1CU1A

Crystal structure of an enzyme complex from hepatitis c virus
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular views of viral polyprotein processing revealed by the crystal structure of the hepatitis C virus bifunctional protease-helicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords PROTEIN (PROTEASE/HELICASE NS3)
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1cu1A05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1cu1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1cu1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cu1A03
3LT3A 4GOJA 1XUGA 3RC3A 3TVJB 3CF0A 3IIMA 1ZD9A 3VR6A 1OH8A 3SJBA 4LJ5A 4K1SA 2PCJA 3A36A 5EOKA 3GLIB 5AJZA 1NP6A 5F2EA 1P57B 2BDIA 1IY2A 2GEUA 2O8TA 4HLUC 2GXQA 2ZYTX 3FPAA 2PR3A 3VB5A 1O2UA 5A4JA 3LBNA 1OWJA 4MG3A 4CZ2A 3LXRA 1ARCA 1SI5H 4YOGA 4DSNA 2Z5FA 1ABIH 1DS6A 1PPCE 4JLAA 3A1SA 1WQVH 2Q0HA 3T1VA 3S9CA 2C5LA 1XX9A 2PMKA 3M5LA 4Y0AA 1DOJA 3ZD7A 4DIHH 2VH5R 3MO3A 1XRJA 5SZHB 3DOFA 2RGXA 4D26A 2IS1A 3GEEA 1Z47A 1TNLA 4D9RA 1TBQH 2GV6A 4US2R 3WY8A 2BC9A 1XEWY 1ZM9A 1LVOA 2NGRA 1J16A 1M6NA 2V9PA 2NZ8A 2FS9A 5CHAB 1MABA 1SGCA 2BD7A 3LGIA 3LW8A 3GDUA 4G5SA 1I4DD 3B1VA 2UUJB 3BTKE 4URXR 1TALA 3AF4A 5BWMA 4K69A 4GNKA 3RXEA 4OGYA 3BD9A 1ELVA 4KTUA 2D26C 4IVPA 4RZ3A 1K8RA 2EFHB 4C9BA 2A45B 5FOXA 3KJIA 1PUIA 4FINA 4MYCA 2GEDA 2OILA 2WIAA 2ZGHA 1W3CA 5JEEA 2ZTXA 1W49A 1C5WB 3I32A 1DE7H 3JZ2B 1TF5A 2XBYA 1ZBDA 3PG5A 1ZZZA 4CRBA 1U8ZA 3N7OA 4JCNA 1WTHD 4INLA 5CDFE 2ZR9A 2WPHS 3A84A 1TPPA 1K1IA 3S7KB 2QMOA 2NU2E 1NRJB 3LH3A 5AWFC 2RHDA 1BBRK 4EPXA 2TRMA 4ZI2A 4B73A 1DPOA 3P20A 2C04A 5HCIA 3UWKA 1G32B 3UPEA 2GRJA 1R2QA 1P9UA 2BDTA 4RD2A 1O3MA 1O3GA 2F91A 1GI7B 3ZS8A 5KSPA 1O3JA 1II8A 2AMPA 1U90A 4UNQA 2AIQA 1GI4A 4F91B 1RYHA 4BFTA 2PKSB 4N3NA 2FYQA 2GGVB 5HKKA 1L8QA 1GBMA 1T3LA 2I1QA 2FH5B 3T1QA 1KIGH 2ZAOA 1GBKA 1O3DA 2PMDA 4GZLA 3RC5A 2K1QA 2ZRIA 2P93A 2ZVQX 4NU0A 4KBFA 4QGFA 3HJNA 2EQBA 2ODQA 4W7SA 3P26A 1TB6H 1SHHB 3DMNA 1HFDA 2YNAA 3IQXA 4C3ZA 4TTQA 2G4TA 1NN6A 2BMJA 2ZEBA 3A7VA 1P6XA 1TNJA 4Q80A 1UVOA 1QL9A 5FTJA 5J40A 3DVLA 2NU3E 1IQHA 5F9FA 3TNFA 1VYUA 4AZ2B 5EZ5A 3TGJE 1RVDA 3VHLB 3P27A 4GLYA 2SGDE 2ONJA 3UQOA 2BWJA 3GYLB 3CM0A 3F68H 1U8AA 2BCJQ 3E70C 1DSTA 3Q72A 1QA7A 3FHCB 5JDUB 2NPIA 3QZRA 5EXXA 3VAAA 2C77A 2ZRFA 1OYWA 3A81A 2OFXA 3QENA 1TNIA 1WAYB 3Q85A 3GJ8A 2QMHA 3AF0A 1KSGA 2JGNA 3P1JA 1BMFD 4S35A 2ATVA 4DOQA 1FI8A 1GBIA 3BOSA 4QGGA 3CLVA 4UEHH 1BS1A 3CRMA 1HV7A 4RD6A 1WRBA 1CGIE 3OSYA 2WPLS 1CR0A 5JPMH 4FCVA 1GJ7B 5G3YA 3ECCA 5K7RA 5AHGH 3I5YA 4A15A 3T27A 3BB1A 3ITIA 2C9OA 3M61U 4W5JA 4D8NA 4CVNA 4IVRA 4F7WA 1F2SE 1K9OE 2IJOB 5T6DA 3W94A 2JAQA 1XKAC 3ZZBA 3SZNA 3ZZ7A 2OE2A 2H8KA 1E0AA 1C1VH 3SNDA 2W58A 1M1YE 4AURA 1GBCA 1O2HA 4DT7B 1RRFA 5EUQB 1Y63A 1KIMA 4JLPA 4R2IA 1KLJH 1VPLA 4BRUA 1JR3A 1ZOMA 2YHSA 4AG1A 1O5EH 1Q21A 2BY8X 1DE0A 3SU5A 4NYJQ 5F6MA 4QL3A 3OE7A 3B23B 2AERH 2I3BA 2W2XA 4C0JA 3EZ6A 1SHYA 2BD2A 1G9XA 2LNCA 4MVNA 1OXTA 1O5AB 4ZV4A 4HAXA 1OXVA 1A1RA 4DSUA 1HBTH 2QBYB 3AF2A 1K2I1 2CHGA 3RU4T 1LS1A 1O2YA 2YWFA 3VB6A 1Y3VA 1W10U 3T35A 3I78A 2J0VA 3SN8A 2ZRHA 1Z28A 1IQNA 5A0FA 4DLTA 2ZFQH 3VGCB 1YPMH 2ASEA 2JJ2D 4IDQA 4XD7A 2FLRH 2V54A 3AGPA 4NYMR 3T2NA 1ZVQA 2JCSA 1TMKA 4BZXA 3F9FA 3QVVA 1V2QT 3KHVA 4BAOB 3SORA 1O3AA 1OWDA 1KMHA 1HAYB 1C2JA 4IEIA 1EX6A 1QL7A 2B8OH 1UBCA 3ADKA 4GUXA 1ZM3A 1QR3E 4AG2A 4HFPB 3HKJB 3FP6E 1DLKB 4IRUB 2ZZUH 4FWIB 2GILA 1YZKA 1G8FA 1RS0A 2VIOA 2C99A 4OHVA 2EYUA 1Z7KA 3BTTE 2OLGA 2YJTD 2YNMA 4PQRA 4MRVA 2QQ0A 3JVUA 4QHYA 1KI6A 1HIAA 3I62A 1NY22 2A4RA 1CHOG 4WBSA 2IUSA 3FGNA 5KDLA 4B2AA 5TV2A 3KXIA 1M8PA 1N8OC 3WRXC 2C78A 2J41A 1NVWQ 2JDIA 1BYIA 2XZPA 1YR6A 3MU1A 4Z0KA 3RLWH 1IAQA 3BBPA 2YNBA 1IQPA 4UNRA 3ADCA 5AJVB 1A5TA 2H1UA 5C4MA 2X19A 1Y3WA 4OQXA 3M7QA 4MQAA 1A2KC 5BQ5A 1KDPA 1KK2A 2WZQA 2FOAA 1J15A 2FTLE 4NSYA 3NWJA 4MQBA 2ZI4A 1TQ0B 3UMSA 1VIAA 4PHFA 3RDPA 1G3RA 1P73A 5A8YA 3ND8A 4F38A 1P12E 4YLGA 1U2RA 2RDLA 5D3MB 1OFHA 4FWTA 4DCSA 2F1JA 1ZYUA 1FNIA 4D25A 1AKSA 4YDHB 3QXCA 5IDVA 1WBBA 4DGJA 1GMHF 2WSSA 3FFAA 2ZSBA 3L0OA 4TMVA 3OYPA 1GHBF 3FE2A 4Q7JB 3ZZ8A 3RVBA 1UTNA 3MFJA 3QJYA 4MYTA 5DIFA 1G4AE 2HLDD 2AN9A 2JLWA 4RKFA 1C1SA 4OI4A 2VRWA 1JWTA 1DG3A 3GLIA 3S69A 2FI5E 2JKHA 1C2DA 4QJ5A 1N5LA 1X3SA 2ZHWH 1GWNA 4GZMA 4ASUA 4MRNA 3E0PB 4TWYA 2GXAA 2Y5GA 1EZSC 1P8VC 3M6AA 1E9AA 1KK3A 5ETXA 2FE4A 4LPKA 3QKSB 4B2BA 3RXJA 3U8RH 4BXWA 2QV1A 2ANBA 1TU4A 4ZKNU 4UE7H 1QF9A 4ZDJA 1G21E 1GI5A 5DE3A 3KB1A 1NKTA 5JWOA 2XCFA 4PSAA 2A31A 2QXGA 1L2EA 1F60A 3ZZ6A 2F43B 2BEKA 1OPHB 1CEEA 1UHBA 4BLSA 3OZXA 3DMDA 3EIEA 9ESTA 1E37B 2YVUA 3VU9B 4NZLA 4V0LA 1ZGVA 3GPLA 1FMJA 1JRTA 2NMVA 2CBZA 1ODFA 2CCJA 1BTPA 2BDBA 4SGAE 3P17H 3CBQA 2BKUA 3G01A 1Y59T 1QRAA 1BTWA 3KKMA 1TPOA 1YPLH 4FUJA 1XUHA 5JHGB 3DD2H 4EFNA 3OEEA 1S2MA 3L8ZA 2A4QA 2BLVA 2JETB 1CLUA 5J4HA 1PQ8A 3EIHA 2P6RA 1NROH 1Y3XA 2NOAA 1ZIOA 3SUDA 4M53A 3KCGH 1TRNA 1F2UA 2FNAA 2QT0A 4MDSA 4P4UA 2AYWA 3PMJA 2ZGXH 4BEJA 5G53C 3PWCA 1MAXA 2NO7A 5FTNA 4TMZA 4LHVA 3PITA 4I1VA 4DWJA 4O2LA 