4FU8A

Crystal structure of the urokinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu8A01
1J16A 2OLGA 5L2YH 1NFWA 2VWLA 2QF3A 4Y0ZE 1G2LA 1TPAE 3GY5A 2CXVA 1C1TA 3JZ1B 2HALA 5HXFA 1UTNA 2G8TA 1Z8RA 1DY8A 1K1JA 1JRTA 1TMBH 4TWYA 1GJ6A 1MTSA 1OWHA 2VIPA 4WY3A 4GLYA 3SJKA 1DWBH 3OY6U 1F0TA 3ZVDA 1CVWH 3U1IB 2QXJA 2XC5A 2AYWA 3IWMA 2Z94A 2FI4E 3MWIU 1ESTA 2QXGA 1O2KA 3RXHA 1QBNA 3NK8A 2ZNKH 5A2MH 3I77A 1IQKA 5GCHF 1AVWA 2GP9B 1VCQA 2VIOA 1ZSJA 3BG4C 1EZXC 3MTYA 1QGFA 1RFNA 1SHYA 3GDSA 4KELA 1ANCA 4UFFH 4AYVB 4AG1A 1NROH 2UWPA 1WQVH 3RC5A 3MNXA 1NRNH 4Q7XA 1BTXA 1YLDA 4X2WA 4GCHF 4UE7H 3SV8A 1UHBB 2P16A 2Y5FA 1G2MA 3G01A 4Q2KA 1GBTA 2O8UA 3Q3KA 1EPTA 1C2GA 1O3JA 2XYAA 3A7WA 2C93B 1C5RA 2VH6A 5FPSA 2W3IA 1PPGE 3PMJA 1GHWH 1XUFA 1GHBG 4DT7B 1CT0E 4YT7H 1QNJA 4SGAE 1WOFA 4J1YA 3F9GA 2OCVB 2FZZA 2ANMH 2H5DA 3PLBA 4M7GA 2PFEA 4BAMB 1DVAH 1ZPBA 2RDLA 2Z9JA 1MCTA 1ZYOA 1AB9B 3QTOH 2GD4B 1MTVA 1S0QA 3BIUH 4B75A 3SNBA 2BD7A 2D26C 1RTLA 3TJVA 4FVBA 4ABJA 1SGDE 1K28D 2FI3E 1KXEA 3SQHE 3TH4H 1NZQH 3MNBA 4A7IB 1FAXA 1SC8U 3KQCA 2R9PA 4Z6AH 1SGFA 3RM0H 2C3SA 2BDIA 3FANA 1BOQA 2KAIA 1O2JA 4NIXA 1YPMH 1ZJKA 4MVNA 3A7XA 3EYDA 1VZQH 3SUGA 2GCHG 1AKSB 1GDUA 1QJ6B 5EQSA 2PTNA 1O30A 1IQEA 3V0XA 1GJBB 2A31A 1YPGH 3M35A 3PLPA 1SR5C 5LH8A 2BY9X 1EXFA 3E6PH 1ZPCA 1NU9A 1BBRE 1VITF 4OS5A 2J34A 2YOLA 1N8OB 1GDNA 1GMCG 3SV6A 1C2FA 1FY1A 4JZFH 4MNXA 4MPWA 1GBAA 3URDA 1J8AA 2BDCA 1JXPA 1O37A 1YPHC 3ZVGA 1OXGA 1HIAA 2HNTF 1BBRK 4Y8ZA 4WVPE 1GJ7B 1V2RT 3URCA 5HM9A 3M3TA 2J38A 4THNH 1EOJA 2VVVA 3A7YA 1ZMLA 1FIWA 1EP6A 2ZDNA 1TRYA 3K65B 2D1JA 4B2AA 3ZV9A 1HYLA 3M5MA 1XXDA 2UWOA 1DSUA 1GDQA 1VGCB 4DG4A 2QY0B 4K3JA 3UY9A 3M7QA 3W94A 1ABJH 2WUCA 2P95A 4MQAA 2R2WU 3LKWA 2ZU5A 3SU1A 2F9UA 1SMFE 3RXEA 1CBWB 1UCYE 2V35A 3K6YA 4I31A 3VGCC 1MUEB 4IC5A 2WPJS 3TIUA 2SFAA 3SU0A 1V2OT 3RXRA 3JZ2B 1C1SA 3GYMA 1DWCH 2STAE 1LTOA 3QO6A 1IQMA 8ESTE 1HLTH 3OU0A 3O8RA 3ZZBA 1B0FA 1UCYK 2DUCA 2GV7A 1ETRH 3TK6A 4ZROA 1GVKB 4X1RU 4UFGH 1OP0A 1QB9A 4BTTB 1E34B 2WV4A 3PROA 2ZC9H 1TNHA 1DWDH 2RCEA 3MU4A 4NGAH 1TPOA 4K5ZA 2B7DH 4YT6H 4E7NA 1QCPA 1F5RA 5EPYA 1FXYA 2BQWB 2VIDA 1FDPA 1HAXB 1MTNC 3ZZCA 1DS2E 4OS2A 3VXEH 1TALA 2XWAA 3SU5A 3V13A 1EATA 1OWIA 1XUHA 1BIOA 4Y76A 3RDZA 3RC4A 1O2SA 4X2XA 2O8LA 1WV7H 2PKSC 2PV9B 1YPKH 4AGJA 5FPYA 3V12A 2BVRH 1LVMA 3MO6A 1QHRB 1W10U 1E0FD 3HGPA 3SBKA 2P93A 2THFB 1J15A 5FX6A 1BMAA 1CA0C 5IDKA 1GJAB 3BV9B 3M3VA 3KGPA 1O5AB 2DE9A 1PPFE 1BJUA 1B0EA 1O2WA 4GUXA 1YPJH 1HDTH 2EA3A 5JPMH 2QCYA 3BTFE 4BAQB 1RGQA 3PM3A 1TX8A 5LPEA 1TQ7B 2ESTE 5G4BA 2ZU2A 3Q3XA 2EI6A 2VINA 4D9RA 1SG8B 4DVAU 3MU5A 2ZFPH 1FNIA 1ESAA 1TABE 4MLFB 4AB8A 3M5NA 3B8JA 2FOEA 3ZZ5A 4I33A 2A4QA 1EUFA 2ODYB 1XMNB 2A4OA 3UNQA 3SO3A 4TPIZ 4DIIH 1N1LA 3QDZB 3UWJH 1AHTH 1LKBA 1XKBC 1OKXA 3ATKA 1A2CH 4INLA 1P9UA 2A45B 4ZKNU 2JETC 6GCHF 2VWNA 3PO1B 4YLUA 1ELBA 5LGOA 2VIVA 5E0HA 3ATWA 4AYYB 7LPRA 4HFPB 1GI8B 4U01A 3AVZA 1INCA 3KL6A 2Z9IA 1ESBA 1PPZA 1O2TA 1ZRBA 4PROA 3MHWU 1U6QA 1H8DH 3VB6A 5DP6A 1TFXA 1DT2A 1C2LA 3ENSB 3E1XB 4WXVA 3BTDE 1S0RA 3BEUA 3NPSA 4UFEH 1GBFA 3ZZ3A 1O3KA 1K1NA 2AEIH 3A8AA 3S7KB 5EXLA 1KDQB 2NU0E 2BD4A 1TA2A 2J94A 4X8VH 4CRDA 3SUDA 2PSYA 2XBWA 3GDVA 2CJIA 2BY8X 2BD9A 2Z7FE 4X6OA 1TRNA 4ZKOU 3D65E 3DHKH 4NWLA 1TPPA 5FPTA 1LCYA 5A8ZA 1F0SA 1HXFH 2BM2A 1C2JA 1SB1H 1ZPZA 3AW1A 3RXKA 1QRZA 4X1QU 3RXVA 1O2IA 4XDEA 1QURH 2FOFA 4NFEA 3EAJA 1QB1A 2STBE 1EB1H 2FPZA 3UR6A 3A8BA 1RS0A 2QAAA 2OBQA 2P3UB 4MDSA 1A7SA 2HNTE 1AO5A 2HPQH 1W3CA 3SJ9A 1MBMA 4SGBE 2SGPE 1Z7KA 5E0JA 2H2ZA 1P2MA 1H9LB 2ZWLH 1BTUA 1RIWC 1UVTH 3A8DA 3W95A 3UOUA 2BHGA 2XNIA 1TPSA 4ABFA 1NRPH 1TOCB 5BPEA 4DW2U 3ESTA 1KIGH 2BY5X 1C1UH 1SLXB 3AAVA 2AERH 1GMHF 2FLRH 1O2MA 1P02A 3GICB 1JRSA 3H7TA 3TLOA 5DP9A 1H8IH 1UCYH 1K1PA 2JH6D 3SUEA 3P70B 5E0GA 2PHBA 1HAYB 3FZZA 4ZHAA 4E7RG 1YP9A 1IQGA 1V2NT 3PMAB 3LPRA 1P8VC 2SGEE 4CREA 2P8OC 3A89A 8GCHG 1QL8A 3S9BA 1O3BA 2FP7B 4BAHB 2IJOB 2FI5E 1V2PT 5ESTE 3S9CA 5JBTA 2LNCA 1IHTH 2IOTA 2PKAB 1TOMH 5HM2A 2SGDE 2PGBB 4A1TA 1DUAA 1W2KH 2FOBA 2W26A 2QXIA 1SBWA 1G3BA 3Q77A 2FS8A 3CP7A 4TWWA 2RA0A 1T8OA 1GL0E 5A8YA 1FY8E 3T28A 4HI3A 3UIRA 3SORA 2AFQB 1OYTH 1ZR0A 2CF8H 3E91A 2ZQ2A 1GJ8B 1UTQA 3BN9A 2FOGA 2XWBI 4FUHA 1AZZA 1DSTA 3SU4A 4ABDA 5JB8S 1ZSLA 2DE8A 1PJPA 1OX1A 4IN1A 1HJAC 3UUZA 1NS3A 5J4QA 3A84A 2A4GA 1O5CB 3ZVCA 3F9FA 1MKXH 2ANKH 1THSH 2F9NA 1ELGA 4ABHA 2FXRA 1HAOH 1KLTA 4CHAB 4Q80A 2TGAA 1BHXB 3RXMA 4HZHA 1OP2A 2Y7XA 3LONA 3TU7H 3UNRA 2GTBA 2H9HA 2FIRH 4FUDA 1LHFH 5C3NA 4KTUA 5DP4A 1FJSA 1GHYH 3NZIA 1IHSH 4KKDA 5DK1A 1GHAF 2ZFTA 1BRBE 1SFIA 2BD8A 3DT0H 2NU3E 1P9SA 4ISHH 1O3EA 3LGVA 2OC0A 2VVCA 1UTLM 3SU2A 3RMLH 3SGQE 1H1BA 3RU4T 3UREA 1Z8GA 1GMDF 2GT8A 4X0WU 1P12E 2VNTA 1DXWA 1ZJDA 4OS4A 1B5GH 1ZMNA 2A7JA 2BB4A 2XBYA 2ZI2H 1HAVA 3GCNA 1W11U 2ZFRH 3RUOA 2R0KA 1PQ7A 1SOZA 2OXSA 4YTAA 1TX6A 2IN2A 4AORA 4WF8A 4UONA 2VVUA 4IMQA 1EX3A 5F8TA 1YGCH 3FP7E 4I8HA 5K0HA 5TJXA 1DY9A 3B9FH 1TAWA 5PTPA 1IQLA 1IQFA 1KLIH 2VWOA 2FOCA 1BZXE 