1GBEA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase (serine proteinase)
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbeA01
5E0GA 3CS7A 2BY8X 2C8WB 2BMGB 2O8TA 2Z3EA 4CR9A 3IITA 2SNWA 3ZZ7A 3LU9B 3D62A 1CQQA 3K65B 1DLKB 1DVAH 1B5GH 1IQGA 2CF9H 1TNGA 3RMOH 1PJPA 1C2DA 4Y7BA 3FZDA 3NPSA 2AS9A 2ZWLH 1C5YB 1E0FD 1UVOA 3C1KA 1A1RA 2Q6DA 4ZKRU 1AUJA 1C2LA 1RGQA 2A4QA 1IAUA 4ZHAA 4WY3A 2H9HA 2B5TB 1THPB 1C2FA 2IN2A 3RMMH 2GVFA 1MAYA 3GCTG 1GVZA 2OINA 2G8TA 3K9XB 2F3CE 1A4WH 1GJ6A 5T6DA 1UVTH 1Z7KA 1XMNB 2P59A 2EI7A 2GMTC 2Z9GA 3MO3A 3JZ1B 3MU5A 4YO9A 3QTOH 5JBAS 4ABHA 2BY6X 1FN8A 1K1LA 1O2PA 4D7GA 2XC0A 4UFGH 5FAHA 4I32A 3GY6A 3O8DA 1GMHG 1HRTH 5TCCA 1WSSH 1UHBA 2EI6A 8LPRA 1Q2WA 1AVWA 1H9IE 1MQ5A 4GCHF 1BZXE 4UFFH 5CHAB 4ISHH 1GI7B 2LPRA 4BTUB 1Q3XA 1IQNA 4DURA 1DSUA 1D3DB 3TH2H 1D4PB 1HBTH 1GMDG 1K22H 1AD8H 4LZ1H 1VCQA 1ZPZA 4GPGA 2BDAA 1AZ8A 2FYRA 1IQHA 1CT4E 1FPHH 1RS0A 1JIMA 3QTVH 1DFPA 1VJAU 1BIOA 1ELAA 4YOIA 1KYNA 4HZHA 4ISIH 1QJ7B 4E06H 4HFPB 1O2LA 3V13A 1TOCB 4MPVA 5ABWA 3QX5H 2FI3E 3TPIZ 4E05H 2KAIA 3LKWA 1GI6A 1ABIH 3RXKA 1GHWH 3IG6B 2G51A 3A89A 1D9IA 2A2QH 3BG4B 2AH4X 2BD2A 3ATWA 2CV3A 1GL0E 2P8OC 3TK9A 2J34A 1FY8E 3LGYA 1PQ8A 1SGYE 3M61U 1XUHA 5E8EH 4TPIZ 3P8NA 5A0CA 1NC6A 2W3IA 1AB9B 1EB1H 4X1SU 1AUTC 1ZHPA 1KY9A 3RP2A 1JIRA 1QB6A 1O3KA 4NZQA 3Q77A 2GV6A 2ZDVH 3RXLA 4MNVA 1AI8H 1UTOA 3UTUH 4KTUA 3MU0A 2F9VA 1NN6A 3RXUA 1ELFA 2BD8A 5GWZA 4QT8C 2A5IA 1QY6A 1EP5A 2XYAA 3F68H 1OPHB 3MOCA 1GMCG 3SGQE 1W0ZU 2A32A 1GHZA 3AAVA 1YPHC 5A09A 1C5VA 3RXSA 1TMUH 2ZFRH 7GCHF 4A5TS 3E1XB 1GHVH 3KGPA 5JB8S 3TJUA 3UNSA 1Z1JA 3TH4H 2VWLA 3GYMA 1SLVB 2VWMA 3A80A 4Q7YA 3BTDE 1YPLH 5FCRA 4WMEA 3RXRA 3HGNA 2OBQA 1AE8H 1DY9A 3OY6U 3PMBB 1ZTKA 2AGGX 1F0TA 1V2KT 1YPJH 2IOTA 4U2WA 1AIXH 2UUJB 1O36A 1O35A 2OBOA 1HAZB 2H2ZA 2BXTH 3KQBA 4WWYA 3GCHC 2Q6GA 3UWJH 3A7WA 1OWHA 2HNTF 5FPSA 1LKAA 2GDDA 4Y8ZA 1XUGA 1YP9A 1W12U 1ZOMA 4BXSA 1BRCE 3TU7H 3ZVEA 3Q76A 3DUXH 4NIVA 4FUCA 2J9NA 4JK5A 1KLIH 6GCHG 3SHAH 2R2MB 3RDZA 2GZ8A 2HALA 1MU8B 5DP5A 3A8AA 1G3BA 1GI9B 2QV1A 3ATIA 5C5OA 1P01A 4KP0A 1L4ZA 1ORFA 2FOBA 1DS2E 1QFKH 2ANKH 3GCTF 1C2KA 3GY4A 2UWOA 3A83A 3NWUA 1C5LH 1E34B 4JZ1A 1TIOA 2ANMH 4I8GA 1AO5A 2BXUH 1TQ0B 3RXIA 2ODQA 4WXIA 1EZUC 2ZDKA 4Y0YE 3U69H 4K3JA 2BVSH 1U6QA 1DE7H 1V2UT 9LPRA 2C8ZB 1O2UA 1NRPH 1V2NT 2FOFA 2FZZA 2J2UA 4B71A 1GMHF 4CBOA 1MKXK 2V3HH 3EA7A 4XBDA 1Y3UA 4TYDA 1C5NH 1ESAA 3SU6A 3A87A 1BT7A 1QQ4A 4UD9H 1QB1A 2FTMA 4XFQA 1OWKA 4Y10E 3PO1B 1GMDF 2ZQ1A 1SQAA 2VJ1A 1EZQA 5GJ4B 2AGEX 1FAKH 1VR1H 1QJ6B 4YT7H 1OWIA 3S7HB 4O97A 4DY7B 4K8BA 2RDLA 4Q2KA 1FNIA 3SU3A 1OX1A 3QUMP 1HJ9A 4NFEA 4I7YH 1NS3A 1SGIB 2WYJA 1MKWH 1ESBA 2P95A 2J95A 1N1LA 4FUEA 1SQOA 1C5TA 2PV9B 2H9TH 5T6FA 4AGKA 4AX9H 1IHTH 4NGAH 1O2WA 3SW2B 2Q6FA 1WV7H 3GY8A 3E90B 1LKBA 4WH6A 1GBHA 4X2YA 2BOKA 3AVZA 1GDQA 