3K09A 1Z8RA 2BY6X 1P4SA 2ZIAA 1HAVA 4U00A 3GY7A 3BORA 4Q18A 2DR3A 4I33A 4RCZA 2GJAA 2AFHE 4GP7A 3RSLA 2A78A 4YO9A 3A4NA 1ZNYA 1ANBA 2JDID 1VCPA 1MCTA 3EX7C 4Y71A 3H5CB 3DT0H 3RHFA 1Q31A 4URUR 5T1VA 3E2IA 1TMUH 1V2WT 1NJGA 3LAWA 1MO3A 1E9EA 4LJ7A 4LPSA 2VJ1A 4B2PA 1G8GA 4FXPA 1O2RA 1JPNA 1Z1JA 2R6CA 3GEIA 1OWHA 4M9SA 1US8B 4I4LA 4AKHA 4DDTA 2P5SA 1JRSA 5BYJA 2PGBB 4QBGB 1GSIA 1W2HA 2VQSA 2REXB 2W26A 4YT6H 4XVUA 3KFXA 3TK9A 3QUMP 3S1AB 4JZ1A 2A7HA 5K8UA 1V2ST 1ZJ6A 3A82A 2VU8E 1CP2A 5EE9A 1RJXB 5FI1B 1GHZA 4X1QU 5SGAE 4TLBA 2FOMB 1RRKA 4JLVA 3VEQB 3EAQA 1C1UH 3BTHE 5H1YA 1TQ6A 2QQEA 1LVBA 4Y7AA 2IYTA 3EZ2A 2RCNA 1O2WA 4TQUS 4HGCA 1IQJA 3BS4A 2MMCA 4UFEH 4FUEA 1JXOA 5JBAS 1N6HA 2VF8A 2QP3A 4OQLA 4Q66C 3A58B 4WOPA 4KO8A 3ZZCA 4HB4A 3DEFA 4XVQA 1E6CA 1OP0A 5TCAA 5HZHA 4I8JA 2AX4A 4V0ME 2BLWA 3LDXH 1PPZA 1AQUA 4M22A 4CH2B 1ELBA 3ZV9A 2GD4B 1YZLA 2GK6A 2XNIA 1IAUA 4DVGA 1F7ZA 2WJYA 2CHAB 2QF0A 1GCTC 1CJTC 5CJPA 5KDDA 5KUTA 5P21A 4XTRA 4IDPA 2Z0MA 3FDIA 521PA 1RE0A 1G20E 5LPFA 3F1SB 1W11U 2GK7A 3CPEA 3K6YA 3TSZA 1V2PT 3A89A 1R5BA 5KNCA 3P6ZB 1G6HA 1VITF 4K8BA 1WTGH 4A36A 3SFVA 3B9FH 2FOHA 2G77B 3MD0A 2PH1A 1E98A 1K1LA 2DFNA 3QG1A 3TIFA 3WMFA 4TWZA 1ZPCA 3REFA 5FAHA 4JYBA 4F4OC 2VP4A 1G3MA 1DOAA 5JSZB 4LSGA 4ZCIA 4IKEA 1FIWA 2IYZA 4NWKA 1TX4B 2AFIE 3IWMA 1Z6GA 4DSTA 2QYIA 3CS0A 4B35A 3NXSA 1KI4A 1EAUA 3NBZC 2IL1A 2QMUA 1Z0IA 3M5MA 2REBA 2P6NA 3A6PC 2VP5A 1OYQA 5IK2A 2CLSA 4ACAA 2SGEE 4DLSA 3QF4B 2J0QA 3UIEA 3GFPA 1AUJA 1O36A 4D4LA 3QXSA 3ZVNA 3ATIA 1TA2A 2HCJB 2Q6TA 3LJJA 2BY7X 1F3OA 2CMYA 1DAFA 1UKYA 4ZKDA 4NBSA 2UZ3A 4P31A 1R4AA 3LDAA 3RXDA 3DM5A 1P9RA 4ZMAH 2RGAA 4GOXA 3EE0B 1A0LA 1D2MA 2QN5T 2ZCKP 2WJVA 2WMOB 3PTNA 1Q3HA 4E06H 3NEJA 4HAVA 3UY9A 1KO1A 4FMCF 4HZUA 5FUWA 1E38B 1N6KA 3UWOA 1GNQA 1XZQA 2XBWA 5AJYA 3QXJA 2QUZA 2G4UA 4YLQH 4V0NA 1C1YA 1BOQA 1GFIA 1P03A 1YPHC 1KJZA 3ZIAA 2ZS8A 2FA9A 1TA6A 4CHAB 1XFAA 3I8XA 4YTAA 3A7TA 5JMTA 3A8AA 2A0QB 2OEPA 3T26A 4B32A 5ABWA 5A0AE 2PKAB 2OLJA 2P2LA 3TRFA 1UF9A 1E0FD 3W3ZB 4OQFA 1TOMH 2PV9B 2Z7FE 3KDSE 1QRZA 2OSBA 3X1YA 5C67A 1UBGA 1ZNZA 5GWZA 4PAMA 3KB2A 4CIDA 1LHCH 2NO0A 4BEBA 1ONBA 3X1ZA 1F92A 1UJ1A 2FG5A 4I31A 2PSXA 3EC1A 4HDCA 5GCHG 3OTPA 4FU7A 1GHXH 1JB1A 1O2NA 5DYGA 1GL1A 1S6HA 1KLIH 3EG5A 3HPTB 1C1PA 3MMGA 4PHHA 4QOSA 3U6BA 5LGOA 2AFQB 3R9IA 2BDCA 3NKVA 3CPJB 1XPOA 1HJ8A 4GVUA 4GCHG 3LH1A 4HATA 3GCNA 2A5DA 2DWPA 1BMNH 2J92A 2E1RA 1W36B 3EZFA 1ZP6A 3BG4C 4AIIA 1XU4A 2JLRA 2QEQA 1XUJA 1RD3B 5DP9A 5DO4H 2C03A 3PROA 2GCOB 1UCYH 1SQ5A 2IBMA 1E0JA 2BHGA 1YPKH 4CBOA 2BQWB 1SXJA 1SQTA 3Q3KA 2WV9A 2QU8A 3AVPA 2F1IA 1CGJE 3ICEA 1GMHG 5HM2A 2P3SA 1IBRA 2P67A 3E5HA 1R10A 1CS4C 1SGWA 1Y3AA 1M7BA 421PA 2RA0A 4G0NA 2FESH 2AR7A 1BMLA 1Z1IA 1SGRE 3PO1C 1JI0A 1C2MA 1ZMLA 1QHHB 3P8FA 1FLEE 1QL8A 2DBYA 1XNJA 5D3MA 2TGDA 1PQ5A 1E2QA 1FL9A 3TR5A 1JXPA 5A0CA 1U98A 3IEVA 1TRMA 2CK3D 2N1BA 2CCGA 4QJ3A 2P6UA 1DWDH 3PUXA 4H9GA 5GIBA 4ZIRB 1RFLA 1QG2A 2ZJ5A 1X6VA 1G41A 3MFYA 3BH6A 2PJZA 1BT7A 1BHXB 2NU1E 4YLUA 1ZCAA 4XTCS 3ZZUA 3BTQE 1C5YB 5FPYA 2F9LA 1B23P 3GY3A 2GETA 1AGPA 1U81A 3T12A 2IK8A 3SV9A 2D7CA 1C5MD 7LPRA 4MDEA 1ZPZA 4ZDIA 2Y5HA 1UCYE 3TNTA 2FFHA 3AP3A 4Q9IA 1EUFA 2KWIA 3GFTA 2WKPA 5HM9A 5FL7D 3HATH 1RFNA 2FTMA 4G5QA 3BIUH 3B60A 4TPYA 1E36B 3J81k 5GVRA 1FMLA 5CB8A 4UJ3A 1MQ5A 1SXJD 4R9UC 2EFEB 4X8LA 2PCLA 2PTCE 3MOCA 1IHUA 3LQQA 3FVQA 1DVRA 2A7QA 2WBLC 3QF7A 2XITA 4K3JA 5EG4A 1S6FA 4PXAA 5GPIB 3VB7A 1K28D 3K0AB 2D3WA 3VX4A 1RZ3A 4Z8XA 1S96A 1Z0DA 1LHFH 3QVUA 2G55A 2JJ2A 1IONA 2ZVPX 2D2DA 2ODPA 3ZZ5A 1C5VA 3PV4A 2G0NA 1AO5A 1IXSB 2ZJYA 1AN0A 3P95A 3T5GA 3DHKH 4D81A 1C4U2 1V6DA 2VHCA 4OHYA 1G8HA 2ZI3A 1P7CA 3GY6A 1V5WA 4Q4HB 3AV0B 4G5RA 1M7GA 5DN6D 2SHKA 1TOCB 1Q1EA 4UXHA 2FXRA 1D2EA 1SLXB 2JLSA 3LIWA 5EP2A 1SKQA 4EJSA 3WNDA 2L0XA 4JMPA 3IQWA 4ZPXA 1HV8A 4YZUA 1KJWA 4M1SA 4WA7A 4DJTA 2OBMA 3TW8B 1GHBG 3RS0A 4FIDA 1ORFA 1L1JA 4EPRA 1DSUA 3ZZ9A 2CK3A 4E7NA 5EJEA 2XSZD 2XTMA 1J8MF 1OIWA 2WINI 1NTPA 2JIZA 3VR2A 1R8QA 1T0JB 4AFZA 3GJ7A 2Y80A 1OIXA 2DUCA 4TQAA 1NJFA 2V55B 1TPZA 1H8HA 4HI0E 4DCTA 1H9HE 5IT5A 2ATXA 2H92A 3ZLJA 3UPUA 3NH6A 5FBLB 2JLQA 4JBXA 3TAUA 3RXTA 1G3IA 3E8LA 1SXJE 2EW1A 1DAEA 3ZD6A 1Z6YA 1E2JA 1CRPA 1WSSH 3B85A 4YONB 2AHOA 2WAYA 2PZFA 4HB3A 1GJDB 2J1LA 2AD5A 1EKBB 1S0QA 2BV3A 5DHFA 2KE5A 3NTUA 3OIWA 1AI8H 3ZZ0A 2WMNB 1C5NH 2NZJA 3KN2A 1VG0B 3OAAD 4IMQA 1JOUB 3HU2A 1HY3A 3VU9A 3HU1A 4JKYA 4D4KA 1UFQA 2IF0A 4Q00A 4Y79A 1C5TA 1SGEE 2JLZA 2P94A 5FH9A 1HAPH 4OJQA 1GBDA 5JECA 1XJQA 3FMIA 1TNHA 2ZRMA 5DP8A 1LHDH 1UTPA 4OHXA 1TUIA 3AUYA 2DWOA 4B47A 3ONWA 1QHRB 1P62B 3RS4A 3UMFA 5ESBA 4FVBA 1NMYA 1NFWA 3E6PH 3GY5A 1GVLA 2TGPZ 3FP7E 3E16B 2VIPA 3ZVAA 4AFUA 2YKGA 1E32A 3EA7A 2XC5A 2R6GA 1GJ6A 4J2YB 4Q5IA 1QB9A 4NZQA 1XXHB 1KZ7B 1WU1A 1ESAA 1CT4E 3FB4A 2JIZD 3OIUA 2YOHA 2O8UA 3KX2A 3QPUA 2KSQA 5KPJA 3P8OA 4POAA 1CR1A 4MKHA 4B3DA 3U44B 1N0VC 2HDNB 3L2OB 4WVPE 3LLMA 4NFFA 1T4GA 8OHMA 4NCYA 3MH4A 4GL2A 4BOHA 3MU4A 3SBEA 4D9QA 4OL0A 4NDZA 4PR0A 4AD8A 3QPVA 3SUEA 1Y5AT 3E91A 2BMDA 2NO9A 1LY1A 1LDTT 1DWBH 