1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
1W0KD 3TK5A 1Z8GA 1AD8H 4HTCH 1WBDA 3E8LA 1R0YA 4PC3A 1A1VA 3K0FB 5BYJA 2ZUDA 5FUXA 1EGAA 2CBZA 3QXJA 1NBMD 4DLZA 4LJ6A 4K60A 4B2AA 2W3KA 1BRCE 2GZDA 1K22H 1UHBA 4M1TA 5DGJA 4YOIA 2D7CA 1JPNA 4FXPA 2O8WA 1VITF 4DCVA 4MYCA 2P6RA 4B34A 1T32A 1UKEA 3WMFA 2P8OB 4IDPA 1ANBA 1CQQA 4ZDWA 1HXEH 1CO7E 2REBA 4LHZA 2VEDA 1TMUH 1C1OA 2VIWA 4Z0KA 2CLCX 1G2MA 3T62A 5LPRA 4D82A 4IVQA 3KXLA 2FI5E 1VCMA 2ANWA 3PCRB 1MQ6A 2JGNA 2JH0D 4OI4A 3J81k 2FS8A 2O8FB 4JLVA 1NKSA 1ZMJA 1Q1ZA 1ELOA 3LJJA 2BY5X 3IEVA 1H4WA 3C7KA 3D31A 4ACAA 7GCHF 4PC2A 2NPFA 1KDRA 4RFVA 3E90B 1SGNE 4K8BA 5BN3A 1BMAA 1GI8B 3LH1A 1GMDF 2FXRA 2GP9B 2UWPA 1N25A 1T8OA 4MUAA 1P9SA 1WBBA 2BDCA 4MDEA 3K9XB 4K81B 1G36A 5B30A 2QXHA 1ZPCA 5K7RA 2YWFA 1DICA 1SXJE 3LNCA 1U0LA 4I1OA 1QTFA 3CX6A 2XXAA 2A7QA 1M8PA 5T6GA 3OTJE 1E96A 4Z6AH 2IXFA 3K0SA 2OAQ1 3VNVA 1K1LA 4M9XA 5P21A 4ZIRB 1CEEA 1FPMA 1YCPM 3DMNA 3MH6A 4NTZA 3R0FA 1DXWA 2VQSA 5EXNA 3IQXA 2XC5A 4JZ1A 3QWCH 4UNNA 4CEJB 4D4MA 4ZHAA 1V3XA 2GV6A 2OBLA 2XOKD 1OLOA 4BAOB 2IOTA 4Q1EA 1TRMA 4LZZA 3BEFB 3P92A 3AAUA 4B44A 2ZF0H 2ZVQX 3OEHD 5FUVA 2Y7XA 1HT1E 1NY5A 4M9ZA 3H7TA 5BQ5A 1VTKA 3ZGXA 3K9HA 1ZM2A 2CF9H 4GL2A 3BTDE 1GRRA 5JCZA 4FCVA 3A1WA 2B92A 3EWSA 3SU4A 5E8EH 1QF9A 1OH6A 1E9EA 4AYXA 4NFEA 4TY6A 2EFDB 4TWZA 2ZU4A 2GAAA 3RVBA 2VBCA 1XU4A 3ZD7A 3MU1A 1W8BH 2IYWA 1TQ0B 3AK5A 4RN6A 3ZH9B 4ESTE 1JIRA 4PR0A 1P04A 2C8ZB 3QDZB 2Z6BD 3T25A 1MR3F 1ZD1A 2EC9H 1LHGH 1QA0A 1ZIPA 3RLFA 3IUYA 1EOLA 1E0SA 1S4QA 1ETSH 2V3HH 4D26A 5DISB 1P2SA 3K9NA 1OKXA 1K2I1 1C2MA 5EXMA 1MKYA 2QGNA 3PYHA 4Z51A 1X8JA 3AVVA 4LUCA 2QGZA 1YPKH 1OWDA 1EWRA 1W46A 2J2UA 3MFYA 3TW8B 3BIUH 5JBCS 1CIPA 5CLQA 1ETUA 3U5ZB 3BSQA 1JMOH 5DKMA 1CJMA 4UJ5A 2CCJA 5EP2A 3T28A 3NXPA 2ZR9A 2ZFRH 4US0R 3SUEA 1AKSB 1TGSZ 4C4PA 2QE7A 4ABIA 3UXMA 1G16A 2ZI7A 2F43A 2VWNA 1Z6YA 3MMGA 2N1BA 5LB4A 1JB1A 4JVNA 3GY4A 1FIWA 1V2TT 1A5TA 4TPYA 2EYUA 4G5OA 4LC1A 3SJBA 1GJ5H 2HNTF 1RPZA 2WPKS 5KUTA 5FXLA 3LW7A 1EESA 2NO1A 1MBQA 4B6EA 3A87A 1HGTH 3K0AB 4PANA 2ZTSA 2ZG0H 3L0PA 3ZZ8A 1JAHA 5J4HA 4D7GA 2FOLA 5DI3A 1G8YA 2CHVA 3NWUA 1P12E 4FUEA 1CULC 1IQPA 2J34A 4NCJA 4XE4A 4RD2A 3V9PA 1W2HA 4G01B 4EPTA 1HE8B 5SGAE 1DM4B 4G0NA 2A5AA 4AFSA 2BD2A 1YR7A 1VCPA 1XUIA 1SHKA 3C5HA 4JYCA 3GY2A 4GMXA 1NG1A 4Q80A 3L33A 3P8GA 1C1RA 3BRWD 1R10A 1L4ZA 5C1UA 4ISLA 4PHGA 1KKLA 4ZXXH 4EPVA 2WWIA 4DCDA 3NH9A 5BWMA 2QTHA 5T6DA 2Q6FA 1BJUA 1A5GH 1XXDA 2WWGA 4L5BA 3HPTB 1AY6H 2NPIA 2VP2A 5EZ5A 3WNDA 4TQUS 1Y3UA 3EIQA 4FU7A 4JSTA 3PUXA 1A3EH 2ZQ5A 1UKVY 2AGIX 3RXRA 1P62B 2QA5A 4B48A 4DT7B 1P3JA 1GDUA 2F9MA 2QT1A 2Y82A 1NLFA 3ZQJA 1XJ0A 4CRWB 1Z2AA 1W2KH 1HV8A 3E1SA 2IYZA 1II9A 5HE8A 2JLZA 4QOSA 3B1VA 4ABDA 4IDNA 4MGYR 4FUDA 1LKAA 3E1XB 1KAOA 1N1LA 2STBE 1OIWA 2ZJYA 1IY0A 1FV9A 2G81E 4CDGA 5L3QA 3Q00A 3GFTA 2BD4A 1LO6A 1KTVA 1N6PA 4W5WA 4FUCA 1O3JA 3I77A 1SSXA 1GVLA 4UD9H 3U44A 4GUXA 2ZITA 1RJ9B 1UVSH 3CW2A 1TNLA 1MO6A 3OE7D 1O2YA 1W4RA 3TSZA 3CUEF 4DKXA 2C8YB 3H0KA 3ZZ3A 1UBGA 1COWA 3RXGA 1FY5A 2CE7A 2HJVA 3BB3A 5DYIA 4JMYA 2A5IA 1N6NA 1QRWA 2H9EH 2ZYUX 3WRXC 3JZ2B 3M5LA 3V0XA 1IN7A 1D9XA 3SJ9A 4YOJA 221PA 4HUTA 2XBYA 3AM1A 2WJGA 5FR2A 3S7KB 2IJOB 4PPGA 1W5TA 4KU4A 3LFUA 4P31A 1FN8A 1KIMA 2HLDD 1NS3A 3R9IA 1W3CA 1KDTA 1H9IE 1O3CA 3RAPR 1FW6A 3C16C 2GNOA 1FTNA 1W13U 3FHTA 1XF9A 2EFCB 1PQ7A 3VB5A 2O8EA 1VGCC 4CREA 5F6MA 2SGPE 3BTEE 4IFBA 1HEIA 2OBNA 5HPYB 5LD2C 3SU8A 2PFEA 4DJZB 1W0KA 1YJ5A 3LLUA 3NPSA 4F4CA 1G20E 1H9HE 4QGGA 1XMIA 1US8B 4Q7KA 1UMAH 3F8TA 3PB1E 2FSGA 1RYHA 3LBIA 1NBMA 3F68H 1T5IA 2A4GA 2Y5GA 3A37A 1ZINA 3WNBA 4JLDA 1V2MT 1BTYA 1K1OA 3K0EA 2PLXA 4HB4A 1E79D 3MRSA 2ZRDA 4ZKRU 2OBMA 3ADBA 3QF4A 1GJBB 1A2CH 1UTOA 1TE0A 3GJ6A 1YZNA 1XBTA 3IQWA 4MYUA 5C46F 1R5OA 2RGCA 1T8NA 5GVRA 3TVDA 5TB5A 1GBMA 2VRWA 2J92A 3MO6A 3A82A 5KU1A 3W90A 5AFYH 1XZQA 4PHFA 3L43A 4B47A 5E0GA 4AG1A 3Q5EA 4RD3A 4C0BA 2TRMA 1MD8A 3W6NA 1Z71A 2W2TA 1W47A 1GBFA 4PAOA 4ABHA 1Z06A 4E7RG 5CHAC 3ETLA 3CRW1 4BFUA 5LPEA 2R0LA 5KOYA 4OHVA 4DZZA 1QJ6B 5AUOB 3SQWA 4DRZA 1KI1A 1XD2A 1XX6A 1NRQH 2ZANA 1ZMNA 3I4LA 2ZI6A 3H7OA 2XWAA 1G3MA 3FFAA 2GVDC 1ZHRA 4CT4B 1WE2A 2WKPA 4N3NA 1Z2CA 2OTVA 1DOJA 3DDCA 2GKVE 5CM9C 3QUMP 1DE7H 2GJ8A 4HSEA 1XCPA 4AKHA 3AF1A 4FWIB 1UVUH 3K65B 3RS3A 3I3SR 1EXFA 3K09C 4O3UA 1RFNA 1NF3A 4JZEH 3CIOA 4Q9KA 2HYIC 1HAOH 4UNPA 2G5NA 3ENSB 1G3EA 1E2EA 2XOKA 1FQJA 2IS6A 1QBOA 5UKDA 1TX4B 3PMJA 3SV8A 1ZTJA 1XD8A 4M21A 3B9FH 2ZRGA 3OEHA 3FVFB 3KEEA 3UMFA 2BBTA 3MJHA 2X19A 1C9KA 4G5QA 2GJSA 1C4U2 4Q9JA 2F55A 3RP2A 4MKGA 1KYNA 3GEHA 1UEIA 1NZQH 4S2EA 1DVAH 3W34A 2HT1A 2EW1A 1BB0B 1A46H 1KTSB 2F9OA 3QBTA 3Q72A 3GLIA 4LC0A 3SR0A 1GOTA 4LV8B 2QM8A 1HAHH 4PZLA 1N0VC 1GBHA 4J0QA 3THWB 1XUKA 4OS7A 4BPBA 1ZMXA 1WSSH 3PUZA 3VR2A 2FX4A 1HBTH 4H42U 3GCGA 3PFIA 4DCTA 1SULA 3MH4A 5J47A 4A8JC 1FX0A 1DFPA 2E1RA 1A5HA 4AWXA 1MCTA 1O3IA 4AB9A 1GJ8B 1ZOMA 2GF9A 1AE8H 4GVUA 3HU1A 4MPWA 1KIGH 2ZREA 3LT3A 3RRZA 1QBVH 2BDAA 2R6DA 1FIZA 2VHCA 