2H9HA

An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Hepatitis A virus protease 3C
publication title An Episulfide Cation (Thiiranium Ring) Trapped in the Active Site of HAV 3C Proteinase Inactivated by Peptide-based Ketone Inhibitors.
pubmed doi rcsb
source organism Hepatitis a virus
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h9hA02
4Y8XA 2AGIX 2NU0E 1AWHB 1HXEH 4JMYA 4D76A 5LPRA 1ETSH 1P57B 1ZR0A 4AG2A 3VB5A 1PQ8A 2VB0A 3RU4D 3U9AH 1GBCA 4FU9A 1IQLA 1UJ1A 1AI8H 3RC4A 3FP7E 1EOJA 2BZ6H 3PMAB 5ESBA 3DD2H 2VWNA 4NIXA 3RMOH 2ZCKP 2OC7A 4MG3A 3TITA 3D23A 1O2GH 4QT8C 3STIA 2RDLA 1LHCH 1O3BA 3RXTA 2QA9E 5A09A 1MTVA 1G2MA 1VCWA 2HVXA 1S6HA 3E8LA 2DE9A 2ZQ1A 5GIBA 1SOTA 1UK2A 5GJ4B 1C5LH 1RRKA 2ZGBH 2OC0A 1GMCG 4JZ1A 1UK4A 1XUJA 3ODDA 4FUHA 2FS8A 1V2NT 1TPSA 3GCHB 1C1WH 5L30H 2P16A 3SU4A 5FX6A 1GBBA 2FOFA 1PPZA 2ANYA 4Y7BA 3GCTG 5DKMA 1OX1A 3P17H 3KCGH 4IGDA 3TIUA 2LNCA 2ZGXH 3DHKH 4U32A 3ZZ5A 2Q6DA 2J92A 3SNBA 1J15A 9ESTA 2VNTA 2Z9GA 2YNBA 3RXVA 3LPRA 1TAWA 4H6TA 1GJ6A 1ESAA 1FDPA 4ZKSU 1Y3YA 2BVSH 3OSYA 1GL1A 2BXUH 1O3OA 5H4IB 3ENSB 1V2VT 2BD9A 4BAOB 4YZUA 3OTJE 2BD7A 2WINI 1TLDA 5EXMA 4OGXA 2BY5X 2F9BH 2ZNKH 1ANDA 4H42U 3TNTA 2VVCA 1KXFA 3ZVFA 3KIDU 1C5XB 1QRZA 1K2I1 1DWBH 2QYIA 1G3CA 4YLUA 3SJ8A 3M37A 1O2SA 1LVMA 2ODPA 1O2OA 1P01A 1H8DH 2BDCA 1YCPM 2BQ7B 1TA6A 2H9TH 4A1TA 2ZKSA 2IJOB 4X1RU 1AN1E 1RTFB 1C2KA 2CF9H 4PROA 2UWPA 1GCTB 3UNRA 4Y8YA 3OY5U 3NXPA 2O8LA 5EPYA 1ESTA 4F49A 4DURA 1P2QA 1QY6A 3KQBA 4MNVA 2FI5E 1HPGA 1LHEH 3LC5A 3K2UA 1K1LA 2BHGA 1LDTT 1QL7A 2TPIZ 1ZOMA 5E0JA 1YPLH 1Y8TA 1ELGA 2C8WB 3RXMA 4MPXA 4BAQB 1Y3XA 3F9EA 1DICA 4FUCA 3BTTE 2ULLA 1KDQB 1UVOA 1V2ST 2ZF0H 5HGGA 2GT8A 3P95A 4Y76A 1LPKB 1Z8JB 2R2MB 3PLPA 2ALPA 3BV9B 1MU8B 3NCLA 5F6MA 5DP3A 3TJVA 2XWAA 4R8TB 3M7UA 1KIGH 1MKWK 3A7XA 4FUDA 4AB8A 1NFXA 1PJPA 2BLOA 5FCKA 2GV6A 1P02A 4YT6H 1ZPBA 4DGJA 5EQRA 1G30B 1J16A 1SGFG 2OC1A 1C5RA 3VPKA 1JRTA 2WPKS 1LPGB 3ZV8A 1CT4E 2A7CA 1EAIA 5HM2A 2ZEBA 4ABAA 1IQEA 2UUYA 4RN6A 3S69A 3MH7A 3TJNA 1W7XH 1T4VH 1UHBB 1WYKA 1FY5A 2B9LA 5GCHF 1BT7A 3FVFB 3LJOA 3UY9A 1CVWH 1TALA 2FOBA 2WPHS 1HJ9A 1MZAA 2R3UA 1EASA 2NU1E 2BMGB 2P93A 1Q3XA 3SNAA 4CR9A 1BRBE 3TGKE 1HLTH 3PLKA 3BIUH 3ITIA 1CSOE 3DA9B 4OS4A 4ZXYH 1UTMA 5GXPA 4RKOB 4WY3A 5K0HA 2BD8A 5DP4A 1PPHE 1MKXK 4WXVA 3P8GA 1GJ7B 3MNBA 4X0WU 1TNIA 4BTTB 1ZGVA 2VIQA 4BXSA 4D7FA 2F91A 3ZZ9A 3B9FH 1EZQA 3A82A 4THNH 4WH6A 5EPNA 1EXFA 2VU8E 1E37B 1IQNA 1AE8H 1VCQA 3U69H 2SGDE 1BJVA 1O32A 2FIRH 2VVVA 4A1VA 1GHZA 2C8YB 1UTLM 3T5FH 1MU6B 5ETXA 2BTCE 3AVZA 1C2MA 1TABE 2GKVE 1JXPA 1FY8E 2FDAA 1AU8A 2ESTE 1C5OH 3T62A 4NFFA 3SQHE 5LPEA 2H9EH 4U30A 1GL0E 2NWNA 1BQYA 3GY3A 5JBAS 1G3DA 1SGCA 1ETTH 2CJIA 2PGQB 3K65B 1FPCH 1OKXA 2HPQH 5LH8A 1BRCE 1Z1IA 3SGBE 1DM4B 1T8MA 3FFGA 3HKJB 3I29A 1LPZB 2AIQA 1WTGH 1NRSH 1UTNA 1UTJA 1CGJE 2G5NA 4Q2KA 3E16B 1W14U 3A7ZA 3C1KA 1LHFH 1NZQH 4Z0KA 5TJXA 1CO7E 2XRCA 2ZDNA 2ZHWH 1SGFA 1LTOA 6GCHF 1SGYE 2ZA5A 1BMMH 1WTHD 1O2QA 3F9FA 3LDXH 1C1OA 4I31A 1H4WA 2C90B 2BLVA 2AMQA 5AHGH 1EPTC 5EQQA 2QC2A 1O5DH 2ILNA 1P3CA 5EXNA 2M5TA 1EATA 1ZJDA 1UVSH 2ANMH 3S9BA 3M3VA 3IG6B 1HAHH 1J17T 1SBWA 5A0CA 2H5DA 2JH6D 1KTTB 2ODYB 1ABIH 1P8VC 3QZRA 1AKSA 5EODA 1UCYK 1WAYB 1TPAE 2C3SA 2XNIA 4FUEA 2EA3A 1P2MA 2AERH 5FXLA 2HWLB 2G4UA 1P2JA 2PSYA 3QTVH 1C5TA 2OQ5A 2ZI2H 5J4QA 2D2DA 3RMMH 2VIVA 2R0KA 2P3UB 1SQOA 4NA7A 1SC8U 1EJMA 2Y5GA 2JETC 2BY6X 4UEHH 1KXAA 1A3EH 1NY22 4FVDA 4GCHG 5AF9H 1GI5A 2I6QA 2AGGX 4Q80A 1T8NA 3A83A 1UVPA 3MTYA 4TY7A 1O3DA 1TA2A 4Y10E 4A7IB 2BQ6B 1HGTH 1Z8IB 1J14A 2OLGA 4FU7A 2VINA 3RLYH 1F0TA 4CHAC 3SV7A 1A1RA 4U2WA 3S9CA 3RM0H 1MKXH 1G36A 1F2SE 2FTLE 3PO1C 1OOKB 1YPEH 5FPYA 4Q7YA 1ZSJA 2VJ1A 1L1JA 3V13A 4B74A 3SV8A 1NROH 1A2CH 1AY6H 1OSSA 2BX3A 2ZFPH 1C5PA 2G4TA 1SQTA 1RS0A 2XBXA 4I8LA 1W7GH 1QJ7B 3E0PB 2WPMS 2Y5HA 3RXPA 1THSH 2KAIA 5B6OA 3H5CB 1YPKH 4BANB 3ZZ7A 2G8TA 2LPRA 5C1UA 4KELA 2VVUA 2I6SA 1RTLA 4CRBA 2BD4A 3SI4H 3GY4A 3SJIA 1NT1A 1OWHA 5FCRA 1K1OA 1ZTLA 1LVYA 2BOKA 3V3MA 4I7YH 1XVMA 2VIDA 4MNWA 4X8UH 5A8XA 4ABFA 1W2KH 2HRVA 3PB1E 2QAAA 3SJOA 1AGJA 4FUJA 1ZZZA 1ARBA 2A4QA 3CENA 1O35A 2CV3A 1WQSA 2FODA 4BAMB 3ATMA 4A5TS 1TBRH 3LT3A 1RJXB 2Z9IA 1K1IA 2P59A 1A5IA 2XBYA 2VIPA 2FWWA 5E0HA 4OS2A 2BDAA 4YT7H 5AVDA 2SGEE 2NU3E 3ZYEA 4H4FA 4NGAH 1IAUA 1EPTB 2ZWLH 2O8UA 2XXLA 3NUMA 2RG3A 1C5YB 1L1GA 1YF4A 1XUHA 4NCYA 4AG1A 4AGKA 3L3TA 4CRFA 4DIHH 2B0FA 3UOPA 1MD8A 4CH8B 1UCYH 5JBCS 1BHXF 1GBDA 1MUEB 4Y0YE 2VIWA 1Z1JA 4TYDA 3BTFE 2F9PA 3S9AA 4UONA 3RM2H 3ZVDA 4I33A 5A2MH 1S0QA 3SUDA 1EQ9A 1LHGH 1MMJN 1HNEE 4X6PA 1AE5A 1OP0A 2HPPH 2JETB 1YC0A 4A6LA 4A92A 5GDSH 1THRH 3T28A 2G52A 1GMHG 5DG6A 1BMNH 4MPWA 3UFAA 1LQDB 1Y5UT 2FLRH 2Z7FE 1NN6A 1SHHB 1MQ6A 1KSNA 1SI5H 1O31A 2J34A 4I8GA 1ELAA 2GDDA 2ZTYA 2WV4A 2R0LA 1V2TT 1KYNA 1WCZA 1GBHA 3FZDA 1ANEA 1FUJA 4CHAB 1S6FA 1V2WT 2TIOA 2BX4A 3QX5H 1MH0A 3PO1B 1O3MA 4XBBA 4FUIA 1DUEA 3RXIA 1HAYB 2WYJA 2Z9LA 1ANBA 4WJG2 3EGKH 1RGQA 1QTFA 4B73A 2H2ZA 3TLOA 4H6SB 1GMDF 3RXLA 4RSPA 4GVUA 4NSVA 