4O0MA 1MTVA 1E2HA 4DEYA 4JLMA 3C5CA 2CLCX 3A4LA 1UVSH 4BFYA 4B74A 3QO6A 1E69A 3QE0A 3UWIA 3SV2H 1NIPA 2A7JA 2Z43A 3KQBA 4DY7B 2QNRA 5FUVA 5LH8A 4MPXA 2G81E 3SGBE 1SKYE 5JFGA 3D65E 4KSCA 4Y0VA 5C2JB 1O3CA 3AVZA 4Q2KA 2YV5A 1G18A 1AGJA 3Q3JB 1O32A 4Y8XA 5FL7A 3FFGA 2A4OA 1GOTA 1EB1H 2J4IA 4ILEA 3B9PA 3STIA 1RJ9A 2FZZA 1UK4A 3HGPA 3M7UA 2C8VA 4I32A 3VB4A 3BAFA 1KXEA 1EPTC 3E90B 2J9RA 3UATA 2PT5A 3RDZA 2GZ7A 4K60A 4JJZA 1AFEH 2CHQA 1NSTA 2C9YA 4ZDWA 3F9EA 3VPKA 1Y3UA 4XWAA 5FX5A 1Q20A 4TTPA 1TL7C 5JLJA 4IOMA 4XWOA 3O47A 3E1SA 3PMBB 3SJOA 4M4SA 4Z6AH 1NBMA 1T3SA 2F9NA 1IQEA 1CKEA 5EZ6B 1BJUA 1EPTA 1LNZA 1V2VT 5FTLA 3GLHA 3FMOB 3QI2A 1HQCA 4A6PA 3KTAB 1BMFA 4DDUA 3H7TA 4ZH8A 4NFEA 3I3SR 2CMKA 2CJIA 2SFAA 821PA 3LPRA 3ZZTA 3MJRA 3CRQA 4IC5A 1S4QA 2IPHA 1OKKA 3Q3XA 4BNRA 2FMJA 1T6NA 3R9WA 3H0KA 3QGNB 1C2IA 4JLNA 5GNDA 5DKMA 4DLXA 1W0JD 1OXXK 3K0FA 2VGCB 4L9SA 1PPEE 3PUYA 2HRVA 3Q5EA 1OIVA 4PROA 3SFZA 4BFUA 1GBAA 3LC3A 1F2TB 3LFUA 4UKDA 4M2LA 2CVFA 2UWPA 1M9UA 1UCYK 1QFKH 3MU5A 3C7KA 2ODNA 2F9BH 1A2CH 3U7HB 1THPB 1W46A 2FOGA 1MO6A 1RC8A 2ZECA 1A4RA 1XXHA 2BY5X 1AE8H 3CX6A 3F6UH 1UM8A 4GT1A 4JBYA 1BIFA 2ZITA 1U0JA 4JVNA 2B7DH 4QM6A 4ZXXH 4RN6A 1EZXC 1K22H 4NL4H 3A80A 2PW8H 2BD5A 2ZHDA 4JBWA 2Q21A 2WPKS 2SGQE 4C7OB 3FP8E 1JBUH 4AYXA 3C8UA 3GJ4A 1I2MA 2IF2A 1TQ7B 721PA 3U3MA 4EAQA 4UXIA 1LTQA 3RRNA 3SYJA 3RYTC 2IYYA 1FPMA 4NMMA 4MNWA 3GY2A 4CEHB 4Y0YE 1I4LD 1IJEA 4Q48A 1N1LA 1OXGA 1QB6A 1KDQA 2CHVA 1YRAA 1EX7A 1XVMA 2O0HA 4IXMA 3BC1A 4LOAA 2WHXA 1YCPK 4K81B 1N25A 2Z83A 1CO7E 2NWNA 3RM2H 3EYDA 1CBUA 1C2EA 4YMTA 1EJNA 4UQOA 4O03A 4FMDF 1R0WA 1XD2B 4PPGA 3RANA 1O2LA 1NRPH 3RMNH 1U99A 4PHGA 1CT2E 2XNDD 1UTJA 1TIOA 4XDEA 3RAPR 4CGZA 2P0EA 1CHOF 2AK2A 1GDDA 5FPKA 5AFZH 3GISB 3RXHA 4FMCB 1JECA 3LBHA 5B6OA 1KSHA 3B13B 2FSGA 1NG1A 5A8ZA 3GY8A 1C9PA 3FFBA 6LPRA 2H6MA 4RKOB 4UNNA 1E99A 3EWAA 1VTKA 3ELAH 3MCAA 2D7DA 2HNTE 1VCMA 1CF4A 2PJRA 3W6OA 1PPGE 1YCPH 4PQYA 1SVPA 4C30A 2VBCA 1MCVA 1LB1B 5LB2A 3SUGA 2V6JA 1GDNA 1BTUA 1C5QA 2GMTC 1Z2CA 1ZRKA 1KMQA 1NLZA 1PQAA 1N6XA 1NLFA 2YC4C 2WJIA 4BZPA 2PX3A 2FEOA 2WUCA 3PYHA 2WJHA 5GXPA 1KNQA 4QNMA 2HEIA 5EW2H 2HNTC 4WXRA 5DP5A 1SULA 4URVR 1VG1A 2YWHA 4YMVA 6Q21A 3CIOA 5HZKA 1R0YA 2BCGY 3EA9A 2VWNA 2TPIZ 4MDFA 2VP6A 1FZQA 3P32A 4IW3B 2LKDA 4O3UA 4WZ6A 4OBEA 1TBRH 3EIQA 1UK3A 2IS6A 4FU9A 1J99A 1KHTA 3L0PA 1MQ6A 4LBWA 3FKQA 4HAWA 1LVGA 4AYVB 6ESTA 4JLOA 1RIWC 1MO5A 1Z07A 3EA8A 1S9HA 1I2DA 1AU8A 3UWJH 3AQ4A 1F2UB 1X7AC 2QBYA 2QMEA 3JVVA 4Z8YA 3D7MA 2O9QA 1VCQA 2ZU5A 3ZVRA 4LI0A 1BTYA 2RHMA 2QPAA 4BAHB 1TYNA 5FCKA 3AKEA 2O8EA 1A1VA 1VG8A 2GZ9A 1L2TA 1KK0A 3T62A 2G1KA 2WJJA 1P9WA 4ZKRU 2W0MA 5IYTA 4PZYA 5DLQC 1FUJA 5TVKA 2BJVA 2W83A 1U94A 1V3XA 4NA7A 3O8RA 1B0EA 3P4YA 4HAUA 1ZU4A 2GZ8A 4DLZA 4I99A 1M7HA 1K1JA 2IYRA 2N46A 4M1TA 3UOPA 3M4YA 3VNUA 2BQ6B 2AL7A 1TF2A 1IQIA 4BQSA 1GBHA 2BXUH 4B33A 5DP3A 3LU9B 1MMJN 4UFDH 2Z9KA 1QHYA 2J95A 4FMBB 1E34B 2GBLA 1XKBC 4N0DA 1T91A 3VMFA 1DADA 4RZXA 4NIYA 1W1WA 3DO6A 2WWFA 2OC1A 1E1QD 4JK6A 2P65A 2VB0A 4K1TA 1FW6A 3SZRA 3K0EA 5TB5A 3SBKA 2Y5FA 1W36C 3GDVA 1PJPA 1W7AA 2FFBA 4AYTA 3EA0A 4Q1BA 4U5XA 2HVXA 1FONA 5FBWB 4RD1A 3THXB 2G83A 1Q1ZA 3PXGA 1TUEA 1D9XA 3GD7A 3ENSB 2ZDMA 3QTVH 5FFMA 1SGQE 1ZW6A 2IYVA 1K1PA 2CEAA 1CGHA 2Z9IA 3A85A 2J9NA 1GMDF 3SC3A 4NCJA 2XGJA 4EQ6A 4GP6A 3BXZA 2QSZA 3A8CA 3NEYA 4FW9A 3LBIA 2C8WB 2Q9CA 2D06A 1EASA 5HGGA 5L6NH 2ESTE 3LGYA 1Z6EA 4P4SB 1XMNB 4KCGA 1ZUHA 4L4UA 4AKIA 4A92A 2J7KA 4A8JA 1GI0A 1TGTA 1KZGB 1KY9A 3TJVA 1D3QB 1IJFA 4YDSA 3A8TA 5G41A 1G5TA 1N0WA 1VR1H 2ANKH 4GSYA 5JBBS 3DHWC 3ZVFA 4KYUA 3HWSA 3ZQJA 1ELFA 2ZYUX 1K21H 3SU8A 4PC7A 5FBVB 3OIVA 1NM6A 3M5NA 4XBDA 5E7JA 2H7VA 2P3TB 1IN4A 3LX5A 1Y5BT 4OQNA 5JB8S 2OT3B 2Z9LA 3RXAA 1GG2A 3PLBA 2ODYB 1SKYB 1OP2A 4ARZA 4TN1A 1JAIA 1P2KA 2PGQB 3LVRE 3ZJYA 4NCIA 4DKXA 4ISLA 4A2WA 3B5JA 4ITRC 1FUKA 2VSFA 1ZHRA 2BKEA 2Q3FA 4I7YH 2H57A 1G16A 4INHA 1YQTA 2GCNA 1H1BA 4LK4A 4QGHA 4NWLA 3QKTA 3QGJA 3ETLA 5E95A 1P3CA 1ANDA 3AUXA 1CA0C 1A61H 2QROA 1FOEB 1YZNA 2J0UB 1D6JA 4Q03A 4MKGA 2XXAA 4NIWA 1QVRA 2TIOA 1GPZA 2IHBA 5IRCD 5EQQA 3KKPA 3ASYA 3RU4E 2OK5A 2YC2C 4IN2A 2W6ID 4TLDA 3SQHE 1RPZA 2DWQA 3AK5A 2ZPTX 3RP2A 4AFSA 2BEJA 4H6TA 2WWXA 1O87A 1T8LA 3SNCA 5B58C 2MSEB 4ABDA 4URZR 3B1XA 5B2ZA 1GAJA 2A32A 2J38A 2GJSA 3RABA 2O0KA 1AY6H 4KP0A 1D5CA 4C0KA 2VIDA 1XTKA 2A2ZA 1SOTA 3PR1A 2Y7XA 4AB9A 4IOKA 1O2KA 3VFDA 2C8YB 3FKSA 4C0HA 3QXXA 2H18A 4WIAA 2ZIQH 3UNQA 5A0BA 2ZR0A 1FY4A 2IN2A 4RJLA 1VCWA 1DPFA 2Z9JA 2E87A 3A37A 5JJLA 3QBTA 1KI2A 1RKBA 2A5GA 4UXJA 4A9AA 4NIXA 1MABB 3BFXA 2J0SA 4KJZA 3LVQE 1HA3A 1W4CA 1P01A 2JLVA 2VWOA 1BZXE 1HJAC 2ZANA 1O5DH 2O5VA 3WXMA 1DFPA 2G9NA 4FUGA 3PEYA 3IKJA 1ZRBA 1T32A 4YOJA 2JJ1D 2H16A 3VKHA 3CZPA 5L8VA 1GJ9B 4IFEA 1EOLA 2ZR7A 2R62A 2F55A 2YOLA 5FL3A 2KAIA 4X8SH 3BIVH 3RMMH 4KVAA 1DARA 3MG9A 1SVIA 2C3SA 4A0HA 5TMPA 4OS6A 2UWLA 3NC1C 2W6JA 3BFKA 3WYFA 1KK1A 3TH4H 1WUNH 3PUVA 1QBVH 3AW0A 1O2VA 1WXQA 2VHJA 4LX0A 2FOEA 2KB0A 2ZI7A 1WBGB 2F9MA 5F9HA 2F9OA 4E7RG 3SJIA 2P5TB 2QORA 1GGDC 4TLAA 