5JZVA 5D3MB 4NKRA 3CRRA 1A7JA 1UTQA 1F60A 1M7BA 1S85A 1CBWC 2NU0E 4ZV4A 2VIPA 2QXIA 3RMOH 2PZGA 2GEDA 3MUFA 1ELVA 2IYQA 1UTPA 3VAAA 1D2NA 5FTJA 4Q18A 2WIBA 1FPCH 5DH9A 4Q7LA 5TCAA 4KXFB 1VKJA 2ILNA 5J5CA 2H9HA 1AIXH 2QORA 2JIZD 5L3SB 1VG0B 3VXFH 5TMPA 2ZRBA 1FXYA 1QVRA 1Z8RA 2O8DA 3FWYA 2ZP0H 4UJ3A 3AVYA 1VCQA 2VP0A 1QJ7B 1M1YE 4ZO4A 2B8WA 2CN0H 1ZNYA 4TYPA 1KYIA 2CL7X 1LMWB 1NRNH 1GL6A 421PA 1EAUA 3FPAA 1HAGE 3CWQA 2V0BA 1OYYA 3T06B 1HB0B 4WF8A 4ABEA 1MKWK 4O2RA 3E3TA 3KX2A 3OX7U 2HPQH 3Q3YA 1F5NA 1TMKA 3Q7PA 3L3TA 2UKDA 2MSDB 2ZI5A 3VX4A 1O2OA 2NG1A 3G0HA 2ZFQH 2JETB 1Z6EA 3ATLA 1E0AA 2B7CA 8GCHG 5HCNA 4UQOA 3ZZ5A 5KSZA 1Z08A 1G5RA 1ZU5A 1ZM9A 4IXNA 3FZDA 1L1NA 3CNLA 2GCHG 4ZDKA 1E69A 1AA9A 3H1TA 2ZGXH 2ZJOA 3BTWE 2IS4A 3KL6A 2ZI3A 2UZIR 1KSGA 1ZCAA 3PXGA 4GRAA 2OSBA 4B2PA 2C98A 1EFCA 5GXPA 1P9UA 3BTFE 5IT5A 1IY1A 1IQGA 1GMHG 4IDHA 4JS0A 4NCHA 1CA0C 3HKIB 3OE7A 3GOVB 1E2HA 2FPMA 4YZUA 1SVSA 3SGQE 2PKSB 2BDBA 1U0HC 2FLRH 2PX0A 2Z9KA 1QCPA 2A9KA 2GZ9A 1BRAA 3IO5A 1AUTC 3I78A 4N0EA 4XSKU 4ZCIA 2ZAOA 4BRWA 1LVBA 1ESMA 2ZNKH 4UXIA 3TE6A 5EXPA 4HB3A 4DLUA 2GCPA 2J0VA 3GLFA 2BY8X 1SGTA 2XZPA 5JBBS 2HLDA 1EPTB 3EPLA 1LFDB 3R8FA 1TABE 4LK2A 2C78A 4AG2A 2NO6A 3NKVA 2GVZC 3U6BA 3FFGA 2ZI4A 2QM7A 2GCTC 1Q1QA 1TNDA 2OM2A 2BDHA 1SVKA 4Q1FA 1W14U 2WV5A 5FTNA 2AFQB 1UADA 3SGAE 1L4DA 3EA9A 2BM2A 3GY8A 3QKTA 3EA0A 2BD8A 1DWCH 2GZ8A 621PA 2QF0A 3I1FA 2GGVB 2AWNA 1O2XA 4BTIB 3ND8A 3U7GA 3B78A 1TMBH 4OI0A 1S1CA 3GJXC 3IHLA 4BANB 4RZUA 2WPDD 4HATA 4HLUA 1H8DH 1E79A 4NFFA 3LH3A 3SUDA 1AGJA 3BFKA 4TQ9A 2ZHFH 3LA6A 4ZKEA 1T9HA 1OSSA 1MZAA 2ZYVX 1F0SA 1E0FD 5FBWB 4JL8A 5EW1H 1W7XH 3DVLA 1JQLB 3EW9A 3IHWA 1W5SA 3QBVA 1MAXA 2ZETA 2H5EA 4X8TH 3LWNA 3P17H 4KLZA 2PHBA 2JKHA 1G4AE 3I8XA 3F9GA 4SGBE 4H9GA 3PITA 4I31A 1S96A 2ZUCA 1IQMA 3LKWA 1GDNA 1DANH 1W12U 1C9TA 2VWMA 2FDCA 2V3OH 1NRJB 2WHXA 4Q1AA 5CB6A 4TYYA 3BTKE 2BWJA 1SVMA 1E2KA 1GJAB 3MFJA 4JT4A 1VJAU 1YP9A 1SKYB 4HFPB 5DI9A 4Y0VA 4AG5A 1NESE 1DAKA 4CW7A 3RU4D 4LJ4A 1LKBA 1A0HB 3K9LA 2IBMA 4TN1A 1ZSJA 3DEFA 3HWSA 1W36D 1Y59T 4TMVA 1TLDA 3CS7A 2VIDA 4FMDF 4GSYA 1RVDA 2GAOA 1Q12A 4LXBH 1VCNA 1UTKA 4RFSA 3RSLA 1C2IA 2QPTA 5LB2A 2X2FA 3CX7A 3I32A 1G291 4MYTA 3CPEA 3EZFA 3TITA 1MU8B 1DWEH 1YZQA 3RUOA 4DXAA 3M6AA 3GDUA 1AGRA 2IHYA 3BTTE 3CH4B 1Z5ZA 3QGJA 1NY22 3SU1A 3NWJA 3D62A 4R8TB 5LDDC 1Z0KA 1TA6A 2BJWA 3O8DA 1C5OH 5EP4A 1Y3VA 1X8KA 1KLIH 2ZI9A 2LCFA 4ABGA 1N2CE 3UWIA 1O3BA 1MAYA 1GCDA 5G4BA 1O3LA 4PZZA 2AD5A 2HDNB 1PLKA 1ZMLA 4UXHA 5A09A 4R7ZA 1RXPA 2ZDMA 4IOJA 3GMTA 2C9YA 1QR3E 4CEIB 3QIAA 1WU1A 1KXEA 3CBQA 4C7OA 3A7TA 4UNRA 4HZUB 2J46A 1E3MA 5EODA 3MD0A 2UUKB 5EXXA 4HAXA 2BOVA 4MNXA 5CIWA 3RC3A 1UPTA 4F4JA 2JH5D 1XEXA 1CE5A 4O97A 3QGNB 1XCGB 4TSFD 4RCYA 1O3YA 4DVAU 4NIVA 4R98A 3RWOA 1TWXB 1BTUA 1LTQA 1S6FA 2C8WB 4Q4AA 4HI0E 1VYVA 7KMEH 3D6TB 3AH8A 4ZXYH 2FZZA 3EC1A 3E5HA 1GJ6A 1C5LH 4X6PA 1X6VA 3ZZ9A 2O9QA 2IEYA 2GZAA 2IPHA 1V2KT 4M1KA 2ZTXA 4HUQA 1J9CH 5FPHA 1EZSC 1GMCG 3DKVA 3NBYC 1V2RT 3SQHE 1FAKH 1VMAA 3FB4A 1NPMA 4AGJA 4PZYA 5JI2E 1EFHA 1TNKA 3K70B 1DT2A 4TMTA 1GHAF 1QNJA 1E9CA 3SO3A 1OWEA 2C96A 1F0UA 3IPYA 4KO8A 1O35A 1DO2A 1H65A 1O3EA 4AG6A 3SNEA 1UDXA 1G8GA 1CSOE 1Z6TA 4EKDA 1Z3IX 1EFUA 5BPEA 2XAUA 1OH8A 1P75A 5CB8A 2JIZA 2HF9A 5JB9S 3SZNA 2WV9A 4KAXA 2P0EA 2JJ8A 4VGCC 4TL9A 4BTTB 2XXLA 3B13B 5KSPA 3FANA 2ZTYA 4WVPE 4D9RA 1UHBB 1G37A 2DFLA 3WYGA 1CBWB 4QJ4A 2C3SA 3IIMA 4Q4HB 4HZHA 1MTUA 2CXVA 4DWJA 3NVAA 2HCJB 1XWIA 4A1TA 2CHAC 2A5KA 2ANBA 2SGFE 1RC8A 2PX3A 4BFWA 1W36C 1DTSA 2DHRA 2YWEA 1SKYE 1OP2A 4G5SA 1SL3A 1C4V2 2IX3A 3M7QA 3GJ7A 2QI9C 3F5FA 4F4IA 3D8BA 1SBWA 1OFIA 1H8HD 1MMJN 4XBBA 4HDOB 2IYSA 4GCHG 5A0CA 4M2LA 4WXRA 1AB9C 1HDTH 1U0JA 3QG1A 3HGNA 1C1UH 2PT7A 3ZS8A 1LHFH 2ZQ2A 1GI0A 4Y6DA 3BV9B 1ZNXA 3T5GA 4JLAA 4MGZR 4PO8A 4LK4A 1LHCH 4G5GA 2EEKA 5EGMA 3B9PA 4BECA 3CR8A 1Y5UT 3QXHA 1IQEA 5JHHB 3X1WA 2GRJA 1T8TA 2ZGBH 2QAAA 4U2WA 2EVWX 3ZZ4A 1R0ZA 4FCWA 1TBRH 2JDID 4MRNA 1FY3A 2RB4A 1PLLA 1BTPA 3NBXX 5FOUA 4DJTA 2QQ0A 1A7SA 3MNCA 5AJWA 5EW2H 1E1RD 2ANKH 4K1EA 2H5CA 4NL4H 1ZU4A 3MJRA 1MD7A 4X8HA 2R6FA 1P2OA 3ELAH 1YCPK 4E03A 4DB4A 5A0AE 2BDYA 1TNJA 3I73A 3PLPA 4E22A 1E2JA 1F6BA 1YCPH 3BK7A 721PA 3VR1A 4M1MA 5EE0A 2Q6DA 1NMXA 1TBZH 2KAIB 2AIPA 4R0IA 4FW9A 5DO9A 3SU5A 1RS0A 2A1DB 1KDQA 3F9FA 1C5XB 2AYWA 3CRVA 1P10A 4ABAA 4KBFA 4M9QA 4HB2A 3ATWA 4XTRA 3QE0A 2WPHS 3OU0A 2QNRA 4B2LA 1GHBG 1CR0A 1EAIA 3GCNA 1VJ9U 1ACBE 1Y5AT 4NMMA 1INCA 3W8RA 4YDSA 1O3NA 2D1JA 1X8LA 2PT5A 5FTKA 2GEUA 5DIFA 1J7KA 1BH2A 5AFZH 1YKSA 1NY6A 1Z8FA 2XB4A 1Q44A 3O47A 1OH5A 2H6MA 1ESAA 5EE9A 3KGPA 1ZC3A 3QKSA 1XX9A 2WPDA 1ZPZA 3F1SB 2SGQE 1EOJA 4MGIR 3RC4A 3QQ5A 5DPAA 4AYTA 2GXAA 4V0MA 3BTME 3TNFA 1GI9B 2FSIA 4ZCLA 1XZPA 4Y0YE 2OQUA 1BTZA 2YWHA 1GI7B 3QUSA 1I2MA 4YMTA 2QZ4A 1HRTH 1O2UA 5JS8A 5G53C 3ND9A 1O31A 1JQJC 1D6RA 2QEQA 5EJEA 1JXMA 1LHDH 4CRFA 1V2QT 3UG6A 3S1AB 4B3BA 4CT5A 3KKNA 4M9SA 2C99A 2QY0B 1GVNB 4JLJA 5H1YA 1GWNA 4GI7A 3CONA 3TUZC 1THRH 1LV7A 