8GCHF 2ZPSA 4Y7AA 1ELDE 3AAUA 1GCTC 3ZZCA 5DP6A 1GBMA 5J4SA 1FIZA 2XW9A 3M36A 1KLIH 4CBNA 5IYTA 4D9RA 2EI6A 3A81A 1K1NA 2OINA 3QN7A 4K8BA 3FZZA 1SHYA 2D1JA 3SU6A 3RMNH 1QQUA 4AFSA 1KXBA 1YP9A 1C1SA 1F0SA 5I25A 1IHTH 1KLJH 3SOSA 2WPLS 1HAXB 2A7JA 3RU4E 4IC6A 2ZFFH 1DS2E 4MTBA 3STJA 5JYIA 4R0IA 2BLQA 2Z94A 1M9UA 2A7HA 4AX9H 2PSXA 2RA0A 3E3TA 4X8TH 1O2WA 3P92A 4AB9A 2PLXA 1O5FH 4AZ2B 4GHQA 1GGDC 2GD4B 2W7UA 1YPHC 3UPEA 4UFGH 3Q76A 1O3IA 2GDEH 1BBRH 3GISB 1D6WA 1OWEA 1AVWA 1DY8A 2UUKB 1E38B 1TB6H 3GYLB 1O2MA 5T3HA 1SFIA 4TY6A 1MTNC 1AVXA 2BDYA 2XCNA 2ZG0H 3ZYDA 3BTEE 3A88A 3MNXA 3GDUA 5GCHG 1W10U 1QA0A 2Y5FA 4UDWH 2Z3EA 4DIIH 1XXFA 2IOTA 1D6RA 1BJUA 3MH5A 1DLEA 2PV9B 4YTAA 3Q3XA 1BA8B 1C4V2 1ZGIA 3P8NA 5LGOA 3R0FA 4I8KA 3LGWA 2ZO3H 2AS9A 1MD7A 2FM2A 3EE0B 1GBAA 1VJ9U 3C27B 4NIWA 1ZSKA 4B2BA 1ZPCA 1CBWB 2H9HA 1E34B 1S81A 5TCCA 3SGAE 3RXFA 2P95A 4B75A 1SGNE 1BCUH 1O3AA 1LVBA 2TGDA 1NO9H 5T6DA 2BVXH 3O8DA 2AH4X 3ATKA 2P3FH 1AQ7A 2QXGA 3KNXA 4K8YA 2OP9A 3GY6A 1GBIA 2FLBH 1O3PB 1DX5M 1O3FA 1HAVB 1H1BA 2SNWA 2BDIA 1TX7A 3MFJA 2PTNA 1XUFA 3KEEA 4NA8A 3BEUA 1EB2A 2FI4E 1C1RA 1A0HB 1C1UH 5GWZA 4SGBE 6ESTA 4DCDA 4DY7B 1YLCA 1GJ5H 3PMJA 1O2KA 3FP6E 1AUJA 1SGQE 3MU8A 4JK6A 2RA3A 1OP2A 3DT0H 1GHAF 4IN1A 1MTSA 2OD3B 2ZCLP 4KGAA 1L1NA 3F68H 4TWWA 3IWMA 3LH1A 1QL8A 1RFNA 2A4RA 4CRDA 2OCVB 1O5EH 1LKBA 2PR3A 1TNHA 2UUJB 1NTPA 2THFB 1XKAC 4NIVA 1TGBA 2BM2A 3M7TA 6GCHG 1SQAA 3KQEA 1TGTA 1TGCA 1O3NA 4GAWA 3S7KB 3URDA 1P3EA 2JKHA 1QL9A 3TVJB 3SUEA 3A7TA 4BNRA 3P8FA 3RXDA 4BTUB 3U8OH 3P70B 1Y59T 7GCHF 1NFUA 1GG6C 2CGAA 1SGIB 4IMZA 1FONA 1GBKA 1IQHA 3VXEH 1SVPA 1IQGA 1DOJA 1EUFA 3MO3A 3R3GB 4MVNA 1QRXA 1C2DA 1JMOH 2BXTH 1JOUB 3LH3A 5DP5A 2ZHEH 1SGDE 1SFQB 1XX9A 3RXQA 3BG4C 4WMEA 1CGIE 1IQMA 1XXDA 1GGDB 4CRAA 3NKKA 1IHSH 3IITA 4XE4A 5A8YA 1QBVH 3F1SB 4ZROA 3PWCA 3VB7A 5HMAA 1TMUH 1RIWC 4ZUHA 1P9UA 2ZHDA 1MTNB 1GI6A 3UUZA 1G2LA 1YCPK 4X1QU 5L2YH 4LZ4B 3GCNA 5C1XA 5C2ZA 1HUTH 1TFXA 1SSXA 5A8ZA 1FNIA 2QXHA 1ARCA 3QDZB 4F4OC 1V2OT 3SZNA 5FBIA 4KKDA 4ASHA 1P10A 4X8VH 4AORA 2ZECA 2QN5T 1C1PA 3ATWA 3MNSA 2ZGJA 1FQ3A 2OBQA 2NU2E 3LC3A 4OS1A 4X2VA 1QB1A 2VWLA 1CT0E 4WMDA 4YO9A 1QRWA 2ZGHA 2BB4A 2ZFQH 4JZDH 1BHXB 3SGQE 1GJ8B 2CMYA 3BSQA 2XC0A 3RXJA 2DUCA 3JZ2B 1KTSB 1ZHPA 4ABHA 1O2UA 2Y7ZA 1CHOF 5F03A 3MNCA 4XBDA 2CXVA 3Q77A 3OY6U 1ZHRA 1YPGH 1GI1A 3BTQE 1MTWA 1K1JA 5C5OA 4X1NU 5CHAC 2ASUB 3EA7A 4OS6A 4TWYA 4CH2B 4YOJA 1C1MA 2PKSC 5F8ZA 2FESH 4JYUH 2WUBA 3WY8A 1O3LA 1TBZH 1UTKA 4GPGA 3E6PH 4INHA 2XC4A 1GI8B 1KXDA 1TNGA 4X2YA 3A7VA 2PHBA 2XC5A 1GI2A 2P94A 1SG8B 4X6OA 2QV1A 2PW8H 1NU7B 1O39A 1BMAA 1F5LA 1TNLA 1VITG 2ZP0H 3A8CA 3RMLH 1QIXB 1D3PB 1HAIH 1N6YA 1XM1A 3KL6A 2HNTC 1G9IE 2PKAB 3SU2A 1HAOH 1Y3VA 1Y5AT 2C93B 1DWDH 3UWIA 2GP9B 2F9OA 2STAE 5PTPA 1SGRE 2HLCA 1GHXH 2IN2A 4BAKB 3TGIE 1HIAB 3GYMA 1LQEA 2SGAA 1TIOA 1FV9A 1T31A 1BBRE 3AW1A 4Y8ZA 2FEQH 1CA8B 2R3YA 2OQUA 2JH0D 1W11U 1TBQH 1GG6B 4DJZB 2ZDKA 1NFYA 2ZU4A 1GHBG 1JIRA 2GV7A 4XSKU 4ZHLU 1TYNA 2D26C 1MAXA 1V3XA 2R2WU 5EOKA 1AMHA 1PQ7A 2V3OH 1ID5H 1MKWH 3U98H 1DITH 1GVKB 3BG4B 2OXSA 2J9NA 4ZHMU 3ZZAA 1VCPA 1K1MA 1GJAB 1F0RA 2BY7X 2HALA 3A85A 5JB8S 2O9QA 3BTKE 3U8TH 1SGTA 4NZQA 4AYYB 3M5MA 4ZMAH 1RIWB 3A87A 1ZYOA 2GMTC 5FPSA 3M35A 1P05A 4ZKOU 1GI9B 1GJ4H 4JZIA 1KDQA 2ZTZA 4CRCA 3O8BA 3SV2H 1V2JT 1DPOA 3RC5A 4BAHB 3RXBA 2FXRA 2B8OH 4SGAE 3PWBA 3UNQA 1O5AB 2FTMA 2W3IA 2FOEA 4INLA 3Q3KA 3A8AA 1HAPH 1GHVH 1BTHH 2O8MA 3M5LA 1F5RA 1H9HE 1H9IE 2A2XH 4YOIA 1IQFA 4UFEH 4X2WA 3GY5A 2BY9X 3F9GA 3TH3H 1VGCC 3AAVA 1C1VH 3KQCA 1FY1A 2G81E 2STBE 1Q2WA 1GVLA 4X8SH 1Z6JH 4YOGA 1LMWB 4X1PU 1O2LA 1ZMLA 1OS8A 3A8BA 1FIWA 3D65E 1W8BH 1UTPA 2FOGA 1UVTH 2FX6A 2Q6FA 3GY8A 8GCHG 3KHVA 1O2JA 1O3HA 1C2GA 1UHBA 3ZZ8A 2QF0A 5ABWA 1RTKA 2J2UA 2ZFSA 4I32A 3N7OA 1W0ZU 1P0SH 8ESTE 3UQVA 5CHAB 3HATH 3LGYA 2PKSB 1EX3A 3T25A 1V2PT 1YPHE 4O03A 3CS0A 1CT2E 1S5SA 1U6QA 1S85A 1FY4A 1PPCE 1BTZA 1B0EA 3MU5A 3M5NA 3H7OA 2A5AA 1O3GA 2P8OC 1SL3A 2C4FH 1A0JA 1O5BB 9LPRA 1P09A 4B1TA 3RDZA 5FPTA 5DK1A 1C4U2 4AOQA 1WQVH 5E8EH 3E91A 1GWAA 4ABBA 1FMGA 1L4ZA 3LKWA 1QURH 2FOMB 1HBTH 1DE7H 1Z8GA 4NG9H 1BOQA 1O3JA 3TGJE 4IN2A 3QGJA 4WMFA 3LOXA 3ZVAA 1YKTA 1C2FA 1QCPA 2ZHQH 1NFWA 2ZPRA 1SLXB 3RC6A 2FOCA 3T27A 4I8JA 1ZMNA 1SGPE 3RXUA 1V2MT 5AFYH 1N1LA 1OPHB 2A32A 1HXFH 2WV5A 2AIPA 1QA7A 1EKBB 2BZAA 5CMXH 4ISOA 1IQJA 1DY9A 3UIRA 5HYOA 1FPHH 2Q6GA 4VGCC 1AFEH 3LU9B 5FHTA 1BRUP 1OYQA 4GLYA 1BIOA 4Z6AH 1ELEE 1EP5A 1FJSA 4Y71A 1K21H 4TPYA 4D8NA 2QXIA 3MH6A 2F9UA 1QJ1B 2ZDAH 3F9HA 1P03A 2WPIS 5EXLA 5FAHA 4ZKRU 2Z3DA 2Y7XA 3QK1A 2FOAA 3CP7A 3U1IB 2BVRH 4WVPE 1BDAA 1O37A 2GMTB 1T8LA 5G4BA 1AZZA 1E0FD 1GDNA 2FYQA 2BDBA 4K1SA 1CBWC 1OWDA 2FI3E 1GBTA 1O2ZA 2GTBA 1EJNA 1NS3A 5CE1A 1DANH 1FZZA 1NESE 3TK6A 1NRRH 4NWKA 4I8HA 4ZH8A 2ZU3A 3P8OA 1EAWA 1OWJA 2RCEA 4CRGA 4HI3A 2F3CE 1BZXE 2WPJS 1CU1A 1AO5A 2JH5D 4BTIB 1XUGA 2FP7B 1PQAA 4FUGA 1VGCB 3RXKA 4ESTE 4FUBA 1ZRKA 2PFEA 1C5MD 4O97A 1C2EA 2ZDMA 5C3NA 3EYDA 2ZQ2A 1D9IA 2GX4A 3H7TA 1K28D 2V6NA 1EJAA 2BY8X 1O2RA 4MPUA 