1FPHH 4ISHH 3THXA 2Y8EA 4KKDA 1YPJH 1EK0A 2FWRA 3KFVA 4JT4A 4BTIB 1O3HA 2GZHA 3VR5A 3M37A 2BYAX 3VNVA 2DHRA 3TPIZ 4JLDA 4QBHA 3TSOA 1BO6A 3TGKE 2KBEA 3K53A 2FI3E 2WSMA 3CR7A 2SGPE 4X6OA 3U9AH 1XPUA 3TVDA 1TPAE 1TWXB 3GLFB 4IMZA 5M04A 1DAIA 5EP3A 1C2GA 3P70B 4XSKU 1PJRA 2VL7A 3S9BA 3FZZA 1HUQA 2ZDNA 1EWQA 4W5WA 3IBGA 3TU7H 1VCNA 2AEIH 1G37A 1NZQH 3OEED 3GLGE 3HGNA 2QM8A 1LTOA 5K8LA 1IN8A 4DSOA 2XTNA 4M1KA 3LH5A 2I4IA 2B7CA 3GJ0A 2H9EH 4KFTA 1N5JA 4BFXA 4NYIR 4L16A 3ASZA 4Y8YA 4US1R 4Q19A 5KO2A 4X2XA 2EFGA 2GMTB 4QFMA 1AVGH 2O0JA 2PFEA 1EZUC 4HLCA 4HZIA 4RCYA 1G4UR 1TNKA 1IN7A 1GKIA 4TYYA 4C0BA 4O2RA 7ESTE 2IEYA 2OCVB 3ATLA 1NPMA 5DNYB 2FI4E 4YXWA 1P04A 1S5SA 1TADA 2QI9C 4DBLC 3KNXA 3ZZ4A 3NUMA 2ERXA 5EU8A 3TJNA 5DISB 4WZBE 3BB4A 1F0RA 3SI3H 4KI0A 4Q1EA 1FQ3A 1A0HB 4V0MA 1GBLA 1OWEA 2CN0H 2ZRDA 1K1MA 2QTFA 3ZIAD 1MH1A 3RXCA 1H8DH 2ZDAH 2XWBI 1EXFA 2OO7A 1HQYE 5L3RA 2XZOA 4XBCA 2HYIC 4EIWA 1Z08A 1NY5A 1GKUB 1YKTA 4JIMA 1SVLA 1EXMA 3N70A 4X1SU 4RVCA 3NDPA 3MWKA 5C1YA 2BVXH 3LKWA 5FR2A 3GQBA 2Z3DA 3OF5A 1D4PB 4F49A 1CU1A 1MO4A 1BA8B 1RRGA 1N6LA 1XCMA 3EAJA 4DW2U 4OKSA 1P2JA 1GG6B 2ZTZA 3A7YA 1S84A 4NIVA 4HDOB 2G51A 1U0LA 1SC8U 1BTZA 1LVMA 1LCYA 1GBBA 2AKYA 2BJWA 1P2IA 2F9VA 3OESA 3BTDE 1P09A 3DUXH 1VITG 4QHSA 3AF1A 2D74A 5L3VA 3DFJA 2AGEX 3U8OH 4EFLA 2ZG0H 1MBQA 2WIBA 2QXIA 1BOFA 1YM0A 2IS2A 1UVTH 1SLUB 4P4TA 1FMGA 1G9IE 2ZHEH 1VITH 1RJ9B 2P8OB 4A6XA 3ZQ6A 1GI2A 5IHPA 1AIXH 1KXDA 1W4RA 1MD7A 2QZ4A 2CNWA 4D0NA 5CYOA 1XUKA 4B2CA 3MUFA 2FPLA 1EGAA 1ZLRA 3W6NA 5J4VA 5JBCS 1AHTH 1LPGB 1YGCH 5FOWA 1BDAA 1GJ5H 3AP1A 1DDJA 2G1JA 4M9FA 1AFQB 1AFQC 2Q9BA 1QBNA 3A8BA 1E2KA 4FD2A 4Q4JA 5IDKA 4JYUH 2OXCA 1GJ8B 3ZYCA 4NONA 3H4MA 2ZGBH 1GVNB 2AD1A 1GRRA 1BMAA 1UTMA 3O8BA 3RXFA 1TNDA 1UHBB 2GCOA 1ZNWA 2IWHA 4M0LA 5CIWA 2W7SA 1O34A 3GJ5A 2HNTF 2OINA 2ZSAA 3T1OA 1K1NA 3RXIA 3K65B 1MR3F 5BYKA 5EXPA 4F93B 3FZDA 3AVUA 2IC5A 1D3TB 2VNTA 1H9IE 1O3OA 1O2PA 2OAQ1 1UTOA 1ANEA 1GI9B 5AJXA 5C1BA 4KFSA 3TQCA 3U4QA 3LJOA 4PC1A 3BN9A 5B64A 2BBOA 1HAIH 1Y5UT 4GI7A 5G3ZA 1E9RA 2KAIB 1O3LA 3U2QA 2ZXUA 3EGKH 3LGUA 3PMAB 1Q2WA 1Y3YA 3RLYH 2ZE6A 1M74A 3CX7A 1G6OA 2H1LA 4NYMQ 3K0CA 2ZI5A 1V2MT 2CL7X 4U02A 1DG1G 5JYIA 2UUFB 1TGNA 1XM1A 4J0QA 2ZCLP 3ZH9B 1NI3A 2BDHA 2D8WA 4I8LA 1MU6B 1GDUA 3Q3YA 5FTMA 1E9SA 3SUFA 2EA3A 1H8IH 2ZJ2A 1EP5A 3ZZDA 1QZXA 2QTVB 2Y6TA 2FO9A 8ESTE 3KQLA 1KTSB 2HXYA 1NL3A 1E4VA 3SR0A 1HEIA 2EEKA 3IG6B 3KQHA 4OQMA 1O30A 3LD9A 2WVJA 3MO9A 2GZDA 2V8OA 2J46A 4PO9A 1P5ZB 1C4OA 2FFAA 4NYJR 1J70A 4Q21A 1P2SA 3AF3A 4B6FA 1S1MA 1Z8GA 2CE2X 1HIAB 4TL8A 3G82C 1KKMA 1YCPM 5H70A 4GOKA 1GM5A 4N1AA 2THFB 3IILA 1MKXK 2O8BA 1BHXF 1PPHE 3V13A 2OQUA 1PVOA 2DY1A 1JR6A 3FHOA 2VTKA 1UO6A 3BTEE 5JCZA 1ZM7A 2ZWLH 2FOBA 1E35B 1Z22A 1O5CB 2ZJBA 2B8TA 2IA5A 3F9HA 5LPRA 1WQ1R 3QG5A 3AVWA 4Q7KA 2A30A 2W6IA 3H1TA 2FZ4A 3NKKA 2R0LA 1ZJKA 3JZMA 1K1OA 5EGMA 3CO5A 3RS2A 1YE8A 4Q4HA 2JLXA 3QX5H 1DWCH 3BTGE 1E9FA 3QSYA 4BE7B 4FUFA 3PO1B 4FUCA 1Y8TA 3PTBA 1XTRA 2FOCA 1LFDB 1LQEA 2ODWA 5AUNB 2UZIR 3UUZA 4OHWA 4NP6A 4RD4A 2D62A 1GJBB 1D3DB 1CRQA 4TZ0A 4B3XA 4ZHMU 2AH4X 3Q9LA 1E1RD 4DT1A 5DK1A 3C41J 3X2SA 5C1XA 2FM2A 2SNVA 1BJVA 1SVMA 1SQAA 2C8XB 1HTWA 2FSHA 4NG9H 3MNSA 1KTVA 1NVVQ 2JH6D 2QY0B 2CJWA 2H9HA 1C2KA 2RG3A 2O8CB 2ZTSA 1Z83A 1P2TA 1AVXA 5A5GA 4DURA 3THYA 5GDSH 4GFDA 2VA8A 1AUTC 5KOYA 1OW3B 4V02A 1B0UA 2GJKA 2CVHA 3CX8A 4NPHA 2R3YA 3U3RA 4LZ1H 4YT7H 1NFXA 2E9SA 3A83A 4GPTA 3SEAA 1VG9B 4ZXYH 4ASHA 4E05H 4CW7A 2R2WU 3Q76A 1SR5C 2F1HA 5J4QA 1JJVA 1FNNA 4ABAA 3SNBA 5AUOB 1L7VC 1VKJA 5DPAA 3B7GA 2A5FA 3NK8A 3OTJE 5J4SA 2O8DB 2F6RA 2ZI2H 4QBIA 5FPHA 4CRCA 2ZJZA 1S0RA 1O2QA 1J8AA 1EWRA 1VGCB 5GCHF 2G0TA 1DAMA 2R6FA 2AWOA 1FTNA 4AG5A 3UR6A 1O39A 3ATMA 4MTBA 4LOYH 4NZYA 3SU4A 1J2JA 1D8TA 1MKYA 4WZAE 1C9KA 3GLHB 2OM2A 1KDRA 1P3JA 1FX0A 3GMTA 1F5NA 1ZD8A 1C2FA 3RS3A 2QT1A 1TRYA 1Z2AA 1FQJA 4HDQB 1OSSA 3BEUA 4HUQB 1HUTH 4TMXA 221PA 1HYLA 1MBMA 1GITA 1FZZA 4U01A 4GPGA 5IK2D 1YLDA 2P8OC 4LC0A 4JSTA 4PANA 4DLYA 4EPVA 2R65A 1AS0A 1EATA 4BANB 1J7KA 4MGZR 1O3KA 3BFVA 1YR7A 2PUQH 4NCHA 4PAQA 3UOUA 3CS7A 3OFNA 1BTHH 5DN6A 3V7TA 1ZMNA 3VR3A 2A5IA 3ODFA 2QRNA 9LPRA 1CA8B 1IOZA 2IX3A 3CNNA 4ESVA 3ZVLA 1ZINA 5JI3E 4P0TA 1ELOA 1LO6A 2PWXA 2HT1A 2BHRA 1D3PB 4MRPA 4A0GA 1L4DA 4TQ9A 2BX3A 4I1SA 3TITA 1KMHB 2VP2A 1EESA 3QWCH 1O33A 3ZVGA 2QA9E 5HKKD 3CZQA 1XF9A 2VWLA 3RSOA 1LPKB 1KO5A 1P2MA 4PSKA 5B57C 3VKGA 2GEVA 2XZLA 1BBRH 4JJKA 1BTXA 3U5ZB 1CSOE 1MTNB 5JBTA 3EWSA 1W2KH 4JZEH 4OI1A 5FPSA 3X1DA 3EQ0H 3GDSA 4LBYA 1FY3A 2FOLA 1C1MA 3GCOA 3R7WB 5FR1A 4RD0A 3IGFA 4UFFH 1S82A 1HPGA 1SHZA 1WV7H 4KTSA 4X8OA 2OFWA 1ZTJA 3NIBA 3MNXA 4A0FA 1EZQA 4A8JC 4AC9A 3MO6A 4HB0A 1RYFA 1KI9A 1XEWX 2JJ8A 4QM7A 2B7BA 1DM4B 3MWYW 5EUMA 3VGCC 5EP1A 2ZRCA 3WRYC 2GCPA 4R98A 2ECKA 2TMKA 2V1XA 4LHWA 3SYNA 4OHZA 1MKXH 2EI6A 1ZR0A 3B1YA 3EZ9A 5B30A 1ESNA 1CJUC 1PPBH 2GNOA 2ZE7A 1BYUA 3THOA 3JZAA 3GCTF 5JZVA 4TL9A 4IEEA 2VP9A 1BMMH 3ZVCA 3TGIE 4C2TA 3NCLA 4Q9HA 3DDCA 1NN3A 2J3EA 4MYUA 3AVVA 1W2GA 5AR1A 1P05A 1V2RT 5JJKA 4NA9H 4QJ4A 1XUIA 