1GBEA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase (serine proteinase)
molecule keywords ALPHA-LYTIC PROTEASE
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbeA01
4X1QU 2AYWA 5CHAB 1AVWA 3BEFB 1HLTH 1NRRH 1A7SA 4IC6A 1W0YH 1JRTA 3S9BA 1NN6A 3A8BA 1EZUC 2Q6DA 1YPHC 2XWAA 4AFSA 2UWOA 1OX1A 1NESE 3RU4T 2AMDA 1DUAA 2ZHFH 2A0QB 1ANCA 1XUFA 3HK6B 3E6PH 3BTEE 4OS6A 1OWHA 1TQ0B 4LK4A 1KXBA 2P8OC 1HDTH 1BCUH 1CGHA 3VXFH 1VJAU 1GJ4H 4KTCA 1TMTH 2A1DB 4H6SB 1TNHA 1P9UA 4X6NA 1D6RA 1EOLA 3ZZ8A 1SLXB 1FN6A 2PKAB 3ZVCA 1YPJH 2I6SA 1A3EH 1ZHMA 1GHVH 1LCYA 2VIQA 3AVZA 3B23B 3DA9B 1O2HA 4ISOA 2WPIS 1O3JA 2SGFE 4ISNA 2FS8A 1Z7KA 2ZIQH 3VB4A 5A09A 1UHBA 1ELCA 3KN2A 3SGAE 5EPNA 2ZQ2A 1EZXC 1LKBA 4CHAB 1W8BH 1W7XH 3N7OA 3V13A 3LKWA 3RMMH 2ASUB 4JZIA 1GVLA 1IHSH 3FZDA 2R9PA 1AKSB 2B0FA 1BMLA 1UTMA 1O3LA 4UONA 3A80A 1NFWA 1O3AA 3LGIA 2AIQA 4GPGA 1AQ7A 2R2WU 4LZ4B 4GVUA 1T4UH 1GHAG 3K9XB 4Q7XA 1O2QA 4XBDA 5DPAA 1W0ZU 2WUCA 4ABAA 3URDA 4YM9A 1P02A 3OX7U 4GCHF 1YP9A 3FP6E 4RSPA 4WMEA 2BDHA 1SFIA 1KSNA 3QGJA 2C90B 2R3YA 1ELFA 4B75A 3RXGA 5EQSA 3ZV8A 4KKDA 3GDSA 1VCQA 2A45B 1KXCA 3TU7H 3EDXB 4UD9H 3E1XB 2Z3EA 3MH6A 2WPLS 3RXIA 2CV3A 3U1IB 3W94A 4TPIZ 1W14U 2H9HA 4ABBA 2BD4A 3SUGA 3MNXA 1NS3A 3PO1C 1JIRA 1K1IA 5DKMA 4I8HA 4NIXA 2AIPA 1C5XB 4CRDA 1TGCA 3T27A 1C5NH 3KQCA 4J1YA 3MH4A 1TLDA 1TFXA 2A7JA 4B73A 1ZPBA 2DE9A 3JZ1B 3H7OA 1ELAA 2FOAA 1Y59T 2ZDVH 4IMQA 1TYNA 2A7CA 3RXVA 2PSYA 1YC0A 1LQDB 1ARCA 1UTLM 2BDGA 4INHA 2G4UA 2GCTC 4NSVA 1EATA 1TX6A 4Q80A 4ZXYH 2XBXA 2J92A 1IQEA 3FZZA 4UFEH 4E7NA 3M3VA 4YESB 1C1WH 3T25A 2ZZUH 1UVOA 1OYTH 4A5TS 5ESTE 1D4PB 3SV7A 1NU9A 1OP2A 2C4FH 1QGFA 3A7WA 4K60A 4Q2KA 3W95A 5DP3A 2RDLA 1O2UA 1RD3B 1NFUA 1GHBF 2R2MB 1HYLA 4OGXA 3MFJA 1HAIH 4AG1A 2BVXH 4I7YH 2ZGJA 1QL8A 3HKJB 2FX6A 2VIWA 1NRPH 2UUKB 1MU6B 1AI8H 4INLA 4BAMB 5F8ZA 2BLOA 3TJNA 1SB1H 1P2OA 1SBWA 1YF4A 4MPVA 1AUJA 5FPYA 1HIAA 1ZPZA 3BSQA 4A6LA 5FXLA 5LH8A 4FUFA 2ANKH 5TCCA 2J2UA 3D62A 3SGBE 2VGCB 4BNRA 1C2KA 3ZZ6A 4MVNA 3TK5A 1G2LA 1UCYE 4WF8A 1YCPM 3TJVA 1UTKA 4NIYA 3MI4A 3VFEA 2QC2A 2QV1A 1EPTC 3F9GA 3MO3A 4B2BA 5DP4A 1FPHH 1C4Y2 1O3KA 4X6PA 2Z3DA 1DS2E 1TGNA 3SU4A 1KXAA 1DY8A 2ODPA 1BHXF 1NC6A 1MQ6A 2BLVA 1CT2E 1HJAC 4CR9A 1SGCA 5DP9A 4MQAA 4DIHH 2H1UA 4GCHG 1P9SA 2ZEBA 1YLDA 4D9RA 2TGDA 2Z9KA 1GPZA 2OTVA 3FP7E 4WWYA 1N8OC 1EB1H 6ESTA 1RFNA 3OY6U 3Q76A 5L30H 1TBZH 2C8WB 3JZ2B 4Z0KA 4UEHH 1D3PB 3B9FH 1C2HA 3RMOH 1Y3YA 4DURA 2XCNA 1WOFA 2CHAC 2PR3A 3SQHE 2ZFTA 3GCNA 5JBTA 1DX5M 1H4WA 2VWNA 1QJ6B 1UK4A 1AD8H 1AZZA 1O32A 4FU7A 1F5KU 3MYWA 3M3SA 3NPSA 2F9OA 4UE7H 3MH7A 2ZGXH 6GCHF 4K1SA 3A8DA 4FVDA 1GJAB 3EQ0H 2SNWA 1QFKH 1LPGB 2HLCA 1NFYA 1AB9B 4NWKA 1BBRK 3TGIE 4TWYA 1MBQA 2G5NA 4BAKB 1N6XA 3RXCA 3Q00A 3EA7A 5EXNA 2Y5FA 1O31A 3SV2H 1U6QA 3BN9A 4JK6A 3TK6A 2W5EA 2Q6FA 1V2ST 1JWTA 3SJ9A 2ZDAH 1BTYA 3M7TA 3VB5A 1LMWB 4KTUA 2AS9A 1O3NA 1TPSA 2VGCC 5FHTA 1CBWB 2F9VA 3QTVH 4DG4A 1OKXA 1GMDG 1FY5A 3CS7A 3U8TH 3M7UA 3UOUA 5CE1A 5DO4H 2EI7A 1O5FH 1MZDA 5AFYH 4X1RU 1G9IE 1V3XA 3TK9A 3VPKA 1FQ3A 1CT4E 1LQEA 1TWXB 1XMNB 3NWUA 1AE8H 4JYUH 1SL3A 5ETXA 1OWEA 1AN1E 1DWBH 5GCHG 1FIZA 3BG8A 1SGEE 1Y5BT 5C1XA 1F0RA 2BZAA 1GG6C 2G5VA 3KIDU 2JH6D 5H4IB 4X0WU 1RTKA 1O2KA 1QTFA 1TNKA 2PSXA 4WXIA 2ZA5A 3TVJB 2P94A 4D9QA 5DP8A 2PUXB 3D49H 4CBOA 2BQ6B 2BXTH 1C5WB 3SORA 3Q3YA 2ZHEH 1ID5H 5FX6A 2XW9A 3GYMA 1QBOA 2PGQB 1GJ5H 3GY8A 1H8IH 4F4OC 1EQ9A 1F0SA 3MHWU 1O2YA 4WMFA 4MG3A 3LH1A 1GBIA 3QN7A 1T8LA 3RMLH 5IDKA 3ZZAA 4TY6A 3RXEA 1KXDA 2QCYA 4FUEA 4IW4E 4ZKRU 3BTQE 2VU8E 1NZQH 2F9UA 1BZXE 1VITG 5L2YH 4Q7ZA 1OWDA 1GGDB 3I78A 5DGJA 1O5EH 3TGKE 2XC4A 1S0RA 4YZUA 4CRCA 1UMAH 3UWJH 3T28A 1GBEA 1ETSH 4K1EA 1Q2WA 4H6TA 1FJSA 1G3BA 3SNDA 4E7RG 1PPHE 1ZHPA 4BANB 1K1LA 2HNTF 3TH2H 1RRKA 2BDIA 1P12E 1JBUH 1UVUH 2C93B 1GJ8B 4NIWA 1O37A 1GMDF 2TGPZ 1ZMJA 3UY9A 1O3GA 2P93A 1XVMA 3A89A 1F0TA 1O0DH 2HWLB 2ZHQH 3QTOH 1UK3A 1MQ5A 3NK8A 3SQEE 1HAXB 1P3EA 2FTLE 5CMXH 4X1SU 1IQGA 1P10A 4WH8A 1QQ4A 2ANWA 2Z94A 1KLJH 4DW2U 1XUGA 2QYIA 3RXUA 1NRNH 1Z8RA 3GDVA 2QY0B 1O3DA 2PKSB 1HXFH 1ZRKA 2FM2A 4KELA 1O2TA 3RXFA 5JB9S 4K8YA 2AGIX 1D9IA 2WYJA 4PROA 1DE7H 2FDAA 1ABJH 2IOTA 3BF6H 1P3CA 1QJ1B 1PPFE 4FUCA 1FDPA 2GGVB 2ZU4A 1QURH 2P3TB 5DP7A 1Y8TA 3A88A 1A0LA 3AAVA 3P8NA 1IQIA 3SNBA 1BMAA 1HUTH 4KP0A 4NSYA 2YNBA 2SGPE 1DSUA 1W2KH 2WINI 2RCEA 2BTCE 4K1TA 3SNEA 4D7GA 3UR9A 1EZQA 2C8ZB 1HBTH 3KNXA 3ZZDA 1C5SA 4ABIA 1LHCH 8GCHG 2JETB 3HATH 1PPZA 2BY9X 1MTWA 1GBKA 2UUJB 4JMYA 4TWWA 2ILNA 2Z9JA 1TNLA 1GJCB 1C2MA 2J34A 1UJ1A 2ZHWH 1O2MA 6CHAC 2STBE 3RMNH 3MO6A 3TGJE 5GDSH 2VWMA 5BRRE 1V2MT 2UWPA 1HAYB 1TB6H 2VVCA 3RM0H 3RC6A 1SGFG 3UIRA 2YOLA 1BHXB 5DG6A 4LZ1H 1GI2A 1GI4A 1W12U 2TIOA 3NZIA 4Y8ZA 4BXWA 1YGCH 1BT7A 1RIWC 1O5CB 2B8OH 1GL0E 1ZOMA 5A8XA 4BTIB 2GMTC 4MNVA 2BXUH 5E0JA 1GL1A 3A83A 5L6NH 1YYY1 2FOMB 1HFDA 3R0FA 1D3QB 1DLKB 4NA8A 4YT6H 1YPEH 4AFZA 3S69A 4BTUB 2P3FH 3SV6A 2HALA 3SV9A 4AZ2B 2Y5GA 5DP5A 1SGDE 1OXGA 2EA3A 1QY6A 2THFB 2PKAA 2FO9A 3QLPH 1BUIA 1P05A 1G3EA 