2H9HA

An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis A virus protease 3C
publication title An Episulfide Cation (Thiiranium Ring) Trapped in the Active Site of HAV 3C Proteinase Inactivated by Peptide-based Ketone Inhibitors.
pubmed doi rcsb
source organism Hepatitis a virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h9hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h9hA02
2YNBA 5BRRE 1DE7H 3A7YA 3TIUA 3JZ2B 2WYJA 1YPHE 2A5KA 3S69A 1O2VA 2TGDA 1GI4A 1OP2A 1YF4A 4ZHLU 2HOBA 2GV7A 3GDUA 3SV8A 5HM2A 2BLVA 1XKBC 5C67A 3VXFH 4AG1A 3GY4A 1C5ZB 4INLA 3E1XB 3URCA 3NKKA 1HJ9A 1ZMNA 3BIUH 3JZ1B 5EQSA 4B75A 1YCPM 4B1TA 1F92A 4INHA 1F0RA 1SBWA 3E0NB 1F0SA 2XCFA 2ZC9H 1D6WA 1SLWB 5GIBA 1MKWH 1EZUC 1P2KA 1ZOMA 2Z3CA 3KF2A 1T32A 1C4Y2 3SJIA 3RMLH 5JBCS 2GZ7A 1SGCA 2FLRH 1TQ7B 1T8OA 3M36A 2ZTYA 1PYTC 3VB5A 1GI1A 5TCCA 3A86A 1Z8RA 3IITA 4MNVA 1GL1A 1FAXA 3GCHB 3P8OA 1YC0A 1ZRBA 1P57B 2ZCHP 8KME2 3C27B 1GHXH 1Z6EA 2SGFE 4B76A 4D8NA 3TGKE 5EXMA 1GBBA 1C5MD 1C2EA 2P3FH 5DGJA 1GI6A 1EKBB 2FOFA 1AIXH 1YPEH 1P2OA 4Q80A 1TX6A 2GCTC 3E16B 3BG4C 1C1PA 1TAWA 1TGSZ 4NZLA 4Y71A 2ZECA 1C5PA 2V6NA 3RXBA 1UTNA 1B5GH 1AUTC 1O2LA 3CS7A 5TCAA 3ZVEA 1GI2A 1DUAA 1QB1A 2GZ9A 5LPFA 1P8VC 2P8OB 1P0SH 1P10A 2R9PA 4BAOB 1O2GH 5A8ZA 3M5MA 1BTHH 1KXAA 2QIQA 3ITIA 1XVOA 3S0NA 4ZH8A 1SGEE 4ZAEA 4BXSA 3HGNA 3GYMA 3SGBE 3SI3H 3FANA 5F8ZA 4IN2A 1C5OH 3RC4A 3QTVH 3UOPA 1HAYB 5LGOA 2ZU2A 1GMHG 1QIXB 2PUXB 2FOAA 3M3SA 4X8VH 5E2OA 8GCHG 1GJAB 3VXEH 1O2QA 2FWWA 3MH4A 3Q3XA 1ETRH 1HDTH 1SB1H 3FVFB 3Q00A 4SGAE 4B74A 3D62A 3EA7A 4Y76A 7GCHG 1TYNA 2GX4A 1O5CB 2XBXA 1MAXA 2Y5FA 2ANWA 2B7DH 4IC5A 2VNTA 4X1SU 3SI4H 1FY4A 4CR5A 3L33A 1A7SA 1SHHB 1ZSJA 1KTSB 2Z9IA 2ZU4A 1Y5UT 1O5FH 2OC7A 3KQBA 1P02A 3T25A 1BUIA 4AORA 2ZQ1A 1KXBA 1DUEA 1LTOA 1BA8B 1WU1A 2QA9E 3PTNA 3HGPA 3MTYA 2Z3DA 5E2PA 2O8TA 4NSYA 1OXGA 3MNCA 2C8XB 1ZTJA 3P70B 1S6HA 1J17T 4K5ZA 1GBAA 1C5UA 3UOUA 1GMHF 3F1SB 8GCHF 5FPYA 1A0HB 1LQDB 1BMNH 2G51A 4K1TA 2Z9KA 1A0LA 4YESB 1ZYOA 4OGXA 7GCHF 1YLCA 2P59A 1RTKA 2ZHEH 4ABGA 1AGJA 4D9QA 1AI8H 1V2NT 2ZCLP 2TGAA 1RS0A 1QRXA 1ARCA 2H1UA 1TMTH 2QV1A 1ORFA 1O36A 1WBGB 1GCTC 1PPGE 1QA0A 2SGEE 2VVCA 4YLQH 2BLWA 1JBUH 3A81A 1ELAA 4E7NA 4XBBA 4JZ1A 2OBQA 1HGTH 1W0YH 4F4OC 4BAKB 1F5KU 4CBNA 2FYQA 1O3OA 4GUXA 1E36B 3MMGA 2PV9B 5E0JA 5A2MH 2J94A 1O32A 1S81A 2BDCA 3F9GA 1EZQA 1EAUA 1CHOG 5TJXA 2CHAB 4JK6A 1ZZZA 2PW8H 3FZDA 2ZGJA 2QGRA 3SNAA 1A5IA 3MO3A 3T5FH 3U8RH 1G30B 2CXVA 4U30A 1K1LA 1C2FA 3ZZAA 2BDIA 2KAIA 1PPCE 3LOXA 3M61U 4XE4A 1D4PB 2DUCA 1NT1A 1LVBA 2G4TA 4B2BA 3M7UA 1CGJE 2PSYA 2G81E 4UD9H 1TBQH 2VINA 3SNBA 4AGJA 1KXFA 7LPRA 3PLPA 3M7QA 2O8WA 3A7WA 4Y8XA 1W11U 3GY2A 1FI8A 1UTOA 3B9FH 2WV5A 1A61H 1FAKH 3ZZ7A 1S82A 1HAVB 1MTWA 4A1VA 1D3DB 3SQEE 1HXEH 4Q2KA 3RLWH 1Z71A 2Y80A 3M5OA 3GDSA 3TH2H 1RTLA 1P01A 1A2CH 2D1JA 1CT2E 2BD2A 1O0DH 1DWEH 3F68H 4GHQA 3BTKE 3FP7E 4MVNA 1UK3A 4CREA 2OBOA 3LIWA 3CS0A 1GBFA 4X2XA 2BQ6B 1S84A 1ANEA 2G00A 4TWYA 4GPGA 3RMMH 4IMQA 2H9TH 6GCHG 1TNLA 2WPMS 5L30H 4AN7A 1GI5A 2XBWA 4D9RA 4WMEA 3ESTA 1O2MA 3E90B 1SQOA 1QA7A 4AYVB 3GDVA 1V2WT 1YPKH 3QK1A 2FYRA 4VGCC 1NZQH 1K22H 5A8XA 2J92A 1RGQA 3K6YA 1XUHA 4LXBH 3VEQB 3HKIB 4WH6A 1V2TT 2IN2A 3GCTF 2CF8H 2FTLE 1HNEE 2BOHB 2G52A 2BDYA 3T26A 1BBRE 2A4OA 1FV9A 2FTMA 1TE0A 1LPKB 4TWWA 4HFPB 2UWPA 1AB9C 3GY6A 1O5EH 2ALVA 1PPHE 1CSOE 1WTGH 2HRVA 1NRQH 3ATKA 4UFGH 4NWLA 1AO5A 1RXPA 1GBEA 1GBDA 3S7KB 3ODDA 4ZKNU 5GJ4B 2C3SA 3MH5A 2A5AA 2OUAA 1MZDA 2PLXA 5K7RA 1C1OA 1H9HE 3M5LA 1GG6B 4FUHA 1K1IA 3DHKH 5JDUB 3ATLA 4BAQB 2SGDE 4NWKA 1ZMLA 3MI4A 1C5QA 2UUFB 1A3EH 5E8EH 3BF6H 2FS9A 1TGBA 1FN8A 4GVUA 4ABFA 3U9AH 4UFDH 5L2ZH 4NGAH 1BTYA 1GJDB 1KY9A 2F9NA 2R0KA 2V3OH 3RXVA 4AYYB 9ESTA 3SV6A 1ZGVA 1ANCA 4I8KA 1A5GH 2QY0B 1ZTLA 4R0IA 3LU9B 3M7TA 3UFAA 4K3JA 2WPJS 4YM9A 1EATA 3BTME 3L6PA 3T29A 4DCDA 3M37A 1P05A 2ASUB 2XBYA 2Z9LA 2ZDMA 1RIWB 4XBDA 4ZMAH 1IAUA 2EA3A 4I7YH 2B8OH 3RC6A 1NFYA 3KN2A 1D3QB 1MD7A 2EI7A 4NA9H 2SFAA 2ZDNA 2XCNA 3V13A 2ZTZA 1RRKA 4ASHA 5AFYH 1DPOA 3E8LA 4ISIH 4YTAA 2Z6BD 4Y0ZE 2CJIA 1RD3B 3D49H 2PGBB 4U2WA 1TQ0B 4BOHA 1N6YA 4FUIA 3TH4H 1IOEA 5EGMA 1TBZH 3PMHB 3A82A 1CA0B 3ATIA 3TK9A 4BTUB 1P2QA 2Y5GA 2ZFQH 2ZP0H 3EGKH 1O3GA 1QL8A 4IGDA 2OTVA 1UCYH 4M7GA 1EQ9A 1ZPCA 3A83A 1CE5A 3EE0B 1GL0E 4NFEA 2ZWLH 1O3KA 1MKXK 4U01A 3P8FA 4FU8A 1NFWA 2O8LA 1QQ4A 2OP9A 3TJUA 6CHAC 1FONA 3FAOA 3U1IB 4OS5A 1SGFG 1NRSH 1DLKB 4DURA 5EQQA 2GTBA 1UTQA 1DWDH 1O2XA 1ARBA 4YOIA 4DW2U 1TRYA 1CGIE 1NU9A 1EAXA 5GCHG 5T6GA 1ID5H 3KEEA 3TH3H 1DWBH 2I6QA 3MNXA 4X1PU 3OY5U 4Y0YE 3BTEE 2ZFSA 2A4GA 2LPRA 1DLEA 3GYLB 1ABJH 1DXWA 3UWIA 1FLEE 3BTFE 2OQUA 3B8JA 3EA8A 1BT7A 4FUGA 1V2OT 1QQUA 4HI3A 1AFQB 2A2XH 4I33A 2ODYB 2BZAA 1PQ7A 3LGIA 4H4FA 4Q7YA 2V35A 1BTPA 4TY6A 2Q6GA 4YZUA 2GZ8A 3MOCA 4WF8A 1QBOA 1RFNA 1TPOA 1GJ6A 1MCTA 5EXLA 1S0QA 1C2LA 3SU6A 1JOUB 2UWOA 3A8CA 1BOQA 1EJMA 4H42U 3RXGA 1QTFA 4BANB 5AF9H 1HAHH 5C5NA 1NESE 3PLKA 4ZKSU 2FOEA 4NCYA 7ESTE 3FZZA 2ZFPH 4A1XA 1O3JA 1MTNC 1W7XH 4A6LA 1V2LT 1DSTA 1ETSH 