3Q7PA 3TUZC 4TY7A 4MGIR 5E0JA 2ZNKH 2UWOA 3U1JB 4WVFA 2STAE 1AVWA 4ZIRA 2G5NA 1ZTKA 1FTSA 4YMSA 4ISIH 5AUPB 1MTUA 2ZEJA 4C7OA 1QCPA 4I81A 1EFTA 1HE8B 3UANA 1KXCA 4PTLA 2VVUA 4ZHAA 2ZPRA 1OH5A 5G40A 5JHHB 4LV6A 2GCTB 3QKSA 2YWGA 1Z29A 1Z5ZA 3HPQA 5J4LA 2ZAMA 4Y8ZA 3RXSA 1T5IA 5ELXA 1NRSH 1JXMA 1KO4A 2Q9AA 2CJWB 1ELEE 4R8TB 1P61B 3W3AA 3KKQA 3K9GA 2ZI9A 3BERA 3SU3A 2EFDB 2ZYWX 4F4JA 1KDTA 2PKSC 2ZUDA 1HAHH 1NU7B 3F9GA 1EAIA 2BXTH 3UTUH 2ZDKA 2ANCA 2GESA 1RW4A 3A8DA 1W12U 3RUOA 2RB4A 4WXVA 1HAZB 1C5ZB 1S8FA 2A5KA 1GBFA 1COWD 4XWKA 1HGTH 2J7PA 1YZTA 1UVPA 4K2YA 4OS2A 1JNYA 4D6PA 2DYKA 2AS9A 4DIEA 4XVRA 2H5EA 4KFRA 2O8CA 1Z6JH 4QG7A 1E0KA 7GCHG 1IXZA 1NVVR 1EPTB 4D82A 4ABHA 5F8TA 2YINC 1WYKA 2ZDVH 3BGWA 3PLKA 3W5JA 5JCPA 1OB2A 3RC6A 2P3FH 1FAXA 4FVDA 1KY3A 1Q22A 1PUJA 5BN5A 1V2TT 1QHXA 3A1VA 1G19A 4RD3A 1QHIA 1WCV1 2ILNA 3IO5A 3MHWU 7KMEH 1NFYA 2ZO3H 5DH9A 3M7TA 8LPRA 1XD9A 3CR8A 4KXFB 2A7CA 1E2GA 2OD3B 2FPZA 4TMWA 3TKLA 4A1TA 2A2XH 2ZU0C 2W00A 2A3RA 1A82A 1ETRH 4C4PA 4BASA 1E2EA 3V3MA 3KQEA 3MH5A 4UNPA 1N6YA 2QAAA 2OFOA 4KAXA 1LHGH 4JL6A 1SQOA 4RSPA 3B8HA 1O5GH 3DZDA 1SVWA 4CH8B 1AS2A 1UEIA 3MNBA 3T28A 5JB9S 4B2LA 4UNSA 2X8AA 4Y0ZE 3SS8A 1KI8A 4X8HA 3UG7A 2IEZA 1BIOA 1SLVB 1AQYA 2H9TH 1P75A 4WMEA 4Q7MB 1SGPE 1VMAA 2QP9X 1JAHA 1DICA 2J5XA 4M9ZA 4LJAA 2J0UA 1YF4A 3S0NA 4FUBA 1TX8A 4IJMA 2Q3MA 1NC6A 1O3FA 4DXAA 2AWNA 1NG9A 3QKUA 5ANRB 4LHXA 1ZUIA 5FUXA 1E79A 5SZKB 3TK5A 2GVZC 4MKIA 3U7GA 1Z0FA 4DC9A 3I72A 1ELAA 1JMOH 4ARZB 1U9IA 4Q4AB 1ZM4A 4B3FX 1YYY1 4IBLH 1N6OA 4B75A 2ZETA 1F0SA 2ANMH 1QHHA 3B82A 4I8KA 5DI3A 4B3GA 3SQEE 4XSGA 2ZA5A 4EDHA 2BLQA 4D76A 5CM8B 3A4MA 5CLLA 3SQXA 1Q0UA 3UFAA 2FOFA 4BPBA 1F5KU 1T0HB 1UBEA 1G8YA 3RXOA 1WE2A 3SNHA 5E2OA 4CT4B 1HAVB 3CPHA 4Z54A 3PEVA 1TFXA 1X8KA 3NBYC 5FBQB 1O3PB 3AP2A 3TVTA 3TUIC 1IQGA 2ZS9A 2OLKA 4ISNA 3M3VA 1SVOA 3KEEA 4M9XA 1A5GH 1W0KA 3WMGA 4KELA 5TCCA 1AKEA 3U7FB 3R9XA 1C5RA 5TARA 1S9DA 4JS0A 4DDVA 5TJXA 3X1WA 3T5FH 5FCRA 1Z3IX 1KSFX 2FGJA 4PC3A 1W13U 1T4VH 5DGJA 1HYQA 1B5GH 2QL6A 3CH5A 5AVDA 2XJ9A 1GZSA 3LLUA 3N2EA 5FBEA 3SJ8A 2WWYA 5CLQA 1ABJH 1DO0A 4Z51A 3PUWA 4QXAA 1MTSA 3U61B 1AZ8A 1LS6A 3FVFB 2Q3HA 2O8LA 3R0FA 4C0QC 1ZC4A 3EW9A 4BFZA 4B48A 2B8WA 1CHGA 3M35A 1EP6A 3LWNA 1WOFA 1GMCG 2D2FA 3QQ5A 3REGA 3SQWA 1HJ9A 3ZDQA 1O3YA 2R44A 3GLFA 2QGNA 3C14C 4AK9A 4S2EA 1NBME 3SHFA 4GRAA 1SZPA 2W0SA 4OI0A 1AK2A 1UTLM 1VYVA 2YZ2A 2HOBA 3ATWA 4LRWA 4V0KA 1JR3D 3DM9B 1N5KA 4D4MA 3W90A 1E2LA 1JJ7A 5A8XA 5UKDA 2C8ZB 4HI3A 2HUPA 5EXLA 2XC4A 4BAMB 5FOSA 1IN6A 4PPNA 3SJKA 4KBGA 1O37A 5FTKA 5EXSA 3KGPA 4KV9A 4XE4A 5E8EH 2JATA 1HAXB 1W47A 3NBFA 3DZ8A 2H2ZA 3SZEA 3LV8A 1T8NA 1OXSC 3MI4A 3T34A 2FV8A 2ZSDA 2RGNA 3MGCA 1DUAA 2V6NA 1YR9A 3TR0A 1QB1A 2FEQH 4PC2A 3P8GA 3SYLA 1GBEA 5F03A 4HSEA 2BDGA 4RKJB 5FXLA 2ZI6A 3AAVA 4LJ8A 3L33A 2WAXA 1OH6A 4AGKA 3MTYA 4OK5A 1JIRA 4H1UA 1HCGA 1IY0A 2QGRA 2O8WA 1DELA 1XJ0A 1XWIA 2CXVA 2QY9A 3SI7A 1Z71A 3WBJA 2CV3A 4AORA 1R5OA 3C16C 3K0CC 1GI1A 2J87A 2JH5D 4WF8A 4G3XA 2XSZA 1TBZH 2O8MA 1NN5A 4WMDA 4IOLA 3H09A 2FSFA 3ZYEA 3KQDA 2GDJA 2BD4A 5BN4A 2EC9H 1GKYA 3PM3A 3RXBA 4IC6A 3BSQA 1DVAH 1Z0KA 2VGCC 1A3EH 6GCHF 4JZKA 2W7UA 4HLUA 1AE5A 3IUYA 1CXZA 2ODEA 2C95A 1OV4A 4A4DA 1Q1BA 4K5ZA 2GAAA 4FUHA 1XD2A 3IIKA 4AFQA 2B92A 1O2SA 1ZAKA 1SMFE 5B6LA 1KKLA 2ZSFA 1JR3E 2ZUCA 4FU8A 2H17A 2VEDA 1MKWH 3I4LA 4ON9A 3THWB 1OF1A 3T5DA 3TUJC 1NESE 2BOHB 3T06B 4ZKEA 1GL7A 1KGDA 3RC4A 4Q1CA 1TQ2A 2EFCB 1OFIA 4DCVA 1YR8A 5I46H 3UKDA 2QAGC 1FX0B 3W5IA 2STBE 2LPRA 1C1RA 3PEWA 1DLEA 3B2EA 1E4YA 2W2TA 4HEJA 1HB0B 4CDGA 2Z9GA 5KSOA 1ZSLA 2VYFA 1Z0AA 1E1RA 3LNCA 1Z06A 3L0IB 3SOPA 1HAOH 3Q00A 3ZV8A 3UG6A 5KSZA 4MPWA 2OESA 3I77A 2CF8H 1G17A 2ZGJA 4OK3A 2GF9A 1KI3A 4Q9KA 1PYTD 5EE0A 3B78A 1BRUP 4K1EA 3DFLA 1O31A 1A3BH 5DP7A 4R0IA 1FN6A 2HPPH 2NIPA 4CYMA 3SHAH 3WYGA 5J4YA 2HYDA 2R2MB 2O8EB 1GMCF 3RXUA 3L8YA 1TMTH 4BZQA 2P16A 3DPUA 1DEKA 4DCDA 1JPJA 1KOFA 3QIAA 1QQ4A 4HAYA 4Y7BA 1QJ1B 3VB3A 2VO1A 4K8YA 5LPNA 2QP4A 2RAPA 1LPZB 3SV7A 3EA5A 1GNRA 2PSYA 5DYIA 1LF0A 1G3BA 2ANWA 1GCTB 6CHAC 1S81A 4LYFA 2FYRA 1AKSB 3ZS9A 2EI8A 4U30A 5C4GB 3EARA 3ADDA 2O8FB 2FWWA 4TMTA 1TONA 4NGAH 3A7ZA 2XX3A 1GGDB 4A6LA 4ABJA 4TYDA 2EI7A 2ZHQH 3RU4D 4NKRA 3QKRA 1NIJA 4ESTE 5DHAA 1ZMJA 3OIYA 5FHTA 1X86B 2DB3A 1NVXQ 1TGCA 5J47A 3SGAE 1E9DA 5CDFA 2ZFPH 4L15A 1R6BX 3RMLH 3FTQA 3RM0H 3BIFA 2ANYA 3RXPA 2BX4A 2ERYA 2REOA 2OBQA 3KXKA 4BLPA 5FUYA 3LQRA 1A7JA 1KSJA 1LW7A 2R6DA 1GI8B 3F8TA 1TQDA 3HK6B 4Q47A 3SGQE 1G3CA 1LMWB 2O8BB 2TBSA 1BUIA 3O8CA 3QDZB 5AUQA 1G291 4HAZA 4MYHA 1ZSKA 2HF9A 1R0ZA 2ZFFH 2HV8A 4Q7LA 5EQTA 2VH0A 2OTVA 1IQLA 1CBWC 2HLDA 2C2HA 3HDTA 2M5TA 2V3HH 3P8NA 3MRSA 4I1OA 4RY2A 1SL3A 2WYJA 4WXPA 3M5OA 4XOJA 1AM4D 3GCGA 2B6HA 4TPIZ 2WPDD 1B7XB 4BAQB 1D9ZA 2IOTA 3IBYA 2FX3A 5AK0A 1FY1A 1WP9A 2GTPA 4JL5A 3QK1A 1HAGE 3MMPA 2FEMA 5C5NA 2C98A 1O2GH 1OKKD 2O8DA 4DLUA 1SVKA 3AKCA 1OB5A 4AN7A 3G5UA 1C1OA 4KTCA 1QVAA 5EE3A 3SU6A 4BUJA 3KQCA 3OY6U 1J8YF 1CJVC 2CE7A 1MV5A 5FX6A 3IEUA 4LV5B 2GHIA 1XTIA 1GHVH 1ZGIA 2ZFTA 3R7WA 4OYHA 1E79D 