4O3TA 1C1VH 3LGVA 5FBIA 4D8NA 2ZFSA 2GDEH 3ELAH 1GVZA 1H9IE 1HIAB 4SGBE 1HNEE 5EU8A 2ZDKA 5HYOA 1MKXK 1L4ZA 1XXDA 3KQBA 4OS5A 9LPRA 4LXBH 1ELTA 5CHAC 3A8CA 1HPGA 1ZSJA 1GDUA 1PPEE 1FONA 3UNRA 3O8BA 2XWBI 1T8OA 1GI1A 3S9CA 3SHCH 3QO6A 4RKJB 3SJIA 1A5IA 4Y7BA 3ZZ3A 2ZNKH 1BDAA 1QR3E 1B5GH 4QT8C 1MD7A 3M37A 2ZHDA 1ARBA 1JOUB 4Y8YA 2QF0A 4O9VA 1AUTC 4ABEA 2M5TA 1P04A 1F92A 1T7CA 1GBAA 1C2DA 1TGSZ 2HPPH 1X7AC 1AY6H 1A1RA 1PQ5A 2WPHS 1C9TA 3PMAB 3LC5A 1S85A 5HM9A 4K5ZA 2G55A 1NO9H 1P2JA 2ZFQH 5TCAA 2CGAA 2OCVB 2O8TA 2BLQA 4X8TH 3EYDA 3KEEA 4AG2A 2FOGA 1HRTH 2ZDNA 2BMGB 1KY9A 2EI6A 2W3KA 4OS2A 4Y0YE 5A8ZA 3QGNB 2C3SA 2ZU1A 3NUMA 2VNTA 1FI8A 3VB7A 2WPKS 1O3PB 1XUHA 1N1LA 2AEIH 1F2SE 1JIMA 3T2NA 1ZYOA 4ZKSU 2H5DA 4HI3A 1L0ZA 3S7KB 1K1PA 3ZYDA 1WSSH 4H4FA 3SGQE 1K21H 4XDEA 2KAIB 5E0GA 2ZP0H 3BG4B 1CBWC 1AFQB 5GXPA 1LTOA 2LPRA 3LC3A 3HKIB 5BPEA 3F9FA 2BM2A 1RS0A 1CA0C 4Z6AH 3MNSA 1YKTA 2VWLA 1AZ8A 3GCOA 1FY3A 1ANBA 2AFQB 2OBOA 2QXJA 1J14A 1P06A 1SG8B 2RA3A 1P2QA 2H5CA 3SZNA 1E36B 4U30A 5ESBA 4DJZB 1GCTC 1S81A 5TJXA 2A4OA 3AASA 1UO6A 4X8VH 3RXTA 2STAE 2YNAA 1TOMH 3ATKA 3LU9B 1C1NA 1A5GH 1E37B 2KAIA 4DY7B 3KQDA 2Y82A 2BLWA 5L2ZH 3F9EA 4WY3A 1E34B 2F3CE 2ZWLH 5C5OA 2CF8H 2ZC9H 4ESTE 4IN1A 1DFPA 1H8DH 4A1VA 1F0UA 1BMMH 1FZZA 3L3TA 1PQ8A 2H9EH 2O8UA 1NFXA 5FX5A 1DXPA 3U98H 2NU0E 4CBNA 5EODA 1UTNA 3MU1A 1SLVB 1TGBA 2VIPA 3U1JB 4IBLH 1Y3VA 4CH8B 4GUXA 1JRSA 3GYLB 3MU4A 3PLBA 4Y10E 4YOJA 1P2KA 2BDCA 2GT8A 1HAPH 1CGJE 1QA0A 3RC5A 3UWIA 3E0PB 4E06H 1E38B 2A5AA 2BQ7B 3EA8A 5EW2H 2ANYA 1LHEH 4JYVH 1BITA 1EJMA 2Z9IA 1ACBE 2PW8H 3ATLA 1FY1A 1XXFA 4BAOB 3A81A 4ASHA 3BTTE 3LPRA 1O2IA 2PLXA 1BTXA 1GBDA 4WMDA 4MPWA 2V0BA 1F5LA 3VB3A 1O3IA 2ZDMA 2HRVA 1QBVH 4JZFH 3RP2A 1XKBC 3I77A 3SBKA 5K0HA 3SI4H 3DFJA 2XBVA 1V2RT 5C3NA 1TGTA 1FAXA 2W7UA 1C5ZB 2W7SA 1XM1A 1EASA 2ZECA 2ZTYA 3U9AH 4DVAU 2ZPRA 3Q3XA 1ELGA 4AN7A 2GTBA 3FP8E 3QUMP 4TYDA 2FOCA 4INKA 4JZDH 5AF9H 3PWBA 1AFQC 2PKSC 4Y7AA 3GY4A 1SQAA 7GCHG 1V6DA 3RXMA 1CA0B 3SJKA 2Z7FE 1YCPH 2FODA 3SW2B 1Y3UA 2J4IA 5IYTA 3ZZ4A 2ZPSA 4ABGA 2AGEX 1MBMA 2V35A 3IG6B 3GY6A 1O3CA 2ODQA 3E3TA 3BTFE 5AHGH 5LPRA 3RXLA 3CS0A 2VB0A 5EOKA 3A87A 1GBTA 1TABE 3Q77A 1BOQA 1MCVA 1O2JA 2NWNA 5F8XA 4MNWA 3UQOA 5LPFA 2Y80A 1ANDA 1P57B 1BIOA 4DOQA 4X2YA 4TPYA 4A1TA 4Q7YA 1O2LA 2GZ9A 4JZEH 1S83A 1V2WT 5AVDA 1ZMNA 3MNCA 1C5YB 2GZ8A 3NCLA 3QZRA 3SU1A 3ZVAA 8LPRA 1V2LT 1SOZA 4IMZA 1H9LB 6GCHG 2V3HH 2SGDE 4M7GA 4NA7A 3DHKH 3LGYA 2NU1E 2BQWB 4CRBA 1ETRH 4MTBA 5AFZH 5T6FA 2XBYA 1RGQA 3E90B 1V2JT 4KGAA 2G81E 2R0LA 2B5TB 2O9QA 1K28D 1NM6A 1UTJA 4ZROA 1DXWA 1BB0B 1ZPCA 1CE5A 4I8KA 1MKWH 5A0CA 1C1QA 2GMTB 3TH3H 1FXYA 7LPRA 3P17H 3RXPA 5JYIA 1MTVA 1QQUA 2BX4A 1WTGH 5E0HA 1C5LH 1VGCB 3OY5U 4NZQA 1O3HA 2FEQH 1EX3A 3A85A 3M35A 1LVOA 2XC5A 4AYVB 4X1PU 3D65E 1GI3A 2F9NA 1NRQH 3RLWH 3TIUA 1BTHH 2FIRH 1KXFA 3SU2A 2G4TA 1G30B 3GISB 1HJ9A 5I46H 2ZTXA 3ZVGA 2ODYB 1G3DA 1A0HB 1AVXA 2QXHA 1EJNA 1GJBB 3F1SB 4CHAC 2A4QA 4XBBA 3U8OH 1MAYA 2A32A 2A5IA 2Y81A 4FU8A 3LGUA 4JK5A 4BAQB 3OTJE 1Q31A 1ZR0A 3RXQA 1TBQH 1GDNA 4ZAEA 3LGWA 6CHAB 1BMNH 1YPGH 4ZUHA 1WCZA 1GI9B 1A0JA 2Q6GA 3ZYEA 3ZVBA 4TY7A 1HAHH 1GI5A 1PYTC 3SU5A 4UDWH 3TLOA 5T6GA 1SGPE 4U32A 1S82A 1T32A 1OP8A 2HOBA 1CHGA 1L1JA 2W3IA 2A2QH 1F7ZA 2GDDA 1A5HA 4X6OA 5JB8S 5A0BA 3A84A 5FCKA 1V2KT 3M7QA 1KLTA 1NROH 4NCYA 1F5RA 1ZTLA 1GBHA 4MLFB 4AGJA 3HPTB 3GICB 3MO9A 1PYTD 1QRXA 1DANH 1ZGIA 1DWEH 3SNAA 1TRYA 4YT7H 2FPZA 1ZTKA 1SGFA 3HGPA 3TJOA 1OP0A 5JDUB 2ZFFH 1AMHA 1C4V2 3ZVEA 1AGJA 2OXSA 1SOTA 1Y5AT 4OS7A 4FUHA 1IQFA 1SGYE 4WH6A 4AORA 2QIQA 1H1BA 1O35A 1TPOA 8KME2 1GJ9B 2JKHA 4UFFH 3RXHA 1O2ZA 1TMBH 1EPTA 2JH5D 4FUDA 1O2GH 1K2I1 3ITIA 1O5AB 3A8AA 1CQQA 4F49A 1C5OH 1MTNB 4I8GA 4B71A 1TONA 1MAXA 1J17T 1HAVB 4FXGH 1MU8B 3RXAA 2P16A 3PB1E 3UFAA 1VGCC 1IQHA 2GV6A 2OC0A 4GHTA 1WAYB 1THSH 1AFEH 2H2ZA 3P95A 2J95A 1EAIA 2GVFA 1TALA 4JCNA 1BA8B 4BTTB 2FOEA 1PQAA 4VGCB 1ABIH 1AWHB 2SNVA 1TNGA 3BTME 2ZCHP 1GCDA 4DIIH 1YPMH 2IPHA 3F9HA 1ZRBA 1L1GA 1PFXC 1XVOA 1KLIH 3ESTA 3K65B 1S5SA 3F68H 1C1RA 2QXGA 4WJG2 2D1JA 1SGQE 1GJDB 2ZO3H 3IITA 4IC5A 1A2CH 3K2UA 3ODFA 2XBWA 1O2XA 2P8OB 1MTSA 1MUEB 2BYAX 3I29A 3PO1B 4HGCA 1ZGVA 2WV5A 1T4VH 1O3MA 1LO6A 2R0KA 2ZGBH 4NG9H 3A86A 4AFUA 1VCWA 2XC0A 2Z3CA 1TAWA 3UQVA 2WPJS 1TE0A 4RN6A 2PV9B 4HFPB 5SGAE 1KDQB 4A92A 1PJPA 1W7GH 3HGNA 3PMJA 1GHXH 1HAGE 4FVBA 4AB9A 1KTTB 1VITF 1Y3WA 4I8JA 1THRH 3P6ZB 4B1TA 1P2MA 1QCPA 2ZGCA 1O2NA 1VZQH 1S0QA 1ELEE 4UFDH 5C20A 2BD2A 4Y71A 2VWOA 1O2RA 3O8RA 4GAWA 2UUFB 3ZZBA 3BTWE 3GCHC 2GT7A 3PROA 2OLGA 3S7HB 3M5OA 4WVPE 1ELDE 3OU0A 1E35B 1P11E 2VJ1A 1O36A 4Y11E 2BX3A 1CU1A 1SSXA 3O8CA 3SJ8A 1W13U 4AGKA 4BOHA 1XUJA 4ABFA 2XTTB 1O33A 3PWCA 1O2SA 4NGAH 4DCDA 4XE4A 2ZTZA 2Y7XA 4FU9A 2XXLA 3LJJA 4ABHA 1SMFE 4NIVA 2RG3A 1DSTA 3T5FH 4ZHAA 3PTNA 5A2MH 3SUDA 3V12A 1AWFH 1ETTH 2B9LA 1C5MD 1GI0A 2Y6TA 5A8YA 1GMHG 3BTHE 2ZKSA 2QF3A 3AW0A 4VGCC 3RDZA 4A7IB 1AE5A 5F8TA 1QL7A 1V2QT 1VITH 2WV4A 1K1JA 3EAJA 3GY3A 5DK1A 5LGOA 1AHTH 4YLUA 