1ZD8A 3LJOA 5DP8A 1TGNA 2FGKA 4H6SB 1TQ7B 3BORA 1CGIE 1QQUA 2ZFPH 521PA 5B57C 4HI3A 3D23A 4PHHA 1G18A 1XTQA 2FOFA 3NBFA 3SW2B 2O52A 4CBOA 3TGIE 2GTBA 3HYTA 2PSYA 1L2TA 3FHCB 1GBIA 4MTBA 1Y8TA 4ZH8A 3FP8E 3DL0A 2VGCC 2DY1A 2ODBA 5JI3E 4JYUH 1FUJA 1O3KA 3NHAA 4EFMA 1HFDA 3DHKH 5HZKA 1GVZA 4PAQA 3HP1A 3GCHB 5FPYA 1ZM7A 1XXHA 5KSYA 3ADDA 3DA9B 1NSFA 4UONA 1XTSA 4V0KA 2SGEE 2YNAA 2IXEA 4JBYA 3GLHB 1GITA 1MO5A 1LPKB 5E3HA 1FP7A 5EXTA 3ZV8A 2OXSA 4I1VA 1GGDC 2B7DH 5KDDA 3E70C 1HLTH 2ZSAA 2FEQH 2Z4SA 2BHGA 4V0OA 5L3QB 1XTIA 1ETRH 4DCUA 3GISB 1NJFA 2W0MA 2PLFA 3RWMB 1Z1JA 2ZEBA 1DG1G 2BQ6B 3E0PB 1MTSA 1C1SA 1K1JA 3ZZ0A 3TPIZ 2FWRA 2P3TB 3QPUA 5F2EA 4K8OA 1QL8A 2BMGB 4BAKB 4WWYA 1AS2A 4MA4A 2OP9A 1PJPA 5HYOA 2TPIZ 4P0TA 1N6YA 1BBRE 2IK8A 4ASUD 3SNHA 1EJMA 3SOPA 4TSFA 1E9BA 4MKFA 2D7DA 5JBTA 1T3LA 3Q9LA 5ELXA 4JVLA 4LDJA 1MKXK 1SLWB 1KMHB 2H1LA 4M1YA 3EA8A 4Q47A 1GHXH 1PQ5A 1MKXH 5SZJA 1C5NH 4H4FA 4ZCMA 1OFHA 1UTJA 3AVUA 1GKUB 5DHAA 5JSZA 5FAHA 2F3TA 1DLKB 5JWOA 4NA9H 3DM5A 2D26C 2OESA 5E7IA 3ECCA 3I92A 5JPMH 3EAJA 4BWYA 1SR5C 2A7HA 4JCNA 3AP3A 4IMZA 2O8EB 3H09A 1C9PA 5DO4H 3B6EA 1O30A 1OV4A 3A1SA 4HB0A 1V5WA 2A2QH 1EATA 1AVWA 2QN5T 4G5RA 4WAUA 3X2SA 1HT2E 1P2QA 3U4QA 4ZPXA 5G41A 2J0UA 4WZBE 2G00A 1BT7A 2F3RA 1G9XA 3TQCA 3U3RA 1LPZB 1SXJC 2BYAX 4AYYB 5B6LA 1Y5BT 2F9VA 1W10U 1LY1A 4F49A 3M61U 2QY9A 4A82A 3V4RA 1ABJH 1G1MA 5JJKA 1UK2A 2V54A 2YOHA 1X7AC 1BA8B 3SC3A 1P61B 1W1WA 1Q1EA 1A3BH 1OP0A 3ZLJA 1VYUA 3AP2A 2B7BA 4H1VA 3AVPA 1YR6A 4RD6A 4I8HA 1CVWH 1S2MA 1WRBA 1Y3AA 3A58B 3KJGA 2B0FA 4OM9A 4HYYA 1CHOG 3ATIA 1EX3A 3BN9A 3SBEA 1Z28A 1O39A 1E9RA 2GJKA 1C5PA 1XUGA 3TGKE 2P93A 2W6ID 2OXCA 5J4VA 4XH9B 9LPRA 4ZI3A 5B58C 3RDZA 1H8HA 3FMPB 3T1QA 1OS8A 2ALPA 1HAPH 2G3YA 4WY3A 2ONKA 1UJ1A 2H7VA 4D6PA 1UF9A 3NEJA 2AWOA 4GOJA 1JXPA 3ICQB 4OS6A 4PQYA 1DUAA 1QRZA 3MTYA 1Q2WA 4AURA 4P4SB 4Q7XA 2QROA 4LYHA 3BG4C 1G8HA 4D7FA 1S81A 3VNUA 4LBZA 4EJSA 4BFVA 3QK1A 1L2EA 3LXRA 1L1GA 5JEDA 1SQAA 3FMIA 1O2HA 4JZKA 4KV9A 3RDPA 4UNQA 2BLWA 2JDIA 2JLXA 1ZRKA 4PHTA 1P2UA 1P3EA 4RD0A 2Z9LA 4GZMA 3WMGA 2XZLA 3DFJA 1E1RA 1N6OA 4HAZA 3TVTA 4EDHA 1O2KA 1J8MF 3QKRA 1LCYA 1TPPA 3W6PA 4DLTA 3LRPA 3UMRA 1L4YA 5A0BA 3ONWA 4B43A 3IITA 2AXNA 1PPHE 1ZNWA 1TOMH 2VP4A 2EU8A 1SGFA 5HM2A 1P2KA 4Q1BA 3LBNA 3RS7A 4A0FA 3GCTF 4JIMA 2NGRA 1KO7A 1PLJA 1RIFA 4LYJA 1NIPA 1O32A 3OEEA 5TJXA 1E34B 1D2EA 2V35A 2XBWA 4NZQA 2G1JA 3H84A 1TTTA 2PJRA 3UR9A 2CXXA 4MQBA 1CJVC 3VKGA 3M3SA 1XM1A 2QP3A 2IS2A 4GPTA 3F0TA 3FHOA 4B71A 4C3ZA 1GBDA 2P8OC 4QNRA 4MUBA 1A2BA 4LRWA 3THYB 4NBSA 3VHLB 5C5OA 3C8UA 3G5UA 1T8LA 4SGAE 1B0EA 3VEQB 2Q3FA 1L8QA 4FXGH 1W0YH 2A4OA 1VDZA 2DFKB 4FMBB 2QMUA 1CXZA 3QJYA 2WPLS 3R9XA 1QHHA 2J59A 1GL0E 2YOFA 4KCGA 5C1XA 1E1QD 2QL6A 4UE7H 1KMQA 3MSXA 1XB2A 1R2QA 2QENA 4M8NE 3QI2A 2ZSFA 4GSOA 5C4MA 3VFEA 2AKYA 1YE8A 1C4Y2 4XVQA 1XVOA 2Y8EA 3PWCA 1AK2A 3SJKA 3N2IA 3V3MA 1JPJA 3F9HA 1NBME 4QKQA 2OCYC 4O3TA 1RRFA 5L3RA 1M74A 1V2WT 3U7FB 2BQWB 3FE2A 2ZROA 3PMHB 2LKDA 4ISNA 1P2TA 1TX6A 2PLRA 2WAXA 4NDZA 2Z3EA 4TZ6A 1GBEA 1HAYB 3KQHA 1KY2A 4EIWA 3U3JA 3OY5U 1GJCB 2OFOA 5CE1A 1G3RA 2P67A 1YPJH 4A2PA 4QJ3A 2XTMA 1II8B 1YZTA 3O8BA 2UUJB 3SV6A 1AFQB 3ZVCA 1O2QA 2R9PA 5EXSA 2EQBA 4LBVA 2DCUA 4AD8A 2GT7A 3U61B 2XW9A 4AKGA 4IS5A 1X86B 3OTPA 4QBGB 1O2PA 1JRSA 1UBEA 5KNDA 1ZSLA 2WPIS 2ZPSA 4JLPA 4PAMA 1EG7A 1J16A 4TQAA 3MU5A 1SHHB 2OLGA 1TX8A 1B0UA 1G9IE 3UIRA 2HF8A 2ALVA 4WXIA 1AHTH 4IRUB 1QZXA 3LX5A 2F9PA 2SGAA 2FOAA 3REFA 1Z22A 2QG6A 2H5DA 2GF0A 1R0XA 3PENA 1FY8E 4CRBA 3BD9A 2FSHA 1Z0JA 1EWQA 2Z9IA 2A32A 3QENA 1KY9A 3TLOA 5KDLA 5J4LA 3RXBA 4NSVA 3AF0A 3UWKA 4Q4JB 4M53A 4Y71A 5FR1A 2PSXA 3HJNA 1C2JA 2D2EA 2A3RA 1HPGA 3GP8A 4OS2A 5AUQA 2WWXA 1LB1B 3SUGA 1M34E 4X2WA 3K0FA 2LPRA 3UQVA 2RGNC 1LQDB 4ASUA 1Z83A 3SJ8A 1EX6A 2GKSA 3TGJE 2WSMA 4GAWA 4A9AA 2ZJAA 2OCBA 4X2VA 3M37A 1IN6A 2X1VA 1CTQA 5C2ZA 4L8GA 2G77B 2WYJA 2Q9BA 3LC5A 4WJG2 1ZC4A 1SMFE 1ZZZA 3T1VA 1N5IA 2BQ7B 1QB6A 1MZDA 4QM6A 4A36A 3KB1A 3E6PH 4OQNA 5AF9H 2R8RA 5BXQC 3W94A 2O0KA 2WMOB 2H9TH 4Q7JB 5M04A 4D25A 3AKYA 3NCLA 4JVMA 1OOKB 3MHWU 1OT3A 2IF0A 2HALA 2NO9A 1ZJ6A 3ODDA 2Z43A 2SHKA 2ZRPA 3DM9B 2G83A 3U8RH 3KQEA 4OK6A 1P0SH 2G51A 5FBRB 4ZKNU 1ZLRA 1HA3A 2PTCE 4JLMA 5TV2A 4NZYA 1RFLA 2E9SA 4NGAH 1J90A 4I8JA 1KI2A 4I32A 2FMXA 4OI2A 3GLGB 4FIDA 4TYDA 4X1QU 2GZHA 3RMNH 3QPVA 1LVYA 1PYTC 2ZHDA 2FOGA 3O8RA 1P01A 4Q03A 2OZEA 4WOPA 3T26A 2BY9X 2ZSDA 4YLUA 3N70A 2YV5A 1NN0A 4Y8YA 3QF7A 5HR5A 1TF5A 3LD9A 5GJWC 1R8SA 1MTVA 2TGTA 1ELBA 2REOA 3UFAA 3ATMA 4KKDA 1SGQE 1BOFA 3ZVDA 4NONA 3CENA 2PL3A 4GP7A 1DLEA 3HGPA 1KDPA 3I5XA 4LI0A 3VMFA 3BIVH 1O3MA 4HGCA 4ZIRA 1XUJA 1DY8A 3P70B 4AGKA 2OUKA 5ESBA 2WPMS 1M2OB 2CJWA 4XWKA 1N3BA 4BAQB 1LTOA 1A0JA 4TMWA 1C5ZB 2HCBA 1ZM3A 5DP3A 2WJYA 1W11U 2W83A 3DOFA 1GNQA 1V43A 2P5TB 2TIOA 1E2NA 3P4YA 1D3TB 5FL7D 1TFXA 5GJCA 1YPEH 4LHYA 3Q5DA 2W6IA 4LJ9A 5I46H 1DSTA 2RA3A 2R6AA 2GMTB 4WXPA 2BKEA 1VYTA 4A1XA 4LYAA 4TTQA 4NIXA 3WHKA 1O5GH 3BBPA 3HU3A 1RJXB 