1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
1MKXK 4GPGA 2F9UA 1NP6A 2HYIC 4X1NU 1P75A 3WY8A 3EZ2A 1KOFA 2WWYA 2CGAA 1Q1BA 2JH5D 2C99A 4AI6A 2C96A 1KZ7B 1ZM4A 3GY3A 2J5XA 2ZETA 3H7TA 2ORVA 2YJTD 2OBOA 4MRRA 1PYTD 2X1VA 3AUXA 2QY0B 4ZHMU 2CN0H 2CHVA 1LF0A 1WV7H 1TMBH 3ADDA 4NIVA 5IYTA 4AB9A 4RKJB 3QF4B 3RVBA 1KMHA 4E07A 2JETB 1OKKD 1F5RA 1NN5A 4MKHA 4KODA 5E0HA 1SGPE 4NBSA 3GPLA 3KHVA 1CR1A 4G1UC 3GDUA 4GP7A 1GCTB 4AG2A 1ZM3A 1KI2A 4X6OA 2NO1A 1H1BA 1P9WA 1AB9C 2ZJYA 1RJ9A 4MG3A 2ERXA 3L33A 3PITA 1O2WA 2J34A 3IO3A 4TPIZ 5AHGH 1P0SH 2FG5A 2NU2E 1W47A 1HT1E 4ZMAH 1JJ7A 1V2QT 1L2TA 4Q1BA 5KPJA 1SLUB 5F6MA 2BXTH 1GL6A 3DHWC 3S7KB 2FE4A 1NIPA 1W36D 1KK2A 3EYDA 3CPJB 4XWAA 4KITB 4KGAA 4LHVA 1XBTA 4E05H 1S3GA 3AVQA 3HGNA 1BRBE 1FN6A 2VSFA 3OIUA 3RSLA 1XUJA 3S9BA 4DCTA 1F92A 1K28D 4JLJA 1C4U2 5T6FA 5EXSA 4NZYA 3DZDA 4M1MA 1NY22 4XVRA 1YPHE 3SYNA 1BJUA 3LDAA 3H7OA 1K1NA 5C5NA 3A4LA 4ESVA 1FXYA 1HNEE 2DPXA 3KKMA 3GCNA 3UWOA 1EQ9A 3L82B 2AS9A 1S83A 1MH0A 4MQBA 5SZJA 2BDTA 3T25A 1NJFA 1O3OA 2AL7A 2VWNA 5HZKA 1TGBA 1SVOA 1LPKB 3DOEA 1UKZA 4CH2B 4Z51A 2O8BA 3TBKA 2GDDA 3ZLJA 1QHHA 3RXRA 5EE9A 4AKHA 3MJRA 3GEEA 3I73A 3EW9A 1EX7A 3ENSB 5TVKA 5G3ZA 1U98A 5FHTA 2W6ID 3PG5A 1OIXA 1VCIA 1R8SA 5BRRE 2WPHS 4D6PA 3QO6A 1XTSA 1GUAA 5J4YA 2F7SA 1K5GA 1AN1E 2WJIA 2WWGA 1X1RA 4M9FA 1BKDR 3D49H 4RFSB 4CEHB 4JK6A 1NPMA 1Z71A 4CHAB 1N8OB 3K8YA 2LNCA 5C1BA 2ZE8A 2B21A 2A31A 1QJ7B 3KB2A 3NHAA 5KYKA 4MGKR 3UUZA 1JR3D 2FH5B 1JWTA 5GCHG 4PSKA 3UKDA 3SZEA 3TH2H 1XXFA 2ZI4A 3LY5A 4IDQA 3EPHA 2J87A 4A6LA 4Y7AA 1CR2A 1V2LT 2N46A 2PKAB 3DL0A 3TUIC 2CK3D 1XUFA 2EFCB 3GYLB 4BWYA 3KZ1E 4KU4A 3RRMA 1NM6A 1HUTH 4U01A 2AEIH 1HDTH 5FFMA 1RYHA 2WWXA 3SJBA 2OQ5A 3T34A 2GXUA 4LPSA 2BM0A 1IM2A 4JLDA 1SVIA 2EW1A 4AWXA 2D74A 4P3YA 3S1AA 2IA5A 4GZMA 1GPZA 3BTDE 3AEZA 4AKIA 3T15A 3RC6A 1W49A 1E2LA 4ZH8A 1KK0A 3RS0A 5F98A 2EFHB 2M5TA 1W1WA 2JJ8A 1XJCA 2CJWB 4GSOA 3LQQA 2CL6X 4DVGA 4KSBA 3RWMB 5KNBA 1O2NA 3QXSA 1EXMA 1E0KA 1P3CA 3P70B 1S4QA 2RGXA 2TGDA 1E1QA 1OLOA 1AZ8A 3SJIA 1AY6H 2W83A 3CENA 1VITG 2WPLS 1GMHF 1H8DH 2ODQA 4B3BA 1EESA 1S0RA 1ELEE 1VIAA 3TK1A 5J4HA 2XBVA 1J99A 1UK3A 2GMTB 3GY7A 3T62A 3FFBA 2GF9A 3SI7A 3N2EA 1Y5UT 1AVXA 5A2MH 2D2FA 2JA1A 1NROH 2G1KA 4JYTA 3ASYA 1GVLA 2CBZA 3RXSA 4CT4B 3NBZC 2B0FA 1IQJA 4MDSA 4OQLA 3PJRA 5SZKB 1N5IA 4AG5A 3KL4A 1C2KA 2J92A 1G16A 3A7ZA 3BTFE 1C5TA 4UJ3A 3OIVA 4IJMA 1GDUA 1DX5M 2FP7B 2VIQA 1YE8A 2OFWA 3RC5A 3QKRB 4NONA 1OXSC 4RFVA 1OFHA 4Y0AA 3RRYA 2RGNA 3QDZB 3A4MA 3OY5U 1TX4B 4Q4AB 1V2WT 3SU1A 5T1VA 5JSZA 4F4JA 1BH2A 4Y79A 2OQUA 2X77A 3OFND 3ZVMA 1JXPA 2XOKD 4RD4A 3FHTA 1P11E 2A5GA 5FPTA 4IEIA 3RXCA 2NOAA 1Z6AA 2FI3E 8ESTE 3EG5A 4CW7A 1UEIA 1GJ4H 2IYVA 4BEBA 4MA4A 1O2JA 3C4JA 1E0JA 3NTUA 2ZHQH 1KIGH 2HT6A 2ZVQX 3IO5A 5JB8S 1U9IA 1MQ5A 1EASA 4LZZA 2FTLE 1Z22A 1D5CA 3VR1A 1TGSZ 1OP8A 3U7EB 1C1OA 4C0LA 4AFSA 4XD7D 1K8RA 3A7YA 1EOLA 2UVQA 5CITA 4DSUA 5E8EH 3SBKA 4Q9LA 1QBKC 1KO7A 1E35B 5FOSA 4AX9H 3SS8A 1S84A 1MTVA 1H8HA 4FXGH 2ZGCA 1EPTA 2FX4A 2BVRH 1W13U 2C78A 4A1FA 2OZEA 2ZRGA 2RCEA 3AF3A 2ZNKH 1XM1A 1T8TA 2A9KA 3I29A 4DLTA 4HB0A 4CREA 4Q5IA 4PO9A 1N6NA 4UNPA 3W5IA 1KTSB 3QWCH 1GI7B 3PEVA 2ZRCA 4PPGA 4N1AA 1ZHMA 4UNQA 4HDQB 4JK5A 1GTVA 1G20E 1O2QA 1AO5A 2SGPE 3EZ7A 2XXAA 2XWBI 3GLFE 4W5JA 1LTOA 1GVKB 2OXRA 1N5KA 3R8FA 3ZVBA 1UBEA 3VGCB 2Y81A 4KO8A 5DGJA 1OWJA 3SV8A 4PANA 4JZDH 2EWWA 3BJIC 1M1YE 1WCZA 1SPJA 5JCPA 1MBQA 2Z9LA 5K0HA 2XC4A 1ZR0A 3K0CC 3GDSA 2FN4A 1Z2CA 4XIGS 2JJ1D 1UVTH 1C1SA 3PLKA 3T1TA 4OL0A 4EJSC 4CH8B 4LHWA 1CS4C 1DO0A 1E2DA 3SEAA 2CVHA 2G1JA 1FMJA 2WPIS 1TPSA 1SVKA 4LHZA 4KBGA 3DHKH 2GJSA 1C2HA 1TX6A 3LH1A 5A0FA 1XNJA 1B0UA 2BWJA 1NY5A 3RXKA 1UO6A 4GHTA 1JAIA 1MABB 1DAEA 4JYVH 4HGCA 2PHBA 3A80A 3KN2A 4GVUA 1E94E 4OQNA 1SGWA 1O33A 1HE1C 4L15A 1OIWA 3M61U 3OYPA 5IDVA 4ZXXH 2A78A 1RXPA 4B6EA 3E0PB 2IHBA 2A45B 3BEUA 3UNSA 3J81k 3B2EA 2ZDKA 5FXLA 1LVYA 3TMKA 5AUQA 3ZYCA 4EDHA 3QKUA 2J7PA 1C5ZB 1JJVA 3PLPA 1SOZA 2WVJA 3CW2A 3UWJH 1IY2A 1E1RA 1RFLA 4BLOA 1B7XB 2I1VB 3LC3A 3FFAA 1ZU4A 3TVDA 1FQJA 4UJ5A 1CA0C 4KFRA 1COWA 3ZZUA 1F7ZA 3SV7A 2AK2A 1O2YA 1EFRD 4I8JA 1E2GA 1A2KC 1GIAA 5BYJA 1LMWB 2XZPA 2Q1JA 4FXPA 2CCKA 3RMNH 3KTAA 2VGCC 3KF2A 3LAWA 5JECA 3K0AA 2UWOA 1C5YB 3I61A 5J4QA 1QURH 4Q1FA 1LHCH 4AIIA 1J15A 2QU8A 4X6MA 3QVUA 4D2IA 2F3RA 5EXPA 1E79D 4KSCA 2MMGA 2HCBA 2P67A 1Y8TA 1P60A 1W7GH 1HAIH 5FOWA 4OHXA 1ORFA 4KV9A 3QI2A 4DLSA 2KJQA 4IFEA 1W14U 1K1OA 1A2CH 1DEKA 4HSEA 1KSGA 1GRRA 2RG3A 7KMEH 3TVJB 4I8HA 1N6LA 2GZ9A 2GCPA 5A5GA 2QTFA 3MO3A 1C4OA 5G53C 4YMUA 4ZUHA 5BN4A 1AN0A 3AW0A 2XNSA 1FQ3A 1S96A 2W2VA 2Q3MA 2VHJA 2JAQA 1LNZA 2Z6BD 1W10U 1KYNA 2ZAOA 2GTBA 2EI8A 3AQ4A 1GVNB 5A0BA 4H42U 1CJVC 2ZTZA 2DE9A 4MVNA 1UVOA 3WMFA 1OF1A 4BFUA 1MD7A 1TEVA 1A46H 3RNLA 2C04A 2UZ3A 3RMMH 1Z0KA 3F0TA 3B6EA 3O8RA 4Y0VA 5ANRB 1XMVA 1C2DA 5AJZA 1VIYA 1E0FD 5C4GB 3MGCA 2ZA5A 1PYTC 1BMMH 1W5SA 2VSXA 3A88A 1GGDB 4YZUA 4Z1MD 1UVUH 1J90A 2BD7A 1CXZA 1WXRA 3Q00A 1ARBA 3KQNA 