2J9NA 3LU9B 3TH3H 4ASHA 5K7RA 3RXUA 1HB0B 1IOEA 2P59A 4JYVH 2BQ7B 2J4IA 3DA9B 1OWKA 5JB9S 1C2HA 5F8ZA 3SUFA 3ODFA 2XRCA 2BMGB 2PR3A 5A0AE 1AE5A 2G5NA 4K1EA 2WUBA 4FUCA 4NA8A 1P10A 1W0YH 1MU8B 2R3UA 4YESB 1YYY1 1O3MA 1VITH 4HTCH 1UMAH 3A86A 4IS5A 1GL1A 3A87A 2Y81A 3F9EA 3E0NB 4H6TA 1G32B 1O2HA 2ODQA 1QQ4A 1ACBE 2Z9GA 1UTOA 2ZGBH 1C5TA 1O36A 3K2UA 1KTTB 2AH4X 2TPIZ 3I29A 3KIDU 1A1RA 2AGEX 1O2QA 1GI7B 1DLEA 3E0PB 3GY8A 4WH8A 2ODPA 1A0JA 2ULLA 2ZG0H 2PLXA 1YC0A 3EQ0H 4AX9H 5GJ4B 1WU1A 1YPLH 4FU8A 1AVXA 2VJ1A 3RXCA 3SN8A 3M61U 1C1VH 2V3HH 2ZDKA 1TBZH 2ZGJA 4GHTA 5EODA 3VB3A 2EI8A 5DP3A 1GJCB 1MZDA 1A46H 3BTME 2XBXA 1C5YB 1BRUP 3F6UH 3RC6A 1EAWA 2BXUH 2FMJA 1LQEA 1HJ8A 4Y8YA 1C4V2 1GMCF 3PTBA 3SGAE 1QL9A 3GYLB 4YOIA 4IMZA 1NC6A 3MYWA 2BD2A 5DJ7A 1AB9C 3MH4A 5E2OA 1FUJA 5DP7A 2R2MB 3RMMH 1AQ7A 4LOYH 4ESTE 3RXQA 1C2EA 5A8XA 2ZTXA 3BIVH 4JZEH 3C1KA 2BYAX 4NA7A 3VEQB 1QL7A 2G81E 4I8LA 3QGJA 1K1MA 3PWCA 1IAUA 1LMWB 4BANB 3SQEE 1FI8A 1ZOMA 2I6SA 1DX5M 1O5BB 2D8WA 1Z71A 4AGKA 4X8UH 1SI5H 5FBIA 3RU4D 4I8JA 3VB7A 3TITA 2BDAA 2GZ8A 1K1LA 1E35B 3U98H 4DOQA 1EZSC 1RRKA 1XVMA 3SHCH 2A5KA 1BTHH 4O3UA 7GCHG 4XE4A 2C8XB 1GI3A 1KTSB 3RXTA 5FCKA 1N8OC 4H42U 1ZMJA 1J17T 1FPHH 1YPEH 1BRCE 4FUFA 4U32A 1C1NA 2H6MA 9ESTA 1Z1IA 1QJ7B 1ANDA 1QBOA 1DPOA 2XC4A 1SLVB 4YZUA 4AOQA 2A7HA 3SU6A 4WH6A 1K9OE 1KXCA 2J2UA 2WPMS 2BD3A 3ZVEA 2WYJA 1HRTH 3ZZDA 4X2VA 3RXGA 1TGSZ 1QFKH 3LGIA 2FX6A 1P2QA 1VGCC 1XUGA 2ZEBA 1NY22 2ZPQA 1MH0A 2ZA5A 2VIQA 2Z9LA 5GCHG 1ELAA 1NRRH 4UDWH 3TJUA 1CBWC 4B2BA 1SQAA 1A3EH 1LO6A 1KSNA 2F9VA 1EJNA 3QN7A 4JK6A 1QRXA 1C5SA 1JMOH 2SNWA 1KY9A 1UK2A 3BTTE 4JMYA 4X2YA 4JZDH 5JBBS 1V6DA 2OTVA 1L0ZA 1GCDA 3M3SA 3CENA 4INKA 5EU8A 3MOCA 3T25A 1Q31A 3U8OH 1PYTC 1DM4B 4X8SH 3F68H 1F92A 1PYTD 2QYIA 2BOKA 3KHVA 1O3LA 1G30B 4RKOB 3FFGA 4ISNA 1A0HB 1IQIA 1NU7B 1T31A 1YM0A 1TWXB 3D49H 1SGTA 2ZIQH 2J95A 3TJOA 2ZCHP 1FONA 1O3AA 2BZ6H 3RXSA 5GDSH 5DO4H 1ZZZA 3ZZ6A 2AMQA 2R0LA 1JBUH 1P01A 1UO6A 1XXFA 4K1TA 3GY3A 3ZVAA 4R0IA 5FX5A 2O8TA 1MBQA 1G37A 2CHAC 5CE1A 1OYQA 3LGYA 4O97A 1RXPA 4FUEA 1G3DA 1HPGA 2ANWA 2WINI 3H7OA 1C4Y2 1DLKB 2Q6GA 3SJOA 3P8NA 4BNRA 1HAIH 3U1JB 1AN1E 2Q6DA 2W3KA 1XKAC 3QGNB 4KGAA 3O8DA 3SNCA 2FLBH 3MFJA 3D23A 1SLWB 1V2JT 1C1RA 1AFQC 2JH5D 5IYTA 5EQQA 1C2MA 1O2NA 2EC9H 3PMBB 3SOSA 2PKAA 1K1IA 4ZH8A 5EXMA 1Y3XA 4TY7A 4ABIA 1OSSA 3KCGH 4I8KA 2FX4A 2CHAB 1L1JA 2WYGA 4DGJA 5EG4A 3TGKE 3MU0A 3MH6A 4JCNA 3R3GB 2BDGA 5GWZA 3L3TA 2GV6A 4MNWA 1AFQB 2O8WA 2Z3DA 3EA8A 3SV7A 1UVPA 1NN6A 1TMTH 1NRQH 2WV5A 4FUGA 3ZZAA 1V2ST 1UTKA 1DE7H 2ZU3A 4H6SB 2ZTZA 3PO1C 1MKXK 4CH8B 3MNCA 5AFYH 1YKTA 3M7TA 2C8WB 2F91A 2B9LA 1V2QT 5E2PA 2OINA 1M9UA 1OWEA 2CF9H 2ZO3H 1GCTB 3LC5A 4ZAEA 1JOUB 5AF9H 1HV7A 1CE5A 4WJG2 3SJ8A 2Q1JA 1TLDA 1V2LT 1DWEH 1LHCH 2UWLA 1MQ5A 1SPJA 2BOHB 3RXFA 1GPZA 3PV4A 2EI7A 1NRSH 1GG6C 1LHGH 3KQBA 1PPEE 3GDUA 2ZGHA 2ZZUH 5GIBA 1BA8B 1FY3A 4NIWA 1A0LA 5DG6A 3I78A 1SGIB 1XUKA 4DY7B 1ZGVA 5B6OA 1IQJA 1C9TA 4MNYA 2TGDA 2AGGX 1O5FH 1D3PB 1L2EA 2XBVA 1ZHMA 1WAYB 3OY5U 8KME2 4Z0KA 2H1UA 1H4WA 3TK9A 1ABIH 3LGUA 1A61H 1GG6B 3LT3A 3VB4A 8GCHF 3ZZ8A 3BEFB 1O5EH 1BMNH 3LJJA 1P3CA 1BT7A 2H5CA 5L2ZH 1Y5UT 4GAWA 2CGAA 3P8FA 1XVOA 1FZZA 5JBAS 3SGBE 4ABEA 3BG8A 2Y80A 1ARCA 1SOTA 3VXFH 2XC0A 3GCTF 4ZHLU 4BTUB 5JBCS 1KYNA 3U8TH 1C4U2 4YOJA 3HK6B 4K1SA 1EZUC 2ANYA 1N6YA 4OS1A 3U69H 4Y7BA 3MH5A 6ESTA 1TGBA 2CMYA 3BTKE 3S0NA 1NESE 1O3FA 3HKJB 1BTWA 1O2ZA 2JKHA 5ETXA 1ORFA 2AS9A 2FM2A 1C5UA 1W8BH 4MPUA 1T32A 1V2MT 3LC3A 3MU8A 1L1NA 2XTTB 1TGTA 1AUTC 1ZLRA 4B74A 4GHQA 4Y8XA 2QF0A 3TGIE 3QX5H 1C5XB 2QIQA 2A2QH 3UTUH 4CR5A 4NZQA 4OGYA 1CT4E 1UVSH 1BUIA 1MZAA 1SFQB 4VGCB 2H9TH 3SV9A 1O3HA 2HRVA 4TY6A 2I6QA 1D3QB 1DFPA 1HAHH 1W13U 2V3OH 2WPKS 4UD9H 3RXPA 2B5TB 3RMOH 3B23B 1PFXC 2FYRA 2GZ7A 3P8GA 1GVZA 1HBTH 3OYPA 3T29A 5EQRA 3UPEA 5LPFA 3ATMA 4K8YA 2OD3B 1GJ5H 2QC2A 1PQAA 5HYOA 1O3PB 4FU7A 4CHAC 1T8MA 3TH2H 1WYKA 1UTJA 2A2XH 1GI9B 5T6GA 1W0ZU 4Y7AA 1UHBA 1DANH 2VIWA 1Y3WA 3RXOA 2TIOA 2B8OH 1AMHA 1PPCE 2ZHEH 3BSQA 1GHZA 4KTSA 3STIA 1B7XB 2P94A 1EQ9A 3MMGA 4CBOA 5DGJA 1HAZB 1YF4A 5EXNA 1S82A 5A0BA 1O38A 2PTCE 1E38B 1WQSA 5EGMA 1P2NA 1ETSH 3O8BA 3FZDA 4AFSA 1WTHD 4TPYA 5EOKA 1YPHE 5LPRA 1P2OA 4NSVA 3QWCH 4B73A 3OTJE 5CHAB 2G4TA 1G36A 1P04A 4ISLA 1Q3XA 2OUAA 4RN6A 5I25A 1TX7A 4O03A 1VR1H 1D3TB 2ZHFH 3FAOA 2TBSA 1ZRKA 3TNTA 4OGXA 4BXSA 2P3FH 5F8XA 1O35A 4JZIA 1XM1A 2UUJB 1TQ0B 1DXPA 3ODDA 4Y10E 1S6HA 3NCLA 4X8TH 1GMHG 3V3MA 1L4ZA 2P3TB 1ANEA 1TNJA 2UUYA 1AKSA 1AFEH 5BRRE 1A4WH 3KF2A 3DUXH 1RJXB 1O3IA 2ZU4A 1GJ4H 2OC8A 1ETTH 3ZZ9A 1WTGH 4FU9A 1O3GA 1O2OA 2F9OA 1Y8TA 1A5HA 1EAIA 1HXEH 2ZCLP 4FUBA 5GXPA 1WCZA 1FY4A 3SZNA 3K9XB 1XUJA 2YNBA 7ESTE 3E90B 3RXLA 2Z3CA 2A0QB 5C2ZA 3GY4A 3TJNA 2QXHA 1LKAA 3L6PA 1Y5BT 3CS7A 2ZECA 1T4UH 2AGIX 1LHEH 5A09A 2D2DA 1J14A 1GWAA 3GCHB 1O2VA 1L1GA 1A5GH 1GBIA 1D9IA 1FIZA 1AVGH 1ZSKA 1BQYA 1ZHRA 3H5CB 2GVFA 4X6PA 1TBRH 2HPPH 4J2YB 5FXLA 3UQOA 4DCDA 2Y82A 4ISOA 2PSXA 3P8OA 3PLKA 4Q7ZA 1O5GH 3BTEE 2ZFQH 