1O5AB

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA)
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5aB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5aB01
4X1NU 1K1PA 2BMGB 1A0LA 1GMHF 1EP5A 3RXPA 1ZYOA 5LGOA 4YLUA 3SNBA 1TA6A 1SOZA 3TIUA 1HPGA 1O3IA 1QNJA 1GI4A 1A3BH 1SI5H 1LHDH 4FU8A 1W13U 3H5CB 2A5KA 4YOGA 2C8ZB 4J2YB 1PPBH 1GDQA 1PYTC 4INHA 1ESBA 1O2IA 5A8YA 2I6SA 2UWOA 2QCYA 1JMOH 4WMDA 3MWIU 3SO3A 1P3EA 2Z9KA 3BEIB 1XM1A 5BPEA 4KKDA 1C5LH 2J94A 1O2YA 3RXSA 5AVDA 1QCPA 2F9UA 1SGDE 4THNH 3T27A 1Z1JA 5FBEA 4F4OC 1GDNA 1C1SA 1OP2A 3ZYDA 2HALA 1A5HA 3W94A 1ELGA 1BRUP 3F6UH 1O30A 1HXEH 3PWCA 5IDKA 1MTWA 2ZQ2A 1DSTA 5LPFA 4ISHH 3RMOH 2BOHB 4AN7A 5DP6A 4I7YH 4AYVB 1GJAB 4X2YA 4LK4A 4AYYB 8GCHF 1GHVH 1D4PB 1SGQE 1VJ9U 1BOQA 1Z8GA 2G00A 1WQSA 1QA7A 1S5SA 3TK5A 1EAUA 4ZKRU 1BUIA 3M3VA 2FTLE 4Y71A 1UTNA 2BDCA 2WPLS 2FOGA 1OXGA 3LGWA 1MZAA 1NTPA 5FCKA 1AE5A 1JOUB 3VB5A 4DY7B 1TWXB 4Y0YE 1GGDB 1QJ1B 3ZVEA 1TB6H 2ZNKH 5F8XA 2DE8A 3WY8A 2A1DB 1VCWA 1ZSLA 1EZQA 1UVSH 4WH6A 3TITA 3A7YA 2GCTC 1MTNB 2FYRA 3MYWA 2Z94A 3HGPA 3V3MA 3M7UA 1SGTA 3SU6A 2ZP0H 2A4OA 2P3FH 1FI8A 4OS7A 2C8XB 3PO1B 1UMAH 3M5NA 5L2ZH 5DP9A 3SV2H 2IPHA 4B71A 3TH3H 5GPIB 1O5CB 2BVSH 5DK1A 2ZDAH 3DFJA 1ZHRA 3UNRA 4KP0A 3VB4A 2J34A 3SHCH 1GHBG 1KY9A 2O8MA 3ZZ4A 1IOEA 1CVWH 1HJAB 1FAKH 1MU6B 1L1NA 1HB0B 3QDZB 1OOKB 4IBLH 4B1TA 1ZJDA 9ESTA 2GDEH 3H7OA 1GHXH 4ABFA 2WPHS 1SR5C 3PTNA 4UEHH 7LPRA 2O8LA 1GJBB 3SGAE 1N8OC 1IQGA 3T29A 1UK2A 1BIOA 4WWYA 1P2IA 1GI0A 2QXGA 1ESAA 1DANH 4OS2A 1UCYH 1CE5A 3T62A 2P8OC 1FN6A 3RXVA 2HGTH 2AS9A 3BIVH 3RXMA 3DFLA 3A89A 2HNTC 1D3PB 1K1LA 2EEKA 2ZA5A 3A86A 4YT7H 5C20A 1SL3A 1YCPM 1UTMA 5DPAA 3BG4B 1CQQA 9LPRA 2IJOB 4A1TA 4H42U 1FDPA 2PR3A 4XBDA 2Q6FA 4AFQA 3GCNA 4Y8XA 1PQ8A 2ZFRH 1ZHPA 1ZGIA 5C3NA 3S9CA 1KDQB 3FVFB 2C93B 1TPPA 1SSXA 2ZDNA 2FOAA 2VWOA 1DX5M 1GCTB 2V0BA 1EZUC 1PPEE 1BBRK 1VJAU 2DUCA 2A0QB 3EA7A 2KAIB 3UFAA 1O2LA 3LIWA 2B5TB 3E8LA 1HAIH 1J8AA 2OC8A 4NG9H 4UFFH 1TNHA 5CMXH 2Z9JA 1CGHA 1Z71A 4CRCA 1EPTB 5J4SA 1W14U 2NU0E 3TNTA 7GCHF 3B23B 1KXAA 3MH5A 1TGBA 2CV3A 1SGPE 1EB2A 1C9TA 1JRTA 1PQ7A 4B74A 1QBNA 4IN1A 1MTUA 5T3HA 1AUTC 3PMBB 1KDQA 2GGVB 2GZ9A 4K5ZA 1FPHH 1S83A 1WOFA 1GI9B 3LGVA 4YOIA 4CRBA 4GLYA 3F68H 1LPZB 3SUFA 2UUJB 4LZ4B 1AY6H 1YPEH 1AHTH 2M5TA 3KN2A 1XVMA 2KAIA 1CU1A 1PPGE 3SNDA 4MNVA 1IQIA 1G2MA 1P3CA 1C2IA 2GCHF 2GV6A 3LOXA 1ELFA 2EI6A 2PFEA 1DWCH 4WJG2 4JCNA 1O2HA 1HAZB 5SGAE 4BAQB 3Q3KA 1AKSB 5EOKA 3GY5A 3PROA 1VZQH 2FM2A 2TPIZ 1F92A 4NWKA 2OD3B 1V2NT 3CS7A 1AD8H 1SGCA 3VGCC 1SGYE 1BRBE 4CHAB 1PYTD 4AG1A 5CE1A 3SNEA 1AWHB 1W2KH 4DURA 1E37B 2BD2A 2PGBB 3E16B 1DXPA 1MBMA 1J16A 2VIWA 2SNWA 1QBOA 3GCHB 1CT2E 1P10A 3TJOA 4K1EA 1BHXB 2EI7A 3LGTA 5A0CA 1NFWA 1TYNA 4ZKNU 2BD7A 1YBWA 1V2VT 1GJ9B 3GY2A 1OWIA 1UK3A 1CHGA 5EXNA 1C5UA 2ZTYA 3SQHE 2XBVA 2H9EH 2QC2A 5LPEA 4VGCB 4GPGA 4WXVA 4CH8B 3SHAH 1DFPA 3SV7A 1S81A 1AKSA 1OWJA 3S69A 2GMTC 4B2AA 5HM2A 1FPCH 1QB9A 1XKBC 2XW9A 1KXFA 3RXOA 1TNJA 4WH8A 4FUGA 3E6PH 1FMGA 1ESTA 1C1QA 1K22H 2J4IA 3QUMP 1BTPA 1TNLA 1BITA 2F9PA 3LGUA 1XX9A 4ABEA 1DITH 1TGNA 3D23A 2J9NA 2ZFFH 1FN8A 1T4VH 1TNGA 2QXIA 1D3QB 1RGQA 2W7UA 3SU5A 4LXBH 1K1OA 2G8TA 1AUJA 3ITIA 4UFDH 4YLQH 3SJKA 1U6QA 2BD8A 3S7KB 2FEQH 4D9QA 2VH0A 1XUFA 3MO6A 1AWFH 4ESTE 1C2GA 3P8OA 1ZRBA 3PLBA 2XCFA 4DG4A 1GMCF 2ZHQH 1TOCB 1HAYB 1GBTA 3LONA 2BDAA 2A4GA 1MBQA 3URCA 3HGNA 2BQ6B 4JZDH 5C5NA 4XDEA 1LHEH 1TONA 3SJOA 1GG6B 1C1TA 1FY8E 1GI2A 1O2JA 1W3CA 2UWLA 4JK6A 4O9VA 1FONA 3SBKA 3U98H 1T8NA 2NU1E 1MTSA 3LKWA 1EP6A 1G2LA 2H6MA 2TBSA 3F9HA 1CA0C 1JIMA 3A84A 3VXFH 4IMZA 1YPHE 4YTAA 4X8UH 4ZMAH 3P8FA 3RM2H 1S0QA 4TPIZ 1C1OA 1FY5A 4XBBA 1DWBH 2GVFA 1EJNA 3RXGA 3ZZAA 1CA8B 4X6OA 2XBYA 2PV9B 4NZLA 3QLPH 1TMUH 3SQEE 2Z3DA 4FVBA 5G4BA 4X8TH 3UTUH 3VB3A 2OINA 1BTWA 3RMNH 1EX3A 2Q6DA 1N1LA 4OGXA 2BZ6H 1QHRB 2ALVA 3EA9A 1ZPBA 4FUFA 3A7XA 1ELAA 1AB9C 3HK6B 4WY3A 1C2DA 4E05H 2FOHA 2QY0B 1ZTKA 1GBDA 2ODQA 4E7NA 2R9PA 4JZ1A 3LH1A 1NRPH 2WV4A 3MH4A 1S6FA 3VXEH 3STJA 1D3DB 5JBCS 2H9TH 2FI4E 3E90B 1KIGH 3BTHE 3RLWH 3SJ9A 3HPTB 7KMEH 5JB8S 2PTCE 4JK5A 2GCTB 7ESTE 5JB9S 1H8DH 1YPKH 2QA9E 1M9UA 2GTBA 2EC9H 5H4IB 3SI3H 2A4RA 5F8ZA 1GBFA 4CRAA 2O8UA 1V2LT 2FI5E 3W95A 3URDA 1PPZA 1OSSA 2FS8A 3MU4A 5DG6A 3RXHA 5DP3A 1F5RA 1O32A 3ZZ6A 1QL9A 2H9HA 1QIXB 2ZGXH 1WU1A 1QA0A 3A7ZA 3A7TA 3BF6H 3RDZA 4INKA 2WPJS 5E0GA 1GJ5H 4KELA 1G3CA 3RM0H 1P01A 1V2QT 2NU4E 4JZIA 1A5GH 2OBOA 4ZH8A 4Q80A 3PB1E 3T2NA 4HGCA 3KQDA 5DP8A 1X7AC 3LH3A 1GMDF 4YOJA 3BTKE 1ANBA 4IMQA 4UE7H 1N8OB 1CBWB 5EGMA 2R2MB 2ZDLA 4Y76A 3RMMH 1AMHA 1TIOA 4DJZB 4X1RU 4IW4E 3U69H 1AVGH 1XKAC 2P8OB 5L6NH 1ETRH 3U8RH 2HVXA 2ZU2A 2BDGA 1PFXC 2BX3A 2OCVB 1DWEH 1IHSH 3VFEA 2PSXA 4MLFB 2WUCA 1UTQA 1ARCA 4XBCA 2FIRH 3FANA 2P95A 3TU7H 4CBOA 1TABE 2AMDA 1V2JT 2ODYB 1KYNA 4UD9H 1NPMA 3RLYH 3RU4T 3M3TA 1EJMA 1PJPA 3U8OH 1ACBE 2Q1JA 1K1MA 1ZLRA 1J17T 1P09A 1MAYA 3RXJA 2BY5X 4BOHA 1C5XB 2Z7FE 1NO9H 1RTLA 1GHAF 1YPHC 5C1YA 1DDJA 4R8TB 1Q2WA 3GCTF 3M5OA 