1HUTH 4HEJA 4OS4A 2OD3B 4KSBA 2J95A 2R3YA 1YPGH 1CP2A 5KTYA 3L8YA 1X1RA 3Q85A 1HAVB 2AS9A 2BXUH 4X1NU 2CGAA 3DKPA 1PPZA 2O8MA 3EYDA 4M22A 4J2YB 5FOWA 4AFQA 3QZRA 3AF3A 2AMPA 2GCHF 3SJOA 1ZGVA 3RRYA 3FMFA 1F2TB 4RFSB 1D4PB 1GKIA 4EPRA 2TBSA 1V2LT 3KJHA 2BKUA 3TH5A 4HLCA 1FONA 1GMHF 1AKEA 4UFFH 4NHOA 1TF2A 1P06A 1HTWA 1QRAA 4M1SA 4RZ3A 4LPKA 2RCEA 4A92A 2HVXA 2I6QA 5JBAS 4B33A 2V6NA 3GJ4A 3MNXA 3RXUA 5J4YA 1G6HA 2B8OH 1OIVA 1HQCA 4BFTA 2ULLA 2JJ2D 2LNCA 3VB7A 1THPB 3A88A 3AAVA 2R6GA 2FFQA 1MTNB 1A82A 1KSNA 4ZKDA 4O0MA 2XBVA 5AVDA 4Q7YA 1FFHA 3RNLA 1UBCA 3SV7A 1OF1A 1OKKA 4HLDA 1CHGA 1HIAA 2PKAA 3DFLA 2FU5C 1OWIA 3MU8A 1SGYE 4LZ1H 1WDTA 1CS4C 4GNKA 1S9HA 2QAGB 2ZA5A 3RRNA 1KJYA 3KNXA 1LNZA 2VA8A 5FBLB 2F9LA 1NFXA 3GLFE 1XD9A 2QA9E 4D4KA 2BD5A 2CV3A 1VCWA 2QAJA 4LJAA 3T61A 1D9IA 4Q4AB 1E1QA 4Z8YA 2ZSBA 1A0LA 2Z5FA 1GRNA 1NMYA 1UJ2A 2ZU1A 4HAWA 5BN4A 3LVRE 3EE0B 3NEYA 4NYMQ 2J94A 2OBOA 1SVLA 1G3BA 2W6JD 5FUWA 3GLGE 2VP5A 5LH8A 1B23P 5DLQC 1OWJA 3TIUA 1TPAE 1R4AA 3KIDU 1ZSKA 1KOFA 4A0HA 1K1PA 1G3UA 3FKQA 2JEOA 3TMKA 5BYKA 4OHXA 4YO9A 2XTZA 5JECA 5JDUB 2VHJA 2AR7A 4AOQA 4DSTA 1E36B 1RD3B 3ZD6A 2QIQA 1JJ7A 3MWIU 3R3GB 2ZUBA 1PZNA 1GBJA 4F4OC 1GBCA 3BG8A 5CDFA 4GZLA 2ZHWH 1ZUIA 2O0HA 1M7HA 2P2LA 1GBBA 4KTSA 2ZRAA 1AO5A 2NU3E 1DDJA 1YZLA 1NFUA 3R8CA 2C77A 4UFEH 1T0JB 3KQCA 3DHWC 2A7JA 1XP8A 2I1VB 1SZPA 1QRXA 2Z4RA 5IHPA 3A7ZA 1RJ9A 4DGJA 3HDTA 4JKYA 6CHAB 1JEDA 1JAIA 4FI3C 1GHVH 4KVGA 4M9FA 3C5CA 1V2OT 5TXGA 2ZPRA 1N5LA 4A5TS 3BERA 4DLSA 5T1VA 2GJAA 3A8DA 1O2GH 1QURH 4X1SU 2J87A 2G4TA 1EJNA 4A0RA 1UKZA 1N5JA 4NIYA 2GEVA 1Q0UA 3MH7A 3B8HA 2ZU6A 3ZVLA 2Y7ZA 4FUBA 2BBWA 3I29A 1W4CA 4BLOA 1DAFA 2HLCA 3LO5A 4DT1A 3FP7E 4C30A 2AMQA 1CT2E 4QGHA 1VR1H 1J70A 4E06H 1DAEA 3EZ9A 1WXQA 4RKEA 1YPMH 5C5NA 4W5HA 3TH4H 1EB1H 3BTHE 1IY2A 1KXFA 5HE9A 4M4SA 2HPPH 4YMWA 3ZZBA 1GHWH 4MYHA 3OY6U 3WNCA 3EC2A 4TLBA 3UREA 1WAYB 4R9UC 1ZNZA 3VKHA 4WMEA 3B9QA 2JAQA 4YLQH 3S69A 2FFAA 3NTUA 4AZ2B 2GJ9A 1US8A 2XC4A 5AWFC 3OIVA 5KYKA 4OQXA 2A5YB 1C1MA 4AKEA 4WMDA 1P03A 5FH9A 1GBAA 2ZYWX 4FVDA 4YT7H 1WBGB 5CM8B 4DCNA 4KITB 3V12A 1O33A 4DDUA 1O87A 2P94A 3PEWA 3AVZA 1E37B 2VP9A 3Q7QA 2FX3A 5AJYA 1KJZA 2IN2A 3IG6B 3NC1C 1N0UA 4YC7A 2EWVA 2ZHEH 1FQ3A 3CPHA 4OKSA 4Y10E 4M0LA 1KI6B 4BNRA 9ESTA 2ZPTX 4XIGS 4QNMA 1N6RA 1XMNB 3F3YA 2OQ5A 1KKMA 1KDQB 1G3CA 2A2ZA 1V2JT 2ODWA 1FNMA 2FV8A 1ELTA 5EE3A 2XJ9A 1GMCF 3PIRA 4KFSA 3AASA 4B74A 2AEIH 2BM0A 1WQVH 1R6BX 3RXSA 3LX8A 2ZYTX 3VPKA 3TJUA 1WMSA 4EPXA 2GBLC 1QHGA 2YC2C 4BEJA 1C5UA 1FN6A 1K6MA 4LX0A 1P9RA 4B75A 2NO7A 3PJRA 2JETC 2QC2A 3SQXA 3RS2A 1HJAB 4DCSA 2D2DA 3M7UA 3QKSB 5DP5A 1KSHA 3TUJC 2GDDA 2F1IA 4MGKR 1G32B 1XUFA 2OLKA 2Z94A 2D3WA 5KNBA 1SFIA 3RXIA 3T5FH 1SG8B 4XWOA 1FPHH 4QG7A 5E7JA 4BTUB 2ZTZA 1RW4A 3AVQA 1SVOA 3A1UA 2ZZUH 3A8BA 4BFZA 4BEBA 1J8AA 2RGEA 4JBWA 3UK6A 2Q3HA 2P3FH 1MRSA 1SHZA 1E94E 3LGYA 4NA8A 5DG6A 5FL7A 3QXXA 1C1NA 3U98H 4CHAB 2KE5A 3QZQA 4B32A 2PKSC 1J14A 1NN6A 2JLQA 4WH6A 2P16A 3RMLH 1SGIB 3B2EA 1V2UT 1NVUQ 3EZ6A 2VIQA 5EUMA 2GESA 1GHYH 3X1ZA 3KKQA 4UKDA 1TQ4A 1NP6A 2ZU2A 3REGA 5FCKA 1OXGA 1U81A 1S5SA 4FN5A 2K5UA 3SEAA 3C1KA 4RKOB 3A81A 3WXMA 4EUNA 3THWA 1MH1A 4GCHF 1WP9A 2BMEA 3PUVA 3U3MA 3SYJA 2BBOA 1EPTC 4IJMA 1YC0A 4ZDIA 1XJCA 5E2PA 1P9WA 2BJVA 3RC5A 4RD1A 2QSYA 1U2RA 1NROH 4JZIA 3PMAB 2JLUA 3GCTG 5G40A 3P8NA 4ZROA 2FO9A 1ZP6A 1PPFE 3EASA 2Q9CA 2ZHQH 1FAXA 3TIFA 3ASZA 3B60A 4LBWA 1LDTT 3NUMA 5C20A 4ZUHA 2H92A 1VIYA 2NMVA 1P11E 5L30H 3BH0A 3MI4A 1K1NA 4ABFA 3CH5A 5ESTE 5D3MA 1TIOA 1QBNA 3B85A 1AFEH 2PGQB 4DLVA 2GWHA 1O2VA 3K70D 3UIEA 2CMYA 4I8KA 1E6CA 3NBZC 2JJ2A 3RM2H 1CT0E 3FVQA 1J15A 3KHVA 2ZJZA 4BFSA 1S1MA 4L16A 1C2FA 2A78A 3SU2A 1BHXB 1KO5A 2ZQ1A 1JXOA 1C5RA 3TJOA 3X1DA 1P73A 1OYTH 4TL7A 4IXMA 3TRFA 4F91B 4OL0A 1Z8IB 2W00A 5FL3A 3FGNA 1AS3A 3AUYA 5GJ4B 3HYRA 1EUFA 1RIWB 2CCKA 2FPLA 3AVXA 2H8KA 2ZE6A 5GPIB 1FNNA 2XTNA 3TK9A 2RKOA 3SDZA 5EUQB 3CP7A 2VB0A 2J7PD 3KZ1E 2AHOA 4DB2A 4Q4LA 1E2DA 1GHBF 3ICEA 2ERYA 4ZI2A 3RLYH 1C5VA 4Q9LA 4OK3A 2OCPA 1IJFA 3LH5A 2C03A 1KSFX 3SJIA 2W6JA 3ZQ6A 4ARZA 2QYIA 3G01A 1BZXE 4K69A 3NG1A 2ECKA 1IN5A 1RE0A 2G9NA 2AXPA 2GBLA 2ZR0A 1THSH 1TPOA 4Z8XA 3NH6A 1SQ5A 3ZVGA 2W2VA 2WVJA 3RXMA 3L6PA 3FFBA 4X6MA 1AKYA 2FNAA 1HAXB 1QB9A 4B1TA 5J4KA 3KQNA 2B5TB 3TU7H 2G5VA 1YR9A 5G3YA 3HK6B 2FX6A 1G30B 2OK5A 1YLDA 2ZU3A 1PPEE 4C0LA 2ATXA 4KGAA 2BXTH 1ESNA 3GDVA 1XEWY 1GCTB 1Q31A 4PXAA 2J9RA 3EPHA 1Q57A 4V0ME 2ZS9A 2FESH 5EQSA 2QMOA 4QGFA 1XVMA 2IXGA 1TBQH 4GT1A 1FL9A 1F5LA 1Z1IA 1IQFA 5K8IA 2AD1A 2UVQA 3ITIA 3UG7A 1ESTA 1BTHH 4TLAA 2B9LA 3B5JA 1P7CA 2HT6A 2FTLE 3NC0C 2VSOA 1Q22A 1W0ZU 2HOBA 2YJTD 4B3CA 1OP8A 3HPQA 2FZLA 3T5DA 3V00A 3DT0H 3ZZ7A 1O2IA 4Y11E 5FX5A 3BH6A 1TRNA 3UOUA 1AJEA 1HXFH 2J9NA 1ZTLA 3RXJA 5EE1A 1V6DA 1SGWA 4C2TA 1FJSA 2DB3A 1N8OB 4OQLA 3VTKA 5A5GA 1KK1A 4GOXA 2ZRHA 3MO3A 1EPTA 2PV9B 4AC9A 1NSTA 3KQUA 2EWWA 1RTFB 5KHOC 3THXB 5F8XA 2EA3A 5GIBA 3SNCA 4ERNA 2WINI 4JYVH 1RKBA 1SGRE 4BOHA 4DBLC 3PTNA 1JECA 