1JIRA 3ZZ4A 4RSPA 3SW2B 1LVOA 1ZTKA 2K1QA 3QZQA 1KXAA 3RP2A 3A8CA 1GBHA 2Z6BD 2GT7A 2IPHA 1P05A 2LPRA 1V2WT 5SGAE 2EEKA 3A81A 2BDBA 4A1VA 4A5TS 1KLJH 1BJVA 1SQTA 4ABAA 1CHOG 3FP6E 1SGPE 1PPBH 2VGCB 4CRFA 1P2JA 1TYNA 1QR3E 3QK1A 1GHBF 4NWKA 1VJ9U 2ASUB 1MD8A 1FN6A 2O8MA 1Q2WA 3HK3B 4D7GA 1LPGB 2A7CA 3M37A 1YCPM 3RMNH 1K22H 4IBLH 1HUTH 3LJOA 3NWUA 4FUIA 1L4DA 5DP5A 1FPCH 7GCHF 1GBMA 1T4VH 1TIOA 2ZHWH 1TBQH 4ZKSU 1GGDC 1ANBA 1P0SH 3S7HB 1LQDB 2Y6TA 4BXWA 2BDHA 2BLVA 1K21H 1UK3A 4X6MA 2SNVA 1J9CH 1EJAA 1F2SE 4B71A 4NG9H 2G00A 4D9QA 1RTKA 4WXIA 1GMDG 3LH1A 3Q00A 2ZU1A 1LVYA 1O3CA 2GCHF 2CN0H 2AIQA 3ELAH 1O3NA 4O3TA 4NZLA 1P11E 5C1UA 2BLOA 3M7UA 1QBVH 2NU2E 1HJ9A 1IQHA 2OC1A 3EDXB 4MPVA 3TGJE 3ZV8A 3WY8A 2C8ZB 3P17H 2NWNA 1GGDB 2Y5GA 5GPIB 1XX9A 1EJMA 2FTMA 1C5PA 1P57B 2FOHA 1MD7A 1NT1A 2ZGCA 1UVUH 1ELFA 2XXLA 1Z8IB 1XUIA 1SHHB 2PUQH 2ZHDA 4BTIB 1O5DH 2F9PA 1RTFB 3DFLA 2AMDA 1Y3VA 1E36B 3SI3H 1ZTJA 4X1SU 2HNTC 1HGTH 3RXIA 1V2TT 1WBGB 1C1QA 1EOLA 1Z6EA 2Y7ZA 4BAOB 1D6RA 1HNEE 2OQ5A 4AG2A 2W7SA 5ESBA 1GI6A 1AD8H 1YCPK 4LZ4B 1ID5H 1SVPA 3SNAA 1ELDE 2HOBA 6CHAC 1AWHB 3T62A 2AIPA 2ZPRA 3BG4B 1WSSH 2ZGXH 4INHA 4CRGA 1O3OA 1E37B 3SU3A 3HGNA 1NFUA 2HGTH 1EB2A 5T6DA 3IITA 3L33A 1SQOA 4X1PU 1GVLA 2V0BA 1DICA 3BEIB 3KQDA 5HGGA 2BTCE 3AAUA 3STJA 1C5WB 4U2WA 1EAXA 4K69A 4UEHH 1QQUA 1Z8JB 3F9HA 1HAPH 5A0CA 2GDEH 2M5TA 3UQVA 2A1DB 1TRMA 4ISIH 2A4RA 4IGDA 1T8NA 3AW0A 1KDQA 3E8LA 6CHAB 3NUMA 2A5AA 1NFYA 1YBWA 3SHAH 3GCOA 1GJDB 4QT8C 1QY6A 1OP8A 1CSOE 1GBKA 4BAKB 4HGCA 1PPHE 1S5SA 3TVJB 3HPTB 4LZ1H 1S85A 1TB6H 1D6WA 1Y59T 4LK4A 1MKWH 1A3BH 1C1OA 2XW9A 4B1TA 1K1OA 4YOGA 2C4FH 1OS8A 2FESH 5EW1H 1CT2E 1DITH 1HAVB 1ARBA 4XSKU 1W7XH 3DFJA 2FDAA 3F1SB 2G4UA 4GCHG 2VH0A 2BLQA 4AFZA 1C5QA 5C67A 1AUJA 4B76A 1GHVH 4I32A 1SGCA 1MCVA 3SV2H 2GCTC 5AFZH 3GOVB 3SI4H 4FVDA 1X7AC 1O3DA 5FCRA 2OQUA 4IW4E 4E06H 3BTHE 1SGYE 9LPRA 1JWTA 2GX4A 4O9VA 1AIXH 1GBCA 1DUEA 4X6NA 1EKBB 3T5FH 4F49A 4MG3A 3BTQE 2FTLE 3SJIA 1FQ3A 2YNAA 2BX4A 1UK4A 1O2LA 1RD3B 2O9QA 3MO3A 1CU1A 1LDTT 1MMJN 2JH0D 3K6ZA 3M36A 2BY7X 2GCTB 5TCCA 1CGHA 4JK5A 3O8CA 2GMTC 1ELTA 5F6MA 1GI1A 1FMGA 3EGKH 5HMAA 1O34A 1WUNH 3FP8E 2BZAA 1HFDA 2RA3A 5L30H 2ZQ1A 4FXGH 1AU8A 1PQ5A 1UTMA 5EPNA 1GBJA 4R8TB 1C5LH 1C2IA 2GZ9A 1KXBA 1MTUA 2WPLS 2G5VA 5AVDA 2ZF0H 1SSXA 1CQQA 3QLPH 4Y6DA 2HWLB 3UFAA 3A80A 3VGCB 2V6NA 1C1WH 4IN2A 3KQEA 1VITG 3ZVBA 1GCTC 1MU6B 2ZKSA 2GMTB 4LXBH 5DPAA 2CV3A 3Q3YA 1BITA 1LVBA 3A7TA 4Y79A 1EPTC 1THPB 1F5KU 3NXPA 1F0UA 3DD2H 2ZP0H 5H4IB 1H9HE 2NU4E 4OS7A 1QA0A 1Y3YA 3RXDA 4ABBA 2UUKB 2ZDMA 4NIYA 1F7ZA 3LOXA 1IQNA 3MU1A 4D8NA 1MTNB 1O39A 3RLWH 2ZDLA 3LIWA 1JIMA 1BMMH 1YCPH 1O33A 1TMUH 1QJ1B 3RXJA 5FAHA 1KXDA 2G52A 1BTYA 2PKSB 1EPTB 3MO9A 7KMEH 4H4FA 1G3EA 1MAXA 3C27B 3MNSA 3ATLA 3RXAA 1TGCA 4OS6A 1NTPA 2FOAA 1DDJA 1DOJA 1SLUB 5DKMA 1SGEE 4Y11E 1O2PA 2AMPA 4ABGA 3T27A 1QIXB 1NPMA 1CA0B 2BX3A 3RXBA 1HCGA 1O31A 4NFFA 5T6FA 1BTZA 2GGVB 1ELEE 3M5OA 5JDUB 3KEEA 5FBEA 3V7TA 1C2KA 1EAUA 2QN5T 3UNSA 3AASA 1BDAA 2BDYA 1K2I1 2C90B 3LGTA 3A7VA 3PMHB 2UUFB 3KN2A 2BQ6B 4WMEA 1MAYA 1UVOA 4U30A 1SGRE 2ZCKP 2SGQE 5C5NA 4XBBA 3TNSA 3HKIB 3HATH 1CGJE 1GI2A 2Y5HA 3T26A 1CA8B 1N6XA 1LPZB 3ZYDA 2KAIB 1A5IA 3CS0A 2PW8H 3ZVFA 1FAKH 1FN8A 1GBLA 1C1MA 4KP0A 4XFQA 1GI4A 3GISB 1BCUH 1AWFH 2VU8E 3S9AA 5C1XA 5C1YA 3RLYH 1KXFA 2JETB 3ZYEA 4CRCA 2ALVA 2FEQH 1V3XA 3R0FA 4NA9H 1P2KA 3VB5A 4K60A 4DURA 1Y5AT 1HAGE 3E3TA 2TRMA 1FY5A 1BBRH 3N7OA 4Q7YA 1GBDA 1C1PA 1HIAB 2W7UA 2BXTH 2XCFA 4CR9A 4VGCC 4AB9A 3SNEA 1G9IE 4AZ2B 4GVUA 1C5ZB 2TGTA 1EASA 1W14U 4JYUH 1V2VT 4K2YA 1CO7E 1CHGA 2ALPA 4MNVA 2OBOA 4K8BA 4D76A 5E8EH 2F9BH 1QTFA 3QTVH 3NKKA 1TONA 2WPHS 1P03A 6GCHG 3KNXA 3Q76A 5CMXH 3RU4E 2GDDA 1O2YA 3BF6H 1F5LA 3VFEA 2J92A 1Y3UA 1NO9H 2Q6FA 1D4PB 4A6LA 2XCNA 4ZXXH 2OC7A 2Z3EA 3PTNA 3LDXH 3A7ZA 3PYHA 1VCWA 1GBBA 5AHGH 1GI5A 2A32A 2SGFE 1GBEA 1T7CA 1RIWB 1C2DA 1O2UA 2BD5A 3U9AH 2GKVE 3ZZ7A 5C5OA 5CHAC 1S83A 1ZHPA 4I7YH 4ZKRU 4WMDA 1OWDA 5ABWA 3P92A 3P95A 2PWXA 4ZMAH 2PUXB 1EP5A 2ZFFH 4FUJA 1AZ8A 5EW2H 1GHXH 1OOKB 1V2UT 3BTWE 2FWWA 5FHTA 3VPKA 4B2CA 1MTWA 1NM6A 2F83A 4F4OC 1UJ1A 3UR9A 2H9EH 4KTCA 4NSYA 1TNKA 4UFDH 3RM2H 4YO9A 3A88A 1P09A 1FLEE 3GCTG 2VWMA 4JYTA 2A5IA 3IG6B 4MTBA 1W12U 2P8OB 4AFUA 1SGQE 1P2IA 4BOHA 1GI0A 4ZHMU 1MQ6A 1H9IE 4CH2B 5C20A 1S6FA 1CHOF 1O2GH 1W7GH 3UWIA 4A92A 3UOPA 1O2RA 1C9PA 1SGFG 3GY6A 3U8RH 4WWYA 1GJ9B 2RG3A 3SNDA 3MH7A 3LH3A 1O32A 3QZRA 1C5NH 3EE0B 3BTGE 3TPIZ 2BVSH 3QUMP 4XBDA 4JZ1A 1FV9A 3OX7U 3PB1E 1C5OH 5DP8A 4XOJA 1VJAU 1TNGA 4WMFA 2PGQB 1OWJA 3GCHC 1NFXA 1BRAA 2SGAA 2NU1E 2TGPZ 2C8YB 3EA9A 3M5LA 1HJAB 1QB6A 5TCAA 2FS9A 1OPHB 4A1XA 3A82A 1AGJA 5T3HA 3A83A 3FVFB 4AN7A 2G55A 2FODA 3OSYA 2G51A 3GY7A 2ZDAH 1P3EA 1V2KT 1TNLA 1AY6H 1C5VA 2F3CE 1P06A 1G3CA 1O0DH 1THRH 1ELCA 2FOMB 1TA6A 2FO9A 4YM9A 1YLCA 1O2XA 1BTPA 2HLCA 3PWBA 8LPRA 3S69A 2WPIS 2HVXA 1F0RA 4I8GA 2QGRA 4RKJB 1C5MD 1MKWK 1BB0B 1ELVA 1S84A 2VGCC 1AE8H 3GY2A 4GPGA 1BHXF 1T8LA 4Y71A 2ILNA 6LPRA 1LHDH 5JYIA 1UTPA 4AFQA 3T2NA 3ATIA 4NCYA 4GSOA 4YLQH 2QA9E 2FYQA 4D7FA 3LGWA 3EA7A 2VB0A 2ZDVH 2ZTYA 1ZGIA 1QA7A 5L6NH 1Z1JA 4CRAA 2ZFSA 1Z6JH 4NIVA 3MI4A 1SGNE 4E05H 5F03A 4DIHH 1S81A 3TK5A 1CGIE 4IC6A 4ZUHA 5J4SA 2OP9A 4X1NU 4XBCA 2R3YA 1BMLA 4DJZB 3P6ZB 1TNIA 4CRBA 2ZHQH 1ZTLA 3ITIA 2BLWA 3A85A 1D3DB 3D62A 4CBNA 1VCPA 2B0FA 3E16B 1PQ8A 1TE0A 4MPXA 4ZXYH 1QRWA 2W5EA 5I46H 1EZQA 1SL3A 4Y0YE 1GHAG 1AI8H 1TGNA 2Z9KA 4TYDA 2QV1A 2BY6X 1LPKB 2BVXH 2ZPSA
