1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
4ZV4A 3NHBA 5JCZA 3FYHA 1MD8A 1P9SA 2N46A 3M0EA 3SJIA 1O2MA 2B7BA 2RGDA 4ZIRB 2ECKA 1JOUB 1W4BA 4L16A 1XM1A 1VKJA 4PSVA 5AVDA 2IA5A 1TGSZ 1V2KT 5JB9S 4I1UA 6CHAC 4NH0A 2W7UA 1SXJA 2WWXA 1G19A 1PJPA 1UHBB 2H9EH 1I4DD 3BEFB 5JJIA 2BQ7B 2VWNA 1F3OA 1U90A 2V7QD 4NL4H 2J45A 1DADA 1G3UA 4PX9A 1YZQA 3A81A 3AVUA 4QRHA 1C1OA 2PCJA 1G7RA 1NG1A 4ITRC 1PPCE 1QHHB 5FBQB 2H17A 3CRRA 2A7CA 1S6HA 3EZ6A 3GOVB 3BTTE 3SO3A 1NBMD 1R0XA 4BFYA 1C1NA 2VQSA 2XB4A 4GZMA 4RJLA 4RKJB 5EJEA 3KJGA 1LS6A 3BG4C 4DJTA 2AEIH 2SGAA 4OS2A 3HJNA 1KAGA 1IJFA 1O33A 2ZPSA 4OM9A 1HJAB 4TYWA 4B3BA 5DE3A 4LV8B 2Q21A 4B43A 3K9HA 1TNLA 4QM6A 1W14U 2XBWA 2ZSBA 4QGGA 4AY2A 1FUJA 5F6MA 1UTOA 3QQ5A 1F7ZA 2ZCHP 2CL6X 4ZI3A 1II8A 4ESHA 3OU0A 1CA0B 3B6EA 2JH5D 5LB2A 4HAWA 1XPOA 3Q9LA 1TNGA 1DSTA 2PHBA 4X1SU 2ZHDA 4YMVA 2LWIA 1CTQA 5AUPB 2OXSA 1PLJA 2IWHA 2ZKSA 5EODA 3MFJA 4BLOA 3WYFA 4Z6AH 5E2OA 3U3MA 1YVDA 1Y3VA 1KSJA 3CPJB 4RD4A 1BHXB 1F48A 2BD2A 4BFVA 3T62A 1QRZA 1TPOA 1B7XB 3T1QA 1CXZA 2QU8A 2JJ1D 1MRSA 1ZTKA 4AZ2B 5LBIA 4PQFA 3STJA 4K8YA 1X7AC 3L8YA 3L2OB 2PBRA 4MLFB 4C30A 4R71A 3OEHD 1TB6H 3BH6A 4GPTA 4LJAA 3B60A 2QBYA 3MSXA 1DY8A 2RGAA 2XNSA 1KJYA 1GHYH 1NJFA 5J4LA 4AKHA 3PMBB 4I1SA 1L2EA 3UR6A 3URDA 2V7QA 1O2LA 1W1WA 3OX7U 1W2KH 4RD1A 3RC8A 3BFVA 1LQDB 2GT7A 4F4JA 1Z8GA 1KK2A 1XMVA 4X1RU 4FUDA 3ZZ7A 2GDEH 1L8QA 1BMAA 1NBMA 1TAGA 2CVHA 2NZJA 1SGTA 4YLGA 1E0AA 1G3IA 4WXRA 4IN1A 1GCTB 2O8LA 1KDQB 1QFKH 1GI9B 3PMHB 1IHTH 8GCHF 1FNMA 3FGNA 3IQWA 5PTPA 3D23A 3SFVA 2XWBI 1HEIA 4EQ6B 5EE0A 4XWAA 2YZ2A 3GLFB 4INKA 1AFQC 3TH4H 3PV5A 1BJUA 7LPRA 3KX2A 1ABJH 4NCHA 4O3UA 1KI7A 2QNRA 2R65A 4AYYB 1GNQA 2OCYC 1EGAA 4IC5A 1JXOA 5LPNA 2P67A 4US1R 1TX7A 1FXYA 3W3AA 4Q4JA 5EU8A 4TL7A 3AW1A 4MQAA 4D0GA 4KBGA 5FBWB 3E16B 8GCHG 1OKKD 3SHFA 2N1BA 3DM9B 1QF9A 4KP0A 4X2WA 1LHFH 2VSFA 2XXAA 1WBDA 3KN2A 1EJAA 2JJ1A 2C4FH 2THFB 3A86A 3CPHA 2ZJ8A 2A5GA 4ZCMA 3EA7A 2EQBA 3OEHA 3EASA 4TMTA 4V0ME 2R0KA 3P95A 3RMLH 1OWJA 1QVAA 2GV7A 1YR7A 2TGTA 3H7OA 1J2JA 1P7CA 3D3QA 1EUFA 1WOFA 2ODEA 1B0UA 1O2TA 5L3QA 2YHSA 1O0DH 2QA5A 1PPFE 3RP2A 1SGPE 3MH5A 1XX6A 4DXAA 1JALA 1ELVA 1TL7C 5HZHA 1PFXC 4UEHH 1DM4B 1QBNA 3AGPA 4TZ6A 3AGQA 4BFUA 2BCGY 1OV4A 1SQAA 3SU0A 1L4YA 3BFXA 2ZPQA 1GKIA 1ELAA 3P8NA 1U9IA 3TJNA 1D3TB 2Z9IA 3SQXA 1EFCA 2C99A 4HFPB 4AG5A 2G4UA 5AJWA 2PSYA 5A0CA 1Y3YA 3SNBA 2OCAA 3SI7A 2KJQA 1MH0A 3T1OA 5LD2B 3P27A 2FA9A 1GHWH 1YHNA 2A31A 3GLIA 3LBNA 1TQ6A 1CBUA 4ZKEA 1HJ9A 2R62A 1L4UA 5HXFA 4Q4HB 4WOPA 1KKLA 2Z43A 3CKLA 2HV8A 4LUCA 2QN5T 1ABIH 3QZRA 1HXFH 1GMCG 1E69A 3TNFA 1Z2CA 4AG2A 2VTKA 4C0HA 1V2OT 2W26A 3BSQA 1VGCC 3AK5A 1OKKA 1Z47A 4Q1BA 3UUZA 2CLSA 3M35A 5FTJA 3UMSA 1ZNYA 4XJXA 5TY0A 3AKDA 3UTUH 4K5ZA 3L0SA 1WAYB 2GJ9A 2GCOA 3UWJH 1A7JA 3CNOA 1XKBC 4AFQA 3KGPA 4IXMA 2JLXA 1S96A 3E0NB 4X8HA 1Z06A 1W4AA 3BV9B 2A5DA 1GI7B 3K8YA 3H7TA 3MMPA 2WJVA 2AGIX 1GI8B 3RXCA 4MYUA 1Z0DA 4JT2A 3FHCB 3A7ZA 1O2YA 3KCGH 1W48A 1G8HA 1KDTA 2RA3A 2G00A 3FE2A 3X2SA 4JZIA 4MPXA 1I4TD 1JI0A 3DHKH 3RM2H 2IYVA 2V9PA 4TQAA 3K70B 1P9WA 1IXRC 2JLUA 1S0UA 1GDUA 1XBTA 1ZYUA 4B3GA 3BTHE 1IQKA 1QHXA 2IHBA 4ZKSU 3CX7A 1DTSA 4FUBA 4VGCB 2A5IA 3RXSA 3X1XA 1KI6A 2F7SA 2QAGB 4K81B 4HB2A 1U8ZA 2P3SA 3V3MA 1GJDB 2HGTH 3KFVA 2BZ6H 5JZVA 3SORA 3K0EA 1XRJA 3ZZUA 5EQSA 2ZU6A 3L0IB 1KLTA 1MR3F 1C1RA 3K6YA 3C4JA 3LGWA 2VP9A 2GF9A 3LW7A 3WP1B 2FEQH 3ICEA 3KB2A 4CW7A 1A5HA 4HLUC 5CM8B 4DDVA 4CHAC 1XEXA 1E2HA 4EKDA 2ZROA 3HGPA 1P8VC 1LO6A 3R7WB 3MLEA 1OFUX 2P8OB 4IMQA 2DE8A 1GNPA 1O5AB 5EXTA 1UCYE 3VR3A 1X3SA 2BOVA 1OFIA 1BMNH 1R5OA 3ZVFA 3BTKE 1XXFA 4NONA 3VR2A 2BD3A 4XE4A 1UTLM 1ZM9A 1X1RA 3MG9A 2ILNA 3HK3B 3FKQA 2Z3DA 3LJJA 1DS2E 5JBBS 1UAAA 4KFTA 1XD9A 4XVQA 2OCPA 2DFKB 1OPXA 3VX3A 1N3BA 1C9PA 1A3BH 3PCRB 1KYNA 3ADKA 2XW9A 1KKMA 4R2IA 1Z83A 2O8BA 2JETB 1XEWX 3ZVDA 1H65A 3B9FH 1OLOA 2P2LA 5IT5A 2CMKA 1F0UA 1HE8B 1LVYA 4JMPA 2DBYA 3Q3JB 1LHDH 2GVFA 3ZS8A 2C95A 2GV6A 2Z83A 2VB0A 3M4YA 5JRJA 4Q02A 5EQTA 3PMJA 2AK2A 1WV7H 1MO5A 3SDZA 2G3YA 3I5XA 2ZU0C 1KY2A 1NKTA 2C78A 5CLLA 2IN2A 4YT6H 1JMOH 3NKKA 4F91B 1QHRB 2OP9A 2SGQE 4MA4A 2GXQA 4RZ2A 1TFXA 4M7GA 4OJKA 4CRBA 2NMVA 1FAXA 1V2JT 4MH0R 4PPGA 4TWZA 1CR0A 4DW2U 4JVLA 1L4ZA 3HGNA 5G41A 1D3PB 2BDYA 4Z8YA 3JZ1B 1CHGA 1O3GA 2BHGA 4BWYA 1XD8A 1A82A 2FYRA 4PC2A 5HMAA 3ZJYA 1GRQA 2FS8A 2SGDE 1GBJA 1TMKA 5T3HA 3LY5A 2F91A 1T31A 1SULA 3GJ3A 2D26C 4OQLA 4CBOA 1AS3A 1S2MA 1WRBA 2FXRA 2YWGA 4FUIA 2FFHA 3A7YA 1C2MA 5L8VA 4RD6A 1GG6B 1SXJB 1VCNA 2ZQ2A 2LKDA 4M9ZA 1RD3B 4NYIQ 3AVOA 3PV0A 2D8WA 5CHAC 1XMJA 4QGHA 4LYHA 2OD3B 1SQTA 3IIJA 4LV5B 1ETUA 3ICQB 3BIUH 4O0MA 3PEYA 4CYMA 2H6MA 1Z08A 4JLOA 3RRYA 1XUIA 2WYGA 5TV2A 2QAJA 4QT8C 4Z8XA 3T2NA 1IY0A 1N0WA 1JPNA 2F43A 2PKAA 2IXEA 3F0TA 1E1QD 1CS4C 1T3HA 2A5JA 1JQLB 2UWLA 4JS0A 3VKGA 5GCHF 3QGJA 4I81A 1MV5A 4JYTA 2EU8A 1MTWA 1E2MA 3E70C 1FN8A 2SFAA 1BJVA 2QZ4A 4NWKA 1I4LD 3AF4A 1KMHA 1JIMA 2FJUA 1VCQA 2Q3FA 1LHEH 3WNCA 2VRWA 5B64A 3LRPA 4IRUB 2ZRDA 