1O3CA 3FZZA 1EQ9A 2GP9B 1K1NA 4JZEH 2PLXA 1FJSA 3Q00A 1C5SA 1C5WB 1CO7E 1FY1A 4BAHB 4OS5A 1WBGB 1P2OA 2EI8A 5JBTA 2FXRA 1QL8A 2FPZA 2J95A 2BVXH 2Z3CA 1YKTA 1QGFA 2R2WU 2Y5FA 1LCYA 3MNSA 3ZZDA 1TPSA 1ZTJA 1GMHG 5JDUB 4DT7B 1G37A 1OWHA 1H9IE 2JH5D 2P93A 3ZZ7A 3SV9A 1FIWA 3A81A 4A5TS 3DT0H 1ZGVA 2WPMS 1OWDA 1P2MA 2B7DH 1VITH 2FDAA 1T8OA 3TH4H 2BB4A 5HGGA 3P8NA 5ESBA 1Y3VA 5GCHG 2ZHEH 3BV9B 4I8HA 3ZZBA 5EPYA 1SGNE 4I33A 1CSOE 2Q6GA 1ZMNA 3MI4A 1T8MA 1VCQA 4MTBA 4R0IA 4I8KA 3SUEA 3CENA 1QB1A 3BTGE 2JH6D 3VGCB 3T5FH 4ABGA 4AG2A 3UWJH 4TWWA 1MKXH 2WINI 3A8DA 4DIHH 3QZRA 1BJUA 5T6DA 3SJIA 1QQ4A 2PHBA 3LPRA 1RIWB 2I6QA 2BDIA 1SQTA 1MKWH 2PSYA 5F8TA 3KQCA 3Q77A 3BN9A 1TE0A 1V2PT 2ASUB 2J38A 3MO9A 4AGKA 3B9FH 1XUGA 2ZU3A 8GCHG 2FOFA 4E7RG 1LTOA 2RDLA 2SGAA 2HWLB 2G81E 3IWMA 6GCHF 1C1RA 4RSPA 3ATKA 2GMTB 1H1BA 2R0LA 1J9CH 1L1GA 1V2RT 3GOVB 3UNQA 2G4UA 4SGBE 3SNCA 3BTME 1DM4B 1GBHA 3LU9B 3LJOA 1D6RA 4I31A 1H8IH 4MNYA 1B0FA 3D65E 4AFSA 1SLXB 1KTSB 2ZGJA 2ANMH 1IQNA 3SUDA 4ZHLU 3AVZA 4NSVA 2AH4X 1O2TA 5F03A 4HTCH 1ZSJA 1P57B 3KQEA 1XUIA 1V2ST 1A61H 3RXEA 4FUCA 1RTFB 1O3BA 1WYKA 4D7FA 2XC4A 1AI8H 4AFZA 2TRMA 1AZZA 4I8JA 2UUFB 1EJAA 3JZ1B 4Z0KA 2R3YA 5FPSA 3PWBA 1ETTH 1TBQH 4RN6A 2QAAA 3FZDA 1LKBA 2F83A 4A6LA 2FOEA 3MO3A 4WF8A 1DT2A 2Y7XA 4KTUA 1O2UA 1OYQA 3MU1A 4RKOB 3RXQA 1INCA 2OTVA 4NA9H 4NFFA 5E8EH 2BM2A 1GJ4H 1KTTB 2GX4A 4D9RA 3F9GA 1AB9B 1EXFA 1THSH 2BD5A 3OYPA 5HXFA 1L2EA 1O2VA 2NU3E 5FX6A 4JMYA 1T8LA 2Z3EA 2CF9H 4ZKSU 4NIWA 2BZAA 2FESH 4HZHA 1C2FA 3K2UA 1DVAH 2W3IA 3IITA 1GBAA 3QTOH 1WV7H 1LHCH 1UTKA 1S82A 1ZPZA 2R0KA 2PKAB 2A7HA 4ZHAA 1O2MA 1UVTH 2ALPA 1IQEA 3MMGA 1O39A 2Z6BD 1KSNA 1UTOA 1C5PA 3E91A 1WUNH 2UUYA 1BMAA 3V7TA 4ZXXH 4U2WA 2QYIA 1O3PB 1GL0E 3S9AA 4X8SH 1W7XH 2BD3A 2XC0A 2C90B 4Y0ZE 1TA2A 1A5IA 2A2QH 3GYMA 3NCLA 5L2YH 4MPXA 1K21H 2ULLA 1MD8A 2FX6A 4K8YA 1TRNA 1O31A 2QV1A 1HGTH 2ZGCA 1XUJA 3E3TA 1EKBB 7GCHG 4B75A 1O0DH 4NIVA 5GJ4B 2OC1A 3DD2H 1UJ1A 1HBTH 1WAYB 1Y5UT 3ZZ3A 1C5OH 3A7WA 3ODFA 1FLEE 1SHYA 5E0JA 5ABWA 5FPYA 1O5AB 1C1PA 1C4V2 2BY8X 1HAVB 1Y8TA 1BTZA 2PKAA 3GY8A 1MQ6A 4UFGH 1ZR0A 1Z8IB 1NS3A 3MNXA 5T6FA 2B8OH 1O3GA 1NESE 1ORFA 3K9XB 4WMEA 1TMTH 3RXIA 1QR3E 1SFQB 4A1VA 1RJXB 2RA0A 2VU8E 1F7ZA 4X6MA 1QFKH 1DOJA 1SQOA 3NWUA 4NWLA 2QF3A 2RG3A 3Q3YA 4FUBA 1HAGE 2FYQA 3MTYA 4D7GA 1BRAA 2D2DA 1GCDA 4MG3A 3LC5A 3TNSA 2A32A 1HYLA 3KHVA 3O8DA 2ZFQH 3SW2B 1NRQH 2ZFTA 1HUTH 4Y79A 5A2MH 3I29A 2ANWA 1AQ7A 5E2OA 2ZEBA 2OXSA 2A31A 1GL1A 1OS8A 3MNBA 5JBBS 1TFXA 4BXWA 2FX4A 2H1UA 4FU9A 1P9UA 1TBRH 2C3SA 2FOCA 4MPUA 2VVCA 3GDUA 1P03A 2V3OH 3VPKA 1G30B 4OS1A 1EPTA 2Y5GA 1SGRE 4TY6A 3TJVA 4BANB 1SGFA 1TALA 1TQ7B 2H2ZA 4TWYA 3GYLB 2QF0A 3MU8A 3SOSA 3UQOA 1ZJKA 3P17H 1YLCA 1F5KU 2A5AA 2G4TA 5ESTE 4Z6AH 2BY7X 1O33A 4A92A 1C2JA 1UCYE 5A0BA 4JYUH 1OP8A 3RXAA 3UIRA 3ZV9A 1O35A 4ZHMU 1HDTH 4LOYH 3D49H 2JKHA 3OY6U 2ZIQH 3KIDU 2OC7A 1GBCA 1O36A 1J15A 3RXFA 4CRGA 1D3TB 1AGJA 2ZCLP 2ZTZA 4O3TA 2YNBA 1K1JA 3SORA 1P2KA 4X2VA 2AIPA 1PPFE 2OP9A 1GMCG 3MH7A 5FAHA 1UVOA 2F3CE 1GBMA 1LQEA 1IQLA 1NN6A 3ELAH 2A4QA 1TRMA 5GWZA 5C2ZA 3PLKA 1ETSH 1O3EA 2BLWA 2ZHFH 1HAXB 1YCPK 3KEEA 5LH8A 1ELEE 1EOLA 2F91A 4CBNA 1XVOA 3NZIA 1OP0A 5TCCA 5EPNA 3RMLH 1BDAA 1IAUA 3M5LA 3M5MA 1HAOH 2VB0A 3NK8A 4AB8A 3CP7A 1EAWA 1O2GH 3MU5A 1K9OE 1RXPA 3RU4D 1O2NA 4GCHF 4YT6H 2ZZUH 2D26C 2VWLA 3O8BA 2AEIH 5EW2H 2G55A 3S7HB 1FQ3A 2ZKSA 4O03A 5DKMA 1GJ6A 1GI7B 2OBQA 2ANYA 3EYDA 3SU2A 3ZVGA 1N6XA 3SNAA 1DUAA 3ZZ5A 1O5GH 2QGRA 1O5EH 4BTTB 3GY4A 2IN2A 4GSOA 2VJ1A 3GY7A 1P02A 1ZMJA 5HYOA 1ELBA 3A85A 1QJ7B 1NFYA 1QBVH 5I46H 2ZCKP 4ZROA 3GICB 1OPHB 4TYDA 1C5NH 4MQAA 2SGFE 1QTFA 3TJNA 2JH0D 1O2ZA 1UK4A 1SHHB 4X1SU 1E34B 2QN5T 1ZOMA 1GVZA 2AMPA 3FAOA 1BTHH 1CT0E 3UR9A 3NKKA 2P94A 2ZWLH 1T32A 3T28A 1RRKA 2O8WA 1A0JA 1BHXF 1QJ6B 3FFGA 1C5RA 3L3TA 1O2OA 4OS6A 3EA8A 3NXPA 1TQ0B 3RXKA 1GBLA 3VB7A 2F9NA 2XBXA 1DXWA 1SG8B 2WYJA 5JYIA 5BRRE 4K69A 4ABAA 4X6NA 2Y5HA 5FPTA 2BHGA 1BTUA 1KXCA 2GZ8A 3TPIZ 1HLTH 2XXLA 3MU0A 1P06A 1GMDG 1CGJE 3U1JB 1O2PA 1SC8U 3P6ZB 2AERH 3RXCA 1ANDA 6LPRA 1NRNH 1OYTH 3PMAB 2ANKH 2QXJA 2J2UA 1ELTA 2BVRH 1GBEA 2CN0H 3EAJA 4AFUA 4O3UA 2QXHA 1TNKA 3SUGA 4MNXA 1H4WA 1Y3WA 1QY6A 1GBBA 4ABBA 1XUKA 3PLPA 1EZXC 5CHAC 3RC6A 2AGIX 1V2WT 3GY6A 4OS4A 2BX4A 1EATA 2A7CA 4Q7ZA 1SB1H 1CHOF 5EODA 3A8CA 4AB9A 2D1JA 4IC6A 2Y6TA 4CREA 1C1MA 2Y80A 1IQKA 1P12E 2OUAA 5B6OA 3UOPA 2AGGX 2HOBA 2XNIA 3DUXH 4UFEH 1ZHMA 1ZSKA 4X1PU 3U8TH 1DUEA 4ABDA 3E0NB 1C1UH 3ESTA 1SLWB 2JETC 1ZRKA 2OQUA 3UUZA 1BBRH 1GHAG 1GJ7B 4WXIA 5EQQA 3V12A 4AX9H 2W7SA 2YOLA 3GCTG 1UCYK 2THFB 3BTTE 2BOKA 3P95A 3LJJA 5FHTA 4K8BA 3ZZ8A 2B9LA 1AFQC 3GDSA 2EA3A 1LHFH 2OC0A 4LZ1H 4X1QU 1BJVA 3QTVH 2BLVA 1D6WA 1K28D 2FOBA 2ZO3H 4I8LA 4K1SA 2WUBA 2F9OA 4X2WA 4I32A 1P2JA 1HFDA 2A7JA 1A3EH 2P59A 4NIYA 4U01A 4Y11E 2NWNA 3I77A 3BTDE 3GISB 2ZG0H 3HATH 5FBIA 4B76A 3OSYA 1BMLA 1TPAE 4UDWH 4GVUA 1NY22 1L4DA 1TOMH 2WPIS 5GDSH 2ZU1A 3O8CA 1V2UT 2D8WA 3QGNB 1O5FH 1VR1H 3SN8A 5A8ZA 5HMAA 1PPCE 2G5VA 1F0RA 