9FA 1P2KA 4ASHA 1BTWA 1SGNE 3SV8A 1MTUA 1ELFA 1F7ZA 2Q6DA 1G37A 3HGPA 1O36A 1AB9C 1BMMH 3E3TA 2J94A 3E6PH 1P04A 5L2YH 2GZ7A 1TGTA 3PLKA 2H9HA 1UCYH 4BAKB 2VH6A 2AEIH 1ZOMA 2F9PA 4KKDA 1CE5A 3ZYEA 4AFUA 1WTGH 2FWWA 4ZHLU 1O3GA 1O2MA 4Y7AA 1GWAA 3GY3A 2KAIA 2ZTXA 3URCA 4DOQA 1HFDA 3STJA 3A80A 4XE4A 2FDAA 2QXJA 3E91A 3MOCA 5FPTA 3MO9A 1C2IA 4JZEH 1KXEA 2Y80A 3R0FA 4GVUA 5E2PA 2ZHEH 2EI7A 5AFYH 2GGVB 2BDYA 1SQOA 4CRCA 3GY7A 3ENSB 1WQSA 1G2LA 2JETB 3ZZDA 3SUGA 4WH8A 1HIAB 3TNSA 1C5UA 4K2YA 4KP0A 2ZHWH 1ORFA 2VGCC 3SHAH 2Y5FA 5GPIB 4GHTA 2ILNA 1A3BH 4NZLA 1XUFA 4IN2A 3UOUA 3LGYA 1W14U 1HLTH 4RKJB 1S0QA 1ZHMA 4Q7YA 1FN8A 3HK6B 4FUFA 3RXOA 4RN6A 1G32B 4JK5A 2RA0A 4B2CA 3TNTA 1YGCH 5F8TA 2CF9H 3K9XB 1TA6A 4DG4A 2UUFB 1GBFA 2A2QH 1V2NT 4A1TA 3U8OH 4BTIB 2BOHB 2OXSA 4AZ2B 1EQ9A 3T26A 3BTQE 4BANB 1FV9A 5EXNA 1P57B 4BNRA 1CSOE 4MPXA 2ZWLH 1GHAG 4E7NA 2BX3A 1O3PB 2FI4E 1C2MA 1NRSH 1PYTC 3V3MA 3SOSA 1SGFG 3RDZA 3EE0B 4WVPE 1CBWB 2Y7XA 1ELAA 2LNCA 1QBVH 1AKSA 1PPCE 3KF2A 4MNWA 4IMZA 2A5IA 2VU8E 3L33A 3TK9A 5FCKA 2BZ6H 1LVMA 2A5AA 1O5BB 2G51A 1DWCH 2XC5A 2AGGX 2W3KA 1UVSH 2GCTB 1TGBA 3ZVBA 4KTUA 1S81A 1GI5A 4Y79A 2ZO3H 3BTGE 2CXVA 2C3SA 1IHTH 2WUCA 3A7WA 2W7UA 3KEEA 3QDZB 1HIAA 3AASA 1O2UA 1UTOA 1BHXB 2A2XH 1MD8A 4K1EA 3ZZ3A 6CHAB 1HAVB 1Q3XA 4ISLA 3A8CA 1FPCH 3NKKA 2Y82A 1KTTB 1Z8IB 2Y7ZA 1UTPA 2BDCA 1G2MA 1Q31A 2ALPA 1MUEB 1FQ3A 4ZUHA 1OP8A 1TFXA 4JZIA 2ZA5A 4MNYA 3UWJH 2GTBA 2J4IA 5J4QA 3AW1A 2Y81A 5F8ZA 4AOQA 1XXDA 1O2IA 1SB1H 2NU1E 2ZG0H 5DK1A 3TIUA 4H42U 1PQAA 1GBTA 3PMBB 2UUJB 3NXPA 2FEQH 2ZGHA 1FJSA 1L4DA 2XBXA 3D62A 3S9AA 4NA8A 2P16A 3FAOA 1ZPCA 1D3PB 5HXFA 2VINA 2ZU5A 1IQNA 2OUAA 2VH0A 1ELEE 1OP0A 1BRUP 4IC5A 4O3TA 3ZZ9A 4CHAC 5T3HA 3BTTE 3KL6A 1P2NA 2ZTYA 3RM2H 4JMYA 4ABEA 4WF8A 1IQGA 3RXPA 