4M4SA 6Q21A 2QQEA 1V2MT 1DOJA 4OS1A 3CX8A 3I92A 1II8B 1LMWB 4BPBA 1CGIE 1HH4A 1NO9H 2E9SA 1JIRA 2IUTA 2ZFSA 3M37A 2I6SA 1MO4A 1UMAH 5B30A 1UK3A 3SNEA 1IN4A 5SGAE 4Q21A 1QJ7B 5GCHG 4GSOA 1QHIA 1O3EA 3VR6A 2OBQA 2IYWA 2VGCB 3RRMA 3IHLA 1KDOA 1GSIA 4YC7A 1NMXA 2GDDA 4I8KA 3ETLA 2ZRFA 1Z0JA 2WJJA 1X8JA 1YM0A 4R8TB 3HPRA 2BKEA 4MPWA 3SBKA 2D2EA 3RWOA 2GCHG 3IHWA 1EX6A 4Q7MB 2R3YA 1NFUA 4C0KA 3TRFA 2QBYB 4FVBA 3TIUA 1OH7A 3MNCA 2FF7A 3LWNA 1GITA 3SJBA 5TDHA 2QT1A 2BY8X 3MU8A 5GWZA 1EFRD 1XKAC 4LBVA 1RYFA 4KAXA 3U60B 2PSXA 3K9LA 4ISOA 3VXEH 4QNRA 2IS1A 1E3MA 4BGDA 4EAQA 1NIPA 1A0HB 3LA6A 4MRRA 3Q7QA 4AFZA 1E1QA 1XJCA 1WSSH 2VIDA 4DEYA 4C7OA 4AIIA 4HTCH 2GXSA 2HLCA 4DLUA 2ULLA 2PKSC 1GBBA 3BOSA 3FHOA 2K1QA 1UVTH 1O36A 5ANRB 1W0ZU 3AH8A 8OHMA 1SLWB 4JLAA 2QT0A 1G30B 1IQNA 2FDAA 2DCUA 5EE9A 3QX5H 1AN1E 1O5CB 2A4RA 1NU7B 2DY1A 3S7KB 1DAMA 1C9TA 2ZRLA 4LPKA 1YR8A 4KFSA 4IVRA 5F8XA 1E0JA 4NCIA 2SNVA 2XOKD 2BY6X 1FY5A 2ZVPX 3A7TA 2WPDD 4Q4JB 4LJ9A 4PQYA 2PGQB 1IXSB 1AB9C 1OWDA 1T5LA 1QL9A 3IWMA 1IJEA 1N5LA 2FEMA 1CKEA 1PVOA 4F49A 1ZD9A 3SV9A 4E7RG 1O3HA 4UXIA 3AB3A 3B1WA 5A8XA 3ZZ0A 1SOZA 1YRAA 2V3HH 2ZDKA 2XXAB 2NIPA 3AAUA 2RKOA 3QXHA 5FBLB 3HK6B 5D3MA 1UCYK 1Q12A 1KI4A 3CX6A 4X2YA 1Q22A 3I4LA 2C2HA 1IOEA 4U7DA 2XBVA 5FI1B 2IYTA 2F83A 4Q7JB 1GDDA 3GY5A 5FOVA 1OPHB 1HUTH 2ZF0H 3LXXA 1BUIA 3EXAA 5L3QB 4JZ1A 1EFRA 4D25A 3ZH9B 1AZTA 3KQCA 1AQUA 2Y5GA 4DLVA 1W0JD 4G5GA 5K8UA 1NZQH 2QM8A 4IC6A 4HEJA 2O8MA 3ZLJA 2W6ID 2A5AA 2GRJA 2HF9A 1L7VC 4V0MA 4B2AA 5C1UA 3BEUA 1GM5A 1FLEE 4Q00A 2FNAA 3AW0A 2H57A 3EA8A 2Q6GA 4QBIA 4JLVA 1W46A 1Y3AA 1VHTA 3BFKA 4KELA 1G291 2OHFA 1XD2A 2RGBA 3BE4A 4X1PU 3U1IB 4GUXA 1Z63A 1ANDA 4I32A 3GLIB 2QY9A 3B1ZA 5L3VA 4QG7A 1V6DA 2REBA 2G8TA 4LJ8A 1RRGA 4R7ZA 4B47A 1DAGA 2PW8H 1D4PB 1VIYA 1AU8A 4TN1A 4US0R 5KDLA 3SYKA 1C5QA 2ZS8A 3URCA 1GI4A 3KKOA 1TUIA 4IFBA 1O5FH 2XOKA 1J90A 1NLFA 3O8BA 5EP2A 5LB4A 2CCJA 1N6HA 2WPDA 1ZYOA 1C5NH 5DP4A 4D4MA 1E0FD 1OWHA 3K0CA 1EAUA 1FQ3A 3KQKA 4JSTA 5DYGA 1NF3A 2RH5A 4J0QA 2ZRBA 2Q1JA 2YINC 1T0HB 4DSUA 2UUFB 4KFUA 4DHEA 5J40A 3FP8E 4MKHA 3KZ1E 1S85A 1ARCA 1UVOA 4B2IA 5DNYB 1P2SA 3BGWA 4Y76A 3Q5EA 2XNIA 2C5LA 4AORA 2PV9B 5B2ZA 4HYYA 2IYUA 1TQ0B 4XSKU 1RW4A 2ZI7A 3ESTA 3HKIB 2VIWA 1XTJA 2JLSA 3NXPA 2ATXA 1G64A 1LNZA 2YVUA 1VCPA 2EWWA 1P60A 1UBGA 1SVOA 2QRNA 2QXJA 2QF0A 1W0JA 2ZE8A 3KQDA 4BTIB 3PLKA 1O2XA 2GZAA 1P11E 1WF3A 4EPYA 1F5KU 3VR5A 1THSH 4FUJA 2W6IA 5CYPA 1UK4A 5FTNA 1YE8A 3GLHE 1TX8A 1W2HA 4C4PA 4UJ5A 1TNHA 3G0HA 3CF0A 2OAQ1 1KI6B 2BC9A 3R3GB 2FZLA 3I62A 2ZI2H 1MD7A 1LW7A 2YOLA 3TGPA 5HKKD 1LVGA 4IFEA 5CK4A 2IW3A 2PLRA 4SGBE 1MKXH 1HJAC 1NLYA 1YRBA 1UBEA 3VFDA 4U30A 2GJAA 4KYUA 2JLRA 4LYFA 4HLUA 3GDSA 2P3FH 2Q9AA 3TSOA 3H09A 4X2VA 2NO1A 1CA0C 1FMJA 4BTTB 3IBYA 3OFND 1HV8A 4JZKA 5J4YA 1S1CA 5FFMA 1AUTC 5GJCA 3TK6A 2BMJA 4KV9A 2J4IA 2ZR7A 4B73A 3B85A 2B0FA 4M9FA 4KO8A 2B21A 2A7JA 1QJ1B 2QPAA 4LY6A 1FFHA 4GI7A 3GY8A 4GOJA 5CIQA 4XOJA 3LV8A 3VMFA 3CRMA 5BPEA 1DUEA 1EAWA 4PC6A 1GL0E 1Z5ZA 2ZRGA 2EI7A 3ZDQA 1XEWY 1S1MA 3B8HA 3KXIA 1IBRA 1J16A 1E2IA 2KI5A 3H5CB 4B75A 4LOYH 1EZUC 3GLFE 4GPGA 5DP5A 1NN1A 3RLYH 4ZXXH 2AWOA 2GXUA 1XUGA 4WF8A 3RXBA 1G8YA 4JVNA 2NWNA 1BIFA 3U7GA 3MMGA 4HAUA 3TK5A 3GD7A 4MDEA 4TMXA 2BX3A 2AFHE 5FTMA 1FOEB 1L1JA 2BDAA 3CRVA 3NUMA 2GZHA 5JWHA 1ZC4A 1NVUQ 4Z1MD 4LX0A 4UDWH 2FOGA 3ZZAA 1GCTC 4LHYA 1OXVA 1XXHE 5HKKA 5JJKA 2HRVA 5LGOA 3I73A 3X1DA 1TQ4A 1Y5BT 4FWIB 3U8RH 4O2LA 3M5LA 3TBKA 3ZS9A 3RXUA 4Q1CA 2G83A 1Q44A 2FGKA 4R98A 3RC4A 4M8NE 3TAUA 4A36A 3QO6A 1A0LA 4INHA 1Z07A 4ZCLA 4FMCB 2HALA 4PQRA 1ZAKA 3OFNA 2AMQA 1DELA 3QXXA 1NRSH 4IKEA 3WMFA 2ZFRH 3S7HB 2OBMA 1SHYA 3CR7A 3QKRB 2FV8A 5EGMA 2LPRA 3SGBE 2AFIE 6CHAB 3BK7A 3CBQA 1NN3A 4DIEA 3SUEA 1KAOA 1U0LA 3HYRA 1ZNWA 3MYWA 4ZDWA 2NU0E 2YC2C 2HVXA 1P04A 1D6RA 1OSNA 5ABWA 1CHOF 3QG5A 3T26A 1W36C 4A1VA 1FNNA 4RI0A 1TLDA 1HY3A 3U7FB 1QQUA 4GCHG 1K1LA 1W7XH 1SGCA 4OI4A 2XNDD 5FL3A 4Q19A 2OUKA 4B32A 1W0KD 1QHGA 2HPPH 3DT0H 3BG4B 1KI3A 1VYUA 3FOZA 1W13U 2PKAB 1EQ9A 1EZXC 1AQYA 2ZI4A 3SU8A 4KTUA 2FPLA 4AKEA 3PLBA 2VF7A 2A5FA 1WCZA 3U44A 1OOKB 1VITF 2J46A 3TQCA 2EYUA 2GEDA 1H9HE 3N2EA 4BOHA 2J7PD 4Z1MA 1H4WA 4LBZA 1C1QA 1C5VA 1AS2A 1ZJ6A 1BCUH 4OBEA 3CS0A 1ANCA 1CHOG 1ZW6A 4M22A 4DIHH 4OI1A 3DA9B 2F3RA 1QZXA 2GJSA 1GJ4H 2PGBB 4OHVA 3OSYA 1YPMH 3U7HB 3SUDA 2J2UA 4I8LA 3BH7A 3M3TA 5AFYH 2ORWA 4DCUA 2NO6A 4YMSA 3W34A 9LPRA 2OC7A 1TBZH 5EUQB 1NESE 4P3YA 1G6OA 1Y3UA 3EZFA 1VITG 2DWQA 3EPHA 1ELDE 4M0LA 1HV7A 2EW1A 1KXAA 1A2BA 4D9RA 2QGRA 3SNAA 1CA8B 1KTVA 2WWHA 3ZZBA 3A8BA 4BEBA 1MKWH 3F68H 2BVNA 1KSGA 1Y5UT 1FDPA 1V2TT 1GTVA 1SGEE 2FWWA 3L0PA 4ACBA 4TQ9A 521PA 4Q7YA 4PR0A 1LB1B 3GJ6A 2G1KA 1EP6A 1UKYA 3ODFA 1ZD1A 2F1IA 4FCVA 3VNUA 4O25A 2R9VA 1VPLA 3L0OA 3EIEA 2XNDA 3P92A 1XJQA 2JJ2D 5FOTA 1W0KA 2RDLA 4E22A 3FVQA 1FW6A 2CMYA 2ZYVX 3LX8A 1SFQB 4A1XA 4N3NA 3QENA 1O2JA 1OIWA 1GUAA 4DLZA 2CHVA 4Q9LA 1E2JA 4C7OB 5KSPA 3VTKA 1Q3TA 2FGJA 2QQ0A 2WSSD 4KJZA 4PC3A 4RFSA 2J0UA 