1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
2XXLA 1PUIA 1Z29A 3SDZA 3PXGA 1BDAA 3PYHA 1UVTH 1C1RA 3X1YA 2QP3A 2BX3A 1DITH 2CL0X 4MGZR 2V3CC 3DUXH 1P2TA 5DP9A 5C5NA 2STAE 3A83A 4QL3A 3U6BA 3SGQE 3E90B 1C9PA 5GCHG 1XD9A 2OCYC 2A5FA 3NCLA 1IQGA 1RPZA 4OBEA 3RANA 1R7RA 2UVQA 4JLJA 3WHLA 3C14C 3VHLB 3WRYC 3EA0A 2QU8A 4M8NE 1XWIA 5FUYA 1TTTA 1HV7A 1H1BA 4B2AA 4ZAEA 3EIEA 1YYY1 1X8KA 2Q6FA 1US8B 4J2YB 1GL0E 4H6SB 1WUNH 3R8CA 1CU1A 1C1WH 1ZTKA 2VSFA 1S6FA 1NG9A 2N46A 2C3SA 2PCJA 1HAVA 2QY0B 4G5QA 2G9NA 3E2IA 2O8EA 1JXMA 1WBDA 4BWYA 4AZ2B 4D76A 4ABJA 1V2RT 4D80A 1OB2A 2WYGA 4D26A 1IOZA 1P2SA 4Q9HA 3LOXA 1ZJDA 3MNSA 2UUYA 1JQLB 1CULC 1VTKA 5J4YA 4ZKDA 2BY5X 1HAPH 2ANYA 1GDQA 4PC3A 2L0XA 3AVPA 4IMQA 3CM0A 5HE9A 4FCVA 5A0BA 4UNRA 3BAFA 1MMJN 1NFYA 1HYLA 1W13U 3G82C 3GPLA 4IOKA 2PJZA 4ARZA 2P3FH 1KXCA 4ABGA 2NOAA 3SBEA 1FTSA 4O97A 1CR1A 1DPOA 2FX6A 4JBWA 3QTVH 1NLZA 3SZNA 3I78A 3ZV8A 3K9GA 3Q7PA 1AK2A 4MDSA 4CHAC 1C1OA 1P2VA 1OP8A 2OEPA 2QTHA 2V7QD 4ARZB 3A4LA 5B57C 1BRBE 3VEQB 2WOOA 3A4MA 3EPLA 1I4LD 1AQYA 1P2QA 1H9IE 1D3PB 2FF7A 2C96A 2O8LA 2BIFA 3MRSA 5CM9C 4FUCA 1G8HA 2UZ3A 4KLNA 2CK3A 1ZNWA 2ZJ5A 2C4FH 3RXHA 3V13A 4LJ9A 1UTJA 3KJGA 2VVCA 4PAOA 3R9XA 4LHZA 5D3MA 1Z0AA 2ZROA 1E2QA 3KUCA 2VIIA 1K22H 1IQHA 1ELVA 2LKDA 4JBXA 1T8TA 1LB1B 1EAXA 1V2UT 1CP2A 2CGAA 1QFKH 2ZRFA 3B1WA 1G64A 4V0KA 2H9EH 3A1UA 3DFLA 2ZJYA 3BD9A 3FP6E 2VO1A 1SQOA 1E0SA 1GILA 1NZQH 3KFVA 1L2TA 3ATIA 3MNXA 2FTMA 2FP7B 4TTRA 4A9AA 4DDWA 4A6LA 1VITF 1YPLH 4AOQA 1SXJC 1Y8TA 5F2EA 2YVUA 3M7TA 3FB4A 4V0ME 1S4QA 4BAOB 4NFEA 2HLCA 1C2JA 2IS1A 1P04A 2JLSA 2OTVA 1IN7A 1HFDA 3GCOA 1GBEA 3OE7D 4NDZA 3PEWA 4GRAA 4Q4JB 2JLXA 1E2GA 3C41J 1P62B 7GCHG 4DZZA 4PPNA 3RS2A 1NFWA 3BBPA 3ZZAA 3IG6B 3UATA 4JVMA 5E0HA 3I8SA 3LVQE 1HAZB 3SU1A 3LBNA 2RH5A 1LCYA 2WKQA 4I33A 1G19A 1FY8E 2BCJQ 2WJVA 4BZXA 4D9QA 5H1YA 3IO5A 1MV5A 3M5LA 4U2WA 2DFTA 2WJYA 4QHSA 1XEWY 3EZ6A 4F38A 5FXLA 1BMFD 4DLXA 2XAUA 1QY6A 2FDAA 4RKEA 3DT0H 2JIZD 2H8KA 3M7UA 1BT7A 2ODBA 3U3JA 5CHAC 1GHVH 1U9IA 1OIXA 2C04A 1SULA 4V0NA 2EFCB 5GJVC 1ZMXA 2ECKA 1ZOMA 1LDTT 3ZZ9A 4LHWA 1QHRB 1OYQA 1EZUC 3CENA 4C0BA 1XM1A 4G01B 6GCHG 2ZS7A 4DIEA 4EJSC 1OFTA 3LD9A 1ETUA 2ZU1A 4MTBA 2G1JA 1LF5A 4MRVA 5EUQB 4WIAA 3CF6R 3NVAA 4EPTA 1ELAA 3ZZCA 3K9NA 3AP2A 3QGNB 2RGAA 4JJKA 1E9AA 2OV2A 3CUEF 2K5UA 4BFVA 4M9ZA 3BIVH 1ZNZA 4WVPE 2VU8E 4PHFA 4O3UA 4A92A 1SFIA 2EFHB 4PHGA 3A37A 2QC2A 2VH6A 2YYZA 1J8AA 2QAGC 3W90A 5EW2H 3P8GA 1G6OA 5FL3A 3N2IA 4KJZA 1TX8A 1SVWA 4HDCA 1F2UA 2JASA 1KNXA 4MGYR 4UNPA 2GJ9A 4NIXA 5A8XA 1C2KA 1J8MF 2Z3DA 3BTQE 2JH6D 2GF0A 5JBCS 1HJAC 2G51A 1M2OB 3ZZDA 3WNDA 1P9NA 5TARA 4B47A 2W83A 4KCGA 3TH2H 1C2EA 1MBMA 2XJ4A 3UMSA 1X7AC 1LMWB 3OHMA 1ZUNB 4TMXA 5FL7D 1KDOA 1ELGA 1L4ZA 4DY7B 4MVNA 4HAWA 2JDIA 4XBCA 1ZMLA 2FWWA 3PWBA 3DM5A 1OS8A 3RMNH 3U1JB 1OXVA 2IYTA 1O2IA 4JZKA 4CIDA 3CF0A 4QOSA 1C2GA 1OXUA 1KTTB 1F5RA 5EXSA 3RXCA 2Z6BD 2ZPSA 5I25A 421PA 2NU0E 2ZE6A 4YESB 4F91B 3CRRA 1P5ZB 1THRH 2AFIE 5LD2B 1OH8A 4E09A 3LFUA 3TBKA 1GM5A 1G16A 3FYHA 4V0LA 2CMYA 2OZEA 5F3WB 1G8FA 1RYFA 3TH3H 3MFYA 4HZIA 3THOA 3VAAA 2QPAA 1F7ZA 3AVVA 5SGAE 5EXLA 3PEVA 4B2IA 3THXB 4JCNA 2NO0A 2FMJA 4P0TA 2BDBA 1SGCA 3GY2A 3GLFE 3R9WA 2UUKB 9LPRA 4NCJA 1LNZA 3AF1A 2O8DB 1SOTA 1H8HA 1DICA 4XD7A 1TBZH 1UBCA 4M1KA 2VIVA 3H86A 4UFGH 3NC0C 4AFSA 1C5WB 121PA 3KHVA 3SR0A 4YQFA 2VJ1A 4BASA 5T6FA 4B2PA 4XVUA 4UFFH 1RIFA 1Z6TA 4PQYA 3MO9A 1TGNA 1BHXB 2ZRLA 1XJCA 1K6MA 3ZJYA 1PPHE 1COWD 1S1MA 3AQ4A 5F98A 1CA8B 4DLZA 4PZLA 4MG3A 2ZF0H 1NJFA 3ND9A 1G3QA 2TRMA 4CEJA 2YOFA 2Q9CA 5CJ2A 1ZSJA 3TK9A 1CJMA 2VH0A 2GAOA 3LX8A 1OXXK 1QHYA 4J1YA 3WRXC 2AIQA 1MUEB 3B6EA 4NTZA 1YPHE 4JL6A 4MKHA 4F92B 1KAOA 4CRFA 2RCNA 4YXWA 1LTQA 1ESAA 2ZP0H 2UKDA 3GDUA 1R8SA 1DSTA 1GGDC 3THWB 5KU1A 4WY3A 4OS2A 4OGYA 3VX4A 5E0JA 2OSBA 2QBYA 1O2OA 1YE8A 1SGFG 1TNKA 1XVOA 2XEXA 1EJNA 1Z07A 2OT3B 1Z83A 4E03A 4MYHA 3SGBE 3SV6A 4M53A 4ABBA 3M6AA 4NP6A 3VGCB 3ADCA 3R3GB 1TMTH 3CS0A 1XD2A 4ABEA 1AIXH 2QM8A 2QIQA 2AERH 1Z8IB 4X2WA 1KHTA 2I6SA 5DN6D 3K9HA 1C1TA 3S9AA 1AHTH 4WMEA 3OIVA 5KNCA 1R2QA 4NYJQ 5JBBS 3EGKH 3FHTA 2ZQ1A 4CRGA 4C0SA 1KY2A 6CHAC 2OG2A 1XRJA 1R0XA 3CP7A 1UPTA 2O9QA 1OH6A 2CLCX 1O35A 4OQMA 1G3CA 3V3MA 2D3WA 2GT8A 4MPXA 3Q3YA 3NUMA 5JFGA 3VB3A 1Z22A 1OLOA 1ZM7A 4YC7A 1CHOF 1GI8B 3GFTA 3KQEA 5DG6A 1LF0A 2OINA 1DAGA 4KI0A 1B0EA 2O8BA 8ESTE 1IN8A 2C99A 4PANA 2QRNA 4K60A 3BC1A 5FBLB 4GP7A 2BLWA 4M0LA 1FY1A 3LVRE 2WM9B 1YPMH 1MU8B 2A5AA 4H6TA 4B2BA 4Z6AH 5C2ZA 3DOFA 1VCQA 3LIWA 5KHOC 2D06A 1DOAA 5IK2D 2J4IA 1XB2A 2O8UA 5C5OA 1CF4A 5C20A 3UNRA 2RMKA 1FN6A 3K1JA 1VG8A 4M1SA 3TK1A 4FW9A 2Y7XA 1K9OE 3IBGA 2WPIS 4B74A 1T4UH 2EEKA 4URXR 4B2LA 2GP9B 2IYLD 4K81B 1KO5A 2FGKA 4DC9A 3WMEA 1S0RA 4IEIA 4JT2A 3TUJC 4DWJA 4OKSA 4Z1MA 4DDVA 2CVHA 4Q4HA 1DBSA 4FIDA 4Y7AA 2Z0MA 1N1LA 4RD3A 2NU3E 3LXXA 2RGNA 4AWXA 2FXRA 1N5IA 3BE4A 1JR3A 1C5YB 2FEOA 4RD4A 5IDVA 1HNEE 2BY9X 1II0A 1DUEA 3OEHA 1Y3WA 4LUCA 3AB3A 2IOTA 1AI8H 1FDPA 4AURA 4AY2A 