1DITH 1SC8U 3DMDA 1ZTKA 4Q4LA 2VF7A 1AIPA 2CNWA 4XTCS 4TY6A 4DGJA 2BD4A 4TMXA 1A1RA 2JEOA 1AE5A 3LVQE 4UFGH 2SFAA 4DDTA 3SE0A 1NU7B 2IYRA 1JI0A 2QMUA 4MPVA 1D6WA 3GJXC 1Q3TA 2OCBA 4D7FA 1FNIA 1L0ZA 2QMEA 4JZKA 3TW4A 4NKRA 3U5ZB 2O8WA 1GBFA 4DCDA 4LBVA 4GOJA 1EJMA 2VP6A 2V1UA 2QQ0A 4Q01A 4LJ5A 1BRCE 2CE2X 1P2UA 4Q7MB 4I33A 4H6SB 1C1MA 1O2TA 1DELA 3JZ2B 2ZI3A 1UPTA 4MGZR 1GNRA 2C4FH 1DADA 1O2SA 2IUUA 2QM8A 3UMFA 4BFWA 5FUVA 5DYIA 3U6KA 4CF7A 3K6YA 4MTBA 1EK0A 3LXRA 3TQFA 2J4IA 1RZ3A 2CHAB 1FUKA 2RHMA 1LKAA 3GLFB 4E7RG 4FVBA 3BORA 1EZQA 3AP3A 3I5XA 2VO1A 1QHRB 1DE7H 1YZQA 1SGCA 4QOSA 3AVPA 1G30B 1GBMA 4DB2A 3RM0H 1HAXB 3CS7A 4W5HA 2F3TA 1G9IE 4BE7B 3UQOA 2QEQA 1O35A 3GCTF 1P2SA 3I8SA 4FIDA 2XZLA 2CVFA 2ZU4A 2GCTC 4SGAE 4GRAA 5ABWA 2BBSA 1Z47A 1S1CA 2GVFA 5DKMA 2F1JA 1E32A 1THPB 2BMJA 1O2GH 3UG7A 1D3PB 3F9GA 1A4WH 1ANKA 4IDNA 2H9HA 1UTMA 2C9CA 1BMNH 3A8CA 2FPLA 3A81A 3P26A 4K81B 1TQ4A 1HXFH 2WOOA 3O8BA 3MH6A 2XB2A 2ZU0C 3THWA 1ZCAA 4D0LB 4IBLH 1KK3A 3AVOA 1IN8A 3CX8A 3ECCA 5C2JB 3KX2A 3KIDU 3SYKA 5B2ZA 2PX0A 3GJ4A 1S9DA 4M1SA 4Q9JA 1C9TA 2BMDA 2PX3A 2VU8E 1AJEA 1TQ2A 3GEIA 2CHGA 3W3ZB 4VGCB 1DTSA 3KUDA 2PR3A 4QM6A 1DFPA 4B35A 2FXRA 2AIPA 2Y5GA 2GEVA 2SNVA 1VHLA 1IOZA 5TMPA 4M9SA 3SBDA 2GJ8A 4L9WA 2KAIA 5CYOA 4YOJA 1XVMA 4RCYA 1XD2B 2ZI5A 3T1QA 3MRSA 1AK2A 3TSOA 2Q3HA 2VWLA 4IFBA 2ZAMA 1KMQA 1PPGE 1OXXK 4FCWA 1T3SA 4YOGA 5EG4A 1CT2E 1H8EA 1KDQB 2V0BA 1JECA 1NVVQ 5AJWA 3MU1A 3BXZA 3OEHD 1MAXA 5LPRA 3NBYC 4LCBA 3ZVAA 3F9FA 3I5YA 1BTXA 3JZ1B 5CDFE 1YBWA 1XPUA 4HEJA 3SUGA 2ATVA 3GJ6A 2GDJA 4X2WA 1O3CA 5KNDA 3KCGH 1FDPA 3EAQA 2GAAA 2ZWLH 2YNMA 1ABIH 1FAXA 3MNXA 4FUEA 5AJYA 1WU1A 2FWWA 1UHBB 4JZFH 4Z54A 1CRQA 4OI2A 4XOJA 2BDBA 2GEDA 4LC1A 4G5QA 4HDOB 2IW3A 2STAE 3IPYA 3PTBA 5BYKA 1G36A 5EZ5A 3Q7PA 4WW0A 3UFAA 2HOBA 5CM9C 2VEDA 3A82A 1AS3A 2VHTA 4I1SA 3GLHB 1E9EA 4Z6AH 1E9DA 2IYLD 1KIMA 2H17A 3RXJA 2VIPA 5GIBA 5JI3E 2GZ7A 3LBNA 1DPOA 3W9YA 3QXXA 1W0YH 1Q1ZA 1C5VA 3TJZA 4KTCA 4JLVA 2WV9A 3SQEE 4FMCB 2QT1A 3CZQA 4JLNA 3T2NA 1ZRHA 1SQOA 3BTWE 4JYUH 3TK6A 4CVNA 1BS1A 3RS5A 4WF8A 1JR3E 3L0PA 3BH0A 4DIDA 5G4BA 1MU8B 2HV8A 1PPEE 4JVLA 4MPWA 5FBRB 2W7SA 2DE8A 3A7VA 1O5CB 5TXGA 2AD1A 2OE2A 4BFYA 3CO5A 4BRWA 3UIRA 4H1VA 2BBTA 3VR3A 1OH6A 1GJ5H 3BH7A 5HE9A 2PUQH 1LPZB 1S6HA 2YHSA 2GCOA 1MV5A 1N6KA 4IOLA 4DUGD 4IDHA 5C1UA 1G3MA 3VX3A 1QFKH 2VGCB 3SU8A 3L0OA 1CR4A 4C0KA 2XEXA 1LHEH 2QAGC 4R2IA 2OC0A 4B48A 1GHBG 1VCWA 5B6LA 521PA 3DZ8A 2DWPA 2AXPA 4ZKRU 3KNXA 4WOPA 2ZPRA 2Z3DA 4IVRA 1EXFA 4C2TA 5JSZB 4ZXYH 4P33A 1UTKA 3TGJE 3G5UA 1QL9A 4OJKA 3VKHA 3RRZA 3LO5A 1GJAB 3QF7A 2O5VA 2ZJBA 6CHAC 4FU9A 4YMVA 3NPSA 4HLUC 5L3QA 3ZZTA 3FWYA 2XXLA 1I4DD 2YOFA 3IILA 1GBJA 4EJSA 3FANA 1E36B 2YNAA 5KDDA 3IWMA 1CTQA 4Q03A 1G6HA 3U98H 2QRZA 2P59A 2HF8A 2XNDD 2BEKA 1SFQB 1II0A 3VB7A 1FONA 4B71A 3GFTA 2PT5A 4UFFH 4CDGA 1C1NA 1ACBE 2FOFA 3K53A 5FTNA 1Z6GA 4TT3D 2BM2A 1MUEB 5TJXA 1F2UB 5JS7A 2YVUA 1HJ8A 2BJWA 4DLXA 5BWMA 3E6PH 1IQHA 1C2GA 4XVUA 3M6AA 5DISB 1EPTB 2BY9X 2F9MA 1JAHA 1DVAH 5BQ5A 3AVWA 1L1NA 5EE1A 1P3EA 1M74A 5JBQA 5SZHB 1CRPA 1C4Y2 1TL7C 4US0R 2RGCA 4M8NE 4K60A 3LBHA 3SJOA 3V4RA 3NEYA 5EE3A 1F0UA 3Q8XB 1V2NT 1DWDH 3TJNA 1WQ1R 4OJQA 1R7RA 2BCGY 4YONB 5GCHF 3SGQE 4B44A 4C0QC 2PT7A 2ZJ2A 1T6NA 2Z9KA 1YRAA 1AIXH 2PZEA 3EX7C 1XCGB 5DK1A 3KJGA 3THXB 3RYTC 4K2YA 2DFTA 3NG1A 1U8AA 4BZQA 4YT6H 1CO7E 5JI2E 2ZR0A 4O3MA 3MSXA 2N42A 1MZDA 1CGIE 3D8BA 4OBEA 1W0ZU 1HIAA 1U8ZA 3IHWA 4R2HA 1SQTA 1QHXA 4RD1A 5FI1B 3A8TA 4RKEA 1MAYA 3MO6A 4KFTA 1OJLA 3IEUA 1LFDB 3IEVA 2BDGA 1M6NA 1TABE 5E0GA 3NIBA 1G17A 4HLCA 3VU9A 5E7MA 4B2BA 3A6PC 1TU4A 3U7HB 2A3RA 1OFIA 1D6JA 4A1XA 5D3QA 1T7CA 1NRPH 5CYPA 4CEJA 4R7ZA 4ZI3A 3A8AA 4IRUB 3RU4D 721PA 2D7DA 1VYVA 1VITF 5EXXA 1GG6C 3KKNA 1U6QA 1HV8A 4UONA 4Q00A 2GVZC 3GMTA 1NFWA 1ZJDA 1Z6TA 2UUJB 4LBWA 2ZU1A 4D8NA 4GCHG 1K1LA 3U3RA 5CIQA 3V12A 2BX3A 4RD6A 1AZZA 4D26A 1BA8B 4BEJA 4DOQA 1ZSKA 2IEYA 5DP4A 2BJVA 1RGQA 3VR5A 1BOFA 1Z3IX 3DOFA 4DY7B 2D1JA 3ZVNA 1SULA 3ZIAA 1Q1EA 3VEQB 2ZG0H 1SOTA 4B43A 3TJVA 3ASZA 3UWIA 5JFGA 4ABGA 2OV2A 3LGTA 4JLBA 2VLIA 2EYUA 5GDSH 1G3UA 3RXUA 3CH4B 1J14A 1T5IA 2O8MA 2P3SA 1GHYH 2WMNB 1P2MA 2W2TA 2B7CA 1ELAA 4UD9H 3S9AA 4GNKA 3D65E 4FUGA 3A37A 4RD0A 1K6MA 1PQAA 1LF5A 4NYJR 3ZVEA 4KYUA 1ETSH 3EPLA 2FM2A 1U81A 1NBME 1THRH 4O9VA 3LGYA 1BTPA 3LPRA 4KHZA 1OKKA 2CDNA 1SGDE 3WMGA 1AQ7A 1ZLRA 2RH5A 3OX7U 2J95A 4AFUA 3TIUA 3C8UA 1P8VC 3PMJA 3ATKA 4NHOA 1DAHA 4OS4A 3TR5A 1Y3AA 1SGIB 5DP6A 2J41A 3ZV9A 2FS8A 4PX9A 1G3RA 2JKHA 3LJJA 3ETLA 3D23A 1GBEA 4D4JA 1FJSA 2AGIX 1HAHH 1A3EH 1TGTA 5LBIA 1KDRA 2PLRA 2OM2A 3KQLA 3A85A 3SQHE 3TVTA 2PUXB 5F8TA 2F9BH 3EAJA 1X6VA 1AGJA 3U1JB 1V2VT 4ZDIA 2GJKA 3CX7A 4R8TB 3OU0A 4I8GA 3AP1A 2G5VA 1TQDA 2A4RA 1O2VA 2J0VA 4GL2A 1O87A 1ZM7A 1P62B 4WIAA 3ZV8A 1A82A 3V7TA 2RA0A 5DHFA 4MYTA 4E09A 1GG2A 2K5UA 1TNHA 2QN6A 3BTME 4OS1A 5CIWA 5TB5A 1HB0B 4LHXA 1HH4A 1XJQA 1KSFX 2QMOA 2BY5X 1SGFA 5EOKA 2B92A 3P8NA 3IIMA 4C0AC 4A6XA 2JASA 2W00A 5JB9S 