2PWXA 1AN1E 1TGTA 4KTCA 1FXYA 1HNEE 3DA9B 3HKJB 3SZNA 4FXGH 5DO4H 2SFAA 3RC5A 4HI3A 2J92A 2RA3A 1OWEA 6CHAC 1GHYH 2WYGA 3ZV8A 1V2MT 4JYVH 2Y81A 3L33A 1AFEH 2Z9LA 1Y5BT 1A4WH 2WPKS 2W26A 3Q76A 1GI8B 1O3DA 4X8VH 2OQ5A 3K6YA 3MHWU 1GJCB 3U9AH 3ZVAA 1T4UH 1K2I1 3ZVFA 2VIDA 1MCTA 2ILNA 1ELDE 2ZFPH 3PV4A 1O2RA 1YM0A 1LMWB 2ODPA 3SU0A 4O97A 2CHAC 2F9VA 1SFIA 5JPMH 3TGJE 1P2NA 1O3OA 6GCHG 8KME2 5EQSA 2ESTE 5AHGH 1OKXA 4F49A 3UNSA 3F9FA 4UONA 1THPB 2HNTF 1O3LA 1YPLH 3JZ2B 3PM3A 1O3KA 1UVUH 2BQWB 1ELCA 4MNWA 3UREA 1PQ5A 4WMFA 4NSYA 2CMYA 4SGAE 1HJ9A 2VH6A 2XCNA 4TPYA 1GI3A 1LVMA 1XXFA 4X6PA 2BXTH 3UR6A 1IQJA 1GVKB 1GVLA 4NZQA 3AAVA 4H6TA 3M3SA 2RCEA 2ZCHP 2GV7A 3A7VA 1K1IA 1H9LB 3PYHA 1NC6A 2FOMB 2BDHA 1Y3YA 1SLUB 2YNAA 3NUMA 2A45B 3UQVA 2CJIA 4ZKOU 3A82A 1C2EA 1HCGA 4H6SB 1SPJA 1F0SA 2XWAA 2ZF0H 1UHBB 5DJ7A 1L1JA 1AVWA 3T25A 1BT7A 2HNTE 1BMMH 5K7RA 1H9HE 5GCHF 1JWTA 1IQMA 2VIOA 2VVUA 1WQVH 2P16A 3SI4H 3LT3A 4ISLA 1A46H 2V6NA 1JXPA 3EE0B 1HAPH 2STBE 3OX7U 4WVPE 2BDYA 1VITF 1C4U2 2R3UA 3V13A 1ABIH 1KXEA 1GG6C 2C8WB 4FVDA 4AOQA 2BDBA 1SOTA 3A88A 1F0TA 1BCUH 2ZU5A 3QGJA 2PW8H 1HIAB 4ISOA 1UTJA 1UHBA 3SGQE 3TVJB 4DCDA 4GAWA 4NCYA 3TH2H 3SU4A 3QX5H 5LPRA 5TCAA 3Q3XA 3LGIA 1MTVA 2ZDKA 1YP9A 2K1QA 1TNIA 1CA0B 2AFQB 4A1XA 1KXBA 2ZPSA 3RP2A 1S85A 1G9IE 4K60A 1FIZA 1GBKA 3H7TA 1CT4E 4J1YA 3M37A 1W12U 2OLGA 3FP6E 3BTQE 1S6HA 2UWPA 1MH0A 2VNTA 4NGAH 1TBZH 1FNIA 2FP7B 3ENSB 1W7GH 2GD4B 1B7XB 2Z9GA 3EGKH 1HIAA 2FMJA 1W0YH 4ABIA 1C2LA 1ABJH 1P2QA 1WTHD 2BXUH 1YC0A 1PPHE 1AZ8A 1YLDA 3RXRA 3HKIB 1V2OT 1FAXA 1FZZA 3QK1A 3STIA 1LVYA 5K0HA 1BRCE 1CGIE 2CF8H 4DGJA 1LPKB 4M7GA 5C1UA 3TJUA 3LDXH 1JRSA 3ATMA 6ESTA 2Z9IA 5A8XA 2VIVA 5AFYH 5I25A 2SNVA 2FLBH 1KLIH 4DVAU 1LO6A 1NU7B 2UUKB 1V3XA 3A80A 2VINA 3LGYA 1CBWC 5CHAB 4BAOB 1A0HB 2BLQA 1THRH 1P05A 2XBWA 1C1NA 3RXTA 2TGPZ 2GT7A 1W10U 3D62A 1PQAA 3A8BA 2PKSC 1Z8RA 3P8GA 1G3EA 1IQFA 1GI5A 1MUEB 1P8VC 3C27B 1QRZA 1GDUA 1E35B 1Z7KA 1C2KA 1GHBF 5DP4A 2SGDE 2ZHWH 4CH2B 4U30A 1UO6A 3VB6A 1BA8B 4FUHA 1QB6A 5E0HA 1O37A 2JETB 1A1RA 3TGIE 1E36B 1YGCH 2FI3E 1O2WA 2GCHG 1S0RA 2TGDA 2ZPQA 4MPWA 2W3KA 3L6PA 1Z1IA 1NROH 2ZPRA 1AFQB 1O2SA 2CGAA 2C8YB 1VGCC 1GJDB 1Y3XA 3KNXA 5IYTA 1C2HA 1RFNA 1ZZZA 5EXMA 1V2KT 3OU0A 3QZQA 4INLA 4ABJA 3MH6A 4B2CA 1HAVA 1C2MA 5C67A 1C5QA 4FUDA 1C1VH 1KLJH 3S9BA 2STAE 3PTBA 1O3NA 3B8JA 1DICA 3TK6A 3KGPA 1L0ZA 1YYY1 2VGCC 2DE9A 1E0FD 1NM6A 1TMBH 2Y7ZA 3MFJA 1NFXA 3P92A 2V3HH 4NA7A 1P9SA 4E06H 1WTGH 5FX5A 1EB1H 4Y7BA 2VWNA 1EASA 4BAKB 1KLTA 2ZDVH 4Y10E 3ZVBA 3EDXB 1YPJH 2H5DA 2Y82A 4ABHA 4H4FA 3M61U 1GWAA 1HRTH 5A09A 3U1IB 1SGIB 2NU2E 4CRFA 1MD7A 1TGCA 1TX7A 6CHAB 4JZFH 1C5YB 3A87A 1YF4A 3BTEE 5DGJA 4BNRA 4X2XA 2FO9A 2XTTB 3MNCA 2H5CA 2VIPA 1BTXA 1DLKB 3BG8A 1O34A 4KTSA 1A7SA 1SGFG 1BTYA 1C5VA 1NFUA 4ZAEA 1GHWH 5EQRA 3KF2A 1GPZA 4X0WU 5EXLA 1OWKA 5GIBA 2ZTXA 1KXDA 2XRCA 2A2XH 1UVPA 1SBWA 1G32B 3AW0A 5A0AE 2AMQA 4GCHG 1BB0B 3AASA 4FU7A 2CHAB 1DE7H 1NRSH 4YM9A 1RIWC 3E0PB 2BY9X 1F2SE 1F0UA 1TAWA 4IN2A 1XXDA 3ATLA 3UY9A 4A7IB 3OTJE 2O8TA 2AYWA 1GHZA 4AZ2B 2HPQH 2ZI2H 3BEUA 4Q7YA 1MKXK 3AAUA 1QRXA 1BQYA 1MZDA 1G36A 1GBJA 1SQAA 2ZGBH 1W0ZU 2AIQA 2BD4A 1QURH 4JYTA 4XSKU 4NIXA 4Y8ZA 3FP7E 5EU8A 3MOCA 1JBUH 1MKWK 4HFPB 5TJXA 2HPPH 1C5TA 4XE4A 3M7QA 1Z6EA 4ZXYH 1W11U 4GUXA 2G52A 2GDDA 3FP8E 1GI6A 3TLOA 1AE8H 4BTUB 3QO6A 5DP5A 1AIXH 8ESTE 1XUHA 1W8BH 4ZUHA 5EW1H 3O8RA 1EAXA 3AW1A 4D76A 4PROA 3ODDA 1A2CH 2B0FA 3QWCH 4CRDA 4KGAA 4YO9A 3TK9A 4NFEA 3SGBE 3ZZ9A 1UTLM 1UTPA 3RXLA 1RTKA 1Z6JH 4RKJB 1WSSH 5FCRA 3BTFE 1GGDC 1IHTH 1AU8A 1VCPA 3EQ0H 4K1TA 1EZSC 1HAHH 2ZHDA 3IG6B 1P11E 5FXLA 1EAIA 1SGEE 3C1KA 2BD9A 3UOUA 2ZQ1A 5HM9A 3ATIA 2IOTA 1QRWA 4IC5A 1MTNC 1O2QA 3SU3A 1IQHA 4Y8YA 1SMFE 4U32A 3BEFB 4ASHA 4MPVA 1C5MD 1LDTT 1MAXA 1Y59T 5DP7A 2PUQH 3PO1C 1T31A 1AVXA 3I78A 3HK3B 1WCZA 1MU8B 1QL7A 2ZFSA 4TY7A 1E38B 1CHOG 1ZMLA 1GBIA 1J14A 4K3JA 1O3FA 2GZ7A 3OY5U 2HRVA 4FUEA 1DLEA 2BQ7B 1DSUA 1NRRH 1G3BA 1GI1A 2P3TB 1ARBA 5C1XA 1HJAC 1NU9A 4OGYA 1O3AA 3G01A 5E2PA 1O2XA 1LPGB 1MQ5A 3ZZCA 1O38A 2XYAA 2QIQA 3R0FA 4YZUA 2VVVA 3QN7A 2FZZA 5T6GA 3KL6A 1LHGH 1ZPCA 3K6ZA 3SJ8A 3BIUH 1SVPA 1DY8A 1YPMH 2F9BH 2G51A 2AGEX 3ATWA 4CR5A 3LC3A 8LPRA 3GCOA 1O5BB 3RXDA 3RC4A 1EUFA 1C5ZB 2FLRH 5JBAS 1O2KA 5GXPA 2O9QA 4GHQA 1DPOA 1DY9A 2ZDMA 1O3JA 1ID5H 3E1XB 4DIIH 1P0SH 5F6MA 4BXSA 4BTIB 2BYAX 4IGDA 3S0NA 3UPEA 4NA8A 2BY6X 3BG4C 2GKVE 2HLCA 1C4Y2 2GT8A 1FV9A 1N6YA 3RUOA 1YPGH 1B0EA 1F5LA 1ZTLA 1TX6A 4DW2U 2VIQA 3NPSA 2LPRA 1MMJN 3A83A 1LVOA 2FS9A 4MVNA 1V2TT 2PUXB 1GJ8B 1GCTC 1FY4A 3ZYEA 2SGPE 4B2BA 4I8GA 3M36A 3V0XA 5AF9H 5ETXA 1B5GH 4Q7XA 2PKSB 1O5DH 2VWMA 3PMHB 2ZU4A 1OX1A 1ANCA 1XMNB 1O3MA 4AGJA 4Y6DA 1HV7A 1ANEA 2TGAA 4ISIH 1P04A 3GDVA 1EPTC 1S84A 2FODA 2WV5A 3GY3A 2SGEE 2XWBI 1Q3XA 5C5OA 4AORA 3RXBA 4B73A 3A8AA 3DHKH 1G3DA 3UWIA 3K65B 1EOJA 1DS2E 4QT8C 2A5IA 1FY3A 4DOQA 1TGSZ 3ZVDA 3KQBA 2LNCA 1VGCB 1NT1A 1TX8A 1DWDH 1V6DA 5EG4A 2SGQE 2ZGHA 4FUJA 3TGKE 2CXVA 4ISNA 4BAMB 2ZC9H 3RU4E 1HJ8A 5AFZH 1TPOA 2TGTA 4YESB 3CS0A 2V35A 1NZQH 1T7CA 1TLDA 3KCGH 1C9PA 4Q2KA 3ZVCA 2FWWA 1AO5A 1FUJA 1O3HA 1ELVA 3T26A 5L30H 5J4QA 2VGCB 2G5NA 1RD3B 1Y5AT 4CHAC 1JIRA 2P3UB 3SU1A 1D9IA 2FTMA 2BTCE 1LQDB 1LVBA 4CR9A 4Y7AA 4XOJA 2ZECA 2BLOA 1Y3UA 4D8NA 3GCHC 2XC5A 3PMJA 4XFQA 4MDSA 1RS0A 2PGQB 4GHTA 2C4FH 2TIOA 3BSQA 3M7TA 1Q31A 2W5EA 1C1WH 1BMNH 4VGCC 1L4ZA 2PTNA 1QQUA 4K2YA 1YCPH 1LKAA 5PTPA 3F1SB 1MCVA 1BZXE 3M35A 4IS5A 3F9EA 3SV6A 3RXUA 1BBRE 3P70B 3VEQB 1VITG 3SV8A 3N7OA 1TRYA 4FUIA 1Z8JB 1HXFH 3BTWE 1SLVB 3R3GB