1TNIA 4XDEA 2Y5HA 3LONA 1NS3A 1PQAA 1TPPA 2GT7A 5IYTA 2WPIS 2AFQB 1JWTA 1MCVA 4SGBE 1O2TA 1C1QA 1T4UH 4MPXA 4X6NA 5EW2H 1JMOH 1WOFA 3P6ZB 5FXLA 4NIYA 1PFXC 1VCWA 2QXJA 1AKSA 1LMWB 1GMCF 1VGCC 1QURH 5CMXH 2J38A 2Q6FA 4NIWA 1G9IE 1ELTA 5C1YA 4KKDA 2FO9A 5FAHA 2OCVB 3PO1B 4FUFA 1C2DA 1KIGH 1O33A 2NU0E 1FJSA 1GI9B 1W2KH 2PKSC 1SOZA 4YOGA 3UUZA 2AERH 1WYKA 3SV2H 1GBLA 3A7TA 4YO9A 5E0HA 1DVAH 3B23B 3MH7A 3KNXA 3SZNA 3PLBA 1NFXA 2ODQA 5AHGH 4XBCA 1ELFA 1THSH 1QR3E 4WVPE 3SNEA 1XVMA 2TIOA 4KTCA 1QBVH 1F5LA 2YOLA 1PPBH 1OP0A 4H6SB 3GY7A 1OWIA 1XXDA 1PPZA 4A92A 3ZZ3A 5HM9A 2HPQH 2QC2A 5FHTA 2ZFRH 2J9NA 3OSYA 6LPRA 3KQEA 1E38B 2FI5E 2BY9X 1ZLRA 1HJAC 2XW9A 3SU2A 4X8TH 1FPHH 1H8DH 1GHZA 2ZPRA 3OU0A 2FESH 1F5RA 1TPAE 2Q1JA 3LKWA 3MO9A 3AAUA 1OKXA 1MBMA 2VIPA 1S0RA 1QNJA 2NU3E 4BNRA 3ZVBA 1YM0A 1W8BH 1XUKA 4MQAA 3G01A 1ZPBA 4ZXYH 1BJUA 2JH0D 4ABJA 5DP9A 2BX3A 3HK6B 2AEIH 3MNSA 3TJVA 1ELEE 3IWMA 1THRH 2VWNA 1A1RA 1P2JA 1GI7B 2FOBA 2P93A 1TLDA 5EQRA 4BXWA 1AZ8A 3M3TA 1BTWA 2KAIB 1WCZA 1K28D 2AMDA 3NPSA 4OS7A 3RXJA 2BB4A 4X6MA 1QB6A 2AMPA 2FOGA 2VIDA 3ATMA 4H6TA 4AFSA 1ESBA 2BM2A 1UJ1A 1O34A 1WQSA 4ISLA 3BIVH 3SGAE 3S9CA 3QGJA 1FY8E 5CE1A 2A4RA 1GJ5H 2OC8A 1MKWK 2CGAA 3GICB 1G3CA 3MU4A 3D65E 1C5TA 1DSUA 3EQ0H 3RM2H 3PWCA 1C1NA 2FM2A 1V2UT 5L2YH 4LZ1H 1T31A 2THFB 1AQ7A 1E0FD 2A2QH 1QJ1B 2G8TA 2GCTB 1H8IH 3BG4B 3W94A 1SGDE 1FY3A 4FUCA 4QT8C 2P94A 3TK6A 2GMTC 5DP8A 3SJKA 4FUJA 1NTPA 2P3TB 1D9IA 3GY5A 4I8JA 1MTSA 3BN9A 3F6UH 3SV9A 1D6RA 2TBSA 1TRNA 4JYTA 4TYDA 1N6XA 1UVTH 1Z6JH 1AZZA 1YBWA 2OC0A 1V2PT 3VGCC 2AYWA 5F8XA 4WH8A 5FCKA 3TNTA 1C5LH 1P2IA 2H9HA 4B2CA 2BY7X 1FN6A 1TGNA 2AS9A 3NCLA 1KYNA 3SO3A 1C9PA 1SG8B 1SHYA 1K1MA 1XMNB 1YPJH 2HGTH 3PWBA 2RDLA 2R2WU 3BV9B 1DWCH 3LGYA 3VB7A 2BQWB 1MBQA 4AB9A 2VVUA 3LH3A 1F0UA 1BTZA 5A8YA 1DY9A 1O5DH 1A5HA 1DXPA 1A3BH 2UUYA 4X1NU 1AWHB 4A1TA 2R0LA 3GY3A 1GBTA 1T7CA 1K21H 4DIIH 2ZA5A 2SNWA 4X6OA 2JETC 3R3GB 1GHVH 1MD8A 4K8BA 1A4WH 3UR6A 1CBWC 1BMLA 1N1LA 1O2SA 3SW2B 1Z8JB 4BAMB 1IQLA 3UNQA 3SUDA 5T3HA 1YP9A 1IHTH 3M5NA 1GJCB 2QF0A 2VB0A 4Y10E 4K60A 1KDQA 1DOJA 1FQ3A 4ABAA 3A7XA 1K1NA 3ZZ9A 2Y6TA 2HNTC 2G5VA 1BBRH 1O3AA 3TJOA 1H9IE 4I31A 4K69A 3SUEA 3L3TA 3AASA 2BDHA 2FX4A 3P17H 2BVXH 3ZVFA 3Q76A 4I32A 3PYHA 3MYWA 2NU1E 3TLOA 1UK4A 5FBIA 3F9EA 2XC0A 1HAZB 3U1JB 1O2UA 2VGCC 3HATH 1E34B 3A8BA 1RTFB 2AIPA 2DE8A 2BD8A 3Q77A 2C93B 3O8DA 2ANMH 2G55A 1GCTB 1BCUH 3ZZDA 1G36A 2HVXA 5C20A 2M5TA 1D3TB 1TONA 4BAHB 4AFUA 4XOJA 4GAWA 1O2PA 2W3KA 4CHAC 3C1KA 3DT0H 3BTWE 1INCA 1C1UH 4OGYA 4FU9A 1V2JT 1OOKB 1D3PB 1MAYA 1EPTC 2BD4A 2OXSA 1U6QA 3MFJA 1HXFH 4LK4A 3UPEA 2EI8A 2O9QA 1VJAU 2FOHA 1C1SA 1NC6A 1BRUP 4Y7BA 3RXDA 1OWDA 1HV7A 1MZAA 3T62A 3TITA 1W3CA 4GLYA 2PSXA 1MQ5A 1K1PA 3RXTA 2AH4X 1OWEA 3CP7A 1CHOF 4HTCH 5LPRA 2NU2E 1TNJA 2VWMA 2CF9H 1LKAA 1GBKA 1O3EA 2QCYA 3O8CA 2ZHWH 2JKHA 1DY8A 3RLYH 3RU4E 2BXTH 2PTNA 1HAXB 3ZZCA 3ZYDA 1Z7KA 3CENA 2XWBI 4O97A 3LC5A 4X2YA 3VB4A 1DICA 1C5XB 3MU0A 3T2NA 2I6SA 1GVKB 3RXMA 4ZXXH 1TOMH 1C1RA 8ESTE 1Y3UA 1QBNA 5DG6A 2C8YB 4UFEH 3UNSA 2NU4E 1QGFA 1P3CA 3QDZB 2PFEA 2XWAA 3MNBA 3SHAH 1SLVB 3V0XA 2ZGHA 4F49A 3QX5H 1GBHA 2OD3B 1GBJA 1M9UA 3LT3A 1L1GA 3TVJB 1C1TA 1FUJA 2ZEBA 3ZVAA 3BTGE 4MNWA 4JMYA 1Z8GA 3I29A 4ZUHA 4D7GA 4VGCB 2FIRH 1O5GH 1Y5BT 1NRRH 3SBKA 2EEKA 1BQYA 2G4UA 3I77A 6GCHF 1HAPH 1MTVA 1GJ8B 3F9FA 1O2YA 1CHGA 1TPSA 1QRWA 4IN1A 1C5SA 3BEUA 3MO6A 2HALA 1ACBE 1C5WB 4YT7H 3PROA 1EXFA 3S9BA 2BOKA 2B0FA 1AB9B 1G3EA 1PYTD 4GHTA 5EW1H 2UWLA 1P9UA 1KLIH 2AGEX 1CA8B 1C1WH 1EB2A 1WSSH 5DO4H 1QRZA 1GI0A 1BJVA 1TMUH 1MQ6A 1B7XB 5PTPA 5EPNA 3GY8A 2C8ZB 3DFJA 1T8NA 5F6MA 1OP8A 2FPZA 1UHBB 1LHEH 5GDSH 5LH8A 3PV4A 4ABBA 3BG8A 1C2HA 3RXFA 2FS8A 3TU7H 1MMJN 2QN5T 3BEFB 2HNTE 2XXLA 5DPAA 1NRPH 1CU1A 2RA0A 1BMAA 2FLBH 1QB9A 3SN8A 4Z0KA 6ESTA 1C2JA 3MU1A 2IJOB 4Y79A 4IW4E 2XC4A 3MWIU 4AG2A 1ESTA 1ZHRA 3RU4D 1SPJA 2VH6A 1O3PB 3LJOA 1DT2A 1O3BA 2V3HH 2ZHQH 4MNYA 4CBOA 1AKSB 1EASA 1SLUB 1V6DA 4HZHA 2PUQH 3M35A 1ESAA 5C1UA 1EJNA 2IOTA 1GI8B 2OQ5A 1V3XA 5EODA 1GVLA 2GDDA 2ZHDA 4ABHA 1J15A 1CT0E 2BLOA 3RXOA 2J4IA 2A1DB 2BTCE 1QL7A 4LZ4B 4GCHG 1SC8U 3GOVB 3R0FA 1O2KA 3Q3KA 1WUNH 1B0EA 4NG9H 2BDAA 2GGVB 3DA9B 3E91A 3SORA 1SI5H 2BD3A 2DE9A 1ZHMA 1O5BB 3UREA 2A7JA 1NRNH 5GPIB 1EPTA 1UTJA 1HAVA 2ZU3A 2FOMB 2C4FH 1FIWA 1O2HA 3ATWA 3H7OA 5DP6A 3SUFA 3PM3A 3U69H 1V2KT 3S9AA 4NFFA 1FPCH 2WINI 5C2ZA 1A46H 1LKBA 2VVVA 4I8GA 3HPTB 3VB6A 1L4ZA 3O8RA 3T27A 4GCHF 2RCEA 3A85A 1QJ6B 4KGAA 5FCRA 4CRFA 3STIA 1A0JA 2XTTB 2ZPSA 6CHAB 1P3EA 3SNDA 4FVBA 1UCYK 3UQVA 2W26A 1VITH 3RDZA 3ZV8A 1ANBA 4AGKA 2XC5A 4YT6H 4X2WA 5CHAC 2RA3A 1AVXA 2K1QA 3P92A 1KLTA 1W0ZU 1QL9A 3LGWA 2SGQE 1HB0B 3OTJE 1Z1IA 4ABIA 1TBRH 3E0PB 4UFFH 1SFQB 5GCHF 1AVGH 4JK5A 5HMAA 2D8WA 5HGGA 1DDJA 2ZFTA 2ZPQA 2CV3A 9LPRA 1J16A 1SQAA 2ILNA 1K1OA 1AHTH 3A89A 2A32A 1VITG 1GPZA 4R8TB 3KQCA 4OS1A 3RXIA 1OS8A 3KL6A 3UR9A 1ANDA 2ZZUH 1B0FA 1YCPH 3ZVCA 4CRBA 1IQMA 1Y3YA 4ZROA 3I78A 1TNKA 2SGPE 4J2YB 4DIHH 3KIDU 1LVYA 5GXPA 1AY6H 1CGHA 3LH1A 4OS4A 5J4SA 