1AB9C 2VIDA 1KXEA 3F6UH 4B76A 1K1OA 1SGIB 1HAVA 3M5NA 5F03A 1NU7B 3VGCC 1P01A 3VXEH 1O38A 2TGAA 5C1UA 4K69A 3RXRA 1EPTB 2OBQA 5ABWA 2GKVE 1SGNE 5J4SA 2GV7A 3FANA 2ZDLA 3RUOA 1SHYA 1ESTA 1C2GA 1PQ7A 4NA9H 4K3JA 1UCYH 8GCHF 2BY7X 1GI8B 1GGDC 1FY4A 1UVTH 1QA7A 5LPEA 1TQ7B 1IQKA 3NXPA 1B7XB 2C8XB 5I25A 3TNSA 2OUAA 1DOJA 1GHAF 1G3CA 2V6NA 6LPRA 4YOIA 2P95A 5T6DA 1BTWA 7ESTE 1ZZZA 4NFEA 1HAOH 4X2XA 3A7TA 4ZKNU 2G52A 2I6QA 1FY8E 2ALPA 1GBJA 1MMJN 2FXRA 1NPMA 2FYRA 2OQ5A 3SOSA 4J2YB 1S84A 1B0EA 3R3GB 1C1TA 2OQUA 1OSSA 1EJAA 1WU1A 1PPGE 1GBBA 3STIA 3P8GA 1HJ8A 1LHDH 1OYQA 3UNSA 4CH2B 2FLBH 2Y5HA 3MU5A 1GBMA 3FAOA 5HXFA 1O3BA 3LONA 3CP7A 4CRGA 1EP5A 2XYAA 1OPHB 1WUNH 1O34A 1DITH 7GCHF 4AX9H 1Z71A 1T31A 2AMQA 2PFEA 1GJ6A 2ZPQA 1QB6A 3A7ZA 1SR5C 4Y8XA 3RXKA 4AB8A 1LDTT 1RXPA 1UVPA 1DY9A 3T29A 1G36A 2UUYA 1T8NA 3PMHB 3ZVDA 1IHTH 1UTOA 4K8BA 1GHYH 1EB2A 1P2NA 2FLRH 4THNH 4Y79A 3V3MA 4WXVA 3TPIZ 1HAZB 3GY2A 3S9AA 1DT2A 2BD8A 2PWXA 2BVRH 1OWKA 1C2FA 2OP9A 1O3OA 5EXLA 1ELVA 4NWLA 1O5DH 2WPMS 3SU3A 2FS9A 1QB9A 3SU0A 3C1KA 4X1NU 4LOYH 2O8LA 1L1NA 1QL9A 2A4RA 1V2NT 3UREA 3ZVFA 4MNXA 4MDSA 2ZF0H 1W11U 3SUFA 1BTUA 3ZZCA 1DDJA 2FZZA 2HPQH 1IQNA 1G2MA 1XUKA 3QX5H 1J16A 1QIXB 1E0FD 1GG6B 2QA9E 1CHOF 1SGTA 1SLUB 4YO9A 2SGEE 1SI5H 1YCPK 1EZSC 2A2XH 1MTNC 2TBSA 4NZLA 2F9PA 1GHZA 3GCTF 3UR6A 1NT1A 4DT7B 3DT0H 1D3DB 3RXDA 1ORFA 2ESTE 3Q3KA 1DM4B 1SHHB 2ZFPH 4U2WA 2QGRA 1Q3XA 3PYHA 3P8FA 2Z9GA 1YPHE 3MU8A 4HZHA 3KHVA 1XUIA 2WYGA 1FPCH 2BY8X 5C1YA 2FX4A 1UCYK 2ALVA 4X8UH 4I33A 2OD3B 4YLQH 3E16B 1GHWH 1GBFA 4ZHLU 2BD3A 2ZFRH 5EPYA 1HGTH 3LT3A 1TMUH 2V3OH 3P70B 4X8SH 1BBRH 2FYQA 1LPKB 2WUBA 1XKAC 3MMGA 5EG4A 3SHAH 3A7XA 1O2VA 4I8LA 1C1SA 3LGTA 1KDQA 3PTBA 4X6MA 1EKBB 1L2EA 4ABJA 4ZXXH 1DWDH 4CRFA 1OWIA 1GI6A 1THPB 2H6MA 1C1PA 3T26A 1O5BB 1KTSB 5FAHA 2EC9H 2OINA 1QRWA 1GI7B 3BIVH 1AVGH 1FUJA 1TBRH 2HNTE 1NY22 3SNCA 2ZG0H 5C5NA 4FUJA 1AU8A 4ISIH 1XX9A 4X2WA 5HMAA 3MTYA 2QXIA 2G8TA 1EAXA 1S6HA 4UFGH 1EOJA 1Z8JB 1N6YA 2DE8A 3PM3A 4D7FA 3OYPA 3U8RH 5A0AE 1JMOH 3RC4A 3O8DA 1IQLA 3EE0B 4I32A 3LOXA 3A82A 3RXBA 4B2AA 1OOKB 1C2EA 3SI3H 1SQTA 4XBCA 3M36A 4DGJA 1ANEA 1FMGA 3RU4D 1J15A 3ZZ7A 1UVSH 1V2OT 2VIVA 1KYNA 1LPZB 1KIGH 3HK3B 3ZZ9A 1ELBA 1UTQA 3MNBA 3AAUA 1D3TB 1C5UA 3GCHB 3BG4C 1O3FA 3UTUH 4OS4A 2TPIZ 4U01A 1VCPA 1MCTA 2QAAA 4IS5A 3PV4A 2SFAA 4XOJA 3M5LA 2BB4A 1T8MA 2D26C 4CR5A 1O2OA 1QBNA 3TITA 4Y6DA 2VH6A 2ZCKP 1W3CA 5C67A 2BD5A 4I31A 3K6YA 1TRNA 2AMPA 4K2YA 1RTLA 2SGQE 2Z6BD 2FOBA 2G51A 4CREA 1Z8GA 1C5QA 1HV7A 4FUGA 2BDYA 1SGRE 2NU3E 1BJUA 2JH0D 4FUIA 2FESH 1J8AA 3GY7A 3C27B 1MTUA 2BOKA 2Z9LA 2ZU3A 1GBCA 1O30A 1C2LA 1A3BH 2BD7A 2XCFA 2PTNA 3ODDA 2FP7B 2HVXA 1C5VA 3DFLA 1LVBA 3UUZA 1HB0B 2PGBB 3S0NA 2W26A 1N8OB 1BRCE 2ULLA 5FPTA 1BTPA 3QK1A 2GX4A 3ZZ5A 3LH3A 1IAUA 3M5MA 1EXFA 2BY5X 1SQOA 1UTPA 3SUEA 1A4WH 2HGTH 2XNIA 1DLEA 2EI8A 1NRSH 3AW1A 3ENSB 4X2VA 4OS1A 1MKXH 1ESBA 3QZQA 3UNQA 4ISLA 3UPEA 1IQJA 1ZSLA 3BTGE 1QJ7B 2FWWA 2OC8A 5JPMH 3L33A 1O2WA 1ZMLA 1TX7A 1PPBH 1FAKH 3D23A 2GZ7A 2D2DA 2ZU2A 1DICA 2CN0H 1GWAA 5DJ7A 1G37A 4BXSA 3SU6A 3VB6A 4Y0ZE 1PPCE 3VEQB 2IN2A 3RXJA 1C2JA 1C1MA 4NFFA 4AOQA 3UOPA 2K1QA 4GLYA 2TRMA 3P92A 2JETC 1HCGA 1ZJDA 1WQSA 1NTPA 3ATIA 1FIWA 5GWZA 1TNIA 1OWJA 5EW1H 1LHFH 1J9CH 3B8JA 1IOEA 4BAHB 2Q1JA 4XSKU 1FLEE 4JYTA 1M9UA 2ANMH 3V7TA 5J4QA 1WV7H 1TX8A 2J9NA 1P8VC 1H9HE 4FUBA 4GSOA 3STJA 3RLYH 4GHQA 1G32B 4YTAA 3FFGA 5HM2A 2P3UB 1LVMA 3LJOA 3T62A 4AYYB 1AKSA 2J38A 2ZU5A 1P03A 3CENA 3BEIB 2RA0A 1SPJA 5GCHF 1TPPA 2GD4B 1C5TA 2FI5E 2F83A 2AERH 1S6FA 3FVFB 1JXPA 1BRUP 4ZKOU 2A5KA 1WBGB 1GVKB 1W10U 1GBLA 2B7DH 1C5RA 3GCTG 3SN8A 1CA8B 3KQEA 3LIWA 3G01A 4ABDA 1CVWH 2F91A 3WY8A 7KMEH 2BVSH 4A1XA 2TGTA 1C9PA 2CJIA 3NKKA 1C2IA 4AFQA 1SVPA 1WTHD 2IJOB 5EGMA 2PUQH 1Y3XA 2BY6X 1V2UT 1Z8IB 4IGDA 1EAUA 1EAWA 2QN5T 3DUXH 3EA9A 3M61U 1LVYA 1ZTJA 2GCHG 4JZ1A 2GCTB 2F9BH 4O3UA 5GJ4B 2A31A 4ZHMU 3PLKA 1TPAE 3QWCH 2BD9A 5E2PA 1CT0E 3E0NB 4RKOB 1O39A 4B2CA 4R0IA 2FTMA 4MPUA 1K9OE 1GDQA 5EXMA 4MNYA 4HTCH 5FBEA 1YPKH 4ZMAH 5JBCS 2A4GA 3KF2A 2HNTC 3KCGH 1Z6EA 1SLWB 1ZJKA 2G00A 5HGGA 1CGIE 3RM2H 1BBRE 1GMHF 5JBBS 1FV9A 1GMCG 3TNTA 5T3HA 4O03A 2R3UA 3ATMA 2C8YB 2UWLA 2VVVA 2XRCA 2OC7A 2FI4E 1Z1JA 3SJOA 1YBWA 1MKWK 4XFQA 1TOCB 1ZSKA 4IN2A 3DD2H 2VINA 2CMYA 2O8WA 2J94A 1INCA 3BEUA 3KL6A 1C1UH 2A7HA 2BOHB 2NU2E 2GCHF 3GOVB 3P8OA 3RXOA 1K1NA 3SV8A 4CRAA 2CXVA 1ZLRA 4YOGA 2FOHA 4D76A 2VIOA 3PMBB 5F6MA 5PTPA 1A61H 2P59A 1QHRB 9ESTA 2ZI2H 3K6ZA 2ZQ1A 3BV9B 3M3TA 2DUCA 1V2VT 1EUFA 2SGAA 3RXSA 1YM0A 8ESTE 3TH4H 2BZ6H 1C1OA 1K22H 1QNJA 5GPIB 1GJ7B 1QRZA 1WYKA 1EP6A 3PLPA 1UHBB 1MH0A 3TJUA 1Z6JH 4Y76A 1GHBG 1DUEA 3H5CB 1TRMA 3LDXH 4MPXA 1SFQB 1WQVH 2OC1A 3E91A 2FOFA 4H42U 4E05H 2VVUA 2VH0A 2BDBA 3MWIU 2NU4E 2EEKA 3U69H 4R8TB 3ZV9A 3EGKH 1GCTB 3MOCA 1ESAA 5E2OA 2FI3E 4B74A 3OSYA 2ZCLP 3L6PA 1YLCA 5GIBA 1C4U2 5K7RA 1DWCH 3MU0A 1FNIA 1D6WA 3V0XA 4SGAE 5EQRA 2O8MA 1HJAB 2D8WA 1MD8A 2BHGA 1BQYA 1LHGH 3GY5A 3QDZB 1IQMA 1Y5UT 1B0FA 1MZAA 4KTSA 1UK2A 1RTFB 3A7YA 2ZGHA 3ATWA 1A46H 1V2TT 3BTKE 1P0SH 1Z1IA 4OGYA 4ZH8A 1BJVA 5DP6A 1CO7E 3GDUA 3BIUH 1TIOA 1BRAA 3VGCB 1P2IA 1FN8A 1SC8U 2H9TH 1BRBE 3IWMA 1K1MA 1GMCF 1AO5A 3URCA 3KGPA 4ISHH 5B6OA 1TA2A 2BDAA 2Y7ZA 2CHAB 1DVAH 4O97A 1RIWB 2LNCA 1AIXH 3E8LA 2FMJA 2AH4X 1VJ9U 5FCRA 1OS8A 3A7VA 1CHOG 1CSOE 2CF9H 1RJXB 1DPOA 3RU4E 1TA6A 3SO3A 5C2ZA 5JBAS 1C5PA 1V2PT 3H7TA 1L4DA 5E8EH 2GP9B 1YPLH 5FPSA 1VR1H 1LKAA 2AGGX 3MH5A 2PTCE 1BTZA 1ZHRA 1TNJA 1P09A 5EQQA 2PHBA 1O2PA 1HXEH 5G4BA 1O3EA 1O5GH 1QB1A 3BTDE