1QHXA 4XJXA 3H7TA 1NFXA 1KY9A 1J15A 1AFQC 1FIZA 3QVUA 2YOGA 3QTOH 2VBCA 1GAJA 3LLMA 1G20E 2WPMS 1A5TA 2J34A 4Q1CA 3MU5A 5L3SB 3VNVA 1OJLA 2G8TA 3A1SA 4ZCIA 3C27B 5E7IA 1V2JT 4MKFA 3K6YA 2QXGA 2RG3A 2ZFPH 2JETB 1IN6A 1TAGA 3SQHE 1LHFH 2O8TA 3AKCA 1GMCF 3OIWA 3BB1A 3QO6A 1DTSA 2P2LA 3ND8A 1L4UA 3TQCA 2BMFA 4Q21A 1KZGB 1AQUA 3QF7A 1GG6C 2EI7A 2QZ4A 4ABDA 4NA7A 1G5PA 4K8OA 1LW7A 2Z83A 1TRNA 1N6PA 4UNNA 4OI0A 2IUUA 2FPZA 1GNPA 5GJCA 1P11E 4RSPA 2WV5A 1Z5ZA 5FFMA 1AY6H 3IQWA 3CRW1 5FTKA 5JSZB 4Y8YA 1FMLA 1EP6A 3MU1A 3Q8XB 1OB5A 5JLJA 3VNUA 2FOEA 5CJPA 3I8XA 2OLKA 5JBTA 3I92A 2QSYA 2CHGA 4AG6A 2W26A 5JB9S 5M04A 5DNYB 1N6RA 3KXIA 1EB2A 3KKNA 1ZVQA 4OS4A 1E0AA 3ZH9B 1N6XA 1SC8U 1JIMA 2H5CA 1DE0A 2ZUCA 3HPRA 7LPRA 1GHYH 1VIYA 3M3TA 2WPDA 2FFBA 1NRPH 1TONA 2R6GA 1F0RA 4CHAB 1NRQH 1Y3AA 1WAYB 1XEXA 4X8SH 1SLXB 4BFZA 5T6DA 1DAKA 3T15A 1X8JA 5EQTA 2GDDA 2GCHF 2C98A 1FTNA 2ZRNA 1OE0A 1ZGIA 5FX5A 1XTJA 3BGWA 2Y5GA 2YV5A 1NBMA 4AC9A 4U7DA 3E6PH 2O8DA 2H6MA 1ELCA 3AF2A 2BQ6B 2HEIA 4PO8A 1E94E 5EXTA 2SGQE 1DEKA 3MH5A 3KKOA 3LGUA 5JEEA 1KY3A 4UXJA 4XTRA 1N0UA 1VYUA 3EWAA 3VB7A 1IJEA 4ZI3A 1D2EA 1MTNC 1O2GH 2G83A 3EZFA 5A09A 4QGGA 4C0HA 1RGQA 3QEOA 2AL7A 1TMKA 1QA7A 3WNCA 4KFTA 2QNRA 3AVXA 4LY6A 1Z0FA 4IBLH 2AHOA 4PSKA 2EA3A 3PV0A 3K70B 2ONKA 1OPHB 3BTKE 3QBTA 4GZLA 1A2KC 3K0EA 1HH4A 1EX6A 1G1MA 1NN0A 1OWJA 2VH5R 1ONBA 1G9XA 2FO9A 1NBME 1MZAA 1W7XH 1DPFA 3PTBA 1XDBA 1GNQA 3JVVA 2FA9A 1CBUA 2YHSA 2GGVB 2OAQ1 1GHWH 1LPKB 1V5WA 3X1ZA 4ZROA 1E2DA 5F03A 2ZTYA 3V4FA 4C0KA 1UK3A 1SVIA 1TNDA 3AF4A 1ZYUA 1XUHA 1ABIH 3OIUA 2JLYA 3KKMA 2EFDB 4B3BA 1QURH 3KB1A 3R20A 1KDRA 2C8VA 2VF8A 1P4SA 1W4BA 2IYQA 2P16A 2OCBA 2ODYB 1T31A 2GVZC 1WBGB 3T1OA 1J8YF 4NL4H 4R71A 1RFLA 3ODDA 1KDPA 2PJRA 4Y0YE 1LO6A 2CEAA 1T5IA 1KXBA 4NYMR 3WHKA 3F68H 3MLEA 3IHLA 3TJOA 2BVRH 1Z6EA 2R2WU 2CL6X 1GPZA 2XWBI 1ZMJA 4DUGA 1SGFA 1UJ1A 4MYCA 1PFXC 2J1LA 2GV7A 1QB6A 3UG6A 4NCYA 5L3VA 3IQXA 3E3TA 1MKWK 3L0IB 3OU0A 3T27A 2BY8X 4Q4AA 4Q4AB 5C3NA 1QG2A 1MD8A 4MNVA 3SGAE 3PB1E 3K65B 3H2YA 2C90B 2EYUA 2R6CA 4LX0A 4LBVA 1A0JA 5L30H 4L5BA 2HGTH 3KJHA 5H8WA 3RU4E 3BH6A 3NEJA 2OXSA 1IOEA 4AG2A 2X19A 2FN4A 4AIIA 4E07A 4UNSA 1VECA 5EW1H 3I1FA 4HB4A 3QX5H 4P32A 1W0JA 4X8UH 2WICA 3A85A 3VPKA 2VP0A 4DSOA 4S2EA 4D81A 1DO2A 1KIMA 1FXYA 1NJGA 4A6PA 3TH4H 1NF3A 2PT7A 3GY4A 2J94A 1P2JA 4P4TA 3QUSA 1W14U 1N5LA 2ZYTX 4XSHA 2ZIAA 4OS5A 4YMTA 3ZVEA 1TLDA 1RZ3A 4FUHA 3T61A 3WY9A 2XRCA 4RI0A 4ZKSU 1D2MA 3WMGA 1FP6A 1AO5A 1P03A 4Q01A 1TX6A 1RD3B 2J41A 1ZUHA 2FOCA 4A6XA 4HLCA 2GKVE 4TMWA 2TBSA 2OXCA 2BBTA 4TL9A 2P95A 1AWFH 3HU1A 4IHQA 2GV6A 2Z4SA 1UADA 1NY22 1E2JA 1S3SA 1K1LA 2BM2A 3L8ZA 1E4YA 4QGHA 1O3IA 1GSIA 4IOJA 1KXFA 1OP0A 1UCYK 3RXBA 3UTUH 4Q9JA 3OY6U 2ZRDA 2KAIB 2C8YB 1QBNA 3ENSB 1ZRHA 1W4AA 1GVKB 2M5TA 2DHRA 4WH6A 4XSGA 3THWA 2NO1A 2QRZA 2DBYA 1X86B 2PZFA 2RA3A 1KXEA 1VITG 5FBQB 4CYMA 3OSYA 3RRNA 2W00A 2ANWA 4NZLA 1Z7KA 3CH5A 1QBOA 1XUKA 2ALPA 5ANRB 1GJBB 1JQJC 3RXPA 5DP4A 5CLLA 1ANKA 4YMUA 1XPRA 4WF8A 1UEIA 1CR0A 2BD2A 3FFAA 8OHMA 4ZMAH 1SR5C 2KAIA 2CLSA 1JR6A 2C2HA 1AZ8A 4KHZA 3T06B 2OHFA 4WW0A 2FOHA 4ZHAA 2ODWA 2QG6A 1G8PA 2H18A 2KE5A 2C9CA 1OWHA 4Y0AA 1G4UR 3S9CA 2OP9A 2NZJA 4DVAU 3PMBB 3LGWA 3LONA 2OILA 1GDNA 2G55A 5E2OA 3GYLB 3A89A 4FVBA 4TYDA 4F49A 2XCNA 1Z1IA 2J92A 2WUCA 3RC6A 1P9UA 1C4Y2 4FMDB 4IVPA 3GCNA 1TGSZ 4JYVH 4UJ3A 2PSXA 4X2VA 5A0AE 4JJZA 3RABA 4FMBB 521PA 3TSOA 1GWAA 2R3UA 1B5GH 2XC4A 2F1HA 1V2ST 3KQCA 1O2PA 3ZZUA 4Z8XA 1PPEE 1QL9A 3U69H 4A1XA 4HI3A 1XXHB 1NM6A 3TNTA 1YCPK 2IHYA 1KNQA 3GCTG 1S85A 3SEAA 4URUR 2R0LA 5GJ4B 1DX5M 2OC7A 1GBBA 3E5HA 1BMNH 4JLKA 2D2EA 3QG5A 3RMOH 3W34A 4NYIR 1JXOA 4D4JA 1DO0A 5E3HA 4IKEA 3I5YA 3O8CA 4QHYA 3T12A 2CCGA 1US8A 2H2ZA 3I29A 5IF9A 1S5SA 1BKDR 1QL8A 3PVSA 5G3ZA 1CA0B 3RC5A 1C4V2 4U5XA 5AFZH 1A1RA 2YNMA 2AKAB 4LJ4A 1C2LA 1TOMH 5HTKA 2CE7A 3WXMA 4Z8YA 1O32A 1C5QA 3SYLA 2Q3HA 1AKEA 1GI2A 3VXEH 3LC3A 4O3TA 1QHGA 5DPAA 3WYAA 2PLXA 1G3IA 3U9AH 4C2TA 3FKQA 1TBQH 2ASEA 4PTLA 4MGIR 1TQ2A 3HWSA 3H1TA 1P09A 1LTOA 3GJ0A 3IBYA 2ZI2H 3GLHA 5GCHF 1SXJB 1XPUA 3MTYA 2QM7A 3O8BA 1T8LA 3ZDQA 1XUFA 1LQDB 3GFPA 2ZETA 3T1VA 1FFHA 1HUQA 1Z63A 2ZTXA 4ESHA 3Q7QA 1ESBA 1EZQA 1O5BB 1JI0A 3LKWA 1YC0A 3RXGA 4W9MC 1DUAA 3PG5A 1P12E 3PLKA 4AKIA 1VPLA 1TUIA 1P9SA 3SU5A 4TL7A 2QF3A 5C1YA 1GHZA 4XBBA 4PQFA 2ZS9A 2QSZA 1N6YA 2PCLA 4IVQA 5FUXA 2OESA 3A8BA 3QF4A 3A8AA 2FV8A 2GA8A 5KSOA 5BXQC 4WJG2 4NWKA 1Q3XA 4LV5B 2F1IA 1C5PA 4AYTA 5FPTA 1ORFA 1M6NA 5FPSA 1E0FD 3B85A 1FMGA 1O3KA 1HIAA 3CPEA 3EW9A 3UY9A 721PA 1C2FA 2FEMA 3NH6A 3TGPA 5SZIA 2ZU4A 4FWIB 3B78A 5F8TA 1RE0A 3RC3A 2ORWA 3GYMA 4BZPA 1H8ED 3B5JA 1FPCH 1PYTC 3JZMA 4TYPA 2JH0D 3CONA 3NWUA 2ZFQH 3RXVA 3TK5A 4QGAA 1N6HA 4KTUA 2RHDA 2EC9H 2J7PA 1G8YA 1XD2B 1J90A 3KQKA 2W3IA 3C5CA 1LQEA 1LVMA 1LS6A 4Q4JA 2VIDA 1E99A 4MGKR 3I61A 2GDJA 4BLOA 2BOHB 2Z9JA 2OFXA 2H9TH 1TNHA 1NPMA 2ZJZA 2R6DA 4PSAA 4RD2A 5L3RA 1XZQA 1W3CA 5G40A 5T1VA 4US1R 1RTLA 2CE2X 1NFUA 3SYJA 1K2I1 3MU0A 2YNAA 