1K1IA 2GZAA 1P9UA 3W3AA 1EWQA 3KEEA 1FI8A 1G5PA 4TSFD 5JZVA 1IHTH 2ZTSA 2ERYA 1BTZA 2CEAA 2VIIA 2HLDD 1CBUA 5M04A 1TF5A 2H18A 2LWIA 1E38B 1W0JD 4EPWA 2QAJA 4P4SB 1K2I1 2D7CA 2W0MA 1PZNA 1KDOA 9ESTA 4PPNA 4A0GA 1IXSB 1P5ZB 5E95A 4B76A 2CXVA 1OP2A 2ZU5A 1HY3A 1J17T 3LGUA 2W6IA 8KME2 5F9FA 1KY3A 1G9XA 2Z83A 1NVXQ 3CNOA 1QVRA 4BTUB 1FTSA 5I46H 4TYPA 4BLPA 4R98A 4AD8A 3RC3A 1A0JA 4YLQH 1XJ0A 1P04A 4ABBA 4JZ1A 2FLBH 4UKDA 1O39A 5DI3B 1UM8A 1UKEA 4JYCA 1JR6A 3GY8A 4NL4H 1SHKA 1JR3A 2IUSA 1FFHA 3FP6E 4URYR 2I3BA 2XJ4A 2BOHB 4M1KA 1RIFA 4MYUA 5CLQA 1F2TA 1A5TA 1AD8H 1CJMA 5J47A 3F68H 1C1WH 4BXWA 1TF7A 2QBYB 4HB3A 1HJAC 4OK6A 2CK3A 3LOXA 4WWYA 3FMOB 1T0HB 3OIYA 3AVXA 2JLZA 1DICA 1ZM2A 1O5BB 2ZRFA 1UVSH 3CWQA 4JT4A 1F2SE 2P0EA 1Y5BT 4TTQA 3PUXA 4PC3A 2V8OA 4DDWA 5EJEA 1OWKA 3GCHC 2C2HA 3ZZ7A 4ISHH 4DVAU 8LPRA 1U94A 1AVGH 2ORIA 1VMAA 3BFVA 4IC6A 2EVWX 3T1VA 1YM0A 3SYLA 4U00A 4NYJQ 1P09A 2ZXUA 1XEWX 1E98A 3U2QA 1G32B 5CHAB 3SJZA 5KU1A 2O8UA 5ESBA 4X1SU 4GBMA 3P6ZB 1GNQA 1FP7A 1KI8A 2ANMH 3M3TA 4A2WA 1DS6A 3MH5A 1GCDA 3FMIA 2EI6A 5EZ6B 3U69H 3E70C 1CKEA 4M9XA 5FBIA 4GZLA 1TRMA 4Q02A 4CRAA 2IL1A 1E4YA 2XNIA 3ZD6A 3UWKA 1VYUA 1C2JA 2OAQ1 2R2MB 4K1TA 1QHNA 1Q57A 1VGCC 4YMWA 3RXOA 1NKSA 1FMLA 2BDIA 4QRHA 4X0WU 2ANCA 4NYMQ 1QBNA 3HKJB 1FZZA 5HZHA 2GX4A 5EP3A 5A8YA 3NUMA 1TRNA 1SXJB 2B8OH 1UTPA 4ESTE 1KTTB 2FU5C 2ZYVX 4ESHA 4S35A 4OK3A 2UUYA 4MITA 2XJ9A 2ALPA 3HYTA 3EPKA 1G41A 2W5EA 3DT0H 3LLMA 4WZBE 4O97A 5FUYA 3M36A 3EWAA 4AZ2B 4A2PA 4JLMA 3BWDD 5FL7D 2GT8A 4TYNA 2D8WA 3MU5A 3LVRE 3BIVH 4YMTA 2G4TA 1UCYE 5LGOA 4CYMA 4TL9A 4B2CA 2O8CB 1C5UA 3QXCA 3OFNA 4Q7ZA 1CHGA 2QA5A 4ARZA 2XOKA 4F91B 2EWVA 4DB4A 2IS2A 3OHMA 5EW1H 1OXGA 3X1DA 2Y82A 1TNIA 1YPKH 1SGNE 1O3IA 2PJRA 1VR1H 5JDUB 3CLVA 2ZFPH 2FOAA 4O3UA 3RXBA 2BCJQ 2QSYA 5CJ2A 1RJXB 2ZRDA 1FV9A 2FX6A 1A2BA 1ZUHA 1XEXB 8GCHG 1PQ8A 2QQEA 3PO1B 4YXWD 1DLEA 1G8YA 3WBJA 1KXFA 3TSWA 3B1VA 2G81E 4XD7A 4Y11E 5SGAE 3KQCA 2QAGA 2H9EH 1OXUA 4F4OC 1SHYA 1C1YA 2QIQA 1S6FA 2ANBA 1Z6EA 1NKTA 2C98A 3P8OA 4KBFA 4TMVA 1DLKB 1LHFH 1MH1A 1US8B 3BFKA 2REBA 4HLUA 4Y10E 1W7XH 4TLCA 4D0NA 1AMHA 3RM2H 1O3NA 1II8B 4HATA 4DXAA 5L2YH 1ZMLA 3RXEA 1CIPA 5H8WA 2BLVA 1TNKA 2QTHA 5CB6A 1QRZA 2SNWA 2R6AA 3HWSA 1AKSA 1P9SA 5DO9A 1O3BA 2Z94A 3W6PA 1W44A 2AGGX 4FUDA 4NCJA 3P92A 3SJKA 2ZYUX 3UK6A 4RD3A 5DIFA 1ZYOA 3O8DA 4ISNA 5UKDA 3U4QB 3AF1A 2D2EA 3Q3XA 4RJLA 2VA8A 5HTKA 1ESTA 4GDFA 3T12A 1ZCBA 4V0LA 4G0NA 1Y3VA 3TJUA 2ODWA 2Z4RA 4ZDKA 3PB1E 1Z1JA 2JJ1A 5DH9A 3RRNA 1S82A 1GHVH 3OEED 4A2QA 3QTOH 1Q3HA 3D3QA 1V2UT 1KO1A 1QZXA 1F0TA 1G3EA 2VP2A 2F43B 3EASA 5DGXA 3Q76A 2W58A 2FF7A 1GRQA 1O3LA 1LB1B 2VH0A 2ZYWX 3ZD7A 3U8RH 1NBMA 2D4HA 3IIJA 1EJNA 2C9YA 4OI0A 1GI1A 1TOMH 1TALA 3ADCA 3UY9A 3RXMA 1E9AA 4AYYB 2ZYTX 2O52A 1TNJA 1O5EH 5LB4A 2VRWA 5E0JA 1SVPA 2BB4A 1X1SA 1SLWB 4XBDA 3T5DA 1HYLA 1GCTC 4KFSA 4TQ9A 3MYWA 4FMCF 4P0TA 5BPEA 4OS6A 2Q6DA 2WHXA 2IEZA 4H1UA 1EFUA 5E7JA 3OSYA 4DT1A 1HAVA 2H5DA 1IXRC 4HI3A 4MUAA 1C5PA 1O3HA 1V2JT 3ADKA 4F92B 4A0RA 3NXPA 5EQQA 3A7WA 4X8LA 1Q3XA 1MKWK 1QRXA 4O3TA 2R6DA 1EFRA 3K9XB 4AYTA 4IVQA 2A2QH 2HJVA 2WM9B 3P95A 3HATH 2PMKA 4PHFA 2OFXA 1TFXA 3RLFA 5DN6D 2A4OA 1XTRA 4NP6A 1KXDA 4M21A 4H9GA 1OB5A 1R2QA 1NRSH 1SVWA 3UATA 2GZDA 4X2VA 1FX0B 2ZIAA 1EWRA 4IKEA 3X1XA 2AXNA 3K9HA 4RZ2A 2HNTC 4CEIA 3DM9B 6Q21A 4QBHA 1UAAA 2OCAA 4EQ6A 3TQCA 1GFIA 4DHEA 3AVTA 1LVMA 3KQUA 3QEJA 1E79A 1C5XB 1DAGA 2LKDA 3C41J 2GK7A 3DKPA 1G8PA 3I4LA 4F49A 3LC5A 1E3MA 4EFLA 4FCVA 1K5DA 1VTKA 3VQTA 1WAYB 5T3HA 3MNBA 2R8RA 1YZKA 1VPLA 3CRMA 1TNLA 3WP0A 3ZS8A 2EFEB 2F1RA 2GEUA 1ZD9A 2W6JD 4QBIA 3ZZBA 5JJLA 4HAYA 3TKLA 2VH6A 4HAZA 1KY2A 3STJA 4QNRA 3ZVRA 2ZHDA 5F9HA 3PUWA 3VX4A 4BFXA 1ETRH 2FPMA 4BLTA 1F48A 4NWLA 3MNCA 2L0XA 3CIOA 4URZR 2BDAA 1JXMA 1VJAU 4UNSA 5DP8A 3A89A 1OYYA 5FUWA 1ZPZA 4CHAC 3PENA 1N8OC 4BANB 4KTUA 1DVRA 3GLIB 1OOKB 1OSSA 2IYUA 1GMCG 4C7OA 3WNBA 2XB4A 1TMTH 2ZEBA 1ESBA 2ZE6A 4Y8ZA 3FP7E 1CULC 1VDZA 3MWIU 1XMIA 5GPIB 1RRGA 1Z0DA 2R2WU 2Y5FA 4M1YA 2ZFRH 1FUUA 2J3EA 3I92A 3B9PA 4TYWA 3CNLA 4MLFB 1TQ0B 2ZR7A 3GCOA 1MT0A 4Z1MA 3SHCH 3SUDA 2Y80A 2WKQA 1HURA 1OFTA 4IOKA 2AH4X 3AUYA 3W6NA 1EFTA 4ZKNU 3SU5A 2G88A 3C14C 4HTCH 5K7RA 4M7GA 1BYIA 1CJTC 1BTUA 2AERH 2SGAA 3RDZA 1Z8GA 2ESTE 2WWFA 4KAXA 1VITH 5JYIA 1QY6A 2VF8A 2ZPSA 4NSVA 3QKSA 6LPRA 2ZE5A 4NCNA 3H09A 1R0WA 5AJVB 2HNTE 4V0NA 5C3NA 2D3WA 1F0RA 1GHBF 3M37A 1GI2A 2BMEA 1X86B 1B0FA 1IY1A 2VWMA 1QHYA 2GETA 5P21A 1OW3B 1RFNA 1JPJA 3K65B 3HJNA 2ZROA 3THYA 2ZRPA 3I77A 1TIOA 4YESB 2FI5E 4NFEA 2ASUB 4RZUA 4ZKEA 2IXGA 1T8NA 2VNTA 1IQFA 2BMFA 4NYIQ 2GMTC 1YR8A 4THNH 3IITA 2AK3A 5HGGA 4LJ8A 1BTYA 2BVNA 1XRJA 4M1OA 4YMSA 1OPHB 1KY9A 2O8TA 1NLFA 2BD9A 1AQUA 1GOTA 4OK5A 5A09A 1YCPM 1QBVH 4LYAA 1SVMA 4Y0ZE 5IK2D 3T61A 1DAIA 4INHA 3BH6A 1O2HA 3LW7A 3WY9A 1A3BH 2FMXA 1CHOG 5JWRA 3BG4B 1QA0A 3H2YA 2ZIQH 1VG0B 4NE2A 4CRFA 1TBQH 3P1JA 4DW2U 3OY6U 2BMGB 1IQLA 1CGJE 4LJ9A 1R0YA 4NWKA 4DIIH 2MSEB 2ZANA 1TMKA 1UTNA 1MTNB 2IPHA 2ZRAA 