1PLKA 1JXPA 3U7EB 1DAKA 5JBCS 1D9XA 2J7PA 3P17H 3IO5A 3MU0A 1HBTH 2WOOA 1P03A 4ZAEA 2Y5FA 4GAWA 1YPGH 4VGCC 4Q5IA 1SVSA 3HWSA 2PH1A 1G2LA 5JS7A 1MABB 1EASA 4LZ1H 2BDGA 3N2IA 2QMHA 4BLQA 4Q7KA 1Q3HA 4M1KA 2XC4A 2VVVA 1HAOH 5SZHB 4WA7A 4JLDA 5F9FA 2JCSA 5GNDA 5DGXA 3SBEA 1K2I1 1AK2A 1G9IE 1WA5A 1JECA 3R8CA 1O2NA 5C20A 4JSYA 2UKDA 4JL6A 4NYMQ 4ABHA 4XVRA 3OE7D 2YWEA 2W7SA 3S69A 1V2RT 5AJXA 4LZ4B 2JLQA 3TW8B 2ERXA 3B8JA 4UNRA 3AKYA 4B34A 1UDWA 1O2OA 4JLPA 4NGAH 4UNSA 4B2PA 1P06A 4S2EA 4ABDA 4D76A 4F38A 2YYZA 1KK1A 2EFDB 2FWRA 3KJEA 4AURA 2HWLB 1T0JB 3VKHA 4NYJQ 1NC6A 3Q7PA 2VH6A 4TLEA 1FQJA 3R9WA 3TU7H 4SGAE 1CJUC 2JJ2A 1UJ1A 1LF5A 3A6PC 4UE7H 3CWZA 2SGFE 3ND9A 2GJKA 4DVAU 4Z51A 1DPFA 3LGTA 3RLFA 3T5GA 4BQSA 4CBNA 4OS5A 2WSSA 1AJEA 2ZECA 2IUUA 4PC1A 1O30A 4B2CA 1ZMLA 2ZPRA 4Q1FA 1SGNE 1T8OA 2NU3E 2Q9CA 1ETRH 3SJ8A 3SGQE 4UQOA 3C27B 1DO2A 2ZWLH 1VJAU 4GZLA 4BZXA 1WU1A 4YMUA 1IN6A 2ALPA 3RS4A 1ZM7A 4BTUB 5E0JA 4P32A 2TRMA 2ATVA 4ZKOU 2QAAA 4CEIA 1I2MA 4EPVA 1V2VT 1ZSKA 3OIVA 1SVMA 1KO7A 2BDIA 3TJOA 4DBLC 5EUMA 3PG5A 3D6TB 2ZHQH 5E0GA 2IYYA 1C4OA 1L0ZA 3NBFA 2ZXUA 2ZE7A 2BMEA 5JDUB 3E5HA 3SZRA 5J4HA 4JMYA 1N6LA 5G3ZA 5KO2A 2AFQB 3K9XB 3OY5U 3OE7A 4UXJA 4CF7A 2Q9BA 2D2FA 1A61H 5LPEA 1T8TA 1OYTH 4ZIRA 3QKSA 4EDHA 3HDTA 3RUOA 4URVR 3WBKA 4P31A 1ZRHA 2IHYA 4AKIA 3VB7A 4JLNA 5JRZA 2MSEB 4Q2KA 2BEKA 3Q72A 3IIKA 5EPNA 3QKTA 1DWDH 4D0NA 2FOMB 3A8DA 4TYQA 3PEVA 2AD5A 3E8LA 3ZZ3A 1DE7H 5HPYB 1UHBA 1GIAA 2AGEX 3FVFB 2VVUA 5JHHB 3A83A 5EOKA 5EPYA 1FY1A 3C8UA 3KUDA 1U0HC 4TTPA 1QURH 4B3XA 1BBRE 1MKYA 1QHHA 1ZCAA 4DSOA 1O3PB 2ODWA 2W2VA 1W47A 1GFIA 3L8ZA 1DBSA 1M34E 2ZIAA 5FX5A 4ERNA 5G53C 5AK0A 2QUZA 2IOTA 1SG8B 2NZ8A 4I8GA 3OYPA 1SMFE 2PT5A 2BM0A 1KIMA 3GYLB 4Z54A 2FH5B 2ZIQH 2ZJZA 1O2IA 1E32A 4UFEH 4LJYA 5BN5A 2DWOA 2BLOA 1UBCA 1GG2A 3PB1E 2GD4B 1COWD 1E9DA 1P3CA 4CR9A 1SLUB 1ELOA 1BTZA 1F60A 4CHAB 3GLHA 3FMIA 3IITA 3PENA 1BA8B 1VG0B 2CF8H 5TCAA 1YC0A 4IW4E 3PV2A 5FUVA 2GTBA 1VITH 3UXMA 3X1YA 4IEEA 1UK2A 1FX0B 3RXIA 2XX3A 2I4IA 1HQYE 3NEJA 1MAYA 1BYUA 2FN4A 5DP6A 2QI9C 3MWLA 1HAHH 1Y8TA 1PQAA 1TF5A 3A4MA 3VKWA 4EIWA 4J2YB 5AF9H 2G9NA 1BTPA 3KQHA 3UFAA 3QN7A 1SFIA 1ZHPA 2UWPA 2VGCC 3HPTB 3IO3A 2C9YA 1G8PA 1DAFA 1UDXA 2V1UA 5FOWA 4XIGS 1SVPA 1YF4A 4O97A 2VU8E 1OYYA 1RRFA 3W5IA 5FTLA 1OJLA 3EGKH 2Z0MA 1NRRH 4RZXA 3FANA 3TLOA 1D3DB 1YZGA 4M1SA 4NIYA 3HR8A 3O8CA 1ZLRA 2A5KA 1G5PA 2P3UB 3F6UH 5KNCA 2I1VB 1LTOA 1QA7A 1Y5AT 2NGRA 2ZDLA 3AVQA 3DM5A 4UFDH 4CRCA 1TIOA 2QTVB 4ABGA 4MNXA 1B0FA 1O32A 1E2DA 3ZYEA 5FTKA 3ZZTA 4E09A 4D7GA 1G6HA 1S3GA 1OWKA 4EQ6A 1S9DA 4CR5A 4RKFA 1JR3E 1NKSA 4BFWA 1GI5A 2VP4A 3GLFA 1JAHA 4AX9H 2WSMA 1E1RD 1BRAA 4F4CA 1COWA 5K8LA 2O8EA 1ESMA 1HUQA 1Z1IA 2ZTZA 1R7RA 2OBOA 2VSXA 3A1WA 4BFTA 1FY8E 2R9PA 3SZNA 2RCNA 2OZEA 2RHMA 4G3XA 1SB1H 1K1MA 3ENSB 2BXUH 1BZXE 1RTKA 3D31A 1D9ZA 2KE5A 4JZDH 3KDSE 2QC2A 5CIWA 2O0JA 3IIMA 1QVRA 1QBVH 1K1OA 2CL7X 1CT2E 1X86B 4L8GA 4QHSA 4Y7BA 1XXHA 5E7IA 1CR4A 3QOFA 2FSFA 5AUOB 4B2BA 1AQ7A 3AVTA 1NS3A 2J1LA 2SNWA 2WJIA 4JYCA 2ZU5A 1F2TB 2ZEBA 4TMWA 1F2UB 5CHAB 1EXMA 3OTJE 1D8TA 3NBZC 5C1YA 4GDFA 1XNJA 3KQNA 1YZKA 4WVFA 5H8WA 4AYWA 1QG2A 1H1BA 1WB9A 2R3UA 4NTZA 3K9NA 5A0BA 1TGBA 2JA1A 5F98A 3WNBA 5JECA 4URXR 4WXIA 1V2WT 2UZIR 2A7HA 2VWOA 4MPUA 3FMOB 2GJ8A 1GDNA 4YO9A 1E0KA 2VIOA 3WP0A 4NMMA 1YPEH 1GBMA 2VIVA 1QIXB 1PPGE 1Z6GA 2YOHA 1ZC3A 3R8FA 2J87A 5FX6A 2GTPA 1A5GH 3DFJA 1OH6A 1LKBA 2NTYC 2FOAA 4L9SA 4A0FA 3H0KA 5DIFA 1W7GH 3PROA 4OK5A 3QK1A 2VHUA 3CH5A 1P01A 3RXGA 1E1RA 1R8SA 3SJAA 1UF9A 1SGRE 3UPEA 4CRFA 4ZDJA 3GCHC 1NVVR 1M2OB 2FFBA 4Q4HA 1ELTA 2A45B 3FWYA 1J17T 4DDUA 4QL3A 2WWYA 1K1PA 4W7SA 5KDDA 3UY9A 4ACAA 2ALVA 2JLZA 2F4LA 2NU2E 4PZYA 3W3ZB 1MO3A 1C4Y2 2V8OA 3P6ZB 3UANA 1SVIA 2C8ZB 1EZSC 1GDQA 2BM2A 1GMDF 2YNAA 2GBLC 4BEJA 3WBJA 5TXGA 4ILEA 5HM9A 1GHXH 2FX6A 1NTPA 1WTHD 3RXVA 1P0SH 5DP9A 1HGTH 1LHCH 3GCGA 2WWWA 4BFZA 4EFLA 1GCDA 1EB1H 4NIXA 3MU1A 2IX3A 3A8AA 1NM6A 5HYOA 1AZZA 4WH6A 3MHWU 3RDPA 5FPTA 1ZTLA 1K5GA 2A2XH 1YPHE 2D7CA 3MU5A 1UTQA 1QBKC 3U6KA 1C1TA 4P4TA 2OLJA 1OB2A 2FP7B 1AGJA 1E2PA 1ZUIA 3T15A 4JBWA 3KHVA 1RZ3A 5LPFA 2VP0A 3QF7A 2PKSB 1SVLA 1HLTH 2WUCA 3DHWC 3T25A 3QPUA 2D4HA 1P72A 3IPYA 1QR3E 1GMDG 1BBRK 4A6LA 4IDQA 3GCOA 821PA 1TPPA 1HAYB 3GY7A 1CU1A 2DR3A 2HEIA 2ONKA 3FP6E 1TGNA 3GISB 2RAPA 4Q1DA 2AMDA 1ZM4A 3U6BA 4P0TA 3L6PA 3LC5A 2J0UB 3W6NA 4JJKA 3UPUA 4TWWA 2Z3EA 4RY2A 4HAZA 5LPRA 2PUQH 4M9SA 1C2IA 3A80A 2QAGA 4A6PA 3BTEE 1D3QB 4FIDA 1P3EA 4IXNA 2QROA 5FBIA 1LVMA 4A8JC 4GOKA 4NFEA 2BDHA 3P32A 1P73A 4JL5A 1AB9B 2HPQH 4PC7A 5AJYA 1FPMA 3RYTC 3BTDE 3BTME 2AK3A 1THRH 4A6XA 1WXQA 5M04A 1EFHA 4NDZA 3OIYA 5AUNB 5A8YA 5FL7D 4BAMB 1OYWA 3LH5A 2I3BA 3EZ2A 4OHYA 1ARBA 1Q1ZA 3RABA 3ASYA 1T8LA 2XZOA 3R7WA 1E36B 1YPLH 4Q1EA 2ORVA 3QLPH 4PHFA 1LPZB 3LQRA 2A5YB 3QUSA 1IN5A 1TAWA 1ZRBA 2LCFA 3PM3A 4PXAA 2B6HA 4YESB 5E7MA 2ZFTA 2HJVA 3AM1A 3A8CA 3TKLA 1TOMH 1VHLA 1FQKA 3QI2A 4YOIA 3RXKA 3RAPR 3JZ2B 3SGAE 3TMKA 1GI6A 2Q3HA 1E9EA 