4ESVA 4MH0R 3RXCA 1AN0A 2KSQA 4FCTA 1IQHA 3NZIA 2IF2A 2C9CA 2DFTA 1QQ4A 4EJSB 6ESTA 3V7TA 3K70C 3QY0A 4X8SH 2YVUA 4AK9A 3QOFA 1AMHA 1V2NT 1J2JA 1JI0A 3G82C 1NVVQ 2GDJA 4TLEA 4NCNA 1MQ5A 1FUUA 4PQRA 1T6NA 3ZZAA 1VG9B 2F9UA 4JLNA 2C8XB 1A5IA 2A2XH 1SQOA 2CNWD 3MGCA 2TMKA 1O5AB 4P4TA 4A4DA 5AJVB 4EQ6B 4NYIQ 3QKRB 1KJWA 2AN9A 2C04A 2BMFA 2NTYC 1OE0A 2O0JA 1TU4A 2W5EA 5AUNB 3SJAA 3T35A 1HH4A 4RI0A 1IN8A 4JZDH 4A6LA 3RC6A 2W7UA 2WWHA 2ZCHP 2J1LA 4B76A 1G5TA 3PUYA 4N1AA 2V6IA 5GCHG 2OFXA 4PO9A 1XMVA 1YM0A 4ZKOU 4XDEA 1ZGIA 1FZZA 2G0TA 4IEIA 3K1JA 3A36A 4KBGA 4INHA 5CYPA 3E0NB 2PZEA 1ZR0A 5ANRB 2VL7A 4KYUA 4OHWA 4K1SA 1C2HA 5T3HA 3U8OH 2D62A 5EZ6B 3JVVA 4FMCF 3R7WA 5H4IB 5J4QA 4F7WA 4NCYA 2FH5B 2NWNA 1JR3E 4DLXA 1FY4A 2ZDNA 4Q02A 3U1JB 2A5JA 1TNGA 1MABA 2WV4A 5JFGA 5AHGH 2AIQA 3KDSE 4INKA 1WCZA 3NK8A 1OPXA 1AUJA 2CEAA 4ILEA 2XC0A 3PM3A 2IUTA 1S0RA 3LC3A 4Z54A 3EZ2A 4XJXA 3JZAA 1ARBA 2Y81A 2JLSA 3Q77A 1U94A 4C0QC 1SGPE 3BF6H 1OFUX 2EFGA 2A4QA 5FX6A 5JHGB 4LYFA 2UZ3A 2C5LA 4B3DA 3M3TA 5SZHB 4V0LA 3RRMA 3DO6A 4HAYA 4CIDA 3EZ7A 2BD9A 2ZEJA 1CLUA 1U8AA 4LOYH 4Z1MD 3NIBA 1G17A 2G1KA 4Q48A 2Y80A 4QBHA 4G3XA 4I8GA 2PCJA 2VYFA 2ANYA 2H1UA 2WPJS 3V4FA 2Q21A 3FZZA 4JT2A 4HZIA 3BFVA 2XWBI 3W9YA 4RJLA 4PSKA 5KPJA 3U6KA 4UXJA 1YYY1 2R9VA 1OFTA 2FS9A 1V2VT 5EOKA 4I99A 2DUCA 2VVUA 1Q1BA 5A0FA 3A7XA 4MPUA 5FBVB 4DOQA 1OW3B 1CHOF 1F7ZA 4MRPA 1W49A 1KXCA 1UEJA 1KI8A 3K09A 4CEIA 1KSJA 2BCJQ 3HR7A 4KI0A 4F38A 3CB4A 2IYXA 3FYHA 4LSGA 4BLPA 1GI6A 4TWWA 1ESBA 4QFMA 1BYUA 1TPZA 1RGQA 4E09A 2NU2E 4XD7D 1PPBH 1T4VH 1J99A 2BDTA 1S82A 2ZU5A 2WWFA 3U3KA 2VWOA 2ZRKA 3RANA 2F9BH 3ZVNA 3RS0A 3ZZCA 1NRRH 3B1ZA 2BEJA 1NRPH 4IC6A 1BIFA 3A89A 5HMAA 3K0CC 3SNDA 4FVBA 1BMFD 4OS1A 1P05A 5L6NH 3A6PC 1GL7A 4LV5B 1TQDA 3RU4T 3ADCA 4QHSA 3HK3B 1KO8A 4LHWA 1P2IA 1DE0A 1UCYH 4O25A 4NWLA 1KO1A 2OG2A 3E16B 4BASA 1P2NA 1RTKA 1TU3A 4URUR 1KTTB 4PX9A 2JA1A 2PMKA 2ZECA 5AR1A 4IN2A 4KFTA 1PUIA 1ZD9A 1CGJE 3WHLA 2ZDAH 5BRRE 1C2KA 1MCVA 1P60A 2YHSA 3A8TA 1R8QA 1T91A 3LGUA 3HKJB 4MPXA 3AKDA 3CRMA 4D80A 4OQFA 4A8JA 1NVXQ 2Q0HA 2H16A 2LWIA 4I7YH 3DOEA 4IN1A 4TLCA 2PUQH 1P5ZB 1SHYA 1ZAKA 1JIMA 4XBCA 3K6YA 2Q3MA 1DAGA 4MVNA 3UTUH 1FDPA 4RSGA 3W5IA 1O2NA 3W8NA 4ESHA 2O8BB 8OHMA 1QGFA 2Z9JA 3PVSA 2J7PA 1M6NA 2ZPQA 2VO1A 3AKEA 1MT0A 1O2TA 3MO9A 4Q4HA 1AVXA 2BX4A 3GFOA 2J45A 5F9HA 3W5JA 2J4IA 4U7DA 1AVGH 2R44A 3V13A 2ODEA 1NMZA 1L4UA 4CRCA 4URVR 4AN7A 1VITH 1J8YF 3IO3A 1SVPA 2BD3A 3RXTA 3TUIC 5A4JA 4DIEA 1C1WH 1E0JA 1EFRD 4MLFB 1EQ9A 4IW4E 2J5XA 3GY7A 1AQUA 3LQQA 3BB4A 2REXB 2QP9X 1TEVA 3A4LA 1P9NA 2JJ1D 3VR6A 3TR0A 3SQEE 2ORWA 2ZVPX 3KKOA 3K6ZA 2K1QA 1IXSB 2X77A 3U1IB 1E99A 1E0KA 2ONJA 1LVGA 3CZQA 5EQTA 2ZE5A 4BLSA 4URZR 4TYWA 2V3CC 1BQYA 1UCYE 3GICB 2WKRA 4I4LA 1AQ7A 3S9CA 1KGDA 2DYKA 1CJUC 5SZKB 4I8LA 1U8YA 1GIAA 2O8UA 2PEZA 4QBFA 4CRGA 5A8ZA 2YWGA 3GCHC 5C1YA 1TYNA 4RD4A 1BIOA 5F98A 4QM7A 2AK3A 1GBKA 3DZ8A 1AS0A 4OI1A 3EX7C 2G55A 3VU9A 3P8OA 1BMNH 5A8XA 4JKIA 4AB8A 3VX3A 1YF4A 1VG1A 4CR5A 2VP6A 1QHRB 2O5VA 1BTXA 3LOXA 1KO4A 1FLEE 2WWYA 2BOKA 3PO1B 2H18A 3QXSA 1SOTA 4K5ZA 5KSOA 1OPHB 3MYWA 2CJWB 1DUEA 1AE5A 2VJ1A 1HCGA 1Z7KA 4MKHA 2G0NA 1Y3XA 2BDGA 2IUSA 1R5BA 1O2RA 3OZXA 2CVFA 3TK1A 4OS5A 4K46A 1C1PA 4I1SA 5FCRA 3LGTA 4U5XA 4MDFA 2KBFA 4IMQA 2FOCA 2KAIA 2BLOA 1KNXA 1YPHE 2P5SA 3KXKA 1GWAA 3LGVA 1E32A 4NYMR 3BWDD 2PH1A 4FU8A 1U98A 2ZE8A 3TSWA 4A2QA 4FD2A 4P3YA 1SI5H 3K0CA 4WW0A 4UFDH 4R2IA 4IOKA 2C4FH 1A2KC 3RXQA 1QB1A 1GL9B 2ZRFA 4DURA 1XPRA 1ZJDA 6GCHG 3P20A 2PW8H 2Z6VA 1PPCE 3VR5A 4IDOA 1MUEB 3ATKA 1H8ED 2GXSA 2ZRLA 1ZCBA 5KDOA 1RZ3A 821PA 1IQKA 5EP1A 3AKCA 2EI8A 4PTLA 2XSZD 3MWKA 2CNWA 1F3OA 3RYTC 4NG9H 2Q1JA 2QUZA 3QO6A 2J3EA 1E2IA 1OSNA 1GNRA 2KI5A 1IQIA 1PUJA 1ELFA 3PV2A 4XTCS 4TT3D 2OUAA 3PROA 2IT1A 2ATVA 2WUCA 4CGZA 3VXEH 2HUPA 1DBSA 2OCVB 4PO1A 1R7RA 1Z6XA 2WM9B 2C90B 2PBRA 2GK7A 4JL6A 3ESTA 2WTUA 2VH0A 3PEVA 3LXXA 5IK2D 4TYQA 4YXWD 3S1AA 4AX9H 4C0KA 2AGEX 1ZHPA 5TCCA 1WTGH 1OXTA 5AJZA 2R3UA 1WTHD 2AGGX 1YKTA 4C9BA 2FEMA 2RGGA 2L0XA 4CEHA 1JWTA 3ZIAD 1HIAB 1EXMA 1TA2A 2PKAB 3UNSA 2JLYA 1DOAA 4CRAA 1IXRC 3KUCA 4U02A 2GV7A 5KNCA 4THNH 1TF7A 2VPPA 3R20A 2XJ4A 4Y8XA 3H2YA 4WVFA 4W7SA 2A5DA 1Z47A 4NH0A 2WZQA 2F1RA 4JK5A 1ELEE 4PPNA 3RS5A 3CNNA 1VCOA 5J40A 1E98A 4K3JA 5DNYB 1DAHA 2FOEA 2VTKA 4RCZA 4X1RU 2ODNA 1OWKA 3CRQA 4MRRA 3ZVRA 3D3QA 2VIIA 3KFXA 4OJQA 1GILA 1UAAA 1C2LA 5CIQA 1PQAA 2IYVA 3RLWH 1ZYUA 4MNYA 3Q76A 4IHQA 4Q5IA 2IS1A 1KAGA 4Z1MA 1F5KU 2A45B 3DZDA 1AZ8A 4Q66C 3PV0A 1BMMH 1G5PA 3GLHA 4OJKA 2Z3CA 1KK0A 1TEXA 2I1QA 3WBKA 1XCMA 1N6KA 1CR4A 1G8FA 4D0NA 4Q19A 2XB2A 1A1RA 4V03A 2VHUA 2LKCA 4JLKA 1GZSA 4OBEA 2IYRA 1ZW6A 4OK5A 3M36A 2HXSA 4A15A 3EGKH 1O3GA 4LJ7A 4ISHH 2V55B 4U30A 1EB2A 3GJ3A 1JR6A 3P8FA 4JYBA 1C2DA 3ZZTA 2P6NA 4XD7A 5HZHA 1X1SA 4O3MA 2RA0A 4AI6A 1C5TA 3SYLA 2IYLD 3P95A 2GCNA 1OB5A 2OC1A 4X8LA 1A4RA 2N46A 3LPRA 5F8TA 2Z7FE 2XXAB 2OV2A 4IFEA 2HNTE 2IW3A 1TPSA 1KZ7B 2IEZA 4NU0A 1BMFA 3LQRA 1KMHA 2XZOA 2GXQA 