chains in the Genus database with same CATH superfamily
4X1NU 1WXRA 1K1PA 2BMGB 1A0LA 1GMHF 4DT4A 1EP5A 3RXPA 1BMFD 1ZYOA 3ZIAD 5C0TA 4ACBA 5LGOA 4YLUA 3SNBA 5HKKD 1TA6A 1SOZA 3TIUA 1HPGA 1O3IA 1QNJA 1GI4A 1A3BH 1SI5H 1LHDH 4FU8A 1W13U 3H5CB 2A5KA 4YOGA 2C8ZB 4J2YB 1PPBH 1GDQA 1PYTC 4INHA 4F55A 1ESBA 4ASUD 1O2IA 5A8YA 2I6SA 3AK5A 2UWOA 2QCYA 1JMOH 4WMDA 3MWIU 3SO3A 1P3EA 2Z9KA 3BEIB 4HG6A 3KYGA 1XM1A 5BPEA 4KKDA 1C5LH 2J94A 1O2YA 3RXSA 5AVDA 1QCPA 2F9UA 1SGDE 1SQRA 4THNH 3T27A 1Z1JA 5FBEA 4F4OC 1GDNA 1C1SA 1OP2A 3ZYDA 2HALA 1A5HA 3W94A 1ELGA 1BRUP 3F6UH 1O30A 1HXEH 3PWCA 5IDKA 1MTWA 2ZQ2A 1DSTA 5LPFA 4ISHH 3RMOH 2BOHB 4AN7A 5DP6A 4I7YH 4AYVB 1GJAB 4X2YA 4LK4A 4AYYB 8GCHF 1GHVH 1D4PB 1SGQE 1VJ9U 1BOQA 1Z8GA 2G00A 1WQSA 1QA7A 1S5SA 3TK5A 1EAUA 4ZKRU 1BUIA 3M3VA 2FTLE 4Y71A 1UTNA 2BDCA 2WPLS 2FOGA 1OXGA 3LGWA 1MZAA 1NTPA 5FCKA 1AE5A 1JOUB 3VB5A 4DY7B 1TWXB 4Y0YE 1GGDB 1QJ1B 3ZVEA 4B6EA 1TB6H 2ZNKH 5F8XA 2DE8A 3WY8A 2A1DB 1VCWA 1ZSLA 1EZQA 1UVSH 4WH6A 3TITA 3A7YA 2J97A 2GCTC 1MTNB 2FYRA 3MYWA 2Z94A 3HGPA 3V3MA 3M7UA 1SGTA 3OEHD 3SU6A 5EJZA 2ZP0H 2A4OA 2P3FH 1FI8A 4OS7A 2C8XB 3PO1B 1UMAH 3M5NA 5L2ZH 5DP9A 3SV2H 2IPHA 4B71A 5EIYA 3TH3H 5GPIB 1O5CB 2BVSH 5DK1A 2ZDAH 3DFJA 3PRDA 1ZHRA 3UNRA 4KP0A 3VB4A 2J34A 3SHCH 1GHBG 1KY9A 2O8MA 3ZZ4A 1IOEA 1CVWH 1HJAB 1FAKH 3PV2A 1MU6B 1L1NA 1HB0B 3QDZB 1OOKB 4IBLH 4B1TA 1ZJDA 9ESTA 2GDEH 3H7OA 1GHXH 4ABFA 2WPHS 1SR5C 3PTNA 4UEHH 2F4LA 7LPRA 2O8LA 1GJBB 3SGAE 1N8OC 1IQGA 3T29A 1UK2A 1BIOA 4WWYA 1P2IA 1GI0A 2QXGA 1ESAA 1DANH 4OS2A 1UCYH 1CE5A 3T62A 2P8OC 1FN6A 3RXVA 2HGTH 3F2HA 2AS9A 3BIVH 3RXMA 3DFLA 3A89A 2HNTC 1D3PB 1K1LA 2EEKA 2ZA5A 3A86A 4YT7H 5C20A 1SL3A 1YCPM 1UTMA 5DPAA 3BG4B 1CQQA 9LPRA 2IJOB 4A1TA 4H42U 1FDPA 2PR3A 4XBDA 2Q6FA 4AFQA 3GCNA 4Y8XA 1PQ8A 2ZFRH 1ZHPA 1ZGIA 5C3NA 3S9CA 1KDQB 3FVFB 4RI0A 2C93B 1TPPA 1SSXA 2ZDNA 2FOAA 2VWOA 1DX5M 1GCTB 2V0BA 1EZUC 1PPEE 2W6ID 1BBRK 1VJAU 2DUCA 2A0QB 3EA7A 2KAIB 3UFAA 1O2LA 3LIWA 2B5TB 3E8LA 1HAIH 1VKYA 1J8AA 2OC8A 4NG9H 4UFFH 1TNHA 5CMXH 2Z9JA 1CGHA 1Z71A 4CRCA 1EPTB 5J4SA 1W14U 2NU0E 3TNTA 7GCHF 3B23B 1KXAA 3MH5A 1TGBA 2CV3A 1SGPE 1EB2A 1C9TA 1JRTA 1PQ7A 5HIYA 4B74A 1QBNA 4IN1A 1MTUA 5T3HA 1AUTC 3PMBB 1KDQA 2GGVB 2GZ9A 3WWFA 4K5ZA 1FPHH 1S83A 1WOFA 1GI9B 3LGVA 4YOIA 4CRBA 4GLYA 3F68H 1LPZB 3SUFA 2UUJB 4LZ4B 1AY6H 1YPEH 1AHTH 2M5TA 3KN2A 1XVMA 2KAIA 1CU1A 1PPGE 5KGOA 4MNVA 1IQIA 3SNDA 1G2MA 1P3CA 1C2IA 2GCHF 2GV6A 3LOXA 1ELFA 2EI6A 2PFEA 1DWCH 4WJG2 4JCNA 1O2HA 1HAZB 5SGAE 4BAQB 3Q3KA 1AKSB 5EOKA 3GY5A 3PROA 1VZQH 2FM2A 2TPIZ 5EJ1A 1F92A 4NWKA 2OD3B 1V2NT 3CS7A 1AD8H 2KCAA 5HIZA 1SGCA 3VGCC 1SGYE 1BRBE 4CHAB 1PYTD 4XRNA 4AG1A 5CE1A 3SNEA 1AWHB 1W2KH 4DURA 1E37B 2BD2A 2PGBB 3E16B 1DXPA 1MBMA 1J16A 2VIWA 2SNWA 1QBOA 3GCHB 1CT2E 1P10A 3TJOA 4K1EA 1BHXB 2EI7A 3LGTA 5A0CA 1NFWA 1TYNA 4ZKNU 2BD7A 1YBWA 1V2VT 1GJ9B 3GY2A 1OWIA 1UK3A 1CHGA 5EXNA 1C5UA 2ZTYA 3SQHE 2XBVA 2H9EH 2QC2A 5LPEA 4VGCB 4GPGA 4WXVA 4CH8B 3SHAH 1DFPA 3SV7A 1S81A 1AKSA 1OWJA 3S69A 2GMTC 4B2AA 5HM2A 1FPCH 1QB9A 1XKBC 2XW9A 4I86A 1KXFA 3RXOA 1TNJA 4WH8A 4FUGA 3F0PA 3E6PH 1FMGA 1ESTA 1C1QA 1K22H 2J4IA 3QUMP 4TT3D 1BTPA 1TNLA 1BITA 2F9PA 3LGUA 1NBME 1XX9A 4ABEA 1DITH 1TGNA 3D23A 2J9NA 5CDFE 2ZFFH 5C0UA 1FN8A 1T4VH 1TNGA 2QXIA 1D3QB 1RGQA 2W7UA 3SU5A 4LXBH 1K1OA 2G8TA 1AUJA 3ITIA 4UFDH 4YLQH 3SJKA 1U6QA 2BD8A 3S7KB 2FEQH 4D9QA 2VH0A 1XUFA 3MO6A 1AWFH 4ESTE 1C2GA 3P8OA 1ZRBA 3PLBA 2XCFA 4DG4A 1GMCF 2ZHQH 1TOCB 1HAYB 1GBTA 3LONA 2BDAA 2A4GA 1MBQA 3URCA 3HGNA 2BQ6B 4JZDH 4M9FA 5C5NA 4XDEA 1LHEH 1TONA 3SJOA 1GG6B 1C1TA 1FY8E 1GI2A 1O2JA 1W3CA 2UWLA 4JK6A 4O9VA 1FONA 3SBKA 3U98H 1T8NA 2NU1E 1MTSA 3LKWA 1EP6A 1G2LA 2H6MA 2TBSA 3F9HA 1CA0C 1JIMA 3A84A 3VXFH 4IMZA 1YPHE 4YTAA 4X8UH 4ZMAH 3P8FA 3RM2H 1S0QA 4TPIZ 1C1OA 1FY5A 4XBBA 1DWBH 2J98A 2GVFA 1EJNA 3RXGA 3ZZAA 1CA8B 4X6OA 2VBCA 2XBYA 2PV9B 4NZLA 3QLPH 1TMUH 3DCLA 3SQEE 2Z3DA 4FVBA 5G4BA 4X8TH 3UTUH 3VB3A 2OINA 1BTWA 3RMNH 1EX3A 2Q6DA 1N1LA 4OGXA 2BZ6H 1QHRB 2ALVA 3EA9A 1ZPBA 4FUFA 3A7XA 1ELAA 1AB9C 3HK6B 4WY3A 1C2DA 4E05H 2FOHA 2QY0B 1ZTKA 1GBDA 2ODQA 4E7NA 2R9PA 4JZ1A 3LH1A 1NRPH 2WV4A 3MH4A 1S6FA 3VXEH 3STJA 1D3DB 5JBCS 2H9TH 2FI4E 3E90B 1KIGH 3BTHE 3RLWH 3SJ9A 3HPTB 7KMEH 5JB8S 2PTCE 4JK5A 2GCTB 7ESTE 5JB9S 1H8DH 1YPKH 2QA9E 1M9UA 2GTBA 2EC9H 5H4IB 3SI3H 2A4RA 5F8ZA 1GBFA 4CRAA 3FKSD 2O8UA 1V2LT 2FI5E 3W95A 3URDA 1PPZA 1OSSA 2FS8A 3MU4A 5DG6A 4F48B 3RXHA 5DP3A 1F5RA 1FX0B 1O32A 3ZZ6A 1QL9A 2H9HA 