2AXNA 5BWMA 1R0WA 4HB3A 5KTYA 4LC0A 2BOKA 2C93B 2Z9KA 4OQNA 3A4NA 1LS1A 2BD8A 1OP2A 3W8RA 3BTFE 4F92B 3QGNB 1MTVA 3LONA 2KWIA 4URZR 3LT3A 1NVXQ 4WZBE 1BHXF 4KU4A 3SHCH 4D4KA 1GILA 2KBEA 3U69H 5L6NH 1RRKA 3GCNA 2FOLA 4YMWA 2HXYA 1XZPA 2ZE6A 1Z2AA 3O8DA 5E3HA 3H1TA 2G0NA 1AKEA 2A4GA 1ZSJA 2H2ZA 4ASUD 3DMNA 1N6XA 3QXJA 3SI3H 2F3CE 1XUFA 4Q03A 2F3TA 1G2MA 1N5JA 1K1IA 1ZPCA 1G3BA 3BB4A 2XJ4A 1C4U2 1UADA 3VB3A 2CLDX 3RNLA 2GF0A 1TOCB 1O2WA 4AYVB 2CCKA 2UZ3A 3PWCA 5JJLA 1K1NA 4DLSA 1NP6A 3CF6R 2N42A 5FPSA 1NFWA 3CS7A 1II9A 3OZXA 1R4AA 1ZHMA 4I33A 4CEIB 4WWYA 1R5NA 4HDOB 2M5TA 3IEUA 1ZP6A 4DRZA 2ZI9A 5FL7A 2BX4A 1BS1A 1EWRA 3ZVAA 4JLKA 1NFXA 2NO0A 3RXAA 2FDCA 2UWOA 3G5UA 2OAP1 1HYQA 3SE0A 4YOGA 2IC5A 3QKSB 3C1KA 2UUYA 2ZYWX 2G1JA 1FIWA 1T6NA 2ZRKA 4YZUA 4LGMA 4A0RA 2NG1A 4GLYA 1UVUH 2AX4A 1MTSA 3B23B 4NA8A 3SNDA 2AHOA 3MWYW 2OQ5A 2EFHB 1IXZA 5G4BA 4URYR 1HNEE 5H4IB 2DPXA 2TMKA 2OE2A 2JGNA 1ESNA 1DWEH 3RXDA 2BM1A 4RD2A 2QG6A 4LYAA 4GNKA 4YDSA 3GDUA 4CRWB 2BDCA 3N7OA 5GJ4B 8KME2 3ZZ8A 5IDKA 4B2LA 4TY6A 1C1YA 1HAPH 4ASUA 5CYOA 3SU5A 4WW0A 2IYQA 3SW2B 4OL0A 2R0LA 1BRCE 4JK6A 4O9VA 3ASZA 4AGKA 1BOFA 4KBFA 1IOZA 2VF8A 1ZOMA 4H9GA 3EARA 3SC3A 1QA0A 1LCYA 1JEEA 4C0SA 1TF7A 3T29A 2QSYA 3FFBA 1MOZA 2WZQA 2ZU3A 2AKYA 1C2FA 3Q8XB 4FINA 1YZTA 3ATLA 1ZRKA 4AK9A 3GLHB 1RVDA 3R9XA 4A2WA 3GY3A 1WDTA 3RC5A 4AB8A 5EW2H 4E06H 3BD9A 2BQWB 1GWAA 3RS5A 3QPWA 2FTMA 4IMZA 1HIAA 4V0LA 1X8KA 2CHQA 2CEAA 3AVVA 4JYVH 1XFAA 1JR3D 2H5DA 1IQLA 4B35A 2ZUCA 1DANH 1K1JA 4Q7XA 1KTTB 1W5TA 4QBFA 1PLLA 4IN2A 2QXHA 2VINA 1AE8H 1IQPA 3VHXA 4BXWA 4FXGH 1ZNXA 4R0IA 2FIRH 3IBGA 5AFZH 3V4RA 1Z71A 2Z9GA 4Q9JA 3UIEA 2WPKS 3T06B 4OHWA 1T8UA 5KSZA 2D7DA 2R2AA 1C2JA 3M36A 5KDOA 5KPDA 4AFSA 1M1YE 3SFZA 2VWMA 2ZRAA 4HZUB 3DKPA 4C2UA 1XZQA 4B3CA 1JXMA 2IK8A 3KTAB 2YWHA 3ADCA 4LK2A 3QY0A 1M74A 2ZTSA 1XF9A 2SGEE 5K0HA 1FJSA 1TRMA 3WMGA 3UNQA 2OSBA 5DHFA 1XPRA 3U8TH 1RJ9A 3IILA 3PVSA 4DDTA 1NVVQ 3BTGE 3O47A 1J15A 3MTYA 1TTTA 2WJYA 1XMNB 1K22H 2RGNC 2ZCLP 4MG3A 2O8WA 3K9GA 1TX6A 3NBXX 1JBKA 4NYIR 1TWXB 1O3DA 3TUJC 4DCNA 4XSGA 1C5MD 1W49A 4CH2B 2GP9B 2O8EB 3PUZA 1K5DA 3T61A 4MUAA 4B1TA 4M1YA 2B7CA 4INLA 2VP5A 2WKQA 4HLQB 5C1XA 3P4YA 1WBGB 1JJVA 4ABEA 1R8QA 1EATA 5TARA 2G4TA 3T35A 2ZC9H 5JS8A 2PL3A 4Q18A 1OX1A 2GZ9A 2UUKB 1T3LA 1O3JA 3O8RA 5C1BA 2VBCA 1O2VA 1JR3A 1ZJDA 1XXHB 1QJ6B 1RXPA 1AVXA 1Q3XA 1TGTA 4PAOA 4O03A 1MO6A 2QGNA 3KQBA 3UOPA 5BXQC 1W36B 1T7CA 3OAAD 2WV5A 3I72A 3KUCA 4IDPA 1RC8A 4GL2A 1GNRA 3STIA 1C5TA 1LF0A 1VR1H 2G55A 3K1JA 4GBMA 3PUYA 1BYIA 3IG6B 3RWMB 3ZZ9A 2W2XA 1UJ2A 1F2SE 1BO6A 4V0OA 1GHVH 3TSZA 5AUQA 3QPVA 2FS9A 4UKDA 4K3JA 4K2YA 4CRAA 4GFDA 4QNMA 2W5EA 2CXVA 1A3EH 2H16A 2BBSA 1TALA 3K53A 1KSFX 5KYKA 1ELCA 1Z6EA 2XTMA 3RHFA 3E2IA 4TYDA 1DITH 1FPHH 3CWQA 1CJTC 4MQBA 1ORFA 1KY3A 3A1SA 1Z6JH 3E1SA 4AC9A 4HUTA 1N6YA 2P6UA 4BAOB 3DO6A 4NCYA 1TYNA 3TVTA 1YZLA 4F4OC 1QHYA 1AIPA 3E0PB 2TGPZ 3K0FA 3TGJE 5GVSA 4L4UA 3GLGB 1OFTA 1G3EA 1RRPA 4X8OA 1J8YF 3TK1A 2UVQA 2NO7A 1DAEA 4GT1A 4US2R 4Q7LA 5KSYA 1N6RA 4NG9H 1GL9B 2F9LA 1AGRA 2WPJS 3P26A 3I3SR 4ASHA 3RXOA 2EI8A 2GBLA 2AIQA 1HAVB 4DOQA 2HYDA 1SGFG 5KNDA 1RFNA 4JL8A 5JBQA 3LD9A 1DXWA 3ZVGA 2F6RA 2R6CA 4TWYA 4U32A 2P5TB 4FN5A 121PA 2ZGJA 2QP4A 1O5EH 1HT2E 1XDBA 5JFGA 1ANEA 1N1LA 4QGFA 5HCNA 4NCJA 5FR1A 1ZIOA 3OAAA 1NPMA 3KQLA 2BLWA 1ELFA 1QB1A 2BIFA 2EC9H 4M1TA 1W4RA 1MT0A 3BJIC 4ZKNU 5HM2A 1KIGH 4LV6A 4ISIH 4H6TA 1U8AA 5TJXA 3HP1A 5EZ5A 3EC2A 1E4YA 3MNSA 2ORIA 1XMIA 3B1VA 1JWTA 4GSYA 1EJMA 3QVUA 1EPTB 4QHYA 2XTNA 5KUTA 2WBLC 4MGYR 2ZRJA 2OO7A 1IHSH 5A5GA 2QP9X 1ZVQA 3SJCA 2FPKA 4ZO4A 3QEOA 3I77A 2W2TA 1Y59T 5FUWA 3QWCH 1NN6A 1INCA 4X8VH 5JHGB 4E5UA 2BQ6B 3RMOH 3VU9B 2ZO3H 5F9HA 3PTNA 3PUWA 4A8JA 2Y5HA 4UFFH 7ESTE 2P0EA 1XCGB 1ELBA 4EPXA 1D9IA 1YLCA 1K9OE 2WIBA 1NJGA 4CH8B 3P8GA 4HAVA 4P4SA 4OHZA 2XAUA 4G5SA 1GBCA 3Q00A 1ZJKA 4M1MA 1TMBH 1OWIA 4I8HA 1E2NA 3PUXA 2A4QA 5FXLA 5FOUA 1KHTA 4MYHA 3SNHA 2ZTYA 1VJ9U 3QVVA 6GCHF 2ZGCA 3LGIA 5DO9A 3SJOA 3SU1A 3LVRE 4BZPA 3T1TA 2P16A 4X8MA 2V6NA 1G7CA 4TT3D 2B8WA 2IJD1 3ZIAD 1HB0B 3LIWA 2FI4E 5FOXA 2ZGBH 1RE0A 1N8OB 3NHAA 2Y8EA 1QRWA 4KFRA 4I99A 5EG4A 4ARZB 4B33A 2JH0D 2HT1A 4TLBA 1L1NA 3KF2A 4UFGH 4C0BA 2OFOA 3EWAA 2QF3A 3HKJB 3EW9A 1TMUH 5J47A 2W0SA 6GCHG 1FZQA 2A9KA 2FEOA 4FUEA 4QC2A 1G3DA 3A1VA 2Y7XA 2V54A 1UTPA 3AP3A 4FUGA 3I32A 2PZEA 1Z22A 4WH8A 2PEZA 1C4V2 3BBPA 2WICA 1KO8A 1VTKA 1ZM2A 2AR7A 1DXPA 5BYKA 1H8IH 5FPYA 2CN0H 1J70A 3T5FH 1GVNB 4Q66C 5FH9A 3FDIA 1ZUNB 1X8LA 2ZEJA 4V0NA 4AFUA 5P21A 5E7JA 3PEWA 5EZ6B 1CLUA 3A36A 2WM9B 3DOEA 3WHKA 2ONJA 4QBGB 1EB2A 1CR1A 1UTNA 1RS0A 1O2SA 1OE0A 1Z0FA 4IOJA 3SEAA 3RXHA 3B9PA 3CP7A 3RM0H 1MU6B 1SI5H 2HF8A 2BCJQ 2GWHA 5SZJA 3RLWH 3SV6A 4PHHA 4TT3A 1IHUA 3ZIAA 1NLZA 3EYDA 1MBMA 3P20A 2ZM5A 3QKRA 3AQ4A 1C2LA 1CGJE 1KMQA 1Z6TA 2V4ZA 2WJHA 3E91A 2F9UA 4FWTA 5DI3A 2Q6DA 3AKCA 3GQBA 3H84A 4A92A 2J0QA 2YOGA 4MPVA 2QM7A 3EIHA 2XC5A 5FCKA 1BKDR 1W4CA 1QB6A 2F1RA 4A1FA 4JIMA 3MCAA 1ANBA 