1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
molecule tags Hydrolase
source organism Hepatitis c virus
publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
4LGMA 1O2TA 1SXJE 4BFUA 4YT7H 1GM5A 1U0LA 2WKPA 2NPIA 1Z6EA 3R8FA 2XJ9A 1C2EA 2O5VA 6LPRA 4EFNA 4D7FA 1BMFA 1ZM4A 2QENA 4TYDA 3KQHA 3PROA 1DPFA 2BDBA 1OH5A 3SHCH 1Y3YA 1Y8TA 3NBZC 3NG1A 3QEOA 2ORWA 4AFZA 4BQSA 2ZI4A 1W44A 1MTSA 2J3EA 1R4AA 2J1LA 1HJAC 4DLYA 3LGUA 5F8TA 1R0YA 3DKVA 3FGNA 4FCWA 1K5DA 2ODYB 5HM2A 1Z47A 2IUTA 2FESH 2C04A 4AB8A 1YQTA 1HUQA 1AM4D 1KMQA 2ZFTA 4MRNA 2PH1A 1ODFA 3D65E 1C1RA 4A15A 2XTMA 1TNGA 4ZKDA 2AYWA 1W0KA 3OU0A 4A0RA 2G00A 4KSBA 1ZGIA 1CRPA 2O8EA 3EZ9A 3ADBA 2G8TA 4AG2A 3L0IB 3BBPA 2HJGA 1VECA 5DPAA 4YXWD 4B76A 1MZDA 1C2FA 4DCVA 3AASA 1CEEA 3CNNA 4H9GA 4I1SA 4JLKA 3GJ5A 1HTWA 4ITRC 2A5KA 2ZDNA 3CNOA 3UK6A 1OWKA 4IEIA 1OWHA 1L2EA 4PZYA 2R0KA 1GJ8B 2AMPA 4A0GA 3EARA 5HXFA 3QY0A 5LD2B 5KUTA 2R65A 5AFZH 4PSVA 1C4OA 2ORVA 3WHLA 1CU1A 3ASYA 1V2PT 3SGAE 2XITA 2BMEA 3TIFA 4HB3A 4UEHH 3BB3A 2QM8A 3KQCA 1TQ2A 2C9YA 3A7YA 3LDAA 2V35A 1MCTA 4NCHA 2G88A 3V13A 4BAHB 4BGDA 5TCCA 1P4SA 2W2XA 4LJ8A 2BY7X 4AYVB 2WUCA 4F4OC 2REOA 1L4UA 2QIQA 1QDEA 1VHLA 2JDID 1RJ9A 4BWYA 1PVOA 1ANBA 5L2YH 1YR8A 1MOZA 2AMDA 1TQ4A 4JL8A 4Y7AA 2AX4A 3GJ0A 1FN6A 2B5TB 2WBLC 4SGBE 3CB4A 1O3YA 3GLGA 1S82A 4TLDA 3IKJA 1E6CA 3U44A 1K1OA 3SYNA 4ZKRU 2O8UA 4OJKA 2REBA 1OHHA 5E7JA 1HDTH 1ZM7A 4G5RA 5DN6D 1ESAA 2QN5T 2IWHA 1JQLB 1SR5C 2ZI9A 2WV9A 3RSOA 1O2YA 1ZBDA 4IJMA 4Y8ZA 4YQFA 2CHAB 2Z7FE 1SBWA 3CRW1 1NRSH 1R0WA 3B82A 3K53A 1HJ8A 4TZ0A 4ARZA 2CNWD 4QJ4A 4INKA 1GRRA 2B8OH 2AK2A 3S0NA 2P0EA 1SSXA 3UMRA 2JLYA 3T5GA 2N46A 4OGYA 1E9AA 1W5TA 2WKQA 1U9IA 1Z07A 1VGCC 4NYJQ 2ZR0A 4EKDA 4B2BA 4VGCB 1E9DA 2VH6A 2H57A 1P9NA 1C1SA 1L4DA 1GGDC 1QHYA 4PO8A 1SGPE 3HR8A 1PUIA 2MMGA 1FIZA 1GHAG 2BVXH 2H9TH 1W1WA 1RIWB 4K1SA 2Z6BD 1G41A 5C2JB 1GILA 2JLWA 4XSHA 7ESTE 1MBQA 2QZ4A 1KI3A 3C1KA 4Q4JB 3KB1A 3THWA 4MGKR 3EGKH 1CJUC 3LJOA 2OEPA 3SV9A 3D31A 1LV7A 4EPRA 1XCMA 2A7CA 1O5FH 1I4TD 1R0XA 1TADA 2BVRH 4ON9A 1FNIA 4FMDB 2WWWA 2IW3A 1Q44A 1N3BA 1GHXH 3OHMA 3UUZA 3G01A 3KGPA 4R71A 5JBTA 1ZRBA 1NJFA 4PXAA 4CRWB 5AF9H 2FYRA 1ETRH 1QJ7B 5EE0A 2GGVB 2EI6A 1I2MA 1IQHA 3SU1A 2OZEA 2ZHFH 2Z94A 3QG5A 2ZI7A 1FY4A 1C4V2 2C8WB 3EC1A 1EX7A 4LJ5A 2WKRA 4QM7A 1XCPA 1J70A 1FP6A 2V3CC 1TUEA 2QA5A 3BSQA 2Z4SA 1ZJ6A 5HZKA 1GHZA 3Q72A 4QBIA 3TUJC 1T3LA 5LB2A 2Q6FA 1C1TA 1UDWA 2XBWA 3T1VA 1RVDA 3IIJA 1Z6XA 1VJAU 3ZZ0A 2UZ3A 3ZZCA 5GCHG 2OO7A 3B5JA 2XSZA 4HDCA 2N1BA 3UR9A 5AJWA 1TLDA 4I8KA 1KI1A 1XMVA 1XPRA 2B8TA 1C5TA 3UG7A 4C0HA 1G32B 3K0CC 1ANCA 1A2KC 4CR5A 2P65A 3UIEA 2BD2A 1CQQA 4JSTA 1U9IC 2EYQA 5DI3B 1MO5A 1ZIOA 4RD2A 2BHGA 2DB3A 1AWHB 1ETTH 3MJRA 2C4FH 1E9EA 2DFKB 4K1EA 1QZXA 1T5IA 2FDCA 1KI8A 1FUKA 1S3GA 1XMJA 3A8CA 2PX0A 1UF9A 3BG4C 2A2ZA 4PAMA 1HE8B 1O3EA 1SULA 3MWLA 1UJ1A 2PZFA 1TPAE 1XTSA 1E99A 1A5IA 4I99A 3JZ1B 3E3TA 2Y81A 2QL6A 2VL7A 1ANEA 3ZYEA 1NRNH 3MNCA 1LPGB 1C1MA 5AHGH 1ABIH 2VP5A 1TMUH 3LX5A 4KJZA 4GI7A 4XVQA 5F9FA 4UJ3A 2A78A 2B7DH 2FLBH 2FOBA 3B1WA 2JLUA 3E0PB 1C1NA 1C2JA 2ULLA 4I7YH 2AD1A 4P32A 3BIFA 3SYJA 3GY6A 2A2QH 2O0HA 1DXPA 2P6UA 2BYAX 4WIAA 4M9XA 1MD8A 4Q9IA 5CB6A 4PHTA 3EAJA 1CJTC 4D0LB 4I8HA 1MQ5A 4LY6A 5KDLA 4Y0VA 5FUWA 2BM2A 3HK3B 1IOEA 2OLGA 1W14U 2VP9A 1FUJA 3GCTG 3SUEA 1E2QA 3P17H 3OIWA 3QPWA 1BH2A 2HNTC 1N6PA 3VQTA 3O8RA 1L0ZA 4YM9A 4ZXYH 3TR0A 1GMCF 1JB1A 5L30H 3V4RA 1ZUIA 2ZRAA 3RU4T 5FX5A 4HAXA 2D4HA 1S6FA 3CENA 2FTLE 2IYTA 4AYTA 4KTUA 1V3XA 2FSHA 1LKAA 3V7TA 1V2QT 5L3SA 1OPHB 3BV9B 2W7UA 2HLDD 2QV1A 3P4YA 1JALA 4NA9H 1JI0A 4JL6A 3A8DA 4D80A 2QNRA 2ZTSA 4LWZA 2Z3DA 1QR3E 3DHWC 4NSYA 1T32A 1ZD1A 3ZVGA 1CLUA 5CJPA 4V0OA 1G9IE 2HXYA 1CVWH 4OK6A 1BUIA 1B5GH 2PT5A 1U94A 2ZUCA 2ZDAH 3EA7A 1NN0A 2FZ4A 2PKSB 3SBDA 4BLOA 1NIPA 4B3XA 2TPIZ 4YDHB 5EP2A 1YRAA 4NCJA 4B2CA 4JLAA 1G4AE 4ACBA 5J4LA 2Z9LA 1O37A 2G9NA 5SGAE 2STAE 3FP6E 2ASUB 4ZI3A 3KF2A 1TU4A 2QT1A 1TIOA 1QB1A 2QSYA 3ZVDA 4MUBA 5A8ZA 4ZCIA 1R5BA 2BD4A 1D3QB 1KTSB 2IA5A 2FX4A 1C2KA 1P73A 1JXOA 3QTOH 2W58A 5TY0A 4QHYA 4JLMA 2SGFE 4KI0A 2A4GA 4LOYH 5KU1A 2G1JA 5JLJA 2QAGB 1GDDA 3OEHA 1TRYA 2WIBA 3WNBA 2VF7A 1YLCA 3AP1A 2ZTZA 1SGYE 4ZKEA 4B32A 2CJWB 3T1OA 2WPLS 3OF5A 1L2TA 1T3SA 3NEYA 2VHQA 2PGQB 3TGKE 4YMSA 4MKIA 5JEEA 5KO2A 5JS7A 3NDBB 1KY3A 1H9IE 2KE5A 2C9CA 1QA0A 1P9SA 3W6OA 2YOHA 2V1UA 4ESHA 3URCA 4RKEA 4G01B 1V6DA 2ZHWH 1RRCA 2ZROA 3K70C 3WNCA 4URUR 1J15A 2XZOA 4AFUA 1VG0B 1S1MA 2WTUA 2JETC 5TARA 3REGA 2QXIA 2CF8H 1QHIA 1KAOA 5AWFC 1GJAB 3HU3A 1ZD9A 4FWIB 1J7KA 2FS9A 1LHGH 2J0QA 2WOOA 1XX6A 4B3DA 2ODWA 5IDVA 2WWYA 3SU4A 3F9FA 1E2EA 2FU5C 3RXLA 2GCHF 1GBFA 4TQAA 1NBME 1KDQA 4MNXA 1D9ZA 4YXWA 3ZVRA 2YWEA 4MGYR 1G19A 2KWIA 1RRPA 3ATLA 2WMNB 2XXAB 2IWRA 3HPQA 4AKEA 2ZYWX 3K0FA 1G8HA 1HV8A 2OESA 5DO4H 4X8UH 1UADA 1FQKA 1C5NH 5TCAA 2QQ0A 1DFPA 1YBWA 1BRAA 2RKOA 2V55B 4MKHA 3AVXA 1GKIA 3KDSE 4F93B 2DFLA 1QBOA 4A8JA 2IC5A 1A1RA 3T35A 1EFRA 1X8KA 1GI1A 3M7QA 2GAAA 2ZHQH 4J1YA 5AJXA 