1AWHB 2ZIQH 1ARCA 1GG6B 2ZWLH 2XBXA 5H68A 2V1UA 3ZVEA 4DT1B 1BJVA 1IXZA 2FWWA 4NSYA 2WWWA 4PQFA 4QC2A 2GK6A 4I33A 4TZ0A 5FPKA 1ZHMA 5H8WA 1KLTA 4AIIA 1XJQA 1LS6A 3PR1A 3TNTA 1QBKC 2A5GA 5IDVA 4ZKSU 3B1WA 1O38A 2SNVA 3A8AA 2WSSD 1C5YB 1LVMA 1K8RA 1D3PB 2RHMA 3E2IA 1N6IA 3SI4H 4FINA 1OXUA 1FI8A 2V1XA 2HWLB 2ZI2H 3T1OA 3IIKA 3IIJA 3CF2A 1NJGA 3PLBA 2PTNA 5EPYA 1ORFA 3VGCB 3BEIB 4YOGA 2AMDA 2C95A 3LGIA 2G4UA 4A2WA 3SHWA 1GL1A 3ZVBA 3WP1B 1VHTA 1O3DA 1IHTH 1NFYA 3GYMA 1MBMA 1XEFA 2GETA 1U99A 2ZFSA 1VG8A 2QPAA 1HUQA 2F6RA 1O2LA 4Y0ZE 3OSYA 1UK4A 3C15C 3GJ5A 1EFRA 1AFQC 4C2UA 5JLJA 4G1UC 1TGCA 3RABA 2JJ1A 1SXJD 5HKKD 3AW1A 1W7AA 2SGDE 2D2FA 4DSNA 1GI1A 1Z6GA 2F43B 2M5TA 4KTCA 4WIAA 3ZYDA 2PEYA 3Q3XA 1E9FA 2FPZA 1BBRK 3KN2A 3T1TA 2YOGA 1KI9A 1JALA 4OHYA 3U69H 3F9EA 4QT8C 1QHSA 3AGPA 4P4SA 3AGQA 3KJIA 1BBRH 4CYMA 4LBYA 4F93B 4X6OA 1XDBA 1ANKA 1W0JD 2A31A 3OIYA 1WQ1R 4MNVA 5DI3B 2GDEH 1P4SA 4E07A 1Y63A 2Y5HA 3SS8A 3OESA 2WJIA 2QMEA 3B82A 1EZXC 5AUPB 4LOAA 4Y7AA 3P1JA 5GVSA 1IAQA 3MOCA 1HYQA 4M1OA 3BIFA 3MWLA 3GJ0A 1F48A 2P3UB 5CDFE 3OIWA 1Q3XA 2FE4A 2NO0A 1NRSH 2O8CA 3W3ZB 5EP3A 3DPUA 4XSGA 1UVTH 1S8FA 2E87A 4HAUA 1ZBDA 4C0HA 3JVUA 2ZR7A 1LPGB 4W9MC 2OO7A 2ZIAA 3QVUA 3T15A 1HAIH 1O5DH 3SGBE 2AFHE 2FP7B 2BCGY 3MCAA 4DEXA 2H17A 3RXKA 5IF9A 2GTPA 3MG9A 2FOHA 4UEHH 1TOCB 2OBQA 1KXBA 4FMCB 1XMJA 5FTLA 1PVOA 1GJ7B 4X8UH 1DVRA 3MAAC 1QL7A 3URDA 3K53A 1U8ZA 1DX5M 2WYGA 1EK0A 3S9AA 4PSVA 4YM9A 1IJEA 3PV5A 4H6TA 3ZS9A 1YVDA 5KO2A 4OHZA 3THYA 2XTTB 3RXOA 2QBYA 2RAPA 3KQLA 4D0GA 1G7TA 2GZ7A 3SHAH 1R5NA 3KJEA 1HV7A 1E2FA 3EDXB 4URXR 3U44B 1TX7A 4S35A 4DDTA 3MMPA 1OYQA 1XKAC 1O3HA 1H8EA 1BYIA 3N5CA 3SYKA 2HYDA 5C18A 3P32A 3I72A 2NQ2C 2XSZA 2TGDA 2QT0A 1CKEA 1SVIA 4FUJA 4BGDA 1ZM4A 1YHNA 4MKIA 5FBQB 4D4LA 1GBLA 1DADA 1XMSA 4TYNA 1B7XB 2DWOA 5LPNA 4KVAA 3LY5A 2RHDA 4BZQA 3WRYC 4EPYA 4TT3A 4PPQA 2B6HA 1VHLA 1IQLA 2GCOA 4LJ8A 2F83A 2D74A 4NYJQ 4PPFA 1YGCH 2FOBA 1FQKA 1QDEA 4KTUA 5IK2A 2QXGA 1FMGA 3LDXH 4YXWA 1BKDR 4HLUC 2QRZA 4Y76A 1E9AA 1E4YA 4AY2A 4US1R 1CRPA 3FAOA 3LU9B 1N6XA 1BRUP 3SHFA 2WJJA 3ZIAA 2PCLA 4B2CA 3STIA 2FPKA 5E7MA 4JLOA 1XPOA 3RXEA 1E2GA 3NDPA 3TGPA 5F3WB 4ACBA 4KFUA 2G88A 1XTRA 5G3ZA 1II8A 5E0JA 1L7VC 1D6WA 1VECA 1UVOA 1NLZA 2OXRA 2BLQA 4WXVA 1MOZA 3CR7A 2Z0MA 4ABBA 3IGFA 2IYTA 2OT3B 4Y8ZA 1C1TA 2RCNA 2GMTC 4ZAEA 3TSOA 1DWBH 3ZJYA 2AKAB 2FYQA 1N0WA 3LBHA 2BHRA 2N42A 2UUYA 1VIAA 4AORA 1SGFG 4PROA 1AZSC 3A86A 4FU9A 4ARZB 3EA7A 2BVRH 4C0AC 3QF4B 2CVHA 3SOSA 1G7CA 1CR1A 1NVVR 3U2QA 1ZTKA 1F0TA 5EU8A 1MKWH 3VQTA 2QQEA 3RXAA 2ZJ8A 1NVWQ 2EFHB 2BOHB 5FBEA 3M4YA 1SLUB 4BUJA 3RXLA 5GNDA 8KME2 4U00A 5EXLA 4NYIR 2VLIA 1UK3A 1NN3A 4A6PA 3CS0A 4HLQB 3UQOA 3WY9A 1E38B 1E2PA 1K1IA 4EFLA 3BC1A 3IKJA 1SQTA 2NOAA 3MH5A 1SC8U 7LPRA 4QRHA 1DXPA 4NIWA 1D5CA 4N0DA 2H57A 3Q3KA 1EASA 1YRAA 1QG2A 2ZRJA 2Q9AA 2FMJA 3VB4A 4AKIA 4Q4JA 1G19A 1O2MA 1QHNA 3UY9A 4TTPA 1HQYE 2XNSA 1D6JA 1GSIA 1MH0A 3GCOA 1XD2B 3S7HB 4MRVA 1JOUB 3CF0A 1OJLA 1C2GA 1GAJA 2QSZA 5T6FA 4F92B 2EI7A 4LHVA 1MTNC 3RXPA 1LF0A 3A8CA 2PGBB 1O3PB 2OINA 4L9SA 2HEIA 3CKLA 3GEIA 1QIXB 2OE2A 4KFRA 3UUZA 1KNQA 2ZU0C 4NWKA 1UTNA 4RZ2A 1TONA 2CE2X 4DLRA 1OXVA 5BN5A 3RMMH 2ZO3H 2ORIA 1T31A 2QAGC 3VHXA 2ZCKP 1HJ9A 2VSXA 4WBSA 1MTWA 3PUWA 4I1UA 1CGHA 4TMXA 3SFZA 2A4RA 1IQNA 5D3QA 2YOLA 2YYZA 3GFPA 1U9IC 3D65E 3GLGA 5EQRA 4IVPA 2SFAA 2R6CA 1D3QB 3EIHA 3THOA 2WSSA 3AEZA 1OXXK 2VF7A 1P2MA 3MWJA 4B2BA 5LGOA 2MMGA 2B8TA 1VITG 2X2EA 1G3DA 3GLIB 2BD7A 5TARA 4WH8A 4FMDB 3F6UH 2RGDA 4ZHMU 3IPXA 3WBJA 3GY5A 5TVKA 5DHFA 1AQYA 4JK6A 1N6HA 1T4UH 5TDHA 1GNPA 4YMUA 1CA8B 1FX0B 5GWZA 3HATH 2FI4E 2V7QD 3TBKA 1BDAA 1VGCB 3KTAA 4AFUA 1FNIA 3FDIA 2YKGA 2Q6GA 2BV3A 4B3FX 5LD2B 1ELGA 3VB3A 1MRNA 1PYTD 3K2UA 2ERXA 2V6JA 1XFAA 1QY6A 6CHAC 4UFGH 1ID5H 1T7CA 3OIUA 7GCHG 1A4WH 1SXJA 1CU1A 3RXHA 2CHGA 2CLDX 1F2UA 4Q21A 5HKKA 4POAA 5DN6D 1GMDG 4PC7A 3SU6A 4BAMB 2WBLC 1WOFA 1H8IH 1MO4A 4B35A 5J4SA 3ZV9A 2FZ4A 3TR5A 4D8NA 1GUAA 2VVCA 1Z8JB 3GY6A 2DFNA 5F8ZA 3C41J 3OYPA 3R7WB 1G21E 3TJNA 1QHIA 5AK0A 3M3VA 5DK1A 3OHMA 5JWHA 1W0JA 1BOQA 3M5NA 2BY7X 2O8DB 1HAVA 1DPFA 1LHEH 3MWYW 3RHFA 3B7GA 1MABB 5HXFA 4C0SA 2JASA 3U60B 3A7WA 4KODA 5FI1B 2BVXH 4XOIA 1F2TA 3TKLA 3QG5A 1I4LD 1NLYA 1II0A 2IHBA 4K2YA 5DP7A 5E4FA 3LIWA 4D9QA 1NM6A 2QTVB 4DLWA 2JH6D 3C27B 1D9ZA 4ASHA 2QCYA 3A80A 5CHAB 1SLVB 1DY9A 2D4HA 4UDWH 4TL6A 1DSUA 5DYGA 1WF3A 1W4BA 1IN4A 2ODQA 2Y5FA 4YTAA 1Z29A 3M7TA 2PR3A 1F2SE 3UNQA 3OFND 2KJQA 1S83A 3SZEA 1K21H 1C5SA 3B8JA 1W44A 3PG5A 2F7SA 4DSOA 1UDWA 3D49H 2WICA 5A8YA 4U32A 2WJVA 1S6HA 1Z63A 4JVSB 1FZQA 3UNRA 2FIRH 1XUHA 5DP4A 2ZRIA 5C1BA 4Q9IA 5FOSA 4Q9HA 3EWAA 1UKYA 1DITH 2WUBA 2QAGA 4CVNA 4IKEA 4MNWA 2BEKA 1ZRBA 3EARA 2HRVA 4KELA 1RYFA 4BXSA 4OQMA 3MNBA 6Q21A 5FPSA 3QNUA 3KQBA 4WMFA 2FFHA 2ODPA 3AF2A 5EPNA 4E5UA 1G4UR 1K28D 1TAGA 1O5FH 2R2WU 2VINA 1S3SA 5CITA 3DUXH 1O2WA 1AWFH 1KLJH 4X2YA 1U9IA 2IYYA 4URWR 4ZHLU 1V2PT 2XNDD 5JRZA 2FFBA 2VIOA 3KXIA 3LW8A 3BFXA 5JEEA 1GJ4H 