3LC5A 5LPNA 3K09A 1FI8A 1L4DA 4Z54A 3RXTA 1ESMA 1P9RA 2EQBA 3L0PA 4OQFA 4RZ3A 2B7BA 4Q7XA 3K9LA 4GPGA 3SUGA 4B76A 1KGDA 3CR7A 3LGYA 3BWDD 1XXFA 1F5LA 1KDQA 1Z71A 3U60B 1V43A 3RRYA 5K8LA 2VA8A 2DYKA 4I1OA 1L4YA 4URZR 3M0EA 2J0UA 4GMDA 3ZZ0A 4KO8A 2D62A 4LZ1H 2IF0A 4GOJA 3RM2H 1E38B 3GCHC 4M9FA 3S7HB 1SQAA 4MNWA 4UKDA 1IQMA 4N0DA 3AGPA 4HAYA 4II7A 3W6PA 3OESA 2W3KA 1DARA 1N0VC 2ZU0C 3RXIA 4TZ6A 1DS6A 4W7SA 3M5NA 4MKGA 4UXIA 1GMHF 3AW1A 1D6WA 3FMIA 4DCDA 5CYPA 3A7VA 2P94A 1C1NA 2ZDMA 1QBVH 3SJAA 2CHVA 1ZTLA 3RYTC 1P9WA 1RFNA 4JZEH 1F2TA 3EPKA 1SKYE 4LWZA 1SGEE 2IC5A 1SHYA 2BOVA 1BIFA 1XD8A 1N6KA 1E96A 5J5CA 1IN4A 4UONA 2GMTC 1NU7B 4PROA 3T2NA 1P10A 4FUEA 4D25A 1Q0UA 4OGXA 4TPYA 1EJAA 1IHUA 5CK5A 3KQLA 1E9CA 1GJ5H 3BG4C 1ESNA 3ADDA 5CLQA 1VCPA 5FL7A 2ZHFH 2WPLS 3WBKA 1QQUA 3MWYW 4L9WA 5KTYA 2WPHS 4X6NA 3JVUA 4WBSA 2STBE 5EZ5A 3T62A 3GJ5A 3WNBA 3TAUA 4XWOA 1GBIA 5CDFE 1CJVC 2F9LA 2PKSB 1OF1A 3MWJA 5JS7A 4TT3A 1SGWA 1V6DA 1INCA 3GY8A 1CGJE 1VHTA 1AN0A 2TGPZ 2QXHA 2ZU6A 1UCYH 4OK6A 2A5GA 621PA 2IF2A 3UWJH 3CO5A 1D5CA 4LC0A 5DP6A 5EUMA 1YU9A 2Q3FA 2CHQA 2HPQH 4FU7A 4B35A 4EKDA 4VGCC 3EE0B 1Z6XA 2DB3A 2H5DA 1HAYB 1HE1C 1P7CA 4B73A 4JYCA 3C8UA 4MPVA 1KI9A 1P2OA 4GMXA 1HXEH 1O38A 2PUXB 4G5OA 4TLDA 1J2JA 1U90A 4QC2A 1GWNA 1MKXK 4MDEA 4LI0A 4DVGA 3GJXC 1GI5A 3BXZA 2FZ4A 3GJ8A 4IRUB 4MRNA 1LHEH 4LK4A 4B48A 2BXTH 4QFMA 4BZQA 1XEWX 4INHA 2G52A 3Q85A 2ZSEA 2NWNA 1PPBH 3MMPA 2AK2A 2SGAA 2SNVA 5AUOB 3EPJA 1EZXC 1UHBA 3IILA 1SFQB 4PHHA 1GBJA 2W2TA 2G81E 1NVWQ 2W7UA 5EXXA 3QKSB 2ATVA 2UUFB 1JB1A 1O3OA 1YZQA 3E0PB 4EPWA 1SGYE 3Q77A 4AGKA 4SGBE 3QLPH 4W5WA 3UFAA 5D3QA 3IIKA 1E79D 3T35A 3B82A 3I72A 2WAXA 3RUOA 2CF8H 2D7DA 2F91A 2SGEE 4IXNA 2W5EA 1GHAG 2W6IA 5GVSA 4LBYA 1F2SE 1HDTH 3QXJA 1EZSC 1VG0B 5AR1A 1Q3HA 2W6JA 5ETXA 4TN1A 1W1WA 5GJWC 1TB6H 3QPUA 1XMIA 1A4RA 1HURA 4IJMA 1AB9C 2VL7A 2ZCKP 4DLVA 4Y76A 3TE6A 3IDQA 3MWKA 3GLGB 2GZ7A 1U98A 1OH5A 1L1JA 3E0NB 2RGXA 1C5LH 4BTUB 4GSOA 4HUTA 5JI2E 1NMYA 2NPFA 2BCGY 2FSIA 1HLTH 1ARCA 2ZECA 1F0TA 2ZREA 4LC1A 4DCUA 3MWLA 2JLRA 4IXMA 4I31A 4DLUA 1BCUH 3FHOA 3IITA 1GI3A 4ON9A 2Y5HA 4AYYB 1DLEA 1Z6GA 3A7XA 3DVLA 3EIQA 5EP3A 2FS8A 3RXUA 1F3OA 4NE2A 3LBIA 2YWFA 3GY5A 2RB4A 5E95A 2Z3CA 4M1MA 2FPLA 2ZA5A 4LDJA 5G3YA 3ADBA 2VSXA 1NESE 3QXXA 2VPPA 4MPWA 1ZC3A 2ANBA 3B2EA 1BTUA 3A6PC 1OV4A 3BIFA 4BRWA 1UKVY 2PGQB 4E7NA 2OFOA 3EC2A 1DM4B 1W36C 1Z28A 4FMCF 2A2QH 1Q22A 3RMMH 2CF9H 4EUNA 1E1QD 2QBYB 2BLOA 1C2DA 2VHTA 2DWOA 2QF0A 1A3BH 1K1MA 2OUAA 1AZTA 4XBDA 1RIWC 5KOYA 2J38A 5FTJA 3E1SA 4BANB 4CH8B 1UCYE 5LPFA 3VKGA 1V2TT 2YC4C 1NNEA 2RGGA 4EQ6A 1VJ9U 1WP9A 1BMLA 3ZVBA 1H65A 3BIUH 1GHXH 3AEZA 3TK6A 2GD4B 1R8QA 1IN5A 2FI5E 1TUEA 1ETTH 3KQDA 1NN1A 2ZRAA 1ZIOA 3VXFH 1KK2A 3LRPA 2Y5FA 1W8BH 1D6RA 4AYWA 1AS3A 4TQUS 2XBVA 4QBHA 2N1BA 1EESA 1W7GH 1FNNA 2UZIR 4WH8A 1FMJA 1KLIH 5DIFA 5JS8A 2AGGX 4ZKOU 1AIPA 2W0MA 2ERYA 4NYMQ 3L6PA 4QM7A 4A2WA 1KIGH 3UOPA 1AZZA 5FOTA 4WVFA 5E7JA 3E91A 1F48A 5K7RA 4C0QC 5HZKA 3ZZ6A 4JMPA 3NHAA 4PHTA 1RTKA 4DEYA 4Y0ZE 3BFXA 6CHAB 1NROH 1IHTH 1BTWA 3RXJA 3D65E 4POAA 4HB0A 3A8CA 3Q3JB 1F6BA 1XCGB 3ZVAA 2XGJA 3P32A 2O0KA 4ZV4A 2CJIA 3EX7C 4TY6A 3H84A 4WAUA 2C8WB 1HE8B 1HUTH 4JL8A 2P3SA 1T8OA 1TAWA 1HY3A 4ZPXA 1WBBA 1V2WT 3PROA 1BYIA 1C2MA 1E2HA 4A8JB 4MNXA 1T7CA 3QUMP 4B3DA 2Z7FE 4WXIA 4ZH8A 3LDAA 2NZ8A 3NPSA 4DJZB 2FX3A 1CJUC 4ABFA 4MQAA 3LY5A 4BUJA 5GADl 3KFXA 3OE7A 4RD1A 4PO1A 2ODPA 4BLRA 2YJTD 2XSZD 3N70A 1ZM4A 2ZE7A 1MTSA 1BRCE 3BTHE 5BW8A 3RXEA 2Q6DA 1C1VH 3DKVA 2X2EA 1MTNB 1I2DA 4OJQA 5TMPA 4EJSA 4YLQH 1S8FA 4DGJA 4PFSA 4GPTA 4E7RG 4FU8A 5A0FA 3KB2A 3AM1A 3AV0B 1Q44A 1EAIA 4JLDA 1ZHRA 3T1QA 3IEUA 5JEDA 1TQ6A 4M2LA 5FH9A 4GI7A 3BB3A 4NZQA 4BXWA 2I1QA 4EPYA 4PC7A 5HKKD 5EP2A 2K1QA 5E8EH 2OC1A 1UEJA 3ESTA 4KYUA 4X8HA 2XCFA 2ZI6A 4IC6A 2PSYA 4A36A 2VHUA 2FOLA 1W0JD 3KTAB 2OCPA 1MKXH 2BB4A 4DG4A 3G5UA 1Y59T 2A2XH 4K3JA 3RXLA 4JIMA 5KDLA 1SKQA 3MAAC 3NWJA 1C9TA 1XU4A 3ZZ4A 4X0WU 4G3XA 2PEYA 3UPEA 2REBA 1U0LA 3VMFA 2DPXA 4IMZA 3LGIA 2A30A 1C5RA 2Q6TA 1WV7H 2P3TB 1U99A 1H8EA 1W0KA 1TA6A 2LNCA 4TY7A 3THYB 1MBQA 4US0R 4Q9LA 5E7MA 4JYBA 4DLTA 1P8VC 1KAGA 4AD8A 3RSOA 1YR7A 5GXPA 3LQRA 4MH0R 4KVAA 2ZR0A 2C9YA 4P4UA 4B3XA 5JJKA 5JZVA 2R6AA 4KBGA 4FXGH 3B8HA 3QKSA 1GBCA 1P72A 4K5ZA 1N25A 1OPXA 5CK4A 1KK1A 6Q21A 3TIUA 2SFAA 2JDID 4TMVA 2G4TA 1B0FA 1IXSB 4D7FA 4OI1A 2HDNB 2I4IA 2ZUDA 5HGGA 3TGKE 4LRWA 3SUDA 2IL1A 1O3LA 3DFJA 5KPDA 4UE7H 3ZLJA 1AGPA 5FOXA 5CDFA 3JZ1B 1C5OH 1ZTJA 1A4WH 2AWOA 1ZINA 1HAXB 4IDOA 1LS1A 1ARBA 1THPB 3KKPA 1YBWA 1VYTA 4G5GA 1TQ4A 2A4OA 1Z0JA 1N6IA 2AD5A 1PQ7A 2NU1E 3A36A 1DELA 4FUDA 3V9PA 1ZM2A 1N6LA 1JJVA 4Y11E 1PVOA 1GCTC 2P93A 5DI3B 4U32A 1C1YA 1RJ9B 2NG1A 4LYHA 2P6RA 1EPTB 1QZXA 2HYIC 2ZRMA 1UBEA 1GL7A 4KU4A 4A0HA 2A5IA 1PPZA 2X77A 1IBRA 4O3MA 3SHAH 4Y71A 2VIWA 1TF7A 1YZTA 3KDSE 2QTFA 1QHIA 1LKAA 2CCKA 2XSZA 3KXKA 2NIPA 3GEIA 2F9BH 4HAXA 4Q1AA 4QBGB 4K69A 1KI3A 2NU4E 3BH0A 1T0JB 4ZIRB 2C95A 2FOBA 4UNQA 4OM9A 4IW3B 2B8OH 