2F3TA 3BK7A 3QF4A 5ESTE 3B1WA 4FUDA 2BB4A 4LJ6A 1UK2A 1ZHMA 3TBKA 3U3KA 2PEZA 1XEXB 4G5GA 1D2NA 1OXUA 3GLGA 2EU8A 3LGWA 1DWEH 2IW3A 4ZCLA 5EXTA 1C5XB 2JASA 3ZGXA 2VIVA 3UIRA 1PLKA 4AYWA 1GMDG 4PAOA 3WP0A 2Z6VA 2OUAA 3LRPA 5CB6A 2BMGB 3PV5A 1YRBA 121PA 2R2AA 5AJWA 2PLRA 2JEOA 3K0FB 2R9VA 3PIRA 5C18A 5HR5A 3D3QA 4B71A 4E09A 2X2EA 5T6GA 3U8TH 1TLDA 1UKVY 1AIPA 4TL6A 3PJRA 5CK5A 1ACBE 2FSIA 1P0SH 1QG4A 4CEIA 1W4AA 2WWGA 4QNRA 2UUKB 1SPJA 2CCKA 1G1MA 1W5SA 4L8GA 3AVTA 2G88A 1BKDR 4C0AC 1E96A 3OHMA 3GLFE 1FP7A 3ESTA 1QA0A 4CRAA 4GMXA 4K8OA 1P2OA 4JLJA 3D6TB 4HZHA 3PVSA 4FN5A 3W34A 2AXPA 1YBWA 3SJCA 1L4YA 3UR9A 3SJ9A 5JWRA 4DZZA 4HUQA 1L4ZA 2WPIS 2GF0A 2IXFA 4Q7ZA 3CNOA 2KJQA 2VIIA 1OX1A 3UQVA 5GJCA 1AB9B 3RS5A 2JJ1A 3T1TA 4GBMA 1J17T 1QHSA 3D31A 4DDWA 2JH0D 2QXHA 2DE9A 3SV6A 1GWAA 1V2JT 3SW2B 1N6NA 1E2FA 2AGIX 1S85A 1P06A 2V6IA 4ZO4A 1US8A 2IYSA 4EJSB 1ZPBA 4ZCMA 1CVWH 4BLRA 1L1NA 3RXKA 3NPSA 4Y76A 2QPOA 1CBWB 1GCDA 3NC0C 1E9CA 2QF3A 1N8OB 2XWAA 1VIYA 2R8RA 2GKVE 1OP8A 2XXLA 5PTPA 1QHGA 3TIUA 3EASA 3F0TA 1XXHE 3X1XA 1SGTA 2XB4A 4Q1AA 2RCEA 1CR4A 1L1GA 3AW1A 3GLGB 4AOQA 2GP9B 3AVXA 4KLNA 1GNPA 1NSFA 5EXMA 1XEXA 5FOTA 2J59A 5L2ZH 3W6PA 4WH8A 2Z4RA 1KYIA 3KKNA 4MGKR 1HH4A 3K0AA 1ETUA 3KJGA 5CK4A 2WPDA 1CA0B 1N0UA 1NY6A 3E3TA 1P9NA 4IXNA 4MITA 4YM9A 4D0GA 1IOEA 2D1JA 3KL6A 3QLPH 1SGNE 1SSXA 5GJVC 3IDQA 1W0KD 4LJ9A 1IQFA 3SU0A 2PKAA 2OCAA 4FCTA 1A5IA 4IDNA 1GI6A 2XTZA 1PZNA 4I8HA 1OHHA 4LY6A 1GL9B 1DTSA 1MOZA 4ESHA 1A46H 4X8UH 4DLVA 4YOIA 4CEJB 2GAOA 1QQUA 3NG1A 2A1DB 2ZRGA 1U9IC 1EFHA 4AX9H 3WNBA 4ZI3A 4WH6A 5K8TA 1OYYA 1IHSH 4IW4E 1OPXA 4WW0A 1NKSA 1E0SA 2QENA 2QTHA 4JZIA 1XBTA 4YESB 1O35A 3FOZA 4YXWD 4EPWA 1V2UT 4V0OA 1MRNA 2GT7A 1MZDA 4LWZA 4Q7YA 3HU3A 3MU0A 1GIAA 1ZSJA 4R7ZA 4X8MA 3AAUA 1C4Y2 8GCHG 2OHFA 4Q1DA 2FZLA 1GVZA 3BG4B 3EPLA 4OS4A 3T29A 4IHQA 2OBNA 1DAHA 3ZZAA 4MNXA 3CH4B 3RRYA 1KXBA 2FDCA 3RNLA 1T8OA 3CF2A 1IQMA 2V4ZA 3AH8A 4M7GA 5E7IA 4F4CA 4JZFH 4BFSA 2FGKA 2W5EA 3GYMA 3RXQA 3MH6A 2GWHA 1YZQA 3NVAA 2LWIA 4Z1MD 2V1UA 1FAKH 1JEDA 5DO9A 1G2LA 1THRH 1I4TD 3U3JA 1GJ4H 1P9SA 3CNLA 1IHTH 3CB4A 3AKDA 5JI2E 3RXGA 2NQ2C 1C5PA 2FDAA 2QE7D 3C27B 2VIQA 1SXJB 4ABGA 3BEFB 3CRRA 1HLTH 2YYZA 1ELCA 1OFUX 1H65A 1Q3XA 1VGCC 4AY2A 1G5PA 1DUEA 1HNEE 5EW1H 3KQKA 3L6PA 4PO1A 4JYTA 2ORVA 4AB8A 3ATKA 2OC7A 3K9LA 3LW7A 1OHHD 4ZKOU 1SOZA 4Q01A 2GXUA 1L0ZA 3NH9A 3ND9A 4DT1B 1F2TA 2QGZA 3M0EA 2ZPQA 4M9QA 3MWJA 4PQFA 5T6FA 1OYTH 1BRCE 3K70B 1TX7A 4RZ2A 2CLDX 1XP8A 2ONKA 5LBIA 1WCZA 4M21A 4UDWH 3CUEF 1AWFH 3QEJA 5EE1A 2BIFA 4Q9JA 3ZVMA 1DXPA 1DO2A 1DBSA 4DIDA 3TE6A 4XIGS 2W3IA 4ERNA 5FI0B 1MTWA 1EB2A 5CHAC 1WF3A 2H5DA 1FXYA 2WM9B 1INCA 2BBTA 1FY8E 2Z3EA 5FPTA 2ZUBA 1X1RA 3GCHB 1ESBA 1OWKA 2NU4E 3BV9B 3QNUA 4HZUB 2OQ5A 1O3NA 3N5CA 1XXDA 1H4WA 1G36A 4DB4A 4MKFA 2MSDB 4XH9B 1HXFH 4D0LB 2A4GA 3AVYA 1LF5A 1AQ7A 1FY5A 1GILA 2A2QH 3ODDA 5E0GA 4JZDH 1TU3A 2ZC9H 3S1AA 4PPFA 4TLCA 1DT2A 2QIQA 3LO5A 1KY2A 4NHOA 2EWVA 4EJSC 3EPKA 1RTLA 2G8TA 1EJMA 5DJ7A 2BVSH 2R6AA 1X8LA 3U3OA 1TX6A 2PUXB 1ANKA 1C4V2 1QRWA 3DKPA 1JQLB 2XCNA 1QHNA 2ZKSA 4BTTB 2CL0X 1Q12A 3RMOH 3B9QA 4ABBA 2FPMA 2F9UA 3NBXX 2F83A 3U44A 4UJ5A 1FDPA 1YHNA 5IF9A 1ZMXA 5L3QB 3AGQA 1BQYA 4C0SA 1PPFE 3O8DA 3EPJA 5EP4A 3K8YA 1N6PA 4IGDA 1VCOA 1G3UA 2ZROA 5CIQA 4M8NE 1RIFA 1Q57A 1W7GH 4LK2A 2BM2A 4X8TH 1D6RA 1NRNH 4X1NU 4BGDA 4A82A 4P4SA 5KPDA 3OEHA 2ZRBA 2IUUA 2HT6A 1Z8FA 1ZUNB 3QN7A 4LYHA 4BXSA 1HT2E 3E1XB 3U98H 2ZU2A 2QPTA 1C1TA 1M34E 1KLTA 1Z8JB 1Z0JA 4GHTA 3QPWA 2ZRNA 4INKA 4EQ6B 4ABIA 3UMRA 2ZQ1A 1E1QA 1OS8A 1WMSA 4EFMA 2B21A 1XDBA 2OXRA 1K5DA 1N6RA 5LB4A 1S1CA 3WBKA 4MUAA 3PEUA 1YZGA 3A88A 1NLYA 4EKDA 4BTUB 1G64A 1TAGA 4CBNA 4GSOA 1BB0B 2XB2A 2YOGA 2WUBA 1U8YA 2WPMS 1KAGA 3VQTA 2XAUA 1X1SA 1MUEB 2C93B 1EX3A 4Y10E 1CJMA 4FUIA 5C1UA 1PYTC 1QNJA 1NN1A 1UTQA 1QRXA 1ZHPA 4J1YA 3D49H 3AVOA 3V4FA 3MAAC 2CHAC 5CE1A 1Q3TA 5D3QA 4B6EA 5KNDA 5JWHA 4C0LA 3C15C 2B9LA 1NF3A 4MUBA 1DANH 1SG8B 2ZP0H 4B44A 4E07A 4QHTA 2Q6GA 2Z94A 4IFBA 1DITH 1BRBE 4LXBH 2UVQA 3VKWA 3A87A 5KNBA 2B0FA 4N0EA 1NNEA 2CDNA 5LD2B 5BXQC 1J14A 1V2NT 3WNCA 5KYKA 2IYLD 1HURA 3I8SA 1O2MA 2IHYA 1N6IA 1II9A 1YC0A 1G2MA 2Y81A 4H1VA 1DX5M 2OP9A 1ELDE 4TTRA 3KJHA 3K9HA 4HLQB 1SHKA 1MTNC 3QY0A 3TW4A 5DSZA 2NG1A 2P95A 4A2PA 1T3HA 4Y6DA 2WWWA 1O2XA 4IN1A 4X6NA 3PLPA 1YPHE 1A5HA 2BD9A 4TMKA 2H5CA 3TSWA 2BTCE 2CF9H 3OY5U 2BOKA 2OBLA 1C2LA 1BITA 3QXHA 3V0XA 3TJZA 3BH0A 1O2JA 4LCBA 1R0XA 1ZCBA 1PQ7A 4ABEA 1TGSZ 3RLFA 3H7OA 1SGDE 3PFIA 3KZ1E 4RSGA 1E3MA 2P59A 621PA 2NU0E 2A5JA 1TNGA 2FS8A 1K5GA 5HPYB 2WYGA 2F9PA 1F6BA 3BF6H 4G1UC 2VHUA 4B1TA 3CENA 2GV7A 4IOJA 1UDXA 4FCWA 2RKOA 1A2BA 2K5UA 1ESMA 1TAWA 4UD9H 3N2IA 1JEEA 4URYR 2ZJOA 4E22A 4E5UA 5BRRE 1NN0A 2TGAA 3GJ3A 2OXSA 1NMXA 1XZPA 4M1OA 1C5UA 5JJIA 1E2MA 2RGEA 2QCYA 3T15A 1HDTH 1SFQB 2ZHFH 2QAGB 1OLOA 1GG6C 4LZZA 2XOKD 1G3QA 2XJ4A 3PCRB 5L3QA 4QKQA 4HTCH 2GVDC 4I8GA 1QDEA 2PL3A 1O3IA 2QA5A 3TK6A 4GCHF 4A0RA 1C2HA 3M36A 1G30B 4CR9A 2HF8A 3L82B 4DEXA 2F3CE 1C5OH 1K6MA 5F98A 5H4IB 4ABFA 3OAAA 5HCNA 4ISOA 