chains in the Genus database with same CATH superfamily
4X1QU 2AYWA 5CHAB 1AVWA 3BEFB 1HLTH 1NRRH 1A7SA 4IC6A 1W0YH 1JRTA 3S9BA 5EJZA 1NN6A 3A8BA 1EZUC 2Q6DA 1YPHC 2XWAA 4AFSA 2UWOA 1OX1A 1NESE 3RU4T 2AMDA 1DUAA 2ZHFH 2A0QB 1ANCA 1XUFA 3HK6B 3E6PH 3BTEE 4OS6A 1OWHA 1TQ0B 4LK4A 1KXBA 2P8OC 1HDTH 1BCUH 1CGHA 3VXFH 1VJAU 1GJ4H 4KTCA 1TMTH 2A1DB 4H6SB 1TNHA 1P9UA 4X6NA 1D6RA 1EOLA 3ZZ8A 1SLXB 1FN6A 2PKAB 3ZVCA 1YPJH 2I6SA 1A3EH 1ZHMA 1GHVH 1LCYA 2VIQA 3AVZA 3B23B 3DA9B 1O2HA 4ISOA 2WPIS 1O3JA 2SGFE 4ISNA 2FS8A 1Z7KA 2ZIQH 3VB4A 5A09A 1UHBA 1ELCA 3KN2A 3SGAE 5EPNA 2ZQ2A 1EZXC 1LKBA 4CHAB 1W8BH 1W7XH 3N7OA 3V13A 3LKWA 3RMMH 4ZCNA 2ASUB 4JZIA 1GVLA 5HKKD 1IHSH 3FZDA 2R9PA 1AKSB 2B0FA 1BMLA 1UTMA 3NRLA 1O3LA 4UONA 3A80A 1NFWA 1O3AA 3LGIA 2AIQA 4GPGA 1AQ7A 2R2WU 4LZ4B 4GVUA 1T4UH 1GHAG 3K9XB 4Q7XA 1O2QA 4XBDA 5DPAA 1W0ZU 2WUCA 4ABAA 5EJ1A 3URDA 4YM9A 1P02A 3OX7U 4GCHF 1YP9A 3FP6E 4RSPA 4WMEA 2BDHA 1SFIA 5EIYA 1KSNA 3QGJA 2C90B 2R3YA 1ELFA 4B75A 3RXGA 5EQSA 3ZV8A 4KKDA 3GDSA 1VCQA 2A45B 1KXCA 3TU7H 3EDXB 4UD9H 3E1XB 2Z3EA 3MH6A 2WPLS 3RXIA 2CV3A 3U1IB 3W94A 4TPIZ 1W14U 2H9HA 4ABBA 3AK5A 2BD4A 3SUGA 3MNXA 1NS3A 3PO1C 2IJD1 1JIRA 1K1IA 5DKMA 4I8HA 4NIXA 2AIPA 1C5XB 4CRDA 1TGCA 3T27A 1C5NH 3KQCA 4J1YA 3MH4A 1TLDA 1TFXA 2A7JA 5GNDA 4B73A 1ZPBA 2DE9A 3JZ1B 2QF4A 3H7OA 1ELAA 2FOAA 1Y59T 2ZDVH 4IMQA 1TYNA 2A7CA 3RXVA 2PSYA 2KCYA 1YC0A 1LQDB 1ARCA 1UTLM 2BDGA 4INHA 2G4UA 2GCTC 4NSVA 1EATA 1TX6A 4Q80A 4ZXYH 2XBXA 2J92A 1IQEA 3FZZA 4UFEH 4E7NA 3M3VA 4YESB 1C1WH 3T25A 2ZZUH 1UVOA 1OYTH 4A5TS 5ESTE 1D4PB 3EE7A 3SV7A 1NU9A 1OP2A 2C4FH 1QGFA 3A7WA 4K60A 4Q2KA 3W95A 5DP3A 2RDLA 1O2UA 1RD3B 1NFUA 1GHBF 2R2MB 1HYLA 4OGXA 3MFJA 1HAIH 4AG1A 2BVXH 4I7YH 2ZGJA 1QL8A 3HKJB 2FX6A 2VIWA 1NRPH 2UUKB 1MU6B 1AI8H 4INLA 4BAMB 4DT4A 5F8ZA 2BLOA 3TJNA 1SB1H 1P2OA 1SBWA 3DSGA 2JIZD 1YF4A 4MPVA 1AUJA 2QF5A 5FPYA 1HIAA 1ZPZA 3BSQA 4A6LA 5FXLA 5LH8A 4FUFA 2ANKH 5TCCA 2J2UA 3D62A 3SGBE 2VGCB 4BNRA 1C2KA 3ZZ6A 4MVNA 3TK5A 1G2LA 1UCYE 4WF8A 1YCPM 3TJVA 1UTKA 4NIYA 3MI4A 3VFEA 2QC2A 2QV1A 3F0OA 1EPTC 3CNRA 3F9GA 3MO3A 4B2BA 5DP4A 1FPHH 1C4Y2 1O3KA 4X6PA 2Z3DA 1DS2E 1TGNA 3SU4A 1KXAA 1DY8A 2ODPA 1BHXF 1NC6A 1MQ6A 2BLVA 1UW7A 1CT2E 1HJAC 4CR9A 1SGCA 5DP9A 4MQAA 4DIHH 2H1UA 4GCHG 1P9SA 2ZEBA 1YLDA 3OEED 4D9RA 2TGDA 2Z9KA 1GPZA 2OTVA 3FP7E 4WWYA 1N8OC 1EB1H 6ESTA 1RFNA 3OY6U 3Q76A 5L30H 3DSOA 1TBZH 2C8WB 3JZ2B 4Z0KA 4UEHH 1D3PB 3B9FH 1C2HA 3RMOH 1Y3YA 4DURA 2XCNA 1WOFA 2CHAC 2PR3A 3SQHE 2ZFTA 3GCNA 5JBTA 1DX5M 1H4WA 2VWNA 1QJ6B 1UK4A 1AD8H 1AZZA 1O32A 4FU7A 1F5KU 3MYWA 2KCOA 3M3SA 3NPSA 2F9OA 4UE7H 3MH7A 2ZGXH 6GCHF 4K1SA 3A8DA 4FVDA 1GJAB 3EQ0H 2SNWA 1QFKH 1LPGB 2HLCA 2JDID 1NFYA 4F48B 4HG6A 1AB9B 4NWKA 1BBRK 3TGIE 4TWYA 1MBQA 2G5NA 4BAKB 1N6XA 3RXCA 3Q00A 3EA7A 5EXNA 2Y5FA 1O31A 3SV2H 1U6QA 3BN9A 4JK6A 3TK6A 2W5EA 2Q6FA 1V2ST 1JWTA 5DN6D 3SJ9A 2ZDAH 1BTYA 3M7TA 3VB5A 1LMWB 4KTUA 2AS9A 1O3NA 1TPSA 2VGCC 5FHTA 1CBWB 2F9VA 2IPQX 3QTVH 4DG4A 1OKXA 1GMDG 1FY5A 3CS7A 3U8TH 3M7UA 3UOUA 5CE1A 5DO4H 2EI7A 1O5FH 1MZDA 5AFYH 4X1RU 1G9IE 1V3XA 3TK9A 3VPKA 1FQ3A 1CT4E 1LQEA 1TWXB 2WSSD 1XMNB 3NWUA 1AE8H 4JYUH 1SL3A 5ETXA 1OWEA 1AN1E 3GS9A 1DWBH 5GCHG 1FIZA 3BG8A 1SGEE 1Y5BT 5C1XA 1F0RA 2BZAA 1GG6C 2G5VA 3KIDU 2JH6D 3U28C 5H4IB 4X0WU 1RTKA 1O2KA 1QTFA 1TNKA 1YWUA 2PSXA 2ZA5A 4WXIA 3TVJB 2P94A 4D9QA 5DP8A 2PUXB 3D49H 4CBOA 2HLDD 2BQ6B 2BXTH 1C5WB 3SORA 3Q3YA 2ZHEH 1ID5H 5FX6A 2XW9A 3GYMA 1QBOA 2PGQB 1GJ5H 2WPDD 3GY8A 2JJ1D 1H8IH 4F4OC 1EQ9A 1F0SA 3MHWU 1O2YA 4WMFA 4MG3A 3LH1A 1GBIA 3QN7A 1T8LA 3RMLH 5IDKA 1YLNA 4TY6A 3ZZAA 3RXEA 1KXDA 2QCYA 4FUEA 4IW4E 4ZKRU 3BTQE 2VU8E 1NZQH 2F9UA 1BZXE 1VITG 5L2YH 4Q7ZA 1OWDA 1MABB 1GGDB 3I78A 5DGJA 1O5EH 3TGKE 2XC4A 1S0RA 4YZUA 4CRCA 1UMAH 3UWJH 3T28A 1GBEA 1ETSH 4K1EA 1Q2WA 4H6TA 1FJSA 1G3BA 3SNDA 4E7RG 1PPHE 1ZHPA 4BANB 1K1LA 2HNTF 3TH2H 1RRKA 2BDIA 1P12E 1JBUH 1UVUH 2C93B 1GJ8B 4NIWA 1O37A 1GMDF 2TGPZ 1ZMJA 4TT3D 3UY9A 1O3GA 2P93A 1XVMA 3A89A 1F0TA 1O0DH 2HWLB 2ZHQH 3QTOH 1UK3A 1MQ5A 3NK8A 3SQEE 1HAXB 1P3EA 2FTLE 5CMXH 5DSFA 4X1SU 4TSFD 1IQGA 1P10A 2V3MA 4WH8A 1QQ4A 2ANWA 2Z94A 1KLJH 4DW2U 5C0TA 5CDFE 1XUGA 2QYIA 3RXUA 1NRNH 1Z8RA 3GDVA 2QY0B 1O3DA 2PKSB 1HXFH 1ZRKA 2FM2A 4KELA 1O2TA 3RXFA 5JB9S 4K8YA 2AGIX 1D9IA 2WYJA 4PROA 1DE7H 2FDAA 1ABJH 2IOTA 1SQRA 3BF6H 1P3CA 1QJ1B 1PPFE 4FUCA 1FDPA 2GGVB 2ZU4A 1QURH 2P3TB 5DP7A 1Y8TA 3A88A 1A0LA 2AHME 3AAVA 3P8NA 1IQIA 3SNBA 1BMAA 1HUTH 4KP0A 4NSYA 2YNBA 4I86A 2SGPE 1DSUA 