1D2NA 4OL0A 2PW8H 3VFDA 4FUIA 1H8IH 3URCA 1ZP6A 4JSTA 2QGRA 3V0XA 5J4LA 1GJDB 1GIAA 3PV4A 3SJBA 3LW7A 3AUXA 3CPJB 2ANKH 3SU8A 1S9DA 3TNSA 1C2HA 5BYKA 4OK5A 3AUYA 4DOQA 4IFEA 4HZUA 2ODQA 3C1KA 1EFHA 2Q0HA 2CLDX 3ADKA 2XXAB 3AP3A 5E0GA 1R0ZA 4QJ4A 3CX6A 4NMMA 2HVXA 1ZD1A 1X8LA 2GVDC 5EP4A 1O2NA 3SORA 1FAKH 2VP6A 2O52A 1OSNA 3UUZA 3U3KA 1C5TA 1W46A 4I81A 5K8TA 4V03A 2HJVA 1A5GH 1VGCC 4X8LA 1ANDA 1UVOA 1BJUA 2GZ8A 1Q21A 4EIWA 4AKEA 1X3SA 5E4FA 4US2R 2GK6A 3STIA 3PR1A 5EZ6B 1OX1A 1A82A 1E2NA 2WIBA 1QHHA 1H8HD 4YOJA 3KQUA 1DADA 3RU4T 2PH1A 4ITRC 1P2IA 2QE7A 2H1LA 4JKYA 1JNYA 5EPNA 4ZDWA 5L8VA 1KTSB 3CRMA 1YZLA 4M9SA 2VINA 1GJ8B 5C1UA 1S6HA 2ZFFH 1NVVR 3ZVLA 4BLPA 3QQ5A 2X2FA 1P3JA 4R0IA 3SC3A 2KJQA 2VIQA 3LW8A 4U01A 5HE8A 2F9MA 1BB0B 1XUGA 3FFGA 3PUWA 4GLYA 5EQSA 1TU4A 1OIVA 4W5JA 1P2KA 1F5NA 2V0BA 1GCTB 4NH0A 4TSFA 2F7SA 4JS0A 3RWOA 2B8WA 5KYKA 1QGFA 3HU2A 1A7SA 1UTOA 4OI4A 3QWCH 3R7WA 1GBDA 2F55A 2IK8A 4QBFA 1G32B 5DYIA 2V54A 3F9GA 4L9SA 3GY6A 5EU8A 4TMTA 2X8AA 2EVWX 4A1FA 2BMGB 2EFGA 1WMSA 2FSGA 2Q3MA 5FBWB 4JLVA 2QAJA 5IRCD 4NSYA 4CRAA 4Y0VA 3PCRB 4TL8A 1BQYA 5FOWA 4BE7B 1YLDA 3QXSA 1S1CA 4DBLC 1JR3D 1UDWA 4H42U 2WWFA 1IJFA 4YDHB 4Q03A 5C4MA 3LPRA 4IN1A 5FHTA 4Q4HB 5EE0A 2VNTA 4NKRA 3BK7A 4N1AA 3LA6A 1XKAC 4JLNA 5C67A 3PMJA 1HEIA 5DLQC 2FWRA 1EPTA 3W6NA 2FSFA 2RAPA 1EP5A 1Z8GA 2QE7D 3DHKH 3U7GA 1O3PB 4ZDKA 1D4PB 1KI7A 2OM2A 2NPIA 1VCMA 3E8LA 1TPAE 5F6MA 1MQ5A 5EP1A 4U00A 2P3UB 2HLDA 4AB9A 1HAGE 3PV2A 2QI9C 2P8OB 4MQBA 4TWZA 2P5SA 1O2WA 1FY5A 1SGNE 4JK6A 2F3TA 3FGNA 4XVRA 4NYJR 4C0JA 4F4JA 2AEIH 1E9FA 3IIJA 4ACBA 3KQHA 3UR9A 2IUTA 5K0HA 3D3QA 3UANA 2W2XA 4DLRA 4J0QA 1AS2A 1O3YA 4KXFB 2QMHA 2O8FA 3TGJE 3QKUA 1UF9A 3FANA 1NG1A 1AKSB 4Q7YA 2IYXA 2KBFA 2YZ2A 3J81k 1YR8A 1YVDA 4HGCA 1NN6A 5HXFA 2WOJA 4LBZA 3U44B 4ILEA 2WSMA 2WTUA 4XFQA 2TPIZ 1OHHD 3QEJA 4JK5A 4LYJA 4KGAA 4X8OA 3GLHB 1WXQA 3BTME 3DHWC 3X1DA 1KI1A 1EAWA 5DGXA 4TLBA 1SPJA 3NBFA 3FE2A 1FZZA 4NBSA 3L82B 5B58C 2GCNA 1CJTC 5TV2A 3BG4B 3SJZA 2CXVA 2FLRH 3KIDU 3BEUA 4EDHA 5IHPA 1W2GA 3AVZA 4YT6H 2UWPA 1ZNXA 4HLQB 4GOXA 1ELDE 1VCWA 3U4QB 2AX4A 5KNDA 2GXUA 2Y6TA 1A0LA 1L2EA 1SVLA 4OJKA 1BTPA 3GLIE 3H7OA 1R6BX 4FUFA 3K70C 3BV9B 2AXNA 4A4DA 4N3NA 3ICEA 1G3RA 3ZYCA 2BBWA 2YNBA 4ESVA 2F1RA 1NMXA 2ZPTX 2H92A 3MH6A 1D6JA 1M1YE 2E87A 4CBNA 5CB6A 1NLFA 3TQFA 3UKDA 4I8LA 5JRZA 4PAMA 2H5EA 1TPZA 4KBFA 2ZC9H 4GNKA 2Y8EA 3EA5A 4P31A 4ZIRA 1GI9B 2WV4A 4KTSA 1W5SA 2JLWA 3I77A 5B6OA 3AVOA 4BEJA 2A5JA 4EFMA 3CZPA 1A7JA 5ELXA 4ABAA 1O3MA 2XNSA 3QNUA 1KI6B 1XTQA 1D3TB 4L16A 2ZRPA 2QXJA 4B3CA 3EAJA 3K9XB 1RRFA 4M21A 4X8VH 1II8B 5EXNA 2O0HA 1O2XA 1FONA 4HLUA 1O2ZA 1NRNH 4IW4E 1SVMA 1KJWA 1Y5BT 2O8CB 4Q1FA 4R2IA 1AWHB 1V2VT 1AGRA 2E9SA 2WWYA 3TMKA 4A0RA 3P26A 2ZM5A 2DWQA 2C8XB 1PJRA 1R5NA 2JA1A 2V3HH 3B9QA 2RGNC 1XKBC 3ITIA 1OFHA 3M3SA 1KJZA 1CSOE 1TEVA 4AKHA 5DP8A 5L3QA 3MO6A 3P8NA 3BORA 1W2HA 1ZIPA 3RLYH 1SB1H 1O2KA 4KODA 4YLUA 1A5IA 1C1UH 2ONJA 1AMHA 1XMJA 1WDTA 4TLAA 1HJ9A 4DXAA 3RVBA 3PFIA 2KB0A 1E4VA 2HT6A 3L0SA 4PO9A 4NIVA 3K2UA 4AG5A 5JBQA 2R9PA 4Y79A 1T3SA 5SZJA 3LH5A 1RRKA 1LPZB 3UXMA 5AHGH 1U0HC 4F4OC 3VKHA 5DI9A 1TWXB 1W47A 5JRJA 1AD8H 4B44A 4DKXA 3TJVA 3SOSA 1KKMA 1CE5A 2GBLA 2Z6VA 1NKSA 4LJ7A 4KLZA 1A46H 3FTQA 3FHCB 1NIPA 2GZDA 2H9HA 3GJ4A 3D8BA 3MH4A 4Q18A 1PV4A 4JZFH 2ZEBA 1D9IA 3BEIB 1G3MA 1NY5A 1V2QT 3DEFA 1FP7A 4M22A 4TYNA 1P2NA 4WZAE 4C0LA 1E2IA 1UMAH 1E9RA 4YMVA 3K0AA 2E1RA 2F9OA 5AJVB 1OKKD 5FR1A 4Q5IA 4AYXA 2PKAB 1KK0A 1W10U 4UQOA 1G3BA 2HJGA 1GI7B 1O5FH 4DRZA 1YF4A 2GILA 3AVYA 1V2LT 1NIJA 4FWTA 1G3EA 1R4AA 2XTZA 2LPRA 2VHCA 1Z6JH 3S0NA 1CIPA 4PXAA 2ZHQH 1N8OC 2A7JA 4NFFA 4GZMA 1BRUP 2GZAA 3S1AA 2BDGA 4F4IA 2V7QA 1QA0A 3A88A 2F9PA 2C8ZB 4D2IA 3LWNA 3QG1A 5JECA 2GJ8A 4BQSA 1SGPE 5TCCA 3TVJB 1G30B 3SQWA 4Y8ZA 1E2LA 1HJAB 1ODFA 1E2KA 2RGEA 3TSZA 4ZDJA 1YPGH 4ZHMU 5LB4A 3P4XA 3T28A 2NQ2C 3RXDA 4I4LA 5A5GA 3BTWE 3GICB 5EPYA 2JIZA 3TJUA 1VGCB 3H09A 5GJBA 3P4YA 3SU0A 3EG5A 1G3DA 1W4CA 1JMOH 1MRSA 1GBTA 3S1AB 2A32A 1R0WA 4KELA 5ESTE 2IYRA 3D7MA 1P0SH 4NCKA 1KDTA 3TAHA 1SI5H 1SLWB 1E0KA 1T4GA 1XUJA 2IT1A 1RTFB 1KJYA 2TGDA 2ZU5A 1UVSH 3KTAA 2V3OH 3W5IA 1NL3A 1C4U2 1EB1H 1TQDA 2P65A 3QPVA 2JJ2A 1C5UA 1QJ6B 3BERA 2F6RA 4JLOA 3CLVA 1E36B 2OLJA 3IHWA 2JAQA 1O5DH 2NGRA 1UTPA 1NY6A 1BHXF 1CS4C 2PWXA 3KGPA 3TU7H 1RC8A 1OWKA 1YM0A 5FUVA 4DDUA 1XMSA 2PBRA 2H1UA 2PMKA 3SNBA 1SVPA 3SU6A 3P20A 4HZHA 3VR4A 5C2JB 2CN0H 1BUIA 1AFEH 1JPJA 2ZVPX 3PUYA 2CMKA 1CRQA 2B7CA 2AR7A 3GLFB 4H1UA 1B0UA 3LH3A 3OF5A 4E5UA 1PYTD 5F9HA 4K1EA 3MSXA 2VGCC 1I4TD 2AWNA 1KSFX 3UPUA 3FP8E 1WQVH 3AH8A 4YXWD 4O25A 3AKYA 3CF2A 1UVUH 1D9ZA 2TMKA 3SI7A 1O3JA 4PPQA 2AKYA 4INKA 3SNHA 1BRAA 4TL6A 3SJCA 1MTUA 2CHAB 2XW9A 1IXRC 1FW6A 4QG7A 2GMTB 3B9FH 4FUGA 4DT7B 5DP5A 2PHBA 1NKTA 1GL6A 1KSHA 3DKPA 1GI1A 1ZHMA 2BVNA 2SGFE 1DG1G 1TA2A 2FM2A 1XXHE 1KO1A 2A5KA 2G0TA 4CT4B 2ZKSA 2QT0A 2FESH 1GI0A 4TYWA 5DHAA 1H9LB 1X6VA 2VQSA 1TQ7B 2DFKB 3MGCA 1TABE 4BNRA 1NRRH 4RZ2A 3U3OA 