2ZPSA 2RGGA 4BLOA 3LXXA 1CR2A 2IS4A 1HJAB 1TMBH 1SB1H 2NPFA 4DB2A 2OCBA 4SGBE 1O2TA 5GJWC 4D80A 1UAAA 2C96A 3K9NA 2ZRJA 2BBSA 3IPYA 3H2YA 4DVAU 1U6QA 4BFWA 3RS7A 1DY8A 3GEHA 2Y7ZA 2DCUA 4JVMA 5G4BA 1T8UA 3ZVEA 5KHOC 1VCIA 3VTKA 1C1NA 1IY1A 5HXFA 1KXAA 1DAGA 4JYCA 2F43A 1Q1QA 4Y11E 1KO8A 1XCPA 3OEHD 3M3TA 4KODA 2G52A 3FMPB 3OX7U 1G7CA 1XCGB 3L0SA 1P72A 3LY5A 3TLXA 3W9YA 4GAWA 1DAKA 4XFQA 1GHAG 2JETC 2QSYA 1CE5A 1LV7A 1RTKA 1P2QA 4A1VA 3KJEA 3BTFE 3THYB 1EJAA 4WAUA 1AJEA 3A1UA 2RH5A 1E9BA 1UKEA 4KFUA 2V35A 2G6BA 1SBWA 2GX4A 3SU1A 1HE1C 1HXEH 1E2NA 4PC6A 5EE5B 1II0A 3M3SA 1XXFA 3Q5DA 4E03A 4R2HA 3STJA 1N3BA 5FOVA 4H4FA 3CP7A 3FKSD 3VR4A 1GBJA 5E2PA 1E2IA 1J9CH 2XEXA 1GL0E 4A8JB 1SVSA 1V43A 3K9XB 4M1WA 1S83A 1X8JA 1OJLA 4A7IB 2IXEA 1KNXA 1FPCH 2GT8A 5HE8A 4ASUD 3WHKA 1QBKC 3V4RA 2QRZA 4A2QA 1Z6TA 1AS3A 1YZUA 1OH7A 2ZJAA 1ZYOA 1CQQA 4C2UA 3ZVBA 3SI4H 4MNYA 3PENA 1TE0A 2VH6A 4W9MC 4EPYA 3UK6A 2QC2A 1AB9C 3I61A 1W0JA 1JBKA 3A1WA 1PFXC 3A1TA 2RGDA 1SGIB 3UREA 3K09C 1QBOA 4VGCC 5JRJA 1ZJDA 4CR5A 1O0DH 3SOSA 4H42U 4YC7A 1GRQA 3WY9A 1Q44A 1TABE 2LCFA 4LGMA 1R7RA 3MNCA 4UFGH 4H6SB 2ZE8A 2DFKB 5F8ZA 4TSFA 4DCNA 1EFRA 3L3TA 4NSVA 1GVKB 2XNDA 2G00A 4BFVA 1O5BB 4MRSA 4WMFA 3UXMA 1F48A 2ZFRH 3MWLA 3KL4A 5JEDA 5CM9C 3RXLA 3HYRA 1WDTA 1XTSA 4BECA 4P3YA 1EQ9A 3A7WA 3D62A 2ZFSA 3B6EA 4U7DA 4TZ6A 1ZC3A 2A5AA 2FF7A 1UDWA 1A0JA 1FV9A 4KU4A 2I6SA 4OM9A 2HPQH 2Z6BD 2ORIA 2Z3CA 3PWBA 4Q02A 2IYQA 2LKCA 5K8IA 2ZU1A 1FJSA 1FN8A 1S3GA 1VHTA 3OU0A 6GCHG 1F0TA 2WPJS 1AWHB 1Z6AA 2XXAB 2ZYVX 4JVLA 3KKOA 3AVQA 4O9VA 7GCHF 4AKEA 5C5OA 2I6QA 2NTYC 3GICB 2BLOA 1FFHA 1Z8IB 4JL8A 2VWMA 1SGFA 3BB3A 4TL7A 2XBXA 5L30H 3EC2A 2FPKA 3IITA 1TEVA 1XMJA 3GCHC 1XJCA 1W0ZU 4AWXA 1IQKA 3RXRA 4QBFA 4TT3D 2BDYA 1BH2A 3EXAA 1SGYE 3TLOA 3VXEH 4JLBA 3GJ6A 4BLQA 4QC2A 2RGBA 2ZQ5A 1WQSA 1P2NA 4EUNA 3GJXC 2IYUA 5AFYH 2PX0A 4LJYA 3SJZA 1KYNA 1FUUA 1MT0A 4TYPA 3U4QB 2FU5C 1EFRD 2FMXA 2NO6A 4OGXA 3K70D 4BLTA 5EPNA 4UONA 4PSVA 4OS5A 4AYYB 5I25A 2QG6A 5KSYA 1MD8A 3CW2A 2NO1A 1UEJA 3LGVA 5F8XA 4X2VA 4BAKB 3R3GB 1O2IA 3URCA 1ZM2A 2F3RA 3U69H 3SO3A 4DHEA 5FOUA 2FN4A 4Q1FA 2PBRA 1XMSA 4RZUA 4WWYA 3F3YA 2UKDA 2GDEH 3KXLA 5E0HA 2SGAA 4Q4JB 3FWYA 2FIRH 5GVSA 1P02A 2GJ9A 1P10A 5EPYA 2XYAA 1GRNA 2OC8A 3OE7D 3EDXB 4RI0A 4X8VH 3TK1A 3AASA 4ZROA 1M2OB 3TMKA 4CT5A 2O52A 3PMHB 1KTTB 2PHBA 2GBLC 1RRPA 1ZTLA 3WYAA 2SNWA 4HLDA 5C20A 1O2ZA 4CRDA 2A5YB 2DFTA 1HT1E 4JSYA 2FJUA 3BG8A 1C9TA 1TQ4A 1F5RA 2PZEA 1U0HC 2VLIA 3LA6A 1NU9A 5L3SB 3NHAA 3FANA 4FMDB 2OBOA 1H8ED 4KGAA 3RRMA 2VVCA 4B76A 2OCYC 1TF7A 5FBIA 3QZQA 2JLUA 4XOIA 4VGCB 3WP1B 1GBTA 5L3SA 3FAOA 2IYXA 1NRRH 5GJBA 1CT0E 3GLIE 1EG7A 1EFUA 3R20A 3NDBB 3NXPA 4IDHA 2BQ7B 1C1WH 1ETTH 4CEIB 4CEHA 2QE7A 1GI3A 2MMGA 4M1YA 4DLRA 1AZSC 2VSOA 4MPUA 3OFND 2ALVA 2BVNA 2VIWA 4G5OA 2ZCHP 3BH7A 1YPGH 4DCUA 1V2LT 3QTOH 2IT1A 1FP6A 5C3NA 3U6KA 4TT3A 1AZZA 1ANCA 1G7RA 2VHTA 4XD7D 1GJCB 1YPEH 3W95A 2GDDA 3SHCH 3U7EB 4B43A 1PV4A 2ZRAA 1G7SA 1KXFA 3FHTA 4O3TA 5HYOA 4DUGA 1FIZA 1OT3A 1D6WA 2ZS7A 1YKSA 2KI5A 3SBDA 4ABYA 3PQCA 1WA5A 3IHLA 3SV8A 2XNSA 5HMAA 3CONA 4NH0A 1GDQA 2HLCA 5KDOA 1BRAA 1MU8B 1WXRA 1O3EA 2WV5A 2ZDLA 3GCTG 3I29A 3SJAA 3CF6R 1YLCA 4O25A 3PV0A 2ZQ2A 4JK5A 3HKIB 5DGXA 2CNWD 3SNEA 3K2UA 3GOVB 5C46F 4YMUA 2FX4A 3HR8A 1H8EA 2QN6A 1XTJA 3IPXA 4GMDA 4A5TS 4NCNA 2BD8A 1GTVA 3MYWA 2WKRA 4X0WU 3HYTA 1T31A 4AGJA 1AGRA 4THNH 1N2CE 3VR1A 4G01B 1CJKC 3SHWA 1VJ9U 4ZAEA 2XBVA 4U2WA 1N5IA 2ASUB 2CGAA 3BEIB 4Q9LA 1G7TA 4M1MA 4GDFA 3CRW1 1YU9A 3TJOA 3E0NB 3VFEA 4Z1MA 1ELGA 2G5VA 4F4IA 4US0R 4JKIA 1XMVA 4FI3C 3HK3B 1BCUH 1T8TA 1AN1E 2ZJ8A 1ZD1A 4K46A 2BMFA 2ZREA 5SZJA 3R8FA 2OV2A 2GKSA 1TGBA 1W8BH 2BBWA 3NWUA 1TPSA 1OFTA 1KAOA 1H9LB 3ICQB 2V7QA 4DUGD 1UVUH 3IO3A 5HTKA 4O3MA 1ARBA 3UNRA 2MSCB 5J4KA 5A09A 1KJYA 1NBMD 1MH0A 1R5NA 3I1FA 4NE2A 2BZAA 2Q6DA 3LOXA 1P2VA 2WOOA 3DA9B 3URDA 5BN3A 1ZIPA 2F1RA 3I92A 4X2WA 3KIDU 2DE8A 2XC0A 2A9KA 1JQJC 2HJGA 1WB9A 4PPQA 3NZIA 2WWIA 4ACBA 2I1VB 2BOVA 4A1FA 5C2ZA 4PZLA 1QGFA 3LX8A 5KTYA 1XD8A 1XVOA 2OUKA 3D23A 1QJ6B 3QOFA 2V3CC 4LZ4B 2CL6X 1DS2E 5LD2C 5LPEA 3FMFA 3R8CA 2BMEA 1TTTA 5JSZA 1LQDB 2OCPA 1CIPA 4TSFD 3PV2A 2TGTA 3IHWA 4DLWA 4D7GA 1XUFA 4MPVA 2WTUA 2X1VA 2Q6FA 2GCHF 1GHYH 3B8JA 3AM1A 2O8FA 3ZYDA 4BWYA 5EQRA 3K1JA 3SNAA 4OI2A 4NTZA 1UPTA 2ZRKA 4IDOA 1ID5H 1JIMA 3LONA 3B1ZA 5DI9A 2R3UA 4MGYR 2R0KA 3W8RA 1UJ2A 3AB3A 5BPEA 4ZKSU 4JT2A 4V03A 1KI7A 4OK6A 1J90A 4MNVA 4TYWA 3TQFA 1W7XH 4W5HA 4NYIQ 2C4FH 1ESTA 4LJ4A 1RXPA 1RGQA 2ZU4A 3QBVA 4AG6A 1T5LA 1NFUA 2IJD1 2V0BA 2WJGA 2FFQA 2Q1JA 4DRZA 2VF7A 3CWZA 2DPXA 5CMXH 4PX9A 3CRVA 3CWQA 2BM1A 2GXSA 4OS1A 1FQKA 1NT1A 4D7FA 4YQFA 3NHBA 1LKAA 4KITB 1W14U 2AKAB 3FYHA 4TYNA 3BTWE 4FXGH 2Z4SA 2RMKA 3Q77A 3S7HB 4ZHLU 1MRSA 3K6ZA 2D4HA 3M1IA 1NRQH 5GJ4B 1II8B 1GUAA 2JLYA 3RRZA 1ETSH 4PHTA 3H84A 2ORWA 1G8PA 3THWA 3KTAA 1MZAA 4X1RU 1KSNA 3T25A 4OJKA 3DOEA 4LDJA 1BBRE 4Q4LA 4R71A 1A7SA 2V7QD 2XW9A 2VSXA 1Z6XA 4CRWB 2VP0A 2QM7A 3MJHA 1YP9A 1ZNXA 4CRGA 2AK3A 1S0UA 5DP6A 2HJVA 3BE4A 3TNSA 1LHEH 1XTQA 1EAXA 4KVGA 