1W2KH 2WINI 2RCEA 2BTCE 4K1TA 3SNEA 4D7GA 3UR9A 1EZQA 2C8ZB 1HBTH 3KNXA 3ZZDA 1C5SA 4ABIA 4F55A 1LHCH 8GCHG 2JETB 3HATH 1PPZA 2BY9X 1MTWA 1GBKA 2UUJB 4JMYA 4TWWA 2ILNA 2Z9JA 1TNLA 2LELA 1GJCB 1C2MA 2J34A 1UJ1A 2ZHWH 1O2MA 6CHAC 2STBE 3RMNH 3MO6A 2RDEA 3TGJE 5GDSH 2VWMA 5BRRE 1V2MT 2UWPA 1HAYB 1TB6H 2VVCA 3RM0H 3RC6A 1SGFG 3UIRA 2YOLA 1BHXB 5DG6A 4LZ1H 1GI2A 1GI4A 1W12U 2TIOA 3NZIA 4Y8ZA 4BXWA 1YGCH 1BT7A 1RIWC 1O5CB 2B8OH 1GL0E 1ZOMA 5A8XA 4BTIB 2GMTC 4MNVA 2BXUH 5E0JA 1GL1A 3A83A 5L6NH 1YYY1 2FOMB 1HFDA 2F43B 1D3QB 1DLKB 3R0FA 4NA8A 1YPEH 1COWD 4YT6H 3S69A 4AFZA 4BTUB 2P3FH 3SV6A 2HALA 3SV9A 2V7QD 4AZ2B 2Y5GA 5DP5A 1SGDE 1OXGA 2EA3A 1QY6A 2THFB 3F3BA 2PKAA 2FO9A 3F2GA 3QLPH 1BUIA 1P05A 1G3EA 4O3TA 1C1VH 3LGVA 5FBIA 4D8NA 2ZFSA 2GDEH 3ELAH 1GVZA 1H9IE 1HIAB 4SGBE 1HNEE 5EU8A 2ZDKA 5HYOA 1MKXK 1L4ZA 1XXDA 3KQBA 4OS5A 9LPRA 4LXBH 1ELTA 5CHAC 3A8CA 1HPGA 1ZSJA 1GDUA 1PPEE 1FONA 3UNRA 3O8BA 2XWBI 1T8OA 1GI1A 3S9CA 3SHCH 3QO6A 4RKJB 3SJIA 1A5IA 4Y7BA 3ZZ3A 2ZNKH 1BDAA 1QR3E 1B5GH 4QT8C 1MD7A 3M37A 2ZHDA 1ARBA 1JOUB 4Y8YA 2QF0A 4O9VA 1AUTC 4ABEA 2M5TA 1P04A 1F92A 1T7CA 1GBAA 1C2DA 1TGSZ 2HPPH 1X7AC 1AY6H 4YXWD 1A1RA 1PQ5A 2WPHS 1C9TA 3PMAB 3LC5A 1S85A 5HM9A 4K5ZA 2G55A 1NO9H 1P2JA 2ZFQH 4AC9A 5TCAA 2CGAA 2OCVB 2O8TA 2BLQA 4X8TH 3EYDA 3KEEA 4AG2A 2FOGA 1HRTH 2ZDNA 2BMGB 1KY9A 2EI6A 2W3KA 1FX0B 4OS2A 4Y0YE 5A8ZA 3QGNB 2C3SA 2ZU1A 3NUMA 2VNTA 1FI8A 3VB7A 2WPKS 1O3PB 1XUHA 1N1LA 2AEIH 1F2SE 1JIMA 3T2NA 1ZYOA 4ZKSU 2H5DA 4HI3A 1L0ZA 3OTPA 3S7KB 1K1PA 3ZYDA 1WSSH 4H4FA 3SGQE 1K21H 4XDEA 2KAIB 5E0GA 2ZP0H 3BG4B 1CBWC 1AFQB 5GXPA 1LTOA 2LPRA 3LC3A 2CK3D 3HKIB 5BPEA 3F9FA 2BM2A 1RS0A 1CA0C 4Z6AH 3MNSA 1YKTA 2VWLA 1AZ8A 3GCOA 1FY3A 1ANBA 2AFQB 2OBOA 2QXJA 1J14A 4FETA 1P06A 1SG8B 2RA3A 1P2QA 2H5CA 3SZNA 1E36B 4U30A 5ESBA 4DJZB 1GCTC 2KX4A 1S81A 5TJXA 2A4OA 3AASA 1UO6A 4X8VH 3RXTA 2STAE 2YNAA 1TOMH 3ATKA 3LU9B 1C1NA 1A5GH 1E37B 2KAIA 4DY7B 3KQDA 2QE7D 2Y82A 2BLWA 5L2ZH 3F9EA 4WY3A 1E34B 2F3CE 2ZWLH 5C5OA 2CF8H 2ZC9H 4ESTE 4IN1A 1DFPA 1H8DH 4A1VA 1F0UA 1BMMH 1FZZA 3L3TA 1PQ8A 2H9EH 2O8UA 1NFXA 5FX5A 1NBMD 1DXPA 5F53A 3U98H 2NU0E 4CBNA 5EODA 2WV9A 1UTNA 3MU1A 1SLVB 1TGBA 2VIPA 3U1JB 4IBLH 1Y3VA 2F4LA 4CH8B 4GUXA 1JRSA 3GYLB 3MU4A 3PLBA 4Y10E 4YOJA 3OFND 1P2KA 2BDCA 2GT8A 1HAPH 1CGJE 2L74A 1QA0A 3RC5A 3UWIA 3E0PB 4E06H 1E38B 2A5AA 2BQ7B 3EA8A 5EW2H 2ANYA 1LHEH 3KYFA 4JYVH 3WW7A 1BITA 1EJMA 2Z9IA 1ACBE 2PW8H 3ATLA 1FY1A 1XXFA 4BAOB 3A81A 4ASHA 3BTTE 5C94A 3VG8A 3LPRA 1O2IA 2PLXA 1BTXA 1GBDA 5EJLA 4WMDA 4MPWA 2V0BA 1F5LA 3VB3A 1O3IA 2ZDMA 2HRVA 1QBVH 4JZFH 3RP2A 1XKBC 3I77A 3SBKA 5K0HA 3SI4H 3DFJA 2XBVA 1V2RT 5C3NA 1TGTA 1FAXA 2W7UA 1C5ZB 2W7SA 1XM1A 1EASA 2ZECA 2ZTYA 3U9AH 4DVAU 2ZPRA 3Q3XA 1ELGA 4AN7A 2GTBA 3FP8E 3QUMP 4TYDA 2FOCA 4INKA 4JZDH 5AF9H 3PWBA 1AFQC 2PKSC 4Y7AA 3GY4A 1SQAA 7GCHG 1V6DA 3RXMA 1CA0B 3SJKA 2Z7FE 1YCPH 2FODA 3SW2B 1NBME 1Y3UA 2J4IA 5IYTA 3ZZ4A 2ZPSA 4ABGA 2AGEX 1MBMA 2V35A 3IG6B 3GY6A 1O3CA 2ODQA 2J97A 3E3TA 3BTFE 5AHGH 5LPRA 3RXLA 3CS0A 2VB0A 5EOKA 3A87A 1GBTA 1TABE 3Q77A 1BOQA 1MCVA 1O2JA 2NWNA 5F8XA 4MNWA 3UQOA 5LPFA 2Y80A 1ANDA 1H8ED 1P57B 1BIOA 4DOQA 4X2YA 4TPYA 4A1TA 4Q7YA 1O2LA 2GZ9A 4JZEH 1S83A 1V2WT 5AVDA 1ZMNA 3MNCA 1C5YB 2GZ8A 3NCLA 3QZRA 5KECA 3SU1A 3ZVAA 8LPRA 1V2LT 1SOZA 4IMZA 1H9LB 6GCHG 2V3HH 2SGDE 4M7GA 4NA7A 3DHKH 3LGYA 2NU1E 2BQWB 4CRBA 1ETRH 4MTBA 5AFZH 5T6FA 2XBYA 1RGQA 1E79D 3E90B 1V2JT 4KGAA 2G81E 2R0LA 2B5TB 2O9QA 1K28D 1NM6A 1UTJA 4ZROA 1DXWA 1BB0B 1ZPCA 1CE5A 4I8KA 1MKWH 5A0CA 1C1QA 2GMTB 3TH3H 1FXYA 7LPRA 3P17H 3RXPA 5JYIA 1MTVA 1QQUA 2BX4A 1WTGH 5E0HA 1C5LH 1VGCB 3OY5U 4NZQA 1O3HA 2FEQH 4P00A 1EX3A 3A85A 3M35A 1LVOA 2XC5A 4AYVB 4X1PU 2YMSB 3D65E 1GI3A 2F9NA 1NRQH 3RLWH 3TIUA 1BTHH 2FIRH 3W1EA 1KXFA 1BMFD 3SU2A 3UB0A 2G4TA 1G30B 3GISB 1HJ9A 5I46H 2ZTXA 3ZVGA 2ODYB 1G3DA 1A0HB 1AVXA 2QXHA 1EJNA 3DCLA 1GJBB 3F1SB 4CHAC 2A4QA 4XBBA 3U8OH 1MAYA 2A32A 5T1VA 2A5IA 2Y81A 4FU8A 3LGUA 4JK5A 4P02A 4BAQB 3OTJE 1Q31A 1ZR0A 3RXQA 1TBQH 1GDNA 4ZAEA 3LGWA 3WWBA 6CHAB 1BMNH 1YPGH 4ZUHA 1WCZA 3N7EA 1GI9B 1A0JA 2Q6GA 3ZYEA 3ZVBA 4TY7A 1HAHH 1GI5A 1PYTC 3SU5A 4UDWH 4OM9A 3TLOA 5T6GA 1SGPE 4U32A 1S82A 1T32A 1OP8A 2HOBA 1CHGA 1L1JA 2W3IA 2A2QH 1F7ZA 2GDDA 4M9FA 1A5HA 4X6OA 5JB8S 5A0BA 3A84A 5FCKA 1V2KT 3M7QA 1E1QD 1KLTA 1NROH 4NCYA 1F5RA 1ZTLA 2VBCA 1GBHA 2KCPA 4MLFB 4AGJA 3HPTB 3GICB 3MO9A 1PYTD 1QRXA 1DANH 1ZGIA 1DWEH 3SNAA 1TRYA 4YT7H 2FPZA 1ZTKA 1SGFA 3HGPA 3TJOA 1OP0A 5JDUB 2ZFFH 1AMHA 1C4V2 3ZVEA 1AGJA 1QZ8A 2OXSA 1SOTA 1Y5AT 4OS7A 2KZ4A 4FUHA 3FKSD 2XOKD 1IQFA 1SGYE 4WH6A 4AORA 2QIQA 1H1BA 1O35A 1TPOA 8KME2 1GJ9B 2JKHA 4UFFH 3RXHA 1O2ZA 1TMBH 1EPTA 2JH5D 4FUDA 1O2GH 1K2I1 3ITIA 1O5AB 3A8AA 1CQQA 4F49A 1C5OH 1MTNB 4I8GA 4B71A 2K0QA 1TONA 3KQ5A 1MAXA 1J17T 1HAVB 4FXGH 1MU8B 3RXAA 2P16A 3PB1E 3UFAA 1VGCC 1IQHA 2GV6A 2OC0A 4GHTA 5C17A 1WAYB 1THSH 1AFEH 2H2ZA 3P95A 2J95A 1EAIA 3KYGA 2GVFA 5HIYA 1TALA 4JCNA 1BA8B 4BTTB 2FOEA 1PQAA 4VGCB 1ABIH 1AWHB 2SNVA 1TNGA 3BTME 2ZCHP 1GCDA 