2D2DA 1LPGB 3QN7A 1FMGA 2ZDKA 3Q3YA 4TPIZ 2TPIZ 5HXFA 4Z6AH 3P8NA 1KTTB 5ESBA 7KMEH 2F9BH 3SU0A 1SGIB 1ZSLA 1O2ZA 2ANYA 3T28A 3GISB 1SOTA 1P11E 4FU7A 3UY9A 5K0HA 4WXIA 1QCPA 5JBAS 4BTIB 3QZQA 2Y82A 1IQEA 4IMZA 1XUFA 5I46H 4WJG2 4CRAA 2ZHFH 1GI3A 1SGQE 3UNRA 1VITF 3SJ9A 2AGIX 1SGPE 3SUGA 1GHWH 1GGDC 1MTNB 1EP6A 4LOYH 1C5NH 1N8OC 2BD5A 1F2SE 2F83A 2A4QA 1KXCA 1P04A 2PHBA 3BTHE 4FUEA 3MU8A 2QYIA 3ENSB 2FOCA 1AWFH 5EXNA 2BDBA 2LNCA 1WTHD 1IQJA 1XKAC 4JCNA 1FDPA 1O39A 1O3MA 1GWAA 3ZZ5A 5A0BA 3BTTE 3RXUA 4ABEA 1ZJDA 1H4WA 1H9LB 4DGJA 5AVDA 1OYQA 2EC9H 1GHAG 1EP5A 5JB9S 2BVSH 3U8TH 2BD9A 4FVDA 2A31A 1C9TA 1P2NA 2PTCE 1CT4E 4ISOA 4Y11E 1VGCB 4AB8A 4JYUH 1S83A 1AD8H 2H6MA 1YPMH 4IS5A 1HRTH 1O2WA 1Z8IB 1P03A 1TOCB 1UVUH 3PB1E 2J2UA 3EAJA 4IBLH 1AE8H 2FDAA 1C4U2 2VIQA 5B6OA 2PKSB 1P2MA 4X0WU 1UK2A 1UTKA 5A0AE 1K1JA 4UE7H 2ZG0H 3DUXH 3STJA 1KSNA 1BTXA 1LHCH 4MPUA 1ZTKA 1GBCA 3RC5A 5C1XA 2ULLA 1UVPA 1V2QT 3PMAB 1LVOA 1O30A 1GHAF 4THNH 2ZGCA 2JH5D 1GJBB 1QJ7B 1QFKH 1AFEH 3GCHC 1HJAB 5EU8A 4DY7B 3H5CB 5DK1A 1IQGA 3HKJB 3SNCA 3RXLA 3V3MA 4MPWA 4FXGH 2YNAA 3K2UA 1HAOH 1O2RA 1IQFA 1EJAA 1L2EA 2A45B 2OLGA 2VWLA 3AW0A 4K8YA 3RXPA 3A8AA 1GDQA 1GHYH 1HCGA 2BY8X 3A80A 2OC1A 3BEIB 3E3TA 4X6PA 5JPMH 3M3VA 3UIRA 1Y8TA 2P8OC 2QF3A 1TA2A 1JIMA 4ZHAA 1S85A 2HWLB 4ZKRU 3PMBB 1BMMH 4Y8YA 2ZNKH 4CRGA 2GCHG 1TIOA 4FUBA 4MNXA 4HGCA 2BMGB 2BQ7B 1C1MA 3MHWU 2BY5X 5G4BA 5EG4A 2STBE 3A7ZA 1E37B 2B9LA 2R3YA 3H7TA 1J8AA 5F8TA 3TPIZ 1ELGA 5J4QA 3FFGA 4K2YA 1ZJKA 1G2LA 1BITA 1CVWH 5FX6A 3QGNB 1BZXE 2R3UA 2W7UA 3ZZ4A 4O9VA 4X8SH 4AFQA 2F9VA 2PKAA 4CRCA 4DVAU 4YOJA 5A0CA 1C5VA 1SL3A 1UVOA 4WMFA 1C4V2 4Q7ZA 1O38A 2F9OA 4NIXA 5FPSA 1VZQH 5L6NH 2ESTE 4AFZA 1Y5AT 5JBBS 2TGPZ 1P9SA 3SV7A 2PWXA 3LGVA 1C5YB 1HIAA 2BDGA 2AGGX 2FMJA 1HUTH 1MH0A 2GCHF 5JYIA 3QUMP 2GMTB 3DFLA 3QO6A 4O3UA 4CH8B 1GDUA 1FNIA 1JRSA 2V0BA 3FP6E 4FUDA 1BB0B 1MU6B 2BXUH 1TFXA 4OS6A 3SQHE 1O35A 1SSXA 4I8LA 1YYY1 4MPVA 3VGCB 1ZMJA 1ZR0A 1P06A 1EOLA 4DG4A 1F7ZA 2Z7FE 3BTDE 1BRBE 1Y3XA 2STAE 1NROH 1OPHB 1W12U 1WQVH 3V12A 1O2IA 1GBMA 3PMJA 1K2I1 1RJXB 1QY6A 1CO7E 3O8BA 4NSVA 1C5RA 4WMDA 2TRMA 2FZZA 4ABDA 2Z3EA 2FP7B 2UUJB 1FXYA 1DFPA 2BLQA 2QXHA 1ABIH 4YLUA 3LDXH 1OWKA 1P12E 1LHGH 1W13U 4RKOB 1G32B 1BIOA 1Y59T 4X1QU 3SU4A 1HFDA 3QTOH 3W95A 2JETB 2AIQA 1UMAH 1QHRB 4INKA 1O37A 4WXVA 1NU7B 4JZFH 1G3BA 3AAVA 1CBWB 1X7AC 3TGIE 2A5IA 5EOKA 1XUJA 4DT7B 1UO6A 2XNIA 3EYDA 3OX7U 1GVZA 2H5CA 1EUFA 5C5OA 1Q31A 4Y6DA 3ZVGA 2CHAC 1OX1A 2F3CE 4ISHH 3SGQE 3KQDA 4Y8ZA 4XFQA 3KHVA 1O2NA 4CR9A 2OINA 4A5TS 2ZU1A 4K1SA 1KXDA 1NPMA 1BRAA 3F9HA 4ZKOU 3NK8A 1HBTH 5ETXA 4B71A 1T8LA 1FZZA 3E6PH 1UVSH 2FX6A 2TGTA 1VCQA 1ZPZA 3QZRA 1FY5A 1BHXB 1EOJA 1BBRK 2VGCB 4O3TA 1TA6A 2A0QB 2JH6D 1GCDA 3FP8E 5ESTE 1EAWA 5F03A 1FIZA 3U98H 4RN6A 2WPLS 2QXIA 3OYPA 2SNVA 1O3IA 5E0GA 2FXRA 2ZQ2A 3D23A 1GMDG 4CHAB 1W7GH 1W10U 2FODA 1WAYB 3KCGH 5JB8S 1Y3WA 2Z94A 2GVFA 1SQTA 1TNGA 3ZZBA 1Y3VA 1EPTB 2FI4E 1BRCE 1GJ9B 4UONA 3K9XB 1SFIA 5I25A 2D26C 5C3NA 2WUBA 2ZI2H 3GCTG 1AU8A 3MU5A 3P95A 4KTSA 3V7TA 3LGTA 2XYAA 3ZYEA 1HJ8A 1JXPA 2WYGA 3LPRA 1HAIH 5IDKA 2ZO3H 1G2MA 4ZHMU 1LHDH 2ALPA 4AX9H 1YLDA 5DP3A 3RXQA 5GWZA 3DD2H 1KLJH 1SMFE 1NFUA 1BTUA 1PPEE 1LVMA 1ZGIA 2ZF0H 1G3DA 1GMDF 1XX9A 4DJZB 1IHSH 2C8WB 2VJ1A 2Y7XA 1GHBG 1L4DA 3NZIA 1LCYA 1L1NA 2VU8E 3RM0H 1Q2WA 3OY6U 5DP5A 3TNSA 1CQQA 4NA8A 4U32A 1P09A 2BZ6H 3UQOA 1BDAA 1W14U 2J34A 5EPYA 3ZZ6A 1XUGA 8LPRA 1WV7H 1GG6C 4X8UH 3NXPA 1DM4B 1EZSC 2HNTF 1MUEB 2WUCA 2QAAA 5AFZH 3RXHA 1XM1A 2C90B 1TB6H 2VWOA 1TGTA 1ZHPA 2BX4A 5BPEA 2F9PA 2BY6X 3WY8A 4ISNA 1AE5A 1S5SA 3SOSA 3LJJA 2F9UA 1J14A 3LC3A 1C2MA 1O3CA 4JZIA 2W3IA 3SHCH 2Z9GA 4TPYA 5T6FA 1BHXF 1O2JA 1PQ8A 2ZGBH 1GHBF 2GT8A 1SR5C 2ZDAH 4WWYA 3SJOA 1GJ7B 2PR3A 4E06H 1MU8B 2A7HA 2GDEH 4K1EA 2XBVA 1ZSKA 5FX5A 1IQNA 1E35B 3VPKA 1SLXB 4E05H 1EX3A 1O3HA 1G37A 1DANH 3EA9A 3LGUA 1MTUA 1T4VH 2QXGA 3TK5A 4TY7A 2ANKH 5ABWA 1RIWC 3GCNA 2PGQB 1OWJA 2ZCKP 3TGJE 1UTMA 4NZQA 3ELAH 4E7RG 1C2GA 1O31A 3U8OH 3A88A 5DP4A 1NY22 1EZXC 3A87A 2BHGA 1L1JA 4PROA 3RXEA 1TALA 2EI6A 2FEQH 5FBEA 1O2OA 2VIOA 2Q6DA 4MTBA 1TMBH 1LHFH 1FY1A 3ODFA 4IC6A 2ZKSA 3AVZA 1EAIA 3SJ8A 1GBIA 2RG3A 1TWXB 3SU5A 1SVPA 1GJ4H 1YPLH 1AN1E 2ZTXA 4I8HA 3NWUA 2H9EH 1MKXH 1CA0C 3RXKA 2WV4A 3EDXB 5FPTA 1ELCA 2P3UB 1SGRE 1KXEA 2GP9B 3TJNA 1ELBA 1DS2E 4RKJB 4MLFB 2ZU5A 3RXRA 1EB1H 1IQHA 2J95A 1YPHC 2ZGXH 3K65B 3A7VA 1OWHA 1UTPA 2BVRH 3AW1A 4KP0A 1S6FA 5HYOA 4O03A 2GKVE 4Y7AA 3RXAA 2CN0H 2XRCA 1LDTT 1VCPA 3NUMA 4RSPA 1C2KA 1PPFE 4JYVH 5T6DA 3ZVDA 2ZDVH 2B5TB 3UWJH 1O3LA 3VB3A 4ESTE 1PQ5A 2GD4B 2A7CA 1C2IA 1O5AB 4UEHH 1HAGE 4Q7XA 1IQKA 2W5EA 4A7IB 1OYTH 1VR1H 3BTQE 4J1YA 4MG3A 3UTUH 2GV6A 1DITH 2ZFFH 1AFQC 3RU4T 5SGAE 1SGYE 4X1RU 1HYLA 2WPKS 4B73A 1T8MA 2H2ZA 2UUKB 3ZZ8A 3HK3B 4D76A 3A84A 4NIVA 1V2RT 1F0TA 1NM6A 1H1BA 2O8MA 3MH6A 5JBTA 1ELVA 1GDNA 1O3FA 1AUJA 2HLCA 1YPGH 4AZ2B 3ZV9A 3P8GA 3QWCH 4AOQA 1SGTA 4B2AA 4NA7A 2NWNA 2HPPH 1XXFA 2Y7ZA 3RMNH 2CMYA 2Y81A 4OS2A 4X2VA 1O3DA 1LO6A 1JIRA 1Q3XA 2ZDLA 2ZIQH 5CHAB 1THPB 3N7OA 1V2VT 5LPEA 2BYAX 2F91A 1YKTA 2BD7A 5DJ7A 3URDA 1L0ZA 2VH0A 1VJ9U 1GMCG 1V2ST 4KELA 2PKAB 3S7HB 2O8UA 5H4IB 3SU1A 4D7FA 5A09A 2Z9JA 3KGPA 2FI3E 1Z1JA 2ODPA 1JRTA 1J9CH 1UHBA 1TRMA 1AMHA 1HPGA 1HIAB 5DKMA 4WY3A 1TX8A 1XUIA 3RMOH 1V2MT 4BTTB 3PTBA 3RXCA 3GCOA 1TABE 3A8DA 3PO1C 1DX5M 4UDWH 3K6ZA 1ZRKA 4XSKU 5DP7A 3VFEA 3BSQA 4DOQA 3RP2A 1SGFA 2H5DA 2IPHA 1UCYE 1YCPK 2P16A 1OSSA 1TNHA 1UTLM 4JZDH 1C1VH 4CH2B 1PJPA 2R2MB 2P95A 2VIVA 1AVWA 4KTUA 3RXSA 1TGCA 1LQEA 1NN6A 1ELDE 1HLTH 2VIWA 3RUOA 1NO9H 1ETTH 4MDSA 1SGNE 4JZEH 3IG6B 3QLPH 1LPZB 3SU3A 4GSOA 1GGDB 1TX7A 2W7SA 1N8OB 2SGAA 1K9OE 2AMQA 2WPHS 2G5NA 4CRDA 1IQIA 1KDQB 1O3NA 1YGCH