1QA7A 1IQMA 5LPEA 1WP9A 1IOEA 5FBVB 1XUIA 1DUEA 2TGPZ 4IS5A 4FWTA 1W36B 2O9QA 1MD8A 1UKYA 4FMDB 2WSMA 1UDWA 5DNYB 1C5MD 3BK7A 4XSGA 1A4RA 1O36A 5DLQC 5IRCD 1IHUA 2OCYC 4ZIRA 1ZRKA 1TTTA 4ZKDA 1O3KA 4TTPA 4GUXA 1UJ2A 4IHQA 1XEWY 2PEZA 3AP2A 1T8LA 2QGRA 3BTEE 2GCNA 1LQEA 3EA5A 3IBYA 3SNAA 1X7AC 1PFXC 5D3MB 2W7UA 2RGEA 1NN0A 4KYIB 1YLCA 5EP2A 3AKYA 4WVFA 5JHGB 3D62A 4PAOA 4HZUA 1AHTH 2P3UB 5GVSA 2HRVA 2VP5A 5K8LA 4JZIA 2FEMA 2NO9A 3M7TA 2WJJA 1KJYA 1AS2A 5A0CA 3NKKA 1XKAC 3VHLB 1RYFA 4A9AA 1ZVQA 4PZYA 3R0FA 3THOA 1MKYA 1DWBH 3IHLA 4JT2A 2W0SA 3NHBA 4IXNA 1AWHB 4PC1A 1O2PA 4K1SA 2ZREA 5I25A 4GPTA 5A4JA 1KI6A 3SI3H 2ZF0H 2ODYB 4J2YB 3OEHA 1EAWA 5C4MA 2IYTA 1OS8A 4GCHF 1N6IA 2O8EB 3QNUA 2QYIA 5PTPA 2F1IA 3BEIB 2WV4A 3VGCC 1OH8A 5ESTE 1KLIH 2MSCB 4C4PA 1GI5A 3ZIAD 4ZO4A 1UTLM 2G3YA 4UE7H 3QBTA 3SQXA 1CP2A 1E96A 4OI4A 1BRAA 4ERNA 1R0ZA 5L30H 4HYYA 2AN9A 5DP7A 1G2MA 2J0UB 2BD2A 3X1WA 1QR3E 3PCRB 1GDNA 3T5GA 1C5SA 2R44A 4JIMA 1XX9A 1KJWA 1IQGA 2W26A 4FWIB 1P3JA 4HUQA 1O2LA 2SGDE 1G18A 4Q1DA 4D80A 1EGAA 1Y63A 4ZKOU 1G7TA 5FOVA 3VKGA 3FVQA 4B34A 1N5JA 1CA8B 3M4YA 4V0ME 4QBFA 1YCPK 4M53A 3CRRA 1AE8H 1TMUH 2JLVA 3FGNA 3RC8A 4FU7A 1GI8B 2O8DA 1W48A 3PV5A 4LBZA 2W3KA 4W7SA 3IIKA 2FFAA 2PWXA 3LT3A 1KSJA 4NDZA 4RZ3A 1R0XA 4BAOB 3NDBB 4K1EA 1JQJC 4NZLA 1E37B 2H16A 2OINA 4A82A 3IQWA 2TPIZ 5KO2A 1EB2A 2BHRA 4WXIA 1QG2A 1BMFD 4ZHAA 5DSZA 1W2HA 3HP1A 2WICA 1N0VC 1W11U 1NRQH 3IG6B 4MUBA 1XXHE 5L3SA 3BFXA 3AW1A 4B74A 4A5TS 1MBMA 4DUGA 1XZQA 3ZYDA 3KFXA 3AGQA 4NCIA 4CBNA 5EXNA 5GXPA 3FE2A 2BDYA 6ESTA 2QN5T 1VCNA 3CONA 1OP0A 1SQ5A 3KQHA 1I2MA 1OSNA 3FTQA 1SMFE 2V54A 2VJ1A 3AM1A 4Q4JA 3FP8E 3NH6A 1D9IA 4WA7A 3PTNA 1QBOA 4Q9KA 3TLXA 3TU7H 1SKYB 4LSGA 1HPGA 3AAVA 3TUJC 2ZCHP 2CXXA 2WPDD 3TJOA 1FPMA 4FI3C 2ZRNA 1TOCB 1D4PB 1A5HA 4LJAA 1R6BX 1HFDA 4ZPXA 3RS3A 2IS6A 5TCCA 2CF8H 4HZIA 2BQWB 1O3JA 2J7KA 1SHHB 4OYHA 1FZQA 1GILA 4M9ZA 2HALA 4D76A 1J8MF 2JLSA 1NG9A 2XAUA 3MI4A 1HT2E 3ODFA 1YP9A 4ABAA 3WRYC 4LRWA 1YYY1 3AKDA 2XNDA 1KAOA 3GDVA 5AUOB 4WH6A 3WYGA 2ZCKP 1TUEA 1IQNA 3KJHA 2J46A 2Q3FA 3QF4A 4YT7H 4TT3A 4CBOA 1E2KA 2Y7XA 1RRPA 4ZHLU 1GVZA 5FTLA 2Q21A 2GCHG 2HPQH 2P93A 1KXEA 3HU3A 1CBWB 3WP1B 4QGAA 4DWJA 1EATA 5H1YA 1OH7A 3UNQA 4UQOA 3K0SA 2G5NA 4H4FA 2FFHA 2DBYA 4ZCLA 1ZJKA 5FTKA 1ZD1A 2P5TB 4LY6A 2WUCA 3Q7QA 3JZMA 4I7YH 5EP4A 1GGDC 2IOTA 2V6IA 4I81A 2ZC9H 1BBRE 3B7GA 1E9BA 1IQEA 4F93B 2UZIR 1OYWA 2ZRBA 1JBKA 2FODA 1T8UA 4LV5B 2F55A 3BIUH 2EQBA 2RGGA 1GMDG 4U5XA 4MDEA 1LY1A 1F0SA 3R8CA 3G0HA 4X1RU 1ZZZA 2TGTA 2OLJA 1W46A 4IDPA 2OXSA 1XMJA 4TZ6A 4IMZA 2QXHA 1N6HA 1DUAA 1BITA 4BZPA 1LS1A 3R9IA 2QGNA 1G3QA 1NRNH 1EFCA 3TGKE 1O3DA 1QL8A 4MNYA 2Q9AA 5FOXA 1OXTA 1Q21A 4AYVB 5IF9A 3M1IA 2B8WA 2N1BA 1PLLA 1A1VA 3UPUA 3LX5A 4CR5A 4II7A 621PA 1HE8B 2XWAA 1W5TA 3IQXA 1Y5AT 4A8JB 4FUBA 2CHAC 2A4QA 2QC2A 2GILA 3CKLA 3A36A 1PVOA 1TQ7B 5AJXA 3K0FA 2ZSDA 4OKSA 2H5CA 4BASA 3MH7A 4NSYA 3CPHA 4DIEA 1Z0JA 3PMAB 1FP6A 4RFSA 1Z1IA 4CEHA 1CQQA 3ICEA 1VCMA 2AMQA 4U32A 1HAVB 2GGVB 2VIWA 1XPOA 1PQ7A 4ABHA 2E87A 2QL6A 1LW7A 1H65A 4US1R 1RS0A 2P8OB 5DYGA 1H8IH 3BD9A 1AS0A 3MU8A 4B47A 2SGEE 3A7XA 1G19A 1T3HA 3LD9A 5CK5A 4RI0A 2PBRA 3M7QA 4AOQA 1KAGA 3PROA 1KI9A 4I1VA 3VB5A 4OQXA 3LGIA 1WDTA 1ID5H 1T91A 2PKAA 2ZE7A 3T26A 3UIEA 8OHMA 1LVOA 5EW2H 1KK1A 3QGNB 1XUHA 2GBLC 4B75A 4LV8B 4RKFA 3R7WB 2GTPA 3SJCA 3PEWA 2AKAB 5EQRA 2RCNA 4ZKSU 1OWHA 1ZJ6A 1P9RA 4CEIB 2D2DA 3QK1A 2BLWA 4JVSB 1G7SA 4OHYA 1W7AA 4XSHA 8GCHF 1V5WA 1UADA 2R62A 4FN5A 1ZSLA 1DG3A 4IVPA 3GLGB 2XRCA 2QXIA 3BB1A 4BFZA 4BUJA 3VXEH 3SBEA 1E2HA 2CJWA 3HR8A 4NIXA 4Q48A 1L4ZA 1XXHB 1G8FA 4VGCC 1UKVY 3I32A 1ZTJA 1G1MA 2HEIA 3WNDA 1C5WB 4A1VA 5SZIA 1D2MA 2AGEX 1IY0A 4MRVA 4QGFA 2FOCA 4N0DA 2ZITA 4FW9A 4E03A 1OHHD 2GHIA 1QQ4A 2LPRA 1KXCA 3TH3H 1RRFA 1T8MA 4C0JA 1AGRA 1TX7A 1N0UA 2KI5A 2V6NA 3NVAA 2FEQH 2FZLA 3ZVCA 1SXJD 4Q7JB 3KXKA 3ZZ5A 4B1TA 4A0HA 4KTSA 5G3YA 4Q4HB 4WBSA 4D82A 1P2OA 3WNCA 1MO5A 1O2XA 2BC9A 3TSZA 1O3FA 4G3XA 3QKRA 2NU1E 4TSFA 2NO6A 2BIFA 1NVWQ 5B58C 2YC2C 5JRZA 4E7NA 1BIOA 3LKWA 3ZZ6A 1J2JA 2HLDA 2VYFA 4Q4AA 1UMAH 1W0JA 2J45A 4A7IB 2ZRHA 2LCFA 2A7JA 1FOEB 1LVGA 1UDXA 1UK4A 2PCJA 4LZ4B 3T27A 3Q72A 2HUPA 2G55A 4YO9A 2ODNA 4KP0A 1FUJA 2BY6X 3SGAE 1NBMD 1GJBB 2NU4E 2ZSFA 2OP9A 3CS0A 3FDIA 3ZVLA 1U99A 4KI0A 2KWIA 3LLUA 3WXMA 3UMSA 4B2PA 5ETXA 4AG1A 1KJZA 1SKQA 1U0HC 2WPJS 3B1WA 2FZ4A 3DPUA 1L4DA 1OT3A 1LDTT 4ZROA 1II9A 3KKQA 2J38A 1FPHH 1J7KA 2PSXA 1GBBA 1YKTA 5E2PA 3BV9B 1TGNA 1X8JA 3DKVA 4D9RA 4ISOA 2VTKA 2HYDA 4DJZB 5AUPB 4LYFA 4L4UA 4LYJA 3LBIA 4CRCA 2PTCE 4URUR 4MNWA 2A5AA 4P4UA 1N25A 1LVBA 2QPOA 1TUIA 5HKKD 2XTZA 4HAWA 1PPZA 5CJPA 2XW9A 5G40A 1G5RA 5ELXA 2AKYA 3U44B 3TR0A 3ZZCA 4B73A 2VWOA 3P8FA 3S0NA 2A32A 2GWHA 5FPYA 1FY8E 2BY8X 2YOHA 3GJ3A 4TMKA 2JLXA 3GJ5A 4QL3A 3A1WA 2FPKA 4QGGA 1Z07A 4LOYH 4K5ZA 3NKVA 4FMBB 3MU0A 1XTJA 4L9SA 5HCNA 1S9HA 3FKSD 1QJ6B 1F6BA 3ATLA 3SJ8A 5JHHB 7LPRA 3B8HA 4XH9B 4CRDA 3B23B 2FDAA 3IUYA 3BTKE 3TGIE 1KKMA 3GJ8A 