4DIIH 1YPMH 2IPHA 3F9HA 1ZRBA 1L1GA 1PFXC 1XVOA 1KLIH 3ESTA 3K65B 1S5SA 3F68H 1C1RA 1VKYA 2QXGA 4WJG2 2D1JA 1SGQE 1GJDB 2ZO3H 5C0UA 3IITA 4IC5A 1A2CH 3K2UA 3ODFA 2XBWA 1O2XA 2P8OB 1MTSA 1MUEB 2BYAX 3I29A 3PO1B 3OEHD 4HGCA 1ZGVA 2WV5A 1T4VH 1O3MA 1LO6A 2R0KA 2ZGBH 4NG9H 3A86A 4AFUA 1VCWA 2XC0A 2Z3CA 1TAWA 3UQVA 2WPJS 1TE0A 4RN6A 2PV9B 4HFPB 5SGAE 1KDQB 4A92A 1PJPA 1W7GH 3HGNA 3PV5A 3PMJA 1GHXH 1HAGE 4FVBA 3F0PA 4AB9A 1KTTB 1VITF 1Y3WA 4I8JA 1THRH 3P6ZB 4B1TA 1P2MA 1QCPA 2ZGCA 1O2NA 1VZQH 1S0QA 1ELEE 4UFDH 5C20A 2BD2A 4Y71A 2VWOA 1O2RA 3O8RA 4GAWA 2UUFB 3ZZBA 3BTWE 3GCHC 2GT7A 3PROA 2OLGA 3S7HB 3M5OA 4WVPE 1ELDE 3OU0A 1E35B 1P11E 2VJ1A 1O36A 4Y11E 2BX3A 3PV2A 1CU1A 1SSXA 3O8CA 3SJ8A 1W13U 4AGKA 4BOHA 1XUJA 4ABFA 2XTTB 1O33A 3PWCA 1O2SA 4NGAH 4DCDA 4XE4A 2ZTZA 2Y7XA 4FU9A 2XXLA 3LJJA 4ABHA 1SMFE 4NIVA 2RG3A 1E1RD 1DSTA 3T5FH 4ZHAA 3PTNA 5A2MH 3SUDA 3V12A 1AWFH 1ETTH 2B9LA 2XNDD 1C5MD 1GI0A 2Y6TA 5A8YA 1GMHG 4Q4LA 3BTHE 4RI0A 1W0JD 2ZKSA 2QF3A 3AW0A 4VGCC 3RDZA 4A7IB 1AE5A 5F8TA 1QL7A 1V2QT 1VITH 2WV4A 1K1JA 3EAJA 3GY3A 5DK1A 5LGOA 1AHTH 4YLUA 1AB9C 2VIDA 1KXEA 3F6UH 4B76A 1K1OA 1SGIB 1HAVA 3M5NA 5F03A 1NU7B 3VGCC 1P01A 3MQKC 3VXEH 1O38A 2TGAA 5C1UA 4K69A 3RXRA 1EPTB 2OBQA 4B6EA 5ABWA 2GKVE 1SGNE 5J4SA 2GV7A 3FANA 2ZDLA 3RUOA 1SHYA 1ESTA 1C2GA 1PQ7A 4NA9H 4K3JA 1UCYH 8GCHF 2BY7X 5HIZA 1GI8B 1GGDC 1FY4A 1UVTH 1QA7A 5LPEA 1TQ7B 1IQKA 3NXPA 1B7XB 2C8XB 5I25A 3TNSA 2OUAA 1DOJA 1GHAF 1G3CA 1K0HA 2V6NA 6LPRA 1WDIA 4YOIA 2P95A 2GJGA 5T6DA 1BTWA 7ESTE 1ZZZA 4NFEA 1HAOH 4X2XA 3A7TA 4ZKNU 3PRBA 2G52A 2I6QA 1FY8E 2ALPA 1GBJA 1MMJN 2FXRA 1NPMA 2FYRA 2OQ5A 3SOSA 4J2YB 1S84A 1B0EA 3R3GB 4RT1A 1C1TA 2OQUA 1OSSA 1EJAA 1WU1A 1PPGE 1GBBA 3STIA 3P8GA 1HJ8A 1LHDH 1OYQA 3UNSA 4CH2B 5CHBA 2FLBH 2Y5HA 3FN8A 3MU5A 1GBMA 3FAOA 1W0KD 5HXFA 1O3BA 3LONA 3CP7A 3DSPA 4CRGA 1EP5A 1OPHB 1WUNH 1O34A 2XYAA 1DITH 7GCHF 4AX9H 1Z71A 1T31A 2AMQA 2PFEA 1GJ6A 2ZPQA 1QB6A 3FO8D 3A7ZA 2EQNA 1SR5C 4Y8XA 3H09A 3RXKA 4AB8A 1LDTT 1RXPA 1UVPA 1DY9A 3T29A 1G36A 2UUYA 1T8NA 3PMHB 3ZVDA 1IHTH 1UTOA 4K8BA 1GHYH 1EB2A 1P2NA 2FLRH 4THNH 4Y79A 3V3MA 4WXVA 3TPIZ 1HAZB 3GY2A 3S9AA 1DT2A 2BD8A 2PWXA 2BVRH 1OWKA 1C2FA 3ZIAD 2OP9A 1O3OA 5EXLA 2LP6A 1ELVA 4NWLA 1O5DH 2WPMS 3SU3A 2FS9A 1QB9A 3SU0A 3C1KA 4X1NU 4LOYH 2O8LA 1L1NA 1QL9A 2A4RA 1V2NT 3UREA 3ZVFA 4MNXA 4MDSA 2ZF0H 1W11U 3SUFA 1BTUA 3ZZCA 1DDJA 2FZZA 2HPQH 1IQNA 2K8IA 1G2MA 1XUKA 3QX5H 1J16A 1QIXB 1E0FD 1GG6B 2QA9E 1CHOF 1SGTA 1SLUB 4YO9A 2KFWA 2SGEE 3SZEA 1SI5H 1YCPK 1EZSC 2A2XH 1MTNC 2TBSA 4NZLA 2F9PA 1GHZA 3GCTF 3UR6A 1NT1A 4DT7B 3DT0H 1D3DB 3RXDA 1ORFA 2ESTE 3Q3KA 1DM4B 1SHHB 2ZFPH 4U2WA 2QGRA 1Q3XA 3PYHA 3P8FA 2Z9GA 1YPHE 3MU8A 4HZHA 3KHVA 1XUIA 2WYGA 1FPCH 2BY8X 5C1YA 2FX4A 1UCYK 2ALVA 4X8UH 4Z1MD 4I33A 2OD3B 4YLQH 3FOAA 3E16B 4RT0A 1GHWH 1GBFA 2YMSD 4ZHLU 2BD3A 2ZFRH 5EPYA 1HGTH 3LT3A 1TMUH 2V3OH 3P70B 4X8SH 1BBRH 2FYQA 1LPKB 2WUBA 1XKAC 3MMGA 5EG4A 3SHAH 3A7XA 1O2VA 4I8LA 1C1SA 3LGTA 1KDQA 3PTBA 4X6MA 1EKBB 1L2EA 1YY3A 4ABJA 4ACAA 4ZXXH 1DWDH 4CRFA 1OWIA 1GI6A 1THPB 2H6MA 1C1PA 3T26A 1O5BB 1KTSB 5FAHA 2HVYB 3PRDA 2EC9H 2OINA 1QRWA 4XD7D 1GI7B 3BIVH 1AVGH 1FUJA 1TBRH 2HNTE 1NY22 3SNCA 2ZG0H 5C5NA 4FUJA 1AU8A 4ISIH 1XX9A 4X2WA 5HMAA 3MTYA 2QXIA 2G8TA 1EAXA 1S6HA 4UFGH 1EOJA 1Z8JB 1N6YA 2DE8A 3PM3A 4D7FA 3OYPA 4XRNA 3U8RH 5A0AE 1JMOH 3RC4A 3O8DA 1IQLA 3EE0B 4I32A 3LOXA 3A82A 3RXBA 4B2AA 1OOKB 1C2EA 3SI3H 1SQTA 4XBCA 3M36A 4DGJA 1ANEA 1FMGA 3RU4D 1J15A 2WHXA 3ZZ7A 1UVSH 1V2OT 2VIVA 1KYNA 1LPZB 1KIGH 3HK3B 3ZZ9A 1ELBA 1UTQA 1KMHB 3MNBA 3AAUA 1D3TB 1C5UA 3GCHB 3BG4C 1O3FA 3UTUH 4OS4A 2TPIZ 4U01A 1VCPA 1MCTA 2QAAA 4IS5A 3PV4A 2SFAA 4XOJA 3M5LA 2BB4A 1T8MA 2D26C 4CR5A 1O2OA 1QBNA 3TITA 4Y6DA 2VH6A 2ZCKP 1W3CA 5C67A 2BD5A 4I31A 3K6YA 1TRNA 2AMPA 4K2YA 2RFKC 1RTLA 2SGQE 2Z6BD 2FOBA 2G51A 4CREA 1Z8GA 1C5QA 1HV7A 4FUGA 2BDYA 1SGRE 2NU3E 3BTDE 1BJUA 2JH0D 4FUIA 2J98A 2FESH 1J8AA 3GY7A 3C27B 1MTUA 2BOKA 2Z9LA 2ZU3A 3OE7D 1GBCA 1O30A 1C2LA 1A3BH 2BD7A 2XCFA 3OAAD 2PTNA 3ODDA 2FP7B 2HVXA 2EY4C 1C5VA 3DFLA 5FL7D 1LVBA 3UUZA 1HB0B 2PGBB 3S0NA 2W26A 1N8OB 1BRCE 2ULLA 5FPTA 1BTPA 3QK1A 2GX4A 3ZZ5A 3LH3A 1IAUA 3M5MA 1EXFA 2BY5X 4B6FA 1SQOA 1UTPA 3SUEA 1A4WH 2HGTH 2XNIA 1DLEA 2EI8A 1NRSH 3AW1A 3ENSB 4X2VA 2J98B 4OS1A 1MKXH 1ESBA 3QZQA 3UNQA 4ISLA 3UPEA 1IQJA 1ZSLA 3BTGE 1QJ7B 2FWWA 2OC8A 5JPMH 3L33A 1O2WA 1ZMLA 4Q63A 1OHHD 1TX7A 1PPBH 1FAKH 3D23A 2GZ7A 2W6JD 2D2DA 2ZU2A 1DICA 2CN0H 1GWAA 5DJ7A 1G37A 4BXSA 3SU6A 3VB6A 4Y0ZE 1PPCE 3VEQB 2IN2A 3RXJA 1C2JA 1C1MA 4NFFA 4AOQA 3UOPA 2K1QA 4GLYA 2TRMA 3P92A 2JETC 1HCGA 1ZJDA 1WQSA 1NTPA 3ATIA 1FIWA 5GWZA 1TNIA 1OWJA 5EW1H 1LHFH 1J9CH 4ACBA 3B8JA 1IOEA 4BAHB 2Q1JA 4XSKU 1FLEE 4JYTA 1M9UA 2ANMH 3V7TA 5J4QA 1WV7H 1TX8A 2J9NA 1P8VC 1H9HE 4FUBA 4GSOA 3STJA 3RLYH 4GHQA 1G32B 3F2FA 3FFGA 4YTAA 2P3UB 5HM2A 1LVMA 3LJOA 3T62A 4AYYB 1AKSA 2J38A 2ZU5A 1P03A 3CENA 3BEIB 2RA0A 1SPJA 5GCHF 1TPPA 2GD4B 1C5TA 2FI5E 2F83A 2AERH 1S6FA 3FVFB 1JXPA 1BRUP 4ZKOU 2A5KA 1WBGB 1GVKB 1W10U 