3QUSA 1F0SA 3NK8A 2NO7A 4JK5A 2CL0X 2ZJAA 4JLBA 2HLDA 3T06B 1FDPA 2P8OB 1P9UA 1NN6A 1LVBA 1SGFG 1J99A 3DL0A 4WZBE 4RZXA 5EZ5A 4NYMR 1QQ4A 3U5ZB 2AGGX 1O2JA 1DLKB 4EIWA 1RTLA 2FX3A 1A3BH 1GNPA 1W47A 1DAIA 1H8ED 5JHGB 3IWMA 5FBRB 4NYJR 1WA5A 2ZU3A 1F5NA 4O0MA 2SGAA 2FI4E 4CDGA 4CVNA 3H5CB 1Z8JB 1Z5ZA 4CRAA 4MKGA 1ZNXA 2J41A 1GHBF 4JLJA 1C1WH 1XD2A 4QKQA 1FFHA 3SN8A 2Y7ZA 2OUAA 1YR6A 3IO5A 2I3BA 3K0EA 1JJVA 3RXSA 5A8YA 4B3FX 2OBMA 3VMFA 4ABJA 1OKKD 3JVVA 8LPRA 1G6OA 2O8CA 1VJ9U 3LKWA 2JH6D 4ABAA 2BD9A 4Q00A 3AH8A 4V0KA 2H8KA 1OWDA 2CHVA 1BHXF 2DFTA 2RA3A 1O39A 3ADCA 9LPRA 4KELA 1SXJC 2F9OA 1SKYB 4KV9A 1ZNZA 2ZFRH 3RSLA 4HB2A 2AFIE 3V12A 1FAKH 3PG5A 1QG4A 1DITH 1BMNH 1Z63A 2ZDVH 4F49A 1UVUH 1MKWH 3EA0A 4KLZA 1GWAA 4M21A 2IX3A 5F9HA 2G81E 2DE9A 4C0JA 3RLYH 1A7JA 1KO7A 1ELCA 3ZZ9A 1J14A 4D9QA 4AI6A 2YWFA 3ZVLA 1P72A 4HLDA 3GLFE 1ETUA 1LHDH 3UMSA 1K1LA 2FI5E 1O2ZA 4OQXA 3PTNA 3ECCA 2ZPQA 4A6XA 2XX3A 4Q7JB 3K9XB 1II8A 2Y82A 1SI5H 1G291 2OFOA 3BTTE 3DZDA 5KYKA 1AO5A 3EIHA 1TNDA 4LJ9A 3RS4A 1S8FA 2ZSFA 4WJG2 3GLIB 2EQBA 2FV8A 1O2LA 3QGNB 1E2HA 4YT6H 1RPZA 1JECA 2IN2A 4NONA 1AQ7A 1T3HA 5EQTA 4IVQA 1WDTA 5IYTA 3Q9LA 1KSFX 2F1IA 2Q0HA 4HI0E 5ELXA 1SVIA 2GK7A 4LV8B 4VGCC 3I8SA 3TJOA 3SHFA 2J4IA 3L8ZA 1G8FA 3RS2A 3OZXA 2GT8A 1OXVA 1GUAA 1MR3F 3A4LA 1VYVA 5C20A 5C5OA 1KI2A 4IEEA 3REFA 4EJSC 1VCMA 2B6HA 3EW9A 1G2LA 1HAOH 4YESB 4JMYA 1THPB 1KI6B 1JR6A 3W3ZB 4ISOA 1DUEA 5DISB 1DVAH 1TNIA 4FUFA 2QROA 6CHAB 1YZGA 4AGJA 3WXMA 1WUNH 5JYIA 1XX9A 1E38B 4LBYA 4AG5A 3CW2A 3PCRB 4IDPA 1QHGA 3TSZA 3MAAC 1DLEA 4WBSA 4ZXXH 1UVPA 4HTCH 4HEJA 2RGAA 3PM3A 1MT0A 1FW6A 4QG7A 3EA5A 3KXIA 5HKKA 1Y3XA 2PUXB 1F2SE 1N1LA 1WTHD 4GDFA 1QCPA 4BRWA 1TPPA 1AFEH 3FMPB 4NG9H 1XEXB 5EP4A 3E16B 2PCLA 4XD7D 1BBRH 3NCLA 2IYWA 2R2AA 2XOKA 4UNRA 4HUQA 2AKYA 4IC6A 4OI1A 4RD1A 4AYWA 3V4FA 3BB4A 5F98A 3U8RH 4I8LA 1OXXK 3OAAA 1TQ7B 2ZS7A 1N8OB 2BBWA 2J0VA 3VTKA 4DXAA 1XXDA 2C96A 1NC6A 4AG6A 3B23B 4UFDH 3EQ0H 3B7GA 3CR8A 4PC3A 1EASA 4K8OA 1US8B 2YNAA 4LHXA 4BRUA 1C2HA 2OLJA 1Q1EA 3P8FA 2P3SA 2J0SA 1RGQA 1Q1BA 1EZQA 4U00A 3QKTA 5EE1A 5AJVB 1QRWA 4INLA 3ZZUA 4NA8A 3IEVA 1TALA 1A0LA 1U99A 4CRFA 5EUQB 4TZ6A 5EQSA 4ABDA 1R2QA 2BDTA 4DB4A 3U7GA 2FOCA 5CDFE 1ZP6A 3EE0B 2Z6VA 4PQRA 4ISNA 1JXPA 5AUPB 2VIQA 5JZVA 3TSOA 2B9LA 5FL7A 3SEAA 1SXJD 5FBQB 4YTAA 3WMFA 2IS2A 2P3TB 4ESVA 2QP3A 4ZDKA 5G41A 4CEIA 2IYQA 1A61H 2HJVA 2AGEX 3BIVH 1AS3A 3LH5A 3QGJA 1GCTB 4BFWA 3M6AA 2O8CB 4URYR 7GCHF 3BTDE 2WWFA 1OF1A 3QX5H 1YKSA 4A82A 2C78A 4BASA 4LJ7A 2V4ZA 4TY7A 3U1IB 2V3HH 3Q3YA 3TPIZ 1VITF 1LO6A 4FXPA 4RCYA 2O8BB 1D6RA 1WCZA 1GWNA 5T6DA 1MTNB 2XTNA 2ZAMA 1GJDB 3RMOH 4B47A 1SFQB 3RABA 2VGCC 1UDXA 1NIJA 1CJVC 1F2TA 1C1YA 5DJ7A 4L4UA 2HVXA 2PWXA 3MH4A 1O3JA 3P95A 521PA 2GWHA 2OCPA 1IHUA 4NYIQ 1JOUB 3UPUA 4JL5A 1D6JA 2MSDB 4HZUB 1GBLA 4UNSA 2FEQH 3RDZA 2GBLC 1K8RA 7LPRA 4X6MA 2Q21A 1ETSH 1UMAH 1IY1A 3FFBA 3K09C 3P20A 5BW8A 2G5VA 4LYAA 4D9RA 1TBZH 3H1TA 2TRMA 2ZF0H 1Q0UA 2B8WA 2ZVQX 4MDFA 1NT1A 2PJRA 5E0GA 3ELAH 2CK3A 2YKGA 3T27A 5A5GA 1CHOG 1K1JA 1PUJA 4AYYB 2GMTC 4A5TS 3KJIA 1HRTH 1OXUA 3RS0A 4DLVA 4MNWA 2PT7A 2GAOA 1LHEH 1E2DA 1OKXA 4DC9A 1GI8B 2ZEBA 3PV2A 2ZI2H 1HAXB 2AEIH 2GBLA 3TUZC 1FQJA 2W3IA 2FA9A 4NU0A 4TL9A 1KKLA 4RCZA 4ZKNU 5PTPA 1M2OB 4ARZB 2JATA 5TB5A 1T6NA 2JLVA 1O2SA 5C46F 1BZXE 3A1UA 4TPYA 1FNMA 1S3SA 4JJKA 3T1QA 5P21A 1CT4E 3G0HA 3PLKA 2J0UA 1NBMA 5FUYA 1HYQA 1TRNA 4B2LA 1O3MA 4O3TA 4MRSA 3K0FB 2FOLA 1PYTC 1S81A 3OY6U 5EQQA 4DT1B 2YYZA 1QRZA 3ZLJA 2D3WA 5EXTA 4ZAEA 2JASA 1IAUA 1TNKA 5GJBA 1XUGA 1N0VC 4E7RG 2PSXA 2EFHB 3X2SA 1FY5A 1SHKA 3FWYA 1LY1A 5BN4A 1W2KH 1SGIB 3MCAA 3ATKA 2H18A 2HRVA 2QMHA 3HP1A 4ZI2A 3ASZA 5CITA 5BN3A 1GG6B 2F3CE 4AURA 3A80A 3QQ5A 4Q19A 2PLXA 2BOKA 3AF3A 2FZZA 1Z08A 4TWWA 1BKDR 2LCFA 2Z9JA 3GLHA 3FHCB 1KSNA 2ZFPH 2ZU6A 2NO1A 5LPNA 4J0QA 4EQ6B 1M1YE 2FZLA 1A4WH 3M4YA 1PPZA 1IQKA 1OWIA 4Y7BA 4QJ5A 4C2UA 3AK5A 3FOZA 1RRKA 1QRAA 3VNVA 1GHBG 3EASA 3HPTB 1F3OA 1UTNA 5IDKA 4KFSA 1US8A 3EIEA 3AKEA 8GCHG 5EQRA 2A7JA 1KKMA 1YGCH 3M35A 4LCBA 1N6XA 1AI8H 3LBNA 1GI6A 1T7CA 4DKXA 3ATMA 2C9OA 3SFZA 5GADl 4ZHMU 1W4AA 4W9MC 2C8VA 4QXAA 4F38A 5BPEA 1GJ4H 4DCDA 1C2MA 3A83A 1TNHA 4R0IA 2P5SA 4GUXA 3N70A 1MKXH 1JPJA 3AVVA 4LYJA 1BIFA 2DE8A 1TGBA 2R6FA 2HNTF 1NU9A 1EFRD 1KAGA 4ZROA 1SVLA 1RC8A 1G2MA 2H17A 1ABJH 1INCA 4PQYA 2EWVA 1GMDG 2ZPSA 1GBBA 3CS7A 2C8YB 1BMAA 1XZPA 2ZRDA 3T25A 3GEEA 2UKDA 3SJKA 2BKEA 3W5IA 3GDSA 4M53A 2C99A 2OXCA 1C1VH 2NO9A 3IHLA 2ZI6A 4TT3A 1KK1A 1ZUHA 4WW0A 1NRRH 1O32A 1AFQC 2UUYA 5EOKA 3HATH 5EPYA 2A31A 4DIDA 3C7KA 1AUJA 2H6MA 1HAZB 1SGRE 2EI8A 3ADDA 1O36A 3BRWD 1DWDH 6GCHG 5DYIA 2H1UA 1CTQA 1B7XB 2WSMA 3ZYDA 1KNXA 2VP6A 1W4CA 3THXA 4DLZA 4Q1EA 3BEIB 3CKLA 4Q48A 2CXVA 2UWLA 1ZTJA 3LGWA 5CIQA 4Y79A 1S2MA 1XXHA 4PPNA 4LXBH 4POAA 2BDYA 3QSYA 1EGAA 2J94A 1HAPH 4OS1A 1KDRA 1AS0A 2A7QA 3OEED 4RKJB 4L8GA 2ZYUX 3VR4A 3MH7A 1NTPA 3DUXH 3QXJA 5K0HA 1ORFA 1BQYA 5C5NA 1NG1A 1M6NA 4K2YA 4GHQA 3FFGA 1O34A 3C5HA 4OQLA 5LPEA 1CE5A 