chains in the Genus database with same CATH superfamily
2YNBA 5BRRE 1DE7H 3A7YA 3TIUA 3JZ2B 2WYJA 1YPHE 2A5KA 3S69A 1O2VA 2TGDA 1GI4A 1OP2A 1YF4A 4ZHLU 5EIYA 2HOBA 2GV7A 3GDUA 3SV8A 5HM2A 2BLVA 1XKBC 5C67A 3VXFH 4AG1A 3GY4A 1C5ZB 2LP6A 4INLA 3E1XB 3URCA 3NKKA 1HJ9A 1ZMNA 3BIUH 3JZ1B 5EQSA 4B75A 1YCPM 2JIZD 4B1TA 1F92A 4INHA 1F0RA 1SBWA 3E0NB 1F0SA 2XCFA 4FOUC 2ZC9H 1D6WA 1SLWB 3DSGA 1MKWH 1EZUC 5GIBA 1P2KA 1ZOMA 2Z3CA 2WZQA 1T32A 3KF2A 1C4Y2 3SJIA 3RMLH 5JBCS 2GZ7A 1SGCA 2FLRH 1TQ7B 1T8OA 3M36A 3NRLA 2ZTYA 1PYTC 3VB5A 1GI1A 5TCCA 3A86A 1Z8RA 3IITA 4MNVA 1GL1A 1FAXA 3GCHB 3P8OA 1YC0A 1ZRBA 1P57B 2ZCHP 8KME2 3C27B 1GHXH 1Z6EA 2SGFE 4B76A 4D8NA 3H09A 3TGKE 5EXMA 1GBBA 1C5MD 1C2EA 5HIZA 2P3FH 5DGJA 1GI6A 3F2GA 1EKBB 2FOFA 1AIXH 1YPEH 1P2OA 4Q80A 1TX6A 2GCTC 3E16B 4ZCNA 3BG4C 1C1PA 1TAWA 1TGSZ 4NZLA 4Y71A 2ZECA 1C5PA 2V6NA 3RXBA 1UTNA 1B5GH 1AUTC 1O2LA 3CS7A 5TCAA 3ZVEA 1GI2A 1DUAA 1QB1A 2GZ9A 5LPFA 1P8VC 2P8OB 1P0SH 1P10A 2R9PA 4BAOB 1O2GH 5A8ZA 3M5MA 1BTHH 1KXAA 2QIQA 3ITIA 1XVOA 3S0NA 4ZH8A 1SGEE 4ZAEA 4BXSA 3HGNA 3GYMA 3SGBE 3SI3H 3FANA 5F8ZA 4IN2A 1C5OH 3RC4A 3QTVH 3UOPA 1HAYB 5LGOA 2ZU2A 2JJ1D 1GMHG 1QIXB 2PUXB 2FOAA 3M3SA 4X8VH 5E2OA 8GCHG 1GJAB 3FO8D 3VXEH 1O2QA 2FWWA 3MH4A 3Q3XA 1ETRH 1HDTH 1SB1H 3FVFB 3Q00A 4SGAE 4B74A 3D62A 2JDID 3EA7A 4Y76A 7GCHG 1TYNA 2GX4A 1O5CB 2XBXA 1MAXA 2Y5FA 2ANWA 2B7DH 4IC5A 2VNTA 2K8IA 4X1SU 3SI4H 1FY4A 4CR5A 3L33A 1A7SA 1SHHB 1ZSJA 1KTSB 2Z9IA 2ZU4A 1Y5UT 1O5FH 2OC7A 3KQBA 1P02A 3T25A 1BUIA 4AORA 2ZQ1A 5FL7D 3VG8A 1KXBA 1DUEA 1LTOA 1BA8B 1WU1A 2QA9E 3PTNA 3HGPA 3MTYA 2Z3DA 5E2PA 2O8TA 4NSYA 1OXGA 3MNCA 2C8XB 1ZTJA 3P70B 1S6HA 1J17T 4K5ZA 1GBAA 1C5UA 3UOUA 1GMHF 3F1SB 8GCHF 5FPYA 1A0HB 1LQDB 1BMNH 2G51A 4K1TA 2Z9KA 1A0LA 4YESB 1ZYOA 4OGXA 7GCHF 1YLCA 2P59A 1RTKA 2ZHEH 4ABGA 1AGJA 4D9QA 1AI8H 1V2NT 2ZCLP 3W1EA 2TGAA 1RS0A 1QRXA 1ARCA 2H1UA 1TMTH 2QV1A 1ORFA 1O36A 1WBGB 1GCTC 1PPGE 1QA0A 2SGEE 2VVCA 4YLQH 2BLWA 1JBUH 3A81A 1ELAA 4E7NA 2W6JD 4XBBA 4JZ1A 2OBQA 1HGTH 1W0YH 4F4OC 4BAKB 1F5KU 4CBNA 2FYQA 3DCLA 1O3OA 4GUXA 1E36B 3MMGA 2PV9B 5E0JA 3PV2A 5A2MH 2J94A 1O32A 1S81A 2BDCA 3F9GA 1EZQA 1EAUA 1CHOG 5TJXA 2CHAB 4JK6A 1ZZZA 2PW8H 3FZDA 2ZGJA 2QGRA 3SNAA 1A5IA 3MO3A 3T5FH 3U8RH 1G30B 2CXVA 4U30A 1K1LA 1C2FA 3ZZAA 2BDIA 2QE7D 2KAIA 1PPCE 4YXWD 3LOXA 2YMSB 3M61U 4XE4A 1D4PB 2DUCA 1NT1A 1LVBA 2G4TA 4B2BA 3M7UA 1CGJE 2PSYA 2G81E 4UD9H 1TBQH 2VINA 3SNBA 4AGJA 2HVYB 1KXFA 7LPRA 3PLPA 3M7QA 2O8WA 3A7WA 4Y8XA 1W11U 3GY2A 1FI8A 1UTOA 3B9FH 1NBMD 2WV5A 1A61H 1FAKH 3ZZ7A 1S82A 1HAVB 1MTWA 4A1VA 1D3DB 3SQEE 1HXEH 4Q2KA 3RLWH 1Z71A 2Y80A 3M5OA 3GDSA 3TH2H 5KECA 1RTLA 1P01A 1A2CH 2D1JA 1CT2E 2BD2A 1O0DH 1DWEH 3F68H 4GHQA 3BTKE 3FP7E 4MVNA 1UK3A 4CREA 2OBOA 3LIWA 3CS0A 3N99A 1GBFA 4X2XA 2BQ6B 1S84A 1ANEA 2G00A 4TWYA 4GPGA 3RMMH 3FOAA 4IMQA 2H9TH 6GCHG 1TNLA 2WPMS 5L30H 4AN7A 1GI5A 2XBWA 4D9RA 4WMEA 3ESTA 2IJD1 1O2MA 3E90B 1SQOA 1QA7A 4AYVB 3GDVA 1V2WT 1YPKH 3QK1A 2FYRA 4VGCC 1NZQH 1K22H 2WSSD 5A8XA 2J92A 1RGQA 3K6YA 1XUHA 4LXBH 3VEQB 3HKIB 4WH6A 1V2TT 2IN2A 3GCTF 2CF8H 2FTLE 1HNEE 2BOHB 2G52A 2BDYA 3T26A 1SQRA 1BBRE 2A4OA 1FV9A 2FTMA 1TE0A 1LPKB 4TWWA 4HFPB 2UWPA 1AB9C 3GY6A 1O5EH 2ALVA 5B6LA 1PPHE 1CSOE 1WTGH 2HRVA 1NRQH 3ATKA 4UFGH 4NWLA 1AO5A 1RXPA 1GBEA 1GBDA 3S7KB 3ODDA 4ZKNU 5GJ4B 2C3SA 3MH5A 2A5AA 2OUAA 1MZDA 2PLXA 5K7RA 1C1OA 1H9HE 3M5LA 1GG6B 4FUHA 1K1IA 3DHKH 5JDUB 3ATLA 4BAQB 2SGDE 4NWKA 1ZMLA 3MI4A 1C5QA 2UUFB 1A3EH 5E8EH 3BF6H 2FS9A 1TGBA 1FN8A 2JJ2D 4GVUA 4ABFA 3U9AH 4UFDH 5L2ZH 4TT3D 4NGAH 1BTYA 1GJDB 1KY9A 2F9NA 2R0KA 2V3OH 3RXVA 4AYYB 9ESTA 3SV6A 1ZGVA 1ANCA 4I8KA 1A5GH 2QY0B 1ZTLA 4R0IA 3LU9B 3M7TA 3UFAA 4K3JA 2WPJS 4YM9A 1EATA 3BTME 3L6PA 3T29A 4DCDA 3M37A 1P05A 2ASUB 2XBYA 2Z9LA 2ZDMA 1RIWB 4XBDA 4ZMAH 1IAUA 2EA3A 4I7YH 2B8OH 3RC6A 1NFYA 2KFWA 3KN2A 1D3QB 1MD7A 2EI7A 4NA9H 3KQ5A 2SFAA 2ZDNA 2XCNA 5HIYA 3V13A 2ZTZA 1RRKA 4ASHA 5AFYH 1DPOA 3E8LA 4ISIH 4YTAA 3N7EA 2Z6BD 4Y0ZE 2CJIA 1RD3B 3D49H 2PGBB 4U2WA 1TQ0B 4BOHA 1N6YA 4FUIA 3TH4H 1IOEA 5EGMA 1E1QD 1TBZH 3PMHB 3A82A 1CA0B 3ATIA 3TK9A 4BTUB 1P2QA 2Y5GA 2ZFQH 2ZP0H 3EGKH 1O3GA 4FETA 1QL8A 4IGDA 2OTVA 1UCYH 4M7GA 1EQ9A 1ZPCA 3A83A 1CE5A 3EE0B 1GL0E 4NFEA 2ZWLH 1O3KA 1MKXK 4U01A 3P8FA 4FU8A 1NFWA 3PRBA 4ASUD 2O8LA 1QQ4A 2OP9A 3TJUA 6CHAC 3AK5A 1FONA 3FAOA 3U1IB 4OS5A 1SGFG 1NRSH 1DLKB 4DURA 5EQQA 