5B64A 2NTYC 2JGNA 1O2RA 1Q0UA 4Q7KA 1HGTH 3H4MA 3LNCA 1GSIA 4DLRA 1CR0A 1DY9A 1KNQA 4DRZA 3ITIA 1BCUH 2OTVA 2TBSA 2IN2A 1DO2A 2FSGA 3UTUH 1N6RA 3GISB 1SFIA 1G3BA 2BX4A 2ZECA 4EPRA 3MFYA 4MNVA 1ZM9A 2O8FB 3VB4A 1XMSA 1ZYUA 2ZPQA 821PA 4DG4A 2FJUA 4Q66C 1VCPA 3GLHE 3SOPA 1XVOA 2RGBA 3DUXH 2AYWA 1NN1A 2FX3A 4US2R 4FUHA 4TWZA 1N6PA 1MABA 3HR7A 4TLBA 2BLOA 2DCUA 1M7GA 3AH8A 5A8ZA 1LHDH 3U8OH 3HKIB 3L2OB 2XTTB 3TUZC 1IN7A 4IW3B 1U90A 2IYYA 2G8TA 4K8OA 3EA8A 3VTKA 5FL7A 1EPTC 7GCHG 1HTWA 5TV2A 1VG1A 2AMPA 4NG9H 1GI4A 1EZSC 5F3WB 5J4LA 1TQ6A 4TMZA 4DZZA 4WAUA 4YLUA 4JVNA 4X1QU 3VXFH 2QY9A 2W3IA 3M7UA 1GMCF 4UXIA 3RXGA 4BOHA 2P5SA 2C9OA 1QHIA 2FV8A 2A7CA 4U7DA 1NVVR 5C67A 3LONA 3EWSA 3DMNA 3MCAA 1MO6A 4LGMA 1E2EA 3KB1A 1E6CA 1BBRK 1KI6B 3FVFB 2QP9X 2QI9C 2YYZA 4ZCMA 3RS2A 5JBTA 1OWDA 1FY1A 4JZEH 2VH5R 1RIWB 1MZAA 3LGVA 1WYKA 3PWBA 1KNXA 5FI0B 2C03A 4MKFA 5IT5A 4YXWA 3F1SB 1JOUB 1EZUC 2F3CE 3D31A 1AUTC 1KXAA 2KBFA 2CCGA 4G5GA 2CV3A 4A1TA 4L5BA 3LQRA 1RPZA 1TB6H 2ZJ5A 3NBXX 3AAUA 4M1WA 2V7QD 1HV7A 1V2TT 2ZSBA 4RCZA 4PO1A 3TNSA 5HR5A 2WWIA 3SHWA 4QKQA 3GFPA 3ZVGA 1V2ST 3QE0A 5JRJA 3MU4A 3CR7A 2JIZD 2AFHE 1G8GA 2WUBA 3K70B 4D7GA 1C5QA 1QB6A 1P7CA 2XYAA 3KUCA 3GQBA 4X8UH 1S3SA 4Q18A 2WKPA 4BGDA 1SBWA 3FPAA 5C5OA 3N70A 4P31A 1GBCA 2PTNA 1IN6A 1KMHB 2CHQA 2Y8EA 1WBBA 2FTMA 2DR3A 3T06B 2J9NA 3K2UA 1PUIA 1XFAA 1G3IA 4QJ5A 1S0QA 1G21E 3RXFA 2ZP0H 2FYRA 4XWKA 1QG4A 4E5UA 4OHVA 1YU9A 2IJOB 5EP1A 1NMXA 1AFQB 4RVCA 3SFVA 1RJ9B 4X8OA 4DT7B 4PAQA 4DCSA 2V35A 1GJ8B 1OWEA 3PV2A 3VR2A 1J70A 1DE0A 2C8VA 4AYWA 3B5JA 3H5CB 1CHOF 2JJ2D 1GBKA 1O5AB 4U02A 2WYJA 1DM4B 4WMDA 4DC9A 3B9QA 3OEEA 1D2EA 4FU8A 4MRPA 5HM9A 3TAUA 2B7DH 4BLQA 1RRCA 4M1TA 1GP2A 1F60A 1FPCH 1O3GA 5FBLB 3VKWA 5GJWC 1O5FH 1E4VA 2XC5A 5JBAS 2PL3A 3GEHA 4TWYA 1DS2E 1D2NA 5A8XA 5CMXH 1KGDA 3EZ6A 4DJTA 4Q9HA 4DEYA 4TLAA 2JLRA 2DYKA 3S69A 3ZH9B 5FTJA 1BT7A 3OAAD 4AURA 2ZTYA 2A7QA 2PFEA 2PLXA 3ZQJA 1ZD8A 4GP6A 1GNPA 2EI7A 4ITRC 4AN7A 1WBGB 1C9PA 5EUMA 2VIDA 1IHSH 2Z6VA 1BB0B 2ZI2H 4DKXA 3F6UH 2C8XB 2O8BB 4U2WA 2Q0HA 4LWZA 1QHHB 4QHSA 4X8VH 2F9VA 3DDCA 1NLZA 4IMQA 1G8HA 1Q12A 1XXDA 4DURA 4LYHA 1T32A 2CCJA 1RTLA 4SGBE 3BOSA 3HDTA 4LK2A 1NY6A 4JMYA 4BLRA 4JLKA 1CU1A 1QL7A 1YPJH 3F9EA 3O47A 4LI0A 3VHXA 1AZTA 5DN6A 1THSH 3TNFA 2P16A 1EJAA 2ZTXA 4A92A 5EPYA 4OM9A 1GL1A 2BYAX 1Z8IB 2OSBA 1TPPA 3GLFA 1V2PT 2R0LA 2OLGA 4ACBA 1Z08A 5B6OA 5KHOC 1GI0A 5EODA 3BGWA 1OH5A 1DSTA 3GJ7A 1ZOMA 1WE2A 2GZ8A 4IOJA 3M3SA 2J9RA 2XBXA 5F8XA 2HNTF 1E2FA 2IC5A 3ZGXA 4K3JA 1PPCE 3T1OA 2J1LA 4HLDA 3RDPA 3T5FH 5FBQB 4TL6A 3MWJA 4HZHA 1HYQA 1G7CA 3L8ZA 3VPKA 1E69A 2ZGBH 2W6JA 2CMKA 5H4IB 3B8JA 1INCA 1NNEA 2GKVE 4HAXA 2OT3B 3AF4A 3Q3KA 2BLQA 1LKBA 1DAKA 1Z6JH 4YDSA 2EFDB 1ONBA 3MTYA 2H1LA 1AVWA 3E2IA 2FS9A 1HBTH 2GBLA 3S1AB 1Z0IA 3KKPA 1SI5H 2BHGA 2JH6D 3WRXC 5LPFA 4PFSA 3ZYEA 3L3TA 1G5TA 4AFQA 1NF3A 1FQKA 3RAPR 5GVRA 1Z29A 3REFA 1DOAA 3V0XA 4HB2A 2QF0A 1XTQA 1SZPA 3BIFA 1O37A 1G4UR 5AUNB 3RP2A 2DUCA 3A7TA 1KYIA 2BY7X 4V03A 4GLYA 3CF0A 3DFJA 2HWLB 1SHZA 1HUQA 3IDQA 2UUKB 1GBTA 1GBHA 3QSYA 2Q6FA 4JSYA 2WPMS 1HEIA 3U61B 4WXPA 3BERA 4BFSA 4B33A 2F9OA 2ANYA 1J16A 2V1XA 4BAKB 3SJAA 3TK5A 4B3FX 3K0EA 3B78A 2G0NA 2ZU6A 3AK5A 4URWR 4TLEA 2QUZA 1YPLH 4R71A 1XD2A 2OD3B 3E90B 2A5DA 4ASUD 4BRUA 2V6JA 3K0FB 1QTFA 5C2ZA 2WJYA 3FFGA 2G9NA 2WJHA 4D25A 4Y6DA 1MTWA 1D3TB 4GFDA 1KDQA 1MKWH 4KFUA 4U30A 4WJG2 5DI9A 3ELAH 1TPOA 1P2IA 4PR0A 1OB2A 1TNGA 2OESA 3W8NA 1Z0AA 3I72A 5CHAC 5J40A 5FAHA 4TMWA 4DIHH 1YZTA 3GOVB 3E1SA 5FBEA 4BZXA 1XF9A 5HE8A 3M3VA 2UWLA 3E1XB 1F5LA 3K0CA 2G4UA 1ETTH 2ONKA 1UHBA 3UOPA 3L6PA 1JBUH 3PLBA 1C5LH 4J1YA 1Z6YA 4BTIB 1Z6XA 1ZNZA 2GKSA 4YQFA 2F4LA 5AR1A 2Z3EA 1AUJA 2DB3A 2P95A 5DE3A 4A4DA 3Q5EA 4HUTA 3V13A 1XTIA 3UNRA 1TADA 3GLHA 1P2NA 3ZVDA 3RXVA 3TAHA 3MO9A 2QXGA 1PJPA 3S9CA 3FMPB 1A0HB 2NU0E 4LBYA 1B0EA 4AC9A 3F5FA 1SXJC 1HRTH 2BD5A 5IK2A 2X8AA 1EX6A 3FYHA 4C30A 3W6OA 5FCRA 1B5GH 4UXHA 1MRNA 2ODPA 4PSAA 3L43A 1S85A 3BBPA 3KGPA 4Q2KA 2UUFB 2Q6GA 1XEFA 3KFVA 4X8MA 2AFIE 1GHXH 2QRNA 1VCQA 4OI1A 3AF0A 2I6QA 1FMGA 2ZDMA 4O2RA 2P3TB 1V6DA 2GCHF 2VVUA 5HCIA 1WUNH 2HPPH 1I4TD 4LOAA 2BDCA 3KL6A 4QT8C 4EPTA 1QIXB 1YR6A 3ZZAA 2EU8A 4WMEA 2FLRH 2FOHA 4IEEA 2AD5A 2WIBA 3MAAC 1GJ9B 2JH0D 2FDCA 2FSFA 1ETUA 3IBGA 1S8FA 3CNNA 2XXAB 1P2KA 5JEDA 1KLJH 4QHYA 4WZAE 2GV7A 4EFMA 2EA3A 5EQSA 3PEYA 3V3MA 3PO1C 2HGTH 1D9XA 2G0TA 4AG6A 3VB6A 2WAYA 2JDID 3BTQE 2ZUDA 5FR2A 2ZO3H 1ZNWA 4AK9A 3N7OA 1LV7A 2WZQA 1AI8H 2IS4A 1RVDA 2J0SA 1GI6A 4CT5A 2ZFSA 1RTKA 1X8LA 2CJIA 7ESTE 4LPKA 1DWEH 3K09C 2XX3A 1GMDF 5FH9A 2VB0A 1ODFA 1NIJA 2ZSEA 4OGXA 2NPIA 1HAPH 4FUJA 3LIWA 4GAWA 4PQYA 2ZDAH 1LPGB 1TNDA 3TK9A 3K9LA 5KSOA 1NSFA 1DT2A 2RGDA 4NPHA 2ZUBA 4IN1A 2ZJAA 1P72A 2CLDX 5C46F 5HYOA 3M35A 4OS2A 3UG6A 4NU0A 5KPDA 4IW4E 1NT1A 1M9UA 3NCLA 3UXMA 2A2XH 1G37A 2ZKSA 1AA9A 3R9XA 2WMOB 2O0KA 3C16C 4B3CA 1NVUQ 2AIQA 2A5KA 1TA6A 1SXJE 2ZZUH 3UR9A 2J2UA 2ZRLA 3X2SA 5AFZH 2WKRA 3SN6A 5TCAA 2KE5A 3URCA 1IJFA 