2Y5GA 2FI4E 3A81A 1ESTA 5JBBS 5C5NA 3SU4A 1O2TA 1SHYA 1BOQA 2ZU3A 1S0QA 4I31A 2F9NA 2RA0A 1MH0A 4YLUA 1FI8A 2XXLA 1O3AA 1A3EH 1QRXA 1G9IE 1W7XH 3RLWH 4WH8A 1QA7A 2A4GA 2UWLA 1O5BB 1TB6H 1GMCF 1NFYA 2A5KA 3MMGA 1ARBA 1O2ZA 1G2LA 4JZFH 5A8XA 1KTTB 1P11E 1T8OA 1WTGH 2THFB 1IQKA 3EAJA 1MCVA 1UCYE 4E7NA 5HGGA 1C4V2 3S9BA 1GJCB 2W3KA 1HV7A 4ABFA 3ZV8A 1DY8A 1WQSA 3QO6A 1G32B 1JBUH 2PGBB 1AHTH 2ZGJA 3BTGE 3PLKA 4GHQA 2FOHA 2GCTB 1KXCA 2O9QA 1XUIA 2EEKA 1CSOE 4NIWA 4KKDA 1YF4A 3FAOA 3E16B 1CVWH 1H1BA 2R3YA 4CH8B 2CHAB 1HAIH 3SJIA 1SOTA 4DW2U 3SGAE 4MNWA 2PKSC 3ZZ9A 5F8XA 1GBDA 2ZU1A 1CO7E 1EAUA 2WUBA 1TNLA 3SV7A 1G36A 3M5NA 1UCYK 2BD5A 1CGHA 1RTLA 1SGRE 2XCNA 1RJXB 2TBSA 1V2JT 5FCKA 6GCHF 1BHXF 2BDIA 2YOLA 1BBRH 1OYQA 5G4BA 2Y7XA 3Q3YA 1O5CB 2SGPE 1OKXA 1DSTA 1F0SA 3MNSA 3ZVCA 1Q31A 1K2I1 4FU8A 6LPRA 1S6FA 4K60A 2ZFQH 1G2MA 3PMAB 4FUFA 1GBCA 2VU8E 2ODYB 1H9LB 1KLTA 2QCYA 2BD4A 2P3UB 2OC0A 4A92A 1P2NA 3B9FH 1XKAC 3FFGA 1UTJA 3BEUA 3MI4A 1BMNH 1H8IH 2SGEE 4NIYA 3GDSA 2XW9A 1HLTH 1EKBB 3GICB 5EQQA 3PB1E 2UUKB 2ANWA 1LHDH 2H9EH 1SSXA 1PFXC 5EODA 1C2JA 3L6PA 5A0AE 2AMQA 4D76A 5EGMA 1ZPCA 3D23A 3P17H 1O3EA 7LPRA 3BG8A 1V2WT 3DT0H 2ALPA 1PYTC 1NFUA 2JETC 4XBBA 1AVGH 3ELAH 3UFAA 1O2KA 1N6XA 2BX4A 2D26C 3C27B 2HPPH 3RXTA 1O3HA 3TK5A 3ZZ5A 1ANDA 3FP7E 3BG4C 1LQDB 1TONA 1DXWA 1XVOA 5HM9A 1SFIA 4NWKA 4TWWA 3E3TA 1TOMH 2ZFSA 4ZAEA 3UY9A 4DJZB 1PPHE 1O3MA 4FUBA 1OSSA 4VGCB 1FPCH 1P2IA 1SGFG 1A61H 1C5RA 3S7KB 4BXWA 2ZI2H 4ZKSU 2PTCE 3MNXA 2Z7FE 1LO6A 1SL3A 3UWIA 1C5ZB 2Y7ZA 2A7HA 3M5LA 1ZGVA 1FUJA 2STBE 3SU1A 1ZTLA 2OC8A 5GPIB 1ANEA 3SZNA 1DWCH 2CJIA 4O03A 1BRUP 3SU2A 3D65E 1HFDA 1C1VH 1XX9A 1ZHRA 1O2SA 1O2OA 3BV9B 1FIZA 4ZMAH 1BTYA 2WPIS 3FZZA 2JKHA 4ZKOU 2VIVA 1C1QA 1XXDA 1TE0A 2GZ7A 1DUAA 5EW1H 1F0RA 3ZV9A 2HPQH 1ELBA 4X8TH 5DK1A 3BF6H 4GHTA 5FXLA 1HJ8A 3BTQE 2VGCC 3VXEH 1K9OE 1C2GA 1VGCB 1CGJE 5L2YH 1ELCA 2FOGA 2OD3B 3OSYA 1LPGB 1ELGA 4OS1A 2Y6TA 3ATLA 1HAPH 4YT6H 1SGDE 3RXCA 1JRTA 3URDA 3UOUA 1ELTA 1F92A 1KXBA 1RIWB 4B1TA 3OU0A 4ZKNU 2ZPSA 1C2IA 1ELVA 2Z3CA 2PFEA 1PPFE 2D1JA 1J15A 2ZHFH 4FVBA 4I33A 1P03A 1QRZA 2BD7A 5C1XA 1V6DA 2R2WU 1HAVA 2AMDA 2QAAA 1BTZA 2H1UA 1C1NA 1YGCH 3TGIE 5JDUB 4ZUHA 2I6QA 4JZEH 2FTLE 4BAHB 2HWLB 1T4UH 3BIVH 1EATA 4Y79A 3A7VA 5L2ZH 1ELDE 1O3OA 1SGEE 1G3DA 2BB4A 3BTME 5FPYA 4AFZA 3MHWU 1TRYA 2AMPA 2EA3A 1GBLA 3M3SA 1DOJA 1IQJA 1O2IA 1B0FA 3UREA 4ZHLU 1KTSB 5FBEA 3T27A 2Q1JA 4NA9H 1SQTA 4UONA 2K1QA 1EP6A 5E0JA 3RXAA 1TYNA 1W2KH 2BD3A 2GV7A 1CHGA 2F83A 1C5SA 1GI0A 1FIWA 1GBJA 1F5LA 1KIGH 3OX7U 3RXFA 3HK3B 1TRMA 3MO6A 4H42U 1DM4B 1HAXB 2WPMS 2ZGCA 1VCWA 3QLPH 3VEQB 2AIQA 1YCPM 2QYIA 3VB6A 2ZIQH 2FODA 2BVXH 3E6PH 4IC5A 3SV2H 1S6HA 3P8OA 3SNEA 5F6MA 2G55A 3PO1C 1EPTB 1EJMA 1J17T 2BDGA 3ZVFA 4B2BA 3DHKH 1WAYB 5A8YA 3LGIA 4Y7AA 1S82A 1MAXA 2BQ7B 5JYIA 2QA9E 1AMHA 1O2HA 1P02A 