1C1TA 2SFAA 3TJOA 1DUAA 3TK9A 4ISHH 1NM6A 4HGCA 1IQIA 4NA9H 3V0XA 1ESBA 5T6FA 4UE7H 4X2XA 6LPRA 1C2LA 3LONA 1B5GH 1TRMA 4OS7A 1FAKH 4E05H 1UO6A 3VB6A 4AFZA 1GBJA 5BRRE 3LGTA 1GI7B 2B7DH 1KXEA 2P8OB 1C2IA 3EA9A 4AN7A 4Y79A 1DFPA 1KXCA 2Y81A 3PMHB 3TJUA 3VFEA 2TGAA 5A0BA 3L6PA 7GCHG 2IPHA 1SOZA 1TE0A 1TGNA 1SGEE 2QGRA 4JZFH 1H8IH 3SN8A 1EAXA 3PTBA 2PGBB 3T29A 1C5WB 1W0YH 1O2PA 1TX6A 2BD2A 4CREA 1V6DA 1WSSH 2EEKA 3AASA 1YPMH 3M61U 3BG8A 2VWMA 2GZ9A 4YLQH 2BOHB 3MU1A 5FBEA 1TNKA 2CF8H 4OGYA 3MMGA 3SNEA 5A0AE 1GJCB 3AW0A 4A1XA 1HCGA 2GGVB 3G01A 3K9XB 3D49H 1CA0C 3EQ0H 1ELBA 1GDUA 1SMFE 1SLVB 2BDGA 3ZVEA 2UUFB 3SHAH 4X6MA 3EDXB 1W3CA 3A86A 1BB0B 1G3BA 2V35A 3ESTA 1S0RA 2GCTC 4J2YB 4K60A 4VGCB 3P6ZB 3ATIA 3Q00A 4ZAEA 4X6NA 3ZZDA 2ALVA 1VJAU 1MQ5A 3RXSA 4IC5A 1QHRB 1O33A 1EOLA 5LPFA 1V2LT 2FX4A 1GBFA 1AB9C 1A3BH 4INKA 1ELFA 2F83A 1KLTA 3VGCC 1Y3UA 2ZFRH 3NWUA 1P2KA 3ZZ3A 3EA8A 4UFFH 1F7ZA 5E2OA 1XUIA 1T8OA 3W94A 1P04A 3SUFA 2W7SA 4ABGA 1UMAH 2DE8A 1AD8H 1PYTD 3ODFA 3ZVGA 2H1UA 1TWXB 3UREA 3BEIB 1FAXA 1FI8A 3QO6A 1JIMA 1EPTA 2BYAX 4WF8A 3QGNB 4WXIA 2F9VA 4IBLH 2XCFA 1D4PB 2C8XB 3KQDA 4KTUA 4MDSA 7ESTE 3MO6A 2FO9A 2HNTE 1K22H 1H9LB 2H6MA 2PTCE 3HGPA 1CHOG 5DO4H 5IDKA 2VIOA 4NFEA 1QBNA 4JCNA 1ETRH 2FZZA 2TGTA 1ZHMA 4Y11E 1ELCA 1P06A 1C9PA 1TGSZ 1J9CH 2HOBA 4RKJB 4DOQA 3LJJA 1O5GH 2HNTF 3MI4A 3TU7H 3SI3H 2QF3A 1O2TA 2NU4E 1QR3E 1NRPH 3A80A 1AHTH 2AMDA 2CHAC 1TMTH 1XVOA 1VZQH 3ZVBA 4E7NA 1GMHF 1DDJA 1YBWA 1DLKB 1O2XA 1P11E 2SGFE 1HAZB 1AFQC 1YGCH 1A0LA 3FP8E 3SO3A 2VGCC 3U1JB 1HB0B 4ABEA 1BTXA 4ISNA 1S84A 1G3EA 3SJ9A 3TH2H 1C1QA 1FN8A 1HJ8A 1N8OC 2AFQB 1BTWA 5JB9S 2BD3A 3Q3YA 5EW1H 5DPAA 3SNDA 3GOVB 1F0UA 5DP9A 4K2YA 4K1TA 1PPFE 1D3DB 4MPVA 2J95A 4UFDH 4MQAA 4LZ1H 1BITA 1TOMH 2A31A 2EI8A 2GCHF 3HGNA 3KF2A 3RXEA 5F8TA 4D9QA 3ZV9A 1A61H 2XBVA 3M3SA 2W5EA 2Q1JA 1QFKH 1B7XB 1TQ0B 7KMEH 5E0GA 1WBGB 1P2IA 1TQ7B 2OTVA 5C1YA 4ABJA 2GZ7A 1K1PA 2WYGA 1AKSB 1XMNB 2EC9H 3MHWU 2F9NA 3BTWE 1FXYA 2FYRA 1LVOA 1UCYE 5EQSA 1DSUA 2Z6BD 1Y3WA 3KGPA 1MCTA 1VITH 2QIQA 1O2NA 1C5NH 3L33A 1LKAA 1O2HA 3UR9A 2ZDLA 3T26A 2R9PA 3BN9A 3RXCA 4JZEH 2VH0A 3DFLA 1CA0B 3MU4A 4ISIH 2AYWA 1L0ZA 3OX7U 1DWCH 3RLWH 1ORFA 1S82A 1GI4A 3F6UH 2GCTB 1EAUA 1FN6A 4XBCA 1T7CA 1O34A 1NC6A 4HZHA 1ELVA 3A7WA 3PTNA 4K1EA 3SQEE 3OYPA 1NRNH 3RUOA 2HGTH 5E2PA 1HJAC 2TGPZ 4YM9A 2J94A 1DXPA 3O8CA 1AB9B 1A5HA 3BTDE 3VGCB 2VH6A 2XBWA 2B5TB 1PPGE 5SGAE 1V2QT 1GI3A 3MOCA 5ESTE 1CE5A 3RXAA 6CHAC 1N6XA 3RXHA 3HK3B 5HXFA 1QQ4A 1T32A 2Y80A 2ODQA 1V2KT 3ELAH 3GDVA 1ACBE 3LGUA 2O8WA 1GMCF 2A4OA 1IOEA 4JYVH 3E90B 4XFQA 1CQQA 3MO9A 4YESB 1PPEE 2A5KA 3QTOH 3OU0A 4ABIA 3PLBA 2A0QB 2KAIB 4NWLA 4Y6DA 1PPBH 3GCTF 1O36A 2ZIQH 1C2JA 4BOHA 3TH4H 2ANWA 5I46H 1PYTC 1EZSC 2CHAB 3UTUH 4ZXXH 1EZXC 3B8JA 1SLUB 2G5VA 3I78A 2EI7A 1AFQB 1ZJKA 3S7HB 2VWOA 5FX5A 2VGCB 2ANKH 3JZ1B 4NZLA 1L4DA 1DVAH 1A46H 1GCDA 1WOFA 3UR6A 1P2NA 3UOUA 1N8OB 4D7GA 2PUXB 1TOCB 3VEQB 3A89A 2A5IA 1AIXH 3T2NA 4B2AA 1C1NA 2P3TB 5JPMH 1HAVA 1EP6A 1QBOA 3PV4A 1EZUC 4KTCA 5T6GA 2V0BA 5JBBS 1G37A 1XUKA 3GDSA 1LHDH 1GJBB 4E06H 1TONA 1OYTH 4FUFA 2SNVA 1GHYH 3MYWA 3GY2A 2G55A 5DP8A 4KP0A 5EGMA 1K9OE 2BLWA 1O3EA 3NZIA 1MBQA 1INCA 1HDTH 1RD3B 5EU8A 5C5NA 1GHWH 5HM9A 1LO6A 3TPIZ 4IMQA 3UNSA 4UD9H 1G32B 4O9VA 1MCVA 1C5ZB 4NIYA 5EG4A 4KTSA 1NPMA 3RP2A 4J1YA 1SR5C 4X1SU 3URCA 2OBOA 1OWKA 4JYTA 3GCOA 4DT7B 1O2IA 1O3CA 4GHTA 1Z71A 4B2CA 1NRQH 1FY3A 2ZDVH 4CR5A 3SU0A 1DWEH 1YM0A 1YCPH 3UWJH 2Z3CA 1GJDB 3UQOA 1C2HA 1HJAB 1L2EA 1YPJH 3A8DA 1C9TA 2Z9KA 1BRAA 5L6NH 3BTGE 3QUMP 3ZZBA 1V2RT 3QWCH 1W12U 1CGHA 2OUAA 8KME2 3NPSA 1AVGH 4NSYA 1MTUA 3BTHE 4MNYA 6CHAB 3MWIU 3M3TA 1OWIA 3K6YA 4FVBA 2XYAA 4AGJA 5DJ7A 3FANA 3QZQA 8LPRA 3ZZ4A 1GMDG 4GSOA 1TRYA 5AFZH 2V3HH 2QCYA 1A4WH 1AUTC 1O0DH 1DXWA 1Z7KA 2BQWB 5JBTA 2H5CA 1TMBH 2XWBI 1AWFH 3SORA 3PYHA 4Q7ZA 1C5QA 2ZU1A 1JRSA 4FU8A 4O3UA 2J38A 1TNJA 2XTTB 3SU1A 1CHGA 1S83A 1XKBC 1KY9A 1Y5BT 1JWTA 5TCAA 3O8RA 3W95A 2Z9JA 2ZZUH 3BIVH 1C4Y2 4DVAU 4OS5A 1O30A 4U01A 1Z8RA 4IS5A 1UVUH 1C5SA 4LOYH 3QLPH 1ZTJA 4HFPB 3SU3A 4FXGH 3K6ZA 1BTUA 2QY0B 1ELTA 3S0NA 1F5KU 2WUCA 2SGQE 1GJ9B 2TBSA 3RU4T 4K5ZA 1IQKA 3SV6A 2C8ZB 1E36B 2PWXA 3E0NB 4WWYA 3A84A 3CS7A 1QGFA 1RXPA 2ZU2A 2ZFTA 3M7QA 3SBKA 1GBLA 1UK3A 2FOHA 2Y6TA 3GICB 4O3TA 1VITF 1BTPA 4WH8A 2A2QH 3TNSA 1T4UH 1HV7A 2ZGCA 2AGEX 4TPIZ 3HK6B 1C5UA 1SLWB 4IW4E 1FLEE 1NU9A 3SNCA 4AFUA 1BUIA 3A7YA 2UWOA 2PKAA 1O2YA 1O5CB 2ZU5A 1Z6EA 3V7TA 1ZRBA 1ZSLA 2ZHFH 3BTME 3LGVA 3RXOA 3U8RH 3MH4A 1P2OA 3ZZ6A 2FPZA 3D62A 2W26A 1QB9A 5DP7A 2OC8A 1A7SA 3I77A 1MBMA 4Q7XA 4ISLA 1HIAA 3HPTB 1BBRK 4LK4A 4LXBH 3V12A 3VXFH 1GVZA 3PMBB 1GHBF 1ZMJA 3BEFB 1TRNA 1TPPA 3GY7A 1E35B 3LIWA 1HAGE 3VB4A 3E1XB 2BD5A 3PM3A 2A1DB 5EW2H 1PQ5A 1SB1H 1GDQA 3KN2A 3GCHC 1A5GH 1OP8A 1D3TB 1OXGA 1THPB 5F8XA 1VR1H 2J4IA 3SJKA 2SGPE 4MNXA 1JBUH 1D3QB 1GI0A 4XDEA 2AEIH 3SU5A 1W13U 3BF6H 2QXJA 5DGJA 1X7AC 4MLFB 1WU1A 2UWLA 3LGIA 3FAOA 3ZVCA 1PFXC 2TRMA 1BTYA 2GT7A 2FMJA 4Y0ZE 3RXGA 2CN0H 1Q31A 1QJ6B 4K69A 2G51A 2ZPQA 4GCHF 1B0FA 1LCYA 3VB3A 1GHAG 1P9SA 2Y82A 1ZPZA 1ABJH 1BMLA 1TPOA 2A4GA 5C67A 3TK5A 4E7RG 5GPIB 4DG4A 3NK8A 4CBOA 1EB1H 4AYVB 4JK5A 4ABDA 2ZTXA 1V2UT 3RXRA 1HRTH 3ATLA 4HTCH 2W3KA 4ZHAA 4GUXA 2GCHG 4K3JA 2ZCHP 2G00A 2YOLA 1WUNH 4B71A 2FS9A 1DSTA 1UTQA 2YNAA 3SV9A 1QB6A 3MU0A 4BXWA 2O8TA 4M7GA 1ZLRA 1F92A 1ANCA 1J8AA 5JDUB 7LPRA 1MAYA 4DW2U 5K7RA 1MZDA 2D8WA 2GZ8A 5L2ZH 3SHCH 3PROA 1SPJA 4AFQA 1P12E 3DFJA 3SW2B 3M5OA 1WV7H 4XOJA 1UTOA 5BPEA 3SUGA 4ZKNU 3HKIB 5C20A 1YYY1 1O38A 2AMPA 2GVFA 3B23B 1GPZA 1HFDA 1O2VA 1HYLA 1YLDA 3DUXH 1O3KA 1C5VA 2ZC9H 1DT2A 2BDHA 2A45B 2PUQH 1GBEA 1TX8A 4B76A 2K1QA 1QNJA 1ZTKA 3EAJA 1AZ8A