3TH4H 1W4RA 1WMSA 2C95A 1GBIA 2QPTA 2K1QA 1TLDA 2P6UA 2H8KA 5H70A 5DJ7A 1F2UA 3NK8A 1W0KA 3WBKA 2CL7X 1WQVH 3A86A 2Z9GA 3QZRA 3AASA 2WV5A 5AWFC 3LH3A 2ODEA 1ELTA 4B2LA 4Z0KA 1T5LA 3EARA 2V55B 1FY4A 4BNRA 4PQRA 2W2XA 2QF3A 1O2KA 1CSOE 2BZ6H 3QKTA 3M5OA 3H84A 3H86A 2QROA 1GL9B 1D8TA 3KTAB 1O30A 1W2GA 1UCYH 3P20A 4L8GA 5LD2B 3B1ZA 1ELDE 3URDA 4I1UA 1T9HA 4PSVA 3THXA 3K0AB 2AR7A 1AZSC 4G5OA 4I31A 1YZNA 4G01B 4OS7A 4INLA 2XSZD 4LV6A 2ANKH 4DLUA 3EZFA 1O0DH 2BOKA 4WXRA 1O5DH 1GHAG 2JATA 4J0QA 3CP7A 2NU3E 4DLZA 1WF3A 4LUCA 2IYQA 1RE0A 3QZQA 2ZCLP 3STIA 2FPZA 1DAMA 1AFEH 1DY8A 1YLDA 4ON9A 2GJ9A 1BMFA 1ZPBA 3W90A 3BEFB 3CWZA 4NCKA 4NYMR 3NBFA 1TGCA 3LGWA 2ZGXH 1N0WA 1FTNA 1JIRA 3JVUA 3VFEA 4NCHA 1T8OA 2HT1A 3LU9B 3VNUA 1FIZA 5LDDC 2ILNA 1C1UH 2X2FA 3ZZ0A 3T28A 1C2FA 3FZZA 4GOXA 1QJ1B 1P2TA 2GDEH 4WVPE 4YOIA 1D6RA 1NL3A 3KJIA 3HU1A 2PH1A 4L16A 1QVAA 5CDFA 1NFYA 1SLXB 2R3UA 3TGPA 3CH5A 2ZHFH 1HCGA 3LDXH 1KKLA 3T29A 2NO0A 4EPVA 1AB9B 4XSKU 2ZGJA 3BTTE 2WPDA 1WTGH 3HPTB 1S2MA 4JSTA 2Z3CA 3IGFA 3ND8A 4Q47A 2YOGA 2NWNA 2IJD1 3EIEA 1XX6A 3E3TA 3RXQA 2CLCX 3PQCA 4UXJA 2P65A 1SL3A 2B5TB 1ZMXA 2OHFA 1RC8A 2XC0A 3QX5H 2C5LA 1TPAE 5J4VA 3SU3A 3RXHA 2ZJOA 1QRAA 2F1HA 5FPKA 2P94A 3Q3YA 1YC0A 1MKXH 3BF6H 2JLWA 5GWZA 2Z4SA 1EP6A 5K8UA 4IDOA 2QZ4A 2C8ZB 1XTKA 3ADBA 3EXAA 3Q3JB 1C2LA 3IPXA 1ELFA 1WSSH 2GV6A 2PLFA 2F9PA 3CR8A 3B1YA 4X6PA 4D4LA 2QAAA 2GP9B 3TITA 2FSHA 3R9WA 3QUMP 1PJRA 4YC7A 2WWHA 4XTRA 3CF2A 3BS4A 1AKEA 2RDLA 2EEKA 3QEOA 3PFIA 4B3GA 1P02A 2R6CA 3DFLA 1XUKA 2H5EA 4MNXA 2EFGA 1ZRBA 3MMPA 1SVLA 4WH8A 1ZMJA 5E7IA 1Z8RA 3OE7D 4LXBH 1JALA 3E5HA 4NA8A 4MDFA 2R9PA 1YCPH 1T0JB 4EPXA 1KXBA 1IN5A 1ABJH 1N5LA 3KXLA 3RU4T 4MGIR 1BOQA 1A61H 2QA9E 2PSYA 1O2IA 1G6OA 2WWWA 1AGPA 2P6RA 2OILA 1P03A 121PA 4Y0YE 2UWPA 1PQ5A 2ZFFH 1ESAA 1X8KA 4A0FA 1GAJA 3W5JA 3HYRA 3C15C 3AVUA 1XD9A 1NS3A 4YM9A 1TYNA 2YKGA 3PEUA 2PKSC 1FNNA 4PHHA 3DVLA 4PTLA 3I1FA 4OS5A 2WSSD 1AM4D 2FSIA 4ABEA 3SFZA 2IF2A 2RKOA 3SV2H 4KLZA 3U3KA 1HLTH 2VINA 3A1VA 5KSZA 3EA9A 2JLYA 2R3YA 2XBYA 3U7GA 3SU2A 4Y8YA 3L0IB 4YDHB 2STBE 4PHGA 3L8YA 2XTMA 1O34A 1RTFB 1EAXA 2BQ6B 2REOA 4P4SA 3W94A 1LTQA 4JMPA 4MKGA 1O3AA 3A4NA 3THWB 2V3CC 2QGZA 3SQWA 1SSXA 3RLWH 5JBBS 4XBBA 5FPSA 2THFB 1C5NH 3EC1A 5AFYH 1R8QA 4IN2A 1B23P 2A1DB 5DG6A 3E16B 1ZINA 1JEEA 1QHSA 1QQUA 4LJYA 1Z83A 2IX3A 1E2IA 4DCVA 3PUYA 2A4GA 3LW8A 5DI3A 5JPMH 3BG4C 3B13B 3EE0B 3NH9A 1KO4A 3PMHB 1RRKA 1BTHH 1YZGA 1LS6A 3QJYA 1XCMA 4TYDA 1O2ZA 2V9PA 3GLIE 2KAIB 2Z0MA 4GMDA 3TRFA 3REGA 4C9BA 1MTNC 1M8PA 2A30A 7GCHF 4NIYA 2QBYA 1W36C 4QGHA 3UREA 2F9LA 3SNDA 5KNCA 5CB8A 3FHOA 1NI3A 2D26C 1NFUA 5IDKA 1ANBA 1D3DB 4AYXA 4MQAA 1PV4A 4N0EA 1V3XA 5J4KA 1MTSA 3MNSA 4KELA 1CJKC 5JJIA 3BSQA 4Z8XA 3HK3B 1EB1H 4JLOA 5L8VA 2A7HA 1M7BA 3ZDQA 3NC0C 1LQDB 2QNRA 2B7BA 1AKYA 4NGAH 4WY3A 3SU0A 1MU6B 5J5CA 1ZNXA 3LJOA 2FFQA 1IQIA 1C2IA 2GF0A 3PM3A 1Y59T 3I78A 3MG9A 1WTHD 1NESE 4ZI2A 2QE7D 1PLJA 4LDJA 3A1UA 4LK4A 5CM8B 4AKGA 3KXIA 3NC1C 4YLGA 2VVVA 3H1TA 1ZP6A 3QPVA 5JS8A 2Z7FE 3WMEA 1L2EA 4P32A 3AKCA 1ZHPA 1OHHA 2DFNA 4D4KA 1R5OA 2V4ZA 3KQEA 4IOMA 3ATWA 2R6GA 1PLKA 1DDJA 1G291 3DEFA 2XITA 3V00A 5EXTA 4V0OA 1BDAA 1GKIA 5BXQC 4OHZA 5B30A 2QT0A 2ZJ8A 3QXJA 1P2JA 2FGKA 2XZOA 4TZ0A 1SXJA 1NFXA 1E2NA 4I99A 1K1JA 1BYUA 4D0GA 1IBRA 2G00A 4TTRA 1Z8JB 3A58B 5LB2A 1KDPA 1SGTA 2OFOA 3ZZDA 3K9GA 2GXSA 2Z5FA 1VJ9U 1KI1A 4ABIA 2ORWA 4OQFA 3PV0A 3T35A 2HVXA 3CB4A 5HM2A 5E3HA 3A83A 5EE5B 3AVYA 2G51A 2ZI9A 1OYTH 3LX8A 2O8CA 2GCOB 1MO3A 2TGAA 3VB3A 2NZJA 4MH0R 5J4SA 3N2IA 1OE0A 1MCVA 3C5HA 1P61B 3BRWD 4PO8A 3D7MA 3FB4A 2D62A 1Z0FA 4RSGA 5K8TA 1RD3B 4R9UC 1GKUB 5FOUA 4PC7A 5HMAA 4LJ7A 4F4IA 1UF9A 1HAYB 5DPAA 6GCHG 4Y7BA 3SU4A 1XEXA 1JNYA 2QCYA 2FNAA 1EAIA 2YV5A 2AX4A 1G64A 3NDPA 3MJHA 3M5MA 2ZI6A 2WBLC 4IC5A 1I4LD 2VIOA 2DFKB 4GOKA 2R9VA 1BHXB 4NYIR 3GCGA 4MRSA 4D4MA 5L3QB 4LX0A 1L1JA 3K09A 4JJKA 3BAFA 3RXDA 1D9ZA 2BOVA 4ACAA 3JZAA 1ELBA 1ZUNB 4EJSB 2WPKS 1US8A 1TEXA 3SORA 5HKKA 3RHFA 5E4FA 2IYWA 3QTVH 4ZDWA 2EYQA 1TWXB 3K70D 4Y76A 2QXJA 3SDZA 3GP8A 1V2KT 1JB1A 1II8A 3K1JA 1P01A 1YF4A 1WRBA 1KI7A 3UQVA 1GJDB 4TN1A 2NMVA 1ZHRA 5C18A 1ZC4A 4ABYA 3FKSA 4X2YA 1M34E 5JLJA 5HXFA 4B2IA 1E2QA 4GI7A 2EC9H 5GJCA 4LJ4A 3SZRA 3P4XA 3U4QA 5L6NH 1E34B 1C4V2 2ODBA 3LRPA 2Z43A 1ZGVA 1ZAKA 2MSDB 3EGKH 1JMOH 2ZS9A 1K22H 2VP4A 4DEXA 1ZSJA 1CA0B 1KSHA 1H9IE 2DHRA 1TX8A 1V2MT 3BE4A 1BJVA 5FUXA 1C1RA 1O38A 4URXR 2HLCA 1VECA 3RXPA 4PXAA 1DAFA 4AGKA 1E9CA 2F43A 4QM7A 1KHTA 5K8IA 3SOSA 1TPZA 1HIAB 1RW4A 1VKJA 1NU9A 1Z06A 1DWCH 2NIPA 3H0KA 2B6HA 2BZAA 1GHWH 2DWQA 1QCPA 3MOCA 2FA9A 3G82C 1Z63A 1E2MA 2YZ2A 4K8YA 4BECA 2P2LA 3VU9B 2XCFA 4I8LA 1YR7A 4PZLA 4ZAEA 1P10A 1CBWC 2ZS7A 2BKEA 4PZZA 2GRJA 4C2UA 4KJZA 3AF2A 3SV9A 1NN6A 3GY5A 5EE0A 2F83A 1E0AA 4Q7XA 2XTNA 4CEJB 4X8HA 1GWNA 2GJAA 4UNNA 2Y6TA 2A5IA 3EZ9A 3WYFA 1YQTA 4OGYA 4LC0A 1EFHA 4B6FA 1XU4A 3EIQA 4EIWA 4OQMA 3C1KA 2G83A 2F9NA 1DARA 1GRNA 1EG7A 2O0JA 3U3MA 1PUJA 4ILEA 1J9CH 3I3SR 3MLEA 2BEJA 