1GGDB 5JB8S 4Q7XA 2CHAB 1GBMA 3GCTF 3UREA 1BT7A 2B9LA 1TNKA 2QYIA 1NU9A 3UFAA 4ESTE 1RTKA 1Z1IA 1MKXK 2J9NA 5K0HA 1THSH 3WY8A 3DFLA 2W7SA 2G00A 2P94A 3U8TH 2HPQH 1GBJA 1NFXA 1NM6A 3RXHA 3QUMP 4KGAA 3E0NB 3SNAA 2VIQA 4AG2A 4FUBA 2A4GA 3K6YA 1YPKH 1O34A 1GBDA 3SU4A 2PHBA 3FFGA 4Y76A 1NFWA 1OSSA 3P8OA 2BD9A 1TX8A 1S6HA 4Q2KA 1C2DA 4YTAA 1EJMA 2XYAA 3AW0A 3M7UA 1EZUC 1GVZA 1K1NA 3HK3B 1XX9A 1BMNH 3GY4A 3EA8A 3U1JB 1CQQA 2HLCA 2XRCA 1SGQE 1YPLH 4Q7ZA 1QHRB 2FO9A 1BTPA 2CHAC 1N8OB 2Z9LA 1XUKA 2UWPA 4WMFA 3OTJE 1LVYA 2ZHQH 1SHHB 5FPSA 4X6PA 4KELA 2IPHA 1VGCB 2PFEA 2ZU3A 2C93B 1A4WH 1QB6A 2ZPSA 2C8XB 2QXIA 2H6MA 1QY6A 2CMYA 4ZHMU 2ANKH 1ZTLA 4A1XA 1E34B 2JETC 1HAXB 3F6UH 1V2WT 2BM2A 2GZ8A 2BX4A 1H4WA 1O39A 4Y8XA 1E36B 1LPKB 5F6MA 3PO1C 3V12A 3QWCH 1O3JA 1V2JT 4GCHG 4B73A 1RIWB 1TMBH 1ZGIA 1TAWA 2SGFE 3RXSA 1OWJA 1BUIA 4NIYA 2LPRA 4Z6AH 4ISIH 2BDHA 1AHTH 1LKAA 2TPIZ 2EI6A 2VB0A 1UTMA 2BY8X 1A7SA 4WXIA 1GJBB 1K9OE 4ZXXH 1O32A 4NG9H 1P2MA 2PUXB 3M7QA 2WPLS 2R3UA 5CHAC 3PO1B 1SOZA 5DKMA 2Z3CA 2ZIQH 1BHXF 3F9HA 3PMHB 3Q3YA 2B5TB 1Y8TA 1P05A 1AO5A 3RXCA 1GHYH 4PROA 1TRMA 4B2AA 1QB9A 1AB9B 1D9IA 1O2RA 1TGSZ 1GJ5H 3UUZA 3PMJA 2FP7B 2ODQA 1F0SA 4KTSA 1OWKA 1QQ4A 3QLPH 1O5FH 4B75A 4SGAE 3MU8A 4IS5A 3TPIZ 1D4PB 1UTNA 4ZHAA 5J4SA 1GMHF 3T2NA 1SPJA 2QXGA 3UWIA 3MMGA 2NU3E 5A8XA 4RSPA 1CHOF 1WSSH 3LT3A 2Y5HA 1DWEH 4X1QU 1KXAA 1MD7A 1J15A 1A5GH 1VZQH 3L6PA 1NO9H 5T6FA 1TOMH 4DT7B 2BXTH 2FOAA 4B76A 1N1LA 6GCHF 2G55A 1BZXE 3PROA 5EPNA 4X8UH 4KTCA 2WPIS 2BLVA 1EX3A 2ESTE 5I25A 2SGDE 3S7KB 5LPRA 1O3BA 1S0RA 3BF6H 3SU1A 3LC5A 4E05H 1C1OA 4I31A 2PSXA 4CBOA 5DP7A 1LVOA 2PV9B 1T8OA 2P8OC 2P93A 2HPPH 2O8TA 3TK5A 2TGTA 3W95A 1GL0E 5A8ZA 2FODA 1SI5H 2Z7FE 3PM3A 4D7GA 1LHEH 3F9EA 1C1VH 2FOFA 3A81A 1ESAA 2HNTE 5DP6A 3SBKA 