chains in the Genus database with same CATH superfamily
4Y8XA 2AGIX 2NU0E 1AWHB 1HXEH 4JMYA 5C17A 4D76A 5LPRA 1ETSH 1P57B 1ZR0A 4AG2A 3VB5A 1PQ8A 3F2HA 2VB0A 3RU4D 3U9AH 1GBCA 4FU9A 1IQLA 1UJ1A 1AI8H 2CK3D 3RC4A 3FP7E 1EOJA 2BZ6H 3PMAB 5ESBA 3DD2H 2VWNA 4NIXA 3RMOH 2ZCKP 2OC7A 4MG3A 3TITA 3D23A 1O2GH 4QT8C 3STIA 2RDLA 1LHCH 1O3BA 3RXTA 2QA9E 5A09A 1MTVA 1G2MA 1VCWA 2HVXA 1S6HA 3E8LA 2DE9A 2ZQ1A 5GIBA 1SOTA 1UK2A 5GJ4B 1C5LH 1RRKA 2ZGBH 2OC0A 1GMCG 4JZ1A 1UK4A 2AHME 4RI0A 1XUJA 3ODDA 4FUHA 2FS8A 2VBCA 1V2NT 1TPSA 3GCHB 1C1WH 5L30H 2P16A 3SU4A 5FX6A 1GBBA 2FOFA 1PPZA 2ANYA 4Y7BA 3GCTG 3DCLA 5DKMA 1OX1A 3P17H 1NBME 3KCGH 4IGDA 3TIUA 2LNCA 2ZGXH 3DHKH 4U32A 3ZZ5A 2Q6DA 2J92A 3SNBA 2WPDD 1J15A 9ESTA 2VNTA 2Z9GA 2YNBA 3RXVA 4P02A 3LPRA 1TAWA 4H6TA 1GJ6A 1ESAA 1FDPA 4ZKSU 1Y3YA 2BVSH 3OSYA 1GL1A 2BXUH 1O3OA 5H4IB 3ENSB 1V2VT 2BD9A 4YXWD 4BAOB 4YZUA 2KCYA 3OTJE 2BD7A 2WINI 1TLDA 5EXMA 4OGXA 2BY5X 2F9BH 2ZNKH 1ANDA 4H42U 3TNTA 2VVCA 1KXFA 3ZVFA 3KIDU 1C5XB 1QRZA 1K2I1 1DWBH 2QYIA 1G3CA 1W0JD 4YLUA 3SJ8A 3M37A 1O2SA 1LVMA 2ODPA 5EJ1A 5IK2D 1O2OA 2W6ID 1P01A 1H8DH 2BDCA 1YCPM 2BQ7B 1TA6A 2H9TH 4A1TA 2ZKSA 2IJOB 4X1RU 1AN1E 1RTFB 1C2KA 2CF9H 4PROA 2UWPA 1GCTB 3UNRA 4Y8YA 3OY5U 3NXPA 2O8LA 5EPYA 1ESTA 3GS9A 2L6OA 4F49A 4DURA 1P2QA 1QY6A 3KQBA 4MNVA 2FI5E 1HPGA 1LHEH 3LC5A 3K2UA 1K1LA 3SYJA 2BHGA 1LDTT 1QL7A 2TPIZ 3UB0A 1ZOMA 5E0JA 1YPLH 1Y8TA 1ELGA 2C8WB 3RXMA 4MPXA 4BAQB 1Y3XA 3F9EA 1DICA 4FUCA 3BTTE 2ULLA 1KDQB 2JDID 1UVOA 1V2ST 2ZF0H 5HGGA 2GT8A 3P95A 4Y76A 1LPKB 1Z8JB 2R2MB 3PLPA 2ALPA 3BV9B 1MU8B 3NCLA 3FO8D 5F6MA 5DP3A 3TJVA 2XWAA 4R8TB 3M7UA 2V7QD 5GNDA 1KIGH 1MKWK 3A7XA 4FUDA 4AB8A 2KX4A 1NFXA 1PJPA 2BLOA 5FCKA 2GV6A 1P02A 4YT6H 1ZPBA 4DGJA 5EQRA 1G30B 1J16A 1SGFG 2OC1A 1C5RA 3VPKA 1JRTA 2WPKS 1LPGB 3ZV8A 1CT4E 2A7CA 1EAIA 5HM2A 2ZEBA 4ABAA 1IQEA 2UUYA 4RN6A 3S69A 3MH7A 3TJNA 1W7XH 1T4VH 1UHBB 1WYKA 1FY5A 2F43B 2B9LA 5GCHF 1BT7A 3FVFB 3LJOA 3UY9A 1CVWH 1K0HA 1TALA 2FOBA 2WPHS 1HJ9A 1MZAA 2R3UA 1EASA 2NU1E 2BMGB 2P93A 1Q3XA 3SNAA 4CR9A 2M2AA 1BRBE 3TGKE 1HLTH 3PLKA 3BIUH 3ITIA 1CSOE 3DA9B 4OS4A 4ZXYH 1UTMA 5GXPA 4RKOB 4WY3A 5K0HA 2BD8A 5DP4A 1PPHE 1MKXK 4WXVA 3P8GA 1GJ7B 3MNBA 4X0WU 2HVYB 1TNIA 4BTTB 1ZGVA 2VIQA 4BXSA 4D7FA 2F91A 3ZZ9A 3B9FH 1EZQA 3A82A 4THNH 4WH6A 5EPNA 1EXFA 2VU8E 1E37B 1YWUA 1IQNA 1AE8H 1VCQA 3U69H 2SGDE 1BJVA 1O32A 1BMFD 2FIRH 2VVVA 1GHZA 4A1VA 2C8YB 4OM9A 1UTLM 3T5FH 1MU6B 5ETXA 2BTCE 3AVZA 2QE7D 1C2MA 1TABE 2WSSD 2GKVE 1JXPA 1FY8E 2FDAA 1AU8A 2ESTE 1C5OH 3T62A 4NFFA 3SQHE 5LPEA 2H9EH 4U30A 1GL0E 2NWNA 1BQYA 3GY3A 5JBAS 3EE7A 1G3DA 1SGCA 1ETTH 2CJIA 2PGQB 3K65B 1FPCH 1OKXA 2HPQH 5LH8A 1BRCE 1Z1IA 3SGBE 1DM4B 1T8MA 3FFGA 3HKJB 3I29A 1LPZB 2AIQA 1WTGH 1NRSH 1UTNA 1UTJA 1CGJE 2G5NA 4Q2KA 3E16B 1W14U 3A7ZA 3C1KA 1LHFH 1NZQH 2KM0A 5KECA 4Z0KA 5TJXA 1CO7E 2XRCA 2ZDNA 2ZHWH 4XRNA 1SGFA 1LTOA 6GCHF 1SGYE 2ZA5A 1BMMH 1WTHD 1O2QA 3F9FA 3LDXH 1C1OA 4I31A 1H4WA 2C90B 2BLVA 2AMQA 5AHGH 1EPTC 5EQQA 2QC2A 1O5DH 2ILNA 1P3CA 5EXNA 1UW7A 2M5TA 1EATA 1ZJDA 1UVSH 2ANMH 3S9BA 3M3VA 3IG6B 1HAHH 1J17T 1SBWA 5A0CA 2H5DA 2JH6D 1KTTB 2ODYB 1ABIH 3U28C 1P8VC 3QZRA 1AKSA 5EODA 1UCYK 1WAYB 1TPAE 2C3SA 2XNIA 4FUEA 2EA3A 1P2MA 2AERH 5FXLA 2HWLB 2G4UA 1KMHB 1P2JA 2PSYA 3QTVH 1C5TA 2OQ5A 2ZI2H 5J4QA 2D2DA 3RMMH 2VIVA 2R0KA 2P3UB 1SQOA 4NA7A 1SC8U 1EJMA 2Y5GA 2JETC 2BY6X 2QF5A 4UEHH 1KXAA 1A3EH 1NY22 4FVDA 4GCHG 5AF9H 2LP6A 1GI5A 2I6QA 2AGGX 4Q80A 1T8NA 3A83A 1UVPA 3MTYA 4TY7A 1O3DA 1TA2A 4Y10E 4A7IB 2BQ6B 1HGTH 1Z8IB 1J14A 2OLGA 4FU7A 2VINA 3WW7A 3RLYH 1F0TA 4CHAC 3SV7A 1A1RA 4U2WA 3S9CA 3RM0H 1MKXH 1G36A 1F2SE 2FTLE 3PO1C 1OOKB 1YPEH 5FPYA 4Q7YA 1ZSJA 2VJ1A 1L1JA 3V13A 4B74A 3SV8A 1NROH 3FOAA 1A2CH 1AY6H 1OSSA 2BX3A 2ZFPH 1C5PA 2G4TA 1SQTA 1RS0A 2XBXA 4I8LA 1W7GH 1QJ7B 3E0PB 2WPMS 2Y5HA 3RXPA 1THSH 2KAIA 5B6OA 3H5CB 1YPKH 4BANB 3ZZ7A 2G8TA 2LPRA 5C1UA 4KELA 2VVUA 2I6SA 1RTLA 4CRBA 2BD4A 3SI4H 3GY4A 3SJIA 1NT1A 1OWHA 5FCRA 1K1OA 1ZTLA 1LVYA 2BOKA 3V3MA 4I7YH 1XVMA 2VIDA 4MNWA 4X8UH 5A8XA 4ABFA 1W2KH 2HRVA 3PB1E 1E79D 2QAAA 3SJOA 1AGJA 3OFND 1ZZZA 4FUJA 1ARBA 2A4QA 3CENA 1O35A 3KYGA 2CV3A 1WQSA 2FODA 4BAMB 3ATMA 4A5TS 1TBRH 3LT3A 1RJXB 2Z9IA 1K1IA 2P59A 1A5IA 2XBYA 2VIPA 2FWWA 5E0HA 4OS2A 2BDAA 4YT7H 5AVDA 2SGEE 2NU3E 3ZYEA 4H4FA 4NGAH 1IAUA 1EPTB 2ZWLH 2O8UA 5DN6D 2XXLA 3NUMA 3N99A 2RG3A 1C5YB 1L1GA 1YF4A 1XUHA 4NCYA 