4Y71A 1DAEA 1YJ5A 2VWMA 4EFLA 1L8QA 3K2UA 2LWIA 2HOBA 4G1UC 3GCHB 2Q3FA 4D0NA 3ZV8A 1P02A 3PMBB 3GLIA 4NDZA 2CHGA 4HGCA 1GIAA 3OX7U 1BJVA 5JWHA 2A45B 1N0WA 3DD2H 2AWOA 1XXHB 4R2IA 5EG4A 3SU6A 1P2MA 1I4DD 3RM2H 5EJEA 4DG4A 4A0HA 2P93A 2YOGA 1C9PA 2TGDA 1P01A 1ESMA 4YMWA 5H4IB 1IQJA 3LAWA 1AS2A 4ZDJA 1KXAA 2FODA 4IW3B 3NUMA 5DKMA 2WSSA 3L3TA 3LC5A 3PUYA 4IW4E 4DW2U 5CB8A 3B9PA 1GFIA 1WBDA 3U6BA 2GXQA 1C2GA 1TNJA 2PTNA 4KVAA 5FTJA 4XBBA 3UXMA 2UUFB 1ZU4A 1SB1H 1FPMA 4IBLH 1GJ7B 2IYRA 1UVSH 2HALA 2RGDA 1KJYA 3KQKA 1AN1E 1SVPA 1EP6A 5TMPA 4H6SB 3GDUA 2Z4RA 4RJLA 5FUVA 5AUNB 3QKSB 2ANBA 2CHQA 5HZHA 1SMFE 4B44A 2OQ5A 1R5NA 1JQJC 4IFEA 1IQIA 2BBSA 4D4LA 4IVRA 4H6TA 3GFOA 4JZIA 4GOKA 4O25A 4KXFB 1O38A 4E06H 1RTFB 1G8YA 4IC5A 4CW7A 1E32A 2FEOA 1GNRA 3E1XB 1CR4A 2AN9A 2ZI5A 1UTLM 5EXXA 3KN2A 1U0HC 1G17A 1ELVA 3RS3A 1ELFA 5T6FA 2DPXA 2IHBA 3UG6A 3RXRA 1AZZA 4QT8C 421PA 4Z6AH 1FLEE 4ISIH 2BEJA 1WOFA 1Y3UA 4UFFH 4R9UC 3RXJA 2XNSA 2IYUA 1X3SA 1SLXB 2OC0A 1ZYOA 4TL6A 2WPDA 3RXOA 1N5KA 3BORA 2B21A 4PPGA 1P0SH 4A2QA 3HWSA 3W34A 1WTGH 2VNTA 4F91B 5DIFA 3SJOA 1ANKA 1E0FD 2AS9A 1CBUA 2Y7XA 3BTEE 5ETXA 3T62A 3B85A 2QCYA 5LDDC 3T29A 1RE0A 1E0JA 3CR7A 3FPAA 1E98A 1CGJE 1IXRC 3KQDA 2OC8A 1IJFA 2ZU5A 5EGMA 4XDEA 4M1TA 1O2IA 3CUEF 3BTKE 1BOFA 1FQ3A 3R9IA 1V43A 2X2FA 2EFEB 1O3DA 4MQAA 2AIQA 3BTQE 3SN6A 2QPTA 2OK5A 5JCPA 4OHWA 4U7DA 2Z9GA 1C5OH 1H8IH 1TU3A 1G5PA 1SGNE 1KO4A 4OK3A 1DUAA 1JIRA 3KKNA 1C5SA 1W49A 4RFSA 2QORA 4TLEA 3S7HB 3VXFH 1GI3A 3AVPA 3U8OH 3ZVEA 2FSIA 5KSZA 2CGAA 4OGXA 1FIWA 5T1VA 3UATA 3CPJB 1DX5M 4B3GA 1YLDA 1G7SA 5JBQA 1FMJA 4NBSA 2PMKA 3LGIA 3E90B 1P12E 1T8UA 3VNUA 3U7EB 2HF9A 1SLWB 2QYIA 1H65A 2QMUA 2OAP1 4ABYA 1XMSA 1FY3A 1RW4A 5E7IA 3PQCA 3W5JA 1O2GH 1D3TB 2X19A 3K0AA 1CXZA 4I1OA 4C0AC 1E96A 1P9RA 1X8JA 1HYLA 4DLXA 4LBWA 1MV5A 2EW1A 3TU7H 1S9HA 1ELGA 4LC0A 2BDIA 4U32A 3HYRA 2ZRIA 2C03A 5CM9C 5E2OA 3DMNA 3R0FA 2D2FA 1GBCA 3P8NA 2VYFA 1OXGA 1UFQA 1C5PA 4Q7YA 3RRMA 2RGXA 3A1WA 1SG8B 1QB6A 4PZLA 1HAHH 2BTCE 1AB9B 2PFEA 2TMKA 1YPMH 1E2FA 4GLYA 2UUJB 1FTNA 1MTNC 2PCJA 3UMFA 4US1R 4X2VA 4JT4A 1MAYA 1BOQA 2CVHA 3SJIA 1G9XA 4UJ5A 1QY6A 2GCOB 3RXTA 2GXSA 2EI7A 1DSUA 3TR5A 5C4GB 3SFVA 2STBE 4HAYA 1UK2A 4GZMA 3U9AH 2AGIX 1IXSB 2VVUA 4MDEA 1QQUA 2GZDA 3Q85A 3R9WA 1SQ5A 3SR0A 4YMVA 1ZGVA 3K9LA 1NVVQ 2RDLA 5C67A 3TH2H 4H1UA 1JAIA 4RSGA 1A2BA 4MITA 4QGAA 5C1UA 4JYBA 3TJVA 5KOYA 3A1TA 1P2OA 1NKSA 3PENA 4BAOB 4RFVA 4LDJA 2EFDB 1JRSA 1MAXA 4JZFH 4AYXA 1G8PA 2GCTC 2OG2A 4CRBA 3TK9A 2OE2A 4MG3A 4URXR 5L2ZH 2QMOA 1TMBH 1RRFA 5HKKD 4BZPA 2ESTE 1KI7A 4I32A 2WPKS 3LOXA 1UTKA 1DM4B 1O2NA 1THSH 3OFNA 1FXYA 1OHHD 4OYHA 4M4SA 2XB2A 1VG1A 1OXTA 4IXMA 4AFSA 1BMLA 1R8SA 2WVJA 3CRQA 1AKSA 3FAOA 4E07A 2ODBA 3RXKA 4CHAC 1KOFA 1YKTA 4ILEA 4Q7ZA 3ONWA 4XIGS 3HU1A 4FUDA 1A82A 3RS5A 5FR2A 1ACBE 2B7BA 4MPWA 2CF9H 1DPOA 3PEVA 4NCIA 4NIVA 4C0KA 3GCGA 5JJKA 4JVLA 2AR7A 5GJCA 3H0KA 3TLXA 4DZZA 4Q7KA 1ZZZA 1YU9A 3DA9B 1IN5A 2Q3HA 2W0SA 1RD3B 1DBSA 4JVSB 1N6RA 2XWBI 5KSYA 1UEIA 2A32A 1TWXB 1T0HB 1ZINA 1P03A 4GSYA 1JBUH 3CF2A 2GZ8A 1PPFE 1W7GH 3C16C 3GPLA 1Z22A 2W6ID 4DDWA 3S7KB 1T8OA 4EPYA 1W2GA 3TH4H 4K5ZA 1ZRHA 1E4VA 1NLZA 4LZZA 1Q1ZA 1H9LB 4Q4LA 1II0A 2B7CA 2HEIA 3LVRE 2VWLA 3TK5A 3HGNA 3NXPA 2WJIA 4JLOA 4AX9H 2IK8A 2F9BH 5JBCS 3AAVA 1HUTH 3HGPA 5TDHA 2G3YA 3GCOA 2FYQA 5DP4A 2OBQA 5H68A 4UXIA 4JYCA 5KDDA 4ZH8A 5JJLA 2FNAA 1W3CA 1Y3AA 1GI4A 2ATVA 1V2KT 3K70D 3R20A 3LV8A 1MCVA 3WBJA 4KHZA 5KHOC 1O87A 2UWOA 1Z0DA 2WJHA 3GLIE 3ZZ6A 1EPTB 2ZGHA 4Z1MA 3AF2A 2PKAB 7GCHG 3K09A 2WINI 1EWQA 1SQTA 1AY6H 5CYOA 3FKQA 1IY0A 3L82B 3QBTA 5J47A 1P10A 1W8BH 1DWCH 2VEDA 5JI2E 1VG8A 1YRBA 4PHFA 4C4PA 1GJ5H 2FEMA 2BCGY 2CJIA 1G6HA 2QGRA 1FMGA 2XEXA 2QEQA 4TL8A 4DT1A 2HPQH 1OWJA 4KYUA 4KU4A 3M5OA 2FI3E 4X8TH 4GPTA 1J16A 2Z9IA 2FWRA 1FV9A 2ZRHA 2P3UB 3S9BA 4ZPXA 2CCKA 1P6XA 1JBKA 2WPDD 4M1MA 2ZJ2A 5BYJA 1SKYE 2OBNA 2F55A 3DFJA 3JVUA 3WY8A 5E0JA 1G3DA 4B35A 3ZZ5A 4B48A 4BFZA 2QF3A 4AORA 3MMGA 3NDPA 4MLFB 1M74A 2BEKA 2Z5FA 3UTUH 1H8HA 3EA9A 4ASUD 1NI3A 2ZSDA 2ZCKP 3MHWU 4EFMA 4DLSA 5L3VA 2WIAA 3OTJE 2VU8E 4JS0A 2XBYA 1J8YF 3NBYC 1NZQH 2TIOA 2D2DA 1CA0C 3UPEA 3GCNA 2C98A 1N6NA 1GVKB 4Q66C 4DDVA 1NN3A 2V6JA 4NFEA 2ZNKH 1NFWA 3FP7E 2F43A 3VKGA 2O8LA 1KI6A 2GCPA 4KVGA 5A4JA 4S35A 5EP3A 3LBIA 5SZIA 4I81A 1Z7KA 2XAUA 4O3MA 3FVQA 2IS4A 1QHRB 3QWCH 1FL9A 2OAQ1 1XTQA 4GCHG 1YZNA 4QHTA 1P2JA 2GP9B 1TYNA 5JB8S 4XVRA 3BH7A 4CEHA 4D81A 2BOVA 1UK4A 3TBKA 4OK5A 2IYXA 5FOXA 1JR3D 1T0JB 4WXPA 5DI9A 1ZM2A 4LRWA 2BD8A 3THOA 4WH6A 4A2WA 4I1VA 3ATIA 1C2LA 1XMIA 1ESBA 4PAOA 5L3QA 5A09A 3QXCA 3WMEA 1GVLA 3MNSA 4OHVA 1P2QA 4ZCMA 1FUUA 3ESTA 3KB2A 1GOTA 3V0XA 4PC7A 4C7OA 3BIUH 1P3CA 4BLSA 2O0JA 2YJTD 4X8HA 1RXPA 3PO1C 5AJYA 2ZG0H 4G5QA 3MNBA 4P4SB 5HM9A 2CLSA 2ZSBA 1XMNB 4TLAA 1W11U 4BANB 2RHMA 1SVWA 2V3OH 3RNLA 2ZXUA 2RGCA 1RFNA 4KLNA 2C3SA 5J4SA 4X1PU 3IG6B 3M7UA 1ZTKA 3RRYA 1BCUH 4JKIA 2GESA 4YOJA 3TRFA 3UQOA 4NWKA 5DHAA 1GSIA 4E03A 4DVAU 4MVNA 4A9AA 5L3QB 1WV7H 3GLFB 