chains in the Genus database with same CATH superfamily
3OTPA 1J16A 2JDID 2OLGA 5L2YH 1NFWA 2VWLA 2QF3A 4Y0ZE 1G2LA 1TPAE 3GY5A 2V3MA 2CXVA 1C1TA 3JZ1B 2HALA 5HXFA 1UTNA 2G8TA 1Z8RA 2XNDD 1DY8A 1K1JA 1JRTA 1TMBH 4TWYA 1GJ6A 1MTSA 1OWHA 2VIPA 3OFND 4WY3A 4GLYA 3SJKA 1DWBH 3OY6U 1F0TA 3ZVDA 1CVWH 3U1IB 2QXJA 2XC5A 2AYWA 3IWMA 2Z94A 2FI4E 3MWIU 1ESTA 2QXGA 1O2KA 3RXHA 1QBNA 3NK8A 2ZNKH 5A2MH 3I77A 1IQKA 5GCHF 1AVWA 2GP9B 2K0QA 1VCQA 4ZCNA 2VIOA 1ZSJA 3BG4C 1EZXC 3MTYA 1QGFA 1RFNA 1SHYA 3GDSA 4KELA 1ANCA 2M2AA 4UFFH 4AYVB 4AG1A 1NROH 2UWPA 1WQVH 3RC5A 3MNXA 1NRNH 4Q7XA 1BTXA 1YLDA 4X2WA 4GCHF 4UE7H 2WSSD 3SV8A 1UHBB 2P16A 2W6ID 1G2MA 2Y5FA 3G01A 4Q2KA 1GBTA 2O8UA 4B6FA 3Q3KA 1EPTA 1C2GA 1O3JA 2XYAA 3A7WA 2C93B 1C5RA 2VH6A 5FPSA 2W3IA 1PPGE 3PMJA 1GHWH 1XUFA 1GHBG 4DT7B 1CT0E 4YT7H 1QNJA 4SGAE 1WOFA 4J1YA 3F9GA 2OCVB 2FZZA 2ANMH 2H5DA 3PLBA 4M7GA 2PFEA 4BAMB 1DVAH 1ZPBA 2RDLA 2Z9JA 1MCTA 1ZYOA 1AB9B 3QTOH 2GD4B 1MTVA 1S0QA 3BIUH 4B75A 3SNBA 2BD7A 2D26C 1RTLA 3TJVA 4FVBA 1BMFD 4ABJA 1SGDE 1K28D 2FI3E 1WDIA 1KXEA 3SQHE 3TH4H 1NZQH 3MNBA 4A7IB 1FAXA 1SC8U 3FO8D 3KQCA 2R9PA 4Z6AH 1SGFA 3RM0H 2C3SA 2BDIA 3FANA 1BOQA 2KAIA 1O2JA 4NIXA 1YPMH 1ZJKA 4MVNA 3A7XA 3EYDA 1VZQH 3SUGA 2GCHG 1AKSB 1GDUA 1QJ6B 5EQSA 2PTNA 1O30A 1IQEA 3V0XA 1GJBB 2A31A 1YPGH 3M35A 3PLPA 1SR5C 5LH8A 2BY9X 1EXFA 3E6PH 1ZPCA 2KCYA 2KFWA 1NU9A 1BBRE 1VITF 4OS5A 2J34A 2YOLA 1N8OB 1GDNA 1GMCG 3SV6A 1C2FA 1FY1A 4JZFH 4MNXA 4MPWA 1GBAA 3URDA 1J8AA 2BDCA 1JXPA 1O37A 1YPHC 3ZVGA 1OXGA 1HIAA 2HNTF 1BBRK 4Y8ZA 4WVPE 1GJ7B 1V2RT 3URCA 5HM9A 3M3TA 2VBCA 2KR7A 2J38A 4THNH 1EOJA 2VVVA 3A7YA 1ZMLA 1FIWA 1EP6A 2ZDNA 1TRYA 3K65B 2D1JA 4B2AA 3ZV9A 1HYLA 3M5MA 1XXDA 2UWOA 1DSUA 1GDQA 1VGCB 4DG4A 2QY0B 4K3JA 3UY9A 3M7QA 3W94A 1ABJH 2WUCA 2P95A 4MQAA 2R2WU 3LKWA 2ZU5A 3SU1A 2F9UA 1SMFE 5CHBA 3RXEA 1CBWB 1UCYE 2V35A 3K6YA 4I31A 3VGCC 1MUEB 4IC5A 2WPJS 3TIUA 2SFAA 3SU0A 1V2OT 3RXRA 3JZ2B 1C1SA 3GYMA 1DWCH 2STAE 1LTOA 3QO6A 1IQMA 8ESTE 1HLTH 2V7QD 3OU0A 3O8RA 3ZZBA 1B0FA 1UCYK 2DUCA 2GV7A 1ETRH 3TK6A 4ZROA 1GVKB 4X1RU 4UFGH 3VG8A 2W6JD 1OP0A 1QB9A 4BTTB 1E34B 2WV4A 3PROA 2ZC9H 3PRDA 1TNHA 1DWDH 2RCEA 3MU4A 4NGAH 1TPOA 4K5ZA 2B7DH 4YT6H 4E7NA 1QCPA 1F5RA 5EPYA 1FXYA 2BQWB 2VIDA 1FDPA 1HAXB 1MTNC 3ZZCA 1DS2E 4OS2A 3VXEH 1TALA 2XWAA 3SU5A 3V13A 1EATA 1OWIA 1XUHA 1BIOA 4Y76A 3RDZA 3RC4A 1O2SA 4X2XA 5HIYA 2O8LA 5KGOA 1WV7H 2YMSB 2PKSC 2QF4A 2PV9B 5EJ1A 1YPKH 4AGJA 5FPYA 3V12A 2BVRH 1LVMA 3MO6A 2J5UA 1QHRB 1W10U 1E0FD 3HGPA 3SBKA 2F4LA 2P93A 2THFB 1J15A 5FX6A 1BMAA 1CA0C 5IDKA 1GJAB 3BV9B 3M3VA 3KGPA 1O5AB 2DE9A 1PPFE 1BJUA 1B0EA 1O2WA 4GUXA 1YPJH 1HDTH 2EA3A 5JPMH 2QCYA 3BTFE 4BAQB 1RGQA 3PM3A 1TX8A 5LPEA 1TQ7B 2ESTE 5G4BA 2ZU2A 3Q3XA 2EI6A 2VINA 4D9RA 1SG8B 4DVAU 3MU5A 2ZFPH 1FNIA 1ESAA 1TABE 4MLFB 4AB8A 1W0JD 3M5NA 3B8JA 2FOEA 3ZZ5A 4I33A 2A4QA 1EUFA 2ODYB 1XMNB 2A4OA 3UNQA 3SO3A 4TPIZ 4DIIH 1N1LA 3QDZB 3UWJH 1AHTH 1OHHD 1LKBA 1XKBC 1OKXA 3ATKA 1A2CH 4INLA 1P9UA 2A45B 4ZKNU 2JETC 6GCHF 2VWNA 3PO1B 4YLUA 1ELBA 1E1RD 5LGOA 2VIVA 5E0HA 3ATWA 4AYYB 7LPRA 4HFPB 1GI8B 4U01A 3F0OA 3AVZA 1INCA 3KL6A 2Z9IA 1ESBA 1PPZA 1O2TA 1ZRBA 4PROA 3MHWU 1U6QA 1H8DH 3VB6A 5DP6A 1TFXA 1DT2A 1C2LA 3ENSB 3E1XB 4WXVA 3BTDE 1S0RA 3BEUA 3NPSA 4UFEH 1GBFA 3ZZ3A 1O3KA 1K1NA 2AEIH 3A8AA 3S7KB 5EXLA 1KDQB 2NU0E 2BD4A 1TA2A 2J94A 4X8VH 2EQNA 4CRDA 3SUDA 2PSYA 2XBWA 3GDVA 2CJIA 2BY8X 2BD9A 2Z7FE 4X6OA 1TRNA 4ZKOU 3D65E 3DHKH 4NWLA 1TPPA 5FPTA 1LCYA 5A8ZA 1F0SA 1HXFH 2BM2A 1C2JA 1SB1H 1ZPZA 3AW1A 3RXKA 4Q4LA 1QRZA 4X1QU 3RXVA 1O2IA 4XDEA 1QURH 2FOFA 4NFEA 3EAJA 1QB1A 2STBE 1EB1H 2KCOA 2FPZA 3UR6A 3A8BA 1RS0A 2QAAA 2OBQA 2P3UB 4MDSA 1A7SA 2HNTE 1AO5A 2HPQH 1W3CA 3SJ9A 1MBMA 4SGBE 2SGPE 1Z7KA 5E0JA 5GNDA 2H2ZA 1P2MA 1H9LB 2ZWLH 1BTUA 1RIWC 1UVTH 3A8DA 3W95A 3UOUA 2BHGA 2XNIA 1E1QD 1TPSA 4ABFA 1NRPH 1TOCB 5BPEA 4DW2U 3ESTA 1KIGH 2BY5X 1C1UH 1SLXB 3AAVA 2AERH 1GMHF 2FLRH 1O2MA 1P02A 3GICB 1JRSA 3H7TA 3TLOA 5DP9A 1H8IH 1UCYH 1K1PA 5B6LA 2JH6D 3SUEA 3P70B 5E0GA 2PHBA 1HAYB 3FZZA 1NBMD 4ZHAA 4E7RG 1YP9A 1IQGA 1V2NT 3PMAB 3LPRA 1P8VC 2SGEE 4CREA 2P8OC 3A89A 8GCHG 1QL8A 3UB0A 3S9BA 1O3BA 2FP7B 4BAHB 2IJOB 2FI5E 1V2PT 5ESTE 3S9CA 5JBTA 2LNCA 1IHTH 2IOTA 2PKAB 1TOMH 5HM2A 2SGDE 3SYJA 2PGBB 4A1TA 1DUAA 1W2KH 2FOBA 2W26A 2QXIA 1SBWA 1G3BA 3Q77A 2FS8A 3CP7A 4TWWA 2RA0A 1T8OA 1GL0E 5A8YA 1FY8E 3T28A 4HI3A 3UIRA 3SORA 2AFQB 1OYTH 1ZR0A 2CF8H 3E91A 2ZQ2A 1GJ8B 1UTQA 3BN9A 2FOGA 2XWBI 4FUHA 1AZZA 1DSTA 3SU4A 4ABDA 5JB8S 1ZSLA 2DE8A 1PJPA 1OX1A 4IN1A 1HJAC 