4UONA 3D8BA 1XTIA 5BN3A 1Q1QA 4ZDKA 4Y10E 1G3MA 4PPFA 2O8FA 3V9PA 3OESA 2VSOA 2GT8A 5EXNA 5GJVC 4AOQA 1SGQE 2BXTH 2O9QA 2A2QH 1GVKB 2OQUA 1WTGH 2QXIA 3RRNA 2Z5FA 2ZUBA 2BBOA 4MRNA 4AWXA 4EUNA 3KJIA 3P8OA 1AMHA 1WXRA 1LPGB 2ZG0H 3EE0B 1QL8A 1XB2A 2VA8A 5KHOC 3UG6A 1S0RA 1UO6A 1VG9B 1DLKB 2GCTC 1S5SA 1Z6XA 4X6NA 3SBDA 3LPRA 2GMTC 2C90B 4WMDA 2A3RA 3THXB 1Q0UA 4CIDA 1P2UA 4XWOA 2YKGA 1YGCH 2BVXH 2ZJOA 1E35B 3PQCA 5B6LA 2Q3MA 3TLXA 4QJ5A 2ZFQH 4F4IA 2P65A 1CVWH 1E4VA 2JKHA 2HT6A 2R2WU 1AKYA 1FY3A 4BLPA 1AA9A 3WXMA 2ZRMA 4BLTA 3QNUA 1P05A 2I1QA 3HU2A 1EAXA 3AF1A 1HIAB 1W3CA 3Q85A 2OFXA 2RGGA 1P2IA 3C5CA 4EJSB 4DDWA 1SVKA 4ISLA 4JZFH 5L30H 1C2EA 2FG5A 1JJ7A 5UKDA 2VHQA 2WINI 4NWLA 4TPIZ 2FX3A 1V2PT 1T4GA 1DY9A 2ANKH 5KSOA 2QMUA 5E2PA 3LGYA 4TLCA 1EG7A 2BD7A 3LGUA 2V1XA 2G77B 2QSZA 1A46H 4KYIB 3GJ0A 3Q77A 4AYXA 2ZFFH 3GJ4A 5T6FA 5J5CA 5FPKA 4A0GA 1IN7A 2B8OH 3AVPA 1HURA 3CRQA 8ESTE 2C3SA 4CGZA 2OEPA 2PT7A 1WUNH 4PSAA 1M6NA 1GJBB 2P93A 3MD0A 1UEIA 3TUIC 1GI1A 2RGNA 1GJCB 1H9IE 1GL7A 5JCPA 1RJ9B 3BTQE 4DLRA 5TB5A 2G5NA 2CDNA 2WTUA 3LU9B 4BRUA 5TVKA 3JZAA 4E7NA 2D1JA 4JZEH 2HOBA 4X6MA 4KCGA 2GEVA 5DSZA 2XXLA 1P2OA 2X77A 5SZIA 3K65B 3UQVA 2FYQA 5KOYA 1IONA 3EPLA 4G5RA 2QMOA 1BQYA 1ACBE 1JRTA 4NKRA 2FLRH 5DI9A 1ZTJA 3U3OA 5IF9A 3KL4A 3K0AA 1C2KA 1QTFA 4U01A 3TITA 1TQDA 3A58B 3SV2H 2CXXA 4PROA 2IT1A 4URUR 1MKXK 2FPZA 3CONA 1MABA 3A1UA 4ZDIA 4TTRA 2JLVA 2BLQA 2F1HA 1GMHF 3GP8A 2IS6A 3UATA 1N6IA 5J4KA 2HNTE 4H1VA 4MNVA 1O38A 1BMMH 1V3XA 4CEJB 2JJ8A 3SV7A 3UWKA 1QNJA 4K1SA 2AL7A 1C5UA 4D4JA 1BTYA 1Z6AA 4DIDA 3F3YA 3CRW1 4AGJA 1TBQH 5J4SA 2ZJAA 1PYTC 1RKBA 5AJZA 1AGPA 2ZCKP 1HDTH 4IOMA 4HATA 1FV9A 5A4JA 1R0YA 3M61U 1KXCA 4YT7H 2DB3A 1ZGVA 3MJHA 3TJUA 1E38B 5J4QA 3ZZ4A 3EZ9A 4Q4AB 4DLYA 1SGWA 3SHAH 1NFYA 1KLIH 3IPXA 4U00A 1CRPA 3ECCA 1GMHG 2MSCB 1XUKA 3LNCA 1OHHD 1KY9A 2HNTC 3RC3A 3SU2A 1U99A 2VLIA 3M1IA 1SKYE 4JCNA 1G8GA 3KIDU 5CJ2A 2DFTA 4MDSA 2J0SA 2AXPA 1GI0A 1R6BX 1J8MF 3ZVLA 3MU4A 1P2MA 2BBTA 5T1VA 4NZLA 1MRNA 3ZQ6A 3VR1A 1BOQA 2LKCA 1RFLA 4II7A 4YONB 1MQ5A 1K8RA 4XBDA 1BBRH 1SGYE 2QV1A 2ZHFH 4CRDA 3ZD6A 2C8YB 4AG1A 2G51A 3CW2A 4OJQA 1F6BA 4WMEA 1SLXB 3GCHB 3WYAA 3K0FB 3BN9A 5AR1A 3AAVA 1ZR0A 3S9AA 2ZA5A 2KSQA 1ELGA 1O3AA 2F9NA 1HYLA 1AM4D 2WHXA 2XTZA 2XCFA 2Z9LA 1N6KA 1QY6A 2V6IA 1QQ4A 2CHAC 1YBWA 3RXJA 4UNPA 3MNBA 2STBE 1Z8FA 4W5WA 5T6DA 4TLDA 2R2MB 3ADBA 2EWVA 4JLBA 4KODA 4KTSA 3ZV8A 2JEOA 3T12A 3CLVA 3FMPB 4ZCIA 4L15A 5EXXA 1TMTH 3B9QA 3CNLA 3G01A 3E6PH 2OINA 1MTUA 1FNIA 5EP3A 3KQUA 1PJRA 2VPPA 3S0NA 1C5XB 3GYMA 3C15C 1W2GA 4MKGA 3P1JA 1EWQA 1KXDA 4DSTA 3U3RA 1SHKA 4M1WA 3AVXA 3MFYA 1T8NA 1OHHA 1BRUP 3NC1C 2XC0A 4RD3A 4FMCF 5EP4A 1OIVA 1ZMNA 3B82A 4XFQA 3A82A 5TCCA 4NYMR 3BC1A 5DP3A 2PLFA 2ZGXH 3CB4A 4XDEA 4KHZA 3FAOA 2GGVB 2CL0X 4DJZB 3X1ZA 3TUZC 3R9IA 3U5ZB 1E96A 1TPAE 2AIPA 3A88A 3SJ9A 3LLMA 4W5HA 2YJTD 3VR4A 4Q7ZA 3TIFA 2FSGA 2ZAOA 1EX7A 3TH2H 3IKJA 2C96A 1P9UA 1HT1E 3AEZA 3FP7E 4A8JB 3RS3A 5C2JB 2ZDVH 4NYJR 3N70A 4JKIA 1QDEA 1TUEA 4R9UC 5BQ5A 4MYCA 1C5YB 4XOIA 2VHCA 5C4MA 1S81A 3ATIA 4P4SB 5FOSA 1CF4A 3TK9A 3NH9A 2K5UA 1CQQA 1TE0A 4OK3A 1MH1A 2PZGA 3ATKA 3SHWA 3EX7C 4ZXYH 1II0A 2ZS9A 2P3TB 2QCYA 1YPKH 2WV9A 1N0UA 3D49H 4LHXA 4WXPA 4A1TA 2GHIA 2NPFA 2IL1A 1GHAF 4FVDA 4DCVA 4DCTA 4CEHA 1YKSA 721PA 5CJPA 1C5ZB 1OXXK 4OKSA 3GCTF 4KSBA 1FX0A 2X2FA 3AV0B 1LPKB 1E9RA 3KFXA 4K69A 4A7IB 2J7KA 2MSDB 1MKWK 5HCIA 1ZMJA 4KI0A 4QKQA 3LBHA 2GAAA 4X8SH 4ABJA 2OCVB 2AKAB 3FMFA 3T34A 2O8DA 2ZJYA 1OYQA 1RTFB 3ZQJA 2ZANA 1KSNA 3QKUA 1Z7KA 1EJNA 1UTJA 4J1YA 2BHRA 4OS7A 3GFTA 4NBSA 1C2GA 2YWFA 1GHAG 2DHRA 2EFEB 3KKQA 4W9MC 1VECA 1EFTA 5F3WB 2QP3A 1YCPK 1THPB 2W58A 4MITA 2GVDC 2VIQA 3SOPA 5FUYA 3GCTG 1O5DH 1FP6A 4IVQA 3THWA 4FXPA 1GBHA 2ODNA 4D9QA 4Q9KA 2WPIS 1EOLA 1T4UH 2OC0A 4MTBA 2ZPTX 4IOLA 4K1EA 3BG8A 4NCKA 5FUXA 4LOAA 3GPLA 4UD9H 1F5NA 3KKMA 4X6PA 2WOJA 2XB2A 5AHGH 3DDCA 5L3RA 1GBEA 2TGDA 4KLNA 1AD8H 1AKSB 2ZZUH 1GMCF 1FONA 4CDGA 1F0TA 2OESA 2GA8A 3RDZA 1KTSB 4CT5A 3R20A 1P9NA 1M8PA 1ODFA 1O34A 3PO1C 5B57C 4OK6A 4Z0KA 3C16C 1N6PA 3M3SA 4OGXA 3BORA 2AMPA 2GETA 4FU8A 2CGAA 3ZV9A 4QBHA 1A2CH 2O0KA 3UMRA 3LAWA 2R6GA 3VAAA 4NSYA 1G32B 1CT4E 1ZD8A 1HAZB 1NI3A 1D2NA 3ATMA 1SHHB 1F0SA 6LPRA 2XITA 5GADl 3NXSA 1VZQH 1E2QA 3GEEA 3GY4A 5LH8A 2V55B 1J9CH 2RMKA 1T3SA 3TJVA 1AZSC 5DI3B 2V6JA 4NP6A 4B6EA 4EFMA 1YR6A 4Y0ZE 4G5QA 4UXHA 4NZYA 2RA0A 2EYQA 1F2TA 1H8ED 1F2UA 2WPMS 3K0CC 2ODYB 3WHLA 1C9KA 4LSGA 2YOFA 2ZI6A 2H18A 3MWKA 3UREA 4BXSA 4AG6A 4ZHLU 2XBYA 4DURA 1HTWA 2H7VA 1EOJA 1HCGA 2O8FB 1AFEH 1SZPA 1MMJN 1O2RA 2C8VA 4BANB 1BMLA 2R44A 1GJ9B 2ODPA 2CV3A 1KK0A 1QB9A 2ZR0A 1JB1A 1MAXA 3GLGE 1F92A 1V2UT 4PPNA 2OBLA 2Y82A 4H1UA 1IY2A 4PZLA 1IN8A 2Z7FE 2ZUDA 4A82A 1OFHA 1XCPA 4ZI2A 1WYKA 3GJ8A 3IQXA 1U2RA 3QZQA 2WMNB 2XEXA 3T27A 1NN0A 1C1UH 1SPJA 1A5IA 2ZHWH 5E4FA 1O3CA 1YR9A 1UTKA 1PV4A 3MI4A 4AKGA 2A0QB 3TNSA 5C2ZA 1XUJA 4NE2A 1NG9A 2IPHA 3ZZCA 3ZVBA 1E34B 1R0ZA 2C98A 4URWR 3DMDA 2ZI5A 4TL9A 3ZVNA 