1GBLA 2B7DH 1C5RA 1S6LA 3GCTG 1H8HD 3SN8A 1CA8B 2JJ2D 3KQEA 3LIWA 2KR7A 3G01A 4ABDA 1CVWH 2F91A 3WY8A 7KMEH 2BVSH 4A1XA 2TGTA 1C9PA 2CJIA 3NKKA 1C2IA 4AFQA 1SVPA 1WTHD 2IJOB 5EGMA 5KEDA 2PUQH 1Y3XA 2BY6X 1V2UT 1Z8IB 4IGDA 1EAUA 1EAWA 4ASUD 2QN5T 3DUXH 3EA9A 3M61U 1LVYA 1WXRA 1ZTJA 2GCHG 4JZ1A 2GCTB 2F9BH 4O3UA 2OK5A 5GJ4B 2A31A 4ZHMU 3PLKA 1TPAE 3QWCH 2BD9A 5E2PA 1CT0E 3E0NB 4RKOB 1O39A 4B2CA 4R0IA 2FTMA 4MPUA 1K9OE 1GDQA 5EXMA 4MNYA 4HTCH 5FBEA 1YPKH 4ZMAH 5JBCS 2A4GA 3KF2A 1SKYE 2HNTC 3KCGH 1Z6EA 1SLWB 1ZJKA 2G00A 5HGGA 1CGIE 3RM2H 3SYJA 1BBRE 1GMHF 5JBBS 1FV9A 1GMCG 3TNTA 5T3HA 4O03A 2R3UA 2YMSC 3ATMA 2C8YB 2UWLA 2VVVA 2XRCA 2OC7A 2FI4E 1Z1JA 3SJOA 1YBWA 1MKWK 4XFQA 1TOCB 1ZSKA 4IN2A 3DD2H 2VINA 2CMYA 2O8WA 2J94A 1INCA 2PP6A 3BEUA 3KL6A 1C1UH 2A7HA 2BOHB 2NU2E 2GCHF 1EFRD 3GOVB 3P8OA 3RXOA 1K1NA 3SV8A 4CRAA 2CXVA 1ZLRA 4YOGA 2FOHA 3F2HA 4D76A 2VIOA 3N99A 3PMBB 5F6MA 5PTPA 1A61H 2P59A 1QHRB 9ESTA 2ZI2H 3K6ZA 2ZQ1A 3BV9B 3M3TA 2DUCA 1V2VT 1EUFA 2SGAA 3RXSA 1YM0A 8ESTE 3TH4H 2BZ6H 1C1OA 1K22H 1QNJA 5GPIB 5B6LA 1GJ7B 1QRZA 1WYKA 1EP6A 3PLPA 1UHBB 1MH0A 3TJUA 1Z6JH 4Y76A 1GHBG 1DUEA 3H5CB 1TRMA 3LDXH 4MPXA 1SFQB 1WQVH 2OC1A 3E91A 2FOFA 4H42U 4E05H 2VVUA 2VH0A 2BDBA 3MWIU 2NU4E 2EEKA 3U69H 4R8TB 3ZV9A 3EGKH 1GCTB 3MOCA 1ESAA 3UAIC 5E2OA 2FI3E 4B74A 3OSYA 2ZCLP 3L6PA 1YLCA 5GIBA 1C4U2 5K7RA 1DWCH 2KCAA 3MU0A 1FNIA 1D6WA 3V0XA 2KM0A 4SGAE 5EQRA 2O8MA 1HJAB 2D8WA 1MD8A 2BHGA 1BQYA 1LHGH 3GY5A 3QDZB 1IQMA 1Y5UT 1B0FA 1MZAA 4KTSA 1UK2A 1RTFB 3A7YA 2L6OA 2ZGHA 3ATWA 2M2AA 1A46H 1V2TT 3BTKE 1P0SH 1Z1IA 4OGYA 4ZH8A 1BJVA 4FOUC 5DP6A 1CO7E 3GDUA 3BIUH 1TIOA 1BRAA 5KGOA 3VGCB 1P2IA 1FN8A 3WWFA 1SC8U 2H9TH 1BRBE 3IWMA 1K1MA 1GMCF 1AO5A 3URCA 3KGPA 4ISHH 5B6OA 1TA2A 2BDAA 2Y7ZA 2CHAB 1DVAH 2J5UA 4O97A 1RIWB 2LNCA 1AIXH 3E8LA 2FMJA 2AH4X 1VJ9U 5FCRA 1OS8A 3A7VA 1CHOG 1CSOE 2CF9H 1RJXB 1DPOA 3RU4E 1TA6A 3SO3A 5C2ZA 5JBAS 1C5PA 1V2PT 3H7TA 1L4DA 5IK2D 5E8EH 2GP9B 2WZQA 1YPLH 5FPSA 1VR1H 1LKAA 2AGGX 3MH5A 2PTCE 1BTZA 1ZHRA 1TNJA 1P09A 5EQQA 2PHBA 3N7DA 1O2PA 1HXEH 5G4BA 1O3EA 1O5GH 1QB1A 2W6ID
chains in the Genus database with same CATH topology
4X1QU 2AYWA 5CHAB 1AVWA 3BEFB 1HLTH 1NRRH 1A7SA 4IC6A 1W0YH 1JRTA 3S9BA 1NN6A 3A8BA 1EZUC 2Q6DA 1YPHC 2XWAA 4AFSA 2UWOA 1OX1A 1NESE 3RU4T 2AMDA 1DUAA 2ZHFH 2A0QB 1ANCA 1XUFA 3HK6B 3E6PH 3BTEE 4OS6A 1OWHA 1TQ0B 4LK4A 1KXBA 2P8OC 1HDTH 1BCUH 1CGHA 3VXFH 1VJAU 1GJ4H 4KTCA 1TMTH 2A1DB 4H6SB 1TNHA 1P9UA 4X6NA 1D6RA 1EOLA 3ZZ8A 1SLXB 1FN6A 2PKAB 3ZVCA 1YPJH 2I6SA 1A3EH 1ZHMA 1GHVH 1LCYA 2VIQA 3AVZA 3B23B 3DA9B 1O2HA 4ISOA 2WPIS 1O3JA 2SGFE 4ISNA 2FS8A 1Z7KA 2ZIQH 3VB4A 5A09A 1UHBA 1ELCA 3KN2A 3SGAE 5EPNA 2ZQ2A 1EZXC 1LKBA 4CHAB 1W8BH 1W7XH 3N7OA 3V13A 3LKWA 3RMMH 2ASUB 4JZIA 1GVLA 1IHSH 3FZDA 2R9PA 1AKSB 2B0FA 1BMLA 1UTMA 1O3LA 4UONA 3A80A 1NFWA 1O3AA 3LGIA 2AIQA 4GPGA 1AQ7A 2R2WU 4LZ4B 4GVUA 1T4UH 1GHAG 3K9XB 4Q7XA 1O2QA 4XBDA 5DPAA 1W0ZU 2WUCA 4ABAA 3URDA 4YM9A 1P02A 3OX7U 4GCHF 1YP9A 3FP6E 4RSPA 4WMEA 2BDHA 1SFIA 1KSNA 3QGJA 2C90B 2R3YA 1ELFA 4B75A 3RXGA 5EQSA 3ZV8A 4KKDA 3GDSA 1VCQA 2A45B 1KXCA 3TU7H 3EDXB 4UD9H 3E1XB 2Z3EA 3MH6A 2WPLS 3RXIA 2CV3A 3U1IB 3W94A 4TPIZ 1W14U 2H9HA 4ABBA 2BD4A 3SUGA 3MNXA 1NS3A 3PO1C 1JIRA 1K1IA 5DKMA 4I8HA 4NIXA 2AIPA 1C5XB 4CRDA 1TGCA 3T27A 1C5NH 3KQCA 4J1YA 3MH4A 1TLDA 1TFXA 2A7JA 4B73A 1ZPBA 2DE9A 3JZ1B 3H7OA 1ELAA 2FOAA 1Y59T 2ZDVH 4IMQA 1TYNA 2A7CA 3RXVA 2PSYA 1YC0A 1LQDB 1ARCA 1UTLM 2BDGA 4INHA 2G4UA 2GCTC 4NSVA 1EATA 1TX6A 4Q80A 4ZXYH 2XBXA 2J92A 1IQEA 3FZZA 4UFEH 4E7NA 3M3VA 4YESB 1C1WH 3T25A 2ZZUH 1UVOA 1OYTH 4A5TS 5ESTE 1D4PB 3SV7A 1NU9A 1OP2A 2C4FH 1QGFA 3A7WA 4K60A 4Q2KA 3W95A 5DP3A 2RDLA 1O2UA 1RD3B 1NFUA 1GHBF 2R2MB 1HYLA 4OGXA 3MFJA 1HAIH 4AG1A 2BVXH 4I7YH 2ZGJA 1QL8A 3HKJB 2FX6A 2VIWA 1NRPH 2UUKB 1MU6B 1AI8H 4INLA 4BAMB 5F8ZA 2BLOA 3TJNA 1SB1H 1P2OA 1SBWA 1YF4A 4MPVA 1AUJA 5FPYA 1HIAA 1ZPZA 3BSQA 4A6LA 5FXLA 5LH8A 4FUFA 2ANKH 5TCCA 2J2UA 3D62A 3SGBE 2VGCB 4BNRA 1C2KA 3ZZ6A 4MVNA 3TK5A 1G2LA 1UCYE 4WF8A 1YCPM 3TJVA 1UTKA 4NIYA 3MI4A 3VFEA 2QC2A 2QV1A 1EPTC 3F9GA 3MO3A 4B2BA 5DP4A 1FPHH 1C4Y2 1O3KA 4X6PA 2Z3DA 1DS2E 1TGNA 3SU4A 1KXAA 1DY8A 2ODPA 1BHXF 1NC6A 1MQ6A 2BLVA 1CT2E 1HJAC 4CR9A 1SGCA 5DP9A 4MQAA 4DIHH 2H1UA 4GCHG 1P9SA 2ZEBA 1YLDA 4D9RA 2TGDA 2Z9KA 1GPZA 2OTVA 3FP7E 4WWYA 1N8OC 1EB1H 6ESTA 1RFNA 3OY6U 3Q76A 5L30H 1TBZH 2C8WB 3JZ2B 4Z0KA 4UEHH 1D3PB 3B9FH 1C2HA 3RMOH 1Y3YA 4DURA 2XCNA 1WOFA 2CHAC 2PR3A 3SQHE 2ZFTA 3GCNA 5JBTA 1DX5M 1H4WA 2VWNA 1QJ6B 1UK4A 1AD8H 1AZZA 1O32A 4FU7A 1F5KU 3MYWA 3M3SA 3NPSA 2F9OA 4UE7H 3MH7A 2ZGXH 6GCHF 4K1SA 3A8DA 4FVDA 1GJAB 3EQ0H 2SNWA 1QFKH 1LPGB 2HLCA 1NFYA 1AB9B 4NWKA 1BBRK 3TGIE 4TWYA 1MBQA 2G5NA 4BAKB 1N6XA 3RXCA 3Q00A 3EA7A 5EXNA 2Y5FA 1O31A 3SV2H 1U6QA 3BN9A 4JK6A 3TK6A 2W5EA 2Q6FA 1V2ST 1JWTA 3SJ9A 2ZDAH 1BTYA 3M7TA 3VB5A 1LMWB 4KTUA 2AS9A 1O3NA 1TPSA 2VGCC 5FHTA 1CBWB 2F9VA 3QTVH 4DG4A 1OKXA 1GMDG 1FY5A 3CS7A 3U8TH 3M7UA 3UOUA 5CE1A 5DO4H 2EI7A 1O5FH 1MZDA 5AFYH 4X1RU 1G9IE 