3UUZA 1NS3A 5J4QA 3A84A 4RI0A 2A4GA 1O5CB 3ZVCA 3F9FA 1MKXH 2ANKH 1THSH 2F9NA 1ELGA 4ABHA 2FXRA 1HAOH 1KLTA 4CHAB 4Q80A 2K8IA 2TGAA 1BHXB 3RXMA 4HZHA 1OP2A 2Y7XA 3LONA 3TU7H 3UNRA 2GTBA 2H9HA 2FIRH 4FUDA 1LHFH 5C3NA 4KTUA 5DP4A 1FJSA 1GHYH 3NZIA 1IHSH 4KKDA 5DK1A 1GHAF 2ZFTA 1BRBE 1SFIA 2BD8A 3DT0H 2NU3E 1P9SA 4ISHH 1O3EA 3LGVA 2OC0A 2VVCA 5EJLA 1UTLM 3SU2A 3RMLH 3SGQE 1H1BA 3RU4T 3UREA 1Z8GA 1GMDF 2GT8A 4X0WU 1P12E 3FN8A 1S6LA 2VNTA 1DXWA 1ZJDA 4OS4A 1B5GH 1ZMNA 2A7JA 2BB4A 4P00A 2XBYA 2ZI2H 1HAVA 3GCNA 1W11U 2ZFRH 1SQRA 2R0KA 3RUOA 1PQ7A 1SOZA 2OXSA 4YTAA 1TX6A 2IN2A 4AORA 4WF8A 4UONA 2VVUA 4IMQA 1EX3A 5F8TA 1YGCH 3FP7E 4I8HA 4Q63A 5K0HA 5TJXA 1DY9A 3B9FH 1TAWA 5PTPA 1IQLA 1IQFA 1KLIH 2VWOA 2FOCA 1BZXE 2J9NA 3LU9B 3TH3H 4ASHA 5K7RA 3RXUA 1HB0B 1IOEA 3KYGA 2P59A 4JYVH 2BQ7B 2J4IA 3DA9B 1OWKA 3H09A 5JB9S 1C2HA 5F8ZA 5KEDA 3SUFA 3ODFA 2XRCA 2BMGB 2PR3A 5A0AE 1AE5A 2G5NA 4K1EA 2WUBA 4FUCA 4NA8A 1P10A 1W0YH 1MU8B 2R3UA 4YESB 1YYY1 1O3MA 1VITH 4HTCH 4P02A 1UMAH 3A86A 4IS5A 1GL1A 3A87A 5HKKD 2Y81A 3F9EA 3E0NB 4H6TA 1G32B 2LELA 1MABB 1O2HA 2ODQA 1QQ4A 1ACBE 2Z9GA 1UTOA 2ZGBH 1C5TA 1O36A 3K2UA 1KTTB 2AH4X 2TPIZ 3I29A 3KIDU 1A1RA 2AGEX 1O2QA 1GI7B 1DLEA 3E0PB 3GY8A 4WH8A 2ODPA 1A0JA 2ULLA 2ZG0H 2PLXA 1YC0A 3EQ0H 4AX9H 5GJ4B 1WU1A 1YPLH 4FU8A 1AVXA 2VJ1A 3RXCA 3SN8A 3M61U 1C1VH 2V3HH 2ZDKA 1TBZH 2ZGJA 4GHTA 5EODA 3VB3A 2EI8A 5DP3A 1GJCB 1MZDA 1A46H 3BTME 2XBXA 1C5YB 2KM0A 4HG6A 1BRUP 3F6UH 3RC6A 1EAWA 2BXUH 2JIZD 4ACBA 2FMJA 1LQEA 1HJ8A 3F2FA 4Y8YA 1C4V2 1GMCF 3PTBA 2WZQA 3SGAE 1QL9A 3GYLB 4YOIA 4IMZA 1NC6A 3MYWA 2BD2A 5DJ7A 1AB9C 3MH4A 5E2OA 1FUJA 5DP7A 4B6EA 2R2MB 3RMMH 1AQ7A 4LOYH 4ESTE 3RXQA 1C2EA 5A8XA 2ZTXA 3BIVH 4JZEH 3C1KA 2BYAX 4F48B 4NA7A 3VEQB 1QL7A 2G81E 3F0PA 4I8LA 3QGJA 1K1MA 3PWCA 1IAUA 1LMWB 4BANB 3SQEE 1FI8A 1ZOMA 2I6SA 1DX5M 5T1VA 3DSPA 1O5BB 2D8WA 1Z71A 4AGKA 4X8UH 1SI5H 5FBIA 3RU4D 4I8JA 3VB7A 3TITA 2BDAA 2GZ8A 1K1LA 1E35B 3U98H 3DSOA 4DOQA 1EZSC 1RRKA 1XVMA 3SHCH 2A5KA 1BTHH 4O3UA 7GCHG 4XE4A 2C8XB 1GI3A 1KTSB 3RXTA 5FCKA 1N8OC 4H42U 1ZMJA 1J17T 1FPHH 1YPEH 1BRCE 4FUFA 4U32A 1C1NA 2H6MA 9ESTA 1Z1IA 1QJ7B 1ANDA 1QBOA 1DPOA 2XC4A 1SLVB 4YZUA 4AOQA 1EFRD 2A7HA 3SU6A 2HLDD 4WH6A 1K9OE 1KXCA 2J2UA 2WPMS 1YY3A 2BD3A 3ZVEA 2WYJA 1HRTH 3ZZDA 4X2VA 3RXGA 3F2HA 1TGSZ 1VKYA 1QFKH 3LGIA 2FX6A 1P2QA 1VGCC 1XUGA 2ZEBA 2HVYB 1NBME 1NY22 2ZPQA 1MH0A 2ZA5A 2VIQA 2Z9LA 5GCHG 2KCPA 1ELAA 1NRRH 4UDWH 3TJUA 1CBWC 4B2BA 1SQAA 1A3EH 1LO6A 1KSNA 2F9VA 1EJNA 3QN7A 4JK6A 1QRXA 1C5SA 1JMOH 2SNWA 1KY9A 1UK2A 3BTTE 4JMYA 4X2YA 4JZDH 5JBBS 1V6DA 2OTVA 1L0ZA 1GCDA 3M3SA 3CENA 4INKA 5EU8A 3MOCA 3T25A 1Q31A 3U8OH 1PYTC 1DM4B 4X8SH 3F68H 5FL7D 1F92A 1PYTD 2QYIA 2BOKA 3KHVA 1O3LA 1G30B 4RKOB 3FFGA 4ISNA 1A0HB 1IQIA 1NU7B 1T31A 1YM0A 1TWXB 3D49H 1SGTA 2ZIQH 2J95A 3TJOA 2ZCHP 1FONA 1O3AA 2BZ6H 3RXSA 5GDSH 5DO4H 1ZZZA 3ZZ6A 1SKYE 2AMQA 2R0LA 1JBUH 1P01A 1UO6A 1XXFA 4K1TA 3GY3A 3ZVAA 2YMSC 4R0IA 5FX5A 2O8TA 1MBQA 1G37A 2CHAC 5CE1A 2J98B 1OYQA 3LGYA 4O97A 1RXPA 4FUEA 1G3DA 1HPGA 2ANWA 2WINI 3H7OA 1C4Y2 1DLKB 2Q6GA 3SJOA 3P8NA 4BNRA 3OAAD 1HAIH 2QF5A 3U1JB 5C0UA 1AN1E 2Q6DA 2W3KA 1XKAC 3QGNB 4KGAA 3O8DA 3SNCA 2FLBH 3MFJA 3D23A 1SLWB 1V2JT 1C1RA 3W1EA 1AFQC 2JH5D 5IYTA 5EQQA 1C2MA 1O2NA 2EC9H 3PMBB 3SOSA 2PKAA 1K1IA 4ZH8A 5EXMA 1Y3XA 4TY7A 4ABIA 1OSSA 3KCGH 4I8KA 2FX4A 2CHAB 1L1JA 2WYGA 4FOUC 4DGJA 5EG4A 3TGKE 3MU0A 3MH6A 4JCNA 3R3GB 2BDGA 3F2GA 5GWZA 3L3TA 2GV6A 4MNWA 1AFQB 2O8WA 2Z3DA 3EA8A 3SV7A 1UVPA 1NN6A 1TMTH 1NRQH 2WV5A 4FUGA 3ZZAA 1V2ST 1UTKA 1DE7H 2ZU3A 3AK5A 4H6SB 2ZTZA 3PO1C 1MKXK 4CH8B 3MNCA 5AFYH 1YKTA 3M7TA 2C8WB 2F91A 2B9LA 1V2QT 5E2PA 2OK5A 4ACAA 2OINA 1M9UA 1OWEA 2CF9H 2ZO3H 1GCTB 3LC5A 4ZAEA 1JOUB 5AF9H 1HV7A 1CE5A 4WJG2 3WWBA 3SJ8A 2Q1JA 4AC9A 1TLDA 1V2LT 2IPQX 1DWEH 1LHCH 2WHXA 2UWLA 1MQ5A 1SPJA 2BOHB 3RXFA 1GPZA 3PV4A 2EI7A 1NRSH 1GG6C 1LHGH 3KQBA 1PPEE 3GDUA 2ZGHA 2ZZUH 5GIBA 1BA8B 1FY3A 4NIWA 1A0LA 5DG6A 2PP6A 3I78A 1SGIB 1XUKA 4DY7B 1ZGVA 5B6OA 1IQJA 1C9TA 4MNYA 2TGDA 2AGGX 1O5FH 1D3PB 1L2EA 2XBVA 1ZHMA 1WAYB 3OY5U 8KME2 4Z0KA 3PRBA 2H1UA 1H4WA 3TK9A 1ABIH 3LGUA 1A61H 1GG6B 3WWFA 3LT3A 3VB4A 8GCHF 3ZZ8A 3BEFB 1O5EH 5KECA 2WPDD 1BMNH 3LJJA 1P3CA 1BT7A 2H5CA 5L2ZH 1Y5UT 4GAWA 2CGAA 3P8FA 1XVOA 1FZZA 1W0KD 5JBAS 3SGBE 4ABEA 3BG8A 2Y80A 1ARCA 4F55A 1SOTA 3VXFH 2XC0A 3GCTF 4ZHLU 4BTUB 5JBCS 1KYNA 2CK3D 3U8TH 1C4U2 4YOJA 3HK6B 4K1SA 1EZUC 2ANYA 1N6YA 4OS1A 3U69H 4Y7BA 3MH5A 6ESTA 1TGBA 2CMYA 3BTKE 3S0NA 1NESE 1O3FA 3HKJB 1BTWA 1O2ZA 2JKHA 5ETXA 1ORFA 2AS9A 2FM2A 1C5UA 1W8BH 4MPUA 1T32A 1V2MT 3LC3A 3MU8A 1L1NA 2XTTB 1TGTA 1AUTC 1ZLRA 4B74A 4GHQA 4Y8XA 2QF0A 3TGIE 3QX5H 2GJGA 1C5XB 2QIQA 2A2QH 3UTUH 4CR5A 4NZQA 4OGYA 3OEED 2EY4C 1CT4E 1UVSH 1BUIA 1MZAA 1SFQB 2RDEA 4VGCB 2H9TH 3SV9A 1O3HA 2HRVA 4TY6A 2I6QA 1WXRA 1D3QB 1DFPA 1HAHH 1W13U 2V3OH 2WPKS 2AHME 4UD9H 3RXPA 2B5TB 3RMOH 3B23B 1H8ED 1PFXC 2FYRA 2GZ7A 3P8GA 1GVZA 1HBTH 3OYPA 3T29A 5EQRA 3UPEA 5LPFA 3ATMA 4K8YA 2OD3B 1GJ5H 2QC2A 1PQAA 5HYOA 