1EAWA 1YC0A 5H4IB 4X0WU 3P8FA 1GBMA 1P9UA 4DCDA 1FY4A 1N8OC 1JMOH 1XUFA 4Y6DA 4FUHA 4JYVH 2Z9JA 2PW8H 1O2VA 4IS5A 3TIUA 2ALVA 3T25A 2VIOA 1AWFH 4OGXA 3P92A 1V2ST 5GXPA 4CRBA 4ISLA 3VGCB 2ZDLA 3GDUA 2JH5D 1HXFH 1ZSKA 1T8MA 2C8YB 2O8WA 1P0SH 1W0YH 4Z0KA 2GKVE 1V3XA 4BANB 3LT3A 1ELEE 2CF8H 3DFLA 1YPEH 3MU1A 1ZMLA 2GP9B 2WPHS 1HJAC 5PTPA 1GHXH 4ABJA 1G3CA 4CRFA 3STIA 3ATMA 1T7CA 3H7TA 2AYWA 2J94A 3FP8E 2ZQ2A 3BIUH 1YCPH 5LPFA 1AY6H 2XC4A 5DKMA 4RSPA 1MZDA 3KQEA 1C1WH 1K1MA 1L4DA 3TNTA 2BDCA 2ZGBH 2GT7A 1EJAA 1CT2E 2G00A 1TPOA 2OTVA 3SJ8A 3PM3A 1V2VT 2ZDAH 3T5FH 1S83A 3KQDA 1UK3A 4O3UA 3QDZB 4IN1A 1O5AB 1S81A 1UHBB 4TY7A 4B76A 3SORA 1BHXB 1EASA 3RXGA 3SI3H 1F5KU 3P70B 4NCYA 1EJNA 3DA9B 1K1JA 1BDAA 1QBOA 3VB5A 5SGAE 2BM2A 1TALA 4CHAB 4YOGA 4YESB 4NA8A 1BBRE 1T8LA 1WCZA 1EOJA 3PLPA 1ZSJA 1TNJA 1DX5M 2TGTA 1NU9A 1SHHB 3UNRA 2FIRH 1C2HA 2JH0D 2OQ5A 1HXEH 2NU1E 5DG6A 3RC4A 2ZCLP 1SGTA 3BTWE 2V3OH 1DT2A 4LXBH 2VWNA 1T8NA 1VITG 2B9LA 2M5TA 1FY5A 2KAIB 2A4RA 2C93B 1Y3XA 1AU8A 2G81E 3TNSA 4D7FA 1QNJA 1SGPE 3M5MA 1ZJDA 4NG9H 4CR5A 1QL7A 1IQEA 1BMAA 1QRWA 3PROA 2GD4B 2ZFPH 5GDSH 4J1YA 1TNIA 1YLCA 3EQ0H 3A82A 1CA0B 3RXOA 4NFFA 5LH8A 4DIHH 2ZC9H 1A5GH 1GBIA 3M35A 5FX5A 3MO9A 1GPZA 4LZ4B 2Z9KA 2BTCE 4BOHA 3K2UA 5EXNA 1GBFA 1PPCE 1J16A 2D2DA 3BTEE 1GVLA 4FU7A 1EZSC 3M7TA 3MNBA 1SI5H 2ZF0H 2JH6D 1O2MA 2PTNA 3F9HA 1UMAH 5BPEA 1KSNA 1FDPA 1MTNC 1S84A 1GHBG 2XNIA 1SB1H 1O38A 3BTHE 1PPZA 3M36A 1UJ1A 5AHGH 3EDXB 2P93A 1P2MA 1XXFA 2ZDMA 1AFQB 1LCYA 1JOUB 1K1IA 1V2PT 1MU6B 2J92A 4OS7A 1AVXA 3LPRA 2OC7A 4I8LA 1O3JA 2P3FH 1O2JA 4A1XA 3A7YA 1P8VC 2NU4E 1QURH 5FHTA 2FDAA 4X6MA 2QN5T 4AFUA 4JZIA 3SOSA 1BITA 1GJ7B 4YOJA 1GGDC 1RRKA 1QBNA 1TGNA 4U32A 5HMAA 3MH7A 4KGAA 1BRBE 2VIQA 3FVFB 1OP8A 1CHOG 4THNH 5TJXA 1C4Y2 1C2EA 1TBRH 2ZU5A 1DLEA 2B0FA 2PLXA 1HAGE 1EXFA 3GY2A 3V3MA 1SFQB 4Y11E 1C5MD 1Y8TA 4CRGA 5J4QA 1V2MT 1C5OH 1O2QA 3LDXH 5DP9A 1C1RA 4UE7H 4ASHA 1NPMA 3A84A 4AGJA 1C1SA 2GDEH 3P8GA 2R0KA 1ZYOA 4IMZA 8KME2 4IGDA 1IQIA 1GI5A 1EAXA 2PR3A 1UTMA 1CE5A 2GMTB 2BLWA 1QR3E 4IMQA 1O37A 2H6MA 1W8BH 2IJOB 3U1JB 4I8HA 2Y5FA 4K2YA 2ZO3H 3GY5A 1GHAG 2STAE 1SLUB 2SGDE 3P6ZB 3F6UH 1HDTH 3H5CB 3SHCH 1QJ1B 1TX8A 1RIWC 5EXMA 1DPOA 4ABDA 1BTHH 5GCHG 1O2RA 3TJOA 1UTKA 2BD9A 2NU0E 4WMDA 1O2GH 3VPKA 2ZTXA 4MG3A 3LC3A 2CXVA 2TGAA 2UWPA 5FX6A 2O8LA 1UTNA 4B2CA 2ZHDA 1O33A 2ANYA 3RXBA 4ABEA 2Z9IA 1VITH 2W26A 2PKAA 2OC1A 3KF2A 2DE8A 2ZEBA 3T26A 1KXAA 1OP2A 1C1OA 2BDBA 1TABE 5K7RA 1P2OA 1Z8RA 3KIDU 3ZZ4A 1H4WA 3UQOA 1NTPA 6ESTA 1MZAA 1NFWA 4U30A 4YTAA 3WY8A 2QGRA 1KXEA 1XKBC 3RLYH 1TWXB 1AKSA 1BJVA 3V0XA 4INLA 4DIIH 3R0FA 1A2CH 2C3SA 1X7AC 1VITF 3BEIB 1WOFA 1HAYB 4HGCA 1G37A 2ZG0H 3RMNH 4XOJA 3LGWA 3URCA 3D49H 4IN2A 3CP7A 2EC9H 4WVPE 1O5GH 3QGJA 5FBIA 1DWBH 3F1SB 1D3PB 2W7SA 2XC5A 2ZFTA 3PYHA 1SC8U 2V35A 2FMJA 3VB4A 1GBTA 3I77A 