3MH4A 2BD3A 3QIAA 2ZI7A 1SGFG 5GADl 1O2UA 1DANH 4KKDA 4BAQB 2J94A 3LA6A 4DDVA 3Q85A 1VG9B 4CRGA 2PKSB 2H92A 4B3DA 2DWOA 4AGJA 4ABJA 3B85A 4Q1CA 2C90B 1FX0A 3LV8A 4Y71A 1M2OB 2CL0X 1MCTA 2ZRIA 5EUQB 1S5SA 5EXLA 1YKSA 2V7QA 4JBWA 1KTVA 4TL7A 1G2LA 1ESNA 1FAKH 4MPUA 1JEDA 1N3BA 3SC3A 1VHTA 1SKYE 4CR9A 2JIZA 3IKJA 1R5NA 3KQDA 5KUTA 3CPEA 1P12E 3DD2H 3ZQ6A 2YNBA 4JCNA 2IYZA 1XUGA 1C5RA 3CUEF 2WAXA 1IN4A 1W8BH 1TE0A 1NRRH 3DO6A 3EC2A 3C7KA 2B8TA 3VR6A 2ZRJA 2BBOA 4BQSA 1Q2WA 3A1TA 4JBXA 4WXVA 4A8JC 1E0SA 4BAHB 1U2RA 1SB1H 3VMFA 2IWRA 5EQTA 2B9LA 3UANA 5C1YA 1GJ6A 3RMLH 4WMFA 1LHGH 4O03A 1GITA 2IWHA 3ZZ4A 4EFNA 1GI9B 1QDEA 2OK5A 1OX1A 2BQ7B 1NRJB 3PR1A 4GMXA 4FUFA 3AVZA 1BMLA 1I2DA 3U3OA 2A5FA 5JBCS 4HAVA 2LKCA 1E1QD 2JJ2A 1SGYE 1HQCA 3GLIA 1C9KA 2AWNA 3QY0A 4BTTB 1N6YA 2P8OC 2IXEA 1FY3A 1R5BA 2VSOA 1T3LA 3PIRA 9LPRA 4JKYA 2OC8A 3SJ9A 1VZQH 3P17H 4BFTA 3ICQB 3NZIA 1A7SA 4MPXA 2H2ZA 3DM5A 1YRBA 4UEHH 4X2XA 3BTGE 2C93B 2ZJZA 1G3CA 3RWOA 4Y8XA 3PVSA 1MQ6A 1JQLB 3U60B 2IYXA 3P8GA 3OAAA 2XCNA 3SW2B 4RZXA 4XFQA 4QFMA 3P27A 3PWCA 2NQ2C 3A8DA 5F2EA 2GCTB 2TIOA 4X1PU 1ZU5A 1V2RT 1BBRH 2HXSA 1UTJA 5CLLA 5EXMA 2F91A 4DCUA 3BB4A 4NH0A 1C1TA 3MWKA 1UK2A 3HPRA 4DCNA 2WIAA 1D3QB 2ZGHA 2ANWA 4Q1AA 1YZUA 1XCPA 2AMDA 3SNEA 1W2KH 3ESTA 2ZHWH 3Q9LA 1YPEH 1NMZA 3QG5A 1N1LA 2ZDNA 2VVCA 2QSZA 2X19A 5H68A 4PAMA 2FMJA 1LO6A 4O2LA 1UTOA 1TRYA 4UFDH 1P06A 4XBCA 4MGYR 1GI3A 4KLNA 4RSPA 2YC4C 5KSPA 4JLAA 4Q1EA 3QQ5A 1QB1A 3ND9A 1TBRH 2ZRKA 3ZVFA 2MMCA 2A2ZA 3GJ0A 2FFBA 3FAOA 1YPGH 4DLVA 3LWNA 2HDNB 2FO9A 1YGCH 3W95A 1F2TB 3U1IB 1P57B 3EPJA 1FW6A 5DP5A 3RMOH 1W0KD 1H8HD 1IQPA 5EPNA 2FZZA 1ELOA 4TPYA 1GBDA 2H9TH 4S2EA 1GM5A 5FPHA 5JMTA 2QTVB 1QB9A 1P73A 4AY2A 1VG8A 4ZDJA 3MUFA 1GL7A 4UFEH 1IXZA 2QP4A 3G01A 2FOLA 3UOUA 3SUEA 2GAOA 5TDHA 3GD7A 3AB3A 1C1QA 3JVVA 1ARCA 3A8BA 3AVVA 3EA7A 4Q80A 1E9RA 2SGFE 4YTAA 3OZXA 1U0JA 2C8YB 3SGBE 5B57C 1ANEA 1K21H 2VP0A 5TY0A 3P32A 4XDEA 3RUOA 3B60A 1UBCA 1IAUA 3OF5A 3PYHA 2QP3A 3M5NA 2KB0A 4WZ6A 2V3OH 3GY6A 2OBMA 2BBWA 1E9SA 2BDHA 3QN7A 1Y3YA 3B9FH 2OAP1 4JL6A 3K9NA 2DFLA 4PC2A 4M22A 1TONA 5D3MA 3CX6A 2P6NA 1JIMA 1S81A 3GLGE 4LJ6A 1GHAF 1MRSA 3HGPA 2A5JA 1EUFA 1Q44A 2ZFQH 4LHYA 4QC2A 2ZFTA 1ELGA 3AKEA 3F8TA 2NG1A 2ZQ2A 4INKA 3SUFA 2BVSH 1AWFH 1T4VH 2PGQB 2XBWA 4HI0E 4CRBA 1HAZB 3SO3A 3NEJA 4B32A 1GJCB 3V4FA 4ASUA 1WB9A 3BC1A 3CRVA 1NLYA 3TPIZ 4ISLA 1XZPA 2OXCA 3M0EA 1V2OT 2R0KA 4CIDA 4CZ2A 1NJGA 4CGZA 3AGPA 3SNCA 2VPPA 4MKIA 1IQKA 1O32A 3S7HB 4QBGB 4M0LA 3TLOA 2G52A 1XP8A 4XOIA 5KDOA 1IJEA 4Q9IA 2G6BA 1L4YA 1BTWA 5F03A 1ZNYA 3MHWU 2C8WB 2A0QB 2ASEA 2DY1A 4QHTA 4FUCA 2O8EA 2J0QA 1ZIPA 1H9LB 1MO4A 4ARZB 2J7PD 3N5CA 2OCVB 2OEPA 4QJ3A 2I4IA 3MMGA 1NSTA 3EQ0H 1SGRE 1WBDA 4DSTA 1QNJA 2ZS8A 1QF9A 1E1RD 2JCSA 3W34A 3U3JA 5EU8A 3UR6A 2D06A 4KCGA 3PUZA 5BW8A 1E9FA 3RSOA 2ZDLA 2QMHA 1COWD 4DSOA 2J0UA 2ECKA 2VHUA 3NWJA 1HJ9A 1Q22A 1KLTA 3CZPA 1SGQE 1XWIA 3HK6B 2NPFA 3VFDA 4FD2A 2IS1A 1EX3A 4NIWA 1GWAA 1ZTLA 1LCYA 2A5YB 2FOBA 2ULLA 1YJ5A 1O5GH 3KQKA 3SU6A 3P4YA 2NZ8A 2QAGB 2PW8H 3LXXA 4AKEA 2IBMA 5T6DA 1K1PA 2Q9CA 4JJZA 4ABFA 4B3XA 4FUIA 2Z9IA 4Q7YA 2TMKA 3RABA 1PPBH 2NGRA 1GMHG 1Z2AA 5EGMA 1C2EA 3QVVA 4URVR 1YPMH 2BKUA 3HPQA 3WHKA 1KDTA 1KZGB 3VNVA 5FBWB 3ZZ8A 3CM0A 2RMKA 2GVDC 6CHAB 1XPRA 2ZEJA 2KSQA 1HXEH 2RB4A 1CGHA 1CF4A 5CE1A 4XE4A 1JXOA 4RN6A 1R10A 1CEEA 1J8YF 4M4SA 4PROA 1HQYE 1MR3F 4NTZA 3ZJYA 5CK4A 1AKSB 2PV9B 1MTUA 1MOZA 4TWWA 2Y7ZA 1QHGA 1CE5A 2BTCE 4RD2A 1C1VH 4BPBA 1RIWC 1ZBDA 2FYQA 4X6NA 1VCOA 5LPNA 5DP9A 4LZ1H 2QV1A 3PUVA 2JDIA 2QG6A 4BAMB 2I1QA 1XKBC 3CRW1 1ANCA 1E2JA 1Q31A 3BTHE 4G5SA 4HAUA 4K8BA 4B2AA 3OTPA 2ALVA 1CLUA 5KTYA 4A36A 3SHFA 1K9OE 4N3NA 3F9HA 1SG8B 4BLSA 3QENA 1F5NA 2JLUA 4UDWH 5AVDA 1UBFA 4TY7A 3A1SA 4JYBA 3F3YA 3K70C 1GKYA 1UJ1A 3NWUA 4TQUS 2VP9A 5KOYA 5BN5A 1BQYA 3WHLA 2OBQA 3TIFA 2VHQA 3U6BA 3QLPH 2FGJA 1E99A 4W9MC 2CNWD 2IT1A 4V02A 5JEEA 4E22A 1UFQA 1F3OA 3OESA 3GY2A 2WYGA 1OV4A 2CMYA 3BB3A 1L7VC 1P2QA 5FOTA 3AV0B 1A0LA 4E06H 2NO7A 3MWYW 2C77A 4PHTA 1AQYA 1AU8A 3ONWA 1AFQC 4DSNA 1JRTA 1YHNA 2I6SA 2ZSAA 1O3YA 1PPHE 4O0MA 4DT1B 4W5WA 1S1MA 1EKBB 2IK8A 2C3SA 1BO6A 2FWRA 4HFPB 4TYQA 1Z28A 3QPUA 4X8SH 2ZU3A 2R2AA 1XMNB 1XDBA 1CJUC 2IUTA 1FL9A 3X1YA 2UKDA 2XGJA 1OIVA 1BUIA 4GT1A 1DSUA 3A87A 1GG6B 2ZUCA 1O2OA 4NA7A 1GBLA 2BD8A 4DLWA 4JS0A 4NCYA 4C3ZA 3KQBA 2YINC 2OCPA 4M2LA 2ZM5A 2GK6A 2CLSA 2YWHA 1SLVB 1H4WA 1V43A 1G3DA 1EAUA 1SVSA 4XWOA 1TBZH 3RXIA 4MYCA 2XSZA 1FLEE 3UMRA 1Z7KA 4EQ6B 1L8QA 1ZUIA 2GD4B 2H7VA 1OPXA 2IYSA 1KI3A 3OIWA 2AHOA 2H1UA 2YWFA 3LH5A 3I8XA 2ZQ5A 5KDLA 2ONJA 1IONA 2F6RA 2R65A 3GY4A 1OKXA 2FESH 4FINA 1JRSA 1GJ7B 5GJ4B 5KSYA 1UTQA 1IAQA 1KI4A 3K6ZA 4KVGA 4PC6A 1BHXF 4TYYA 4TL8A 3C5CA 3QOFA 1A5IA 3D6TB 5JJKA 2HJGA 4JL5A 4V0KA 1JPNA 3QPWA 3CBQA 1GDQA 1K1MA 4CRWB 4GHQA 2YOLA 4GSYA 1Z8FA 3UPEA 1KSNA 2CF9H 4A8JA 2FI4E 4MYHA 2JETC 4POAA 4KXFB 1O31A 5AK0A 2GZHA 4DDUA 2ZVPX 3O8CA 1BMAA 1PPFE 3ATIA 4ABDA 4C7OB 5L3VA 1C2MA 1NG1A 1NMYA 1H9HE 