4AG1A 2RDEA 4AGKA 3L3TA 4CRFA 4DIHH 2B0FA 3UOPA 1MD8A 4CH8B 1UCYH 5JBCS 1BHXF 1GBDA 3W1EA 1MUEB 4Y0YE 2VIWA 1Z1JA 4TYDA 3F0OA 3BTFE 2F9PA 3S9AA 4UONA 3RM2H 3ZVDA 4I33A 5A2MH 1S0QA 3SUDA 1EQ9A 1LHGH 1MMJN 1HNEE 4TSFD 4X6PA 1AE5A 1OP0A 2HPPH 2JETB 2K0QA 1YC0A 4A6LA 4A92A 5GDSH 1THRH 3T28A 3FKSD 2G52A 1GMHG 5DG6A 1BMNH 4MPWA 3UFAA 1LQDB 1Y5UT 2FLRH 2Z7FE 1NN6A 1SHHB 1MQ6A 1KSNA 2JJ2D 1SI5H 3CNRA 1O31A 2J34A 4I8GA 1ELAA 2GDDA 2ZTYA 2WV4A 2R0LA 1V2TT 1KYNA 1WCZA 1GBHA 3FZDA 1ANEA 1FUJA 4CHAB 1S6FA 1V2WT 2TIOA 2BX4A 3QX5H 1MH0A 3PO1B 1O3MA 4XBBA 4FUIA 2YMSD 1DUEA 3RXIA 1HAYB 2WYJA 2Z9LA 1ANBA 4WJG2 3EGKH 1RGQA 1QTFA 4B73A 2H2ZA 3TLOA 4H6SB 1GMDF 3RXLA 4RSPA 4GVUA 4NSVA 8GCHF 2ZPSA 4Y7AA 1ELDE 3AAUA 1GCTC 3ZZCA 5DP6A 1GBMA 5J4SA 1FIZA 2XW9A 3M36A 1KLIH 4CBNA 5IYTA 4D9RA 2EI6A 3A81A 1K1NA 2OINA 1EFRD 3QN7A 4K8BA 3FZZA 1SHYA 2D1JA 3SU6A 3RMNH 1QQUA 4AFSA 1KXBA 1YP9A 1C1SA 1F0SA 5I25A 1IHTH 1KLJH 3SOSA 2WPLS 1HAXB 2A7JA 3RU4E 4IC6A 2ZFFH 1DS2E 4MTBA 3STJA 5JYIA 4R0IA 2BLQA 2Z94A 1M9UA 2A7HA 3DSOA 4AX9H 2PSXA 2RA0A 3E3TA 4X8TH 1O2WA 2EY4C 3P92A 4AB9A 2PLXA 3F3BA 1O5FH 4AZ2B 4GHQA 1GGDC 2GD4B 2W7UA 1YPHC 3UPEA 4UFGH 3Q76A 1O3IA 2GDEH 1BBRH 3GISB 1D6WA 1OWEA 1AVWA 1DY8A 2UUKB 1E38B 1TB6H 3GYLB 1O2MA 5T3HA 1SFIA 4TY6A 1MTNC 1AVXA 2BDYA 2XCNA 2ZG0H 3ZYDA 3BTEE 3A88A 3MNXA 3GDUA 5GCHG 1W10U 1QA0A 2Y5FA 4UDWH 2Z3EA 4DIIH 1XXFA 2IOTA 1D6RA 1BJUA 3MH5A 1DLEA 2PV9B 2J97A 4YTAA 3Q3XA 1BA8B 1C4V2 1ZGIA 3P8NA 5LGOA 3R0FA 4I8KA 3LGWA 2ZO3H 2AS9A 1MD7A 2FM2A 3EE0B 1GBAA 1VJ9U 4Q63A 3C27B 4NIWA 1ZSKA 4B2BA 1ZPCA 1CBWB 2H9HA 1E34B 1E1RD 1S81A 5TCCA 3RXFA 2P95A 3SGAE 4B75A 1SGNE 1BCUH 1O3AA 1LVBA 2TGDA 1NO9H 5T6DA 2BVXH 3O8DA 1W0KD 2AH4X 3ATKA 2P3FH 1AQ7A 2QXGA 3KNXA 4K8YA 2OP9A 2XOKD 3GY6A 1GBIA 2FLBH 1O3PB 3PV2A 1DX5M 2F4LA 1O3FA 1HAVB 1H1BA 2SNWA 2BDIA 1TX7A 3MFJA 2PTNA 1XUFA 3KEEA 4NA8A 3BEUA 1NBMD 4FETA 1EB2A 2FI4E 1C1RA 1A0HB 3OTPA 1C1UH 5GWZA 4SGBE 6ESTA 4DCDA 4DY7B 1YLCA 1GJ5H 3PMJA 3WWFA 1O2KA 3FP6E 1AUJA 1SGQE 3MU8A 4JK6A 2RA3A 1OP2A 3DT0H 1GHAF 4IN1A 1MTSA 2OD3B 2ZCLP 4KGAA 1L1NA 3F68H 4TWWA 3IWMA 2IPQX 1QL8A 3LH1A 1RFNA 2A4RA 4CRDA 2OCVB 1O5EH 1LKBA 2PR3A 1TNHA 2UUJB 1NTPA 2THFB 1XKAC 4NIVA 1TGBA 2BM2A 3M7TA 4RT1A 6GCHG 1SQAA 3KQEA 1TGTA 1TGCA 1O3NA 4GAWA 3S7KB 3URDA 1P3EA 2JKHA 1QL9A 2J98B 3TVJB 3SUEA 3A7TA 4BNRA 3P8FA 3RXDA 3OEHD 4BTUB 3U8OH 3P70B 1Y59T 7GCHF 1NFUA 1GG6C 2CGAA 1SGIB 4IMZA 1FONA 1GBKA 1IQHA 3VXEH 5DSFA 1SVPA 4ACBA 1IQGA 1DOJA 2HLDD 1EUFA 3MO3A 3R3GB 4MVNA 1QRXA 1C2DA 1JMOH 2BXTH 1JOUB 3LH3A 5DP5A 2ZHEH 1SGDE 1SFQB 1XX9A 3RXQA 3BG4C 4WMEA 4TT3D 1CGIE 1IQMA 1XXDA 1GGDB 4CRAA 3NKKA 1IHSH 3IITA 4XE4A 5A8YA 1QBVH 3F1SB 4ZROA 5KEDA 3PWCA 3VB7A 5HMAA 1TMUH 1RIWC 4ZUHA 1P9UA 2ZHDA 4HG6A 1MTNB 1GI6A 3UUZA 1G2LA 1YCPK 4X1QU 5L2YH 4LZ4B 3GCNA 5C1XA 5C2ZA 1HUTH 1TFXA 1SSXA 1SKYE 5A8ZA 1FNIA 2QXHA 1ARCA 3QDZB 4F4OC 1VKYA 1V2OT 3SZNA 5FBIA 3OAAD 4KKDA 1SQRA 4ASHA 1P10A 4X8VH 4AORA 2ZECA 5HIZA 2QN5T 1C1PA 3ATWA 3MNSA 2ZGJA 1FQ3A 2OBQA 2NU2E 3LC3A 4OS1A 4X2VA 1QB1A 2VWLA 1CT0E 4WMDA 3SZEA 4YO9A 1QRWA 2ZGHA 2BB4A 2ZFQH 4JZDH 1BHXB 3SGQE 1H8HD 1GJ8B 2CMYA 3BSQA 2XC0A 3RXJA 2DUCA 3JZ2B 1KTSB 1ZHPA 4ABHA 1O2UA 2Y7ZA 1CHOF 5F03A 3MNCA 4XBDA 2KZ4A 2CXVA 3Q77A 3OY6U 1ZHRA 1YPGH 1GI1A 3BTQE 1MTWA 1K1JA 5C5OA 4X1NU 5CHAC 2ASUB 3EA7A 4OS6A 4TWYA 4CH2B 4YOJA 1C1MA 2PKSC 5F8ZA 2FESH 4JYUH 1QZ8A 2WUBA 3WY8A 1O3LA 1TBZH 1UTKA 4GPGA 3E6PH 4INHA 2XC4A 1GI8B 1KXDA 1TNGA 4X2YA 3A7VA 2PHBA 2XC5A 1GI2A 2P94A 1SG8B 4X6OA 2QV1A 2PW8H 1NU7B 1O39A 1BMAA 1F5LA 1TNLA 1VITG 2ZP0H 3A8CA 3RMLH 1QIXB 1D3PB 1HAIH 1N6YA 1XM1A 3KL6A 3PRDA 2HNTC 1G9IE 2PKAB 3SU2A 1HAOH 1Y3VA 1Y5AT 2C93B 1DWDH 3UWIA 2GP9B 2F9OA 2STAE 5PTPA 1SGRE 2YMSB 2HLCA 1GHXH 2IN2A 4BAKB 3TGIE 1HIAB 3GYMA 1LQEA 2SGAA 1TIOA 1FV9A 1T31A 1BBRE 3AW1A 4Y8ZA 2FEQH 1CA8B 2R3YA 2OQUA 2JH0D 1W11U 1TBQH 1GG6B 4DJZB 2ZDKA 1NFYA 2ZU4A 1GHBG 1JIRA 2GV7A 4B6FA 4XSKU 4ZHLU 5KGOA 1TYNA 2D26C 1MAXA 1V3XA 2R2WU 5EOKA 1AMHA 1PQ7A 2V3OH 1ID5H 1MKWH 3U98H 1DITH 1GVKB 3BG4B 2OXSA 2J9NA 4ZHMU 3ZZAA 1VCPA 1K1MA 1GJAB 1F0RA 2BY7X 2HALA 3A85A 5JB8S 2O9QA 3BTKE 4ACAA 3U8TH 1SGTA 4NZQA 4AYYB 3M5MA 4ZMAH 1RIWB 3A87A 1ZYOA 2GMTC 5FPSA 3M35A 5C0UA 1P05A 4ZKOU 1GI9B 4I86A 1GJ4H 4JZIA 1KDQA 2ZTZA 4CRCA 3O8BA 3SV2H 1V2JT 1DPOA 3RC5A 4BAHB 3RXBA 2FXRA 2B8OH 4SGAE 3PWBA 3UNQA 1O5AB 2FTMA 2W3IA 2FOEA 4INLA 3Q3KA 3A8AA 1HAPH 1GHVH 1BTHH 2O8MA 3M5LA 1F5RA 1H9HE 5T1VA 1H9IE 2A2XH 4YOIA 1IQFA 4UFEH 4X2WA 3GY5A 2BY9X 5EJLA 3F9GA 3TH3H 1VGCC 3AAVA 1C1VH 3KQCA 1FY1A 2G81E 2STBE 1Q2WA 1GVLA 4X8SH 1Z6JH 4YOGA 1LMWB 4X1PU 1O2LA 1ZMLA 1OS8A 3A8BA 1FIWA 3D65E 1W8BH 1UTPA 2FOGA 1UVTH 2FX6A 2Q6FA 3GY8A 8GCHG 3KHVA 1O2JA 1O3HA 1C2GA 1UHBA 3ZZ8A 2QF0A 5ABWA 1RTKA 2J2UA 2ZFSA 4I32A 3N7OA 1W0ZU 1P0SH 8ESTE 3UQVA 5CHAB 3HATH 3LGYA 2PKSB 1EX3A 3T25A 1V2PT 1YPHE 4O03A 3CS0A 1CT2E 1S5SA 1U6QA 1S85A 1FY4A 1PPCE 1BTZA 1B0EA 3MU5A 3M5NA 3H7OA 2A5AA 1O3GA 2P8OC 1SL3A 2C4FH 1A0JA 1O5BB 9LPRA 1P09A 4B1TA 3RDZA 5FPTA 5DK1A 3F0PA 1C4U2 4AOQA 1WQVH 