1JR3D 1YZGA 1BMLA 2ZGCA 2W26A 4GDFA 1XPUA 3CZPA 4B3XA 4Y79A 1P57B 2ZRMA 2P95A 2KBEA 2I6SA 1G7RA 4YDHB 3UPEA 2BM1A 4D76A 2GA8A 1X3SA 3GLIE 4KP0A 1GI2A 1W7GH 1QJ1B 4DW2U 4YMVA 1HJAC 1B5GH 4HDQB 3GLFB 4V02A 2ODYB 1OXSC 2ANMH 3UWOA 1DEKA 4A8JB 1AZTA 3L8ZA 1GVKB 1LS1A 1ZPBA 2O8FA 4OYHA 1RRCA 1TNIA 2WJHA 1S3GA 3EXAA 1NFWA 4GBMA 1KI4A 5CK5A 1EAXA 3RXFA 3T34A 2ZC9H 5GCHF 2GT8A 3IILA 4D0LB 1T8UA 2A30A 2Q6TA 4BLTA 3FTQA 5L8VA 4RY2A 1PV4A 2XRCA 4LGMA 3KQDA 4XSHA 1OWHA 4CHAC 1EJAA 3KCGH 4TY7A 4ITRC 3GPLA 1IBRA 4JYTA 1GKYA 1O34A 3BEUA 2C93B 1EZUC 2Y6TA 3BH7A 3P27A 1QHXA 3A4NA 2CL6X 1PJRA 2IYUA 3VR3A 3B1YA 1IM2A 3Q8XB 1Q3TA 3QXCA 3X1YA 4URYR 4X1PU 1C4OA 1HAZB 2CK3D 4J1YA 3SORA 5K8UA 4YESB 1KY3A 3KFVA 2UWOA 3TVJB 4PFSA 2JCSA 1NNEA 4LY6A 4X6NA 4CEJA 1O5CB 1VCIA 1LW7A 3NHBA 4Q7ZA 3CWZA 4D4JA 2JATA 1FTSA 4NPHA 4IW3B 3N2EA 4GHQA 3EIEA 2RDLA 3GYLB 3IDQA 1NN5A 2I4IA 3DMDA 1E9SA 1O3OA 4GHTA 1CF4A 2D8WA 1O2SA 2KWIA 1O5BB 2B21A 5LPFA 2CMKA 1O37A 2AK2A 1ANCA 1IOZA 1I2DA 3PWBA 1TRYA 2DPXA 4LCBA 3VU9B 1GI5A 2R2MB 2HJGA 3RS4A 2VU8E 2BIFA 2YINC 4NP6A 4GFDA 2FA9A 4I81A 5JJIA 4MG3A 4EFNA 3QPWA 2KB0A 3L0OA 2D06A 1TALA 5E95A 4OGYA 3GJ8A 3SJZA 4LPSA 5DP6A 4BFYA 5HM9A 1ZUHA 1UVPA 1TQ2A 1ANEA 1Q20A 3AVOA 1OB2A 3CLVA 2BDIA 1VPLA 2FF7A 2XX3A 7ESTE 2A7CA 3LV8A 3M5MA 3BE4A 2R2AA 1HE1C 2ZE7A 3W3AA 4DHEA 3M1IA 2OC8A 3A84A 2VHQA 1JBKA 2QP4A 4BLQA 1RIWC 4QHYA 2OC7A 1T0HB 4BZXA 2OILA 2PJZA 2QRNA 1P72A 3JZ1B 2F9NA 1KI6A 3OEED 1DS6A 4YT6H 2AH4X 3WYAA 3SN6A 4DY7B 2H2ZA 2BLVA 3TLXA 2DWQA 4P32A 1WA5A 2P65A 1K5GA 6LPRA 1TL7C 2ASUB 1CA0B 1AKSA 2RGNA 4MITA 1EZQA 1G6OA 3QVVA 2FJUA 3AVTA 5ABWA 2FM2A 1KI3A 2QN6A 4XFQA 4WZ6A 5TY0A 1O2JA 1BITA 1T3SA 4FWTA 5L2YH 1T4GA 3ZVMA 4X0WU 3K0AA 1ABIH 4C7OB 2P59A 2DE8A 1SGDE 3A1TA 2C9OA 2QV1A 3GEEA 2EYQA 5CLLA 1OX1A 2BY6X 2PWXA 1LF5A 1G41A 1XEXB 5DGXA 2BX3A 1EP5A 5JWRA 4CH2B 1P02A 2XEXA 2IJD1 1QG4A 3VKWA 4U01A 4JBXA 1C2EA 3CF6R 1GCTC 4RKJB 2CF8H 2V7QA 4A7IB 2RGXA 4L4UA 3EA5A 4CF7A 4NZLA 4ISOA 3A1VA 1K1MA 1KDOA 5FFMA 1JRTA 1SFQB 2GCTB 4Q01A 4L9WA 4DUGD 1U6QA 3KL4A 1UTMA 5C3NA 1HY3A 4H1UA 4HUQB 4B3GA 1S84A 3TK6A 3QEOA 2GHIA 2R65A 1S9DA 5K8TA 3QTVH 1PPGE 2DWPA 2ZRNA 3H86A 4QBIA 3CO5A 1RRKA 5DN6A 2VNTA 2QU8A 3PEUA 2XYAA 3B1XA 1V2ST 2CJIA 4LZ4B 3FMOB 3SZRA 1G64A 4CEHB 2Z83A 5FOXA 1G3QA 2FN4A 1NI3A 1WXRA 1YU9A 1G2LA 3KKMA 2BMDA 3C4JA 2W7SA 2OFWA 5EE5B 3RXVA 1C1YA 1Y3WA 2IWRA 2F3CE 3BGWA 1N8OC 3TJZA 1CRQA 4Y7BA 2PUXB 5JB8S 2VH6A 3LGWA 1E9DA 3UMSA 4B73A 4DVGA 4YMSA 1ONBA 3BJIC 5CJ2A 5B64A 3SI7A 3K8YA 2UWLA 4BFXA 4GOKA 2FTMA 4FUHA 2ZFTA 2ZJBA 2ZS8A 2HXYA 3VFDA 1TGBA 2CHQA 2OLJA 1NIJA 1UO6A 1RRPA 4P4UA 4WA7A 3T12A 1KZGB 4ZDJA 2XGJA 4EJSC 4II7A 4NCIA 4GLYA 4IGDA 4IBLH 3AV0B 4DIHH 3K9GA 4W5JA 2WKQA 3UR6A 1GRQA 3X1XA 4OGXA 3LAWA 1DAMA 4M1WA 4QGAA 2P6UA 1DAIA 4PSAA 3OFNA 1NU9A 4JZFH 1ZIOA 4LV6A 2THFB 4JLBA 1O3AA 1EX7A 1JJVA 4XBDA 3A7YA 1D3DB 2QF3A 4D2IA 4GPGA 1XTKA 2RG3A 2YZ2A 1F92A 2VHTA 3R9WA 3GDSA 3LLMA 3SNAA 3ZZUA 1DPOA 2CDNA 2VH5R 3UANA 3SHCH 4X8OA 1SGCA 3KUDA 5JBQA 3HR8A 1GDQA 2SNWA 4UNSA 1ANDA 1O5EH 1L1JA 3CM0A 1AIPA 1ODFA 3TH3H 1TUIA 3SNBA 1SB1H 2P3SA 2ZKSA 2IC5A 1ZRHA 2A5FA 1O2ZA 3SI3H 2GX4A 2AERH 1XNJA 2QTFA 1Z6AA 4KLNA 2J41A 4NCKA 3MU4A 5DE3A 6GCHF 4LWZA 5FHTA 2XNDA 3FKSD 3BTQE 1NU7B 3PV4A 1JR3A 2YNBA 5C4GB 4IC5A 2V8OA 1Y3YA 5LBIA 4TMKA 1D2MA 1WQSA 1Q3HA 3WMEA 1LVOA 1CJKC 1YPLH 2OEPA 3QTOH 3RM0H 3OAAD 3IBGA 2CLSA 4IDQA 5DP9A 3AF4A 1G7SA 4DEYA 3W95A 1ELCA 4DG4A 3BB1A 1GJ9B 4IOMA 2MSCB 1GBTA 4DLYA 2QPOA 1O36A 4TLDA 5GDSH 5JYIA 2RGAA 3I61A 1O3FA 3VB6A 1OYWA 3IEUA 1E4VA 5L3VA 3SN8A 2FG5A 3I62A 1NL3A 2QMHA 1KI7A 2HGTH 1DG3A 2XITA 4X8MA 2ZGJA 1T3HA 4NE2A 1Z07A 5C2JB 4TPIZ 4R2HA 1BRBE 1P6XA 3H4MA 2W2XA 2ZSEA 4IVRA 5IDKA 3VR4A 3AW0A 3B23B 4Q00A 2BBSA 5DJ7A 2FEOA 3T29A 3S9BA 2V4ZA 1MU6B 1NN1A 3L0IB 5H70A 1WCV1 2G6BA 2FSFA 3SJCA 3SE0A 4YQFA 3UOPA 4D81A 4TL8A 1YZUA 2JLVA 4LJ5A 1YBWA 1TNHA 2GILA 5CJPA 2BMJA 1G3IA 1M7GA 2J7KA 3QKUA 1IOEA 4AYVB 2CK3A 3PLKA 4A6XA 1YPHC 5I25A 2WAYA 4O2LA 1HYLA 2ZRCA 4VGCB 2W58A 5F9FA 1EFTA 5E2OA 2VWLA 2ASEA 3L82B 1HURA 2GVFA 1D8TA 2VF8A 1CR2A 2J0SA 4YLGA 3RXDA 1FP6A 3W6OA 1KK3A 2RMKA 4XOJA 3THXA 3A85A 4FUFA 3AVWA 1E2LA 2O8LA 4HDCA 2ZS7A 1J17T 1GDDA 1TAWA 3S0NA 2TGAA 4M7GA 4NYJR 2XCNA 3RC8A 3U7HB 2FI3E 1P2JA 3C14C 5FOTA 4XVRA 3FOZA 5L2ZH 3TAUA 4IOLA 2GD4B 1SVWA 2Z3DA 1NO9H 1SKQA 3GQBA 2CHAB 4XWAA 1H9LB 3LONA 1H1BA 2C8VA 4O9VA 1MV5A 5JJLA 1ZYOA 3H5CB 3ODFA 2NZ8A 3ASYA 1W36B 2DBYA 1IHUA 2UUFB 1Q21A 2BB4A 3ZVFA 5PTPA 3GLHE 4CH8B 4EPWA 4TTRA 1DWDH 2MMCA 3EPKA 4GMDA 5HCIA 2BTCE 2RH5A 2ZDVH 5GADl 3UPUA 1P8VC 4EQ6A 1WB9A 3FP6E 1K9OE 2O8CB 1XKBC 2OHFA 3LVQE 2JLWA 1GP2A 5IYTA 4DDWA 2XCFA 4B2IA 1AB9B 1K5DA 3NKKA 4Q1DA 1F0RA 1CJTC 5IRCD 1WV7H 3STJA 3GD7A 4ZMAH 4INLA 1WUNH 3EAQA 3Q3JB 3U7EB 3NXSA 1XXHB 4NA7A 1C1QA 4Q1CA 1B0FA 1OHHD 2CCGA 4CR9A 1ZVQA 3TNSA 4KSCA 2BVNA 2ANCA 1GM5A 5HTKA 1CBUA 1NTPA 2ZJ2A 5A2MH 1W4AA 1AGPA 1FOEB 4B6FA 1OKKD 2J38A 1W48A 1RRGA 4V0NA 2J0QA 2G52A 2QBYB 