4QM7A 5JEDA 4JLJA 1O3LA 1GKYA 3A7VA 3OF5A 2BLVA 2PFEA 3UOUA 1N6NA 4TYYA 1PYTD 1BRBE 2OUAA 4AN7A 2ZSDA 1TPSA 5JWOA 2G81E 2OLGA 1WCV1 2IYLD 1KI8A 2ZGHA 1HXEH 4PZZA 3F5FA 4I7YH 1W44A 4HI0E 4HUQB 1ZHRA 5DH9A 1O35A 1RTLA 4YMTA 5HGGA 2JATA 4DZZA 1MBQA 4YTAA 1DX5M 1AY6H 2AN9A 1LTQA 5FBVB 9ESTA 4MGIR 1DVAH 3VNVA 3NC0C 2KAIB 3AVWA 1H8EA 1E2KA 1TNJA 4C0QC 2IXFA 3MWJA 2VHJA 2BTCE 2FX4A 4MRPA 2KB0A 5E0HA 1YJ5A 4B76A 3LBIA 2QMEA 1KZ7B 1DOAA 4C0JA 2XJ9A 3SU3A 2G52A 2WUBA 5DP8A 3HU3A 4I31A 3EC1A 3NG1A 2AD1A 5IK2D 2ZHEH 1MTNB 3KXLA 3RRZA 4G5OA 4OQXA 3U4QB 3PUVA 5CDFE 2FU5C 2ODBA 2DE9A 4A4DA 1E0SA 1OW3B 4P4UA 1FL9A 4IS5A 3CENA 1VIAA 1S4QA 1NVWQ 3KB1A 1KYIA 1N5KA 1J99A 2CJWA 3UG7A 3LJOA 2XRCA 4NA7A 2QTHA 1P12E 1EPTC 2YV5A 1CIPA 1HAGE 3K6ZA 1WP9A 2G6BA 3B78A 1FI8A 4PHTA 3M7TA 4IHQA 1GBIA 1NY6A 1GL1A 1RJXB 2D74A 3ZD7A 2BJVA 2Y81A 1G7TA 3REFA 3V7TA 2ANCA 4X0WU 2JASA 1GJ6A 1YP9A 1TRNA 1ETTH 4Y0YE 3K0AB 5DLQC 2F9MA 1Q20A 3IUYA 1Z8IB 4NU0A 4LJ6A 3BS4A 4TY7A 1A1VA 1OXGA 1AO5A 1E9CA 2A30A 1ESAA 1O5GH 1T8MA 4DB4A 3GFPA 3MO6A 1CBWB 2WWIA 4Q9IA 3AF0A 3U3JA 1AHTH 1BMFD 3U61B 2RCEA 2W3IA 3KKPA 3UIRA 2X8AA 1A0JA 3AKEA 4WZ6A 3VGCC 3NEYA 1U0JA 1CJKC 2OG2A 1ANKA 1MCTA 4WMFA 2IS4A 1O37A 2O8UA 1NY22 2STAE 5F8TA 4D26A 3LGVA 2ZI3A 3BEIB 3AF2A 1JPJA 5DKMA 3P70B 1TX4B 4TMKA 1L2TA 2ANBA 1N8OC 3LH3A 1P02A 2ZTXA 4UNQA 3QTVH 3AASA 1PUIA 3PLPA 4N1AA 2EFCB 1KXFA 2BY5X 4B44A 4I1OA 4LZZA 5IK2A 4C2TA 2J9RA 2QENA 2X2EA 3EDXB 2BY9X 1EXFA 4U2WA 2OBNA 4A5TS 1RGQA 2O52A 3TR5A 4DCDA 2HUPA 1GBFA 221PA 1UKVY 4DEXA 5GJWC 1GGDB 3VPKA 1A5TA 1Z0KA 1Q21A 4OS6A 2ZYTX 3TH3H 2C77A 4BAQB 1GL6A 4C0LA 4HLCA 1WQVH 3TAHA 1EESA 1A7SA 1QRXA 3SYJA 3TVDA 4NFFA 3W95A 4FU7A 1GBKA 2P5SA 4RSPA 3AVYA 1RIWB 1EAIA 7GCHF 2H9HA 4MGZR 4X8UH 1K28D 4LBYA 3W8NA 3LFUA 3WMEA 4M21A 2Y80A 3A7WA 3ZGXA 3R0FA 1CP2A 2R8RA 4OYHA 1UBFA 4OS4A 2CBZA 4WY3A 2GCHF 4POAA 2OILA 1MQ6A 1KXBA 2BOHB 2EA3A 1H8DH 3GY6A 1F0RA 4ZPXA 1N25A 1FAKH 1W10U 3DZDA 3OTPA 1G3RA 1BMFA 8LPRA 2OCBA 4MKFA 3PR1A 5H68A 1L1GA 1Y3XA 1UKZA 3SS8A 3FTQA 1O3BA 1QL7A 1O3NA 2QY0B 1JNYA 3NTUA 1IQJA 7GCHG 2GESA 5KNBA 4Y6DA 4HDCA 4IOKA 4QFMA 4RN6A 3CR8A 3W9YA 3OY6U 2IYRA 1J7KA 5DISB 4LPSA 4FCWA 2PX0A 1GVLA 4E07A 1EK0A 5A0AE 1U8YA 4ESTE 3DZ8A 5ETXA 1P3JA 3HYTA 4D2IA 5GJBA 1O3YA 1P2JA 3M3VA 4X6OA 1SHZA 1XVOA 4KKDA 1VDZA 4TPYA 4CZ2A 2C9OA 3IEVA 1HQCA 5T6GA 5EE5B 3HR7A 1XVMA 3RXTA 4RCZA 3V13A 1GBLA 5EQRA 3QF4A 3M5NA 1O31A 2O0HA 3DFLA 2ZRNA 4V0KA 2H92A 3RSLA 1V2NT 5EE1A 1PPHE 2QIQA 3QEJA 1GKUB 1IQGA 5A2MH 1C5SA 3ONWA 3QJYA 1DG3A 4YXWD 3UQOA 4DT1A 2A1DB 1XTRA 4QGAA 4LJ7A 1WMSA 1T4VH 1KO4A 2AH4X 3JZMA 4ISHH 1DFPA 3RXRA 4K1TA 3T1VA 2ZU1A 5F2EA 4U5XA 2VEDA 1S9HA 2XZPA 2BDBA 1B0EA 1C1PA 1TBRH 5JSZA 2WPLS 3EG5A 1PPBH 2BV3A 1Z0AA 4KTCA 3WY9A 3W6PA 5EXSA 3VB6A 3I5YA 1E2GA 2GDJA 4D6PA 4CEHB 3B13B 5CB6A 3AUXA 3PMAB 1CULC 1CEEA 2ZQ1A 3EZ7A 1V2LT 1YKTA 1DS6A 2XCNA 2FZ4A 1TEXA 2P6NA 1HRTH 1OF1A 2ESTE 1KI9A 4KSCA 4EJSC 3T28A 4DB2A 2HLDD 1G36A 1W36D 4DSNA 2O8DB 5BW8A 1UFQA 2ZAMA 4LRWA 4ON9A 1GI2A 5C5NA 5HR5A 1YPJH 5HZKA 4PO1A 2BY7X 1G4AE 3LH1A 2GZDA 3NDBB 4I8JA 3W5JA 2ZYUX 2RGCA 3U2QA 3RU4E 4IJMA 1YZUA 4HZUA 2IYXA 2P6RA 3LOXA 3QTOH 1ZUHA 1XTKA 1X6VA 2OT3B 3KTAA 4NA9H 1S83A 1XEFA 4XWKA 3THWB 1Z6YA 1E2EA 1A4RA 2C04A 4UJ3A 1KXEA 1W8BH 4PO8A 4M9XA 1Z1JA 1S3SA 4PTLA 2A7QA 2CK3D 1O2ZA 1I2DA 2YNBA 2VVCA 5F03A 4KVGA 3FFGA 2PJZA 3I8SA 3F9GA 1VCWA 5EE3A 3W6OA 2RB4A 1EZQA 5FAHA 2QGZA 4YXWA 3NBYC 2GVZC 1SLVB 1IY1A 1G18A 4U02A 3GJ5A 3LLUA 5E95A 3J81k 4BE7B 4DC9A 4B48A 1C1WH 2RGEA 3A85A 4DT7B 3EAJA 4DWJA 4QOSA 2IYZA 4TL8A 1K6MA 5CITA 2XGJA 2VIIA 4Y0VA 3H4MA 4TMVA 1KJZA 3TQFA 2P95A 5I25A 1S0QA 3UWOA 4UNNA 5ELXA 1FUKA 2WWFA 1XWIA 3P4XA 2FM2A 1HAXB 2R6DA 2XYAA 1O2GH 1O3OA 5DGJA 3I29A 2GZ8A 1O2HA 1A1RA 1IQIA 1AE5A 3X1WA 2J92A 4CT4B 1E9BA 3UKDA 2ZREA 5BN4A 1P9RA 1P75A 2HLDA 3KEEA 4OHXA 1EP5A 5FBRB 4GMDA 2GCOB 4OI0A 2IEZA 5AJVB 1AWHB 4F7WA 2REOA 1UVPA 1US8A 2YC4C 2HCJB 3KL6A 3U98H 4ABYA 4FCTA 3L33A 1R5BA 4M53A 1TGCA 5JEEA 4Y8YA 3B5JA 4AB9A 3PWBA 5KPJA 3ZYDA 3RC6A 4O3TA 2WV4A 2GX4A 4LDJA 2ZE5A 4RFVA 5IRCD 2W0MA 4NSVA 1TABE 1ZBDA 4IBLH 2GCTB 1C5OH 2OV2A 3GDVA 2FOFA 4D8NA 2GMTB 3B1XA 3MOCA 3VEQB 2CK3A 4LK4A 2ZSAA 2HNTF 4G0NA 1DVRA 4YQFA 2IF2A 2F1JA 1S84A 4LHZA 1FPCH 1TONA 4Q4LA 2NPIA 3WYGA 2W6JD 4N0DA 4BFSA 3OIWA 1BTXA 1VYVA 6ESTA 3GLGA 2VO1A 1FZZA 4RCYA 2MMCA 1W5SA 2CLCX 4YOJA 4DUGD 3L43A 3W94A 2XWAA 3MH6A 1TNKA 1P5ZB 2GNOA 1VG8A 4M2LA 4D0LB 3C14C 2Z4RA 1EKBB 2YNMA 4HAXA 2E1RA 1S8FA 1BTWA 5HE8A 1KDPA 4XBCA 4BAKB 1QHSA 2IBMA 1A2KC 1HAVA 4X8LA 3E1XB 2BMFA 1MU8B 1AS0A 1DARA 4FUFA 2B5TB 5JPMH 2WIAA 3GJ7A 3ATWA 3VX4A 1Y63A 1VCOA 4K8OA 1P2KA 2H5CA 1JEDA 4LWZA 1U94A 4PAQA 1OP0A 1XEXB 2W3KA 2FMXA 1XTSA 1QHNA 4N0EA 2QXGA 4FMBB 3MH7A 2JIZD 1Z29A 2GK7A 3ZVCA 2TIOA 2QE7D 3SUGA 3RXPA 4Y71A 1OP8A 1UCYH 1OXSC 1NNEA 2TBSA 1XP8A 3F9HA 1QG4A 2H1LA 1CR2A 2FOBA 2OXCA 1C5LH 1DUAA 3TPIZ 3MJRA 3S9BA 1CJMA 4TYPA 3GMTA 1FY4A 2FOHA 1ESBA 3NWUA 1IM2A 2FMJA 1BH2A 2FLBH 