1QIXB 2ZGXH 1WU1A 1QA0A 3A7ZA 3A7TA 3BF6H 3RDZA 4INKA 2WPJS 5E0GA 1GJ5H 4KELA 1G3CA 3RM0H 1P01A 1V2QT 2NU4E 4JZIA 3SZEA 1A5GH 2OBOA 4ZH8A 4Q80A 3PB1E 3T2NA 4HGCA 3KQDA 5DP8A 1X7AC 3LH3A 1GMDF 4YOJA 3BTKE 1ANBA 4IMQA 4UE7H 1N8OB 1CBWB 5EGMA 2R2MB 2ZDLA 4Y76A 3RMMH 1AMHA 1TIOA 3UB0A 4X1RU 4DJZB 4IW4E 3U69H 1AVGH 1XKAC 2P8OB 5L6NH 1ETRH 3U8RH 2HVXA 2ZU2A 2BDGA 1PFXC 2BX3A 2OCVB 1DWEH 2WHXA 1IHSH 3VFEA 2PSXA 4MLFB 2WUCA 1UTQA 3FO8D 1ARCA 4XBCA 2FIRH 3FANA 2P95A 3TU7H 3DSOA 4CBOA 1TABE 2AMDA 1V2JT 2AHME 2ODYB 1KYNA 4UD9H 1NPMA 3RLYH 3RU4T 5T1VA 3M3TA 1EJMA 1PJPA 3U8OH 1ACBE 2Q1JA 1K1MA 1ZLRA 1J17T 1P09A 1MAYA 3RXJA 2BY5X 4BOHA 1C5XB 2Z7FE 1NO9H 1RTLA 1GHAF 1YPHC 5C1YA 1DDJA 1OHHD 4XD7D 4R8TB 1Q2WA 3GCTF 3M5OA 1O3CA 3FZZA 1EQ9A 2GP9B 1K1NA 4JZEH 2PLXA 1FJSA 3Q00A 1C5SA 1C5WB 1CO7E 1FY1A 4BAHB 4OS5A 1WBGB 1P2OA 2EI8A 5JBTA 2FXRA 1QL8A 2FPZA 2J95A 2BVXH 2Z3CA 1YKTA 1QGFA 2R2WU 2Y5FA 1LCYA 3MNSA 3ZZDA 5CHBA 5C17A 1TPSA 1ZTJA 1GMHG 5JDUB 4DT7B 1G37A 1OWHA 1H9IE 2JH5D 2P93A 3ZZ7A 3SV9A 1FIWA 3A81A 3OAAD 3DT0H 4A5TS 3UAIC 1ZGVA 2WPMS 1OWDA 1P2MA 2B7DH 1VITH 2FDAA 1T8OA 3TH4H 2BB4A 5HGGA 3P8NA 5ESBA 1Y3VA 5GCHG 2ZHEH 3BV9B 4I8HA 3ZZBA 5EPYA 1SGNE 4I33A 1CSOE 2Q6GA 1ZMNA 3MI4A 1T8MA 1VCQA 4MTBA 4R0IA 4I8KA 3SUEA 3CENA 1QB1A 3BTGE 2JH6D 2QE7D 3VGCB 3T5FH 4ABGA 4AG2A 3UWJH 4TWWA 1MKXH 2WINI 3A8DA 4DIHH 3QZRA 1BJUA 2L74A 5T6DA 3SJIA 1QQ4A 2PHBA 3LPRA 1RIWB 2I6QA 2BDIA 1SQTA 1MKWH 2PSYA 5F8TA 3KQCA 3Q77A 3BN9A 1TE0A 1V2PT 1SKYE 2ASUB 1K0HA 2J38A 3MO9A 4AGKA 3B9FH 1XUGA 2ZU3A 8GCHG 2FOFA 4E7RG 1LTOA 2RDLA 2SGAA 2HWLB 2G81E 3IWMA 6GCHF 1C1RA 4RSPA 3ATKA 4P02A 2GMTB 1H1BA 2R0LA 1J9CH 1L1GA 1V2RT 3GOVB 3UNQA 2G4UA 4SGBE 3SNCA 3BTME 1DM4B 1GBHA 3LU9B 3LJOA 1D6RA 4I31A 1H8IH 4MNYA 1B0FA 3D65E 4AFSA 1SLXB 1KTSB 2ZGJA 2ANMH 1IQNA 3SUDA 4ZHLU 3AVZA 4NSVA 2AH4X 1O2TA 5F03A 4HTCH 1ZSJA 1P57B 3KQEA 1XUIA 1V2ST 2IJD1 1A61H 3RXEA 3FN8A 4FUCA 1RTFB 1O3BA 1WYKA 4D7FA 2XC4A 1AI8H 4AFZA 2TRMA 1AZZA 4I8JA 2UUFB 1EJAA 3JZ1B 4Z0KA 2R3YA 5FPSA 3PWBA 2XNDD 1ETTH 1TBQH 4ZCNA 4RN6A 2QAAA 3FZDA 1LKBA 2F83A 4A6LA 2FOEA 3MO3A 4WF8A 4YXWD 1DT2A 2Y7XA 3FOAA 4KTUA 1O2UA 1OYQA 3MU1A 4RKOB 3RXQA 1INCA 2OTVA 2OK5A 4NA9H 4NFFA 5E8EH 2BM2A 1GJ4H 1KTTB 2GX4A 2RDEA 4D9RA 3F9GA 1AB9B 3OFND 1EXFA 1THSH 2BD5A 3OYPA 5HXFA 1L2EA 1O2VA 2NU3E 5FX6A 4JMYA 1T8LA 1UW7A 2CF9H 2Z3EA 4NIWA 4ZKSU 2LELA 1NBMD 2BZAA 2FESH 4HZHA 1C2FA 3K2UA 1DVAH 2W3IA 3IITA 1GBAA 3QTOH 1WV7H 1LHCH 1UTKA 1S82A 1ZPZA 2R0KA 2PKAB 2A7HA 4ZHAA 1O2MA 1UVTH 2ALPA 1IQEA 3MMGA 1O39A 2Z6BD 1KSNA 1UTOA 1C5PA 3KQ5A 3E91A 1WUNH 2UUYA 1BMAA 3V7TA 4ZXXH 4U2WA 2QYIA 1O3PB 1GL0E 3S9AA 4X8SH 1W7XH 2BD3A 2XC0A 2C90B 4Y0ZE 1TA2A 1A5IA 2A2QH 3GYMA 3NCLA 5L2YH 4MPXA 1K21H 2ULLA 1MD8A 2FX6A 4K8YA 1TRNA 1O31A 2QV1A 1HGTH 3KYFA 2ZGCA 1XUJA 3E3TA 1EKBB 7GCHG 4B75A 1O0DH 4NIVA 5GJ4B 2OC1A 3DD2H 1UJ1A 1HBTH 1WAYB 1Y5UT 3ZZ3A 1C5OH 3A7WA 3ODFA 1FLEE 1SHYA 5E0JA 5ABWA 3WWBA 5FPYA 1O5AB 1C1PA 1C4V2 2BY8X 1HAVB 1Y8TA 1BTZA 2PKAA 3GY8A 1MQ6A 4UFGH 1ZR0A 1Z8IB 1NS3A 3MNXA 5T6FA 1YLNA 2B8OH 1O3GA 1NESE 1ORFA 3K9XB 4WMEA 1TMTH 3RXIA 1QR3E 1SFQB 4A1VA 1RJXB 2RA0A 2VU8E 1F7ZA 4X6MA 1QFKH 1DOJA 1SQOA 3NWUA 3GS9A 4ACAA 4NWLA 2QF3A 2RG3A 3Q3YA 4FUBA 1HAGE 2FYQA 3MTYA 4D7GA 1BRAA 2D2DA 1GCDA 4MG3A 3LC5A 3TNSA 2A32A 1EFRD 1HYLA 3KHVA 3O8DA 2ZFQH 3SW2B 1NRQH 2ZFTA 1HUTH 4Y79A 5A2MH 3I29A 2ANWA 3OEED 1AQ7A 5E2OA 2ZEBA 2OXSA 2A31A 1GL1A 1OS8A 3MNBA 5JBBS 1TFXA 4BXWA 2FX4A 2KX4A 2H1UA 4FU9A 1P9UA 5GNDA 1TBRH 2C3SA 2FOCA 4MPUA 5B6LA 2VVCA 3GDUA 1P03A 2V3OH 3VPKA 1G30B 4OS1A 1EPTA 2Y5GA 1SGRE 2KFWA 4TY6A 3TJVA 4BANB 2KCYA 1SGFA 1TALA 1TQ7B 2H2ZA 4TWYA 3GYLB 2QF0A 3MU8A 4FETA 3SOSA 3UQOA 1ZJKA 2F43B 3P17H 1YLCA 1F5KU 2A5AA 2G4TA 5ESTE 4Z6AH 2BY7X 1O33A 4A92A 1C2JA 1UCYE 5A0BA 4JYUH 2HVYB 1OP8A 3RXAA 3UIRA 3ZV9A 1O35A 4ZHMU 1HDTH 4LOYH 3D49H 2JKHA 3OY6U 2ZIQH 3KIDU 3VG8A 2OC7A 1GBCA 1O36A 1J15A 3RXFA 4CRGA 1D3TB 1AGJA 2ZCLP 2ZTZA 4O3TA 2YNBA 1K1JA 3SORA 1P2KA 4X2VA 2AIPA 1PPFE 2OP9A 1GMCG 3MH7A 5FAHA 1UVOA 2F3CE 4B6FA 1GBMA 1LQEA 1IQLA 1NN6A 3ELAH 2A4QA 1TRMA 5GWZA 5C2ZA 3PLKA 1ETSH 1O3EA 2BLWA 2ZHFH 3N99A 1HAXB 1YCPK 3KEEA 5LH8A 1ELEE 1EOLA 2F91A 4CBNA 1XVOA 2CK3D 3NZIA 1OP0A 5TCCA 5EPNA 3RMLH 4Q63A 1BDAA 1H8ED 1IAUA 3M5LA 3M5MA 1HAOH 2VB0A 3NK8A 4AB8A 3CP7A 1EAWA 1O2GH 3MU5A 1K9OE 1RXPA 3RU4D 1O2NA 4GCHF 4YT6H 2ZZUH 2D26C 2VWLA 3O8BA 1KMHB 2AEIH 5EW2H 2G55A 3S7HB 1FQ3A 2ZKSA 2W6JD 4O03A 5DKMA 1GJ6A 1GI7B 2OBQA 2ANYA 3EYDA 3SU2A 3ZVGA 1N6XA 3SNAA 1DUAA 3ZZ5A 1O5GH 2QGRA 1O5EH 4BTTB 3GY4A 2IN2A 4GSOA 2V3MA 3MQKC 2VJ1A 3GY7A 1P02A 1ZMJA 5HYOA 1ELBA 3A85A 1QJ7B 1NFYA 1QBVH 5I46H 2ZCKP 4ZROA 3GICB 2LP6A 1OPHB 4TYDA 1C5NH 4MQAA 4P00A 2SGFE 1QTFA 3TJNA 3WW7A 2JH0D 1O2ZA 1UK4A 1SHHB 4X1SU 4Q4LA 1E34B 2QN5T 1ZOMA 1GVZA 2AMPA 3FAOA 1BTHH 1CT0E 3UR9A 3NKKA 2P94A 2ZWLH 1T32A 3T28A 1RRKA 2K8IA 2GJGA 2O8WA 1A0JA 1BHXF 1QJ6B 3FFGA 1C5RA 3L3TA 1O2OA 4OS6A 3EA8A 3NXPA 1TQ0B 3RXKA 1GBLA 3VB7A 2F9NA 2XBXA 1DXWA 1SG8B 2WYJA 5JYIA 5BRRE 4K69A 