1FLEE 1P10A 1GDQA 1EJNA 1FPHH 4WMEA 1W7GH 3ODFA 4Y11E 3RUOA 2QV1A 4DCDA 1C1TA 5JBAS 4AG1A 2HOBA 3FP8E 4UEHH 1XMNB 3ATIA 2PKSB 2WYJA 2RCEA 3RXRA 2OC7A 1GPZA 2IN2A 2OD3B 1F0RA 1ELBA 2UUKB 1S5SA 3TITA 2D2DA 3VXEH 3MH6A 1WQVH 4NWLA 1ELCA 1GCTB 4JK6A 4IW4E 3RLWH 5A0CA 1JOUB 2BD2A 1QCPA 2FXRA 2K1QA 3GICB 4NWKA 5BPEA 2BOKA 1NFYA 1QGFA 3BIUH 3SUDA 3U8RH 2QXHA 2XC0A 5LPFA 2VGCB 1ZMJA 2EA3A 4ZKNU 3M35A 1BBRK 1QL9A 1SVPA 3MH5A 1W2KH 4UE7H 4NGAH 3EYDA 2Z9JA 1M9UA 3LIWA 3OSYA 8GCHF 1C5QA 2H5CA 1MKWK 4WH6A 3D49H 4X8TH 4YESB 1Z6EA 1PPHE 3RXBA 5JBCS 3A8AA 3BIVH 1Z7KA 3GDUA 3PWCA 1KLJH 1MU6B 3TJVA 1A5HA 4A92A 2FLRH 2ZGXH 4NSYA 1A61H 3ZZ7A 4WWYA 1C5TA 1GI0A 1YKTA 1W13U 4XOJA 2OC0A 1YP9A 3MU1A 1O2WA 1C5ZB 4VGCC 5EXLA 3P8GA 3LONA 3Q77A 1Y5AT 5A0BA 1IQFA 3LH3A 3OYPA 2ZEBA 1NY22 3HATH 1KSNA 1TNLA 5C1YA 1ZSJA 1V2KT 3FANA 2HGTH 4F4OC 4X0WU 3RLYH 2G5VA 2P8OB 2FIRH 1D3QB 1TQ7B 3E90B 4H4FA 3ZZ5A 1KLIH 1C2EA 1ZJKA 3IG6B 2JKHA 1XKAC 2FOEA 1UVPA 1EJAA 5TCAA 1DSTA 5EQRA 1GG6C 3I78A 4UD9H 2NU0E 1WUNH 2P59A 4UFEH 4Y6DA 1SSXA 2Z9IA 2J95A 4O97A 2HRVA 2XWAA 1ETTH 1J16A 3OX7U 5AFZH 5E0JA 4YT6H 1BRAA 1GMHG 3HPTB 1YPHC 3D23A 4GAWA 1HAZB 1RFNA 4CH2B 1GHXH 2V0BA 1F2SE 3AVZA 3PV4A 3TH2H 2ZDKA 1LKBA 1ZHRA 1C1QA 2H1UA 1P9UA 3VGCC 1AE8H 3RXGA 3V0XA 5L6NH 1PQ5A 2Z3DA 2ZGBH 3GY6A 1OX1A 2R0KA 3DUXH 4XDEA 1JMOH 1TBQH 1C2HA 2STAE 1LTOA 2ALVA 1B5GH 1L0ZA 3U1IB 3P6ZB 4CR9A 2F9UA 4DIHH 1O5DH 3LGWA 4DW2U 2OQUA 2FPZA 1HAGE 1UHBB 1K1IA 3SQHE 6CHAC 1YPMH 1BJVA 2ZFQH 4ABDA 2A1DB 5C20A 3Q76A 1YF4A 1NT1A 2WUBA 2ZECA 1THRH 7ESTE 3UY9A 1P2JA 1S85A 1AUJA 1E37B 2BB4A 3SHCH 1RIWC 4FXGH 1K2I1 4JZDH 3SV7A 1YPGH 2FESH 5I46H 2BQ6B 4NFEA 3EA7A 4NA9H 3O8DA 1EAXA 5FXLA 4FU7A 4INKA 2G5NA 3BTFE 4Y7BA 5PTPA 4X1SU 4K5ZA 1K28D 1HB0B 3P8FA 4H6SB 2EC9H 1QA7A 1C1MA 