1N2CE 4Q80A 1EPTA 2D3WA 4A2QA 1ZU4A 7KMEH 2NOAA 4KGAA 4JYBA 3LDXH 3B2EA 4OGYA 3WRXC 4XTCS 1ZPBA 3UR9A 2RG3A 5I46H 3LVQE 2O8CA 1OKXA 1GBTA 2CJWB 2J94A 3TVJB 1CRQA 5EW1H 2O8BB 1OWEA 3TJZA 2OTVA 1FUUA 2H9TH 1G4UR 5B6OA 1N5IA 2TPIZ 3DKVA 3VU9A 1SBWA 2Q0HA 4HZIA 2A32A 2W6JA 1AVGH 1Q1EA 2VWLA 5CDFA 4K8BA 3ZZ6A 2BWJA 3QBTA 4TSFD 3WNDA 1E9SA 3ZVRA 3A84A 4QHTA 2X1VA 4DUGA 4ZUHA 3A87A 1WE2A 1G3QA 1KNQA 2PUXB 4L5BA 4LBWA 3EA0A 4PSKA 4QXAA 3H2YA 2PTNA 5A0FA 2ANWA 2PMDA 2F9OA 4C0AC 3MNXA 5IHPA 3ELAH 1O3IA 1ZMXA 4GCHF 1H8HD 2XZLA 4F93B 3M6AA 4NIWA 2B92A 1PPEE 2GCNA 5GIBA 4GRAA 1MZAA 2JIZA 4DIIH 1AUJA 2P94A 1KO1A 3RU4T 1G21E 1C5PA 4ARZA 2QE7A 2NU1E 4HB0A 5JBAS 5EP1A 3NDPA 4D7FA 1Z8RA 2W83A 3S1AA 4DLTA 1AVWA 4KVAA 2J41A 5CMXH 1IQFA 1D5CA 2DWPA 1FMLA 4BZQA 4A9AA 2R6FA 4S35A 2BDTA 3KJHA 4MNWA 2FOCA 3TW4A 1GOTA 5CM9C 1P57B 1P2TA 3V4FA 4MKIA 2JLYA 2GILA 1JQJC 2HCBA 2BZAA 4TQUS 4BLRA 1M7GA 1IQEA 3QXCA 4E05H 1VG1A 5FBEA 2FTLE 2ZS7A 1VMAA 1NIJA 1O2UA 4DGJA 3SN8A 2F43B 3SZEA 4TTQA 1ONBA 5L2ZH 2QPTA 1FN6A 1SKYB 3BIVH 2V0BA 2ZU2A 4JLMA 1SGDE 3I61A 4D80A 5JYIA 2CHAB 1GPZA 2I6QA 2OXRA 2F9BH 4G1UC 4ABAA 4Y7AA 4TSFA 5J4VA 1KMHB 2L0XA 2AS9A 1GJ5H 4TMZA 1G5TA 4H4FA 2GEUA 1ZU5A 3K0SA 4IVPA 1LKAA 4TZ0A 5E8EH 1G17A 2H8KA 1IAQA 4OQMA 3QE0A 1KI2A 2QN6A 2WPHS 1P4SA 5LD2C 4CREA 3REGA 4AD8A 3PXGA 1NSTA 5JWRA 1FP7A 1GJAB 1E99A 1Z28A 3NVAA 4PO9A 1H8HA 3K09C 3P8FA 5JB8S 1E9AA 2ZR9A 4EPWA 3GFOA 4E03A 2BEJA 1WBBA 3PITA 3MGCA 4ZKRU 2VP2A 2Z94A 3U8OH 4Q47A 2AYWA 3D65E 3QG1A 4PHGA 2PX3A 4XSHA 2Q6FA 2CE7A 1XMSA 3BF6H 1HA3A 1P2QA 4M9QA 1CSOE 3QDZB 2FODA 1Z8JB 2HJGA 1NROH 3CH4B 4Q01A 3D7MA 4JVSB 1P2VA 1C2HA 4A2PA 1Z0IA 1KDRA 1BIOA 1O3MA 4WVPE 1TQ2A 4BECA 2HDNB 3BAFA 2PTCE 2SGPE 3TE6A 4BNRA 3OEED 1DSUA 5FCRA 4B6FA 1YCPH 3C5HA 3UNSA 1S82A 1BTHH 3QF4B 1OSSA 3S9CA 5L3SA 5HE9A 3BWDD 2G0TA 1UVSH 1GRRA 3FKSD 4ESVA 1P6XA 3E90B 3HATH 4C9BA 4YM9A 2Q6TA 1G16A 1PQ7A 3RU4D 3DPUA 3A1TA 4TL6A 3A8TA 3RXEA 4DCSA 1AFQB 4AI6A 4G01B 3THXA 3ZVEA 3NIBA 1V43A 3SQEE 1UKEA 2ASUB 5IDVA 4DT1B 3THYA 2BYAX 3K70C 3E3TA 4Y11E 1SL3A 2OLKA 3DL0A 4B74A 1GJ7B 5IYTA 1J14A 4CRGA 1DWBH 1NU9A 4KLZA 3T5DA 1T5IA 1OXUA 3TGKE 5JSZB 2ANYA 2QAGC 3G82C 1BTUA 1V2ST 2D06A 3UMFA 1M7BA 4LCBA 5BYJA 5FR2A 3SR0A 5TMPA 1E6CA 2BB4A 5GDSH 4B71A 2OC1A 4EJSA 2ZDAH 4YDHB 3I8XA 1NMYA 1BITA 5L2YH 3F8TA 1CO7E 3PYHA 4X1NU 4Q9HA 1LHGH 1SOTA 1G41A 1TA6A 5JI2E 1ELEE 1TADA 1H9LB 3C41J 2SHKA 2OC8A 2V3CC 4B3FX 4GP7A 2ZU4A 4GHTA 4X2XA 5D3MB 3BB1A 3SNCA 1QGFA 2ANMH 2C03A 3HPQA 4NIVA 2C9CA 4A0HA 4ABFA 4XH9B 3UK6A 1GHZA 2P8OC 5ESTE 2G5VA 3MO3A 3DD2H 1PQ5A 5DPAA 4HI3A 1FTSA 2W00A 3FFAA 4O2RA 4TLAA 2DYKA 1KJWA 2V3OH 4LHWA 3PEUA 2EEKA 3A89A 1EFUA 4BFXA 1HAIH 5JLJA 4Y8ZA 1GJ8B 3OEEA 2FFQA 1ETSH 2CCGA 4IGDA 1NN5A 3MWIU 2ZITA 2IUSA 1Q31A 1DPOA 2BMDA 2J3EA 3LKWA 1MTNC 1PUJA 1HPGA 3SOSA 2J9NA 3LQQA 3FKSA 3F1SB 2ZRHA 3QBVA 4IEIA 3OIUA 3EA5A 3PO1B 2FPMA 1RYHA 3RS0A 2WYJA 2BVSH 2XTTB 2Y6TA 4WBSA 1U98A 2BKUA 1D6WA 1NT1A 2QPOA 1F5LA 2JDID 2JETC 1Q1BA 3PFIA 1XD2B 2REXB 2J38A 3GICB 3EPKA 3CZPA 5HTKA 4ZHAA 2IXGA 1YCPM 2GK6A 2GKVE 3ZZ5A 2IF0A 2IEYA 3V0XA 1K21H 4ZKDA 4H42U 4MUBA 3Q3KA 4CEJA 1O39A 1PPZA 3CO5A 2EI6A 4ISNA 1VGCB 4FD2A 1ZZZA 5F8ZA 3DVLA 2C8WB 1B23P 1RRCA 1KI1A 4BUJA 1XX9A 1GI3A 4ABBA 2GAOA 3Q3YA 2CJIA 4TYNA 5FHTA 1SXJE 1CBWC 2PLXA 1OH5A 4HSEA 4JT4A 1JR6A 1IAUA 4LHVA 4XTRA 5K7RA 4Y8XA 2Z6BD 1U6QA 3FZZA 4JJZA 1US8B 4HLDA 4Q4AA 1TA2A 4MGKR 1Q57A 4EFNA 2V35A 2FESH 1V5WA 5B58C 3SU4A 5DHAA 4LXBH 1UTMA 2VIPA 1KSHA 4JKYA 2FZZA 4GVUA 2O8TA 5KU1A 4Q48A 1E79D 1GBAA 1SSXA 3CM0A 2WKPA 4P33A 4RSGA 2AERH 5CLQA 1OB5A 2VNTA 2XBXA 2FI3E 1GG6C 1SXJC 1O3KA 2ODQA 1Z3IX 1SGIB 3NPSA 4EPRA 2GKSA 1VCIA 2VP6A 2CF9H 3SJKA 3FB4A 3Q76A 2JH6D 1SKQA 4H6SB 1GRNA 4JBYA 4B3DA 1GGDC 2JDIA 3KXKA 4FMDF 3RMMH 2ZSEA 1O87A 4LJ4A 1N0VC 3BIFA 1TNIA 2QORA 3NKVA 2TGAA 4V02A 2WAYA 3AP2A 2F55A 3MAAC 2IYSA 2PR3A 1ESTA 2Z6VA 1O5BB 1E9FA 4OI2A 4RVCA 2ZQ5A 1GWNA 1RIWC 5K8IA 3LW8A 3K2UA 3AP1A 4HDQB 3N5CA 3RXLA 4FI3C 1AWFH 4YLQH 4L9WA 1JRSA 2J5XA 2WAXA 3SV8A 3M5MA 5A09A 1ZSLA 2J95A 4GMXA 1UM8A 3F9EA 1KK3A 1SR5C 1YU9A 4K60A 2D2DA 1O2KA 3RVBA 1KNXA 4DY7B 5JMTA 3AF3A 2F9VA 3CZQA 5EXLA 1YZNA 1AI8H 2ASEA 1KLJH 2BD9A 3MRSA 421PA 3CF2A 3BH0A 1NRNH 3PIRA 1NBME 5JBTA 2EFGA 3QIAA 2J0VA 3TH5A 4RKOB 4ZHMU 3ZYCA 2NU4E 1E79A 1G3CA 3NK8A 3Q3XA 3RSOA 3EWSA 1ZIPA 4MVNA 1Q2WA 1DAIA 1SQ5A 2BBWA 3U1JB 1DO0A 2VL7A 3W90A 2HYIC 2O8CB 2FSHA 3QXSA 3QSYA 2FE4A 5D3QA 2B9LA 2Z9JA 3KNXA 4QJ3A 1B5GH 2ZNKH 3UWIA 1R10A 1OH8A 1KDQA 2BJWA 3SU6A 1X1SA 3DUXH 3ODDA 4IDHA 4RKEA 4V03A 3VFEA 4R2HA 1ID5H 2OM2A 1NY5A 1PQ8A 3GEHA 5DN6D 1DDJA 4Q1AA 3TSWA 1P2NA 1TRYA 1GBDA 2PEYA 1P62B 4DVGA 2AGGX 2ZDMA 4Y79A 2CHGA 4HAYA 4AYTA 3TGIE 2WKRA 1TU3A 1D6JA 4RZUA 1FTNA 3ZZDA 1TQ7B 1OIXA 1W11U 2Z4SA 1E98A 3RS2A 2RGXA 5ESBA 3VGCB 4FW9A 3LXRA 1ZINA 3VXFH 3L82B 1GAJA 4JK5A 2GCPA 1YQTA 4CVNA 4WXVA 5GPIB 4D81A 2PCLA 2QRZA 2ZDNA 1DE0A 1R2QA 2G88A 1HJ8A 5LDDC 1WQSA 1U81A 4QJ4A 2J34A 1KGDA 1MUEB 2FOEA 