3UQVA 4ZKNU 1W36B 4CREA 3SFZA 1ZPZA 5EE5B 1E1RA 1SSXA 1VDZA 4OI2A 2GEVA 1E1QA 8GCHF 4RD0A 1FAXA 3ZIAD 1TGBA 3B7GA 2CHAC 2GCHG 1QJ7B 2CXXA 2IPHA 1EXFA 3NKKA 2QAGA 4BAHB 4CRDA 1NVUQ 1PJPA 2ZE5A 2QXIA 3GLFA 4F7WA 3PJRA 5J40A 3MH7A 1SG8B 2CV3A 1EKBB 3PQCA 5FPHA 3AKEA 2BKUA 4EPVA 5AUNB 1MTVA 2BDAA 2NMVA 4BEBA 2QMEA 1IONA 1GHBG 4Q9IA 1BJVA 1MU6B 2J7PD 3T5FH 3P8FA 3U7HB 2X1VA 2OBQA 4PC2A 1EWQA 4LJYA 2OXRA 1VYVA 4IVRA 2ZRBA 2ILNA 1BMAA 3MNBA 4Z51A 4X2XA 4LBWA 4F4CA 3HYTA 3BFVA 3QKTA 3GY3A 1FLEE 2Z9IA 2XB2A 3P92A 6LPRA 1IQNA 1QJ1B 4FUJA 4K2YA 1HIAB 3SQEE 3NXSA 2Q21A 2BBSA 3BS4A 4FMCB 5DYGA 4MKIA 3LXRA 1QCPA 3X2SA 3BB4A 1PPGE 3SHCH 3ZVNA 5KSYA 3UMRA 1YPHC 4KKDA 4U30A 3H4MA 4IN2A 1C5VA 4P4SA 3ZVDA 2DUCA 1FY3A 1UKZA 3O8DA 2Q6GA 4RN6A 3HR8A 1G18A 3ZZ5A 4YMWA 1F0SA 4Q02A 4I8KA 3ZQ6A 3CS7A 2IWHA 2V6IA 5AUQA 1ETRH 2F9NA 3W95A 4KFUA 4H1VA 4ABHA 4WXRA 1EPTC 3R9IA 1UDXA 2ZFRH 1UTNA 1M7GA 1B23P 1DANH 2VVVA 3AGQA 2ZANA 4DDTA 4LXBH 1FX0B 3LGTA 2ZQ2A 3BN9A 1IQLA 1WTGH 1KI4A 1HRTH 5H68A 4HYYA 3NEYA 5FOSA 4ERNA 1FJSA 4AN7A 1Z0KA 4QNMA 3VFEA 2R6FA 3RS4A 4JLBA 3GEEA 2GXAA 1ELFA 1UAAA 2O5VA 2BHRA 3SZRA 2OAP1 1Z08A 3ZIAA 3STJA 2LCFA 3SU2A 2BYAX 3OTJE 1GL1A 1KZ7B 4IS5A 1CEEA 3A87A 3H0KA 2HF9A 1Z8JB 2QENA 4BFWA 5A8ZA 4XOIA 4A2PA 1BTYA 1DS2E 4YOGA 4XDEA 3ZYDA 4R2HA 3ZVGA 1ZW6A 4I1UA 1KXDA 3R7WB 2GXQA 1YRBA 2FSHA 5L3SA 1Z2CA 2ZI5A 4LHXA 1CBWC 4NG9H 2R9VA 3RDPA 5BQ5A 4TPIZ 2TGAA 3G01A 1ZMNA 3AVUA 1GI6A 1GJ6A 4HDOB 4HSEA 2WBLC 2AS9A 2JH5D 2DWPA 3D49H 2VHJA 4TT3D 2W7SA 1W7AA 1PLJA 5CYOA 5CE1A 2UWLA 3CWQA 2FOFA 1DXWA 1MCTA 1XMNB 1YZUA 1G2MA 3U98H 3UWKA 2BTCE 1J70A 2ZAOA 2R62A 3EAQA 1EQ9A 3B13B 5LD2C 6ESTA 3P6ZB 4R98A 3TJNA 2F9VA 3K0CC 1MOZA 5EODA 2HPPH 2ZTZA 2QP9X 5HCIA 3CRQA 3RXQA 1N3BA 3PWCA 2HOBA 1AN1E 2V6NA 3ZVRA 1AE5A 2GDEH 3EA7A 2Y7ZA 1AA9A 1YCPM 3GCGA 3QE0A 3RMLH 1GBAA 2ZWLH 4UEHH 3P1JA 5GPIB 3NKVA 2OO7A 4A7IB 4ZO4A 5HM9A 4NCHA 1BYUA 5FBVB 2D4HA 2A7CA 3LT3A 4NWLA 2GWHA 1WF3A 3F9FA 5JHHB 2BD7A 2KWIA 3CB4A 1QHNA 5CMXH 4QXAA 2RCEA 5GDSH 4DIIH 1IQPA 3D62A 2EWWA 3LH1A 3VU9A 2ODEA 3B1VA 1S96A 5KPJA 3CX7A 4M7GA 4RFVA 3KEEA 5DK1A 1KSJA 3K0SA 5FPYA 1BMFA 5AJXA 1MKYA 1GMDF 2RGDA 4B3FX 3VB5A 1XPOA 4CT5A 2ZTSA 3X1WA 2EW1A 4IGDA 3AAVA 2WWXA 1NMZA 2VWLA 1KI6A 5FOVA 1NN3A 1TFXA 1G7SA 8GCHG 2ZXUA 1U94A 4GCHF 4OQLA 4GVUA 1GVZA 2IN2A 2W2VA 3SUFA 4LHVA 4AB8A 4XTCS 1Z06A 2OCAA 3HKIB 3HJNA 3K0AB 1JBUH 4AFUA 2ZSDA 3ZD7A 4Q66C 1F5KU 3PO1B 4B6EA 1YR9A 3B1ZA 3C15C 1EATA 2A0QB 2V35A 2IS2A 4TTQA 5F8XA 4M4SA 1HGTH 2XB4A 4HZUB 1UVPA 3AK5A 2P67A 4OHWA 4JZDH 3TRFA 1IAUA 2HWLB 2ZYUX 3OY5U 4AK9A 5JJLA 1YJ5A 2WMNB 1M7HA 4FUBA 4X8MA 4XD7D 3SNAA 1TMUH 2DR3A 4IEEA 2Z3EA 3OX7U 3Q00A 4AI6A 4C3ZA 2A9KA 4LCBA 5BPEA 2WWWA 1XXHA 1MTWA 3THXA 3CNOA 2VP2A 4GCHG 1UM8A 1TALA 1N0WA 2ZQ5A 2WMOB 3LX5A 3QDZB 1SXJE 2HXYA 2GVFA 3B60A 3OTPA 1HJ8A 3OAAA 2AYWA 2TGTA 1VCIA 1Z6AA 3EARA 1S82A 1S9HA 3VB4A 4GT1A 4Q1BA 2AGIX 221PA 1RJ9A 2CJWA 1UFQA 3MCAA 1D8TA 1ZSKA 1U81A 5ESBA 4K46A 2THFB 1VKJA 4MPUA 4D0GA 1COWA 1TNIA 1W49A 4TLCA 1II8A 2GCTC 1OYYA 2BDIA 3M35A 3A1WA 2V1XA 3QF4B 4MNYA 3AKDA 1GG6B 2SGDE 1FPHH 1S0QA 4YT7H 4CRBA 3GDSA 3TUIC 3AVWA 4JT4A 1NU9A 3SFVA 4EFNA 4Q00A 5T3HA 4LSGA 2QMUA 2XZPA 3BTFE 1S0UA 2PX3A 3UWOA 2CL7X 1LHGH 4XWAA 4JZIA 1P75A 4GSYA 2QGZA 4DIDA 5IYTA 1DE7H 3TPIZ 2VWOA 4JVSB 2A7HA 1RYHA 1EFRD 5AK0A 2YKGA 2B7DH 4L8GA 2XWAA 1ZUIA 1U2RA 5E2PA 1E2MA 1WCV1 2XBXA 2ZUBA 5TY0A 3FWYA 3N5CA 5AFYH 4HATA 5EQQA 4PZYA 4CEIB 4MRRA 3TLOA 3MI4A 4X1RU 1ANEA 2ZJOA 1TYNA 1EXMA 3KN2A 5J4HA 1NRSH 1ELOA 2H17A 3MU8A 1EX7A 3PEYA 1LKBA 2Z43A 4X1NU 4H4FA 3KL6A 5LGOA 4AX9H 3VGCC 2GT7A 1J16A 4KFSA 2F43A 3SHFA 1NSFA 2Q9BA 2FFQA 4C9BA 4EPRA 1YR6A 1NN5A 4OHVA 1Q1BA 4OS1A 1D3QB 4LGMA 2QL6A 2HALA 3W5JA 3GJ6A 1A61H 5KSPA 2H16A 1O2LA 1TX4B 1CQQA 1E0JA 5JDUB 1ZBDA 2GJSA 4TQ9A 1HQCA 1RS0A 1OT3A 1P61B 3EA9A 4URYR 4GHQA 3GMTA 4BOHA 2XTNA 4CEIA 2P5TB 1JRTA 4TWWA 4YLGA 3IIMA 1MH1A 4X8TH 3AW0A 3HPTB 3CWZA 3MJRA 4YMSA 4G0NA 2P59A 5BRRE 2QQEA 3ZS9A 1BA8B 5TCAA 1NLYA 1MR3F 2UWOA 1H8DH 3V7TA 2JJ2D 4Q7LA 1A2BA 1EAUA 4BAQB 3O8RA 5HZHA 2VTKA 2WIAA 4MUBA 1ELEE 2HNTC 1QQ4A 1DVAH 1GOTA 1Q1EA 1YPEH 2FH5B 3SJKA 2ZIQH 2B6HA 5EXMA 1FPMA 4D7GA 4NCIA 2BMDA 1FL9A 4AYVB 2BKEA 4UJ5A 3RS3A 3PUZA 1EFRA 1SGDE 4WOPA 1ESTA 4MYUA 2IYZA 1Y5AT 4P3YA 1TNJA 4JYUH 5DISB 2N42A 3DM9B 2WSSA 4WXPA 1YQTA 1EFUA 1M74A 1MRNA 1E9SA 1HYQA 1HAHH 3EQ0H 1AUJA 1ZU5A 5EE1A 1GJAB 1CHOG 2AGEX 3OYPA 3RP2A 5KDOA 1TMBH 2PTCE 4Q4LA 1K1PA 3LJOA 3BFKA 1TF2A 2V4ZA 1DDJA 3FVFB 2V1UA 2SHKA 2G5NA 2I1VB 4ZDIA 3PM3A 2QPOA 1XTIA 4BFXA 4PR0A 1QRAA 1GHBF 1O3CA 3BTEE 2JJ1D 1ZCBA 4A1VA 3M4YA 2J9RA 1AUTC 1VCNA 3RS7A 2BY7X 1G7TA 2VWMA 1VITH 1UTMA 3PTNA 5BN4A 2BVXH 1C5XB 1E69A 3K70D 3U7FB 4Q7ZA 1PLLA 1ID5H 1W0ZU 1O3HA 4JKIA 3FKSD 1NTPA 2GBLC 4BFUA 2QA5A 1G7CA 2RGBA 5DSZA 2KBEA 1TNLA 4LK2A 5DN6A 1CJKC 3F1SB 2FI4E 4XOJA 2BOKA 4M9XA 3MG9A 2R65A 1CA0C 1R0YA 1EGAA 1C5MD 4TYYA 3MNCA 2BMJA 4CVNA 4X1QU 1XTRA 1G21E 1CT4E 2J0QA 3KQBA 2Y80A 4DSUA 1LFDB 