4FUGA 2QXJA 5L3SA 4Q2KA 2ZDLA 1AN1E 4JL5A 2WOJA 3T27A 2VIVA 3A7VA 3SV9A 3BTGE 2OCAA 3HU2A 1GJDB 5DSZA 2F1HA 2WOOA 1S0UA 5FUYA 4E05H 3HPRA 1XEWX 1CT4E 4PC6A 1GFIA 5CYOA 5F03A 3AUXA 4CRDA 3PTBA 2MSEB 1C5QA 3PQCA 1GI4A 3PMBB 3N7OA 1IONA 1ELAA 4LJYA 2OC0A 4DUGA 1P3CA 3UATA 1I4TD 2GCOB 3QEJA 2FODA 1IAUA 5JRJA 4BLRA 2PMDA 1JBUH 5EG4A 3A4MA 4Q7MB 2GXUA 4X8VH 1EAWA 2FOMB 2X8AA 2F91A 3BS4A 3ZYCA 5JSZB 1NT1A 3SU3A 1KHTA 1NG9A 4XVUA 2CL0X 1QL9A 3I5YA 3SV2H 5K0HA 3PO1C 3IWMA 2ZAMA 4CZ2A 1EKBB 1S0QA 4DIDA 2W3IA 3M5OA 2DR3A 3UWJH 1BHXF 3U4QB 2J0UB 2NZJA 3SFVA 3P26A 2VSFA 4K1TA 4FUIA 1FUKA 2YNMA 3P4XA 8LPRA 3ZVAA 1P09A 4JMPA 3M0EA 1GPZA 1YZKA 4EAQA 4HAVA 1SGEE 2HNTC 4DDVA 1QA7A 1TGTA 1JNYA 4KHZA 1BS1A 2WIAA 1IHSH 3A83A 2F4LA 3E91A 1UTLM 1BUIA 3EQ0H 5FPTA 5FTMA 2IA5A 1DARA 3GY3A 2VVVA 3O8CA 1PQ8A 1DELA 1TB6H 1HJ8A 1ZJKA 5FI0B 1Z6JH 3MU0A 2ZFFH 3P6ZB 4QXAA 3U3OA 4P33A 2ZGHA 1TADA 2F1JA 3OF5A 1TQ6A 4BE7B 4RSPA 4PC1A 1KXAA 3RU4E 3SU0A 5JMTA 5C67A 4CBNA 121PA 3NDBB 1T5LA 1UBFA 1YR8A 2HV8A 2FDAA 1PFXC 3U9AH 2NU1E 2VGCB 2BZAA 1R0WA 4MPVA 1M9UA 1TMTH 5B2ZA 3WY8A 4ON9A 1XTJA 3ZDQA 5FBIA 1MO3A 1A61H 2FYRA 2R62A 2O8BA 1AM4D 4JJKA 1C1VH 4RKFA 2Z9GA 1DO0A 5BW8A 1XXHE 3BAFA 1VZQH 3QSYA 3JZMA 3TJVA 2XNIA 1E2MA 4RZXA 1AI8H 2FGJA 1I4DD 4AYWA 3MNSA 3SBKA 1GHAG 1C5WB 2STAE 3FKSA 1GGDB 4K8YA 2NIPA 1E35B 4ISIH 1ELDE 2ESTE 1G8PA 2A0QB 2G8TA 3BOSA 3U8TH 2RGBA 2IL1A 2R0KA 4US2R 3OAAA 4DIIH 4A1VA 2EFEB 1N6LA 1KXDA 3BXZA 1AU8A 3TAHA 4C0JA 2JLRA 1P2VA 1NKTA 2QE7D 3MLEA 2I3BA 2BZ6H 4KJZA 4BRUA 1OH7A 2EI6A 2FLBH 4GP6A 1OIXA 3TW4A 4QHTA 4BZPA 4BQSA 2BVSH 4E7NA 4BAHB 1JEEA 3TH2H 1FY1A 2PZFA 1QHYA 2YC4C 4DSUA 2ORVA 5CMXH 3WP0A 3ZZ6A 5B6OA 1BO6A 4KYIB 3D7MA 1ETTH 5AJXA 4ABJA 4QL3A 5KPDA 1BTWA 5GJVC 1N5KA 3CNOA 1NC6A 2OAP1 2W0SA 3IBYA 1QHHB 3DD2H 3ZZDA 1GHZA 2AX4A 3TQFA 4R71A 1UM8A 2V9PA 3KTAB 5SZIA 4DC9A 4Y0AA 1QFKH 2ZM5A 2IUUA 3QLPH 8ESTE 1TUEA 4YONB 4TMZA 5GJBA 1SPJA 1IQJA 4L15A 1SXJB 1F2UB 5FOVA 3QN7A 3L2OB 5EQQA 2BC9A 3KB2A 2ZDKA 1YRBA 1Z0DA 4WZAE 1W2GA 1O0DH 1DS2E 3EPJA 3CPJB 1EP6A 5JCPA 4ABYA 3KF2A 4A1FA 1L0ZA 1GG6C 4AFZA 1FMJA 4TWYA 1UFQA 3M35A 5HGGA 1Z0FA 1QVAA 1Z0IA 3URCA 5K8LA 1E2QA 2DE9A 3AQ4A 4JSYA 8GCHF 3L0SA 4JJZA 2TGPZ 1F5RA 2ZJ5A 4MDSA 4O03A 1FMLA 2WMNB 5E0HA 4HZUA 2ZXUA 4LHXA 1RTLA 1SLXB 1GTVA 5CK4A 4MQAA 1HNEE 5JS7A 1Z0AA 1SOZA 3ZYEA 4MRSA 3T2NA 4IEEA 1ZUNB 1YLCA 1LQEA 2AL7A 2ZCLP 3EG5A 3RSOA 2QGRA 1COWD 3QX5H 3SUFA 3LDAA 3SBDA 1BCUH 1KK2A 4QJ5A 1UCYK 3AP1A 3VGCC 1AZZA 2IWHA 3ADKA 2O8TA 1XRJA 3PEYA 3KQKA 3BG4B 1GI3A 1OHHA 2AFIE 1WYKA 1XXFA 3WYFA 4X2XA 4RVCA 1T8MA 1U90A 3UKDA 3CX8A 2NU4E 2C2HA 4BXWA 4A0GA 1GG2A 1YQTA 1C5MD 5ETXA 3I8SA 3KKPA 3AB3A 3SYNA
chains in the Genus database with same CATH superfamily
4YRJA 3ANYB 3EYWA 2X5JO 4JB3A 1Z8GA 3G88A 1GGJA 4NF2A 4W8OA 3E8LA 4PC3A 5J2TB 3ZZ1A 1A1VA 4CKWA 3P8ZA 1EGAA 1I4OA 1NBMD 1ABEA 1IZYA 3V9AA 3TD6A 3AERA 4G56A 1UHBA 3CIFA 4ZT6A 1JPNA 1KZ1A 1VITF 1XNHA 2Q1UA 5T4HA 1SZCA 3N6XA 3K6SA 3GEMA 3BJZA 4DARA 2P8OB 4IDPA 1O6BA 4ZDWA 1CO7E 3MTIA 5C5IA 5REQB 5HIKA 1U9YA 3THRA 3JD4A 2VJCA 3ANXA 1L4GA 5TQ2A 1F7VA 1VCMA 2ANWA 3I4CA 1IATA 4R54A 3J81k 1QIJA 2WRZA 4BN5A 2O8FB 1A9RA 5AI0A 1Q1ZA 3LJJA 2C7VA 1LI4A 1R6UA 4CI9A 1H4WA 4PLHA 2J09A 1BEEA 3KB6A 4X7RA 2AG0A 1CEYA 3QLTA 2NPFA 4JXXA 1BMAA 1GI8B 3LH1A 2J3QA 1T8OA 2VQ3A 3FDZB 1UZMA 4TV8A 2XVZA 2IODA 4HJXA 2WF6A 4IY1A 2JGDB 3JQGA 4YN3A 4I1OA 2W11A 4JI6B 4JJ8A 1RACA 2XXAA 2ZYDA 4S3MA 2A7QA 4B2YA 3ITNA 1OA1A 2PRJA 4HNSA 2HADA 1FP1D 4IV8A 1K1LA 4M9XA 5P21A 3FF1A 1FPMA 1YCDA 3DMNA 4YT2A 1DXWA 3IQXA 4XRGA 1T6ZA 2WJ3A 3A06A 1V3XA 2GV6A 2OBLA 4Q1EA 4CCYB 3FTPA 3LPAA 2NXCA 4J6EA 4F3KA 3Q3CA 3SSOA 3OEHD 3D6HA 4AF7A 4D3ZA 3GLUA 3H7TA 2YVAA 1LU9A 4PRKA 1LZKA 2NLOA 3ZGXA 4EJ6A 1R9GA 2X8BA 1BX1A 1GRRA 4QASA 4FCVA 1YAJA 3OCVA 1U5BA 5E8EH 2ZU4A 4B3RB 3H1GA 5LFAA 3FDJA 1XU4A 2QJTA 4YASA 2IYWA 4EUHA 4Q3EA 1LPSA 4ESTE 4YRKA 4MS4B 2I6FA 3C74A 2F3PA 3WLHA 1SC4A 3T25A 1MR3F 1NI4A 1P1FA 4KPUB 2QTLA 2GN1A 2P5YA 2GDZA 2PUEA 1OKXA 2WPNA 3TL2A 1ULSA 3OU6A 3BRSA 1NW3A 4DEVA 2Q1YA 4Z51A 1X8JA 3TQOA 3EXG1 3WK8A 2ZUFA 3ZJUA 1G20B 2OA0A 1JKIA 1NVMB 3TW8B 4RSRA 5JBCS 5CM2Z 1CIPA 2VJOA 4IMIB 3BSQA 1XZKA 2CSXA 3T28A 3NXPA 2ZR9A 3TQHA 3SUEA 3UBMA 4KKVA 4C4PA 4ABIA 3DWFA 1G16A 1JHVA 3ESCA 1QO0D 2VWNA 5K0TA 3H2HA 2X9LA 1U65A 3NDIA 2HDWA 1V2TT 4CM8B 1A5TA 4OUDA 4CMHA 2NO1A 4I55F 4Q4DA 4HGYA 1SZDA 4LF9B 4RY8A 1JAHA 2BHLA 5J4HA 3HS3A 4D7GA 4BO0A 3LNTA 2CHVA 5JAOA 3DC7A 4BY9E 1C9JA 4QATA 5CMLA 3BMCA 3Q0IA 1DM4B 4HWKA 2LDBA 3RJ9A 1ACLA 4IHKA 3RM3A 3C5HA 4JYCA 3I2HA 2MJLA 3LCCA 1W25A 5CIYA 4YRAA 1X7XB 3H4IA 4Q80A 3P8GA 2ZTHA 1R10A 4XE5A 2E4WA 5DWQA 3ZE6A 1Q0SA 5C1UA 3K3PA 3RVPA 2ZT5A 4NARA 3RREA 3NH9A 2QTHA 3PBKA 3BWMA 5T6DA 1FFWA 5EMNA 1A5GH 4HDRB 3ZV3A 1MX9A 4HS9A 2NPIA 4KXWA 2VP2A 3UWDA 3CT6A 2H4ZA 1GSAA 4FU7A 3DDUA 2H2GA 1Z45A 5KSWB 2ZQ5A 3GGPA 4WN3A 1P62B 1MC8A 1E8MA 3PC7A 3M83A 2QA5A 4B48A 3O1LA 1DX6A 2F9MA 2GBFA 1N32B 2Y82A 4Q3AA 4QXMA 2P8JA 4I86<