1V3XA 3TK9A 3VPKA 1FQ3A 1CT4E 1LQEA 1TWXB 1XMNB 3NWUA 1AE8H 4JYUH 1SL3A 5ETXA 1OWEA 1AN1E 1DWBH 5GCHG 1FIZA 3BG8A 1SGEE 1Y5BT 5C1XA 1F0RA 2BZAA 1GG6C 2G5VA 3KIDU 2JH6D 5H4IB 4X0WU 1RTKA 1O2KA 1QTFA 1TNKA 2PSXA 4WXIA 2ZA5A 3TVJB 2P94A 4D9QA 5DP8A 2PUXB 3D49H 4CBOA 2BQ6B 2BXTH 1C5WB 3SORA 3Q3YA 2ZHEH 1ID5H 5FX6A 2XW9A 3GYMA 1QBOA 2PGQB 1GJ5H 3GY8A 1H8IH 4F4OC 1EQ9A 1F0SA 3MHWU 1O2YA 4WMFA 4MG3A 3LH1A 1GBIA 3QN7A 1T8LA 3RMLH 5IDKA 3ZZAA 4TY6A 3RXEA 1KXDA 2QCYA 4FUEA 4IW4E 4ZKRU 3BTQE 2VU8E 1NZQH 2F9UA 1BZXE 1VITG 5L2YH 4Q7ZA 1OWDA 1GGDB 3I78A 5DGJA 1O5EH 3TGKE 2XC4A 1S0RA 4YZUA 4CRCA 1UMAH 3UWJH 3T28A 1GBEA 1ETSH 4K1EA 1Q2WA 4H6TA 1FJSA 1G3BA 3SNDA 4E7RG 1PPHE 1ZHPA 4BANB 1K1LA 2HNTF 3TH2H 1RRKA 2BDIA 1P12E 1JBUH 1UVUH 2C93B 1GJ8B 4NIWA 1O37A 1GMDF 2TGPZ 1ZMJA 3UY9A 1O3GA 2P93A 1XVMA 3A89A 1F0TA 1O0DH 2HWLB 2ZHQH 3QTOH 1UK3A 1MQ5A 3NK8A 3SQEE 1HAXB 1P3EA 2FTLE 5CMXH 4X1SU 1IQGA 1P10A 4WH8A 1QQ4A 2ANWA 2Z94A 1KLJH 4DW2U 1XUGA 2QYIA 3RXUA 1NRNH 1Z8RA 3GDVA 2QY0B 1O3DA 2PKSB 1HXFH 1ZRKA 2FM2A 4KELA 1O2TA 3RXFA 5JB9S 4K8YA 2AGIX 1D9IA 2WYJA 4PROA 1DE7H 2FDAA 1ABJH 2IOTA 3BF6H 1P3CA 1QJ1B 1PPFE 4FUCA 1FDPA 2GGVB 2ZU4A 1QURH 2P3TB 5DP7A 1Y8TA 3A88A 1A0LA 3AAVA 3P8NA 1IQIA 3SNBA 1BMAA 1HUTH 4KP0A 4NSYA 2YNBA 2SGPE 1DSUA 1W2KH 2WINI 2RCEA 2BTCE 4K1TA 3SNEA 4D7GA 3UR9A 1EZQA 2C8ZB 1HBTH 3KNXA 3ZZDA 1C5SA 4ABIA 1LHCH 8GCHG 2JETB 3HATH 1PPZA 2BY9X 1MTWA 1GBKA 2UUJB 4JMYA 4TWWA 2ILNA 2Z9JA 1TNLA 1GJCB 1C2MA 2J34A 1UJ1A 2ZHWH 1O2MA 6CHAC 2STBE 3RMNH 3MO6A 3TGJE 5GDSH 2VWMA 5BRRE 1V2MT 2UWPA 1HAYB 1TB6H 2VVCA 3RM0H 3RC6A 1SGFG 3UIRA 2YOLA 1BHXB 5DG6A 4LZ1H 1GI2A 1GI4A 1W12U 2TIOA 3NZIA 4Y8ZA 4BXWA 1YGCH 1BT7A 1RIWC 1O5CB 2B8OH 1GL0E 1ZOMA 5A8XA 4BTIB 2GMTC 4MNVA 2BXUH 5E0JA 1GL1A 3A83A 5L6NH 1YYY1 2FOMB 1HFDA 3R0FA 1D3QB 1DLKB 4NA8A 4YT6H 1YPEH 4AFZA 3S69A 4BTUB 2P3FH 3SV6A 2HALA 3SV9A 4AZ2B 2Y5GA 5DP5A 1SGDE 1OXGA 2EA3A 1QY6A 2THFB 2PKAA 2FO9A 3QLPH 1BUIA 1P05A 1G3EA 4O3TA 1C1VH 3LGVA 5FBIA 4D8NA 2ZFSA 2GDEH 3ELAH 1GVZA 1H9IE 1HIAB 4SGBE 1HNEE 5EU8A 2ZDKA 5HYOA 1MKXK 1L4ZA 1XXDA 3KQBA 4OS5A 9LPRA 4LXBH 1ELTA 5CHAC 3A8CA 1HPGA 1ZSJA 1GDUA 1PPEE 1FONA 3UNRA 3O8BA 2XWBI 1T8OA 1GI1A 3S9CA 3SHCH 3QO6A 4RKJB 3SJIA 1A5IA 4Y7BA 3ZZ3A 2ZNKH 1BDAA 1QR3E 1B5GH 4QT8C 1MD7A 3M37A 2ZHDA 1ARBA 1JOUB 4Y8YA 2QF0A 4O9VA 1AUTC 4ABEA 2M5TA 1P04A 1F92A 1T7CA 1GBAA 1C2DA 1TGSZ 2HPPH 1X7AC 1AY6H 1A1RA 1PQ5A 2WPHS 1C9TA 3PMAB 3LC5A 1S85A 5HM9A 4K5ZA 2G55A 1NO9H 1P2JA 2ZFQH 5TCAA 2CGAA 2OCVB 2O8TA 2BLQA 4X8TH 3EYDA 3KEEA 4AG2A 2FOGA 1HRTH 2ZDNA 2BMGB 1KY9A 2EI6A 2W3KA 4OS2A 4Y0YE 5A8ZA 3QGNB 2C3SA 2ZU1A 3NUMA 2VNTA 1FI8A 3VB7A 2WPKS 1O3PB 1XUHA 1N1LA 2AEIH 1F2SE 1JIMA 3T2NA 1ZYOA 4ZKSU 2H5DA 4HI3A 1L0ZA 3S7KB 1K1PA 3ZYDA 1WSSH 4H4FA 3SGQE 1K21H 4XDEA 2KAIB 5E0GA 2ZP0H 3BG4B 1CBWC 1AFQB 5GXPA 1LTOA 2LPRA 3LC3A 3HKIB 5BPEA 3F9FA 2BM2A 1RS0A 1CA0C 4Z6AH 3MNSA 1YKTA 2VWLA 1AZ8A 3GCOA 1FY3A 1ANBA 2AFQB 2OBOA 2QXJA 1J14A 1P06A 1SG8B 2RA3A 1P2QA 2H5CA 3SZNA 1E36B 4U30A 5ESBA 4DJZB 1GCTC 1S81A 5TJXA 2A4OA 3AASA 1UO6A 4X8VH 3RXTA 2STAE 2YNAA 1TOMH 3ATKA 3LU9B 1C1NA 1A5GH 1E37B 2KAIA 4DY7B 3KQDA 2Y82A 2BLWA 5L2ZH 3F9EA 4WY3A 1E34B 2F3CE 2ZWLH 5C5OA 2CF8H 2ZC9H 4ESTE 4IN1A 1DFPA 1H8DH 4A1VA 1F0UA 1BMMH 1FZZA 3L3TA 1PQ8A 2H9EH 2O8UA 1NFXA 5FX5A 1DXPA 3U98H 2NU0E 4CBNA 5EODA 1UTNA 3MU1A 1SLVB 1TGBA 2VIPA 3U1JB 4IBLH 1Y3VA 4CH8B 4GUXA 1JRSA 3GYLB 3MU4A 3PLBA 4Y10E 4YOJA 1P2KA 2BDCA 2GT8A 1HAPH 1CGJE 1QA0A 3RC5A 3UWIA 3E0PB 4E06H 1E38B 2A5AA 2BQ7B 3EA8A 5EW2H 2ANYA 1LHEH 4JYVH 1BITA 1EJMA 2Z9IA 1ACBE 2PW8H 3ATLA 1FY1A 1XXFA 4BAOB 3A81A 4ASHA 3BTTE 3LPRA 1O2IA 2PLXA 1BTXA 1GBDA 4WMDA 4MPWA 2V0BA 1F5LA 3VB3A 1O3IA 2ZDMA 2HRVA 1QBVH 4JZFH 3RP2A 1XKBC 3I77A 3SBKA 5K0HA 3SI4H 3DFJA 2XBVA 1V2RT 5C3NA 1TGTA 1FAXA 2W7UA 1C5ZB 2W7SA 1XM1A 1EASA 2ZECA 2ZTYA 3U9AH 4DVAU 2ZPRA 3Q3XA 1ELGA 4AN7A 2GTBA 3FP8E 3QUMP 4TYDA 2FOCA 4INKA 4JZDH 5AF9H 3PWBA 1AFQC 2PKSC 4Y7AA 3GY4A 1SQAA 7GCHG 1V6DA 3RXMA 1CA0B 3SJKA 2Z7FE 1YCPH 2FODA 3SW2B 1Y3UA 2J4IA 5IYTA 3ZZ4A 2ZPSA 4ABGA 2AGEX 1MBMA 2V35A 3IG6B 3GY6A 1O3CA 2ODQA 3E3TA 3BTFE 5AHGH 5LPRA 3RXLA 3CS0A 2VB0A 5EOKA 3A87A 1GBTA 1TABE 3Q77A 1BOQA 1MCVA 1O2JA 2NWNA 5F8XA 4MNWA 3UQOA 5LPFA 2Y80A 1ANDA 1P57B 1BIOA 4DOQA 4X2YA 4TPYA 4A1TA 4Q7YA 1O2LA 2GZ9A 4JZEH 1S83A 1V2WT 5AVDA 1ZMNA 3MNCA 1C5YB 2GZ8A 3NCLA 3QZRA 3SU1A 3ZVAA 8LPRA 1V2LT 1SOZA 4IMZA 1H9LB 6GCHG 2V3HH 2SGDE 4M7GA 4NA7A 3DHKH 3LGYA 2NU1E 2BQWB 4CRBA 1ETRH 4MTBA 5AFZH 5T6FA 2XBYA 1RGQA 3E90B 1V2JT 4KGAA 2G81E 2R0LA 2B5TB 2O9QA 1K28D 1NM6A 1UTJA 4ZROA 1DXWA 1BB0B 1ZPCA 1CE5A 4I8KA 1MKWH 5A0CA 1C1QA 2GMTB 3TH3H 1FXYA 7LPRA 3P17H 3RXPA 5JYIA 1MTVA 1QQUA 2BX4A 1WTGH 5E0HA 1C5LH 1VGCB 3OY5U 4NZQA 1O3HA 2FEQH 1EX3A 3A85A 3M35A 1LVOA 2XC5A 4AYVB 4X1PU 3D65E 1GI3A 2F9NA 1NRQH 3RLWH 3TIUA 1BTHH 2FIRH 1KXFA 3SU2A 2G4TA 1G30B 3GISB 1HJ9A 5I46H 2ZTXA 3ZVGA 2ODYB 1G3DA 1A0HB 1AVXA 2QXHA 1EJNA 1GJBB 3F1SB 4CHAC 2A4QA 4XBBA 3U8OH 1MAYA 2A32A 2A5IA 2Y81A 4FU8A 3LGUA 4JK5A <