2WYGA 3S9CA 1C1TA 1C5XB 4ISNA 3QZRA 3KNXA 3E91A 4MDSA 3EA8A 3SJ9A 4X2WA 5T3HA 5A8ZA 4JK6A 5AF9H 4DG4A 1GI8B 5C1YA 1GJ8B 2Z94A 3Q3KA 3LH1A 3DD2H 1GHBF 1NO9H 4SGAE 1L2EA 3VB3A 1NZQH 4B73A 4BAQB 1TX7A 1MTSA 5CHAC 1UK2A 4AZ2B 3BTFE 2YNBA 2ZTYA 4AYVB 3SV6A 2A7CA 1DANH 1N6YA 5EU8A 1KXFA 1TQ7B 3VGCC 4DVAU 2OXSA 2TGDA 4AN7A 1QIXB 1C5PA 3SUFA 3FANA 5AFYH 1WTHD 1D6WA 1GI4A 3MNCA 3KCGH 2FS9A 1F0UA 5LPRA 3W95A 5DGJA 3GISB 1IHSH 2R9PA 3RXJA 2TGPZ 1TMTH 2PHBA 5F03A 2HOBA 1C1MA 2GTBA 1A5HA 2BDHA 2WPKS 2ZCHP 3UR9A 2BOHB 3M7UA 2ODPA 4AORA 1A5IA 1CHOF 2AEIH 5IYTA 3QN7A 1NESE 3SV9A 3TGJE 1BTXA 1BCUH 1YPGH 4OS6A 4D9RA 1MKXH 2ZP0H 1C5QA 4F49A 3U98H 4WF8A 3LH3A 2F9UA 3ATKA 2NU3E 2SNVA 1RD3B 2SGFE 1AB9C 1TA6A 3ZZ3A 1HIAA 1AGJA 1D6RA 1BB0B 1P06A 3RU4T 5L6NH 4JMYA 4B2AA 2FOMB 3N7OA 4TPYA 1GHAF 1FZZA 5DPAA 4ESTE 1V2OT 5L30H 4FXGH 2GZ9A 1FLEE 2Z3DA 3SO3A 4JYUH 2SGAA 3DFJA 1H9HE 3VFEA 1SR5C 3A8CA 2O8MA 2HNTE 3NXPA 2RCEA 1A3BH 5EQRA 1NRNH 1Y59T 5GCHF 1JRSA 1C1UH 3STJA 1GHYH 2FM2A 2VVCA 1LHGH 4CHAC 3HKJB 3RC5A 1V2LT 2RG3A 2TPIZ 1INCA 4BNRA 4B74A 2NU2E 1KDQB 2BLVA 4AG1A 5I25A 1TRNA 2P94A 2OQUA 1EOLA 5CE1A 2AIPA 3PWCA 1DWDH 3GYLB 3GOVB 4MPWA 1W7GH 3T28A 3M5OA 2VIPA 1ZGIA 4BTIB 2QXIA 1XUJA 1QCPA 1NFXA 1OOKB 2WPJS 3AAUA 2VNTA 5DP4A 5A2MH 3SUEA 2FXRA 1PPGE 3F9EA 5BRRE 1VJ9U 4AG2A 1T31A 3HKIB 1NRQH 1SOZA 3MU4A 3RM2H 3KL6A 1WU1A 5E2PA 1BA8B 1GJ5H 1GG6B 2XBWA 1GDUA 3M7QA 4D9QA 1GL1A 2XWBI 1QB9A 3E8LA 3TGKE 3VXFH 1P2QA 2VVUA 2CGAA 3MH6A 1SGCA 5I46H 1A7SA 3I29A 4PROA 2XCFA 1O3CA 1UTPA 4INKA 2FI5E 4X6OA 1C5UA 1OWJA 2PGQB 1A0HB 3NZIA 1E35B 1WYKA 1ZRBA 3ZVBA 2ZFFH 1O3GA 2FLBH 4K69A 4KELA 1ZSLA 1D3QB 4ZXYH 1O31A 1WUNH 2ZU4A 3ENSB 3VB7A 1ID5H 1T32A 4AYYB 4YLQH 1AE5A 4WMFA 1O2YA 3T2NA 1L1NA 1FQ3A 3ZZBA 4MTBA 2XBXA 1TLDA 3BN9A 4TY6A 1AFQC 1O3IA 1NROH 3K6ZA 1P2JA 1TX6A 1ZHMA 3S9AA 4HTCH 2VIWA 1RXPA 3BSQA 1QHRB 2ZGXH 1GJAB 4AFSA 2Y80A 4ZROA 1UCYH 3TJNA 2QIQA 3OYPA 4Y71A 4ABBA 5J4SA 3LJOA 2V0BA 4BAMB 1RFNA 3U8OH 2A1DB 1G30B 4XDEA 3RU4D 2ZNKH 4KTCA 1LHEH 3ODFA 5DP6A 2LNCA 5JBTA 4YZUA 3SBKA 1ZMNA 1J8AA 5DO4H 3RXVA 3E0NB 1QL8A 2H5CA 1O3FA 1AWHB 3L3TA 2CMYA 1F5RA 5C20A 4M7GA 1JWTA 1F7ZA 2PKSB 1P04A 5FPTA 1UVPA 1GJDB 3SQHE 4MNXA 4ZXXH 1TGSZ 2A4OA 1E36B 3SGBE 3TK6A 2BHGA 1CGIE 2VB0A 1HAVB 3LGVA 3RXHA 1LVYA 4X8UH 1L1GA 5C2ZA 1YPMH 4A7IB 1HAHH 1SLXB 2FOAA 2AGIX 4CBNA 3ESTA 4X6PA 4X6NA 3U8RH 1AN1E 4X1NU 2A7JA 1GI2A 1RTKA 2B8OH 3RXMA 2A5AA 4NSYA 2H5DA 2Z9LA 4X2XA 1C1PA 1MKWK 1HNEE 1UVUH 1DDJA 1K1OA 3S69A 2ZCKP 3T62A 3TLOA 3MH4A 5E2OA 1MTVA 5LGOA 2EI8A 5HM2A 1S85A 4NWLA 2ZHQH 1O2NA 1SVPA 2F9PA 1HYLA 1XUKA 4I8KA 3EYDA 1ZRKA 1Z71A 3HGPA 3ODDA 4ZH8A 4UEHH 1LPKB 3A88A 3UOPA 2JETB 4INHA 1PPEE 1NY22 1HUTH 1MQ6A 4F4OC 8GCHG 2HRVA 1ARCA 1TMBH 3A86A 2WV4A 5LPEA 2QXGA 1THSH 2GCTC 2ZKSA 1GCTB 1SG8B 1DITH 4UFDH 1TBQH 3B23B 3GDVA 3R3GB 3UIRA 1SMFE 