5E8EH 3E91A 1GWAA 4ABBA 1FMGA 1L4ZA 3LKWA 1QURH 2FOMB 1HBTH 1DE7H 1Z8GA 4NG9H 1BOQA 1O3JA 2WZQA 3TGJE 4IN2A 3QGJA 4WMFA 3LOXA 3ZVAA 1YKTA 1C2FA 1QCPA 2ZHQH 1NFWA 2ZPRA 1SLXB 3RC6A 2FOCA 3T27A 4I8JA 1ZMNA 1SGPE 1WXRA 3RXUA 1V2MT 5AFYH 1N1LA 1OPHB 2A32A 1HXFH 2WV5A 2AIPA 1QA7A 1EKBB 2BZAA 2OK5A 5CMXH 4ISOA 1IQJA 1DY9A 3UIRA 5HYOA 1FPHH 2Q6GA 4VGCC 2QF4A 1AFEH 3LU9B 5FHTA 1BRUP 1OYQA 4GLYA 3KQ5A 1BIOA 4Z6AH 1ELEE 1EP5A 1FJSA 4Y71A 1K21H 4ASUD 4TPYA 4AC9A 4D8NA 2QXIA 3MH6A 2F9UA 1QJ1B 3MQKC 2ZDAH 3F9HA 1P03A 2WPIS 5EXLA 5FAHA 4ZKRU 2Z3DA 2Y7XA 3QK1A 2FOAA 3CP7A 3U1IB 2BVRH 4WVPE 1BDAA 1O37A 2GMTB 1S6LA 1T8LA 5G4BA 4FOUC 1AZZA 4ZCNA 1E0FD 1GDNA 2FYQA 2BDBA 4K1SA 4Q4LA 1CBWC 1OWDA 1FX0B 2FI3E 1GBTA 1O2ZA 2GJGA 2GTBA 1EJNA 1NS3A 5CE1A 1DANH 1FZZA 1NESE 2W6JD 3TK6A 1NRRH 4NWKA 4I8HA 3OE7D 4ZH8A 2ZU3A 3P8OA 1EAWA 1OWJA 2RCEA 4CRGA 4HI3A 2F3CE 1BZXE 2WPJS 1CU1A 1AO5A 2JH5D 4BTIB 1XUGA 2FP7B 1PQAA 4FUGA 1VGCB 3RXKA 4ESTE 4FUBA 1ZRKA 2PFEA 1C5MD 4O97A 1C2EA 2ZDMA 5C3NA 3EYDA 2ZQ2A 1D9IA 2GX4A 3H7TA 1K28D 2V6NA 1EJAA 2BY8X 1O2RA 4MPUA 1C1TA 3DSPA 2SFAA 3TJOA 1DUAA 3TK9A 4ISHH 1NM6A 4B6EA 4HGCA 1IQIA 4NA9H 3V0XA 1ESBA 5T6FA 4UE7H 4X2XA 6LPRA 1C2LA 3LONA 1B5GH 1TRMA 4OS7A 1FAKH 4E05H 1UO6A 3VB6A 4AFZA 1GBJA 5BRRE 3LGTA 1GI7B 2B7DH 1KXEA 2P8OB 1C2IA 3EA9A 4AN7A 4Y79A 1DFPA 1KXCA 1YY3A 2Y81A 3PMHB 3TJUA 3VFEA 2TGAA 5A0BA 3L6PA 7GCHG 2IPHA 1SOZA 1TE0A 1TGNA 1SGEE 2QGRA 2RFKC 4JZFH 1H8IH 3SN8A 1EAXA 3OEED 3PTBA 2PGBB 3T29A 1C5WB 1W0YH 1O2PA 1TX6A 2BD2A 4CREA 1V6DA 1WSSH 2EEKA 3AASA 1YPMH 3M61U 3BG8A 2VWMA 2GZ9A 4YLQH 2BOHB 3MU1A 5FBEA 1TNKA 2CF8H 4OGYA 3MMGA 3SNEA 2V3MA 5A0AE 1COWD 1GJCB 3AW0A 4A1XA 1HCGA 2GGVB 3G01A 3K9XB 5EJZA 3D49H 1CA0C 3EQ0H 1ELBA 1GDUA 1SMFE 1SLVB 2BDGA 3UAIC 3ZVEA 2UUFB 3SHAH 4X6MA 3EDXB 1W3CA 3A86A 1BB0B 1G3BA 2V35A 3ESTA 1S0RA 2GCTC 4J2YB 4K60A 4VGCB 3P6ZB 3ATIA 3Q00A 4ZAEA 4X6NA 3ZZDA 2ALVA 1VJAU 1MQ5A 3RXSA 4IC5A 1QHRB 1O33A 1EOLA 3VG8A 5LPFA 1V2LT 2FX4A 1GBFA 1AB9C 1A3BH 4INKA 1ELFA 2F83A 1KLTA 3VGCC 1Y3UA 2ZFRH 3NWUA 1P2KA 3ZZ3A 3EA8A 4UFFH 1F7ZA 5E2OA 1XUIA 1T8OA 3W94A 1P04A 3SUFA 2W7SA 4ABGA 1UMAH 2DE8A 1AD8H 1PYTD 3ODFA 3ZVGA 2H1UA 1TWXB 3UREA 3BEIB 1FAXA 1FI8A 2KCPA 3QO6A 1JIMA 1EPTA 2BYAX 4WF8A 3QGNB 3NRLA 2F9VA 4WXIA 4IBLH 2XCFA 1D4PB 2C8XB 3KQDA 4KTUA 4MDSA 7ESTE 3MO6A 2FO9A 2HNTE 1K22H 4XD7D 1H9LB 2H6MA 2PTCE 3HGPA 1CHOG 5DO4H 5IDKA 2VIOA 4NFEA 1QBNA 4JCNA 5HIYA 1ETRH 2FZZA 2TGTA 1ZHMA 4Y11E 1ELCA 1P06A 2XNDD 1C9PA 1TGSZ 1J9CH 2HOBA 4RKJB 4DOQA 3LJJA 1O5GH 2HNTF 3MI4A 3TU7H 3SI3H 2QF3A 1O2TA 2NU4E 1QR3E 1NRPH 3A80A 1AHTH 2AMDA 2CHAC 1TMTH 1XVOA 1VZQH 3ZVBA 4E7NA 1GMHF 1DDJA 1YBWA 1DLKB 1O2XA 1P11E 2SGFE 1HAZB 1AFQC 1YGCH 1A0LA 3FP8E 3SO3A 2VGCC 3U1JB 1HB0B 4ABEA 1BTXA 4ISNA 1S84A 1G3EA 3SJ9A 3TH2H 1C1QA 1FN8A 1HJ8A 1N8OC 2AFQB 1BTWA 2L74A 5JB9S 2BD3A 3Q3YA 4P00A 5EW1H 5DPAA 3SNDA 3GOVB 1F0UA 5DP9A 4K2YA 2IJD1 4K1TA 2KCOA 1PPFE 1D3DB 4MPVA 2J95A 4UFDH 4MQAA 4LZ1H 1BITA 1TOMH 2A31A 2EI8A 2GCHF 2YMSC 3HGNA 3KF2A 3RXEA 5F8TA 4D9QA 3ZV9A 1A61H 2XBVA 3M3SA 2W5EA 2Q1JA 1QFKH 1B7XB 1TQ0B 7KMEH 5E0GA 1WBGB 1P2IA 1TQ7B 3FN8A 2OTVA 5C1YA 4ABJA 2GZ7A 1K1PA 2WYGA 1AKSB 1XMNB 2EC9H 3MHWU 2F9NA 3BTWE 1FXYA 2FYRA 1LVOA 1UCYE 5EQSA 1DSUA 2Z6BD 1Y3WA 3KGPA 1MCTA 1VITH 2QIQA 1O2NA 1C5NH 3L33A 1LKAA 1O2HA 3UR9A 2ZDLA 3T26A 2R9PA 3BN9A 3RXCA 4JZEH 2VH0A 3DFLA 1CA0B 3MU4A 4ISIH 2AYWA 1L0ZA 3OX7U 1DWCH 3RLWH 1ORFA 1S82A 1GI4A 3F6UH 2GCTB 4F48B 1EAUA 1FN6A 4XBCA 1T7CA 1O34A 1NC6A 4HZHA 1ELVA 3A7WA 3PTNA 4K1EA 5FL7D 3SQEE 3OYPA 1NRNH 3RUOA 3AK5A 2HGTH 5E2PA 1HJAC 2TGPZ 5EIYA 4YM9A 2J94A 1DXPA 3O8CA 1AB9B 1A5HA 3BTDE 3VGCB 2VH6A 2XBWA 2B5TB 1PPGE 5SGAE 1V2QT 1GI3A 3MOCA 5ESTE 1CE5A 3RXAA 6CHAC 1N6XA 3RXHA 3HK3B 5HXFA 1QQ4A 1T32A 2Y80A 2ODQA 1V2KT 3ELAH 3GDVA 1ACBE 3LGUA 2O8WA 1GMCF 2A4OA 1IOEA 4JYVH 5CHBA 3E90B 4XFQA 1CQQA 3MO9A 4YESB 1PPEE 2A5KA 2EQNA 3QTOH 3OU0A 4ABIA 3PLBA 2A0QB 2KAIB 4NWLA 4Y6DA 1PPBH 3ZIAD 3GCTF 1O36A 3F2FA 2ZIQH 1C2JA 4BOHA 3TH4H 2ANWA 5I46H 1PYTC 1EZSC 2CHAB 3UTUH 4ZXXH 1EZXC 3B8JA 1SLUB 2G5VA 3I78A 2EI7A 1AFQB 1ZJKA 3KYFA 3S7HB 2VWOA 5FX5A 2VGCB 2ANKH 3JZ1B 4NZLA 1L4DA 1DVAH 1A46H 1GCDA 1WOFA 3UR6A 1P2NA 3UOUA 1N8OB 4D7GA 2PUXB 1TOCB 3VEQB 3A89A 2A5IA 1AIXH 3T2NA 4B2AA 1C1NA 2P3TB 5JPMH 1HAVA 1EP6A 1QBOA 3PV4A 1EZUC 4KTCA 5T6GA 2JJ1D 2V0BA 5JBBS 1G37A 1XUKA 3GDSA 1LHDH 1GJBB 4E06H 1TONA 1OYTH 4FUFA 2SNVA 1GHYH 3MYWA 3GY2A 2G55A 5DP8A 4KP0A 5EGMA 4Z1MD 1K9OE 2BLWA 1O3EA 1YLNA 3NZIA 1MBQA 1INCA 1HDTH 1RD3B 5EU8A 5C5NA 1GHWH 5HM9A 1LO6A 4RT0A 3TPIZ 4IMQA 3UNSA 4UD9H 1G32B 4O9VA 1MCVA 4M9FA 1C5ZB 4NIYA 5EG4A 4KTSA 1NPMA 3RP2A 4J1YA 1SR5C 4X1SU 3URCA 2OBOA 1OWKA 4JYTA 3GCOA 4DT7B 1O2IA 1O3CA 4GHTA 1Z71A 4B2CA 2J98A 1NRQH 2J5UA 2KCAA 1FY3A 2ZDVH 4CR5A 3SU0A 1DWEH 2LELA 1YM0A 1YCPH 3UWJH 2Z3CA 1GJDB 3UQOA 1C2HA 1HJAB 1L2EA 1YPJH 3A8DA 1C9TA 2Z9KA 1BRAA 5L6NH 3BTGE 3QUMP 5CDFE 3ZZBA 1V2RT 3QWCH 1W12U 1CGHA 2OUAA 4DT4A 8KME2 3NPSA 1AVGH 4NSYA 1MTUA 3BTHE 4MNYA 6CHAB 3MWIU 3M3TA 1OWIA 3H09A 3K6YA 4FVBA 