3STIA 4CEHB 2O8FB 1LFDB 4HSEA 1KK2A 1C5ZB 4WXIA 1OOKB 1FY8E 1NF3A 2R6AA 2ECKA 1GPZA 1IQPA 4G5SA 1K5GA 2BX4A 3VR3A 2MSEB 5L6NH 5IK2D 1ELAA 4EPTA 3BG8A 1DE7H 1VDZA 4MGIR 4AGKA 2BD5A 2EFGA 2RGEA 2A5DA 1W10U 1XEWX 2BCJQ 2JLRA 2O8DB 1NS3A 4MNVA 4CRCA 3NHAA 4TLCA 5GVRA 1TE0A 1VPLA 3IHWA 3OFND 3CBQA 1G3IA 3GLHE 1Z0IA 4I8JA 3FVFB 1EB1H 4V0MA 3AVWA 5A0AE 3MWKA 1E9CA 4DUGD 3PJRA 2JLXA 4DCNA 4DSTA 4Q1AA 4II7A 2BVSH 4K8BA 1EAIA 4MH0R 8GCHF 3OY5U 4HATA 1S1CA 4C9BA 3MI4A 4CH2B 1O2MA 4UKDA 3LONA 3VHXA 3F9GA 2ZHDA 1L7VC 1EZSC 1BYIA 1ZC4A 1AK2A 3L0OA 2SGPE 3LRPA 1NVVR 2ZM5A 3PLBA 2ODEA 5HGGA 1O2QA 4D0GA 3MFYA 1TOMH 3SZEA 5LPRA 1KO8A 1S96A 5FX6A 4UONA 1D3DB 3VPKA 2IEYA 1OWEA 1CKEA 4BFTA 1CHOF 3AVZA 2FO9A 2VIOA 3RXVA 2QAGC 2PR3A 3DMDA 4X2XA 3SNCA 5J4VA 3QBVA 1QF9A 1FMLA 2WPJS 1DANH 5F8ZA 3KTAA 3OIUA 1M9UA 2FFHA 1O5DH 1V2MT 2XJ4A 3C41J 2J92A 1GBMA 3IQXA 2C5LA 3QN7A 1IQEA 2RMKA 4LZ1H 1GHWH 3GJ4A 3OSYA 1A5TA 1X7AC 2AMQA 4NCNA 4HAVA 3WMGA 3BG4B 2YHSA 1O3OA 3RRZA 1P5ZB 1DE0A 4NCKA 1B23P 4TYQA 1O3CA 1QFKH 3U3RA 2R8RA 4QHSA 1E79A 4GT1A 4YLGA 1KJWA 3W8RA 1OYTH 2BLWA 3PMAB 3F0TA 3LU9B 2H92A 3QKRB 5AFYH 1EZXC 3QE0A 2XCFA 2Y80A 1UBFA 3A8BA 1O3KA 3P92A 1VITG 1Z0JA 4IDHA 2ZKSA 1EG7A 1EUFA 2OQUA 1GI5A 3I92A 4D6PA 4HYYA 4WMDA 1XJCA 1JXMA 1GBKA 4PHGA 1E1RA 4LHWA 1N2CE 3RWMB 1DAFA 1VR1H 2ZWLH 1NP6A 3AEZA 2XNDA 4MRRA 3SU2A 4K3JA 3LGTA 1VCIA 3ZZ8A 4X1QU 1HAYB 4AN7A 5JFGA 2RGGA 2GJSA 1MO6A 3HJNA 2VP0A 4GHTA 4GRAA 3KQNA 3DKPA 5JRJA 2ZGCA 1SGFA 1DG1G 1DO0A 3SV8A 4JBYA 1OPXA 1Z8RA 2RGNC 2LKDA 2WWIA 3SE0A 3NTUA 2TGPZ 4LJ4A 2VIWA 4BLTA 2W7SA 1AIXH 1O3HA 2EVWX 1F0UA 3CX7A 4MGZR 3MTYA 1XEXA 1VMAA 1MU8B 1LHFH 1PQ8A 4KO8A 2Z3EA 3MD0A 4ZHLU 2RCNA 3AKCA 5FH9A 5FOUA 1VG9B 1LQDB 3TVDA 1DG3A 1E9RA 1KXDA 4CEJA 4A1VA 2ZRGA 1Z0KA 2I4IA 3KIDU 1G3CA 3ICQB 1S84A 4GMXA 1EJAA 2WYJA 3NXSA 4RZ3A 5IHPA 1MKWK 3BB1A 2SNVA 5LPFA 5IRCD 4W5JA 1Z8FA 2G4TA 2GEVA 1E2KA 1XCGB 3ODFA 1P06A 1TMKA 1KIGH 1P9WA 2BMJA 2ZUBA 3AM1A 2R9PA 4X6NA 4MPVA 4P4UA 3FP8E 3VR6A 4UXJA 3RMLH 3A37A 5FI0B 5C4MA 3GCHC 2WWHA 3ZVMA 4ZDWA 3ZZ3A 5CDFA 3RXAA 3M3VA 1W2HA 1HT2E 1AQUA 4ZMAH 1DAKA 2D1JA 3SI7A 4RSPA 4PSAA 2KAIA 2CVFA 3UWJH 2QP4A 2W26A 4DURA 2CE2X 2J5XA 2MSCB 3WRYC 3U61B 4HZIA 3ZVNA 1W7AA 3CS0A 1B0FA 1Q57A 5J4KA 5E0HA 1KIMA 1E0KA 3R8CA 2UUKB 3ZJYA 1NNEA 4W5WA 4KSCA 1YPJH 1AGRA 1IN4A 4NMMA 1T8NA 1RIWC 5JSZB 3R7WB 4ZUHA 2RB4A 5J4HA 2PSYA 2YC2C 1F2UA 2D62A 1QIXB 4URVR 1OFTA 5DN6A 1A0HB 3EZ6A 1OJLA 2VIIA 3TGPA 4NZYA 3BC1A 1KXFA 3D6TB 5DNYB 4NCYA 2J9NA 1ZRKA 2BKUA 1SL3A 2FGJA 2FTMA 4X0WU 3GEIA 1GDNA 1VGCB 4OQMA 1NPMA 4FUIA 1MO3A 1LQEA 4YMTA 1C2DA 4Q5IA 4ESTE 2J59A 5J5CA 1V2WT 2BBOA 4A2PA 2W83A 4MYTA 3JZ2B 2BM0A 1LMWB 2VJ1A 4Q01A 2GV7A 5H8WA 3RU4D 2QAGA 2ZR9A 2V0BA 2ZJ8A 1BJUA 2YZ2A 1P2UA 4HLCA 1AE5A 1T8TA 1IBRA 3LLMA 1OSNA 3KQUA 5TXGA 3WBKA 2Z3CA 2V6IA 4Q2KA 1KNQA 4DUGA 1A0JA 5KSOA 2P8OC 2CCJA 1R8QA 2IS1A 1UPTA 1SLUB 3E1SA 5JBAS 5GJVC 3SQHE 1TMTH 2QGNA 3NPSA 1GMHG 4OBEA 2ANYA 5AK0A 3MU0A 1MTWA 3LT3A 2OFWA 1HPGA 3TH5A 2ODQA 2NGRA 1L4ZA 4MDSA 2K1QA 2V9PA 1ESNA 2X77A 1Q3XA 1P61B 2GXUA 2Q9BA 3P6ZB 3GEHA 1ZD8A 5CJ2A 3Q3XA 2F43B 3QZQA 1KTTB 2Q9AA 3TJNA 2NWNA 3BTME 3LGYA 4D4KA 3MH5A 2NU2E 1MD7A 1XBTA 1WBGB 3ZZBA 4P0TA 4DT7B 3D49H 2E87A 1XUFA 2KSQA 1EXFA 1Z6TA 4TQUS 4Q02A 2F1JA 2QN6A 1V2OT 4O2RA 4Q9KA 1CF4A 3CONA 1BIOA 2OUKA 2D7CA 3SS8A 2QBYA 4WOPA 2W2VA 5EZ6B 4LJAA 4F4IA 2AFQB 1Z0AA 3FKSD 3BH6A 2BBTA 3LFUA 3IO3A 3BJIC 3I5YA 3M61U 1M7BA 4AZ2B 2ZE5A 3SNEA 3HPRA 1EOLA 4DLTA 1LVOA 3PEWA 2ZU0C 1SVSA 4LYHA 1UJ2A 1UBCA 3VKWA 3KUCA 2D74A 3TQCA 4GP6A 2OCYC 2X1VA 1N6HA 2C2HA 3DOEA 3G5UA 3L6PA 4A0FA 3QXHA 3B1XA 3QNUA 1U90A 2Y8EA 2GKSA 4X8OA 3A89A 2ZRPA 5EODA 3X1DA 2O0KA 5K7RA 1O2HA 1R7RA 1VIAA 3T5DA 3W3AA 1F92A 1GCTC 1M8PA 1E37B 3EWSA 2O8FA 1S0UA 3AP3A 1XD8A 4N1AA 1DT2A 2QXGA 1FN8A 4D8NA 3RXCA 5CLQA 3KZ1E 4YDSA 1KSJA 1CO7E 3LQQA 3CPEA 2JCSA 2NU4E 1WU1A 1X6VA 1NM6A 3PB1E 1F60A 4EPVA 4V02A 5JECA 1O5CB 2ZSEA 3CIOA 1OKKA 4Z54A 4UFGH 2ZAOA 2VGCB 4V0LA 3QXSA 1Q1QA 4F4CA 4G5OA 3A8TA 4JVMA 4PPFA 1ZSJA 1WBBA 2G6BA 4XVUA 1XM1A 2VWNA 3UNRA 3L33A 2D2EA 1UM8A 1Q3TA 1YP9A 3QVUA 1ZM3A 2JJ8A 4C0BA 4OS5A 3SZRA 5UKDA 621PA 1UBGA 2IYSA 4P33A 4ISHH 4A8JB 2A5FA 5K8IA 1THRH 3ITIA 1E2JA 3PUWA 1VCWA 4FINA 1SOZA 1PLLA 5LBIA 1G3MA 3H7TA 2HT1A 2IYZA 1DWBH 2ZJOA 2VSXA 1A7SA 5TJXA 2F3RA 3PR1A 3RU4E 3AQ4A 3IITA 2WPMS 3FHOA 1OH6A 3S9AA 2XXLA 1NRPH 2WPIS 1TX7A 4IOMA 2VHJA 1O31A 3PV4A 1GDUA 1EPTA 1J2JA 2EWWA 1NSFA 1U8ZA 3CH4B 3KTAB 3I1FA 2PZEA 4B6FA 3TUIC 4BUJA 4XWKA 1ZMNA 5KTYA 5F2EA 4YZUA 3FKSA 4BFYA 1P05A 3RP2A 4AD8A 3P1JA 1OSSA 1GCDA 5A2MH 4ZV4A 2BQ7B 5EUMA 3QF4B 2CHAC 4FVBA 4X1RU 5E7MA 4Q7XA 2FPMA 5M04A 1NN5A 5T6GA 3NHBA 2GHIA 3LPRA 4NH0A 1Y59T 1P2NA 1N8OC 1DEKA 2IS6A 3T26A 3B60A 1LVGA 1LF5A 4WY3A 1G4UR 1ZJDA 4KYIB 2ZRNA 3U8TH 4RY2A 1E2NA 1AA9A 1O2XA 4RKFA 3RXIA 3EAQA 4Q18A 221PA 3EX7C 1WF3A 2FWWA 4Z8XA 1S9DA 1P2SA 1OB2A 2XZLA 1EJNA 1EK0A 9ESTA 1P2KA 1AZ8A 2FOHA 1GGDB 4Q1FA 3AVYA 2GK6A 4PSKA 4ABBA 4O3UA 2A5YB 1UK3A 1PPBH 