2GTBA 1UTQA 1DWDH 1O2XA 1ARBA 4YOIA 4DW2U 1TRYA 1CGIE 1NU9A 1EAXA 5GCHG 5T6GA 1ID5H 3KEEA 3TH3H 1DWBH 2I6QA 3MNXA 4X1PU 3OY5U 4Y0YE 3BTEE 2ZFSA 2A4GA 2LPRA 1DLEA 3GYLB 1ABJH 1DXWA 3UWIA 1FLEE 3BTFE 2OQUA 3B8JA 3EA8A 1BT7A 3KYGA 4FUGA 1V2OT 1QQUA 4HI3A 1AFQB 2A2XH 4I33A 2ODYB 2BZAA 1PQ7A 3LGIA 4H4FA 4Q7YA 2V35A 1BTPA 4TY6A 2Q6GA 4YZUA 2GZ8A 2YMSD 3MOCA 1E1RD 4WF8A 1QBOA 1RFNA 1TPOA 1GJ6A 1MCTA 5EXLA 1S0QA 1C2LA 3SU6A 1JOUB 2UWOA 1SKYE 3A8CA 1BOQA 1EJMA 4H42U 3RXGA 1QTFA 4BANB 5AF9H 1HAHH 5C5NA 1NESE 3PLKA 1YWUA 4ZKSU 2FOEA 4NCYA 1K0HA 7ESTE 3FZZA 2ZFPH 4A1XA 1O3JA 1MTNC 1W7XH 4A6LA 1V2LT 1DSTA 1ETSH 1TNIA 4XDEA 2Y5HA 3LONA 1NS3A 1PQAA 4P02A 1TPPA 2GT7A 5IYTA 2WPIS 2AFQB 1JWTA 1MCVA 4SGBE 1O2TA 1C1QA 1T4UH 4MPXA 4X6NA 5EJLA 4P00A 5EW2H 1JMOH 1WOFA 3P6ZB 5FXLA 4NIYA 1KMHB 1PFXC 1VCWA 3UAIC 2QXJA 1AKSA 1LMWB 1GMCF 1VGCC 1QURH 5CMXH 2J38A 2Q6FA 4NIWA 1G9IE 1ELTA 5C1YA 4KKDA 2FO9A 5FAHA 2OCVB 3PO1B 4FUFA 1C2DA 1KIGH 1O33A 2NU0E 2V7QD 1FJSA 1GI9B 1W2KH 2PKSC 1SOZA 4YOGA 3UUZA 2AERH 1WYKA 3SV2H 1GBLA 3A7TA 4YO9A 5E0HA 1DVAH 3B23B 3MH7A 3KNXA 3SZNA 3PLBA 1NFXA 2ODQA 5AHGH 4XBCA 1ELFA 2GJGA 1THSH 1QR3E 4WVPE 3SNEA 2J98A 1XVMA 2TIOA 4KTCA 1QBVH 1F5LA 2YOLA 1PPBH 1OP0A 4H6SB 3GY7A 1OWIA 1XXDA 1PPZA 4A92A 3ZZ3A 5HM9A 2HPQH 2QC2A 5FHTA 2ZFRH 2J9NA 3OSYA 6LPRA 3KQEA 2QF5A 1E38B 2FI5E 2BY9X 1ZLRA 1HJAC 2XW9A 3SU2A 4X8TH 1FPHH 1H8DH 1GHZA 2ZPRA 3OU0A 2FESH 1F5RA 1TPAE 2Q1JA 3LKWA 3MO9A 3AAUA 1OKXA 1MBMA 2VIPA 1S0RA 3F0OA 1QNJA 2NU3E 4BNRA 3ZVBA 1YM0A 1W8BH 1XUKA 4MQAA 3G01A 1ZPBA 1BMFD 1BJUA 2JH0D 4ZXYH 4ABJA 5DP9A 2BX3A 3HK6B 2AEIH 5C94A 2LELA 3MNSA 3TJVA 1ELEE 3IWMA 1THRH 2VWNA 1A1RA 1P2JA 1GI7B 2FOBA 2P93A 4XD7D 1TLDA 5EQRA 4BXWA 1AZ8A 3M3TA 3UB0A 1BTWA 2KAIB 1WCZA 4B6EA 1K28D 2AMDA 3NPSA 4OS7A 3RXJA 2BB4A 4X6MA 1QB6A 2AMPA 3OE7D 2FOGA 2VIDA 3ATMA 4H6TA 4AFSA 1ESBA 2BM2A 1E79D 1UJ1A 1O34A 1WQSA 4ISLA 3BIVH 3SGAE 3S9CA 3QGJA 1FY8E 5CE1A 2A4RA 1GJ5H 2OC8A 1MKWK 2CGAA 3GICB 1G3CA 3F2HA 3MU4A 3D65E 1C5TA 1DSUA 3EQ0H 3RM2H 3PWCA 3WWFA 1C1NA 2FM2A 1V2UT 2F43B 5L2YH 4LZ1H 1T31A 2THFB 1AQ7A 1E0FD 2A2QH 1QJ1B 2G8TA 2GCTB 1H8IH 2XNDD 3BG4B 3W94A 1SGDE 1FY3A 4FUCA 4QT8C 2P94A 3TK6A 2GMTC 5DP8A 3SJKA 4FUJA 1NTPA 2P3TB 1D9IA 3GY5A 4I8JA 1MTSA 3BN9A 3F6UH 3SV9A 1D6RA 2TBSA 1TRNA 4JYTA 1COWD 4TYDA 1N6XA 1UVTH 1Z6JH 1AZZA 1YBWA 2OC0A 1V2PT 3VGCC 2AYWA 5F8XA 4WH8A 5FCKA 3TNTA 1C5LH 1P2IA 2H9HA 4B2CA 2BY7X 1FN6A 1TGNA 2AS9A 3NCLA 1KYNA 3ZIAD 3SO3A 1C9PA 1SG8B 1SHYA 1K1MA 1XMNB 1YPJH 2HGTH 3PWBA 2RDLA 2R2WU 3BV9B 1DWCH 3LGYA 3VB7A 2BQWB 1MBQA 4AB9A 1H8ED 2VVUA 3LH3A 1F0UA 1BTZA 5A8YA 1DY9A 1O5DH 1A5HA 1DXPA 4ACBA 1A3BH 2UUYA 4X1NU 1AWHB 4A1TA 3F3BA 2R0LA 3GY3A 1GBTA 1T7CA 1K21H 4DIIH 2WHXA 2ZA5A 2SNWA 4X6OA 2JETC 3R3GB 1GHVH 1MD8A 4K8BA 1A4WH 3UR6A 5CDFE 1CBWC 1BMLA 1N1LA 1O2SA 3SW2B 1Z8JB 4BAMB 1IQLA 3UNQA 3SUDA 5T3HA 1YP9A 1IHTH 3M5NA 1GJCB 2QF0A 2VB0A 4Y10E 4K60A 1KDQA 1DOJA 1FQ3A 4ABAA 3A7XA 1K1NA 5KEDA 3ZZ9A 2Y6TA 2HNTC 2G5VA 1BBRH 1O3AA 3TJOA 1H9IE 4I31A 4K69A 3SUEA 3L3TA 3AASA 2BDHA 2FX4A 3P17H 2BVXH 3GS9A 3FN8A 3ZVFA 3Q76A 4I32A 3PYHA 3MYWA 2NU1E 3TLOA 1UK4A 5FBIA 3F9EA 2XC0A 1HAZB 3U1JB 1O2UA 2VGCC 3HATH 1E34B 3A8BA 1RTFB 2AIPA 2DE8A 2BD8A 3Q77A 2C93B 3O8DA 2ANMH 2G55A 1GCTB 1BCUH 3ZZDA 1G36A 2HVXA 5C20A 4F55A 2M5TA 5T1VA 1D3TB 1TONA 4BAHB 4AFUA 4XOJA 4GAWA 1O2PA 2W3KA 4CHAC 3C1KA 3DT0H 3BTWE 1INCA 1C1UH 4OGYA 4FU9A 1V2JT 1OOKB 4F48B 1D3PB 1MAYA 1EPTC 2BD4A 2XOKD 3F0PA 2OXSA 1U6QA 3MFJA 1HXFH 4LK4A 3UPEA 2EI8A 3F2FA 2O9QA 1VJAU 2FOHA 1C1SA 1NC6A 1BRUP 2J5UA 4Y7BA 3RXDA 1OWDA 1HV7A 1MZAA 3T62A 3TITA 5EJ1A 1W3CA 4GLYA 2PSXA 1MQ5A 1K1PA 3RXTA 2AH4X 1OWEA 3CP7A 1CHOF 4HTCH 5LPRA 2NU2E 1TNJA 2VWMA 2CF9H 5KGOA 1LKAA 1GBKA 1O3EA 2QCYA 2RFKC 3O8CA 1FX0B 2ZHWH 2JKHA 1DY8A 3RLYH 3RU4E 2BXTH 2PTNA 1HAXB 2PP6A 3ZZCA 3ZYDA 1Z7KA 3CENA 2XWBI 4O97A 3LC5A 4X2YA 3VB4A 1DICA 1C5XB 3MU0A 3T2NA 2I6SA 1GVKB 3RXMA 4ZXXH 1TOMH 1C1RA 8ESTE 1Y3UA 1QBNA 2F4LA 5DG6A 2C8YB 4UFEH 3UNSA 4RT1A 2NU4E 1QGFA 1P3CA 3QDZB 2PFEA 2XWAA 3MNBA 3SHAH 1SLVB 3V0XA 2ZGHA 4F49A 3QX5H 1GBHA 2OD3B 1GBJA 1M9UA 3LT3A 1L1GA 3TVJB 1C1TA 1FUJA 2ZEBA 3ZVAA 3BTGE 2QF4A 4MNWA 4JMYA 1Z8GA 3I29A 4ZUHA 4D7GA 4VGCB 2FIRH 1O5GH 1Y5BT 1NRRH 3SBKA 2EEKA 1BQYA 2G4UA 3I77A 5EJZA 6GCHF 1MTVA 1HAPH 1GJ8B 3F9FA 1O2YA 1CHGA 1TPSA 1QRWA 4IN1A 1C5SA 3BEUA 3MO6A 2HALA 1ACBE 1C5WB 4YT7H 3PROA 1EXFA 5C17A 2WV9A 3S9BA 1WXRA 2BOKA 2B0FA 1AB9B 1G3EA 1PYTD 3KYFA 4GHTA 5EW1H 2UWLA 1P9UA 1KLIH 2AGEX 1CA8B 1C1WH 1EB2A 1WSSH 5DO4H 1QRZA 1GI0A 1BJVA 1TMUH 1MQ6A 1B7XB 2EQNA 5PTPA 5EPNA 3GY8A 2C8ZB 3DFJA 1T8NA 5F6MA 1OP8A 2FPZA 1UHBB 1LHEH 5GDSH 5LH8A 3PV4A 4ABBA 3BG8A 1C2HA 3RXFA 2FS8A 3TU7H 1MMJN 2QN5T 3BEFB 2HNTE 2XXLA 5DPAA 1NRPH 1CU1A 2RA0A 1BMAA 2FLBH 1QB9A 3SN8A 4Z0KA 6ESTA 1C2JA 3EE7A 3MU1A 2IJOB 4AC9A 4Y79A 4IW4E 2XC4A 3MWIU 4AG2A 1ESTA 1ZHRA 3RU4D 1SPJA 2VH6A 1O3PB 3LJOA 1DT2A 1O3BA 2V3HH 2ZHQH 4MNYA 4CBOA 1AKSB 1EASA 1SLUB 1V6DA 4HZHA 2PUQH 3MQKC 3M35A 1ESAA 5C1UA 1EJNA 2IOTA 1GI8B 2OQ5A 1V3XA 5EODA 1GVLA 