2XYAA 4AGJA 5DJ7A 3FANA 3QZQA 1MABB 8LPRA 3ZZ4A 1GMDG 4GSOA 1TRYA 5AFZH 2V3HH 2QCYA 1A4WH 1AUTC 1O0DH 1DXWA 1Z7KA 2BQWB 5JBTA 2H5CA 1TMBH 2XWBI 1AWFH 3SORA 3PYHA 4Q7ZA 1C5QA 2ZU1A 1JRSA 4FU8A 4O3UA 2J38A 1TNJA 2XTTB 3SU1A 1CHGA 1S83A 1XKBC 1KY9A 1Y5BT 2WV9A 1JWTA 1OHHD 5TCAA 3O8RA 3W95A 2Z9JA 2ZZUH 3BIVH 1C4Y2 4DVAU 4OS5A 1O30A 4U01A 1Z8RA 4F55A 4IS5A 1UVUH 5C0TA 1C5SA 4LOYH 3QLPH 1ZTJA 4HFPB 3SU3A 4FXGH 3WWBA 3K6ZA 1BTUA 2QY0B 1ELTA 3S0NA 1F5KU 2WUCA 2SGQE 1GJ9B 2TBSA 3RU4T 4K5ZA 1IQKA 3SV6A 2C8ZB 1E36B 2PWXA 3E0NB 4WWYA 3A84A 3CS7A 1QGFA 1RXPA 2ZU2A 2ZFTA 3M7QA 3DSGA 3SBKA 1GBLA 1UK3A 2FOHA 2Y6TA 3GICB 4O3TA 2PP6A 1VITF 5HKKD 1BTPA 4WH8A 2A2QH 2JIZD 1T4UH 3TNSA 1HV7A 2ZGCA 2AGEX 4TPIZ 3HK6B 1C5UA 1SLWB 4IW4E 1FLEE 1NU9A 3SNCA 4AFUA 1BUIA 3A7YA 2UWOA 2PKAA 1O2YA 1O5CB 2ZU5A 3PRBA 1Z6EA 3V7TA 1ZRBA 1ZSLA 2ZHFH 3BTME 3LGVA 3RXOA 3U8RH 3MH4A 1P2OA 3N7EA 3ZZ6A 2FPZA 3D62A 2W26A 1QB9A 5DP7A 2OC8A 1A7SA 3I77A 1MBMA 4Q7XA 4ISLA 1HIAA 3HPTB 1BBRK 4LK4A 4LXBH 3V12A 3VXFH 5F53A 1GVZA 3PMBB 1GHBF 3PV5A 1ZMJA 3BEFB 1TRNA 1TPPA 3GY7A 1E35B 3LIWA 1HAGE 3VB4A 3E1XB 2BD5A 3PM3A 2A1DB 5EW2H 1PQ5A 1SB1H 1GDQA 3KN2A 3GCHC 1E1QD 1A5GH 1OP8A 1D3TB 1OXGA 1THPB 1WDIA 5F8XA 1VR1H 2J4IA 3SJKA 2SGPE 4MNXA 1JBUH 1D3QB 1GI0A 4XDEA 2AEIH 3SU5A 1W13U 3BF6H 2QXJA 5DGJA 1X7AC 4MLFB 1WU1A 2UWLA 3LGIA 3FAOA 3ZVCA 1PFXC 2TRMA 1BTYA 2GT7A 2FMJA 4Y0ZE 3RXGA 2CN0H 5C94A 1Q31A 1QJ6B 4K69A 2G51A 2ZPQA 4GCHF 1B0FA 1LCYA 3VB3A 1GHAG 1P9SA 2Y82A 1ZPZA 1ABJH 1BMLA 3N7DA 1TPOA 2A4GA 5C67A 2KFWA 3TK5A 4E7RG 5B6LA 5GPIB 4DG4A 3NK8A 4CBOA 1EB1H 2K8IA 4AYVB 4JK5A 4ABDA 2ZTXA 1V2UT 3RXRA 1HRTH 3ATLA 4HTCH 2W3KA 3F2GA 4ZHAA 4GUXA 2GCHG 4K3JA 2ZCHP 2G00A 2YOLA 1WUNH 2KR7A 4B71A 2WHXA 2FS9A 1DSTA 1UTQA 2YNAA 3SV9A 1QB6A 3MU0A 4BXWA 2O8TA 4M7GA 1ZLRA 1F92A 1ANCA 1J8AA 5JDUB 7LPRA 1MAYA 4DW2U 5K7RA 1MZDA 2D8WA 2GZ8A 5L2ZH 3SHCH 3PROA 1SPJA 4AFQA 1P12E 3DFJA 3SW2B 3M5OA 1WV7H 4XOJA 1UTOA 5BPEA 3SUGA 4ZKNU 1H8ED 3HKIB 5C20A 1YYY1 1O38A 2AMPA 2GVFA 3B23B 1GPZA 1HFDA 1O2VA 1HYLA 1YLDA 3DUXH 1O3KA 1C5VA 2ZC9H 1DT2A 2BDHA 2A45B 2PUQH 1GBEA 1TX8A 4B76A 2K1QA 1QNJA 1ZTKA 3EAJA 1AZ8A
chains in the Genus database with same CATH topology
4Y8XA 2AGIX 2NU0E 1AWHB 1HXEH 4JMYA 4D76A 5LPRA 1ETSH 1P57B 1ZR0A 4AG2A 3VB5A 1PQ8A 2VB0A 3RU4D 3U9AH 1GBCA 4FU9A 1IQLA 1UJ1A 1AI8H 3RC4A 3FP7E 1EOJA 2BZ6H 3PMAB 5ESBA 3DD2H 2VWNA 4NIXA 3RMOH 2ZCKP 2OC7A 4MG3A 3TITA 3D23A 1O2GH 4QT8C 3STIA 2RDLA 1LHCH 1O3BA 3RXTA 2QA9E 5A09A 1MTVA 1G2MA 1VCWA 2HVXA 1S6HA 3E8LA 2DE9A 2ZQ1A 5GIBA 1SOTA 1UK2A 5GJ4B 1C5LH 1RRKA 2ZGBH 2OC0A 1GMCG 4JZ1A 1UK4A 1XUJA 3ODDA 4FUHA 2FS8A 1V2NT 1TPSA 3GCHB 1C1WH 5L30H 2P16A 3SU4A 5FX6A 1GBBA 2FOFA 1PPZA 2ANYA 4Y7BA 3GCTG 5DKMA 1OX1A 3P17H 3KCGH 4IGDA 3TIUA 2LNCA 2ZGXH 3DHKH 4U32A 3ZZ5A 2Q6DA 2J92A 3SNBA 1J15A 9ESTA 2VNTA 2Z9GA 2YNBA 3RXVA 3LPRA 1TAWA 4H6TA 1GJ6A 1ESAA 1FDPA 4ZKSU 1Y3YA 2BVSH 3OSYA 1GL1A 2BXUH 1O3OA 5H4IB 3ENSB 1V2VT 2BD9A 4BAOB 4YZUA 3OTJE 2BD7A 2WINI 1TLDA 5EXMA 4OGXA 2BY5X 2F9BH 2ZNKH 1ANDA 4H42U 3TNTA 2VVCA 1KXFA 3ZVFA 3KIDU 1C5XB 1QRZA 1K2I1 1DWBH 2QYIA 1G3CA 4YLUA 3SJ8A 3M37A 1O2SA 1LVMA 2ODPA 1O2OA 1P01A 1H8DH 2BDCA 1YCPM 2BQ7B 1TA6A 2H9TH 4A1TA 2ZKSA 2IJOB 4X1RU 1AN1E 1RTFB 1C2KA 2CF9H 4PROA 2UWPA 1GCTB 3UNRA 4Y8YA 3OY5U 3NXPA 2O8LA 5EPYA 1ESTA 4F49A 4DURA 1P2QA 1QY6A 3KQBA 4MNVA 2FI5E 1HPGA 1LHEH 3LC5A 3K2UA 1K1LA 2BHGA 1LDTT 1QL7A 2TPIZ 1ZOMA 5E0JA 1YPLH 1Y8TA 1ELGA 2C8WB 3RXMA 4MPXA 4BAQB 1Y3XA 3F9EA 1DICA 4FUCA 3BTTE 2ULLA 1KDQB 1UVOA 1V2ST 2ZF0H 5HGGA 2GT8A 3P95A 4Y76A 1LPKB 1Z8JB 2R2MB 3PLPA 2ALPA 3BV9B 1MU8B 3NCLA 5F6MA 5DP3A 3TJVA 2XWAA 4R8TB 3M7UA 1KIGH 1MKWK 3A7XA 4FUDA 4AB8A 1NFXA 1PJPA 2BLOA 5FCKA 2GV6A 1P02A 4YT6H 1ZPBA 4DGJA 5EQRA 1G30B 1J16A 1SGFG 2OC1A 1C5RA 3VPKA 1JRTA 2WPKS 1LPGB 3ZV8A 1CT4E 2A7CA 1EAIA 5HM2A 2ZEBA 4ABAA 1IQEA 2UUYA 4RN6A 3S69A 3MH7A 3TJNA 1W7XH 1T4VH 1UHBB 1WYKA 1FY5A 2B9LA 5GCHF 1BT7A 3FVFB 3LJOA 3UY9A 1CVWH 1TALA 2FOBA 2WPHS 1HJ9A 1MZAA 2R3UA 1EASA 2NU1E 2BMGB 2P93A 1Q3XA 3SNAA 4CR9A 1BRBE 3TGKE 1HLTH 3PLKA 3BIUH 3ITIA 1CSOE 3DA9B 4OS4A 4ZXYH 1UTMA 5GXPA 4RKOB 4WY3A 5K0HA 2BD8A 5DP4A 1PPHE 1MKXK 4WXVA 3P8GA 1GJ7B 3MNBA 4X0WU 1TNIA 4BTTB 1ZGVA 2VIQA 4BXSA 4D7FA 2F91A 3ZZ9A 3B9FH 1EZQA 3A82A 4THNH 4WH6A 5EPNA 1EXFA 2VU8E 1E37B 1IQNA 1AE8H 1VCQA 3U69H 2SGDE 1BJVA 1O32A 2FIRH 2VVVA 4A1VA 1GHZA 2C8YB 1UTLM 3T5FH 1MU6B 5ETXA 2BTCE 3AVZA 1C2MA 1TABE 2GKVE 1JXPA 1FY8E 2FDAA 1AU8A 2ESTE 1C5OH 3T62A 4NFFA 3SQHE 5LPEA 2H9EH 4U30A 1GL0E 2NWNA 1BQYA 3GY3A 5JBAS 1G3DA 1SGCA 1ETTH 2CJIA 2PGQB 3K65B 1FPCH 1OKXA 2HPQH 5LH8A 1BRCE 1Z1IA 3SGBE 1DM4B 1T8MA 3FFGA 3HKJB 3I29A 1LPZB 2AIQA 1WTGH 1NRSH 1UTNA 1UTJA 1CGJE 2G5NA 4Q2KA 3E16B 1W14U 3A7ZA 3C1KA 1LHFH 1NZQH 4Z0KA 5TJXA 1CO7E 2XRCA 2ZDNA 2ZHWH 1SGFA 1LTOA 6GCHF 1SGYE 2ZA5A 1BMMH 1WTHD 1O2QA 3F9FA 3LDXH 1C1OA 4I31A 1H4WA 2C90B 2BLVA 2AMQA 5AHGH 1EPTC 5EQQA 2QC2A 1O5DH 2ILNA 1P3CA 5EXNA 2M5TA 1EATA 1ZJDA 1UVSH 2ANMH 3S9BA 3M3VA 3IG6B 1HAHH 1J17T 1SBWA 5A0CA 2H5DA 2JH6D 