1WA5A 4ZCIA 1TAGA 4JBYA 1Q20A 1L1GA 2YWGA 5E2OA 2Q9BA 2YWEA 2GNOA 5FX5A 1ANDA 3FHCB 3R20A 3SHAH 4Q7LA 1W4CA 1G4AE 5C20A 3V9PA 5HPYB 2OLKA 2G77B 3QUSA 2ZU2A 2VBCA 1ZGIA 4NFFA 2X2EA 2VIVA 1CT4E 4X8TH 4O25A 1TU3A 3RC4A 4AORA 1E2PA 4EUNA 1O3PB 3RXLA 5JWHA 4V0MA 1ZPCA 2GESA 2GXQA 2OG2A 4XVQA 1H8ED 5AF9H 3CRQA 3R7WA 2FOMB 3SNBA 3B82A 3QKSB 4D9QA 2PZGA 1EOJA 2WOJA 2P3FH 2FOGA 3TE6A 3A84A 4HLQB 4TQAA 1ZMNA 3OE7A 5TARA 3SNHA 1ZIOA 3WYAA 1R4AA 4QJ4A 5DO4H 1T4UH 6GCHF 4JL8A 4EAQA 2WJVA 1J8AA 3GLGA 3THYB 2CE7A 1OFUX 4F7WA 3ZS9A 221PA 1RKBA 1YR9A 1HA3A 4NA9H 4K46A 5DHAA 2OC1A 1XXHA 3QBVA 3B1XA 1SGEE 1YVDA 3Q5DA 4HB4A 3FZDA 3TNTA 3U9AH 4BFVA 1DG1G 1TAWA 3HU2A 3R3GB 3SI4H 2H6MA 1DBSA 3NXSA 3QXHA 2ZDVH 1ZC3A 2VQSA 4NZQA 3QGJA 3FOZA 3ZZ3A 2PGBB 2GXAA 1CVWH 3MFJA 5L3RA 2RHDA 1EZXC 1M7HA 3KDSE 4JKIA 4IGDA 3EIHA 3SZNA 1NC6A 1Y3XA 2Y5HA 3E0NB 2OUAA 5F8ZA 3ATMA 2WJGA 2OUKA 1TA2A 2E1RA 1EP5A 1ZW6A 2WSSA 1DXPA 2GT7A 4FVDA 2RGNC 2ZR9A 4MRNA 2BV3A 1A7JA 2FEOA 3DA9B 3RLYH 3SV6A 4JLPA 2WTUA 1O3EA 1O2MA 4Q4HA 4FCTA 1W4BA 4D81A 1HJAB 3X1ZA 1P05A 1FIWA 4I32A 2VHCA 4KVAA 4P4TA 5FR1A 2PCLA 5GJBA 5G41A 2REXB 5A0AE 2O0HA 2PEYA 4ZIRB 4F4CA 2O8LA 4QG7A 3SYJA 3FKQA 2BM1A 2PZFA 1N2CE 3GCHB 4ZV4A 2OO7A 1U9IC 1NZQH 1T31A 4DLYA 2IF0A 4C0HA 3FMFA 3KJEA 3E8LA 3U7FB 3RXTA 1N6OA 3CF6R 2HXYA 2FOEA 5GJVC 1P9NA 2FIRH 2HCJB 2AFQB 3TH5A 4F38A 3GFOA 3GYMA 5LH8A 1WCV1 2JLQA 4HZUB 2SGQE 1S0UA 2OBNA 2PJZA 1A5GH 3ZZ9A 2Z9JA 1SR5C 1HAGE 5FX6A 4ISIH 4Z8YA 4JVMA 4AFZA 1G7RA 4QXAA 4EKDA 1DXWA 5BN3A 1NTPA 2Q6TA 1DPFA 1MMJN 2ZPTX 1GDDA 2BXUH 3W8RA 3MD0A 3U8TH 1VGCB 3E91A 1BRUP 3RU4E 4K69A 2ZRMA 1N6XA 1Q1QA 2GA8A 3GICB 4PPQA 2SHKA 3BG8A 1WOFA 3I62A 2KBEA 5FCKA 1Y3UA 4AB8A 1Z5ZA 3U44A 1ELCA 4FMDF 4OHWA 5L2ZH 4C0SA 1BIFA 2E9SA 3PXGA 3GCTG 3QG1A 1FY5A 2H57A 1UBGA 3EA0A 5FTMA 4PPFA 1W4AA 2QORA 1T4GA 1FN8A 1FNMA 2QPAA 3VAAA 1HAOH 3BN9A 4HDCA 2QE7A 1UCYK 3PV4A 4A15A 1P6XA 5C1XA 2IHYA 2AWOA 1DOJA 1F5KU 4HUQB 3OTJE 3RS7A 3RXAA 2QENA 4EPYA 4PQFA 1ELVA 4G5RA 2IXFA 1W12U 4Q21A 1YZLA 2RA3A 2V3HH 4NMMA 1GZSA 1NO9H 1ESMA 3VR4A 3Q77A 4ASHA 2BVXH 2O8FA 1C5OH 1O3MA 4TLDA 1KO5A 1WQSA 2O8DB 3L0SA 2VL7A 1Y3WA 1GL0E 2ZHEH 1C1PA 4H6TA 5FL3A 4RY2A 1P4SA 1NN3A 5DP3A 4UNRA 1X3SA 1VYTA 1UVPA 5JCZA 2OC7A 4Q19A 1CT0E 2TRMA 4I8KA 1L4UA 1OXVA 3TW8B 3SN8A 4R0IA 2QM7A 5L3SB 2ZQ1A 3LFUA 2WINI 1XB2A 4TMTA 5IHPA 4M9QA 1QRWA 4BXSA 421PA 1OWIA 1WXQA 1U0LA 1KO8A 1BZXE 2RGAA 4I4LA 5GNDA 1W3CA 4DBLC 2R6FA 4I1OA 2J59A 1UEJA 1TF2A 3RANA 3M5LA 1GBAA 5T6GA 3PMBB 1U8YA 1OYQA 4IXMA 5LD2C 1XD8A 4XJXA 3ODDA 4QNMA 4Q4JB 4A6PA 3KKOA 1P2VA 1SQAA 1QGFA 3C27B 2PMDA 3EDXB 3SR0A 2OBLA 1YPHC 3RS4A 2RAPA 1GHZA 4C0BA 2ATXA 3MWLA 5JWOA 4RKOB 2HF9A
chains in the Genus database with same CATH superfamily
1PWXA 3EXEA 1MKXK 2AI3A 4GPGA 3I6IA 2WE8A 1NP6A 3W0LB 4X1NU 1UXHA 3NHLA 1SXIA 3EZ2A 1DEXA 1YLNA 3H97A 4EF4A 4OHBA 2F4NA 1DBPA 2C96A 3H65A 1MB4A 3ECAA 4L0QA 1KMMA 2ZETA 1WLYA 4OREX 1FC0A 2O7SA 4QUEA 1I01A 2OBOA 3S6JA 4I7EA 5J43A 3AUXA 2CN0H 1CQJA 1LSUA 1Q7RA 2CB9A 2V5VA 3C3XA 1Q7EA 1WV7H 4H6WA 1GSAA 3UB0A 4RDHA 1GCIA 4G4SP 3AERB 5IXYA 5EIAA 3RVBA 1KMHA 4MKHA 4LJLA 5E0HA 4YP6A 1G4HA 2PU7A 3GPLA 3AT1A 1JT9A 3S2YA 1O7JA 1GCTB 2I2AA 1THTA 4LRSB 2BH2A 3FM9A 2NO1A 3JATA 1JHZA 3TI7A 4Q4DA 2ZJYA 3O2SB 5C8YF 3C6BA 1RXEA 2W5UA 2XKBA 3TCNA 3GD5A 4QTYA 4QO8A 5C31A 5LVAA 3HABA 3FAKA 2ZB3A 1O97D 2W6QA 5AHGH 1DB3A 2WF5A 3JWJA 3WB9A 4MQFB 3PWSA 3NTLA 2BZ0A 3LQ1A 3OTQA 1GL6A 3DHWC 4Y7DA 2X9VA 4H08A 1FFXA 3Q8LA 2XNCA 3C3MA 4KITB 1KJQA 1F2VA 1X8XA 4KGAA 3L7MA 1ACMA 1BXGB 4LTNA 1UCFA 4KXLA 4KWEA 1XUJA 5EMKA 4GX5A 3SCZA 4BVBA 1F92A 4NZYA 4M1MA 2TMYA 2JG3A 2OMKA 3A06A 4XVRA 2DPXA 3KKMA 3MHTA 4PICA 3W3AD 2FR0A 3MUEA 3T25A 3IE0A 5BVHB 3I2HA 1I1OA 3HDVA 2VAVA 1LPKB 1UOEA 3CLSC 4Z51A 1WL8A 3TBKA 3RXRA 3ORRA 3UHJA 3FVTA 4F2PA 3K1TA 1UFRA 5KNDH 4Y1RB 4R2WA 3EBPA 4CT0A 1YF3A 2W6ID 1OIXA 1O8CA 1VCIA 3ONVA 3DGEC 2FJ0A 3W2HA 2D00A 3OQJA 16PKA 1E7QA 2WJIA 1X1RA 4M9FA 3LGSA 1PNTA 4IIFA 2BSAA 3CSUA 4NRDA 2AB0A 9ABPA 1NYTA 2YYYA 4JJAA 3DSOA 5AVOA 1TJ4A 2P4EA 4PSKA 4DL9A 4N6OA 3SZEA 1BVUA 2ZI4A 3LY5A 2P9ZA 2HJ9A 1UJMA 2ALJA 2H1VA 1V2LT 2N46A 4IDEA 3DL0A 3AU9A 2ZT6A 2HD4A 2CK3D 2RFKC 1XUFA 2EFCB 1MC5A 4G8JA 3RRMA 2GLXA 5I51A 3W4KA 1N2CA 3V7UA 2EBFX 4BVLA 2WP0A 5JNWA 2OQ5A 3SLKA 1XZMA 2ACEA 4AWXA 2D74A 5GIOE 5C5EA 1GPZA 1V16B 3CGGA 1Q2UA 3AEZA 3RC6A 1E2LA 3WB0A 2GEFA 3RHTA 5F98A 1DWUA 2JJ8A 4KO3S 1PSZA 4GSOA 1YU6A 2AFVA 5KNBA 1O2NA 3QXSA 1EXMA 1HKUA 1N5MA 1E0KA 4BKPA 1S4QA 4Z0NA 1QDLB 1NT4A 3HV0A 4LTDA 1E1QA 1AZ8A 1HX7A 3M6IA 2W83A 2VBIA 3F5DA 1GMHF 2FSPA 1HL3A 2ODQA 4PHCA 3ROMA 3IV7A 1ELEE 5HMMA 2UYHA 5J4HA 2PL9A 4D56A 4EA7A 3V32A 2D2FA 3C8DA 3KOOA 1GVLA 3TCXB 2J0EA 2CBZA 1A9RA 4CT4B 2KS6A 3I6ZA 2MSKA 1IQJA 1I6LA 4MW2A 4EO9A 5BWOA 4G1FA 2HA5A 4MDSA 3PJRA 5HEKA 2WMYA 5SZKB 1N5IA 2W70A 3KL4A 1C2KA 3OKFA 1G16A 4RQAA 1PUXA 2YL2A 3UJDA 1N2EA 1YE8A 1EP2B 3RC5A 1N0HA 4JCOA 4EG3A 4TS4A 4Y0AA 4DUZB 2ISSD 3QDZB 3ZK7A 3SU1A 5AH0A 4F4JA