1SGQE 4TWYA 2CVFA 4BAMB 2ZYVX 3REFA 3I4LA 3KQNA 1HBTH 3I62A 4CEHA 1KK3A 2WPJS 5FR2A 2FYRA 4KP0A 2R3YA 2IWRA 4C0AC 2IYUA 3NH9A 3HGNA 3F5FA 3U6KA 1QRWA 2FOGA 1L7VC 1BIOA 5TVKA 1KI8A 1IY0A 3T5DA 3MO3A 2DE9A 3A4NA 4NGAH 2Z9KA 5CB8A 3DMNA 4LJAA 1DAIA 2VLIA 3QZRA 1YP9A 1QF9A 5AVDA 1ANBA 4X6MA 2O8EB 4FI3C 3QZQA 3L3TA 1WQSA 1NSTA 3A8TA 3RRMA 4TZ0A 3VU9B 5G4BA 4OYHA 2KI5A 4IDNA 3GLIB 4A2QA 1Z0DA 2PZEA 1WSSH 1Q31A 2ZZUH 2XXAA 4M1WA 2ZSFA 5PTPA 3KX2A 4PC1A 5DP3A 2FOMB 1WOFA 2BDTA 5DI3A 1VZQH 4JLMA 3UNSA 1XJQA 2A45B 4FMDF 2ZI3A 1PQ5A 3SHWA 1G41A 2QCYA 1XF9A 3PUVA 1GP2A 4JMYA 1P57B 3NZIA 4EAQA 4DLSA 2ZJAA 4Y8XA 5JYIA 1GMDG 1ZJ6A 1QDEA 3IUYA 1P60A 5IK2A 3V12A 1XVMA 3A81A 1RXPA 2JGNA 1YGCH 2G4UA 1C5NH 1E2EA 3IO3A 3SV7A 2WVJA 1T8MA 4DUGD 1UHBB 5JBAS 2LWIA 1CT2E 3GLGA 3ZQJA 3UIRA 2CNWD 1JPNA 1Y3YA 2P6UA 4QM6A 3R0FA 2GCOA 3PV5A 1QTFA 5FI1B 2GESA 3HYRA 2R0KA 4E22A 1IXZA 5A0CA 5F9FA 5GIBA 3UG7A 1AVXA 1EASA 1MO4A 2G6BA 3ZZ8A 3VR1A 3FZZA 2XTTB 4I1VA 5FTLA 3NBYC 3NK8A 2J46A 3IPXA 3Q3XA 1A0HB 4RFSA 1PPFE 2ZRHA 1DT2A 1OKKA 3L8YA 3QN7A 1CBWB 1CO7E 2G5VA 3K0FB 2OBLA 4GL2A 5J4VA 5JHGB 4A5TS 4I1SA 5KDDA 5JWRA 1HT1E 4X6PA 1U8ZA 2FTLE 1Z8RA 2GF9A 4WZBE 1KKLA 1GMCG 3GISB 4NIYA 1E9EA 3UK6A 2J7KA 3WY8A 2EFEB 1G3UA 3FKSA 4KFRA 1FUUA 1CVWH 2DY1A 4Y7BA 2WSSD 1PQ8A 4M1TA 1MH0A 1IQFA 1O39A 2GRJA 1O3GA 4L4UA 4DSTA 4EPXA 3SE0A 1WA5A 4ZXYH 1KO4A 4CR5A 4RD6A 1K1OA 1Z2AA 4I7YH 1SXJD 4OQNA 2WZQA 1SLVB 1XXDA 3M1IA 3GJ7A 3UIEA 1T4VH 2ZCHP 2ZJBA 1CGHA 2J87A 1QNJA 1JEDA 4ASHA 2IBMA 1NO9H 3LO5A 2DFLA 1G17A 2J45A 3FDIA 1T91A 1E34B 2ZU2A 1W5TA 4HUQB 5H70A 2A3RA 1AU8A 2XOKD 2GJAA 5BYJA 1TQ0B 2FJUA 5KUTA 4NA8A 3A7TA 1ZC4A 1B7XB 3EC1A 2J9NA 2MMGA 2VP9A 3K0CA 2OBMA 1HXFH 4ISOA 2XOKA 1BTZA 3SZEA 1GRRA 5J4KA 2JATA 4D6PA 2OLGA 4GOKA 4MRSA 1WB9A 2P6NA 4JYTA 1Z6YA 1EFCA 1F0UA 4RKOB 2GCPA 2ZEJA 5HKKA 3HGPA 3MUFA 2J3EA 2IXEA 2R44A 1FX0A 1ZGVA 4C4PA 1DAHA 1BTXA 5FTNA 1OXGA 3M5OA 3P17H 2ZGBH 1THSH 2B9LA 2QMOA 5FOUA 3M37A 4OHXA 3P27A 3SV8A 1HA3A 3A7ZA 3DDCA 1FOEB 1P2MA 2J0VA 3VKWA 2OC8A 2W0SA 4EJSB 1BBRH 3MJHA 1FZQA 4TYQA 4BFSA 4AG1A 2ALVA 3P95A 2F4LA 1A5HA 3JZ2B 5B64A 3N7OA 1IQEA 2REXB 5B30A 3SQXA 2IEYA 3ZZ7A 1GITA 5TB5A 4NCNA 1O30A 5K8IA 4AORA 2ZI4A 2MSEB 4KYIB 1YZGA 4D0NA 1GKIA 3NXPA 3B9PA 4VGCB 4RKFA 2NU2E 2R2AA 3C5HA 3SI3H 1FUKA 4ABYA 2OCVB 1M34E 1LVBA 3QENA 1GJ4H 1O36A 5AJWA 1BO6A 4DJTA 1CHGA 1I4DD 1TRMA 3NTUA 1V2MT 3ZVMA 2HCBA 2G88A 5DHFA 4ISNA 3B1YA 1JOUB 3AVTA 3R8FA 3UNQA 1A2CH 4YONB 1XX9A 1VR1H 1F2UB 1K1IA 5C1XA 4DCSA 4ABIA 1KDQB 3GDVA 4ISHH 2D2DA 1GHAF 3IWMA 2AH4X 3GLHE 4JVNA 3OEHD 3EZ2A 2J0SA 1LVGA 3U44A 2YOHA 2ZCLP 4PC6A 3PLBA 5C46F 3E16B 5TJXA 2HCJB 3I3SR 1W12U 2O8FB 4W5HA 1KYNA 3LDXH 3NDPA 2CNWA 5J47A 4LV8B 3CW2A 4ZXXH 5KNBA 3M61U 4FU9A 4KSCA 1OWDA 1P3EA 1O37A 1QRZA 3LQQA 2FFHA 3U5ZB 5TXGA 2C93B 3L0OA 4KITB 2VIPA 3SBKA 4BECA 4GDFA 3U2QA 1C2IA 2OQUA 3VQTA 2ZRKA 1MAYA 3GY7A 5TDHA 2BVSH 4ACAA 2A4RA 2FI3E 4P33A 3MD0A 2XZOA 1O0DH 2Z9LA 2O0JA 4Q7KA 5JJIA 3TVDA 5B6LA 1C1SA 5GVRA 3L43A 5LDDC 3REGA 2HRVA 2AD1A 4YOIA 3SU3A 4DCNA 1Y3XA 3VTKA 2ZS8A 2BDHA 2BXUH 3M5MA 2GCOB 3MU4A 3OAAD 4LPKA 2A1DB 1HQYE 4WMFA 4URVR 5UKDA 1SKYB 2HXSA 2QYIA 3ZYEA 4FXPA 2ZSBA 1FIWA 2CBZA 1UK4A 2PUQH 1ZR0A 3FOZA 2JLQA 1ANCA 5AJZA 2O8WA 2F43B 3BTTE 1H9HE 1O3FA 3KKQA 4CR9A 4DHEA 2BWJA 4B2CA 2BY6X 1ZM9A 1ZD9A 1FNIA 2P8OC 2FEQH 4JLAA 2ZJ8A 4Q7MB 4B75A 3KJEA 1VHLA 1GTVA 4RFSB 2PZGA 4BTTB 2FG5A 1TPPA 2P0EA 3TR5A 5FBEA 5LPRA 5JMTA 3K6ZA 3AF3A 2HUPA 4ZHLU 2D74A 2A31A 1BOFA 1DWDH 4N0EA 5AJYA 2PKSC 2ATXA 4R7ZA 1CRPA 1S83A 3Q5DA 1TGTA 3GLIA 3C7KA 1O3DA 3DO6A 4ZCLA 1GJ7B 1GVNB 2DCUA 3SNCA 2HF8A 1EX3A 1RJXB 4M1YA 4LHYA 4KTCA 1Q3TA 4JLPA 4LZ4B 4B43A 5AUPB 3CBQA 3RDZA 2XC0A 4YO9A 1O2RA 1ZU4A 3RM0H 5BN5A 3VX3A 1JALA 1JIRA 1AS0A 4IC5A 4RKJB 4NYIQ 1G7RA 1GG2A 4M1OA 1NS3A 4TMZA 4RZUA 1T32A 1VIAA 4DT1B 4GP6A 1YRAA 1LVYA 3DZ8A 3BH7A 3PIRA 1AGJA 3PO1C 1DVRA 3ASZA 1E2FA 2C5LA 3X1XA 1K28D 3QK1A 3M36A 2FPMA 1DFPA 1MO6A 1HAIH 1ZCAA 4IOMA 2MMCA 2ZDNA 1W44A 2EI6A 3PITA 5DE3A 4ZI2A 2ZDKA 2ZO3H 5FCRA 4MDFA 4MYTA 3LGVA 1SGIB 6GCHF 3RLWH 4R9UC 4JSYA 2AMQA 1SHZA 1MT0A 3RWMB 1GRNA 1T3HA 2GTPA 4Q9KA 2W6JD 1W48A 2BZAA 1GNRA 3ATKA 4MRPA 4XWKA 4I8GA 3A80A 1J17T 1MKWH 2V6JA 2J0UB 1ZNYA 1T8NA 3BOSA 1SBWA 1Z3IX 2FZZA 1O5AB 3CNLA 1V2OT 4JBYA 1KO8A 1TEXA 3QVVA 3Q72A 2Z9GA 2REOA 3CPHA 1UTLM 5EE9A 3AASA 1MQ6A 2QORA 5LB2A 5IT5A 4A8JC 4AGJA 5DO9A 4CGZA 1O3AA 1KTVA 1KLTA 3NHBA 3QXCA 2JETC 1E32A 1EOJA 5JWHA 2OUKA 1W4RA 1VG9B 4QJ3A 1SQ5A 2GCTB 1GUAA 4HLDA 2YINC 1JXPA 4Y10E 2WAYA 5EGMA 2WINI 1NRJB 2ORIA 1XCMA 3RXSA 1GZSA 2QAGB 4HTCH 1WRBA 2Q1JA 3AP1A 1NT1A 4X1PU 5EQRA 2C77A 1OKXA 2QT1A 1X1SA 4V0MA 3V4RA 2JJ8A 1O2QA 4NZYA 4BRUA 4GBMA 3HKJB 2ZGCA 1HAOH 1O2YA 3DPUA 2IXGA 2A4GA 2NO9A 4NSVA 1E2PA 1K21H 4BTIB 3FVQA 4ISLA 1HAVB 2PV9B 4ESTE 1R5OA 3SU4A 3D6TB 3ECCA 2D2FA 4HAVA 1GCDA 4UFEH 1ZAKA 3QJYA 2BJWA 1IY2A 1LPGB 2IJD1 4BXSA 4E05H 3FMPB 1EUFA 3UR6A 4KAXA 4XVQA 4F93B 5JPMH 3L2OB 1GKUB 1SVKA 1MO5A 4RY2A 