1K28D 2CHAC 2QXHA 5EPNA 3SJOA 3B8JA 1BMLA 1E38B 4Q7XA 1O34A 1C4U2 1TGBA 2FESH 1HCGA 1GCDA 1KLJH 2ASUB 1Z8JB 4NA7A 3LONA 3RMLH 4GAWA 4CRAA 1W3CA 1K21H 4MLFB 2PUQH 3SU5A 3RC6A 2A2XH 4NIXA 3QGNB 1H8DH 4BTTB 3A7TA 1BJUA 3PWBA 2ZZUH 1GVKB 1W13U 1CBWB 2G5NA 3RXEA 3W94A 2HLCA 2O8UA 4Q7ZA 3ZVAA 1EUFA 3LC5A 1EX3A 3NCLA 2VGCB 4MPUA 5EPYA 3SQEE 3UUZA 3RUOA 2VVVA 5E0HA 1GBEA 3PLBA 1YYY1 5K0HA 2ZHEH 1O3DA 1ACBE 1SGNE 3OTJE 4LK4A 3PMJA 4OGYA 4GUXA 2BQWB 4X1PU 2G4TA 6CHAB 4K1EA 1MTUA 4ZHMU 3AW0A 2FLRH 3SNAA 4BAOB 1BBRK 1YBWA 1S0RA 4Y8XA 5C67A 3MH5A 1YM0A 2BZAA 3LJJA 1QTFA 4XBCA 4XSKU 1GWAA 1KXDA 1AZZA 3EGKH 1ZLRA 1OWDA 4A1VA 2PWXA 3ITIA 3SUGA 4AB9A 4BAKB 4B75A 1P12E 2ZDNA 2A45B 3SNCA 1K1PA 1FY1A 1BTWA 1DICA 4OS2A 1WQVH 4X2VA 4E7RG 4JZDH 1ZJKA 1TNHA 1ZMJA 1P09A 2A0QB 1VZQH 1O5EH 1DXPA 3GY3A 2Y82A 1QL9A 1F2SE 2FYQA 3U1IB 3ZVDA 5C3NA 1P3EA 4AOQA 4VGCC 5AVDA 1TNKA 3MTYA 3G01A 4H6TA 4FUJA 4X8SH 2VWOA 5EQSA 1FXYA 1SPJA 2F9OA 3IWMA 1O32A 1V2RT 2VINA 2FP7B 2J38A 3BTTE 3KEEA 3PTNA 1W14U 1UTLM 1G3EA 1BTPA 1OWEA 1W11U 3MYWA 2C90B 1LHCH 3A7XA 3LIWA 4DGJA 4YM9A 3HPTB 1DWEH 1ETTH 4ABIA 2ZPRA 3TH3H 3O8CA 2BZ6H 3KHVA 1FONA 3NUMA 5A0BA 1GBBA 3ZZ6A 1UK4A 2BLQA 2FX6A 4WJG2 3UNQA 5EW2H 2BY9X 1O3PB 3A85A 1DUEA 3M37A 2QF3A 2WPLS 5AFZH 4CRDA 2VIDA 1CU1A 1Y5AT 3MWIU 4U01A 5EXLA 1GJ4H 1GI1A 2ZHWH 1MMJN 1NRSH 2HNTC 3E0PB 1WBGB 2J4IA 4GVUA 1VGCC 5CMXH 2HVXA 2G4UA 1QGFA 3A7ZA 1TPPA 4UFEH 3V7TA 2D8WA 2ZU2A 1EZXC 2VH6A 3CENA 1N8OB 1TBZH 4NSVA 1J14A 2ZECA 3KQCA 2ULLA 5JB9S 3RU4E 3MFJA 2GCHG 3GY7A 4Y8YA 1LVOA 3RM0H 1XVMA 8GCHF 1HB0B 4J2YB 2W5EA 1ZR0A 2AERH 3H7OA 2BX3A 4KTSA 3GCOA 2VH0A 1GG6C 1ANCA 3GCNA 1Z1IA 1C5WB 1NRRH 1L1JA 1IOEA 2FS8A 1O3NA 1QBVH 3NK8A 1ETRH 1CT0E 1LPZB 3T29A 2R0LA 1TA2A 1CA8B 3F9GA 4OS4A 3BTKE 1B0EA 3PV4A 2G52A 1HJAB 1TAWA 1P2KA 1BMMH 1SGFA 4OS5A 2AFQB 2ZPQA 1MTWA 4FUDA 4H4FA 1UTQA 4AB8A 4K5ZA 2A31A 1YPKH 1ETSH 4MVNA 1ZTJA 2XBVA 1BRAA 4Y0ZE 3JZ2B 1MD8A 2OUAA 2P8OB 5HYOA 3AW1A 1OYTH 1ANBA 2F91A 1AQ7A 1MD7A 4Z6AH 2OP9A 1MBMA 2OCVB 1BQYA 2QF0A 4R8TB 1O39A 3LOXA 5DJ7A 4X1RU 3PMHB 1O3LA 1PQ7A 1IQFA 1S5SA 1V2TT 4K1SA 1FAXA 3O8RA 3SV8A 1ZPBA 1C9PA 2FPZA 1C2MA 2UUFB 2UUYA 3SI4H 1EPTC 2I6SA 2IPHA 5DP7A 1YPHE 4I8JA 1UVSH 1QQUA 3RXQA 4ABGA 5EG4A 1YLDA 2TRMA 1HPGA 2HGTH 2PUXB 4IW4E 3RXDA 3LGUA 2FEQH 1OXGA 5F8TA 1GBKA 3K6YA 3QZQA 1C9TA 1PQ5A 5IDKA 3UPEA 4O9VA 2RA3A 3EA9A 4UDWH 2XRCA 3FP6E 3LGTA 5B6OA 3RXPA 1PYTD 1A46H 1M9UA 2QC2A 1LQEA 3ZVGA 1P57B 3TITA 3UR6A 2PKAB 1LVBA 3SNBA 1FMGA 2BVRH 4GSOA 3P95A 1P05A 1W10U 1THRH 3L33A 2XBYA 4HI3A 4R0IA 4FVDA 2GT8A 3TJVA 2FOEA 1Z8IB 2R3UA 5GIBA 3GCHB 1BTUA 3O8BA 1Y5BT 4Y76A 1GJBB 1AKSB 1O2XA 1O0DH 2ESTE 4MQAA 3ZYEA 3BEFB 1NM6A 1LHFH 4DOQA 1IQMA 2BDYA 3ZZDA 1GBAA 4XE4A 1FY3A 1FN6A 1T4VH 1J9CH 1KDQA 2ZTZA 7KMEH 1NT1A 1TGTA 2FX4A 3M3TA 4NZLA 2WUCA 4K1TA 1PQAA 3MU8A 1TFXA 1Z6EA 