2GDDA 2ZHDA 4ABHA 1J15A 1CT0E 2BLOA 2RDEA 3RXOA 2J4IA 2A1DB 2BTCE 1QL7A 4LZ4B 4GCHG 1SC8U 3GOVB 3R0FA 1O2KA 3Q3KA 1WUNH 1B0EA 4NG9H 2BDAA 2GGVB 3DA9B 3E91A 2J98B 3SORA 1SI5H 2BD3A 2DE9A 1ZHMA 1O5BB 3UREA 2A7JA 1NRNH 5GPIB 1EPTA 1UTJA 1HAVA 2ZU3A 4ACAA 2FOMB 3WW7A 3PRDA 2C4FH 1FIWA 1O2HA 2KM0A 3ATWA 3H7OA 5DP6A 3SUFA 3PM3A 3U69H 1V2KT 3S9AA 4NFFA 1FPCH 2WINI 5C2ZA 1A46H 1LKBA 2VVVA 4I8GA 3HPTB 3VB6A 1L4ZA 3O8RA 3T27A 4GCHF 2RCEA 3A85A 1QJ6B 4KGAA 5FCRA 4CRFA 3STIA 1A0JA 2XTTB 2ZPSA 6CHAB 1P3EA 3SNDA 2EY4C 4FVBA 1UCYK 3UQVA 2W26A 1VITH 3RDZA 5HKKD 3ZV8A 1ANBA 4AGKA 2XC5A 4YT6H 4X2WA 5CHAC 2RA3A 1AVXA 2K1QA 3P92A 1KLTA 1W0ZU 1QL9A 3LGWA 2SGQE 1HB0B 3OTJE 1Z1IA 4ABIA 1TBRH 3E0PB 4UFFH 1SFQB 5GCHF 1AVGH 4JK5A 5HMAA 2D8WA 5HGGA 1DDJA 2ZFTA 2ZPQA 1W0KD 2CV3A 9LPRA 1J16A 1SQAA 2ILNA 1K1OA 1AHTH 3A89A 2A32A 1VITG 1GPZA 4R8TB 3KQCA 4OS1A 3RXIA 1OS8A 3KL6A 3UR9A 1ANDA 2ZZUH 1B0FA 1YCPH 3ZVCA 4CRBA 1IQMA 1Y3YA 4ZROA 3I78A 1TNKA 2SGPE 4J2YB 4DIHH 3KIDU 1LVYA 5GXPA 1AY6H 1CGHA 3LH1A 4OS4A 5J4SA 2D2DA 1LPGB 3QN7A 1FMGA 2ZDKA 3Q3YA 4TPIZ 2TPIZ 5HXFA 4Z6AH 3P8NA 1KTTB 5ESBA 7KMEH 2F9BH 3SU0A 1SGIB 1ZSLA 3CNRA 1O2ZA 2ANYA 3T28A 3GISB 1SOTA 1P11E 4FU7A 3UY9A 4DT4A 5K0HA 4WXIA 1QCPA 5JBAS 4BTIB 3QZQA 2Y82A 1IQEA 4IMZA 1XUFA 5I46H 4WJG2 4CRAA 2ZHFH 1GI3A 1YLNA 1SGQE 3UNRA 1VITF 3SJ9A 2AGIX 1SGPE 3SUGA 1GHWH 1GGDC 1MTNB 1EP6A 4LOYH 1C5NH 1N8OC 2BD5A 1F2SE 2F83A 2A4QA 1KXCA 1P04A 2PHBA 3BTHE 4FUEA 3MU8A 2QYIA 3ENSB 2FOCA 1AWFH 2V3MA 5EXNA 2BDBA 2LNCA 1WTHD 1IQJA 1XKAC 4JCNA 1FDPA 1O39A 1O3MA 1GWAA 3ZZ5A 5A0BA 3BTTE 3RXUA 4ABEA 1ZJDA 1H4WA 1H9LB 4DGJA 5C0TA 5AVDA 1OYQA 2VBCA 2EC9H 1GHAG 1EP5A 5JB9S 2BVSH 3U8TH 2BD9A 4FVDA 2A31A 1C9TA 1P2NA 2PTCE 1CT4E 4ISOA 4Y11E 1VGCB 1H8HD 4AB8A 3N7DA 4JYUH 1S83A 1AD8H 2H6MA 1YPMH 4IS5A 1HRTH 1O2WA 1Z8IB 1P03A 1TOCB 1UVUH 3PB1E 2J2UA 3EAJA 4IBLH 1AE8H 2FDAA 1C4U2 2VIQA 5B6OA 2PKSB 1P2MA 3OTPA 4X0WU 2KX4A 1UK2A 1UTKA 2WPDD 5A0AE 1K1JA 4UE7H 2ZG0H 3DUXH 3STJA 1KSNA 1BTXA 1LHCH 4MPUA 1ZTKA 1GBCA 3RC5A 5C1XA 2ULLA 1UVPA 1V2QT 3PMAB 1LVOA 1O30A 1GHAF 3DSPA 4THNH 2ZGCA 4I86A 2JH5D 1GJBB 1QJ7B 1QFKH 1AFEH 2CK3D 3GCHC 1HJAB 5EU8A 4DY7B 3H5CB 5DK1A 1IQGA 3HKJB 3SNCA 3RXLA 3V3MA 4MPWA 4FXGH 2YNAA 3K2UA 1HAOH 1O2RA 1IQFA 1EJAA 1L2EA 2A45B 4M9FA 2OLGA 2VWLA 3AW0A 4K8YA 3RXPA 3A8AA 1GDQA 1GHYH 1HCGA 2BY8X 3A80A 2OC1A 3BEIB 3E3TA 4X6PA 5JPMH 3OAAD 3M3VA 3UIRA 1Y8TA 2P8OC 2QF3A 1TA2A 3SYJA 1JIMA 4ZHAA 1S85A 2HWLB 4ZKRU 3PMBB 1BMMH 4Y8YA 2ZNKH 4CRGA 2GCHG 1TIOA 4FUBA 2M2AA 4MNXA 4HGCA 2BMGB 2BQ7B 1C1MA 3MHWU 2BY5X 5G4BA 5EG4A 2STBE 3A7ZA 1E37B 2B9LA 2R3YA 3H7TA 1J8AA 5F8TA 3TPIZ 1ELGA 5J4QA 3FFGA 4K2YA 1ZJKA 1G2LA 1BITA 1CVWH 5FX6A 3QGNB 1BZXE 2R3UA 2W7UA 3ZZ4A 4O9VA 4X8SH 4AFQA 2K0QA 2F9VA 2PKAA 4CRCA 4DVAU 4YOJA 5A0CA 1C5VA 1SL3A 1UVOA 4WMFA 1C4V2 4Q7ZA 1O38A 2F9OA 4NIXA 5FPSA 1MABB 1VZQH 5L6NH 2ESTE 4AFZA 1Y5AT 5JBBS 2TGPZ 1P9SA 3SV7A 2PWXA 3LGVA 1C5YB 1HIAA 2BDGA 2AGGX 2FMJA 3PV5A 1HUTH 1MH0A 2GCHF 2HLDD 5JYIA 3QUMP 2GMTB 3DFLA 3QO6A 4O3UA 4CH8B 1GDUA 1FNIA 1JRSA 2V0BA 3FP6E 4FUDA 1BB0B 1MU6B 1VKYA 2BXUH 1TFXA 2L6OA 4OS6A 3SQHE 1O35A 1SSXA 4I8LA 1YYY1 4MPVA 3VGCB 1ZMJA 1ZR0A 1P06A 1EOLA 4DG4A 1F7ZA 2Z7FE 3BTDE 1BRBE 1Y3XA 2STAE 1NBME 1NROH 1OPHB 1W12U 1WQVH 3V12A 1O2IA 1GBMA 3PMJA 1K2I1 1RJXB 1QY6A 1CO7E 3O8BA 4NSVA 1C5RA 4WMDA 2TRMA 2FZZA 4ABDA 2Z3EA 2FP7B 2UUJB 1FXYA 1DFPA 2BLQA 5C0UA 2QXHA 1ABIH 4YLUA 3LDXH 1OWKA 1P12E 1LHGH 2L74A 2J97A 3WWBA 1W13U 4RKOB 1G32B 1BIOA 1Y59T 4X1QU 3SU4A 1HFDA 3QTOH 3W95A 2JETB 2AIQA 1UMAH 1QHRB 4INKA 1O37A 4WXVA 1NU7B 4JZFH 1G3BA 3AAVA 1CBWB 3DSOA 1X7AC 3TGIE 2A5IA 5EOKA 1XUJA 4DT7B 1UO6A 2XNIA 3EYDA 3OX7U 1GVZA 2H5CA 1EUFA 5C5OA 1Q31A 4Y6DA 3ZVGA 2CHAC 1OX1A 2F3CE 4ISHH 3SGQE 3KQDA 4Y8ZA 4XFQA 3KHVA 1O2NA 4CR9A 2OINA 4A5TS 2ZU1A 4K1SA 1KXDA 2YMSC 1NPMA 1BRAA 3F9HA 4ZKOU 3NK8A 1HBTH 5ETXA 4B71A 1T8LA 1FZZA 3E6PH 1UVSH 2FX6A 2W6ID 2TGTA 1VCQA 1ZPZA 3QZRA 1FY5A 1BHXB 1EOJA 1BBRK 2VGCB 4O3TA 1TA6A 2A0QB 2JH6D 1GCDA 3FP8E 4OM9A 5ESTE 1EAWA 5DSFA 5F03A 1FIZA 3U98H 4RN6A 2WPLS 2QXIA 3OYPA 2SNVA 1O3IA 5E0GA 2FXRA 2ZQ2A 3D23A 1GMDG 4CHAB 1W7GH 1W10U 2FODA 1WAYB 3KCGH 5JB8S 1Y3WA 2Z94A 2GVFA 1SQTA 1TNGA 3ZZBA 1Y3VA 2KCOA 4HG6A 1EPTB 2FI4E 1BRCE 1GJ9B 4UONA 3K9XB 1SFIA 5I25A 2D26C 5C3NA 2WUBA 2ZI2H 3GCTG 1AU8A 3MU5A 3P95A 4KTSA 3V7TA 3LGTA 2XYAA 3ZYEA 1HJ8A 1JXPA 2WYGA 3LPRA 1HAIH 5IDKA 2ZO3H 1G2MA 4ZHMU 1LHDH 2ALPA 2KR7A 4AX9H 1YLDA 5DP3A 3RXQA 5GWZA 3DD2H 1KLJH 1SMFE 1NFUA 1BTUA 1PPEE 2OK5A 1LVMA 1ZGIA 2ZF0H 1G3DA 3OFND 1GMDF 1XX9A 4DJZB 1IHSH 2C8WB 2VJ1A 2Y7XA 1GHBG 1L4DA 3NZIA 1LCYA 1L1NA 2VU8E 3RM0H 1YY3A 1Q2WA 3OY6U 5DP5A 3TNSA 1CQQA 4NA8A 4U32A 1P09A 2BZ6H 3UQOA 1BDAA 1W14U 2J34A 5EPYA 3ZZ6A 1XUGA 8LPRA 1WV7H 4B6FA 1GG6C 4X8UH 3NXPA 5GNDA 1DM4B 1EZSC 2HNTF 1MUEB 2WUCA 2QAAA 5AFZH 3RXHA 1XM1A 2C90B 1TB6H 2VWOA 1TGTA 1ZHPA 2BX4A 5BPEA 2F9PA 2BY6X 3WY8A 4ISNA 1AE5A 1S5SA 3SOSA 3LJJA 2F9UA 1J14A 3LC3A 1C2MA 2KCAA 1O3CA 4JZIA 2W3IA 3SHCH 2Z9GA 4TPYA 5T6FA 1BHXF 1O2JA 1PQ8A 2ZGBH 1GHBF 2GT8A 