1OOKB 1P3EA 3I73A 2FP7B 4XBBA 4KSBA 1XX6A 3WHLA 4TYQA 3ZZ3A 2WICA 2OAP1 1NVUQ 8GCHF 2FODA 1W44A 5JS7A 2EYQA 4JLKA 4QGAA 1AZTA 1KI6B 5E7MA 4KYIB 3QEOA 2X2FA 3KUCA 2J45A 4B34A 4LUCA 3TJUA 1UBFA 5EQSA 3IIJA 1QURH 4ZUHA 1FNMA 3ADBA 1OKXA 2BVRH 3LGTA 2JA1A 2VINA 1IN5A 1P2UA 2G3YA 4NCKA 1UKZA 2ZE5A 2W3KA 3WMEA 3K0SA 3F5FA 1GHAF 4RFSB 3GFOA 2J34A 1O5FH 1VHLA 4P33A 4L5BA 3QKRB 4IVQA 1DY9A 3AKYA 3RWMB 4LHZA 5CYPA 4D4JA 2KBFA 3GP8A 4O97A 2XTTB 3BWDD 1GHWH 2XOKA 2IWRA 3KUDA 1ELTA 4URWR 4LYJA 5LDDC 2GZAA 3BRWD 4LBVA 3SN6A 5K0HA 3SU2A 1VDZA 3DKVA 1F5LA 4PZZA 1JALA 4KHZA 4P32A 2ODBA 2PZGA 2N42A 3GY4A 1WBDA 2WSSD 4DIIH 2GA8A 4NA8A 2QXJA 3RXVA 1EFCA 3MLEA 1SFIA 4LHYA 1RIWB 1QY6A 3P92A 3U1IB 3MWIU 4LV8B 1XPRA 2WWHA 1HRTH 2ZGCA 5AF9H 1AA9A 2ZRPA 3TAHA 2GCHG 1OE0A 1P11E 2FX6A 5GADl 3S9AA 3HPRA 4AKGA 1CTQA 3A7XA 3RWOA 4LYAA 5L2YH 4XJXA 5EODA 1GJAB 4EPTA 2AGGX 2ZTYA 1IXRC 3L43A 2D2EA 3V9PA 4B3BA 3SDZA 5JS8A 5E3HA 5E4FA 2BDAA 3C4JA 3SE0A 5H8WA 3MH7A 4JYVH 3DL0A 3KQUA 1H8HD 3V12A 1XMIA 1AKYA 1VZQH 1KDQB 1O38A 1CULC 4WXIA 2ZM5A 4DG4A 1EAWA 1Z63A 1W48A 4CHAC 2OC0A 3VXFH 4HUTA 1NO9H 5T3HA 3MU8A 5SZIA 2CXXA 4HB2A 1T8MA 4QT8C 2WOJA 4LC1A 4RFVA 3AEZA 1PLJA 1P60A 1ZU5A 5KU1A 3D8BA 1A4WH 2PTNA 1W4BA 5J5CA 1SLWB 5DG6A 1IM2A 1T7CA 1RTFB 1W5TA 2UUYA 1B0FA 1G3EA 2ALPA 1DXWA 3TH5A 2J2UA 4PO8A 3A86A 3T61A 3TH3H 1SGFG 4CF7A 3TGPA 4MRRA 1XB2A 2BY9X 1W0YH 2X77A 3BJIC 2VHQA 4MH0R 2QAJA 3MSXA 3SYKA 1T9HA 2F7SA 4B3CA 4HYYA 2V3OH 3I5XA 2HCBA 6CHAB 2WKQA 2GCTC 4XSHA 2ZF0H 3HR7A 5FBRB 5BW8A 1OSNA 2B5TB 4U32A 1KI1A 4RKEA 4CREA 3RC8A 2ZSEA 1QTFA 3KF2A 2IXGA 4II7A 2R9PA 1EOJA 2IUTA 1E2PA 3C5HA 2ZU6A 4A1XA 3Q8XB 1YVDA 1UMAH 1SXJC 1O2OA 1KO7A 2BM0A 1O3BA 5CITA 2HGTH 2AMDA 2W2VA 4CRFA 2HALA 2QAGA 2GTBA 4TWWA 3GLHE 5DI3B 4MA4A 1AMHA 4X1PU 2GVFA 1MAYA 4X6MA 3ZVDA 5TDHA 1W36D 2ULLA 3V00A 3U60B 3H86A 4L9WA 4DJZB 3Q7QA 2WV4A 3UNSA 2BD3A 1L4UA 5DP4A 1YJ5A 1VYTA 4RFSA 5JRZA 3VX3A 2F4LA 2EWWA 4TLEA 4KLZA 4BRWA 1THSH 1QJ7B 4YMWA 4X2YA 4LBZA 4WY3A 3K70C 4X6PA 2ZRLA 1G5RA 4JVSB 4Q4AA 4IS5A 4QRHA 1C5SA 2YWEA 2DFLA 5HE9A 3QUSA 3JZ1B 3RXMA 5TXGA 3KQNA 1NMZA 1V2OT 3EPHA 1G3DA 5F3WB 1VECA 2J7PD 3G0HA 4Q7XA 2AIPA 2J94A 2W6JD 2PT7A 3HP1A 2VPPA 1UTKA 4TY6A 1MKWK 4OS7A 2IYWA 4GHQA 1XEFA 1KDOA 1OWIA 1C1QA 2HXSA 1GP2A 2GJ8A 4ZDKA 1ZRHA 2OG2A 1QIXB 4D2IA 1E2DA 2SGFE 2C9CA 1D9IA 3LC5A 2AXNA 1GL6A 5A2MH 4PFSA 2BZ6H 1UADA 1PLLA 2PEYA 3PUZA 2YOFA 8KME2 5EXNA 4F92B 1C5LH 4CEJA 1V2KT 2AMQA 1LKBA 2OZEA 2Y82A 2PLXA 1F0UA 1COWA 2RGNC 4MLFB 3W8NA 2RA3A 1S3SA 2XRCA 3TH2H 5TY0A 1AD8H 1T4UH 2HWLB 1R8SA 4AI6A 3P4XA 2PLFA 1VJAU 5H68A 3VHXA 4B2IA 2C90B 1LVYA 5JBQA 5CJ2A 3CKLA 2P3UB 1NS3A 2RGCA 4I1UA 1E94E 2EVWX 2VVVA 3C1KA 3PB1E 3EZ7A 1TEXA 1RRCA 4JMYA 4WJG2 2FLBH 2ZU3A 3BTME
chains in the Genus database with same CATH superfamily
3LT3A 3GARA 4GOJA 1VSUA 1XUGA 1RWMA 3RC3A 3T7IA 1U04A 3TVJB 1VB5A 1JKMA 2WU4A 4KOEC 3GLUA 4G0VA 3CF0A 3IIMA 1QG6A 4LEIA 2QRQA 1ZD9A 2J07A 3H4TA 3N8DA 2UZ1A 3VR6A 3FVRA 2FPPA 3DWGA 1IATA 1D1PA 1OH8A 3ABIA 4IQGA 1IZ7A 4G25A 3SJBA 4E7PA 3HDHA 1IXYA 2H7XA 5THXA 3KVYA 4M8SA 4LJ5A 4K1SA 1SD1A 2PCJA 5GY7A 3LVBA 2DE0X 3SKYA 3UQZA 2CNDA 3A36A 4TKUA 1Y8QA 5AVJA 5EOKA 1GLNA 1CIVA 5CXUA 3GLIB 4CI9A 4HMQA 1XFDA 2P7HA 5AJZA 2Y1DA 4ARBA 4QT4A 4ALMA 1QFMA 3E3OA 4DR7B 1T9KA 4UVHA 3Q87B 3T5TA 3L8MA 4JB3A 3ZU5A 2XWPA 1NP6A 4EB8A 5F2EA 2JA2A 3HDVA 4UMEA 5LU8A 1P57B 1PNOA 4I4NA 1SA0A 4JXJA 4LK3A 4MV0A 3E9YA 4NOMA 4CKXA 2PRSA 5DBFA 2BDIA 1IY2A 2GEUA 3EMVA 3GT0A 5IJ9A 5F76A 4G26A 2O8TA 4HLUC 2D3TA 5CUQA 3JATB 4YT2A 3EF0A 2R11A 3R09A 2GXQA 1X1DA 2ZYTX 1MNAA 1QE5A 3FPAA 4I5IA 2PR3A 3VB5A 1O2UA 1O9BA 4YJDA 2OYCA 3D0RA 5EUCA 3BPSA 3BWYA 1VJTA 3LBNA 5A4JA 3MJDA 3ER9A 1R12A 2CMFA 4R83A 1YVRA 4OHMA 5CR9A 3JWHA 1OWJA 1RI3A 4MG3A 4C20A 5ITZB 4CZ2A 4RHFA 1KQGA 2O3JA 3CQ9A 1NUPA 1YUBA 3CW9A 1ARCA 1SI5H 4YOGA 2JHCA 2QX8A 2Z5FA 3LXRA 3MPUA 3KE9A 3NTLA 5THQA 3VYSB 2CV2A 2AG0A 5EJ7A 1XZMA 1ABIH 4HDKB 1DS6A 5ALZA 3F98A 4BQEA 1PPCE 1L7PA 1Y3CE 5DDIP 3K72B 4AJJA 2XUZA 3QH4A 4JLAA 1UANA 2BKLA 1KMCA 3LTNC 3A1SA 4NV1A 1M1YB 4ND5A 3N1UA 1WQVH 2Q0HA 3T1VA 2ZT8A 3S9CA 1NW4A 3HC7A 2C5LA 1JQ3A 3M33A 4KE8A 1H1TA 1KMNA 4ND8B 4CCYB 5F7OA 4HH4A 1XX9A 2PMKA 1FDUA 2E18A 5EIFA 4BB6A 3M5LA 2D59A 2WIKA 3F6RA 3HB9A 4S2UA 4KZKA 1R6TA 4Y0AA 4AMUA 1DOJA 1GTZA 1P5JA 4DIHH 1SD5A 2BE7A 2C5BA 2C54A 2VH5R 4PONA 3ZCXA 1I6WA 1BEEA 1V96A 3JQBC 3MO3A 1P7ZA 1XRJA 1OXKB 1EQUA 5DNCA 4L0DA 3C85A 5SZHB 2BYTA 3DOFA 2RGXA 4D26A 2RFKC 2IS1A 4UPVA 2P4SA 3GEEA 2PQ0A 1Z47A 3IEKA 4ZEMA 3JQ6A 2V3MA 1TNLA 4D9RA 1TBQH 2GV6A 1RI5A 3WY8A 1T26A 2DP4E 4US2R 5TEVA 3W8FA 2QW1A 2BC9A 2JI9A 5IJ0B 1XEWY 4BMNA 4P53A 1ZM9A 5HIMA 1LVOA 5AIAA 1MB4A 4RQBA 1FBTA 2NGRA 1J16A 1C4KA 3MWGA 4G9BA 5EGNA 3EGOA 3GLTA 2AG1A 4JY7A 1M6NA 2V9PA 2NZ8A 1ZISA 3A2MA 3D3NA 2FS9A 5CHAB 1MABA 1SGCA 3G85A 5JXHA 1NNUA 1U63A 2BD7A 1UCFA 3I9LA 1CY4A 3BG5A 3LGIA 3LW8A 1SNYA 3F67A 1S89A 2XVZA 1ZOSA 3C6YA 4WKBA 3GDUA 1PDVA 2IEAA 4G5SA 1IY9A 1PGNA 1MQSA 1PG0A 1EDDA 1I4DD 1QX4A 2C4HA 2DECA 3B1VA 1C3OA 2A6PA 1TVKB 2ZYHA