1D3TB 4JYTA 1FV9A 2NWNA 2GGVB 1K1NA 5ESTE 1MTNB 3I78A 1Y3YA 4GCHG 2PSXA 1UO6A 4FU9A 9ESTA 1LMWB 4DT7B 4X8VH 3U8TH 3EE0B 1AFEH 1MBQA 1MCTA 2Y81A 2Z6BD 4RKJB 1GJ9B 1B7XB 4WXVA 3HK6B 2XTTB 3U9AH 3ZZAA 1GCTC 1GDNA 3S0NA 5EOKA 4X1QU 4ABAA 2ZA5A 1Z8GA 2BQ6B 4AFQA 2FO9A 1LDTT 1YCPK 3PTBA 4IC6A 3OY5U 2F9BH 2BYAX 2GCHF 4RKOB 7ESTE 1XM1A 3AASA 5HXFA 3CS0A 2QY0B 3Q3XA 4CH2B 2P16A 5F8ZA 2Y5HA 2B7DH 1GGDB 1TPSA 1QA0A 4K8YA 1MUEB 5JBCS 3SJKA 2FOCA 5JPMH 2DUCA 4FUIA 5C1UA 3ZZCA 1OP0A 3A8BA 1HAOH 2WINI 1A0JA 1SBWA 4LOYH 3UQVA 1CBWC 3SUDA 3HATH 4CRCA 3QWCH 3A8DA 1GI3A 1SLWB 2ILNA 1EB2A 1O30A 1E37B 2TIOA 4SGBE 1IQLA 2SFAA 1TGCA 4CREA 1BUIA 2YNAA 3Q00A 5ETXA 4MNYA 3SU0A 2CN0H 4D8NA 2FWWA 3ZZ8A 2W7UA 4MPXA 1SGQE 1VCPA 2PSYA 5DP8A 1EQ9A 2OLGA 4FUGA 1CA0C 3TVJB 1L0ZA 1O5DH 1PPBH 6CHAC 5DP3A 1ABJH 1V2QT 3M3VA 4ISOA 1HGTH 4RN6A 3F9FA 1FJSA 1OS8A 1EPTA 1JXPA 1YKTA 1HIAB 1P10A 2BY5X 3V12A 2WV5A 1Y5UT 2C8XB 4A1TA 2C4FH 4O3TA 2P3TB 4JCNA 4A6LA 4TWYA 7GCHG 4GLYA 3SNDA 5T6GA 3ZYDA 1EAIA 3SN8A 3NKKA 4IBLH 5TCAA 1Z6JH 1ZZZA 2BLOA 1P3CA 3KN2A 2BY7X 2DE9A 1Y3WA 2GX4A 1O3BA 2SGQE 8ESTE 1A0LA 1Y3VA 1NU7B 3QK1A 1O5FH 1TPAE 2QXJA 4H6SB 2G5VA 2XWAA 5ESBA 2V6NA 1LVMA 1RTFB 4Q80A 1LTOA 2ZGHA 1P9SA
chains in the Genus database with same CATH superfamily
3CNRA 5E0GA 3CS7A 2BY8X 2C8WB 2BMGB 2O8TA 2Z3EA 4CR9A 3IITA 2SNWA 3ZZ7A 1YY3A 2KFWA 3LU9B 3D62A 1CQQA 3K65B 1DLKB 1DVAH 1B5GH 1IQGA 2CF9H 1TNGA 3RMOH 1PJPA 1C2DA 4Y7BA 3FZDA 5CDFE 3NPSA 2AS9A 2ZWLH 1C5YB 1E0FD 1UVOA 3C1KA 1A1RA 2Q6DA 4ZKRU 1AUJA 1C2LA 1RGQA 2A4QA 1IAUA 4ZHAA 4WY3A 2H9HA 2B5TB 3ZIAD 1THPB 1C2FA 2IN2A 3RMMH 4YXWD 2GVFA 1MAYA 3GCTG 1GVZA 2OINA 2G8TA 3K9XB 2F3CE 3KYFA 1A4WH 1GJ6A 5T6DA 1UVTH 1Z7KA 1XMNB 2P59A 2EI7A 2GMTC 2Z9GA 3MO3A 3JZ1B 3MU5A 4YO9A 3QTOH 5JBAS 2PP6A 4ABHA 2BY6X 1FN8A 1K1LA 1O2PA 4D7GA 2XC0A 4UFGH 5FAHA 4I32A 3GY6A 4AC9A 3O8DA 2CK3D 4OM9A 1GMHG 1HRTH 5TCCA 1WSSH 1UHBA 2EI6A 8LPRA 4RT1A 4F55A 1Q2WA 1AVWA 1H9IE 1MQ5A 3OAAD 4GCHF 1BZXE 4UFFH 5CHAB 4ISHH 1GI7B 2LPRA 4BTUB 1Q3XA 1IQNA 4DURA 1DSUA 1D3DB 3TH2H 1D4PB 1HBTH 1GMDG 1K22H 1AD8H 4LZ1H 1VCQA 1ZPZA 4GPGA 2BDAA 1EFRD 1AZ8A 2FYRA 1IQHA 1CT4E 1FPHH 1FX0B 1RS0A 1JIMA 3QTVH 1DFPA 1VJAU 1BIOA 1ELAA 4YOIA 1KYNA 4HZHA 4ISIH 1QJ7B 4E06H 4HFPB 2QE7D 1O2LA 3V13A 1TOCB 4MPVA 4FOUC 5ABWA 3QX5H 2FI3E 3TPIZ 4E05H 2KAIA 3LKWA 1GI6A 1ABIH 3RXKA 1GHWH 3IG6B 2G51A 5KEDA 3A89A 1D9IA 2A2QH 3BG4B 2AH4X 2BD2A 3ATWA 2CV3A 1GL0E 2P8OC 3TK9A 2J34A 1FY8E 3LGYA 1PQ8A 1SGYE 3M61U 1XUHA 5E8EH 3DSPA 4TPIZ 3P8NA 5A0CA 1NC6A 2W3IA 1AB9B 1EB1H 4X1SU 1AUTC 1ZHPA 1KY9A 3RP2A 1JIRA 1QB6A 1O3KA 4NZQA 3Q77A 2GV6A 2QF5A 2ZDVH 3RXLA 4MNVA 1AI8H 1UTOA 3UTUH 4KTUA 3MU0A 2F9VA 1NN6A 3RXUA 1ELFA 2BD8A 5GWZA 4QT8C 2A5IA 1QY6A 1EP5A 3UB0A 2XYAA 3F68H 1OPHB 3MOCA 1GMCG 3SGQE 1W0ZU 2IJD1 2A32A 1GHZA 3AAVA 1YPHC 5A09A 1C5VA 3RXSA 1TMUH 