4Z1MD 1WDIA 1SR5C 2ZDAH 4TSFD 4WWYA 3SJOA 1GJ7B 2PR3A 4E06H 1MU8B 2A7HA 2KCPA 2GDEH 4K1EA 2XBVA 1ZSKA 5FX5A 1IQNA 1E35B 3VPKA 1SLXB 4E05H 1EX3A 1O3HA 1G37A 1DANH 3EA9A 3LGUA 1MTUA 1T4VH 2QXGA 3TK5A 4TY7A 2ANKH 5ABWA 1RIWC 3GCNA 4XRNA 2PGQB 1OWJA 2ZCKP 3TGJE 1UTMA 4NZQA 3ELAH 4E7RG 1C2GA 5F53A 1O31A 4RT0A 3U8OH 3A88A 5DP4A 1NY22 1EZXC 3A87A 2BHGA 1L1JA 4PROA 3RXEA 1TALA 2EI6A 5DN6D 2IPQX 2FEQH 5FBEA 1O2OA 2VIOA 2Q6DA 4MTBA 1TMBH 1LHFH 1FY1A 3SZEA 3ODFA 4IC6A 2ZKSA 3AVZA 1EAIA 3SJ8A 1GBIA 2RG3A 1TWXB 2KZ4A 3SU5A 1SVPA 1GJ4H 1YPLH 1AN1E 2ZTXA 4I8HA 3NWUA 2H9EH 1MKXH 1CA0C 3RXKA 2WV4A 3EDXB 5FPTA 1ELCA 2P3UB 1SGRE 1KXEA 2AHME 2GP9B 3TJNA 1ELBA 1DS2E 4RKJB 4MLFB 2ZU5A 3RXRA 1EB1H 2KCYA 1IQHA 2J95A 1YPHC 2ZGXH 3K65B 3A7VA 1OWHA 1UTPA 2BVRH 3AW1A 4KP0A 1S6FA 5HYOA 4O03A 2GKVE 4Y7AA 3RXAA 2CN0H 2XRCA 1LDTT 1VCPA 3NUMA 4RSPA 1C2KA 1PPFE 4JYVH 5T6DA 3ZVDA 2ZDVH 2B5TB 3UWJH 1O3LA 3VB3A 4ESTE 1PQ5A 2GD4B 2A7CA 1C2IA 1O5AB 1W0JD 4UEHH 1HAGE 4Q4LA 4Q7XA 1IQKA 2W5EA 4A7IB 1OYTH 1VR1H 3BTQE 4J1YA 4MG3A 3UTUH 2GV6A 5IK2D 1DITH 4Q63A 2ZFFH 1AFQC 3RU4T 5SGAE 1SGYE 4X1RU 1HYLA 2WPKS 4B73A 1T8MA 2H2ZA 2UUKB 3ZZ8A 3HK3B 4D76A 3A84A 4NIVA 1V2RT 1F0TA 1NM6A 1H1BA 2O8MA 3MH6A 5JBTA 1ELVA 1GDNA 1O3FA 1AUJA 2HLCA 1YPGH 1S6LA 1UW7A 4AZ2B 3ZV9A 3P8GA 3QWCH 4AOQA 1SGTA 4B2AA 4NA7A 2NWNA 2HPPH 1XXFA 2Y7ZA 4RI0A 3RMNH 2CMYA 2Y81A 4OS2A 4X2VA 1O3DA 1LO6A 1JIRA 1Q3XA 2ZDLA 2ZIQH 5CHAB 1THPB 3N7OA 1EFRD 1V2VT 5LPEA 2BYAX 3FKSD 3OEED 2F91A 3OEHD 1YKTA 2BD7A 5DJ7A 3URDA 1L0ZA 2VH0A 1VJ9U 1GMCG 1V2ST 4KELA 2PKAB 3S7HB 2O8UA 5H4IB 3SU1A 4D7FA 5A09A 1QZ8A 2Z9JA 3KGPA 2FI3E 1Z1JA 2ODPA 1JRTA 1J9CH 3U28C 1UHBA 1TRMA 1AMHA 1HPGA 1HIAB 5DKMA 4WY3A 1TX8A 1XUIA 3RMOH 1V2MT 4BTTB 3PTBA 3RXCA 3GCOA 1TABE 3A8DA 3PO1C 5CHBA 1DX5M 4UDWH 3K6ZA 1ZRKA 4XSKU 5DP7A 1OHHD 3BSQA 3VFEA 4DOQA 3RP2A 1SGFA 2H5DA 2IPHA 1UCYE 1YCPK 2P16A 1OSSA 1TNHA 1UTLM 4JZDH 1C1VH 4CH2B 1PJPA 2R2MB 2P95A 2VIVA 1AVWA 4KTUA 3RXSA 1TGCA 1LQEA 1NN6A 1ELDE 1HLTH 2VIWA 3RUOA 1NO9H 1ETTH 4MDSA 1SGNE 4JZEH 3IG6B 3QLPH 1LPZB 3SU3A 4GSOA 1GGDB 1TX7A 2W7SA 1N8OB 2SGAA 1K9OE 2AMQA 2WPHS 2G5NA 4CRDA 1IQIA 1KDQB 1O3NA 1YGCH
chains in the Genus database with same CATH topology
2YNBA 5BRRE 1DE7H 3A7YA 3TIUA 3JZ2B 2WYJA 1YPHE 2A5KA 3S69A 1O2VA 2TGDA 1GI4A 1OP2A 1YF4A 4ZHLU 2HOBA 2GV7A 3GDUA 3SV8A 5HM2A 2BLVA 1XKBC 5C67A 3VXFH 4AG1A 3GY4A 1C5ZB 4INLA 3E1XB 3URCA 3NKKA 1HJ9A 1ZMNA 3BIUH 3JZ1B 5EQSA 4B75A 1YCPM 4B1TA 1F92A 4INHA 1F0RA 1SBWA 3E0NB 1F0SA 2XCFA 2ZC9H 1D6WA 1SLWB 5GIBA 1MKWH 1EZUC 1P2KA 1ZOMA 2Z3CA 3KF2A 1T32A 1C4Y2 3SJIA 3RMLH 5JBCS 2GZ7A 1SGCA 2FLRH 1TQ7B 1T8OA 3M36A 2ZTYA 1PYTC 3VB5A 1GI1A 5TCCA 3A86A 1Z8RA 3IITA 4MNVA 1GL1A 1FAXA 3GCHB 3P8OA 1YC0A 1ZRBA 1P57B 2ZCHP 8KME2 3C27B 1GHXH 1Z6EA 2SGFE 4B76A 4D8NA 3TGKE 5EXMA 1GBBA 1C5MD 1C2EA 2P3FH 5DGJA 1GI6A 1EKBB 2FOFA 1AIXH 1YPEH 1P2OA 4Q80A 1TX6A 2GCTC 3E16B 3BG4C 1C1PA 1TAWA 1TGSZ 4NZLA 4Y71A 2ZECA 1C5PA 2V6NA 3RXBA 1UTNA 1B5GH 1AUTC 1O2LA 3CS7A 5TCAA 3ZVEA 1GI2A 1DUAA 1QB1A 2GZ9A 5LPFA 1P8VC 2P8OB 1P0SH 1P10A 2R9PA 4BAOB 1O2GH 5A8ZA 3M5MA 1BTHH 1KXAA 2QIQA 3ITIA 1XVOA 3S0NA 4ZH8A 1SGEE 4ZAEA 4BXSA 3HGNA 3GYMA 3SGBE 3SI3H 3FANA 5F8ZA 4IN2A 1C5OH 3RC4A 3QTVH 3UOPA 1HAYB 5LGOA 2ZU2A 1GMHG 1QIXB 2PUXB 2FOAA 3M3SA 4X8VH 5E2OA 8GCHG 1GJAB 3VXEH 1O2QA 2FWWA 3MH4A 3Q3XA 1ETRH 1HDTH 1SB1H 3FVFB 3Q00A 4SGAE 4B74A 3D62A 3EA7A 4Y76A 7GCHG 1TYNA 2GX4A 1O5CB 2XBXA 1MAXA 2Y5FA 2ANWA 2B7DH 4IC5A 2VNTA 4X1SU 3SI4H 1FY4A 4CR5A 3L33A 1A7SA 1SHHB 1ZSJA 1KTSB 2Z9IA 2ZU4A 1Y5UT 1O5FH 2OC7A 3KQBA 1P02A 3T25A 1BUIA 4AORA 2ZQ1A 1KXBA 1DUEA 1LTOA 1BA8B 1WU1A 2QA9E 3PTNA 3HGPA 3MTYA 2Z3DA 5E2PA 2O8TA 4NSYA 1OXGA 3MNCA 2C8XB 1ZTJA 3P70B 1S6HA 1J17T 4K5ZA 1GBAA 1C5UA 3UOUA 1GMHF 3F1SB 8GCHF 5FPYA 1A0HB 1LQDB 1BMNH 2G51A 4K1TA 2Z9KA 1A0LA 4YESB 1ZYOA 4OGXA 7GCHF 1YLCA 2P59A 1RTKA 2ZHEH 4ABGA 1AGJA 4D9QA 1AI8H 1V2NT 2ZCLP 2TGAA 1RS0A 1QRXA 1ARCA 2H1UA 1TMTH 2QV1A 1ORFA 1O36A 1WBGB 1GCTC 1PPGE 1QA0A 2SGEE 2VVCA 4YLQH 2BLWA 1JBUH 3A81A 1ELAA 4E7NA 4XBBA 4JZ1A 2OBQA 1HGTH 1W0YH 4F4OC 4BAKB 1F5KU 4CBNA 2FYQA 1O3OA 4GUXA 1E36B 3MMGA 2PV9B 5E0JA 5A2MH 2J94A 1O32A 1S81A 2BDCA 3F9GA 1EZQA 1EAUA 1CHOG 5TJXA 2CHAB 4JK6A 1ZZZA 2PW8H 3FZDA 2ZGJA 2QGRA 3SNAA 1A5IA 3MO3A 3T5FH 3U8RH 1G30B 2CXVA 4U30A 1K1LA 1C2FA 3ZZAA 2BDIA 2KAIA 1PPCE 3LOXA 3M61U 4XE4A 1D4PB 2DUCA 1NT1A 1LVBA 2G4TA 4B2BA 3M7UA 1CGJE 2PSYA 2G81E 4UD9H 1TBQH 2VINA 3SNBA 4AGJA 1KXFA 7LPRA 3PLPA 3M7QA 2O8WA 3A7WA 4Y8XA 1W11U 3GY2A 1FI8A 1UTOA 3B9FH 2WV5A 1A61H 1FAKH 3ZZ7A 1S82A 1HAVB 1MTWA 4A1VA 1D3DB 3SQEE 1HXEH 4Q2KA 3RLWH 1Z71A 2Y80A 3M5OA 3GDSA 3TH2H 1RTLA 1P01A 1A2CH 2D1JA 1CT2E 2BD2A 1O0DH 1DWEH 3F68H 4GHQA 3BTKE 3FP7E 4MVNA 1UK3A 4CREA 2OBOA 3LIWA 3CS0A 1GBFA 4X2XA 2BQ6B 1S84A 1ANEA 2G00A 4TWYA 4GPGA 3RMMH 4IMQA 2H9TH 6GCHG 1TNLA 2WPMS 5L30H 4AN7A 1GI5A 2XBWA 4D9RA 4WMEA 3ESTA 1O2MA 3E90B 1SQOA 1QA7A 4AYVB 3GDVA 1V2WT 1YPKH 3QK1A 2FYRA 4VGCC 1NZQH 1K22H 5A8XA 2J92A 1RGQA 3K6YA 1XUHA 4LXBH 3VEQB 3HKIB 4WH6A 1V2TT 2IN2A 