4FN5A 2J2UA 3U4QB 2FG5A 1NVUQ 4GMDA 4M9ZA 4Q7LA 4HUQB 3M5NA 3PUZA 2JIZD 2XBXA 4BFXA 1OLOA 1XD9A 3SUDA 2O9QA 4JSYA 2HYIC 3B9QA 1QURH 4I4LA 2QSZA 2EC9H 4PC2A 2FH5B 3BN9A 3C27B 5A0CA 2VPPA 1AD8H 3ZD6A 2ZUDA 1E2IA 2QP9X 4PZZA 2PV9B 3SQWA 1R10A 4HLUA 1KXBA 1XFAA 3U3JA 2CXXA 3KL4A 1RIFA 5FL7D 4YLUA 1PFXC 4LI0A 3X1WA 3AKYA 4GOXA 1GTVA 2EYUA 3R3GB 4D4MA 3DPUA 4OI2A 3CRMA 2A2XH 4NWLA 1TX4B 5FUXA 2QM7A 4EJSB 3SJBA 2D26C 3EWAA 4O2LA 1D4PB 3I62A 4FMCB 1EOJA 3KJEA 3PWBA 2IXFA 2R2MB 4Q7MB 2OLKA 3LIWA 4K1TA 2H5DA 4L9SA 4UFEH 1V5WA 1IY2A 3FMIA 1Y5AT 1N0UA 1HGTH 4Q03A 3GJ8A 2OINA 1NO9H 4BAKB 3I5XA 4DSNA 4JZEH 3ZD7A 1BTYA 3UWOA 1U8YA 2DBYA 1KO1A 1Q3HA 4BLRA 3VR2A 5BN5A 2R6DA 2H5EA 1SGDE 2BY5X 1D5CA 5JB9S 4CR9A 1OFIA 2F4LA 1N25A 4Q4HB 2ONJA 2FSFA 2FE4A 2ALPA 1WE2A 1SQAA 2G83A 5DSZA 4PFSA 2GMTB 1GI2A 3C5CA 1W0ZU 5JDUB 1DAMA 1C5QA 1Z3IX 2HXSA 2V1XA 2XOKD 4CEIB 4XD7A 5FBLB 3GJXC 3AF1A 4TMTA 2BD7A 3N2EA 3HK6B 1QL8A 3FMFA 4OM9A 1YVDA 1K1IA 1DY9A 2FFQA 4GL2A 4CIDA 2QI9C 2F83A 3I3SR 3TLOA 3KKOA 3LD9A 3QXXA 3M1IA 3BFVA 1SVOA 3ND9A 5LD2C 1TGNA 4S2EA 3MLEA 2ZVPX 4NPHA 2A7HA 3RC8A 4OL0A 1JNYA 1KMHA 3QO6A 4EAQA 1XUKA 3ZYCA 5CHAB 1YZUA 3BWDD 4QBHA 4DLRA 5IT5A 1LTOA 4TLBA 4KAXA 1HCGA 3M5LA 1L1JA 4FUHA 4US2R 2SGEE 2ZU2A 1PZNA 3QK1A 4JYTA 1RFLA 4LV6A 3GYMA 1TONA 4PC6A 5FR1A 3LWNA 3PYHA 4JBXA 1TAWA 4IOLA 4GOJA 1HFDA 2GEDA 2AWNA 1IQLA 4NZQA 1VYTA 1YPHE 1TAGA 3Q77A 2PGBB 3KKQA 1Z29A 1ZM9A 2GV6A 3QDZB 2P3FH 2ZRCA 2Y5HA 1T4GA 3RC5A 1GITA 3WYFA 1F2UB 4HUTA 1JPNA 2VSFA 4A1FA 4G5GA 2JJ1A 3ZIAA 3U98H 1GJ6A 4YC7A 2CV3A 4R8TB 5GWZA 2FPKA 1ZU5A 2OBOA 3WYAA 4I31A 4HDOB 1GG2A 2VIDA 3MFJA 1OX1A 1KK0A 2HF8A 1XJQA 3CM0A 2ZJZA 1P2IA 4FU7A 4FU9A 1CR2A 1ZSKA 3QLPH 2DWPA 1DARA 2PKSC 1C1UH 1NY22 2NO0A 1A5GH 1BTWA 1D8TA 1AJEA 4DOQA 3KKMA 1HIAB 3QENA 1GJBB 3U69H 2XW9A 3UFAA 4JZ1A 2Y6TA 3A7TA 5FAHA 4A36A 1OIVA 4DCSA 3X1XA 3B8JA 2J95A 2JJ1D 3Q76A 3U3KA 1BTPA 2GZ9A 3T15A 1K2I1 2ZREA 4A92A 1C5RA 721PA 3TVTA 1ELBA 5B2ZA 5F03A 6GCHF 6CHAC 2ZECA 2ZIAA 1TPOA 4EQ6A 4K8YA 1GL6A 2ZPTX 1XPOA 3VB4A 5C3NA 2CLCX 1ZHMA 2O8WA 1YR7A 5DYGA 3CP7A 4INHA 4SGAE 2ZU4A 4BLPA 4H42U 1Z28A 2WV5A 5CM8B 2Y5GA 3EYDA 3CWZA 3GISB 4Z51A 1MRSA 3T61A 2GDDA 3PITA 2RGNA 2R2WU 1OYQA 3BGWA 1A3EH 5T3HA 3PV5A 2FOMB 1OT3A 3QKUA 3W90A 4C0QC 2GEUA 3VU9B 1QJ6B 1GJCB 3SOPA 1NVXQ 1W13U 3MU4A 5ESBA 4Q4AA 1E0SA 3K0SA 1XTIA 3LA6A 1CULC 1RS0A 3H84A 3MWJA 1LW7A 4A4DA 2ZU1A 1E9FA 2CDNA 3RHFA 2QXHA 1CR1A 1E2MA 4A6LA 1PYTD 4WZAE 3U7FB 1UKYA 3UQVA 1GAJA 2B92A 2OC1A 121PA 1ELTA 1Z6YA 2OBLA 2DHRA 3BFKA 1TGSZ 2ODPA 3LXRA 4RKOB 3AW0A 1TQ0B 3SO3A 5CLLA 2BHRA 2GX4A 5E8EH 1QHHA 4KTSA 3AP2A 4D7GA 1O33A 3K9HA 1MTVA 5GJ4B 2Z0MA 2VP4A 2W6JD 2ANMH 3S9CA 2PMDA 4BAMB 3FB4A 2G55A 2Z83A 5DP3A 4IXNA 4B75A 2FXRA 4UNQA 1EKBB 3LH1A 4Q9HA 1K9OE 5L8VA 1OH7A 4FUCA 2D7DA 3AVOA 4YONB 6ESTA 1QBNA 4K69A 3CLVA 1ZLRA 2IUUA 1CJKC 5JRZA 1JAHA 2ZQ1A 2PHBA 2GTBA 4O9VA 5F8XA 4KBFA 1UVTH 2R62A 4LBZA 4M9SA 1UHBA 4YOGA 1RKBA 2GRJA 2UZIR 4DIIH 1E9BA 1EFTA 5EW2H 2WSSD 1GL0E 1O3GA 1ZUNB 1TL7C 3TSWA 3U2QA 2OV2A 1QBVH 4HAUA 4IDOA 4MRVA 4Z8YA 3A82A 1G5RA 1UEJA 2A1DB 1QVRA 1SHZA 3QPVA 2CJWA 2JJ2A 1T5LA 1DXWA 4TTRA 3QKRA 4C3ZA 3TAUA 2GJAA 1UTMA 3NEJA 1EAWA 2C8XB 1DY8A 2OXRA 1HBTH 3FFAA 1NRQH 2BB4A 2FX6A 3VEQB 3F1SB 2ZJBA 3AUXA 1O3LA 1P2VA 1II9A 1SGTA 4PO1A 5DP7A 3FDIA 3MU8A 4TMVA 2IJD1 3P8GA 1IN7A 3C4JA 3IILA 1ID5H 1FOEB 3I73A 4RZUA 4UXHA 2ODNA 3O8DA 5FBWB 1R0ZA 3ZQ6A 1Q12A 3VAAA 2OSBA 4JLPA 2OTVA 1SGEE 3RM0H 4WF8A 1W4RA 1AUTC 3BTFE 2BMDA 3H86A 4M22A 3A7XA 3ZZ4A 4Q9JA 2JJ2D 3THWB 2A5AA 8KME2 1A5HA 1GL9B 2FOAA 3W8NA 3ZZDA 4BNRA 1PQAA 4MKFA 1SQOA 3W6NA 2C90B 1BTXA 4Y0ZE 5J4QA 3TGIE 5D3MB 4JZDH 3LBHA 1TPSA 3M0EA 2ZANA 1WRBA 2R6CA 4ISLA 3QJYA 4CZ2A 4AKHA 3K9NA 3NBXX 3KXKA 1YZKA 3SOSA 2OFXA 1F48A 3U3OA 3CF0A 1TRMA 3B2EA 5G3ZA 5IF9A 1FPHH 3ZZAA 3KL6A 3QEJA 1KYNA 2VVVA 2QF0A 5G53C 2QUZA 2W6JA 1E69A 2XYAA 3O8CA 4JT2A 1PLJA 4TYYA 2XC5A 1CBWB 4GZLA 5JBBS 1U0JA 4PPQA 2G51A 3EIQA 1ELDE 3NZIA 4FU8A 1SPJA 3IUYA 4QBGB 4L9WA 1CT0E 1HJ9A 4M0LA 4R7ZA 1XP8A 3SU5A 5D3MA 4MQBA 5ANRB 4WZ6A 2ZRFA 2WM9B 3DEFA 3KQLA 1QHXA 1UTPA 2QTHA 5JS8A 5CMXH 2O8BA 4Y8YA 1NMZA 3F68H 1JEDA 2R3UA 3RXGA 1EQ9A 3UIRA 2GA8A 3F5FA 1O3PB 2OCVB 1GKUB 5J40A 4Q21A 3NIBA 3HDTA 1GJ9B 2H1LA 1H1BA 1F7ZA 4IN2A 1F5KU 4N0DA 3K6YA 3RXUA 5I25A 1EJMA 4IOJA 2ILNA 2J87A 4L5BA 1D9IA 2A5IA 2G0TA 1MKXK 3SNAA 1DS6A 3VGCC 2F9UA 4LYFA 1WB9A 1J8AA 5A0BA 2GJ9A 1V2VT 2SFAA 4X6OA 1YPKH 3F9EA 4OQFA 4QJ3A 5ABWA 3PV0A 2OHFA 4F4JA 3SYKA 1UCYE 3ZQJA 1ZAKA 1TB6H 2JETB 2NIPA 1LHCH 5FI1B 1C1PA 2JLQA 1W36B 4AK9A 3TJUA 1MTUA 1S5SA 4IVPA 1NROH 4WMEA 3A7ZA 3PXGA 4EJSA 3BTGE 1TF2A 1IQNA 3OIYA 2VSOA 4NIWA 1EFHA 3KXLA 1IQFA 4LHVA 2J45A 3GY4A 4M1YA 2JLZA 2J9RA 5JWOA 3OE7D 2XRCA 5BQ5A 3EZ2A 4MRPA 4NL4H 3SNHA 1GMDF 5GDSH 1VCQA 4D2IA 3OESA 1LCYA 1P62B 3VX4A 2RA0A 1XTRA 2FIRH 2P59A 2IUSA 1YPGH 3RUOA 1UKEA 1HY3A 2GJ8A 2ZPRA 2WJYA 1ZMJA 2OCBA 2BC9A 4P31A 1ZC3A 3VKHA 1X8LA 4OS4A 1QNJA 4C0SA 4E5UA 3T2NA 4CT4B 2SGDE 3AAUA 3RXDA 