4ABAA 3W1EA 4X6NA 2Y5HA 5FPTA 2BHGA 1BTUA 1KXCA 2GZ8A 3TPIZ 1HLTH 2XXLA 3MU0A 1P06A 1GMDG 1CGJE 3U1JB 1O2PA 1SC8U 3P6ZB 2AERH 3RXCA 1ANDA 6LPRA 1NRNH 1OYTH 3PMAB 3F3BA 2ANKH 2QXJA 2J2UA 5DN6D 1ELTA 2BVRH 1GBEA 2CN0H 3EAJA 4AFUA 4O3UA 2QXHA 1TNKA 3SUGA 4MNXA 1H4WA 1Y3WA 1QY6A 1GBBA 4ABBA 1XUKA 3PLPA 1EZXC 5CHAC 3RC6A 2AGIX 1V2WT 3GY6A 4OS4A 2BX4A 1EATA 3F0OA 2A7CA 4Q7ZA 1SB1H 1CHOF 5EODA 3A8CA 4AB9A 2D1JA 4IC6A 2Y6TA 4CREA 1C1MA 2Y80A 1IQKA 1P12E 2OUAA 5B6OA 3UOPA 2AGGX 2HOBA 2XNIA 3DUXH 4UFEH 1ZHMA 1ZSKA 4X1PU 1YWUA 3U8TH 1DUEA 4ABDA 2WV9A 3E0NB 1C1UH 3ESTA 1SLWB 2JETC 1ZRKA 2OQUA 2JIZD 1BBRH 1GHAG 1GJ7B 4WXIA 5EQQA 3UUZA 3V12A 4AX9H 2W7SA 2YOLA 3GCTG 3OE7D 1UCYK 2THFB 3BTTE 2BOKA 3P95A 3LJJA 5FHTA 4K8BA 3ZZ8A 1S6LA 2B9LA 3PRBA 1AFQC 3GDSA 2EA3A 1LHFH 2OC0A 4LZ1H 4X1QU 1E1RD 1BJVA 3QTVH 2BLVA 1D6WA 1K28D 2FOBA 2ZO3H 4I8LA 4K1SA 2WUBA 2F9OA 4X2WA 4I32A 1P2JA 1HFDA 3F2GA 2A7JA 1A3EH 2P59A 4NIYA 4U01A 4Y11E 2NWNA 2QF4A 3I77A 3BTDE 3GISB 2ZG0H 3HATH 5FBIA 4B76A 4Z1MD 3OSYA 1BMLA 1TPAE 4UDWH 4GVUA 1NY22 1L4DA 1TOMH 2WPIS 1QZ8A 5GDSH 2ZU1A 3O8CA 1V2UT 2D8WA 3QGNB 1O5FH 1VR1H 3SN8A 5A8ZA 5HMAA 1PPCE 2G5VA 1F0RA 2PWXA 1AN1E 1TGTA 5KECA 4KTCA 1FXYA 1HNEE 3DA9B 3HKJB 3SZNA 4FXGH 5DO4H 2SFAA 3RC5A 4HI3A 2J92A 2RA3A 1OWEA 6CHAC 1GHYH 2WYGA 3ZV8A 1V2MT 4JYVH 2Y81A 3L33A 1AFEH 2Z9LA 1Y5BT 1A4WH 2WPKS 2W26A 3Q76A 1GI8B 1O3DA 4X8VH 2OQ5A 4FOUC 3K6YA 3MHWU 1GJCB 3U9AH 3ZVAA 1T4UH 1K2I1 3ZVFA 2VIDA 1MCTA 2ILNA 1ELDE 2ZFPH 3PV4A 1O2RA 1YM0A 1LMWB 2ODPA 3SU0A 4O97A 2CHAC 2F9VA 1SFIA 5JPMH 3TGJE 1P2NA 1O3OA 6GCHG 8KME2 5EQSA 2ESTE 5AHGH 1OKXA 4F49A 3UNSA 3F9FA 4UONA 1THPB 2HNTF 1O3LA 1YPLH 3JZ2B 3SYJA 3PM3A 1O3KA 1UVUH 2BQWB 1ELCA 4MNWA 3UREA 1PQ5A 4WMFA 4NSYA 2CMYA 4SGAE 1HJ9A 2VH6A 2XCNA 4TPYA 1GI3A 1LVMA 1XXFA 4X6PA 2BXTH 3UR6A 1IQJA 1GVKB 1GVLA 3CNRA 4NZQA 3AAVA 4H6TA 3M3SA 2RCEA 2ZCHP 2GV7A 3A7VA 1K1IA 1H9LB 3PYHA 1NC6A 2FOMB 2BDHA 1Y3YA 1SLUB 2YNAA 3NUMA 2A45B 3UQVA 2CJIA 2HLDD 4ZKOU 3A82A 1C2EA 1HCGA 4H6SB 1SPJA 1F0SA 2XWAA 2ZF0H 1UHBB 5DJ7A 1L1JA 3OTPA 1AVWA 3T25A 1BT7A 2HNTE 1BMMH 5K7RA 1H9HE 2EY4C 2KCOA 5GCHF 1JWTA 1IQMA 2VIOA 2VVUA 1WQVH 2P16A 3SI4H 3LT3A 4ISLA 1A46H 2V6NA 1JXPA 3EE0B 1HAPH 2YMSC 2STBE 3OX7U 4WVPE 2BDYA 1VITF 1C4U2 2R3UA 3V13A 3DSPA 1ABIH 1KXEA 1GG6C 2C8WB 4FVDA 3NRLA 4AOQA 2BDBA 1SOTA 3A88A 1F0TA 1BCUH 2ZU5A 3QGJA 2PW8H 1HIAB 4ISOA 1UTJA 1UHBA 3SGQE 3TVJB 4DCDA 4GAWA 4NCYA 3TH2H 5KEDA 3SU4A 3QX5H 5LPRA 1E1QD 3F2FA 5TCAA 3Q3XA 4RT1A 3LGIA 1MTVA 2ZDKA 1YP9A 2K1QA 1TNIA 1CA0B 2AFQB 4A1XA 1KXBA 2ZPSA 3RP2A 1S85A 1G9IE 4K60A 1FIZA 1GBKA 3H7TA 1CT4E 4J1YA 3M37A 1W12U 2OLGA 3FP6E 3BTQE 1S6HA 2UWPA 1MH0A 2VNTA 4NGAH 1TBZH 1FNIA 2FP7B 3ENSB 1W7GH 2GD4B 1B7XB 2Z9GA 3EGKH 1HIAA 2FMJA 1W0YH 4ABIA 1C2LA 1ABJH 1P2QA 2XOKD 1WTHD 2BXUH 1YC0A 1PPHE 1AZ8A 1YLDA 3RXRA 3HKIB 1V2OT 1FAXA 1FZZA 3QK1A 3STIA 1LVYA 5K0HA 1BRCE 1CGIE 2CF8H 2WSSD 4DGJA 1LPKB 4M7GA 2IPQX 5C1UA 3TJUA 3LDXH 1JRSA 3ATMA 6ESTA 2Z9IA 5A8XA 2VIVA 5AFYH 5I25A 2SNVA 2FLBH 1KLIH 4DVAU 1LO6A 1NU7B 1WDIA 2UUKB 1V3XA 3A80A 2VINA 3LGYA 1CBWC 5CHAB 4BAOB 1A0HB 2BLQA 1THRH 1P05A 2XBWA 1C1NA 3RXTA 2TGPZ 2GT7A 1W10U 3D62A 1PQAA 3A8BA 2PKSC 1Z8RA 3P8GA 1G3EA 1IQFA 1GI5A 1MUEB 1P8VC 3C27B 1QRZA 1GDUA 1E35B 1Z7KA 1C2KA 1GHBF 5DP4A 2SGDE 2ZHWH 5F53A 4CH2B 4U30A 1UO6A 3VB6A 1BA8B 4FUHA 1QB6A 3EE7A 5E0HA 1O37A 2JETB 1A1RA 2K0QA 2WPDD 3TGIE 1E36B 1YGCH 2FI3E 1O2WA 2GCHG 1S0RA 2TGDA 2ZPQA 4MPWA 2W3KA 3L6PA 1Z1IA 1NROH 2ZPRA 1AFQB 1O2SA 2CGAA 2C8YB 1VGCC 1GJDB 1Y3XA 3KNXA 5IYTA 1C2HA 1RFNA 1ZZZA 5EXMA 1V2KT 3H09A 3OU0A 3QZQA 4INLA 4ABJA 3MH6A 4B2CA 1HAVA 1C2MA 5C67A 1C5QA 4FUDA 1C1VH 1KLJH 1COWD 3S9BA 2STAE 3PTBA 1O3NA 3B8JA 1DICA 3TK6A 3KGPA 3N7DA 1L0ZA 1YYY1 2VGCC 2DE9A 1E0FD 1NM6A 1H8HD 1MABB 1TMBH 2Y7ZA 3MFJA 1NFXA 5DSFA 3P92A 2V3HH 4NA7A 1P9SA 4E06H 1WTGH 5FX5A 1EB1H 4Y7BA 2VWNA 1EASA 4BAKB 1KLTA 2ZDVH 4Y10E 3ZVBA 3EDXB 1YPJH 2H5DA 4TSFD 2Y82A 3N7EA 4ABHA 4H4FA 3M61U 5IK2D 1GWAA 1HRTH 5A09A 3U1IB 1SGIB 2NU2E 4CRFA 1MD7A 1TGCA 1TX7A 6CHAB 4JZFH 1C5YB 3A87A 1YF4A 3BTEE 5DGJA 4BNRA 4X2XA 2FO9A 2JJ2D 2XTTB 3MNCA 2H5CA 2VIPA 1BTXA 1DLKB 2J5UA 3BG8A 1O34A 4KTSA 1A7SA 1SGFG 1BTYA 1C5VA 1NFUA 4ZAEA 1GHWH 5EQRA 3KF2A 1GPZA 4X0WU 5EXLA 1OWKA 5GIBA 2ZTXA 1KXDA 2XRCA 2A2XH 1UVPA 1SBWA 1G32B 3AW0A 5A0AE 2AMQA 4GCHG 1BB0B 3AASA 4FU7A 2CHAB 1DE7H 2YMSD 1NRSH 4YM9A 1RIWC 3E0PB 2BY9X 1F2SE 1F0UA 1TAWA 4IN2A 1XXDA 3ATLA 3UY9A 3DSGA 4A7IB 3OTJE 2O8TA 2AYWA 1GHZA 4AZ2B 2HPQH 2ZI2H 3BEUA 4Q7YA 5FL7D 1MKXK 3AAUA 1QRXA 1BQYA 1MZDA 1G36A 1GBJA 1SQAA 2ZGBH 1W0ZU 2AIQA 4AC9A 2BD4A 1QURH 4JYTA 4XSKU 4NIXA 4Y8ZA 3FP7E 5EU8A 3MOCA 1JBUH 1MKWK 4HFPB 5TJXA 2HPPH 1C5TA 4XE4A 3M7QA 1Z6EA 4ZXYH 4OM9A 1W11U 4GUXA 2G52A 2GDDA 3FP8E 2J98B 1GI6A 3TLOA 1AE8H 4BTUB 3QO6A 5DP5A 1AIXH 8ESTE 1XUHA 1W8BH 4ZUHA 5EW1H 3O8RA 1EAXA 3AW1A 4D76A 4PROA 3ODDA 1A2CH 2B0FA 3QWCH 4CRDA 2YMSB 4KGAA 4YO9A 3TK9A 4NFEA 3SGBE 3ZZ9A 1UTLM 1UTPA 3RXLA 1RTKA 1Z6JH 4RKJB 2RFKC 1WSSH 5FCRA 3BTFE 1GGDC 1IHTH 