1O3PB 4FU7A 4CHAC 1T8MA 3TH2H 1WYKA 1UTJA 2A2XH 4XD7D 1GI9B 5T6GA 1W0ZU 4Y7AA 1UHBA 1DANH 2VIWA 1Y3WA 3RXOA 2TIOA 2B8OH 1AMHA 1PPCE 2ZHEH 3BSQA 1GHZA 4KTSA 3STIA 1B7XB 2P94A 1EQ9A 3MMGA 4CBOA 5DGJA 1HAZB 4DT4A 1YF4A 2KX4A 1S82A 5EXNA 1O38A 2PTCE 1E38B 5A0BA 1UW7A 1WQSA 5EGMA 1P2NA 1ETSH 3ZIAD 3O8BA 3FZDA 4AFSA 2KZ4A 3DSGA 1WTHD 4TPYA 5EOKA 1QZ8A 1YPHE 5LPRA 1P2OA 4NSVA 3QWCH 4B73A 3OTJE 5CHAB 2G4TA 1G36A 1P04A 4ISLA 1Q3XA 2OUAA 4RN6A 5I25A 1TX7A 4O03A 1VR1H 1D3TB 2ZHFH 3FAOA 2TBSA 1ZRKA 3TNTA 4OGXA 4BXSA 2P3FH 5F8XA 1O35A 4JZIA 1XM1A 2UUJB 1TQ0B 1DXPA 3ODDA 4Y10E 1S6HA 3NCLA 4X8TH 1GMHG 5EIYA 3V3MA 1L4ZA 2P3TB 1ANEA 1TNJA 2UUYA 1AKSA 1AFEH 5BRRE 1A4WH 3KF2A 3DUXH 1RJXB 1O3IA 2ZU4A 1GJ4H 2OC8A 1ETTH 3ZZ9A 1WTGH 4FU9A 1O3GA 1O2OA 2F9OA 1Y8TA 1A5HA 1EAIA 1HXEH 2ZCLP 4FUBA 5GXPA 1WCZA 1FY4A 3SZNA 3K9XB 1XUJA 2YNBA 7ESTE 3E90B 3RXLA 2Z3CA 2A0QB 3KYFA 5C2ZA 3GY4A 3TJNA 2QXHA 1LKAA 3L6PA 1Y5BT 3CS7A 5DN6D 2ZECA 5C17A 1T4UH 2AGIX 1LHEH 5A09A 2D2DA 1J14A 1GWAA 3GCHB 1YLNA 1O2VA 1L1GA 1A5GH 1GBIA 1D9IA 1FIZA 1AVGH 3KQ5A 1ZSKA 1BQYA 1ZHRA 3H5CB 2GVFA 4X6PA 1TBRH 2HPPH 4J2YB 5FXLA 3U28C 3UQOA 4DCDA 2Y82A 4ISOA 2PSXA 3P8OA 3PLKA 4Q7ZA 1O5GH 3BTEE 2ZFQH 1JIRA 3ZZ4A 4RSPA 3SW2B 1LVOA 1ZTKA 2K1QA 3QZQA 1KXAA 3RP2A 3A8CA 1GBHA 2Z6BD 2GT7A 2IPHA 1P05A 2LPRA 1V2WT 5SGAE 2EEKA 3A81A 2BDBA 4A1VA 4ASUD 4A5TS 1KLJH 1BJVA 1SQTA 4ABAA 1CHOG 3FP6E 1SGPE 1PPBH 2VGCB 4CRFA 1P2JA 1TYNA 1QR3E 3QK1A 1GHBF 4NWKA 1VJ9U 2ASUB 1MD8A 1FN6A 2O8MA 1Q2WA 3HK3B 4D7GA 1LPGB 2A7CA 3M37A 1YCPM 3RMNH 1K22H 4IBLH 2F43B 1HUTH 3LJOA 3NWUA 4FUIA 1L4DA 5DP5A 1FPCH 7GCHF 4RT1A 4I86A 1GBMA 1T4VH 1TIOA 2ZHWH 1TBQH 4ZKSU 2KCAA 1GGDC 1ANBA 1P0SH 3S7HB 1LQDB 2Y6TA 4BXWA 2BDHA 2BLVA 1K21H 1UK3A 4X6MA 2SNVA 1J9CH 3DCLA 1EJAA 1F2SE 4B71A 4NG9H 2G00A 4D9QA 1RTKA 4WXIA 1GMDG 3LH1A 3Q00A 2ZU1A 1LVYA 1O3CA 2GCHF 2CN0H 2AIQA 3ELAH 1O3NA 4O3TA 4NZLA 1P11E 5C1UA 2BLOA 3M7UA 1QBVH 2NU2E 1HJ9A 1IQHA 2OC1A 3EDXB 4MPVA 3TGJE 3ZV8A 3WY8A 2C8ZB 3P17H 2NWNA 1GGDB 2Y5GA 5GPIB 1XX9A 1EJMA 2FTMA 1C5PA 1P57B 2FOHA 1MD7A 1NT1A 2ZGCA 1UVUH 1ELFA 2XXLA 1Z8IB 1XUIA 1SHHB 2PUQH 2ZHDA 4BTIB 1O5DH 2F9PA 1RTFB 3DFLA 2AMDA 1Y3VA 1E36B 3SI3H 1ZTJA 4X1SU 2HNTC 1HGTH 3RXIA 1V2TT 1WBGB 1C1QA 1EOLA 1Z6EA 3PV2A 2Y7ZA 4BAOB 1D6RA 1HNEE 2OQ5A 4AG2A 2W7SA 5ESBA 1GI6A 1AD8H 1YCPK 4LZ4B 1ID5H 1SVPA 3SNAA 1ELDE 2HOBA 6CHAC 1AWHB 3T62A 2AIPA 2ZPRA 3BG4B 1WSSH 2ZGXH 4INHA 4CRGA 1O3OA 1E37B 3SU3A 3HGNA 1NFUA 2HGTH 1EB2A 5T6DA 3IITA 3L33A 1SQOA 4X1PU 1GVLA 2V0BA 1DICA 3BEIB 3KQDA 5HGGA 2BTCE 3AAUA 3STJA 1C5WB 4U2WA 1EAXA 4K69A 2QE7D 4UEHH 1QQUA 1Z8JB 3F9HA 1HAPH 5A0CA 2GDEH 2M5TA 3UQVA 2A1DB 1TRMA 4ISIH 2A4RA 4IGDA 1T8NA 3AW0A 1KDQA 3E8LA 6CHAB 3NUMA 2A5AA 1NFYA 1YBWA 3SHAH 3GCOA 1GJDB 4QT8C 1QY6A 1OP8A 1CSOE 4RT0A 1GBKA 4BAKB 4HGCA 3N7EA 1PPHE 1S5SA 3TVJB 3HPTB 4LZ1H 1S85A 1TB6H 1D6WA 1Y59T 4LK4A 1MKWH 1A3BH 1C1OA 2XW9A 4B1TA 1K1OA 4YOGA 2C4FH 1OS8A 2FESH 5EW1H 1CT2E 1DITH 1HAVB 1ARBA 3MQKC 4XSKU 1W7XH 3DFJA 2FDAA 3F1SB 2G4UA 4GCHG 2VH0A 2BLQA 4AFZA 1C5QA 5C67A 1AUJA 3FOAA 5F53A 4B76A 1GHVH 4I32A 1SGCA 1MCVA 3SV2H 2GCTC 5AFZH 3GOVB 3SI4H 4FVDA 1X7AC 1O3DA 5FCRA 2OQUA 4IW4E 4E06H 3BTHE 1SGYE 9LPRA 1JWTA 2GX4A 4O9VA 1AIXH 1GBCA 1K0HA 1DUEA 4X6NA 1EKBB 3T5FH 4F49A 4MG3A 3BTQE 5DSFA 2FTLE 3SJIA 1FQ3A 2YNAA 2BX4A 1UK4A 1O2LA 1RD3B 2O9QA 3MO3A 2YMSD 1CU1A 1LDTT 1MMJN 2JH0D 3K6ZA 3M36A 2BY7X 2GCTB 5TCCA 1CGHA 4JK5A 3O8CA 2GMTC 1FX0B 1ELTA 5F6MA 1H8HD 1GI1A 1FMGA 3EGKH 5HMAA 1O34A 1WUNH 3FP8E 2BZAA 1HFDA 2RA3A 5L30H 2ZQ1A 4FXGH 1AU8A 1PQ5A 1UTMA 5EPNA 1COWD 1GBJA 4R8TB 1C5LH 1C2IA 2GZ9A 1KXBA 1MTUA 2WPLS 2G5VA 5AVDA 2ZF0H 1SSXA 1CQQA 3QLPH 4Y6DA 2HWLB 3UFAA 3A80A 3VGCB 2V6NA 1C1WH 4IN2A 3KQEA 1VITG 3ZVBA 1GCTC 1MU6B 3F3BA 2ZKSA 2GMTB 4LXBH 5DPAA 2CV3A 3Q3YA 1BITA 1LVBA 3A7TA 4Y79A 1EPTC 1THPB 1F5KU 3NXPA 1F0UA 3DD2H 2ZP0H 5H4IB 3OE7D 1H9HE 2NU4E 4OS7A 1QA0A 1Y3YA 3RXDA 4ABBA 2UUKB 2ZDMA 4NIYA 1F7ZA 3LOXA 1IQNA 3MU1A 4TT3D 4D8NA 1MTNB 3WW7A 1O39A 3RLWH 2ZDLA 3LIWA 1JIMA 1BMMH 1YCPH 1O33A 1TMUH 1QJ1B 3RXJA 5FAHA 1KXDA 2G52A 1BTYA 2PKSB 1EPTB 3MO9A 7KMEH 4H4FA 1G3EA 1MAXA 3C27B 3MNSA 3ATLA 3RXAA 1TGCA 3UAIC 4OS6A 1NTPA 2FOAA 1DDJA 1DOJA 1SLUB 5DKMA 1SGEE 4Y11E 1O2PA 2AMPA 4ABGA 3T27A 1QIXB 1NPMA 1CA0B 2BX3A 3RXBA 1HCGA 1O31A 4NFFA 5T6FA 1BTZA 2GGVB 1ELEE 3M5OA 5JDUB 3KEEA 5FBEA 3V7TA 1C2KA 1EAUA 2QN5T 3UNSA 3AASA 1BDAA 2BDYA 1K2I1 2C90B 3LGTA 3A7VA 3PMHB 2UUFB 3KN2A 2BQ6B 4WMEA 1MAYA 4Z1MD 1UVOA 4U30A 1SGRE 2ZCKP 2SGQE 5C5NA 4XBBA 3TNSA 3HKIB 3HATH 1CGJE 4TSFD 1GI2A 2Y5HA 3T26A 1CA8B 1N6XA 1LPZB 3ZYDA 2KAIB 1A5IA 3CS0A 2PW8H 3ZVFA 1FAKH 1FN8A 1GBLA 1C1MA 4KP0A 4XFQA 1GI4A 2L6OA 3GISB 1BCUH 1AWFH 2VU8E 3S9AA 5C1XA 5C1YA 3RLYH 1KXFA 2JETB 3EE7A 3ZYEA 5HIZA 4CRCA 2ALVA 3NRLA 2FEQH 2RFKC 1V3XA 3R0FA 4NA9H 4XRNA 1P2KA 3VB5A 4K60A 4DURA 5EJZA 1Y5AT 1HAGE 3E3TA 2TRMA 3GS9A 1FY5A 1BBRH 3N7OA 4Q7YA 1GBDA 1C1PA 1HIAB 2W7UA 2BXTH 2XCFA 4CR9A 4VGCC 5CDFE 4AB9A 3SNEA 1G9IE 4AZ2B 4GVUA 1C5ZB 2TGTA 