2ZFRH 7GCHF 4A5TS 3E1XB 1GHVH 3KGPA 5JB8S 3TJUA 3UNSA 1Z1JA 3TH4H 2VWLA 3GYMA 1SLVB 2VWMA 3A80A 4Q7YA 3BTDE 1YPLH 5FCRA 4WMEA 2YMSC 3RXRA 3HGNA 2OBQA 1AE8H 1DY9A 3OY6U 1NBMD 3PMBB 1ZTKA 2AGGX 1F0TA 1V2KT 1YPJH 2IOTA 4U2WA 1AIXH 2UUJB 1O36A 1O35A 5C0UA 2OBOA 1HAZB 2H2ZA 2BXTH 3KQBA 4WWYA 3GCHC 2Q6GA 3UWJH 3A7WA 1OWHA 2HNTF 5FPSA 1LKAA 2GDDA 3EE7A 4Y8ZA 1XUGA 1YP9A 1W12U 1ZOMA 4BXSA 1BRCE 3TU7H 5EIYA 3ZVEA 3Q76A 3DUXH 4NIVA 4FUCA 2J9NA 4JK5A 1KLIH 6GCHG 3SHAH 2R2MB 3RDZA 2GZ8A 2HALA 1MU8B 5DP5A 3A8AA 3F2GA 1G3BA 1GI9B 2QV1A 3ATIA 5C5OA 1P01A 4KP0A 1L4ZA 1ORFA 2FOBA 1DS2E 1QFKH 2ANKH 3GCTF 1C2KA 3GY4A 2UWOA 3A83A 3NWUA 1C5LH 1E34B 4JZ1A 1TIOA 2ANMH 4I8GA 5KGOA 1AO5A 2BXUH 1TQ0B 3RXIA 2ODQA 4WXIA 1EZUC 2ZDKA 4Y0YE 3U69H 4K3JA 5HKKD 2M2AA 2BVSH 2W6ID 1U6QA 1DE7H 1V2UT 9LPRA 2C8ZB 1O2UA 1NRPH 1V2NT 2FOFA 2FZZA 2J2UA 4B71A 1GMHF 4CBOA 1MKXK 2W6JD 1E79D 2V3HH 3EA7A 4XBDA 1Y3UA 4TYDA 1C5NH 1ESAA 3SU6A 3A87A 1BT7A 1QQ4A 4UD9H 1QB1A 2FTMA 4XFQA 1OWKA 4Y10E 3PO1B 1GMDF 2ZQ1A 1SQAA 2VJ1A 1EZQA 5GJ4B 2AGEX 1FAKH 1VR1H 1QJ6B 4YT7H 1OWIA 3S7HB 4O97A 4DY7B 3W1EA 4K8BA 2RDLA 4Q2KA 1FNIA 3SU3A 1OX1A 3QUMP 1HJ9A 4NFEA 4I7YH 1NS3A 1SGIB 2WYJA 1MKWH 1ESBA 2P95A 2J95A 1N1LA 4FUEA 1SQOA 1C5TA 2K8IA 2PV9B 2H9TH 2L6OA 5T6FA 4AGKA 4AX9H 1IHTH 4NGAH 1O2WA 3SW2B 2Q6FA 1WV7H 3GY8A 3DSGA 3E90B 1LKBA 4WH6A 1GBHA 4X2YA 2BOKA 3AVZA 1GDQA 2Y5GA 2FI4E 3A81A 1ESTA 5JBBS 5C5NA 3SU4A 1O2TA 1SHYA 1BOQA 2ZU3A 1S0QA 4I31A 2F9NA 2RA0A 1MH0A 4YLUA 1FI8A 2XXLA 5EJLA 1O3AA 1A3EH 1QRXA 2JDID 1G9IE 1W7XH 3RLWH 4WH8A 1QA7A 2A4GA 3N7EA 2UWLA 1O5BB 1TB6H 1GMCF 1NFYA 2A5KA 3MMGA 1ARBA 1O2ZA 1G2LA 4JZFH 5A8XA 1KTTB 1P11E 1T8OA 1WTGH 2THFB 1IQKA 3EAJA 1MCVA 1UCYE 4E7NA 5HGGA 1C4V2 3S9BA 1GJCB 2W3KA 1HV7A 4ABFA 4ZCNA 3ZV8A 1DY8A 1WQSA 3VG8A 3QO6A 1G32B 1JBUH 2PGBB 1AHTH 2ZGJA 3BTGE 3PLKA 4GHQA 2FOHA 2GCTB 1KXCA 2O9QA 1XUIA 2EEKA 1CSOE 4NIWA 4KKDA 1YF4A 3FAOA 3E16B 1CVWH 1H1BA 2R3YA 4CH8B 2CHAB 1HAIH 3SJIA 1SOTA 4DW2U 3SGAE 4MNWA 5FL7D 2PKSC 3ZZ9A 5F8XA 1GBDA 2ZU1A 1CO7E 1EAUA 2WUBA 1TNLA 3SV7A 1G36A 3M5NA 1UCYK 2BD5A 1CGHA 1RTLA 1SGRE 2XCNA 1RJXB 2TBSA 1V2JT 5FCKA 6GCHF 1BHXF 2BDIA 2YOLA 3OTPA 1BBRH 1OYQA 5G4BA 2Y7XA 3Q3YA 1O5CB 2SGPE 1OKXA 1DSTA 1F0SA 3MNSA 2RFKC 3ZVCA 1Q31A 1K2I1 4FU8A 6LPRA 1S6FA 4K60A 2ZFQH 2KCPA 1G2MA 3PMAB 4FUFA 1GBCA 2VU8E 2ODYB 3N7DA 1H9LB 1H8ED 1KLTA 2QCYA 2BD4A 2P3UB 2OC0A 4A92A 5EJ1A 1P2NA 3B9FH 1W0JD 1XKAC 3FFGA 1UTJA 3OEED 3BEUA 3MI4A 1BMNH 1H8IH 2SGEE 4NIYA 3GDSA 2XW9A 1HLTH 1EKBB 3GICB 5EQQA 3PB1E 4P02A 2UUKB 2ANWA 1LHDH 2H9EH 1SSXA 1PFXC 5EODA 1C2JA 3L6PA 5A0AE 2AMQA 4D76A 5EGMA 5DN6D 1ZPCA 3D23A 3P17H 1O3EA 7LPRA 3OFND 3BG8A 1V2WT 2J98A 3DT0H 2ALPA 1PYTC 1NBME 1NFUA 2JETC 4XBBA 1AVGH 3ELAH 3UFAA 1O2KA 1N6XA 2BX4A 2D26C 3C27B 2HPPH 3RXTA 1O3HA 3TK5A 3ZZ5A 1ANDA 3FP7E 3BG4C 1LQDB 1TONA 1DXWA 1XVOA 