1K22H 4K1SA 5EW2H 4WJG2 1V2PT 1DY9A 1TONA 1SQAA 5FBIA 2Z6BD 1MCVA 4ZH8A 1OXGA 2SGQE 3GCHB 4OS6A 1QL7A 2Q6FA 1VGCC 1NESE 1FNIA 1LCYA 1O2NA 5DG6A 2AGIX 1V2ST 4B2BA 1BTXA 1RRKA 1MTNC 1YLCA 1C5OH 1QRZA 1CT2E 3MH4A 3UQOA 1VJAU 2ZU4A 2R2MB 3C1KA 1A0JA 4B74A 1BBRE 5DP4A 2P95A 4TYDA 2XBWA 4K69A 1MKXH 1BRCE 3SW2B 4Y8ZA 1KY9A 1GVLA 3Q3XA 1GJDB 5LPEA 1G9IE 4YZUA 2FYRA 1XUHA 2FOCA 4CRGA 2BDIA 1GI8B 1YPEH 2VWMA 4X8SH 1QTFA 3DT0H 1SL3A 4XBBA 4HI3A 3ZVGA 3GISB 1B7XB 1Y59T 1PJPA 4BOHA 1SFIA 1TNGA 3KN2A 5HYOA 5EQQA 2VWNA 1KXBA 1V2TT 4R8TB 3A82A 4CR5A 4TPYA 1V3XA 1XVMA 4GLYA 3R3GB 4BTUB 2ZFSA 1QRWA 1EZSC 2O8LA 1O3NA 3RXDA 4LOYH 3ZYDA 4OS2A 1KTSB 4UFFH 4ABFA 2Z94A 2KAIB 4ISOA 1T4UH 1YYY1 3N7OA 5EOKA 1Y5BT 4X6OA 2STBE 1UVUH 1UHBA 3UQVA 5HGGA 3LJOA 1FY8E 1TWXB 1Y3XA 1LHDH 3A86A 2VJ1A 1G3DA 1BOQA 4LK4A 1KLTA 4Y8YA 1O2JA 5GWZA 2AERH 1DUEA 1JRSA 4AGJA 4XSKU 4ABHA 1J8AA 3BEIB 1TE0A 1P9SA 2GT7A 1C5XB 1X7AC 1K1PA 4UDWH 3SV9A 1G36A 1FY4A 3RXMA 3T25A 2VIWA 1CA0B 3I29A 2BD5A 2J2UA 2FS8A 4CRAA 1ACBE 1UTLM 2ZC9H 3A7YA 1FIWA 2XCNA 3SV2H 1O3AA 1AI8H 1DSUA 1GBHA 1C5LH 1LVBA 3MNXA 1AVWA 2BVSH 3LC3A 5FX6A 1BITA 1UVOA 2FMJA 1ABIH 1P0SH 3A88A 2PSYA 1UCYE 2ZFPH 4INHA 3GDVA 4JYUH 1C2GA 1EP6A 7KMEH 1H9IE 5JB9S 1ELTA 4X1PU 5C5NA 3ZZAA 4JZFH 2H9TH 1GHVH 1T8LA 2V3HH 1P3CA 1ZGVA 1TBRH 1H8DH 2V35A 2ULLA 4AYVB 2GD4B 1OS8A 1P03A 2BXUH 3ZVCA 2GDEH 1Y3UA 4ISNA 5DJ7A 4Q80A 5H4IB 4HGCA 2A4OA 3SU2A 1OP2A 4Y10E 1D6WA 4O3UA 4HFPB 1ETRH 3O8RA 1UMAH 1LMWB 5GJ4B 1UK4A 3C27B 2GT8A 2BD3A 1A2CH 4E06H 1DOJA 4GSOA 4MNXA 1MZDA 3M37A 3I77A 2F83A 1YCPH 3MH7A 3ITIA 3E8LA 1S83A 4ZKRU 1O3KA 1IHSH 1K1LA 3JZ2B 3ODDA 2PGQB 2OQ5A 2V3OH 1F5KU 2ODPA 9LPRA 3SUEA 1MTVA 2OBQA 5HM2A 1S6FA 5GCHF 1DITH 9ESTA 1C5VA 1UCYK 1ZYOA 1CBWC 3PLBA 3ZZCA 1ARBA 3EA9A 1ZMNA 2SNW