1EASA 1W14U 4JYUH 1V2VT 4K2YA 1E79D 1CO7E 1CHGA 2ALPA 4MNVA 2OBOA 4K8BA 2LP6A 5E8EH 4D76A 2L74A 2F9BH 1QTFA 3QTVH 3NKKA 1TONA 2WPHS 4OM9A 1P03A 6GCHG 3KNXA 3Q76A 5CMXH 3RU4E 2GDDA 1O2YA 3BF6H 1F5LA 3VFEA 2J92A 1Y3UA 1NO9H 2Q6FA 1D4PB 4A6LA 2XCNA 4ZXXH 2OC7A 2Z3EA 3PTNA 3LDXH 3A7ZA 3PYHA 1VCWA 1GBBA 5AHGH 1GI5A 2A32A 2SGFE 1GBEA 1T7CA 1RIWB 1C2DA 1O2UA 2BD5A 3U9AH 2GKVE 3ZZ7A 5C5OA 5CHAC 2J97A 1S83A 1ZHPA 4I7YH 4ZKRU 4WMDA 1OWDA 5ABWA 3P92A 3P95A 2PWXA 4ZMAH 5C94A 2PUXB 1EP5A 2ZFFH 4FUJA 1AZ8A 5EW2H 1GHXH 1OOKB 1V2UT 3BTWE 2FWWA 2XOKD 5FHTA 3VPKA 4B2CA 1MTWA 1NM6A 2F83A 4F4OC 1UJ1A 3UR9A 2H9EH 4KTCA 4NSYA 1TNKA 4UFDH 3RM2H 4YO9A 3A88A 1P09A 1FLEE 3GCTG 2VWMA 4JYTA 2A5IA 3IG6B 4MTBA 1W12U 2P8OB 4AFUA 1SGQE 1P2IA 4BOHA 1GI0A 4ZHMU 3CNRA 1MQ6A 1H9IE 4CH2B 5C20A 1S6FA 1CHOF 1O2GH 1W7GH 3UWIA 4A92A 3UOPA 1O2RA 1C9PA 1SGFG 3GY6A 3U8RH 4WWYA 1GJ9B 2RG3A 3SNDA 3MH7A 3LH3A 1O32A 3QZRA 1C5NH 3EE0B 3BTGE 3TPIZ 1KMHB 2BVSH 3QUMP 4XBDA 4YXWD 4JZ1A 1FV9A 3OX7U 2WV9A 3PB1E 1C5OH 5DP8A 4XOJA 1VJAU 1TNGA 4WMFA 2PGQB 1OWJA 3GCHC 1NFXA 1BRAA 2SGAA 2JJ1D 2NU1E 2C8YB 2TGPZ 3EA9A 2IJD1 3M5LA 1HJAB 1YWUA 1QB6A 5TCAA 2FS9A 5C0TA 1OPHB 4A1XA 3A82A 1AGJA 5T3HA 3A83A 3FVFB 4FETA 4AN7A 2G55A 2FODA 3OSYA 2G51A 3GY7A 2ZDAH 1P3EA 1V2KT 1TNLA 1AY6H 1C5VA 2F3CE 1P06A 1G3CA 3FKSD 1O0DH 1THRH 2JJ2D 1ELCA 2FOMB 1TA6A 2FO9A 4YM9A 1YLCA 1O2XA 4M9FA 1BTPA 2HLCA 3PWBA 8LPRA 3S69A 2WPIS 2HVXA 1F0RA 4I8GA 2QGRA 4RKJB 1C5MD 1MKWK 1BB0B 1ELVA 1S84A 2VGCC 1AE8H 3GY2A 4GPGA 1BHXF 1T8LA 4Y71A 2ILNA 6LPRA 1LHDH 5JYIA 1UTPA 4AFQA 3T2NA 3ATIA 4NCYA 4GSOA 3OEHD 4YLQH 3SZEA 2QA9E 2FYQA 4D7FA 3LGWA 3EA7A 2VB0A 2ZDVH 2ZTYA 1ZGIA 1QA7A 5L6NH 1Z1JA 4CRAA 2ZFSA 1Z6JH 4NIVA 3MI4A 1SGNE 4E05H 5F03A 4DIHH 1S81A 3TK5A 1CGIE 4IC6A 4ZUHA 5J4SA 3PV5A 2OP9A 4X1NU 4XBCA 2R3YA 1BMLA 4DJZB 3P6ZB 1TNIA 4CRBA 2ZHQH 1ZTLA 3ITIA 2BLWA 3A85A 1D3DB 3D62A 2J98A 4CBNA 1VCPA 2B0FA 3E16B 1PQ8A 1TE0A 4MPXA 4ZXYH 1QRWA 2W5EA 5I46H 1EZQA 1SL3A 3N7DA 4Y0YE 1GHAG 5IK2D 1AI8H 3N99A 1TGNA 2Z9KA 4TYDA 2QV1A 2BY6X 1LPKB 2BVXH 2ZPSA
chains in the Genus database with same CATH topology
1J16A 2OLGA 5L2YH 1NFWA 2VWLA 2QF3A 4Y0ZE 1G2LA 1TPAE 3GY5A 2CXVA 1C1TA 3JZ1B 2HALA 5HXFA 1UTNA 2G8TA 1Z8RA 1DY8A 1K1JA 1JRTA 1TMBH 4TWYA 1GJ6A 1MTSA 1OWHA 2VIPA 4WY3A 4GLYA 3SJKA 1DWBH 3OY6U 1F0TA 3ZVDA 1CVWH 3U1IB 2QXJA 2XC5A 2AYWA 3IWMA 2Z94A 2FI4E 3MWIU 1ESTA 2QXGA 1O2KA 3RXHA 1QBNA 3NK8A 2ZNKH 5A2MH 3I77A 1IQKA 5GCHF 1AVWA 2GP9B 1VCQA 2VIOA 1ZSJA 3BG4C 1EZXC 3MTYA 1QGFA 1RFNA 1SHYA 3GDSA 4KELA 1ANCA 4UFFH 4AYVB 4AG1A 1NROH 2UWPA 1WQVH 3RC5A 3MNXA 1NRNH 4Q7XA 1BTXA 1YLDA 4X2WA 4GCHF 4UE7H 3SV8A 1UHBB 2P16A 2Y5FA 1G2MA 3G01A 4Q2KA 1GBTA 2O8UA 3Q3KA 1EPTA 1C2GA 1O3JA 2XYAA 3A7WA 2C93B 1C5RA 2VH6A 5FPSA 2W3IA 1PPGE 3PMJA 1GHWH 1XUFA 1GHBG 4DT7B 1CT0E 4YT7H 1QNJA 4SGAE 1WOFA 4J1YA 3F9GA 2OCVB 2FZZA 2ANMH 2H5DA 3PLBA 4M7GA 2PFEA 4BAMB 1DVAH 1ZPBA 2RDLA 2Z9JA 1MCTA 1ZYOA 1AB9B 3QTOH 2GD4B 1MTVA 1S0QA 3BIUH 4B75A 3SNBA 2BD7A 2D26C 1RTLA 3TJVA 4FVBA 4ABJA 1SGDE 1K28D 2FI3E 1KXEA 3SQHE 3TH4H 1NZQH 3MNBA 4A7IB 1FAXA 1SC8U 3KQCA 2R9PA 4Z6AH 1SGFA 3RM0H 2C3SA 2BDIA 3FANA 1BOQA 2KAIA 1O2JA 4NIXA 1YPMH 1ZJKA 4MVNA 3A7XA 3EYDA 1VZQH 3SUGA 2GCHG 1AKSB 1GDUA 1QJ6B 5EQSA 2PTNA 1O30A 1IQEA 3V0XA 1GJBB 2A31A 1YPGH 3M35A 3PLPA 1SR5C 5LH8A 2BY9X 1EXFA 3E6PH 1ZPCA 1NU9A 1BBRE 1VITF 4OS5A 2J34A 2YOLA 1N8OB 1GDNA 1GMCG 3SV6A 1C2FA 1FY1A 4JZFH 4MNXA 4MPWA 1GBAA 3URDA 1J8AA 2BDCA 1JXPA 1O37A 1YPHC 3ZVGA 1OXGA 1HIAA 2HNTF 1BBRK 4Y8ZA 4WVPE 1GJ7B 1V2RT 3URCA 5HM9A 3M3TA 2J38A 4THNH 1EOJA 2VVVA 3A7YA 1ZMLA 1FIWA 1EP6A 2ZDNA 1TRYA 3K65B 2D1JA 4B2AA 3ZV9A 1HYLA 3M5MA 1XXDA 2UWOA 1DSUA 1GDQA 1VGCB 4DG4A 2QY0B 4K3JA 3UY9A 3M7QA 3W94A 1ABJH 2WUCA 2P95A 4MQAA 2R2WU 3LKWA 2ZU5A 3SU1A 2F9UA 1SMFE 3RXEA 1CBWB 1UCYE 2V35A 3K6YA 4I31A 3VGCC 1MUEB 4IC5A 2WPJS 3TIUA 2SFAA 3SU0A 1V2OT 3RXRA 3JZ2B 1C1SA 3GYMA 1DWCH 2STAE 1LTOA 3QO6A 1IQMA 8ESTE 1HLTH 3OU0A 3O8RA 3ZZBA 1B0FA 1UCYK 2DUCA 2GV7A 1ETRH 3TK6A 4ZROA 1GVKB 4X1RU 4UFGH 1OP0A 1QB9A 4BTTB 1E34B 2WV4A 3PROA 2ZC9H 1TNHA 1DWDH 2RCEA 3MU4A 4NGAH 1TPOA 4K5ZA 2B7DH 4YT6H 4E7NA 1QCPA 1F5RA 5EPYA 1FXYA 2BQWB 2VIDA 1FDPA 1HAXB 1MTNC 3ZZCA 1DS2E 4OS2A 3VXEH 1TALA 2XWAA 3SU5A 3V13A 1EATA 1OWIA 1XUHA 1BIOA 4Y76A 3RDZA 3RC4A 1O2SA 4X2XA 2O8LA 1WV7H 2PKSC 2PV9B 1YPKH 4AGJA 5FPYA 3V12A 2BVRH 1LVMA 3MO6A 1QHRB 1W10U 1E0FD 3HGPA 3SBKA 2P93A 2THFB 1J15A 5FX6A 1BMAA 1CA0C 5IDKA 1GJAB 3BV9B 3M3VA 3KGPA 1O5AB 2DE9A 1PPFE 1BJUA 1B0EA 1O2WA 4GUXA 1YPJH 1HDTH 2EA3A 5JPMH 2QCYA 3BTFE 4BAQB 1RGQA 3PM3A 1TX8A 5LPEA 1TQ7B 2ESTE 5G4BA 2ZU2A 3Q3XA 2EI6A 2VINA 4D9RA 1SG8B 4DVAU 3MU5A 2ZFPH 1FNIA 1ESAA 1TABE 4MLFB 4AB8A 3M5NA 3B8JA 2FOEA 3ZZ5A 4I33A 2A4QA 1EUFA 2ODYB 1XMNB 2A4OA 3UNQA 3SO3A 4TPIZ 4DIIH 1N1LA 3QDZB 3UWJH 1AHTH 1LKBA 1XKBC 1OKXA 3ATKA 1A2CH 4INLA 1P9UA 2A45B 4ZKNU 2JETC 6GCHF 2VWNA 3PO1B 4YLUA 1ELBA 5LGOA 2VIVA 5E0HA 3ATWA 4AYYB 7LPRA 4HFPB 1GI8B 4U01A 3AVZA 1INCA 3KL6A 2Z9IA 1ESBA 1PPZA 