1L0ZA 4XH9B 1C5SA 5HPYB 3RRZA 1HPGA 5LBIA 4HLUC 3ZS8A 1D9XA 1J99A 1S2MA 1Q20A 4LPSA 5EE3A 4DLWA 1CR4A 2OE2A 1W11U 2OD3B 4RCYA 1FUJA 2XITA 4NHOA 1AVGH 4NIWA 3LLUA 821PA 1SL3A 2ZGHA 2WJJA 2HYDA 1WE2A 4A82A 4BLSA 2GTBA 1RKBA 4KV9A 1TBRH 1TU3A 4AFQA 5L2ZH 4IDQA 4K8BA 4DEXA 1UJ2A 4OS6A 4C7OA 3LNCA 4OHZA 1EJMA 3ICQB 4BAKB 3RXFA 2WHXA 2QROA 5CM8B 3TSWA 3VR6A 2XTMA 3FMFA 3GLGE 2XC5A 2WJGA 1GI4A 1E1RD 2XJ9A 1QIXB 5G53C 3F9HA 1L1NA 2BJVA 3U8RH 5FX6A 4YTAA 3SV9A 3CX8A 4IDHA 1F60A 4HB3A 5K8UA 3AF0A 3W8NA 1C4OA 3PENA 3S7KB 2FDCA 3A58B 4DIHH 2BM1A 1H4WA 2HLDD 3HP1A 4GFDA 4D0LB 2XBWA 1T0HB 3UWIA 7ESTE 2ZSAA 2FE4A 1JAHA 1G6HA 1MZDA 4DSNA 1A3EH 1DY9A 2EU8A 4D82A 3CR8A 2TIOA 4XE4A 3U1IB 4BLQA 2QP4A 3M3VA 5JCPA 4CZ2A 5FPKA 1UTKA 2ANCA 2OK5A 5A4JA 3NC1C 1BBRE 3D23A 2CJWB 4A8JA 3B1XA 3URDA 3PMAB 1IAQA 3BF6H 2YC2C 1TF5A 4K8YA 1O2HA 3IEVA 5B2ZA 4B33A 4ZKEA 4RJLA 3OFND 1J7KA 1Q1ZA 3FP7E 1NP6A 1GKYA 1HB0B 3GP8A 4GHTA 3KXLA 1JJ7A 1RRGA 4ZKRU 4FVDA 2AMPA 4ZCMA 5D3MB 2ZI9A 3SUEA 5FI0B 1G37A 1Y63A 4PPGA 4TTPA 4B3GA 2ZYWX 1N6NA 1XCPA 2VEDA 3CIOA 1VG1A 3G0HA 9ESTA 4JVLA 5SZKB 1J14A 4AFZA 5HYOA 5A2MH 2GNOA 1K1JA 4FCTA 4LZZA 2F83A 4Q47A 4ZUHA 2AFHE 4GAWA 5P21A 3TJZA 2ZHWH 1E79A 1L8QA 1O31A 2IS6A 1GMHG 3HATH 3ATMA 3SJOA 3TITA 1KO7A 3W9YA 1RRPA 4H9GA 1SMFE 3Q9LA 2XNDA 3CRVA 1P2UA 1GJ9B 1ELBA 1QVAA 1OXTA 2BZ6H 3SW2B 2FLBH 2A5DA 3C4JA 2D1JA 3SS8A 5EG4A 3SNEA 1OFUX 5F8ZA 1ELTA 1KMHB 1DWCH 3VB6A 2G77B 3KUDA 2H57A 4QBIA 1IM2A 2QGNA 2QTVB 3TLXA 4K1SA 1NVVQ 4QRHA 2WPKS 2GEUA 2IX3A 2C03A 1BOQA 3S9BA 1TPOA 2OFWA 2ORVA 1E3MA 1YLCA 4OHYA 1NVXQ 2GK7A 3T29A 1OOKB 2F3CE 2DE8A 3Q3KA 3GOVB 3ETLA 3I73A 4RCZA 4IOLA 2HV8A 1BZXE 2AXPA 2IYWA 3IGFA 3TW4A 3MWIU 2ZPQA 4FD2A 5SZHB 2FU5C 2A2ZA 2J2UA 2AFQB 3EPHA 1CGIE 3MYWA 2ZRIA 3B8JA 4Q1DA 1Z8FA 4QJ5A 1O5EH 2ZGJA 5LH8A 2B0FA 3WYFA 1SQTA 2ZVQX 1XZPA 5CIWA 4HFPB 2Z5FA 1MO3A 1AFQB 1LY1A 4D4LA 5JI3E 1G2LA 1SLUB 2G0NA 1QL7A 1II9A 1SHKA 2BEJA 1G36A 4DT1A 3ZGXA 4X1SU 3QY0A 1W2KH 2IYSA 2OBOA 2D8WA 2VYFA 4B32A 4A0GA 1JWTA 2WWHA 5I46H 5FAHA 2BM0A 1V3XA 1IQIA 2ZDLA 3SV2H 2VP5A 1K1NA 3A7YA 3FZDA 4OQXA 2I6QA 3W3AA 2WJIA 3GFOA 3WYGA 1TE0A 4NA9H 4HI0E 3EIHA 4D8NA 8KME2 1O2JA 5DJ7A 4PX9A 5FBIA 5FCKA 1M8PA 1AKYA 1ZHPA 3VR2A 3TIFA 5CITA 1O2SA 1ZPCA 4RZXA 2A5YB 5JWOA 1W0KD 1Y3UA 2ZU3A 2RKOA 1T9HA 4V0OA 2HNTF 1PPCE 2B5TB 4LJ8A 2PX0A 1E37B 1ABJH 7KMEH 3SN6A 1T8UA 3RXMA 4B71A 1EFTA 1Y3VA 4CRWB 4XIGS 3A82A 3RHFA 2GXSA 1E98A 2FFAA 2GKSA 4LOAA 1R10A 2ZI7A 1MCVA 2I3BA 1P3CA 5KO2A 3TUZC 1CR2A 1UKEA 1O3EA 3BG8A 2BC9A 1T6NA 1XNJA 1Q1QA 4QHTA 1P6XA 3SOPA 4LV6A 1XBTA 3WP0A 1G5RA 3K53A 4G5RA 4MUAA 4FCWA 1FQKA 3DZDA 2D26C 3OEEA 2QUZA 1UKYA 1AB9B 4X6OA 1MABB 1BTHH 2OBNA 2D7CA 1RIWB 2JLZA 1DY8A 3THYA 2FODA 2OC0A 1QRXA 1GJCB 1QB9A 5BN3A 2FS9A 1BS1A 3BJIC 3LAWA 4UDWH 4LYFA 2VP4A 4LJ6A 2GZHA 1BBRK 1O87A 3W94A 1PUJA 3ZZTA 2A7QA 3PMHB 2QEQA 4WA7A 2J59A 1E9DA 3ZD6A 3HU3A 4CBOA 2ESTE 4WZ6A 1TIOA 1TX7A 1DG3A 3NIBA 3EWSA 1LV7A 2UUJB 3H5CB 1ZM3A 3LV8A 1XJ0A 1K5GA 1I2MA 1O2VA 1UBFA 3SI4H 2ZITA 3KNXA 1AJEA 5DP7A 5FTMA 3KCGH 1VJAU 5HR5A 2OQ5A 4HDQB 3F9EA 4O0MA 1OWEA 1DAFA 2V9PA 2J5XA 5IDKA 4AKGA 1JRSA 4YM9A 1HV8A 1ZRBA 2BQWB 3FAOA 2ZR7A 1WU1A 3QSYA 4D4KA 2C78A 2QQ0A 1PQAA 4ISIH 1DAMA 3GCHB 3UOUA 3QOFA 1SVOA 1OH7A 3T1TA 5T6GA 1D3DB 2GZ9A 1OYWA 4Y6DA 1KI2A 4NONA 4NU0A 1XTSA 2FMXA 3UMFA 1GVLA 3QIAA 4Q48A 2ERXA 1N5KA 3U3MA 4V02A 2ODNA 3SN8A 2GETA 4P4SB 1IQKA 3ONWA 4BFTA 2IW3A 2R8RA 2B21A 3A86A 4XSKU 1XFAA 2VF7A 3EA8A 2XYAA 2QN5T 3DMDA 1E9BA 4BGDA 2AIPA 2GHIA 3HK3B 2BBOA 2RGCA 4QGFA 3ZZ3A 5GNDA 3W8RA 2ZHDA 2BMEA 1YHNA 4S35A 3QKRA 4CEJB 1U8YA 3DA9B 4C7OB 1ZLRA 4A15A 4INLA 1S81A 4NPHA 2VIOA 1ZPBA 2NTYC 4I8HA 1ZYOA 4Q7JB 1EG7A 2Q9AA 2QV1A 1TOCB 2Y82A 4THNH 2AN9A 2FYQA 3OFNA 2XBYA 1GDDA 2SNWA 2WKPA 1FQJA 1DAEA 5AWFC 1QG4A 2YWEA 4D9RA 1IQJA 2ZRCA 1FNMA 1G9IE 5FUWA 3WMFA 3W6OA 2WWGA 2ZE8A 3SBDA 1M7BA 2MSCB 3AVQA 2AK3A 2A4QA 2VGCB 1N8OB 3RC8A 1Q12A 3RXOA 1C1QA 4B34A 3MMGA 3KZ1E 3BTGE 2BD8A 2G3YA 3RS0A 1YKTA 4LYAA 1AE8H 1OYTH 3UQOA 3OIYA 2GAAA 1Q2WA 4FN5A 3CH4B 3U61B 5L2YH 1TNGA 4U02A 1X1RA 2ZPRA 4Q2KA 2PLFA 3SNDA 1OFIA 3RXKA 5A8YA 4Q1EA 1YZKA 2BX4A 3LJJA 2WUBA 1DXPA 1WQ1R 1XX6A 1U6QA 2IA5A 1QR3E 4I8JA 1EOLA 4A1TA 5H4IB 1JR3E 1O2UA 3AAUA 1MAXA 2GJKA 2V55B 3BRWD 1GBHA 1SGRE 1SHHB 4DB2A 2O8MA 1ZD8A 2XX3A 2R2MB 3RC4A 3ZVFA 3TR0A 2RHMA 1UK2A 1V2PT 1EWRA 5J4QA 1RRCA 1CKEA 4WMDA 1C1PA 4LOYH 4Q19A 3E70C 1XEXB 3P8OA 1HCGA 2FX4A 2FNAA 4MA4A 4TLEA 5GWZA 1TADA 3A84A 3EYDA 3RU4D 5DKMA 2G00A 1WCZA 1QB1A 3U3RA 1TGCA 4OS7A 3SYNA 2CK3D 4UXHA 2LKCA 1SZPA 2NO7A 2BD5A 4HUQA 3K0FA 5EOKA 4WXVA 2VRWA 3IPYA 3U7EB 3ATWA 4YDSA 3V00A 3NG1A 3CNNA 4TQAA 1KMQA 1Q57A 2IXFA 2VB0A 4YZUA 1GL9B 5JSZA 2Z4RA 1C9KA 4EQ6B 1OIWA 3F8TA 3QBVA 3A1TA 4DLYA 5L6NH 3Q76A 3QGJA 5G41A 1LHDH 1V2KT 1U9IC 3OEED 4L15A 3LU9B 1GBLA 2QAAA 1AM4D 1KSGA 3TKLA 4I32A 4K1TA 3T34A 3PLPA 1WYKA 2ZDAH 3W3ZB 1WXRA 3N2EA 1UO6A 3I32A 1MD7A 1ZJKA 1XP8A 3OZXA 2XNDD 5CHAB 1PLKA 4PSVA 3BEFB 2VWNA 4QT8C 