1KTTB 2ODYB 1ABIH 1P8VC 3QZRA 1AKSA 5EODA 1UCYK 1WAYB 1TPAE 2C3SA 2XNIA 4FUEA 2EA3A 1P2MA 2AERH 5FXLA 2HWLB 2G4UA 1P2JA 2PSYA 3QTVH 1C5TA 2OQ5A 2ZI2H 5J4QA 2D2DA 3RMMH 2VIVA 2R0KA 2P3UB 1SQOA 4NA7A 1SC8U 1EJMA 2Y5GA 2JETC 2BY6X 4UEHH 1KXAA 1A3EH 1NY22 4FVDA 4GCHG 5AF9H 1GI5A 2I6QA 2AGGX 4Q80A 1T8NA 3A83A 1UVPA 3MTYA 4TY7A 1O3DA 1TA2A 4Y10E 4A7IB 2BQ6B 1HGTH 1Z8IB 1J14A 2OLGA 4FU7A 2VINA 3RLYH 1F0TA 4CHAC 3SV7A 1A1RA 4U2WA 3S9CA 3RM0H 1MKXH 1G36A 1F2SE 2FTLE 3PO1C 1OOKB 1YPEH 5FPYA 4Q7YA 1ZSJA 2VJ1A 1L1JA 3V13A 4B74A 3SV8A 1NROH 1A2CH 1AY6H 1OSSA 2BX3A 2ZFPH 1C5PA 2G4TA 1SQTA 1RS0A 2XBXA 4I8LA 1W7GH 1QJ7B 3E0PB 2WPMS 2Y5HA 3RXPA 1THSH 2KAIA 5B6OA 3H5CB 1YPKH 4BANB 3ZZ7A 2G8TA 2LPRA 5C1UA 4KELA 2VVUA 2I6SA 1RTLA 4CRBA 2BD4A 3SI4H 3GY4A 3SJIA 1NT1A 1OWHA 5FCRA 1K1OA 1ZTLA 1LVYA 2BOKA 3V3MA 4I7YH 1XVMA 2VIDA 4MNWA 4X8UH 5A8XA 4ABFA 1W2KH 2HRVA 3PB1E 2QAAA 3SJOA 1AGJA 4FUJA 1ZZZA 1ARBA 2A4QA 3CENA 1O35A 2CV3A 1WQSA 2FODA 4BAMB 3ATMA 4A5TS 1TBRH 3LT3A 1RJXB 2Z9IA 1K1IA 2P59A 1A5IA 2XBYA 2VIPA 2FWWA 5E0HA 4OS2A 2BDAA 4YT7H 5AVDA 2SGEE 2NU3E 3ZYEA 4H4FA 4NGAH 1IAUA 1EPTB 2ZWLH 2O8UA 2XXLA 3NUMA 2RG3A 1C5YB 1L1GA 1YF4A 1XUHA 4NCYA 4AG1A 4AGKA 3L3TA 4CRFA 4DIHH 2B0FA 3UOPA 1MD8A 4CH8B 1UCYH 5JBCS 1BHXF 1GBDA 1MUEB 4Y0YE 2VIWA 1Z1JA 4TYDA 3BTFE 2F9PA 3S9AA 4UONA 3RM2H 3ZVDA 4I33A 5A2MH 1S0QA 3SUDA 1EQ9A 1LHGH 1MMJN 1HNEE 4X6PA 1AE5A 1OP0A 2HPPH 2JETB 1YC0A 4A6LA 4A92A 5GDSH 1THRH 3T28A 2G52A 1GMHG 5DG6A 1BMNH 4MPWA 3UFAA 1LQDB 1Y5UT 2FLRH 2Z7FE 1NN6A 1SHHB 1MQ6A 1KSNA 1SI5H 1O31A 2J34A 4I8GA 1ELAA 2GDDA 2ZTYA 2WV4A 2R0LA 1V2TT 1KYNA 1WCZA 1GBHA 3FZDA 1ANEA 1FUJA 4CHAB 1S6FA 1V2WT 2TIOA 2BX4A 3QX5H 1MH0A 3PO1B 1O3MA 4XBBA 4FUIA 1DUEA 3RXIA 1HAYB 2WYJA 2Z9LA 1ANBA 4WJG2 3EGKH 1RGQA 1QTFA 4B73A 2H2ZA 3TLOA 4H6SB 1GMDF 3RXLA 4RSPA 4GVUA 4NSVA 8GCHF 2ZPSA 4Y7AA 1ELDE 3AAUA 1GCTC 3ZZCA 5DP6A 1GBMA 5J4SA 1FIZA 2XW9A 3M36A 1KLIH 4CBNA 5IYTA 4D9RA 2EI6A 3A81A 1K1NA 2OINA 3QN7A 4K8BA 3FZZA 1SHYA 2D1JA 3SU6A 3RMNH 1QQUA 4AFSA 1KXBA 1YP9A 1C1SA 1F0SA 5I25A 1IHTH 1KLJH 3SOSA 2WPLS 1HAXB 2A7JA 3RU4E 4IC6A 2ZFFH 1DS2E 4MTBA 3STJA 5JYIA 4R0IA 2BLQA 2Z94A 1M9UA 2A7HA 4AX9H 2PSXA 2RA0A 3E3TA 4X8TH 1O2WA 3P92A 4AB9A 2PLXA 1O5FH 4AZ2B 4GHQA 1GGDC 2GD4B 2W7UA 1YPHC 3UPEA 4UFGH 3Q76A 1O3IA 2GDEH 1BBRH 3GISB 1D6WA 1OWEA 1AVWA 1DY8A 2UUKB 1E38B 1TB6H 3GYLB 1O2MA 5T3HA 1SFIA 4TY6A 1MTNC 1AVXA 2BDYA 2XCNA 2ZG0H 3ZYDA 3BTEE 3A88A 3MNXA 3GDUA 5GCHG 1W10U 1QA0A 2Y5FA 4UDWH 2Z3EA 4DIIH 1XXFA 2IOTA 1D6RA 1BJUA 3MH5A 1DLEA 2PV9B 4YTAA 3Q3XA 1BA8B 1C4V2 1ZGIA 3P8NA 5LGOA 3R0FA 4I8KA 3LGWA 2ZO3H 2AS9A 1MD7A 2FM2A 3EE0B 1GBAA 1VJ9U 3C27B 4NIWA 1ZSKA 4B2BA 1ZPCA 1CBWB 2H9HA 1E34B 1S81A 5TCCA 3SGAE 3RXFA 2P95A 4B75A 1SGNE 1BCUH 1O3AA 1LVBA 2TGDA 1NO9H 5T6DA 2BVXH 3O8DA 2AH4X 3ATKA 2P3FH 1AQ7A 2QXGA 3KNXA 4K8YA 2OP9A 3GY6A 1GBIA 2FLBH 1O3PB 1DX5M 1O3FA 1HAVB 1H1BA 2SNWA 2BDIA 1TX7A 3MFJA 2PTNA 1XUFA 3KEEA 4NA8A 3BEUA 1EB2A 2FI4E 1C1RA 1A0HB 1C1UH 5GWZA 4SGBE 6ESTA 4DCDA 4DY7B 1YLCA 1GJ5H 3PMJA 1O2KA 3FP6E 1AUJA 1SGQE 3MU8A 4JK6A 2RA3A 1OP2A 3DT0H 1GHAF 4IN1A 1MTSA 2OD3B 2ZCLP 4KGAA 1L1NA 3F68H 4TWWA 3IWMA 3LH1A 1QL8A 1RFNA 2A4RA 4CRDA 2OCVB 1O5EH 1LKBA 2PR3A 1TNHA 2UUJB 1NTPA 2THFB 1XKAC 4NIVA 1TGBA 2BM2A 3M7TA 6GCHG 1SQAA 3KQEA 1TGTA 1TGCA 1O3NA 4GAWA 3S7KB 3URDA 1P3EA 2JKHA 1QL9A 3TVJB 3SUEA 3A7TA 4BNRA 3P8FA 3RXDA 4BTUB 3U8OH 3P70B 1Y59T 7GCHF 1NFUA 1GG6C 2CGAA 1SGIB 4IMZA 1FONA 1GBKA 1IQHA 3VXEH 1SVPA 1IQGA 1DOJA 1EUFA 3MO3A 3R3GB 4MVNA 1QRXA 1C2DA 1JMOH 2BXTH 1JOUB 3LH3A 5DP5A 2ZHEH 1SGDE 1SFQB 1XX9A 3RXQA 3BG4C 4WMEA 1CGIE 1IQMA 1XXDA 1GGDB 4CRAA 3NKKA 1IHSH 3IITA 4XE4A 5A8YA 1QBVH 3F1SB 4ZROA 3PWCA 3VB7A 5HMAA 1TMUH 1RIWC 4ZUHA 1P9UA 2ZHDA 1MTNB 1GI6A 3UUZA 1G2LA 1YCPK 4X1QU 5L2YH 4LZ4B 3GCNA 5C1XA 5C2ZA 1HUTH 1TFXA 1SSXA 5A8ZA 1FNIA 2QXHA 1ARCA 3QDZB 4F4OC 1V2OT 3SZNA 5FBIA 4KKDA 4ASHA 1P10A 4X8VH 4AORA 2ZECA 2QN5T 1C1PA 3ATWA 3MNSA 2ZGJA 1FQ3A 2OBQA 2NU2E 3LC3A 4OS1A 4X2VA 1QB1A 2VWLA 1CT0E 4WMDA 4YO9A 1QRWA 2ZGHA 2BB4A 2ZFQH 4JZDH 1BHXB 3SGQE 1GJ8B 2CMYA 3BSQA 2XC0A 3RXJA 2DUCA 3JZ2B 1KTSB 1ZHPA 4ABHA 1O2UA 2Y7ZA 1CHOF 5F03A 3MNCA 4XBDA 2CXVA 3Q77A 3OY6U 1ZHRA 1YPGH 1GI1A 3BTQE 1MTWA 1K1JA 5C5OA 4X1NU 5CHAC 2ASUB 3EA7A 4OS6A 4TWYA 4CH2B 4YOJA 1C1MA 2PKSC 5F8ZA 2FESH 4JYUH 2WUBA 3WY8A 1O3LA 1TBZH 1UTKA 4GPGA 3E6PH 4INHA 2XC4A 1GI8B 1KXDA 1TNGA 4X2YA 3A7VA 2PHBA 2XC5A 1GI2A 2P94A 1SG8B 4X6OA 2QV1A 2PW8H 1NU7B 1O39A 1BMAA 1F5LA 1TNLA 1VITG 2ZP0H 3A8CA 3RMLH 1QIXB 1D3PB 1HAIH 1N6YA 1XM1A 3KL6A 2HNTC 1G9IE 2PKAB 3SU2A 1HAOH 1Y3VA 1Y5AT 2C93B 1DWDH 3UWIA 2GP9B 2F9OA 2STAE 5PTPA 1SGRE 2HLCA 1GHXH 2IN2A 4BAKB 3TGIE 1HIAB 3GYMA 1LQEA 2SGAA 1TIOA 1FV9A 1T31A 1BBRE 3AW1A 4Y8ZA 2FEQH 1CA8B 2R3YA 2OQUA 2JH0D 1W11U 1TBQH 1GG6B 4DJZB 2ZDKA 1NFYA 2ZU4A 1GHBG 1JIRA 2GV7A 4XSKU 4ZHLU 1TYNA 2D26C 1MAXA 1V3XA 2R2WU 5EOKA 1AMHA 1PQ7A 2V3OH 1ID5H 1MKWH 3U98H 1DITH 1GVKB 3BG4B 2OXSA 2J9NA 4ZHMU 3ZZAA 1VCPA 1K1MA 1GJAB 1F0RA 2BY7X 2HALA 3A85A 5JB8S 2O9QA 3BTKE 3U8TH 1SGTA