4ZMAH 2UUJB 3ZVMA 3UNRA 1C2DA 1XTQA 3PV4A 2FFAA 4D82A 3B1YA 5AWFC 3DEFA 3S1AB 2ZVQX 3A37A 2KBFA 2EVWX 1ZGIA 1PZNA 4DLXA 3EQ0H 4FMDB 1D2EA 1T9HA 1TU4A 5DYIA 2NQ2C 5EXPA 2NO9A 3SN6A 4OQFA 4XVUA 1RIFA 2ZETA 1HFDA 2GXAA 4HB4A 3I1FA 2D62A 1TEVA 3LO5A 2Z3CA 5H1YA 3NWJA 4LJ5A 5G40A 1N6OA 2IJOB 3Q5DA 4GOXA 2BD4A 3GLIE 2QEQA 1G37A 1JBUH 1M9UA 2BMGB 621PA 4HZHA 2E87A 5CE1A 4JYUH 2OFWA 1HE1C 1AKSA 3K70D 3U44B 2AWNA 2B7DH 5C67A 3AUYA 2QTFA 1E94E 1NRJB 4GHQA 4WAUA 3PJRA 4ABIA 2P59A 2IWRA 3RANA 3SI4H 1O3FA 1DT2A 4LI0A 4MRSA 3BERA 5DN6A 3ITIA 3NH6A 1CGHA 5DK1A 2VHTA 1LY1A 1U9IC 1DWCH 3H86A 3F9FA 4ZROA 2F9PA 2CNWD 1TNDA 1G8FA 3EPJA 1ZM3A 1P10A 3VB4A 1OXTA 3K09A 2FSIA 3VQTA 5C18A 1C5WB 1DICA 4JVMA 2A2ZA 3A7XA 1NMZA 5C3NA 1SVWA 1FMGA 1TPZA 5FPHA 1DG1G 3FPAA 1ZPZA 5G3YA 2O5VA 3BXZA 3RXQA 3LX5A 1P61B 4RZ3A 1C1VH 3L3TA 2CE2X 3RXFA 1RPZA 2FI5E 4XBBA 5GXPA 1ZNZA 1E2FA 4YLUA 5K8TA 4PAMA 5CK5A 3TR0A 2BVRH 5DG6A 1A4WH 3CIOA 1BDAA 1T32A 4MDFA 1QBOA 3ND8A 3SQHE 1BB0B 2A4OA 4IDNA 1E37B 2CVFA 3A4LA 1FIZA 2H1UA 3DOFA 5H70A 3LDAA 3GY2A 1W7AA 1QRAA 4I1VA 2H5EA 5DO4H 1CE5A 3THOA 4BLSA 1W0YH 2HXSA 4Y0AA 1MZDA 2PMKA 1GZSA 3NCLA 1YYY1 4D4LA 2A78A 3M7UA 4FUCA 1IQHA 1XU4A 3WY8A 2WMOB 1TF2A 3SYNA 5L3SB 1LVOA 4M1OA 2OK5A 2X19A 3KQEA 1XJ0A 1KOFA 1G9XA 1DEKA 2QA9E 4HGCA 4MNYA 1J8AA 5GVRA 3SJZA 4X8TH 4JBXA 4DLWA 2VH5R 4RFSB 4ZH8A 2WJGA 1LFDB 1M7HA 2LNCA 4I4LA 2ZRIA 1LQEA 4PFSA 1CT0E 3THYB 1VCMA 3M7QA 4XD7D 1O2QA 5C46F 2QYIA 4FU9A 3SUFA 4DKXA 2ZRPA 1GP2A 5DP7A 1YPHC 1V2QT 4BAHB 2CNWA 2ZJ5A 2WVJA 3BB3A 3HU1A 3D62A 3EAQA 2IS2A 4DG4A 4K46A 1NL3A 5JI3E 1NRQH 1OS8A 3MUFA 2PWXA 2B8TA 1UEJA 1XUHA 1G1MA 4BRWA 2JAQA 2ZP0H 2XSZD 5EXMA 2Y7ZA 1KO5A 1BT7A 1UPTA 2BD5A 3MO9A 4HUQA 5DJ7A 4RD0A 1CJVC 1P09A 1Y3WA 2PZFA 4EPTA 4NZQA 3SYLA 2ZRCA 3U9AH 1ZCBA 4PPQA 5EQQA 1EX3A 1KZGB 3CNNA 4WZAE 5SZKB 3MH4A 5CB8A 1XPUA 2KAIA 3EA9A 1DAHA 3AVZA 1GVZA 3WRYC 1SGFA 1AIXH 3V12A 1AZ8A 1D2MA 3VB5A 3GEIA 3BRWD 3V00A 3PTBA 1AN0A 2ERYA 3SQWA 1MCVA 3EIQA 4A15A 3QUMP 2ZJBA 3LC3A 4THNH 1XXDA 5A8ZA 4KITB 3IDQA 3M5OA 1XCMA 1WQ1R 1G7SA 1C1SA 2VYFA 1YLDA 1SXJD 5C4GB 1SC8U 1IQMA 2DFNA 3RXMA 2J59A 2QL6A 3U4QA 4WJG2 2DUCA 3CUEF 3ADDA 3RS7A 4C3ZA 5FI0B 2GZ7A 4LC1A 3IGFA 1LVBA 2JLWA 3FZDA 2ZSFA 1QCPA 4FUHA 4NPHA 3JVVA 1C5RA 2R6AA 4LYJA 2ZFPH 3KKNA 4MYTA 4MRVA 1GHBF 3I78A 3U3KA 3TNTA 4KXFB 2FO9A 3JVUA 1NSFA 1W12U 3C7KA 4BASA 4XD7A 2DFLA 2VH0A 4IW3B 5C5OA 1E2LA 2C8XB 1G20E 4NCNA 1G5RA 1LDTT 1OT3A 4W5JA 1VYTA 1LV7A 1NRPH 2WWGA 4GP6A 3RMNH 1F5RA 4WIAA 4IDOA 1DLEA 3GJXC 1T91A 3BTWE 1O2PA 5BRRE 2VJ1A 4O3MA 3B7GA 4X1QU 2ZJ2A 2XSZA 1JAIA 3FHTA 1C1MA 3CPEA 3VHLB 1L4DA 2MMGA 4NHOA 4PANA 2PJRA 1SQOA 2RHDA 3OHMA 1GHBG 3NZIA 1S6FA
chains in the Genus database with same CATH superfamily
1CUHA 1QQ6A 4D8UA 3HJGA 1MD8A 1IEWA 2R8ZA 2EG5A 1T24A 2R47A 2WD9A 2QRGA 4A5OA 5BV7A 3QHAA 2N46A 2X8JA 1OAOA 4Z7JA 1N1DA 2ECKA 4UZEA 2WE7A 1JOUB 2EGUA 3GR6A 3TKYA 4ZMBA 1NUSA 2W7TA 4U9IS 6CHAC 4NH0A 2N1MA 3IT0A 2JGRA 3SXUB 1SXJA 4LRXA 2WWXA 5BXYA 1RLJA 5EAIA 3SSAA 2H9EH 1E20A 1J07A 3BEFB 2X1HA 4GPAA 4DAEA 4GWLA 1PZXA 1U90A 1H1TA 4GYJA 4CM1A 4A7PA 4PX9A 3A81A 2XMSA 1WHTA 1NG1A 3V1MA 2UDPA 4IQGA 3PXEA 2A7CA 4MUYA 3ZDEA 3HJRA 1S6HA 3BTTE 4KKVA 4BFYA 2SKDA 1SEVA 4GZMA 5EJEA 1SD2A 2I66A 1K06A 2SGAA 4BKMA 3Q1KA 2CXTA 4RF2A 2C1ZA 1KAGA 3GJRA 1O33A 4X6XA 2PQ0A 4QDZA 4B43A 4QTTB 3RVMA 1XQ1A 4QM6A 1J2RA 4D99A 2VQDA 2XBWA 2PWZA 3LT0A 3AKZA 3LDGA 5AESA 1CA0B 3DLBA 2JH5D 4FETA 5LB2A 4HAWA 1GSOA 2PHBA 4X1SU 3GBVA 2LWIA 5AUPB 2OXSA 1TKBA 2P79A 2XUGA 2IWHA 2ZKSA 5CNMA 1CUEA 3TTWA 1F38A 1O94C 1LRJA 1YBVA 3MFJA 3A4IA 3WYFA 3U3MA 4RD4A 3WLIA 2BD2A 4BFVA 3GRCA 1QRZA 5LQJA 5FTWA 1CXZA 2QM3A 4L4SA 1GZUA 5FO1A 4IQFA 4GMKA 5FRDA 1X7AC 3L2OB 2PBRA 2XCTB 4MLFB 2WG0A 1E7YA 4R71A 1TB6H 3NBAA 4KWTA 1C80A 3JPWA 3RYIA 1O7JA 2OVBA 1UAYA 4CLHA 1GHYH 1ZL2A 5J4LA 2ZBFA 4GLBA 1PWHA 1V39A 1L2EA 4FGZA 1DQZA 3UR6A 2V7QA 3AK4A 5B6PA 3IUEA 1W1WA 1W2KH 3ESZA 4F4JA 1Z8GA 2V0NA 3L6DA 4X1RU 3ENWA 1XTZA 4NU8X 1ZJJA 1GTJ1 2MR5A 3DEAA 3FIJA 3GL9A 1FDRA 3F0OA 1OREA 4JXKA 4L6IA 5DCLA 2ZYSA 1FMCA 3IQWA 3D23A 2O3TA 5CT8A 1HEIA 3GLFB 2OCGA 3A1EA 2BP7B 3V4OA 3BQ9A 4K2AA 3HB4X 3NP7A 4E31A 4O3UA 2QNRA 4AYYB 1PJ3A 1EGAA 1JXOA 4OH7A 4WNIA 4US1R 1LBTA 2WKWA 2G80A 3W3AA 1LBSA 1T36A 2ZSUA 4J7CA 5A3JA 3AW1A 3NDJA 3SGLA 3STUA 5FBWB 1XSEA 1OKKD 4IS3A 4KP0A 3D6FA 3LZCA 4DJEC 2XXAA 1WBDA 2JJ1A 3JARB 5GGYA 4O4JB 3V4LA 5DSXA 4B31A 3F7NA 3LI2A 4S04A 3IRVA 4OG2A 3FMVA 3OEHA 1A88A 4UAVA 3CKMA 4M0EA 4V0ME 3RMLH 4ZAVA 2GV7A 3H7OA 1PJQA 1DKOA 4R3NA 3RTDA 4QSHA 2ODEA 1LBIA 2YHSA 3RNOA 3DQQA 1OLXB 4V0QA 3MH5A 5B2EA 1ELVA 1YUBA 1NW4A 4G26A 3PEFA 4UEHH 3AGPA 3NFRA 3JASA 3I6MA 2X0JA 4JT8A 3AGQA 4BFUA 4REQB 3TO5A 4ITVA 3ZWVA 1U9IA 3TJNA 3HYCA 2Z9IA 3SQXA 2RGRA 3SC2B 5H9WA 4IX1A 3SNBA 4W6ZA 4NMLA 2V9ZA 3P27A 3QMPA 5FV7A 1OD6A 1T2VA 4MICA 3OECA 1FSGA 4WOPA 2XGSA 1Q0TA 4P7JA 4R8KA 2Z43A 3CKLA 1GO2A 2ZTVA 5IAJA 2XBLA 1BXRB 4F56A 2BI8A 3PYLA 1FC0A 1F8FA 1JQDA 3PLAE 4AG2A