1AU8A 1VCPA 3EQ0H 4K1TA 1EZSC 1HAHH 2ZHDA 3IG6B 1P11E 5FXLA 1EAIA 1SGEE 3C1KA 2BD9A 3UOUA 2ZQ1A 5HM9A 3ATIA 2IOTA 1QRWA 4IC5A 1MTNC 1O2QA 1W0JD 3SU3A 1IQHA 4Y8YA 1SMFE 4U32A 3BEFB 2V7QD 4ASHA 4MPVA 1C5MD 1LDTT 1MAXA 1Y59T 5DP7A 2PUQH 3PO1C 1T31A 1AVXA 3I78A 2WZQA 3HK3B 1WCZA 1MU8B 1QL7A 2ZFSA 4TY7A 1E38B 1CHOG 1ZMLA 1GBIA 1J14A 4K3JA 1O3FA 3U28C 2GZ7A 3OY5U 2HRVA 4FUEA 5EJLA 1DLEA 2BQ7B 1DSUA 1NRRH 1G3BA 1GI1A 2P3TB 1ARBA 2EQNA 5C1XA 1E79D 1HJAC 1NU9A 4OGYA 1O3AA 3G01A 5E2PA 1O2XA 1LPGB 1MQ5A 3ZZCA 1O38A 2XYAA 2QIQA 3R0FA 4YZUA 2VVVA 3QN7A 2FZZA 5T6GA 3KL6A 1LHGH 1ZPCA 3K6ZA 3SJ8A 3BIUH 1SVPA 1DY8A 1YPMH 1YY3A 2F9BH 2G51A 2AGEX 3ATWA 4CR5A 3LC3A 8LPRA 3GCOA 1O5BB 3RXDA 3RC4A 1EUFA 1C5ZB 2FLRH 5JBAS 1O2KA 5GXPA 2O9QA 4GHQA 1DPOA 1DY9A 2ZDMA 1O3JA 1ID5H 3E1XB 4DIIH 1P0SH 5F6MA 4BXSA 4BTIB 2BYAX 4IGDA 3S0NA 3UPEA 4NA8A 2BY6X 3BG4C 2GKVE 2HLCA 1C4Y2 2GT8A 1FV9A 1N6YA 2L6OA 3RUOA 1YPGH 1B0EA 1F5LA 3PV5A 1ZTLA 1TX6A 4DW2U 2VIQA 3NPSA 2LPRA 1MMJN 3A83A 1LVOA 2FS9A 4MVNA 2KZ4A 1V2TT 2PUXB 1GJ8B 1GCTC 1FY4A 3ZYEA 2SGPE 4B2BA 4I8GA 3M36A 3V0XA 5AF9H 5ETXA 1B5GH 2M2AA 4Q7XA 2PKSB 1O5DH 2VWMA 3PMHB 5C94A 2ZU4A 1OX1A 1ANCA 1XMNB 1O3MA 4AGJA 4Y6DA 1HV7A 2JJ1D 1ANEA 2TGAA 4ISIH 1P04A 3GDVA 1EPTC 1S84A 2FODA 2WV5A 3GY3A 2SGEE 2XWBI 1Q3XA 5C5OA 4AORA 3RXBA 4B73A 3A8AA 3DHKH 1G3DA 3UWIA 3K65B 1EOJA 2PP6A 1DS2E 1W0KD 4QT8C 2A5IA 1FY3A 4DOQA 1TGSZ 3ZVDA 3KQBA 2LNCA 1VGCB 1NT1A 1TX8A 1DWDH 1V6DA 5EG4A 2SGQE 2ZGHA 4FUJA 3TGKE 2KM0A 2CXVA 4ISNA 2QF5A 4BAMB 2ZC9H 3RU4E 1HJ8A 5AFZH 1TPOA 2TGTA 2KR7A 4YESB 3CS0A 2V35A 1NZQH 1T7CA 1TLDA 3KCGH 1C9PA 4Q2KA 3ZVCA 2FWWA 1AO5A 1FUJA 1O3HA 1ELVA 3T26A 5L30H 5J4QA 2VGCB 2G5NA 1RD3B 1Y5AT 4CHAC 1JIRA 2P3UB 3SU1A 1D9IA 2FTMA 2BTCE 1LQDB 1LVBA 4CR9A 4Y7AA 4XOJA 2ZECA 2BLOA 1Y3UA 4D8NA 3GCHC 2XC5A 3PMJA 4XFQA 4MDSA 1RS0A 2PGQB 4GHTA 2C4FH 2TIOA 3BSQA 3M7TA 1Q31A 2W5EA 1C1WH 1BMNH 4VGCC 1L4ZA 2JDID 2PTNA 1QQUA 2KCPA 4K2YA 1YCPH 1LKAA 5PTPA 3F1SB 1MCVA 1BZXE 3M35A 4IS5A 4RT0A 3F9EA 3SV6A 3RXUA 1BBRE 3P70B 3VEQB 1VITG 3SV8A 3N7OA 1TRYA 4FUIA 1Z8JB 1HXFH 3BTWE 1SLVB 3R3GB
chains in the Genus database with same CATH topology
4X1NU 1K1PA 2BMGB 1A0LA 1GMHF 1EP5A 3RXPA 1ZYOA 5LGOA 4YLUA 3SNBA 1TA6A 1SOZA 3TIUA 1HPGA 1O3IA 1QNJA 1GI4A 1A3BH 1SI5H 1LHDH 4FU8A 1W13U 3H5CB 2A5KA 4YOGA 2C8ZB 4J2YB 1PPBH 1GDQA 1PYTC 4INHA 1ESBA 1O2IA 5A8YA 2I6SA 2UWOA 2QCYA 1JMOH 4WMDA 3MWIU 3SO3A 1P3EA 2Z9KA 3BEIB 1XM1A 5BPEA 4KKDA 1C5LH 2J94A 1O2YA 3RXSA 5AVDA 1QCPA 2F9UA 1SGDE 4THNH 3T27A 1Z1JA 5FBEA 4F4OC 1GDNA 1C1SA 1OP2A 3ZYDA 2HALA 1A5HA 3W94A 1ELGA 1BRUP 3F6UH 1O30A 1HXEH 3PWCA 5IDKA 1MTWA 2ZQ2A 1DSTA 5LPFA 4ISHH 3RMOH 2BOHB 4AN7A 5DP6A 4I7YH 4AYVB 1GJAB 4X2YA 4LK4A 4AYYB 8GCHF 1GHVH 1D4PB 1SGQE 1VJ9U 1BOQA 1Z8GA 2G00A 1WQSA 1QA7A 1S5SA 3TK5A 1EAUA 4ZKRU 1BUIA 3M3VA 2FTLE 4Y71A 1UTNA 2BDCA 2WPLS 2FOGA 1OXGA 3LGWA 1MZAA 1NTPA 5FCKA 1AE5A 1JOUB 3VB5A 4DY7B 1TWXB 4Y0YE 1GGDB 1QJ1B 3ZVEA 1TB6H 2ZNKH 5F8XA 2DE8A 3WY8A 2A1DB 1VCWA 1ZSLA 1EZQA 1UVSH 4WH6A 3TITA 3A7YA 2GCTC 1MTNB 2FYRA 3MYWA 2Z94A 3HGPA 3V3MA 3M7UA 1SGTA 3SU6A 2ZP0H 2A4OA 2P3FH 1FI8A 4OS7A 2C8XB 3PO1B 1UMAH 3M5NA 5L2ZH 5DP9A 3SV2H 2IPHA 4B71A 3TH3H 5GPIB 1O5CB 2BVSH 5DK1A 2ZDAH 3DFJA 1ZHRA 3UNRA 4KP0A 3VB4A 2J34A 3SHCH 1GHBG 1KY9A 2O8MA 3ZZ4A 1IOEA 1CVWH 1HJAB 1FAKH 1MU6B 1L1NA 1HB0B 3QDZB 1OOKB 4IBLH 4B1TA 1ZJDA 9ESTA 2GDEH 3H7OA 1GHXH 4ABFA 2WPHS 1SR5C 3PTNA 4UEHH 7LPRA 2O8LA 1GJBB 3SGAE 1N8OC 1IQGA 3T29A 1UK2A 1BIOA 4WWYA 1P2IA 1GI0A 2QXGA 1ESAA 1DANH 4OS2A 1UCYH 1CE5A 3T62A 2P8OC 1FN6A 3RXVA 2HGTH 2AS9A 3BIVH 3RXMA 3DFLA 3A89A 2HNTC 1D3PB 1K1LA 2EEKA 2ZA5A 3A86A 4YT7H 5C20A 1SL3A 1YCPM 1UTMA 5DPAA 3BG4B 1CQQA 9LPRA 2IJOB 4A1TA 4H42U 1FDPA 2PR3A 4XBDA 2Q6FA 4AFQA 3GCNA 4Y8XA 1PQ8A 2ZFRH 1ZHPA 1ZGIA 5C3NA 3S9CA 1KDQB 3FVFB 2C93B 1TPPA 1SSXA 2ZDNA 2FOAA 2VWOA 1DX5M 1GCTB 2V0BA 1EZUC 1PPEE 1BBRK 1VJAU 2DUCA 2A0QB 3EA7A 2KAIB 3UFAA 1O2LA 3LIWA 2B5TB 3E8LA 1HAIH 1J8AA 2OC8A 4NG9H 4UFFH 1TNHA 5CMXH 2Z9JA 1CGHA 1Z71A 4CRCA 1EPTB 5J4SA 1W14U 2NU0E 3TNTA 7GCHF 3B23B 1KXAA 3MH5A 1TGBA 2CV3A 1SGPE 1EB2A 1C9TA 1JRTA 1PQ7A 4B74A 1QBNA 4IN1A 1MTUA 5T3HA 1AUTC 3PMBB 1KDQA 2GGVB 2GZ9A 4K5ZA 1FPHH 1S83A 1WOFA 1GI9B 3LGVA 4YOIA 4CRBA 4GLYA 3F68H 1LPZB 3SUFA 2UUJB 4LZ4B 1AY6H 1YPEH 1AHTH 2M5TA 3KN2A 1XVMA 2KAIA 1CU1A 1PPGE 3SNDA 4MNVA 1IQIA 1G2MA 1P3CA 1C2IA 2GCHF 2GV6A 3LOXA 1ELFA 2EI6A 2PFEA 1DWCH 4WJG2 4JCNA 1O2HA 1HAZB 5SGAE 4BAQB 3Q3KA 1AKSB 5EOKA 3GY5A 3PROA 1VZQH 2FM2A 2TPIZ 1F92A 4NWKA 2OD3B 1V2NT 3CS7A 1AD8H 1SGCA 3VGCC 1SGYE 1BRBE 4CHAB 1PYTD 4AG1A 5CE1A 3SNEA 1AWHB 1W2KH 4DURA 1E37B 2BD2A 2PGBB 3E16B 1DXPA 1MBMA 1J16A 2VIWA 2SNWA 1QBOA 3GCHB 1CT2E 1P10A 3TJOA 4K1EA 1BHXB 2EI7A 3LGTA 5A0CA 1NFWA 1TYNA 4ZKNU 2BD7A 1YBWA 1V2VT 1GJ9B 3GY2A 1OWIA 1UK3A 1CHGA 5EXNA 1C5UA 2ZTYA 3SQHE 2XBVA 2H9EH 2QC2A 5LPEA 4VGCB 4GPGA 4WXVA 4CH8B 3SHAH 1DFPA 3SV7A 1S81A 1AKSA 1OWJA 3S69A 2GMTC 4B2AA 5HM2A 1FPCH 1QB9A 1XKBC 2XW9A 1KXFA 3RXOA 1TNJA 4WH8A 4FUGA 3E6PH 