3GCTF 2CF8H 2FTLE 1HNEE 2BOHB 2G52A 2BDYA 3T26A 1BBRE 2A4OA 1FV9A 2FTMA 1TE0A 1LPKB 4TWWA 4HFPB 2UWPA 1AB9C 3GY6A 1O5EH 2ALVA 1PPHE 1CSOE 1WTGH 2HRVA 1NRQH 3ATKA 4UFGH 4NWLA 1AO5A 1RXPA 1GBEA 1GBDA 3S7KB 3ODDA 4ZKNU 5GJ4B 2C3SA 3MH5A 2A5AA 2OUAA 1MZDA 2PLXA 5K7RA 1C1OA 1H9HE 3M5LA 1GG6B 4FUHA 1K1IA 3DHKH 5JDUB 3ATLA 4BAQB 2SGDE 4NWKA 1ZMLA 3MI4A 1C5QA 2UUFB 1A3EH 5E8EH 3BF6H 2FS9A 1TGBA 1FN8A 4GVUA 4ABFA 3U9AH 4UFDH 5L2ZH 4NGAH 1BTYA 1GJDB 1KY9A 2F9NA 2R0KA 2V3OH 3RXVA 4AYYB 9ESTA 3SV6A 1ZGVA 1ANCA 4I8KA 1A5GH 2QY0B 1ZTLA 4R0IA 3LU9B 3M7TA 3UFAA 4K3JA 2WPJS 4YM9A 1EATA 3BTME 3L6PA 3T29A 4DCDA 3M37A 1P05A 2ASUB 2XBYA 2Z9LA 2ZDMA 1RIWB 4XBDA 4ZMAH 1IAUA 2EA3A 4I7YH 2B8OH 3RC6A 1NFYA 3KN2A 1D3QB 1MD7A 2EI7A 4NA9H 2SFAA 2ZDNA 2XCNA 3V13A 2ZTZA 1RRKA 4ASHA 5AFYH 1DPOA 3E8LA 4ISIH 4YTAA 2Z6BD 4Y0ZE 2CJIA 1RD3B 3D49H 2PGBB 4U2WA 1TQ0B 4BOHA 1N6YA 4FUIA 3TH4H 1IOEA 5EGMA 1TBZH 3PMHB 3A82A 1CA0B 3ATIA 3TK9A 4BTUB 1P2QA 2Y5GA 2ZFQH 2ZP0H 3EGKH 1O3GA 1QL8A 4IGDA 2OTVA 1UCYH 4M7GA 1EQ9A 1ZPCA 3A83A 1CE5A 3EE0B 1GL0E 4NFEA 2ZWLH 1O3KA 1MKXK 4U01A 3P8FA 4FU8A 1NFWA 2O8LA 1QQ4A 2OP9A 3TJUA 6CHAC 1FONA 3FAOA 3U1IB 4OS5A 1SGFG 1NRSH 1DLKB 4DURA 5EQQA 2GTBA 1UTQA 1DWDH 1O2XA 1ARBA 4YOIA 4DW2U 1TRYA 1CGIE 1NU9A 1EAXA 5GCHG 5T6GA 1ID5H 3KEEA 3TH3H 1DWBH 2I6QA 3MNXA 4X1PU 3OY5U 4Y0YE 3BTEE 2ZFSA 2A4GA 2LPRA 1DLEA 3GYLB 1ABJH 1DXWA 3UWIA 1FLEE 3BTFE 2OQUA 3B8JA 3EA8A 1BT7A 4FUGA 1V2OT 1QQUA 4HI3A 1AFQB 2A2XH 4I33A 2ODYB 2BZAA 1PQ7A 3LGIA 4H4FA 4Q7YA 2V35A 1BTPA 4TY6A 2Q6GA 4YZUA 2GZ8A 3MOCA 4WF8A 1QBOA 1RFNA 1TPOA 1GJ6A 1MCTA 5EXLA 1S0QA 1C2LA 3SU6A 1JOUB 2UWOA 3A8CA 1BOQA 1EJMA 4H42U 3RXGA 1QTFA 4BANB 5AF9H 1HAHH 5C5NA 1NESE 3PLKA 4ZKSU 2FOEA 4NCYA 7ESTE 3FZZA 2ZFPH 4A1XA 1O3JA 1MTNC 1W7XH 4A6LA 1V2LT 1DSTA 1ETSH 1TNIA 4XDEA 2Y5HA 3LONA 1NS3A 1PQAA 1TPPA 2GT7A 5IYTA 2WPIS 2AFQB 1JWTA 1MCVA 4SGBE 1O2TA 1C1QA 1T4UH 4MPXA 4X6NA 5EW2H 1JMOH 1WOFA 3P6ZB 5FXLA 4NIYA 1PFXC 1VCWA 2QXJA 1AKSA 1LMWB 1GMCF 1VGCC 1QURH 5CMXH 2J38A 2Q6FA 4NIWA 1G9IE 1ELTA 5C1YA 4KKDA 2FO9A 5FAHA 2OCVB 3PO1B 4FUFA 1C2DA 1KIGH 1O33A 2NU0E 1FJSA 1GI9B 1W2KH 2PKSC 1SOZA 4YOGA 3UUZA 2AERH 1WYKA 3SV2H 1GBLA 3A7TA 4YO9A 5E0HA 1DVAH 3B23B 3MH7A 3KNXA 3SZNA 3PLBA 1NFXA 2ODQA 5AHGH 4XBCA 1ELFA 1THSH 1QR3E 4WVPE 3SNEA 1XVMA 2TIOA 4KTCA 1QBVH 1F5LA 2YOLA 1PPBH 1OP0A 4H6SB 3GY7A 1OWIA 1XXDA 1PPZA 4A92A 3ZZ3A 5HM9A 2HPQH 2QC2A 5FHTA 2ZFRH 2J9NA 3OSYA 6LPRA 3KQEA 1E38B 2FI5E 2BY9X 1ZLRA 1HJAC 2XW9A 3SU2A 4X8TH 1FPHH 1H8DH 1GHZA 2ZPRA 3OU0A 2FESH 1F5RA 1TPAE 2Q1JA 3LKWA 3MO9A 3AAUA 1OKXA 1MBMA 2VIPA 1S0RA 1QNJA 2NU3E 4BNRA 3ZVBA 1YM0A 1W8BH 1XUKA 4MQAA 3G01A 1ZPBA 4ZXYH 1BJUA 2JH0D 4ABJA 5DP9A 2BX3A 3HK6B 2AEIH 3MNSA 3TJVA 1ELEE 3IWMA 1THRH 2VWNA 1A1RA 1P2JA 1GI7B 2FOBA 2P93A 1TLDA 5EQRA 4BXWA 1AZ8A 3M3TA 1BTWA 2KAIB 1WCZA 1K28D 2AMDA 3NPSA 4OS7A 3RXJA 2BB4A 4X6MA 1QB6A 2AMPA 2FOGA 2VIDA 3ATMA 4H6TA 4AFSA 1ESBA 2BM2A 1UJ1A 1O34A 1WQSA 4ISLA 3BIVH 3SGAE 3S9CA 3QGJA 1FY8E 5CE1A 2A4RA 1GJ5H 2OC8A 1MKWK 2CGAA 3GICB 1G3CA 3MU4A 3D65E 1C5TA 1DSUA 3EQ0H 3RM2H 3PWCA 1C1NA 2FM2A 1V2UT 5L2YH 4LZ1H 1T31A 2THFB 1AQ7A 1E0FD 2A2QH 1QJ1B 2G8TA 2GCTB 1H8IH 3BG4B 3W94A 1SGDE 1FY3A 4FUCA 4QT8C 2P94A 3TK6A 2GMTC 5DP8A 3SJKA 4FUJA 1NTPA 2P3TB 1D9IA 3GY5A 4I8JA 1MTSA 3BN9A 3F6UH 3SV9A 1D6RA 2TBSA 1TRNA 4JYTA 4TYDA 1N6XA 1UVTH 1Z6JH 1AZZA 1YBWA 2OC0A 1V2PT 3VGCC 2AYWA 5F8XA 4WH8A 5FCKA 3TNTA 1C5LH 1P2IA 2H9HA 4B2CA 2BY7X 1FN6A 1TGNA 2AS9A 3NCLA 1KYNA 3SO3A 1C9PA 1SG8B 1SHYA 1K1MA 1XMNB 1YPJH 2HGTH 3PWBA 2RDLA 2R2WU 3BV9B 1DWCH 3LGYA 3VB7A 2BQWB 1MBQA 4AB9A 2VVUA 3LH3A 1F0UA 1BTZA 5A8YA 1DY9A 1O5DH 1A5HA 1DXPA 1A3BH 2UUYA 4X1NU 1AWHB 4A1TA 2R0LA 3GY3A 1GBTA 1T7CA 1K21H 4DIIH 2ZA5A 2SNWA 4X6OA 2JETC 3R3GB 1GHVH 1MD8A 4K8BA 1A4WH 3UR6A 1CBWC 1BMLA 1N1LA 1O2SA 3SW2B 1Z8JB 4BAMB 1IQLA 3UNQA 3SUDA 5T3HA 1YP9A 1IHTH 3M5NA 1GJCB 2QF0A 2VB0A 4Y10E 4K60A 1KDQA 1DOJA 1FQ3A 4ABAA 3A7XA 1K1NA 3ZZ9A 2Y6TA 2HNTC 2G5VA 1BBRH 1O3AA 3TJOA 1H9IE 4I31A 4K69A 3SUEA 3L3TA 3AASA 2BDHA 2FX4A 3P17H 2BVXH 3ZVFA 3Q76A 4I32A 3PYHA 3MYWA 2NU1E 3TLOA 1UK4A 5FBIA 3F9EA 2XC0A 1HAZB 3U1JB 1O2UA 2VGCC 3HATH 1E34B 3A8BA 1RTFB 2AIPA 2DE8A 2BD8A 3Q77A 2C93B 3O8DA 2ANMH 2G55A 1GCTB 1BCUH 3ZZDA 1G36A 2HVXA 5C20A 2M5TA 1D3TB 1TONA 4BAHB 4AFUA 4XOJA 4GAWA 1O2PA 2W3KA 4CHAC 3C1KA 3DT0H 3BTWE 1INCA 1C1UH 4OGYA 4FU9A 1V2JT 1OOKB 1D3PB 1MAYA 1EPTC 2BD4A 2OXSA 1U6QA 3MFJA 1HXFH 4LK4A 3UPEA 2EI8A 2O9QA 1VJAU 2FOHA 1C1SA 1NC6A 1BRUP 4Y7BA 3RXDA 1OWDA 1HV7A 1MZAA 3T62A 3TITA 1W3CA 4GLYA 2PSXA 1MQ5A 1K1PA 3RXTA 2AH4X 1OWEA 3CP7A 1CHOF 4HTCH 5LPRA 2NU2E 1TNJA 2VWMA 2CF9H 1LKAA 1GBKA 1O3EA 2QCYA 3O8CA 2ZHWH 2JKHA 1DY8A 3RLYH 3RU4E 2BXTH 2PTNA 1HAXB 3ZZCA 3ZYDA 1Z7KA 3CENA 2XWBI 4O97A 3LC5A 4X2YA 3VB4A 1DICA 1C5XB 3MU0A 3T2NA 2I6SA 1GVKB 3RXMA 4ZXXH 1TOMH 1C1RA 8ESTE 1Y3UA 1QBNA 5DG6A 2C8YB 4UFEH 3UNSA 2NU4E 1QGFA 1P3CA 3QDZB 2PFEA 2XWAA 3MNBA 3SHAH 1SLVB 3V0XA 2ZGHA 4F49A 3QX5H 1GBHA 2OD3B 1GBJA 1M9UA 3LT3A 1L1GA 3TVJB 1C1TA 1FUJA 2ZEBA 3ZVAA 3BTGE <