1O2TA 1ZRBA 4PROA 3MHWU 1U6QA 1H8DH 3VB6A 5DP6A 1TFXA 1DT2A 1C2LA 3ENSB 3E1XB 4WXVA 3BTDE 1S0RA 3BEUA 3NPSA 4UFEH 1GBFA 3ZZ3A 1O3KA 1K1NA 2AEIH 3A8AA 3S7KB 5EXLA 1KDQB 2NU0E 2BD4A 1TA2A 2J94A 4X8VH 4CRDA 3SUDA 2PSYA 2XBWA 3GDVA 2CJIA 2BY8X 2BD9A 2Z7FE 4X6OA 1TRNA 4ZKOU 3D65E 3DHKH 4NWLA 1TPPA 5FPTA 1LCYA 5A8ZA 1F0SA 1HXFH 2BM2A 1C2JA 1SB1H 1ZPZA 3AW1A 3RXKA 1QRZA 4X1QU 3RXVA 1O2IA 4XDEA 1QURH 2FOFA 4NFEA 3EAJA 1QB1A 2STBE 1EB1H 2FPZA 3UR6A 3A8BA 1RS0A 2QAAA 2OBQA 2P3UB 4MDSA 1A7SA 2HNTE 1AO5A 2HPQH 1W3CA 3SJ9A 1MBMA 4SGBE 2SGPE 1Z7KA 5E0JA 2H2ZA 1P2MA 1H9LB 2ZWLH 1BTUA 1RIWC 1UVTH 3A8DA 3W95A 3UOUA 2BHGA 2XNIA 1TPSA 4ABFA 1NRPH 1TOCB 5BPEA 4DW2U 3ESTA 1KIGH 2BY5X 1C1UH 1SLXB 3AAVA 2AERH 1GMHF 2FLRH 1O2MA 1P02A 3GICB 1JRSA 3H7TA 3TLOA 5DP9A 1H8IH 1UCYH 1K1PA 2JH6D 3SUEA 3P70B 5E0GA 2PHBA 1HAYB 3FZZA 4ZHAA 4E7RG 1YP9A 1IQGA 1V2NT 3PMAB 3LPRA 1P8VC 2SGEE 4CREA 2P8OC 3A89A 8GCHG 1QL8A 3S9BA 1O3BA 2FP7B 4BAHB 2IJOB 2FI5E 1V2PT 5ESTE 3S9CA 5JBTA 2LNCA 1IHTH 2IOTA 2PKAB 1TOMH 5HM2A 2SGDE 2PGBB 4A1TA 1DUAA 1W2KH 2FOBA 2W26A 2QXIA 1SBWA 1G3BA 3Q77A 2FS8A 3CP7A 4TWWA 2RA0A 1T8OA 1GL0E 5A8YA 1FY8E 3T28A 4HI3A 3UIRA 3SORA 2AFQB 1OYTH 1ZR0A 2CF8H 3E91A 2ZQ2A 1GJ8B 1UTQA 3BN9A 2FOGA 2XWBI 4FUHA 1AZZA 1DSTA 3SU4A 4ABDA 5JB8S 1ZSLA 2DE8A 1PJPA 1OX1A 4IN1A 1HJAC 3UUZA 1NS3A 5J4QA 3A84A 2A4GA 1O5CB 3ZVCA 3F9FA 1MKXH 2ANKH 1THSH 2F9NA 1ELGA 4ABHA 2FXRA 1HAOH 1KLTA 4CHAB 4Q80A 2TGAA 1BHXB 3RXMA 4HZHA 1OP2A 2Y7XA 3LONA 3TU7H 3UNRA 2GTBA 2H9HA 2FIRH 4FUDA 1LHFH 5C3NA 4KTUA 5DP4A 1FJSA 1GHYH 3NZIA 1IHSH 4KKDA 5DK1A 1GHAF 2ZFTA 1BRBE 1SFIA 2BD8A 3DT0H 2NU3E 1P9SA 4ISHH 1O3EA 3LGVA 2OC0A 2VVCA 1UTLM 3SU2A 3RMLH 3SGQE 1H1BA 3RU4T 3UREA 1Z8GA 1GMDF 2GT8A 4X0WU 1P12E 2VNTA 1DXWA 1ZJDA 4OS4A 1B5GH 1ZMNA 2A7JA 2BB4A 2XBYA 2ZI2H 1HAVA 3GCNA 1W11U 2ZFRH 3RUOA 2R0KA 1PQ7A 1SOZA 2OXSA 4YTAA 1TX6A 2IN2A 4AORA 4WF8A 4UONA 2VVUA 4IMQA 1EX3A 5F8TA 1YGCH 3FP7E 4I8HA 5K0HA 5TJXA 1DY9A 3B9FH 1TAWA 5PTPA 1IQLA 1IQFA 1KLIH 2VWOA 2FOCA 1BZXE 2J9NA 3LU9B 3TH3H 4ASHA 5K7RA 3RXUA 1HB0B 1IOEA 2P59A 4JYVH 2BQ7B 2J4IA 3DA9B 1OWKA 5JB9S 1C2HA 5F8ZA 3SUFA 3ODFA 2XRCA 2BMGB 2PR3A 5A0AE 1AE5A 2G5NA 4K1EA 2WUBA 4FUCA 4NA8A 1P10A 1W0YH 1MU8B 2R3UA 4YESB 1YYY1 1O3MA 1VITH 4HTCH 1UMAH 3A86A 4IS5A 1GL1A 3A87A 2Y81A 3F9EA 3E0NB 4H6TA 1G32B 1O2HA 2ODQA 1QQ4A 1ACBE 2Z9GA 1UTOA 2ZGBH 1C5TA 1O36A 3K2UA 1KTTB 2AH4X 2TPIZ 3I29A 3KIDU 1A1RA 2AGEX 1O2QA 1GI7B 1DLEA 3E0PB 3GY8A 4WH8A 2ODPA 1A0JA 2ULLA 2ZG0H 2PLXA 1YC0A 3EQ0H 4AX9H 5GJ4B 1WU1A 1YPLH 4FU8A 1AVXA 2VJ1A 3RXCA 3SN8A 3M61U 1C1VH 2V3HH 2ZDKA 1TBZH 2ZGJA 4GHTA 5EODA 3VB3A 2EI8A 5DP3A 1GJCB 1MZDA 1A46H 3BTME 2XBXA 1C5YB 1BRUP 3F6UH 3RC6A 1EAWA 2BXUH 2FMJA 1LQEA 1HJ8A 4Y8YA 1C4V2 1GMCF 3PTBA 3SGAE 1QL9A 3GYLB 4YOIA 4IMZA 1NC6A 3MYWA 2BD2A 5DJ7A 1AB9C 3MH4A 5E2OA 1FUJA 5DP7A 2R2MB 3RMMH 1AQ7A 4LOYH 4ESTE 3RXQA 1C2EA 5A8XA 2ZTXA 3BIVH 4JZEH 3C1KA 2BYAX 4NA7A 3VEQB 1QL7A 2G81E 4I8LA 3QGJA 1K1MA 3PWCA 1IAUA 1LMWB 4BANB 3SQEE 1FI8A 1ZOMA 2I6SA 1DX5M 1O5BB 2D8WA 1Z71A 4AGKA 4X8UH 1SI5H 5FBIA 3RU4D 4I8JA 3VB7A 3TITA 2BDAA 2GZ8A 1K1LA 1E35B 3U98H 4DOQA 1EZSC 1RRKA 1XVMA 3SHCH 2A5KA 1BTHH 4O3UA 7GCHG 4XE4A 2C8XB 1GI3A 1KTSB 3RXTA 5FCKA 1N8OC 4H42U 1ZMJA 1J17T 1FPHH 1YPEH 1BRCE 4FUFA 4U32A 1C1NA 2H6MA 9ESTA 1Z1IA 1QJ7B 1ANDA 1QBOA 1DPOA 2XC4A 1SLVB 4YZUA 4AOQA 2A7HA 3SU6A 4WH6A 1K9OE 1KXCA 2J2UA 2WPMS 2BD3A 3ZVEA 2WYJA 1HRTH 3ZZDA 4X2VA 3RXGA 1TGSZ 1QFKH 3LGIA 2FX6A 1P2QA 1VGCC 1XUGA 2ZEBA 1NY22 2ZPQA 1MH0A 2ZA5A 2VIQA 2Z9LA 5GCHG 1ELAA 1NRRH 4UDWH 3TJUA 1CBWC 4B2BA 1SQAA 1A3EH 1LO6A 1KSNA 2F9VA 1EJNA 3QN7A 4JK6A 1QRXA 1C5SA 1JMOH 2SNWA 1KY9A 1UK2A 3BTTE 4JMYA 4X2YA 4JZDH 5JBBS 1V6DA 2OTVA 1L0ZA 1GCDA 3M3SA 3CENA 4INKA 5EU8A 3MOCA 3T25A 1Q31A 3U8OH 1PYTC 1DM4B 4X8SH 3F68H 1F92A 1PYTD 2QYIA 2BOKA 3KHVA 1O3LA 1G30B 4RKOB 3FFGA 4ISNA 1A0HB 1IQIA 1NU7B 1T31A 1YM0A 1TWXB 3D49H 1SGTA 2ZIQH 2J95A 3TJOA 2ZCHP 1FONA 1O3AA 2BZ6H 3RXSA 5GDSH 5DO4H 1ZZZA 3ZZ6A 2AMQA 2R0LA 1JBUH 1P01A 1UO6A 1XXFA 4K1TA 3GY3A 3ZVAA 4R0IA 5FX5A 2O8TA 1MBQA 1G37A 2CHAC 5CE1A 1OYQA 3LGYA 4O97A 1RXPA 4FUEA 1G3DA 1HPGA 2ANWA 2WINI 3H7OA 1C4Y2 1DLKB 2Q6GA 3SJOA 3P8NA 4BNRA 1HAIH 3U1JB 1AN1E 2Q6DA 2W3KA 1XKAC 3QGNB 4KGAA 3O8DA 3SNCA 2FLBH 3MFJA 3D23A 1SLWB 1V2JT 1C1RA 1AFQC 2JH5D 5IYTA 5EQQA 1C2MA 1O2NA 2EC9H 3PMBB 3SOSA 2PKAA 1K1IA 4ZH8A 5EXMA 1Y3XA 4TY7A 4ABIA 1OSSA 3KCGH 4I8KA 2FX4A 2CHAB 1L1JA 2WYGA 4DGJA 5EG4A 3TGKE 3MU0A 3MH6A 4JCNA 3R3GB 2BDGA 5GWZA 3L3TA 2GV6A 4MNWA 1AFQB 2O8WA 2Z3DA 3EA8A 3SV7A 1UVPA 1NN6A 1TMTH 1NRQH 2WV5A 4FUGA 3ZZAA 1V2ST 1UTKA 1DE7H 2ZU3A 4H6SB 2ZTZA 3PO1C 1MKXK 4CH8B 3MNCA 5AFYH 1YKTA 3M7TA 2C8WB 2F91A 2B9LA 1V2QT 5E2PA 2OINA 1M9UA 1OWEA 2CF9H 2ZO3H 1GCTB 3LC5A 4ZAEA 1JOUB 5AF9H 1HV7A 1CE5A 4WJG2 3SJ8A 2Q1JA 1TLDA 1V2LT 1DWEH 1LHCH 2UWLA 1MQ5A 1SPJA 2BOHB 3RXFA 1GPZA 3PV4A 2EI7A 1NRSH 1GG6C 1LHGH 3KQBA 1PPEE 3GDUA 2ZGHA 2ZZUH 5GIBA 1BA8B 1FY3A 4NIWA 1A0LA 5DG6A 3I78A 1SGIB 1XUKA 4DY7B 1ZGVA 5B6OA 1IQJA 1C9TA