1FMGA 1ESTA 1C1QA 1K22H 2J4IA 3QUMP 1BTPA 1TNLA 1BITA 2F9PA 3LGUA 1XX9A 4ABEA 1DITH 1TGNA 3D23A 2J9NA 2ZFFH 1FN8A 1T4VH 1TNGA 2QXIA 1D3QB 1RGQA 2W7UA 3SU5A 4LXBH 1K1OA 2G8TA 1AUJA 3ITIA 4UFDH 4YLQH 3SJKA 1U6QA 2BD8A 3S7KB 2FEQH 4D9QA 2VH0A 1XUFA 3MO6A 1AWFH 4ESTE 1C2GA 3P8OA 1ZRBA 3PLBA 2XCFA 4DG4A 1GMCF 2ZHQH 1TOCB 1HAYB 1GBTA 3LONA 2BDAA 2A4GA 1MBQA 3URCA 3HGNA 2BQ6B 4JZDH 5C5NA 4XDEA 1LHEH 1TONA 3SJOA 1GG6B 1C1TA 1FY8E 1GI2A 1O2JA 1W3CA 2UWLA 4JK6A 4O9VA 1FONA 3SBKA 3U98H 1T8NA 2NU1E 1MTSA 3LKWA 1EP6A 1G2LA 2H6MA 2TBSA 3F9HA 1CA0C 1JIMA 3A84A 3VXFH 4IMZA 1YPHE 4YTAA 4X8UH 4ZMAH 3P8FA 3RM2H 1S0QA 4TPIZ 1C1OA 1FY5A 4XBBA 1DWBH 2GVFA 1EJNA 3RXGA 3ZZAA 1CA8B 4X6OA 2XBYA 2PV9B 4NZLA 3QLPH 1TMUH 3SQEE 2Z3DA 4FVBA 5G4BA 4X8TH 3UTUH 3VB3A 2OINA 1BTWA 3RMNH 1EX3A 2Q6DA 1N1LA 4OGXA 2BZ6H 1QHRB 2ALVA 3EA9A 1ZPBA 4FUFA 3A7XA 1ELAA 1AB9C 3HK6B 4WY3A 1C2DA 4E05H 2FOHA 2QY0B 1ZTKA 1GBDA 2ODQA 4E7NA 2R9PA 4JZ1A 3LH1A 1NRPH 2WV4A 3MH4A 1S6FA 3VXEH 3STJA 1D3DB 5JBCS 2H9TH 2FI4E 3E90B 1KIGH 3BTHE 3RLWH 3SJ9A 3HPTB 7KMEH 5JB8S 2PTCE 4JK5A 2GCTB 7ESTE 5JB9S 1H8DH 1YPKH 2QA9E 1M9UA 2GTBA 2EC9H 5H4IB 3SI3H 2A4RA 5F8ZA 1GBFA 4CRAA 2O8UA 1V2LT 2FI5E 3W95A 3URDA 1PPZA 1OSSA 2FS8A 3MU4A 5DG6A 3RXHA 5DP3A 1F5RA 1O32A 3ZZ6A 1QL9A 2H9HA 1QIXB 2ZGXH 1WU1A 1QA0A 3A7ZA 3A7TA 3BF6H 3RDZA 4INKA 2WPJS 5E0GA 1GJ5H 4KELA 1G3CA 3RM0H 1P01A 1V2QT 2NU4E 4JZIA 1A5GH 2OBOA 4ZH8A 4Q80A 3PB1E 3T2NA 4HGCA 3KQDA 5DP8A 1X7AC 3LH3A 1GMDF 4YOJA 3BTKE 1ANBA 4IMQA 4UE7H 1N8OB 1CBWB 5EGMA 2R2MB 2ZDLA 4Y76A 3RMMH 1AMHA 1TIOA 4DJZB 4X1RU 4IW4E 3U69H 1AVGH 1XKAC 2P8OB 5L6NH 1ETRH 3U8RH 2HVXA 2ZU2A 2BDGA 1PFXC 2BX3A 2OCVB 1DWEH 1IHSH 3VFEA 2PSXA 4MLFB 2WUCA 1UTQA 1ARCA 4XBCA 2FIRH 3FANA 2P95A 3TU7H 4CBOA 1TABE 2AMDA 1V2JT 2ODYB 1KYNA 4UD9H 1NPMA 3RLYH 3RU4T 3M3TA 1EJMA 1PJPA 3U8OH 1ACBE 2Q1JA 1K1MA 1ZLRA 1J17T 1P09A 1MAYA 3RXJA 2BY5X 4BOHA 1C5XB 2Z7FE 1NO9H 1RTLA 1GHAF 1YPHC 5C1YA 1DDJA 4R8TB 1Q2WA 3GCTF 3M5OA 1O3CA 3FZZA 1EQ9A 2GP9B 1K1NA 4JZEH 2PLXA 1FJSA 3Q00A 1C5SA 1C5WB 1CO7E 1FY1A 4BAHB 4OS5A 1WBGB 1P2OA 2EI8A 5JBTA 2FXRA 1QL8A 2FPZA 2J95A 2BVXH 2Z3CA 1YKTA 1QGFA 2R2WU 2Y5FA 1LCYA 3MNSA 3ZZDA 1TPSA 1ZTJA 1GMHG 5JDUB 4DT7B 1G37A 1OWHA 1H9IE 2JH5D 2P93A 3ZZ7A 3SV9A 1FIWA 3A81A 4A5TS 3DT0H 1ZGVA 2WPMS 1OWDA 1P2MA 2B7DH 1VITH 2FDAA 1T8OA 3TH4H 2BB4A 5HGGA 3P8NA 5ESBA 1Y3VA 5GCHG 2ZHEH 3BV9B 4I8HA 3ZZBA 5EPYA 1SGNE 4I33A 1CSOE 2Q6GA 1ZMNA 3MI4A 1T8MA 1VCQA 4MTBA 4R0IA 4I8KA 3SUEA 3CENA 1QB1A 3BTGE 2JH6D 3VGCB 3T5FH 4ABGA 4AG2A 3UWJH 4TWWA 1MKXH 2WINI 3A8DA 4DIHH 3QZRA 1BJUA 5T6DA 3SJIA 1QQ4A 2PHBA 3LPRA 1RIWB 2I6QA 2BDIA 1SQTA 1MKWH 2PSYA 5F8TA 3KQCA 3Q77A 3BN9A 1TE0A 1V2PT 2ASUB 2J38A 3MO9A 4AGKA 3B9FH 1XUGA 2ZU3A 8GCHG 2FOFA 4E7RG 1LTOA 2RDLA 2SGAA 2HWLB 2G81E 3IWMA 6GCHF 1C1RA 4RSPA 3ATKA 2GMTB 1H1BA 2R0LA 1J9CH 1L1GA 1V2RT 3GOVB 3UNQA 2G4UA 4SGBE 3SNCA 3BTME 1DM4B 1GBHA 3LU9B 3LJOA 1D6RA 4I31A 1H8IH 4MNYA 1B0FA 3D65E 4AFSA 1SLXB 1KTSB 2ZGJA 2ANMH 1IQNA 3SUDA 4ZHLU 3AVZA 4NSVA 2AH4X 1O2TA 5F03A 4HTCH 1ZSJA 1P57B 3KQEA 1XUIA 1V2ST 1A61H 3RXEA 4FUCA 1RTFB 1O3BA 1WYKA 4D7FA 2XC4A 1AI8H 4AFZA 2TRMA 1AZZA 4I8JA 2UUFB 1EJAA 3JZ1B 4Z0KA 2R3YA 5FPSA 3PWBA 1ETTH 1TBQH 4RN6A 2QAAA 3FZDA 1LKBA 2F83A 4A6LA 2FOEA 3MO3A 4WF8A 1DT2A 2Y7XA 4KTUA 1O2UA 1OYQA 3MU1A 4RKOB 3RXQA 1INCA 2OTVA 4NA9H 4NFFA 5E8EH 2BM2A 1GJ4H 1KTTB 2GX4A 4D9RA 3F9GA 1AB9B 1EXFA 1THSH 2BD5A 3OYPA 5HXFA 1L2EA 1O2VA 2NU3E 5FX6A 4JMYA 1T8LA 2Z3EA 2CF9H 4ZKSU 4NIWA 2BZAA 2FESH 4HZHA 1C2FA 3K2UA 1DVAH 2W3IA 3IITA 1GBAA 3QTOH 1WV7H 1LHCH 1UTKA 1S82A 1ZPZA 2R0KA 2PKAB 2A7HA 4ZHAA 1O2MA 1UVTH 2ALPA 1IQEA 3MMGA 1O39A 2Z6BD 1KSNA 1UTOA 1C5PA 3E91A 1WUNH 2UUYA 1BMAA 3V7TA 4ZXXH 4U2WA 2QYIA 1O3PB 1GL0E 3S9AA 4X8SH 1W7XH 2BD3A 2XC0A 2C90B 4Y0ZE 1TA2A 1A5IA 2A2QH 3GYMA 3NCLA 5L2YH 4MPXA 1K21H 2ULLA 1MD8A 2FX6A 4K8YA 1TRNA 1O31A 2QV1A 1HGTH 2ZGCA 1XUJA 3E3TA 1EKBB 7GCHG 4B75A 1O0DH 4NIVA 5GJ4B 2OC1A 3DD2H 1UJ1A 1HBTH 1WAYB 1Y5UT 3ZZ3A 1C5OH 3A7WA 3ODFA 1FLEE 1SHYA 5E0JA 5ABWA 5FPYA 1O5AB 1C1PA 1C4V2 2BY8X 1HAVB 1Y8TA 1BTZA 2PKAA 3GY8A 1MQ6A 4UFGH 1ZR0A 1Z8IB 1NS3A 3MNXA 5T6FA 2B8OH 1O3GA 1NESE 1ORFA 3K9XB 4WMEA 1TMTH 3RXIA 1QR3E 1SFQB 4A1VA 1RJXB 2RA0A 2VU8E 1F7ZA 4X6MA 1QFKH 1DOJA 1SQOA 3NWUA 4NWLA 2QF3A 2RG3A 3Q3YA 4FUBA 1HAGE 2FYQA 3MTYA 4D7GA 1BRAA 2D2DA 1GCDA 4MG3A 3LC5A 3TNSA 2A32A 1HYLA 3KHVA 3O8DA 2ZFQH 3SW2B 1NRQH 2ZFTA 1HUTH 4Y79A 5A2MH 3I29A 2ANWA 1AQ7A 5E2OA 2ZEBA 2OXSA 2A31A 1GL1A 1OS8A 3MNBA 5JBBS 1TFXA 4BXWA 2FX4A 2H1UA 4FU9A 1P9UA 1TBRH 2C3SA 2FOCA 4MPUA 2VVCA 3GDUA 1P03A 2V3OH 3VPKA 1G30B 4OS1A 1EPTA 2Y5GA 1SGRE 4TY6A 3TJVA 4BANB 1SGFA 1TALA 1TQ7B 2H2ZA 4TWYA 3GYLB 2QF0A 3MU8A 3SOSA 3UQOA 1ZJKA 3P17H 1YLCA 1F5KU 2A5AA 2G4TA 5ESTE 4Z6AH 2BY7X 1O33A 4A92A 1C2JA 1UCYE 5A0BA 4JYUH 1OP8A 3RXAA 3UIRA 3ZV9A 1O35A 4ZHMU 1HDTH 4LOYH 3D49H 2JKHA 3OY6U 2ZIQH 3KIDU 2OC7A 1GBCA 1O36A 1J15A 3RXFA 4CRGA 1D3TB 1AGJA 2ZCLP 2ZTZA 4O3TA 2YNBA 1K1JA 3SORA 1P2KA 4X2VA 2AIPA 1PPFE 2OP9A 1GMCG 3MH7A 5