3I72A 2ATXA 3SUGA 1DAGA 1TEXA 1VHTA 1X86B 3Q7PA 1EX6A 1EATA 2GDEH 4U02A 1DDJA 3F6UH 1C5WB 1XTKA 2VTKA 1YF4A 4MYCA 4UE7H 1AVGH 2BY9X 3FANA 1OYWA 3KHVA 1DOAA 4L16A 1GMHF 5DI3A 2F9VA 2C95A 4LJYA 3SJ8A 3UOUA 3ND8A 3NWJA 3D8BA 4FVDA 3HKJB 1T4VH 3IBGA 1KJZA 1UAAA 1G7CA 5LB4A 1YYY1 1Z1IA 2GT7A 1D2MA 4DIHH 5H70A 5HMAA 3FYHA 3E6PH 4X8VH 2C93B 4IKEA 1HEIA 3TNFA 3C8UA 3GQBA 5CHAC 2V7QD 4FXGH 1NESE 3LW8A 3TKLA 3KCGH 3DZ8A 3LJJA 1Y5BT 2F9NA 1Z6GA 3KQBA 3U1JB 1X1SA 5B57C 1KDTA 4HZUA 2NPFA 1GBJA 4DB2A 3BD9A 5K8TA 1WAYB 3CRVA 1MUEB 3RC4A 2XCNA 3FE2A 5KNBA 5GVSA 1CP2A 4LHZA 3ZV9A 2RG3A 1GRNA 2F91A 4A1XA 1VITH 4Y10E 3Q8XB 3VFDA 1P2TA 2QE7D 4QFMA 1SXJA 4IN1A 1ZOMA 1KTVA 3RXEA 2HWLB 5A8XA 4IHQA 3IBYA 4EUNA 1PPGE 3P8OA 2BJVA 1CS4C 3NC1C 1AKSB 1BT7A 1VYUA 2IYVA 4Y0AA 1MABA 3G82C 1BRCE 2XWAA 4ZO4A 4QRHA 2O8DA 2FM2A 2GZ7A 5G40A 3HKIB 4DY7B 2H5CA 1IXZA 3TW4A 3A88A 2SGQE 4JLDA 5JPMH 2F9PA 4U5XA 5BWMA 4LX0A 1XNJA 3M3SA 2JAQA 5EXPA 1AKYA 3QF4A 3A1SA 4GSOA 3BH0A 2WHXA 3ENSB 1T8MA 1Z8GA 5BXQC 1AN0A 3TQFA 4J2YB 2OD3B 3S1AB 1SVKA 3ZVBA 4Z0KA 3JZMA 1XF9A 1O5AB 4AB9A 2YVUA 4D4JA 4X1NU 2NZ8A 2GZAA 3OAAD 3KEEA 1BO6A 2AHOA 1A4RA 2NZJA 4I8GA 1AIPA 4D82A 2ZGJA 4TMKA 2PEYA 3ZVAA 1HE1C 4PAQA 1IONA 2PKAA 1LB1B 3RANA 2F7SA 4FMDF 2Z9KA 5FOWA 2EA3A 1HAVA 1NLFA 2WV4A 3ZS8A 1COWA 2F1RA 1HB0B 2FS8A 3AVQA 5J4YA 1G18A 3PIRA 3A1VA 3CF6R 4WXVA 1N5IA 5F3WB 3U44B 1O5EH 4RD6A 1XD2B 3SQXA 4X6PA 2J46A 3L43A 3L2OB 1IAQA 2BIFA 3A87A 1LNZA 4TY6A 3O8BA 3SI3H 1AHTH 1VZQH 2V7QA 1ONBA 2P16A 1L1NA 4B3BA 1Z1JA 3GY8A 4K46A 4ZCLA 2A5GA 4TWYA 2GVFA 1O3FA 4M1OA 1PQ5A 1QL7A 4FMBB 1O2OA 1Z6JH 3VX3A 2HV8A 1J90A 3CNLA 2TGAA 3A84A 4YMUA 3SORA 1HLTH 2F9LA 2HUPA 3A81A 4K60A 4B74A 2ZCLP 4DIEA 4TMZA 1J8MF 4ACAA 2ZI3A 1D3PB 1KHTA 1ESTA 5HYOA 4I33A 2GF9A 3EZ7A 4XSKU 2G77B 1VIYA 2WWXA 2ZRBA 4I1UA 1OP2A 3PEUA 3QKSA 4LPKA 4X1SU 4KFRA 4OQNA 1YZQA 1V2TT 4PROA 4TYNA 2WJJA 3A6PC 1P60A 3RLFA 2F1HA 3W95A 1FTSA 3GJ6A 4KITB 1NU7B 2H2ZA 3K0AB 2YNMA 1C5UA 3MH6A 3QZRA 1I2DA 3OIVA 1KXEA 2VA8A 4AY2A 1KLTA 2OCAA 3K70B 2GKVE 3U6KA 1BHXB 3BAFA 2WOJA 4CYMA 3CPHA 2XBVA 1GNQA 1QTFA 5KDOA 1QRXA 1XU4A 4B2IA 1JEEA 1HV7A 3OE7A 1OW3B 4FUGA 1C4Y2 3AUYA 1WMSA 4TMWA 1DVRA 2XC0A 4D76A 1N5JA 1RJ9B 1GBEA 3A7VA 3VB5A 4LZ4B 2NG1A 1WSSH 5B6OA 2JH5D 5KNCA 4JJZA 4KGAA 2YV5A 4TSFD 4XE4A 1EWRA 4DEYA 1DO2A 2ZS9A 1RYHA 2A0QB 1MABB 1G21E 3NWUA 5JCZA 1G3RA 3MUFA 2FMJA 2AL7A 1TGTA 1PQ7A 3KFXA 1EESA 2JKHA 3AVTA 3MSXA 2A4RA 2DFNA 3EXAA 3H7OA 1I4LD 4W7SA 5C2ZA 1XPUA 5JHHB 6Q21A 1XUHA 2VLIA 3GFPA 1BBRE 3T1TA 5C18A 1IM2A 3H4MA 4KFUA 1GMCG 5FHTA 2F9MA 1IQMA 1O2WA 1CJMA 2NU3E 2BOHB 4C7OB 1TA2A 3TK1A 1CA8B 3NH9A 1HAGE 1AQYA 3GCTF 3MWYW 2TGTA 2CL7X 4NFFA 1D6WA 4XWAA 5FPHA 3ICEA 1RZ3A 821PA 4PC1A 3E70C 1O3NA 2ZZUH 2ZE7A 1LPZB 1SZPA 2WPHS 3P32A 1M34E 3TK6A 1CA0B 4FUEA 2ONKA 4DBLC 5DG6A 2ERYA 1ZPBA 5JI3E 1MMJN 1ZVQA 1UHBB 4PANA 3EA8A 1O2VA 2ASEA 3M5MA 1C9KA 4HZHA 4UNPA 1O35A 1CBWC 5K8UA 2HNTE 1LDTT 1MH1A 4AG1A 4LV5B 3GP8A 2W3KA 1E2GA 5KSPA 1C5MD 4M9QA 3F3YA 1BTHH 5KNDA 1EAXA 2FN4A 5CIWA 2ZDMA 3RXPA 1SGQE 2IXEA 2X8AA 2BY8X 1H8DH 2A4QA 5FBIA 3PUXA 1NFXA 3V00A 3FZZA 4HAZA 2LKCA 5IK2A 1HH4A 2XB4A 1ELEE 1NMYA 4E09A 5B30A 4CBOA 2GCOA 3W6PA 1EPTC 2OT3B 3LQRA 1EXMA 2PW8H 4XWOA 2ZC9H 3IDQA 4TT3D 1SKQA 4CEJB 4EDHA 4CREA 4R98A 2WICA 5DE3A 3DOFA 2VB0A 2GZHA 5EXSA 1LF0A 1CHGA 5A0FA 1FP7A 1GVNB 3N2IA 2ZTXA 1D2EA 4B1TA 1WP9A 4JZKA 4QM6A 1TA6A 4NTZA 1C5VA 4Q4AB 3TE6A 1A2CH 1P09A 3QPUA 2ZE6A 3QG1A 4IS5A 1KI9A 4IFBA 1Y5UT 1QHHB 1QG2A 2P6NA 3MG9A 3SJZA 3MO6A 1TQDA 4E22A 3K6ZA 4M8NE 4TWZA 4HLUC 3Q3KA 3LGVA 3RXBA 3E5HA 1E0AA 2WWGA 1TF5A 1DELA 2ZRJA 1HA3A 2H7VA 1S0RA 3LXXA 4K81B 3TITA 3I77A 4X8MA 4ABIA 5SZHB 1G20E 2NU1E 5FTNA 1GKYA 4ASHA 4Q1CA 2IL1A 1GVZA 4Y76A 4GCHF 2WUBA 1UCYH 2QY0B 3ZVCA 2CN0H 4HI3A 3QIAA 5FTLA 2P94A 3MYWA 1BYUA 1NY5A 3Q7QA 3TVJB 3ZZTA 1EZUC 2XTTB 3AKDA 2FSGA 1LVMA 2ANWA 5TVKA 4GBMA 1GP2A 2PJZA 4WMFA 5EE3A 4XTRA 2DUCA 4A7IB 1HT1E 1G3QA 1XUJA 2G5NA 4RD3A 4OKSA 4Q1DA 1MZAA 1QL9A 3AGQA 2VF8A 2DCUA 2VHUA 1HNEE 4YLQH 1V2LT 2FDAA 4US0R 5GIBA 1KLIH 1Q2WA 5FTKA 5L3RA 4JYUH 3V9PA 2BVNA 1B0UA 5B58C 1PPHE 1SXJB 5F6MA 4XOIA 3RC6A 2YOLA 1TF7A 1V2ST 2P67A 5G3YA 1W5SA 3LLUA 3EPLA 5LGOA 2XGJA 2ZDLA 2GVDC 3A85A 2VHCA 4TMXA 1O2PA 1TQ6A 2G52A 3SNBA 4WVPE 4NE2A 1Z06A 2ZFQH 1ZPCA 2VP2A 1ZW6A 5HR5A 1PLKA 1O3IA 5FTMA 1C2IA 2BX3A 3D7MA 2ZQ5A 3GYLB 5C1XA 4WA7A 3H09A 1M7HA 3M36A 1UO6A 3GJ3A 3PFIA 2W00A 3WNDA 4O97A 3PVSA 1ZYUA 4NSVA 5DGJA 3TNSA 4CRGA 1HQYE 4FCTA 3VR5A 1TBRH 1XTJA 3EZFA 1W48A 3GD7A 5I46H 3UANA 3SJCA 1BDAA 4MA4A 4QC2A 1RJXB 1NFYA 3T5FH 4KCGA 1W46A 3MOCA 4MPUA 3PWCA 5C1BA 3STJA 2A9KA 4PX9A 3B78A 1H4WA 3SV7A 1OB5A 1ZTLA 3WY9A 2KB0A 2G0NA 4Q4JA 1SLVB 4XBCA 2R3YA 2EEKA 2BM1A 3MU5A 3VB7A 1UKZA 5JJIA 3KQEA 1EP5A 1GZSA 3KNXA 4HAWA 3P26A 3QI2A 1YPHC 2BZAA 1U6QA 1NL3A 1F6BA 2IYLD 5BYKA 2WJGA 2MMCA 1CIPA 1HAVB 4WWYA 2W0MA 3GLGE 1XXFA 4ABFA 3T34A 3WRXC 4MYHA 4D26A 4DJZB 1KO5A 2V54A 3B8HA 2C8ZB 3SGBE 3MRSA 3I4LA 1MH0A 1YHNA 1O3AA 8ESTE 