1DLKB 1U0JA 4BPBA 1T3LA 2WPDD 2F1JA 2YWGA 1GRQA 1N5JA 1PZNA 4O2LA 2ASUB 2JKHA 4MLFB 2B92A 3HDTA 3RNLA 1Z47A 4QKQA 4KSBA 2ZGXH 3EASA 3FFBA 4BFYA 4CDGA 2VSOA 3ASYA 5HMAA 1O5CB 3WP1B 2VVUA 2BLVA 5FBRB 4O9VA 5HCNA 1BMMH 2IYYA 1AZSC 3EXAA 1KYIA 4CW7A 1RVDA 1SOZA 1KOFA 2FGJA 1O33A 1OXSC 1SXJA 1OWIA 4HB2A 2IHBA 1EK0A 1G4AE 4PZZA 2J95A 5LPEA 3F0TA 4HAUA 2XZLA 3I5XA 1DWBH 3GJ3A 3RS5A 2PFEA 2PGBB 1LHCH 1JEEA 3FPAA 2ZJ2A 1GGDB 1ACBE 1XTKA 3KL4A 4E06H 4SGAE 1QVRA 1ETSH 3T25A 2PKAA 2FOAA 1W0YH 1OHHA 1CLUA 3NDBB 5L3QB 3HR7A 2YWHA 4Z1MD 4WWYA 2JEOA 4CEHB 1F2TB 2ZHEH 3F3YA 3QXHA 1KSNA 3RSLA 5EJEA 3T26A 2WJHA 4O03A 2JLUA 3K09C 3QI2A 2AMDA 2PTNA 5HM2A 2PL3A 1C1MA 2WYJA 1SVSA 4BLTA 4ASUD 3TNFA 1YPJH 3A1VA 3ZV9A 4B6FA 1TPSA 4MITA 2F9UA 2HNTE 3DD2H 3GCTF 3U8OH 2HT1A 2O8BB 1LVOA 3WBJA 2ZAMA 3ZZBA 1XEFA 3L33A 4PPFA 4G1UC 1QHHB 3B23B 2QPTA 3D31A 4I99A 2JLVA 4PAQA 1JBKA 4ASUA 4HEJA 1G291 2WKRA 3S69A 2IJOB 1WTHD 1CXZA 2BD4A 2CDNA 1Z0IA 4DB4A 1Y5UT 1C5ZB 1E6CA 3TVTA 3U8TH 1F92A 3GEHA 2KSQA 1KXAA 2O8CA 3K8YA 2GX4A 2ZNKH 5CIQA 1TL7C 5BWMA 2BLQA 2EYQA 2PLRA 2PR3A 1UTQA 2RDLA 3M7QA 1K8RA 1U8AA 1GBMA 4URWR 3A8DA 1QHSA 1AQ7A 1OSSA 3DL0A 5EXPA 3VHXA 1R5BA 1FQ3A 1OW3B 2ZFSA 4KVGA 4R8TB 1ZRKA 3RXRA 2JJ1A 2IYVA 2Z94A 3VR5A 1P06A 1DWEH 2GEDA 2A78A 3VR3A 1AVWA 3NBXX 1OP2A 2ZDVH 2QA9E 3EZ9A 1T5LA 4TSFD 3UREA 4C2UA 1KMHA 1NI3A 3MHWU 4TMKA 3HPQA 3T5GA 5KSZA 4CH2B 2H7VA 1TRYA 4DCTA 4QNRA 2NO6A 2IS4A 2RA0A 3F6UH 1XUIA 4G5SA 1E35B 3GD7A 2IEZA 1VMAA 1HT2E 4IDPA 4DCVA 4DW2U 2ANMH 3SJ8A 1FY4A 2ZRJA 4D4MA 1L1GA 3CKLA 1W36D 2WV9A 1N2CE 1DOJA 3P70B 2MSDB 1NBMD 1O2TA 1GDUA 3QPWA 1YCPH 2BD3A 4CF7A 4DURA 3O47A 2SGPE 3ATLA 1O34A 1YZNA 2BD9A 3ZVCA 1SGTA 3RXAA 3KJIA 3U4QA 2BDYA 3SJ9A 1RW4A 3BSQA 5C4GB 1NC6A 4M9QA 3SO3A 4B1TA 3BTDE 2WWIA 4IFBA 1ZSLA 1Z1JA 1K5DA 4JZ1A 4JL5A 1IY1A 7GCHF 3Q5EA 3LBHA 4LJ5A 2QY9A 3NBZC 3SJIA 1GFIA 8LPRA 1YKSA 5ABWA 1BITA 2ZR9A 3QKRB 2DFNA 3ODFA 1BH2A 1GBKA 3MFJA 5C18A 1P02A 2ZRGA 1JECA 5AF9H 3JZAA 3ELAH 4GUXA 4Z0KA 1G5TA 2IUSA 4C30A 2ULLA 2CCJA 1VCOA 2EWVA 3KF2A 3RAPR 3RLFA 1O2MA 4A0FA 1FV9A 1CT0E 3EZ7A 2XNIA 1XMVA 2BQ7B 2VHQA 2QN6A 4HAZA 4OK3A 2FIRH 1JAIA 4O2RA 1GBFA 1CTQA 3PEUA 1P01A 3PUXA 1QBKC 4PQRA 4EFLA 3TH5A 3SYKA 1YPKH 1P05A 1FN8A 3TGIE 3MOCA 1KLJH 2W6ID 2PEZA 1G8GA 1DSUA 1N6OA 2Y81A 5DGJA 2BV3A 1ZZZA 2C9OA 4RVCA 2FPKA 3HK6B 5DO4H 1A1VA 5C1BA 1UBGA 1S84A 4FINA 2V8OA 1J9CH 2F3RA 3IKJA 4RSGA 5DH9A 2BDCA 1O3NA 1HTWA 4UD9H 1O5GH 3C16C 2BHGA 1V2NT 1O3BA 1IHSH 4CRCA 3EDXB 5JCZA 2ZG0H 4X2YA 1MABA 3A7WA 2JCSA 2PMDA 2ZFTA 1M9UA 2BEKA 3DOEA 1P73A 2PT5A 2W58A 2YOLA 1AKSA 2FZLA 3E1XB 3TW8B 5JB8S 2B8TA 3FMOB 1S3GA 2EI8A 3CZQA 4Q80A 5J4SA 2G1KA 3GQBA 4UFDH
chains in the Genus database with same CATH superfamily
1V1MB 1TPYA 5K51A 1I51A 2XXLA 1PUIA 1Z29A 2BKAA 2SKEA 2ZWPA 4PTZA 2ZAGA 4YP6A 3TG8A 2BF4A 3KT8A 1M1YA 1ESCA 3L49A 3PXGA 3SDZA 1BDAA 3PYHA 1VSQA 2JH8A 2PUFA 3O4HA 1UVTH 1WKBA 2VC2B 1C1RA 3X1YA 2QP3A 4LRYA 4X66B 4DA8A 2XXBA 1A2QA 2BX3A 3M9XA 2BSAA 3DFZA 3JQCA 4KPGA 1DITH 2CL0X 1PNTA 2PVSA 2XVMA 3O1HB 4YTEA 4MGZR 4Y6QA 3H4TA 2V3CC 3S7ZA 2ZUUA 3LSYA 1BDBA 3DUXH 1P2TA 3VOBA 5DP9A 4DA9A 5C5NA 1LA2A 5IT0A 3DL4A 2STAE 1DMSA 2HI0A 3ANXA 3A83A 4QL3A 3U6BA 3SGQE 3F5SA 3LUGA 3E90B 1M34A 1C9PA 5GCHG 1UH5A 1XD9A 2G9QA 2OCYC 1S4MA 8ATCA 2A5FA 1L4HA 3IAAA 4WINA 3NCLA 5BT9A 4BB6A 1IQGA 4U5QA 2TMGA 1RPZA 2UVDA 4OBEA 1D6MA 1UOEA 5NLLA 3RANA 4WN9A 1R7RA 1PJ3A 2QTAA 2UVQA 4M1QA 1U4SA 1H42A 4XCXA 3ZUPA 3QEMB 5IG2A 4JLJA 5EHQA 2PZLA 1G8SA 3UMMA 3WHLA 3DE3X 3IT3A 3STHA 1U0GA 2LBPA 3C14C 3VHLB 3EA0A 3PX3A 1QH8B 1ES9A 5HKLA 1U8CB 3WRYC 4BDTA 2QU8A 2UZ4A 1JP7A 4M8NE 4L75A 1XWIA 1BH6A 1RNLA 2C5GA 5FUYA 1TTTA 1BCRB 5FAKA 4LNHA 1HV7A 1TQ8A 1A04A 1H1BA 1UL1X 5BV0A 1SD5A 4WN3A 2WYUA 4B2AA 1R37A 3AXTA 4ZAEA 1LC3A 3LUPA 3SJ7A 5HJEA 3RJMA 2PBFA 3F4BA 1MB2A 1I1OA 4YX9A 3YASA 1RRVA 5ETJA 2IOFA 1KMNA 4D57A 1Z13A 2AZ4A 4R2JA 3EIEA 4EW6A 1YYY1 1JH8A 2Q6FA 1X8KA 2P68A 3ABZA 1NJ1A 3C3KA 5E4TA 5CA1F 5AW2A 4HKTA 1US8B 4J2YB 1M54A 1UOQA 1GL0E 2I7DA 5B3JC 4H6SB 1Z2PX 2BZ0A 1IIBA 3WFIA 4MWOA 1WUNH 2XI4A 3R8CA 5JV5A 1G66A 2HRQA 4TOIA 3X43A 1CU1A 2D00A 1IQRA 1WMDA 4W8GA 2YYSA 3ENKA 5JO0A 3KR0A 1C1WH 3QLEA 5EIYA 2AEEA 1MW8X 1ZIDA 1ZTKA 2CBXA 3RIYA 3TQQA 1AHNA 3GGCA 3NHMA 2VSFA 1S6FA 1NG9A 2N46A 3PRJA 2C3SA 2CXRA 2PCJA 4PX5A 1YS7A 3D0RA 2QRQA 1HAVA 3HCEA 2CXUA 2BSXA 2QY0B 1XHLA 3NTVA 4G5QA 5ARDA 1EEHA 2G9NA 3HEAA 3E2IA 4AN1A 1MQ9A 2O7VA 2VPTA 3JQBA 2O8EA 3ROKA 4UEOA 4Z86A 4EHFA 1JXMA 1WBDA 5DK4A 4G5XA 1M5TA 4BWYA 5K0GA 2BH2A 2B4AA 2WFAA 4AZ2B 1RJDA 4PIMA 5DM1A 1K0UA 5K3OA 5IWAB 3JQAB 3OZBA 4JODA 1GTSA 1P1RA 4D76A 3GYBA 4ABJA 4MB2A 1V2RT 4D80A 3UC5A 2MU1A 4BKMA 4RKQA 1NPYA 1OB2A 3ETNA 2WYGA 3BULA 4INOA 4D26A 1P2SA 1IOZA 1JHPA 4X1OA 3RHTA 4Q9HA 1L1FA 3VZPA 4RTKA 3LOXA 3UGJA 2RKWA 2P2YA 1CUIA 1WHSB 1ZJDA 3FO8D 4LZAA 3TQSA 1P1HA 1S8NA 2WDPA 3H13A 4KO3S 2W4QA 3MNSA 2UUYA 1JQLB 1NPDA 1CULC 1VTKA 2DZDA 3VZSA 3PWSA 5J4YA 4OX9B 5ECYA 2H8GA 4ZKDA 2HQSA