3QUMP 2XNDD 1D9XA 3QF7A 2FOFA 4JVNA 1KK3A 4QOSA 3ZIAD 1HXEH 4Y0YE 5K8LA 1E1RD 1GHYH 2XSZD 1IQGA 3AF4A 2YNBA 4TQ9A 1QHSA 3W9YA 3SJ9A 3T12A 3A86A 2QC2A 1WXQA 4C2TA 1LVYA 5FCKA 1KMHB 5FFMA 5TV2A 2YWHA 4BEJA 3RAPR 3PUVA 1S4QA 3PEYA 2CEAA 2FFAA 1T4UH 1ZIPA 1ZCBA 5HCIA 1AZSC 1N6KA 3SDZA 5FPTA 1OH8A 1XXHE 4RD0A 2CMKA 4QBFA 1P7CA 3ADKA 4TYPA 5AJZA 1CRQA 1G3EA 3LO5A 3IGFA 5EPNA 1R6BX 1BRBE 2QG6A 3H2YA 4NHOA 1D2NA 1G5TA 1VKJA 3MNXA 1NLYA 2ZEJA 3SU3A 3VHLB 1CSOE 2J34A 2E9SA 1A46H 1DICA 1Z0FA 4V03A 2FOEA 5FOVA 1K1MA 4DSOA 1ZR0A 1G8GA 2CCGA 3U4QA 3SUFA 2GXAA 4FIDA 2Q1JA 3A4NA 3D3QA 1E34B 1XRJA 3RRNA 4MYUA 3BOSA 1JRTA 2VVCA 4CGZA 2XC4A 1R5OA 2ZP0H 2NOAA 1E2LA 3A4MA 4KBGA 4B33A 3W94A 4C30A 1KZGB 4JKYA 2AERH 2IXGA 2FLRH 1WXRA 1TGCA 1E3MA 4DCUA 3HR7A 3HU2A 3N5CA 1ZHPA 3B1ZA 3IIMA 4QNMA 4ZIRB 3LC3A 1DADA 1U8AA 3RWOA 1AWFH 1KDQB 2CNWA 1OV4A 4TPIZ 5BRRE 3K65B 4F92B 4UQOA 1BITA 1KY2A 4CF7A 2J7KA 4FMCF 3BF6H 2ZHEH 2NQ2C 2ZA5A 3GLHB 3QOFA 1HURA 2BXUH 2XZPA 4FD2A 3TH3H 1Y63A 4JIMA 2O8MA 3MGCA 1NVWQ 2DWQA 2L0XA 1XDBA 2IYYA 2QT0A 3E91A 4V0NA 3F8TA 2ZYTX 2ZITA 5EE5B 2GILA 3UNQA 4ERNA 1KZ7B 1N6IA 2WMOB 3OYPA 2PLFA 1MQ6A 1BMMH 3X1ZA 1ZNWA 2XXAA 2Q6TA 4BPBA 3SQEE 1W7XH 3NC0C 1TBQH 1T31A 3VFEA 1SVMA 1AGJA 4NP6A 1CT2E 3GY5A 1GL7A 1TEVA 3CWQA 1L1GA 1OIWA 2A5JA 5EW1H 1AMHA 4RN6A 4JLVA 1YPLH 3QVVA 2CLDX 4AIIA 5DK1A 4DDUA 1GL1A 4DDTA 3B13B 4XJXA 1O2UA 1KSGA 1ZPZA 1FNNA 2QPAA 2I6SA 2HCBA 1GI7B 4OHYA 3M3TA 3GY3A 1PJRA 3P70B 2ZR7A 1UCYK 1VCPA 3SC3A 3DFLA 3RVBA 1Z6AA 4R2HA 3SBEA 2Q3MA 3GJ7A 2CMYA 3THXB 4G0NA 1TX6A 4U2WA 2GF0A 1NFUA 4V0ME 3MO9A 2JGNA 2I1QA 5JEDA 4MUAA 2GDJA 2NO6A 1XKAC 4X8LA 4EPXA 2VRWA 2Q6DA 4TTPA 3SBKA 4IGDA 5DP5A 5FCRA 1JIMA 5D3QA 4E7NA 4FW9A 3SNDA 3THYB 1ZJKA 5DLQC 1LTQA 1AFQB 1JR3A 4X2WA 1DS2E 1C5XB 5FBVB 2CBZA 2P6RA 3K9GA 1KI4A 4OHZA 1XUIA 4WAUA 3NVAA 1Q22A 2ZQ2A 3FZDA 2PBRA 2QMEA 1Z71A 1K6MA 1OS8A 1HQCA 2OP9A 2AXNA 2VQSA 2GETA 2ZFSA 1G36A 2AH4X 4CRDA 1V2UT 2Q9CA 1ARBA 5HTKA 3MO3A 1WYKA 5GXPA 2LNCA 3AW1A 1E9SA 1V2JT 4ZHAA 4NZLA 2OILA 2GCNA 1BMFD 1G3UA 3LNCA 2FOGA 4B71A 4CHAB 3DM9B 4KP0A 5FL3A 1GBHA 2KI5A 3PO1B 4Y6DA 3RS7A 2BJWA 1IHTH 1C4U2 1EB2A 4IDQA 4XBDA 5EXMA 1P57B 2QBYB 3KJGA 4DWJA 2J0UB 4AFQA 1C5LH 2Y5FA 3ETLA 3Q3JB 1AKEA 4ASUA 1SGWA 5ESTE 1P8VC 2DWOA 1TPZA 3TAHA 1KDOA 1TABE 4CH8B 1Z83A 3UNSA 3GY2A 3RDPA 4IOKA 3IQWA 1HXFH 3AB3A 2BY6X 1VCOA 3ATWA 2GVZC 2O8TA 2XNIA 4LUCA 4NYIR 3LVQE 4AC9A 1EX3A 1FX0A 4CBNA 4BTTB 2OXSA 1DAHA 3TW8B 1G7TA 2BMFA 2KJQA 2O52A 4RZ2A 2THFB 2ERXA 3VXEH 2J7PD 1IOZA 3A58B 5E2PA 3X1YA 1TFXA 1L4YA 1GHAF 3UWIA 3L0PA 2QA9E 1MO4A 3A8AA 3CRRA 2R9VA 1Z2AA 1KLJH 4JK6A 2A4OA 3MU1A 4BEBA 2ZJ5A 1T9HA 3PLPA 3SI4H 1MU6B 1RRGA 3MWIU 3D62A 2EU8A 4Z1MD 1XKBC 2ALVA 3B1VA 2O8EB 2QRZA 1XEWY 4DVGA 3SHWA 2F6RA 4THNH 1NSTA 4QGHA 5SZKB 3C14C 1QVAA 2P2LA 3SJAA 2ZIQH 4RD4A 4FWTA 2NU0E 3CZPA 2IBMA 2GTPA 2P5TB 4QGGA 1T8LA 1YZTA 3C15C 4FI3C 1DOJA 3LW7A 1QHNA 2VIPA 4KTCA 4Y11E 4BXWA 2IT1A 1OIXA 4Q47A 1GBTA 1F5RA 1KXCA 3L0SA 3NH6A 2QXJA 1U98A 2IPHA 4GPGA 3GY7A 1DWEH 2BDGA 1MRNA 4H4FA 2QAAA 4PTLA 1VCNA 1XVOA 2YC4C 1H9HE 1ZMXA 2W6IA 3B1YA 4GNKA 1E94E 1ZNYA 4P3YA 1BB0B 5HE8A 3OEEA 1IN6A 1GG6C 1ZHRA 1K1PA 4ZKSU 3BEFB 1YM0A 5FXLA 3AF0A 3P4XA 3DO6A 4RI0A 2RHDA 4P4SA 2BQWB 2QTVB 3Q5DA 3K8YA 3OEHD 3THYA 4L15A 2ANCA 1AU8A 3WP1B 4BECA 4FUJA 1W0YH 4YO9A 3I29A 2GJKA 5FPSA 1V2NT 2JLSA 3SV6A 1U81A 4NA7A 1F5LA 2CE7A 3BTWE 4G3XA 4RFSB 3BEUA 1SHYA 4M2LA 1UTJA 2Z43A 4GFDA 1BTUA 3GLFA 5EXNA 2D06A 5G4BA 3GLGB 1XZQA 2R6GA 4DCTA 4EPWA 2X2EA 1AVWA 3GOVB 1E1QD 1WCV1 3SYLA 2GCHG 1C1OA 2PLRA 2RGBA 3EDXB 2QGZA 3U60B 3MJHA 5JSZA 2ZTYA 5JMTA 2K5UA 2REXB 4IRUB 2KAIB 4MNYA 1II8B 4OHXA 1C5YB 2ZO3H 1QB9A 4HB0A 3EC2A 4BAQB 2SNWA 2BLQA 4DRZA 5AVDA 4ABHA 4DJTA 1G64A 3SHAH 2H16A 1TUIA 3AGPA 3VU9A 1MKYA 4X2YA 1BRUP 3LDXH 5DP6A 1HJAB 2ZRKA 1AZTA 4B34A 1AE8H 4E05H 5LH8A 2BWJA 3NBFA 4M1WA 5H1YA 4Y8XA 3KUDA 4A1TA 1AVXA 1S85A 2BLVA 1JJ7A 2OC7A 2P95A 1CGHA 2RH5A 3VB6A 3L8YA 4UDWH 5KPDA 4Q80A 4BFSA 1T91A 3IPYA 1HAIH 2UVQA 4NYMQ 5B64A 1GI0A 2HT6A 2FF7A 2V8OA 1MBMA 3RMNH 1AB9C 1LPKB 1TX8A 2VWOA 5DH9A 2VINA 3IEUA 4A6PA 1S6HA 4B73A 1W4BA 2G4UA 1GDQA 3BK7A 4Q1BA 2GCTB 1N6LA 2ZYVX 1WQ1R 1N6OA 4O03A 1W12U 3E8LA 1YCPK 4LSGA 2PEZA 3BERA 4CT5A 3BS4A 1LS1A 1TNLA 4GAWA 3DM5A 4U01A 2FPZA 4LJ6A 2ANKH 1DSTA 1X1RA 2ZJYA 4A8JC 1UKVY 3GMTA 3HYTA 4YOIA 3S69A 3UKDA 2VH5R 1C9TA 4OS6A 4NGAH 5GNDA 3FTQA 5AR1A 3K1JA 1G37A 1G7RA 3GDVA 1FX0B 4PHHA 4OS7A 2FJUA 1QA7A 1OE0A 4RVCA 3I78A 4NIYA 2BXTH 3NKKA 4C0LA 1PPCE 5DGXA 2R44A 4U30A 3UR6A 1GBAA 3MMPA 3LX8A 4PR0A 2ZS8A 2HYDA 3Q00A 3SU0A 4PQFA 2IHYA 2YOFA 3A7WA 4B43A 1F0RA 1QGFA 2ZRMA 4LPSA 1NKTA 4URWR 3RC3A 1BTZA 3FHTA 5EU8A 1KSHA 1WQVH 1G16A 3P27A 3QTVH 3WP0A 3WHKA 3RMMH 2JEOA 1KY9A 1GRQA 2FGKA 2FP7B 3TIUA 1EFUA 2PL3A 3CX6A 4DHEA 1K22H 2AXPA 2BMGB 3BTHE 2PX3A 1W0JD 4IMQA 3BE4A 2C77A 4W5HA 4Q9LA 2PUQH 1FJSA 3Q5EA 5L3SB 1E4YA 2HCJB 2A30A 1K21H 4OS2A 5E95A 4M7GA 2B0FA 1FY1A 1S83A 2LPRA 4AKGA 3ZVFA 4JBWA 4TTQA 3B9FH 3DT0H 1P75A 2CK3D 1O30A 1ZMLA 4B3CA 2ZE8A 5C1YA 1OYYA 4QGFA 4MPXA 4LBVA 4XTCS 3JZAA 4JCNA 3KX2A 2BZ6H 3KJHA 1Q31A 4FUBA 2DYKA 7KMEH 3S1AA 2IJOB 5DP9A 1U2RA 1O2RA 2G1KA 4ZDIA 3N7OA 1K1NA 1ARCA 2FPLA 4QL3A 5FOTA 1UBEA 2IOTA 4XSGA 2ZFFH 2HDNB 1RTKA 1W0JA 4BOHA 1W36D 3UREA 2WJVA 1OXSC 3A36A 1Z2CA 5FPYA 1GI9B 2J38A 3NKVA 4BZXA 1YZLA 2ORIA 4GP7A 3RXMA 1P04A 1NJGA 2BV3A 1SOTA 4D25A 4KFTA 5EE9A 1N6YA 4XFQA 5AUOB 3GFTA 2HLCA 1AGPA 4LK4A 1SFIA 2BDCA 1Y3VA 2F3TA 1P11E 1FAXA 1FZQA 1ZSLA 2QPOA 1GBIA 2DY1A 1COWD 1JWTA 1NMXA 2BQ6B 3UY9A 1F0TA 3RLWH 2JA1A 3VR1A 3R9XA 2W5EA 1KYIA 4BE7B 4LHYA 1BBRK 2W2TA 1QJ1B 4OI0A 2BDHA 3FMOB 5GPIB 1F2TB 1FZZA 3R7WA 3EG5A 2RAPA 2VO1A 3OTPA 4F7WA 1HIAA 3WYGA 3B6EA 1OP8A 3RXQA 1E35B 4BZQA 2HGTH 5EXLA 1E79D 5DHFA 5FBEA 1O2KA 1YCPM 3CZQA 4DSUA 2ZETA 4JLNA 1KDPA 3EPKA 1UVOA 2IEZA 1PV4A 4LOAA 4H1VA 1SHHB 2NTYC 1SC8U 4TN1A 1YPEH 2AIPA 5DP8A 1VTKA 1PJPA 1LS6A 1XEFA 1B0EA 4NKRA 1E2PA 3SU8A 4WH8A 1EFCA 3F9HA 1Q21A 1M7GA 1IN8A 2IF2A 5GJWC 3SZNA 1OFHA 1Z8IB 3E0NB 1CR0A 2JDIA 4P4TA 3BFXA 3TGJE 8OHMA 3I8XA 1O0DH 2CL6X 3ZS9A 4TYWA 4BTIB 1J17T 1WQSA 2KBEA 2QE7A 1G30B 3U7HB 1ELOA 1A1VA 2OM2A 1NY6A 5CE1A 4QNRA 3O47A 4N3NA 2WYGA 3U3MA 4ZIRA 4M9FA 1K28D 3D23A 3M7TA 2GD4B 1BS1A 4HDQB 2KBFA 2FFBA 3TMKA 2BDAA 3VB3A 3T28A 4WXRA 1N5LA 2RCEA 4DLWA 4NIXA 1E36B 4UD9H 3I61A 1J9CH 3LH3A 2JIZA 3ZDQA 5FPKA 3DVLA 3EPJA 1ANDA 5HPYB 1JMOH 4BFVA 4OJQA 1E1QA 5AUQA 1FPCH 4X8SH 3ZH9B 2YINC 4BLQA 2IF0A 3ODDA 1YE8A 3AVUA 1YCPH 1JR3E 4M1SA 2QTFA 2PZGA 3DDCA 4B2AA 2A3RA 1XB2A 1CGIE 2I1VB 1GHVH 3EPHA 1IJEA 4KODA 1P3JA 2D8WA 3UWKA 1YC0A 1P3EA 5E3HA 5GCHF 5DO9A 2H9EH 1V2RT 2HPPH 1W0KD 3CH5A 1QBKC 4HFPB 2VHTA 2Q6GA 3M37A 3VGCB 4DEXA 1O5BB 2QRNA 5FOSA 5SZJA 3TNTA 1KGDA 1YR9A 2BD3A 4ABEA 2VIVA 5CK5A 1EAUA 3SV2H 2AFHE 1NG9A 2ZRLA 4IDNA 3E2IA 4Q4HA 3CO5A 4GVUA 1Y3WA 1XJ0A 4B6EA 2QY9A 4ZKOU 1W36C 3RXFA 2H9HA 3IPXA 5HCNA 4WVFA 2AKAB 1LKBA 4URZR 2DR3A 4UNNA 2ZGBH 3LY5A 4B2PA 4HB4A 4AWXA 3K0CA 1O5GH 4BTUB 2WAXA 3ZGXA 5CYPA 3PMJA 1UTOA 2VBCA 3V3MA 2YWGA 1UTQA 4FCVA 3IIKA 4JYVH 4LK2A 3TJZA 2ZSAA 2ZGXH 2V6NA 3RXHA 4ABGA 2QU8A 4XH9B 2AD5A 5KPJA 3GICB 2WZQA 1ZCAA 1PPEE 2AK3A 4DLUA 1DTSA 2SHKA 4JMPA 1NRJB 4N0EA 4BXSA 4M1KA 1OP0A 3URDA 4AKIA 2WAYA 1OFUX 1O3BA 5E4FA 4AOQA 3SGQE 5EP1A 2ZCHP 1G3BA 2NMVA 2GNOA 2R0LA 4DGJA 1NN1A 2J7PA 3J81k 2QQEA 3KKPA 3KFVA 2N42A 2TBSA 2JH0D 1IHSH 4OI4A 3DHKH 1XVMA 2M5TA 1XWIA 3CX8A 5HE9A 3UOPA 1GBDA 4HLQB 2PTCE 3RYTC 1C1QA 4IMZA 1BA8B 4TSFA 1G1MA 2FMXA 2BLOA 2ZDKA 1TOCB 1Q20A 4PO9A 5JWRA 3ZZ7A 1S0QA 2I6QA 1SGCA 4XOJA 1RYFA 2VH0A 2XTZA 4MTBA 4KKDA 1FONA 3PMHB 1FI8A 3AV0B 5B6LA 5CK4A 1H8EA 1H8HD 2UWPA 3PTBA 1NBMD 3SW2B 2QAJA 2E1RA 3I32A 4LC1A 3BXZA 1TTTA 4TL7A 2EFCB
chains in the Genus database with same CATH superfamily
3RD5A 2QM3A 3HVJA 4LGMA 4ZXPA 1O2TA 2Z58A 1SXJE 3OHPA 2C0CA 2MR5A 2COUA 1X1AA 1RLOA 3FLBA 4NSNA 1VJ0A 4PFJA 3R40A 5M2QA 3PLAE 2B4TO 4HX2A 3IJPA 1UT5A 1R5JA 2DP4E 2MTBA 4H60A 4BFUA 1CQZA 4YT7H 1JDUA 1PJ2A 1U0LA 1GM5A 2WKPA 2NPIA 1ZMOA 1Z6EA 3MBOA 4MQFB 4PO3X 2O1EA 1I1NA 1ONNA 5DW3A 5FWYB 5KX5B 5LL6P 3R8FA 5AXCA 1DFIA 2XJ9A 1C2EA 3TXXA 2O5VA 2YNMD 4O4LB 4FCCA 3BG5A 1DO8A 1D7AA 2AF4C 6LPRA 2IHKA 2X0IA 4EBBA 4ZVUA 4MVJA 4D7FA 4ND7A 1BMFA 1CJSA 3B6MA 3EBPA 4JGIA 1ZM4A 3D81A 4L95C 2VJMB 4ZICA 2QENA 3D8TA 3EQZA 5BRNA 4TYDA 4A0QA 3KQHA 2HIMA 3PROA 1DPFA 2BDBA 2CVOA 1OI2A 1OH5A 4L8LA 3SHCH 1Y3YA 1Y8TA 2VHEA 2PPVA 3NBZC 5FFNA 5LOVF 4AQYB 2QVLA 3NG1A 3QEOA 2ORWA 4AFZA 1CUBA 4BQSA 2ZI4A 1W44A 1YL6A 3UWMA 1Z6QA 1QH0A 2L17A 1Z7EA 3IXLA 1XNQB 4OGGA 3ECAA 1MTSA 1XTZA 2J3EA 4C5CA 1J2YA 2C07A 2PQ6A 4LNUA 3EEQA 1T6BY 3SX0A 4U39A 1R4AA 2HK9A 5FJJA 2J1LA 5K8VA 3GUZA 1HJAC 1ND6A 4DLYA 3LGUA 3HXKA 5F8TA 1R0YA 3DKVA 3FGNA 3JQDA 4FCWA 1K5DA 2ODYB 5HM2A 1WULS 1Z47A 2FESH 2C04A 2IUTA 1I2ZA 1E7MA 1N4AA 1K5HA 1USKA 4G2NA 4AB8A 3KOZA 4C4OA 3QZUA 4CKBA 4LFAB 3TLJA 4FTWA 1UOQA 1YQTA 1HUQA 1AM4D 1KMQA 4EG1A 5GGYA 2ZFTA 4MRNA 4ZI5A 1B76A 4WNYA 3P52A 3VJMA 1IMOA 2PH1A 2PYIA 1E1DA 2IEIA 3NEPX 1ODFA 3D65E 2VXCA 2OHHA 3B2QA 5EUCA 3T7JA 1YQWA 5E9AA 4RM3A 3ZWXA 1C1RA 1ECBA 4A15A 5DM2A 1LBHA 2XTMA 1R6VA 2A7XA 3QE4A 1TNGA 1Y80A 4ZKDA 2W42A 4IGAA 2AYWA 3Q2OA 3KSRA 5CA0B 2EY4C 1HL3A 1W0KA 4L2IA 3OU0A 4NENB 2RHWA 4A0RA 4BB5A 2G00A 2EX0A 2WYUA 4KSBA 4NXNB 4JXZA 1ZGIA 4KXVA 4N8EA 5H02A 3ENVA 2IV7A 4ZALA 1SD5A 3NBQA 4R5MA 1PZGA 3EZ9A 5BT8A 4JYZA 3UMMA 2B2XA 1EM8B 5KWJA 2E4ZA 3G13A 3ADBA 2G8TA 3EMBA 4AG2A 4K26A 2GZ1A 3L0IB 4G1VA 4PLGA 5A5FA 1NVGA 2WVHA 2UYOA 1PSZA 3UTCA 1JHYA 3BBPA 2HJGA 4I9UA 1VECA 3KOOA 5DPAA 4LXTA 4X84A 1KVQA 5G1OA 4YXWD 1V47A 4B76A 1RXCA 5EVCA 5SY6A 1MZDA 3UMVA 5HJ7A 1RYBA 5AYVA 4WGGA 3OLVA 2E21A 2IEDA 3C3MA 1C2FA 2J3QA 1WUIS 1Z45A 2XUHA 3ET5A 4YAWA 4P6VF 4DCVA 2HQ1A 3AASA 4EB3A 5ADHA 1CEEA 4EMBA 5BVHA 2VDRB 3V80A 1HPLA 1T5OA 1ABFA 4OO3A 3CNNA 4H9GA 3ZBUA 1B8PA 2A94A 4RTMA 4UU8A 1L1QA 2XCQA 5DV9A 4BVHA 2GK3A 4I1SA 4JLKA 3N0TA 1L5HA 1VLHA 3GJ5A 4FOLA 4ES6A 7ADHA 4Q9DA 3ZDRA 1CFZA 1HTWA 2AJTA 4ITRC 2A3NA 3EUFA 4D0SA