5HM9A 1SFIA 3PV2A 4NWKA 3E3TA 1TOMH 4TWWA 2ZFSA 4ZAEA 3UY9A 4DJZB 1PPHE 1O3MA 4M9FA 4FUBA 4ASUD 1OSSA 4VGCB 1FPCH 1P2IA 1SGFG 1A61H 1C5RA 3S7KB 4BXWA 2ZI2H 4ZKSU 2PTCE 3MNXA 2Z7FE 1LO6A 1SL3A 3UWIA 1C5ZB 2Y7ZA 2A7HA 3M5LA 1ZGVA 1FUJA 2STBE 3SU1A 1ZTLA 2OC8A 5GPIB 1ANEA 3SZNA 1DWCH 2CJIA 4O03A 1BRUP 3SU2A 3D65E 4XRNA 3FOAA 1HFDA 1C1VH 1XX9A 1ZHRA 1O2SA 1O2OA 3BV9B 1FIZA 4ZMAH 3KQ5A 1BTYA 2WPIS 3FZZA 2JKHA 4ZKOU 2VIVA 1C1QA 1XXDA 1TE0A 2GZ7A 1DUAA 1VKYA 5EW1H 1F0RA 3ZV9A 2HPQH 1ELBA 4X8TH 5DK1A 3BF6H 4GHTA 5FXLA 4XD7D 1HJ8A 4RI0A 3BTQE 2VGCC 3VXEH 1K9OE 1C2GA 1VGCB 1CGJE 5L2YH 1ELCA 2FOGA 4ACBA 2OD3B 3OSYA 1LPGB 1ELGA 3DCLA 4OS1A 4ACAA 2Y6TA 3ATLA 1HAPH 4YT6H 1SGDE 3RXCA 1JRTA 3URDA 3UOUA 1E1QD 1ELTA 1F92A 1KXBA 1RIWB 4B1TA 3OU0A 5EJZA 4ZKNU 2ZPSA 1C2IA 1ELVA 2Z3CA 2PFEA 1PPFE 2D1JA 1J15A 2ZHFH 4FVBA 4I33A 1P03A 1QRZA 2BD7A 5C1XA 1V6DA 2R2WU 1HAVA 2AMDA 2QAAA 1BTZA 2H1UA 1C1NA 1YGCH 3TGIE 5JDUB 4ZUHA 2I6QA 4JZEH 2FTLE 4BAHB 2HWLB 1T4UH 3BIVH 1EATA 4Y79A 3A7VA 5L2ZH 1ELDE 1O3OA 1SGEE 1G3DA 2BB4A 3BTME 5FPYA 4AFZA 5C94A 3MHWU 1TRYA 2AMPA 2EA3A 3MQKC 1GBLA 3M3SA 1DOJA 1IQJA 1O2IA 1B0FA 3UREA 4ZHLU 1KTSB 5FBEA 3T27A 2Q1JA 3NRLA 4NA9H 2JJ1D 1SQTA 2KR7A 4UONA 2K1QA 1EP6A 5E0JA 3RXAA 1TYNA 1W2KH 2BD3A 2GV7A 2HVYB 1CHGA 2F83A 1C5SA 1GI0A 1FIWA 1GBJA 1F5LA 1KIGH 3OX7U 3RXFA 2KZ4A 3HK3B 1TRMA 3MO6A 4H42U 1DM4B 1HAXB 2WPMS 2WPDD 2ZGCA 1VCWA 3QLPH 3VEQB 2AIQA 1YCPM 2QYIA 3VB6A 2ZIQH 2FODA 2BVXH 3E6PH 4IC5A 3SV2H 1S6HA 3P8OA 3SNEA 5F6MA 2G55A 3PO1C 1EPTB 1EJMA 1J17T 2BDGA 3ZVFA 4B2BA 3DHKH 3KYGA 1WAYB 5A8YA 3LGIA 4Y7AA 1S82A 1MAXA 2BQ7B 5JYIA 2QA9E 1AMHA 1O2HA 1P02A 1W0KD 1EAWA 1YC0A 5H4IB 4X0WU 3P8FA 1GBMA 1P9UA 4DCDA 1FY4A 1N8OC 1JMOH 1XUFA 4Y6DA 4FUHA 4JYVH 2Z9JA 2PW8H 1O2VA 4IS5A 3TIUA 2ALVA 3T25A 2VIOA 1AWFH 4OGXA 3P92A 1V2ST 5GXPA 4CRBA 4ISLA 3VGCB 2ZDLA 3GDUA 2JH5D 1HXFH 1ZSKA 1T8MA 1QZ8A 2C8YB 2O8WA 1P0SH 1W0YH 4Z0KA 2GKVE 1V3XA 4BANB 3LT3A 1ELEE 2CF8H 3DFLA 1YPEH 3MU1A 1ZMLA 2GP9B 3FKSD 2WPHS 1HJAC 1H8HD 5PTPA 1YWUA 1GHXH 2WZQA 4ABJA 1G3CA 4CRFA 3STIA 3ATMA 1T7CA 3H7TA 2AYWA 2J94A 3FP8E 2ZQ2A 3BIUH 1YCPH 5LPFA 1AY6H 2XC4A 5DKMA 4RSPA 1MZDA 3KQEA 1C1WH 1K1MA 2J5UA 1L4DA 3TNTA 2BDCA 2ZGBH 2GT7A 1EJAA 1CT2E 2G00A 1TPOA 2OTVA 3SJ8A 3PM3A 1V2VT 2ZDAH 3T5FH 1S83A 3KQDA 1UK3A 4O3UA 3QDZB 4IN1A 1O5AB 1S81A 1UHBB 4TY7A 4B76A 3SORA 1BHXB 2L74A 1EASA 3RXGA 3SI3H 1F5KU 3P70B 4NCYA 1EJNA 2VBCA 3DA9B 1K1JA 1BDAA 1QBOA 3VB5A 5SGAE 2BM2A 1TALA 4CHAB 4YOGA 4YESB 4NA8A 1BBRE 1T8LA 1WCZA 1EOJA 3PLPA 1ZSJA 1TNJA 1DX5M 2TGTA 1NU9A 1SHHB 3UNRA 2FIRH 1C2HA 2JH0D 2OQ5A 1HXEH 2NU1E 5DG6A 3RC4A 2ZCLP 1SGTA 3BTWE 2V3OH 1DT2A 4LXBH 2VWNA 1T8NA 1VITG 2B9LA 2M5TA 1FY5A 2KAIB 2A4RA 2C93B 1Y3XA 1AU8A 2G81E 2V7QD 3TNSA 5F53A 1QNJA 4D7FA 1SGPE 3M5MA 1ZJDA 4NG9H 4CR5A 2HLDD 1QL7A 1IQEA 1BMAA 1QRWA 1SQRA 3PROA 2GD4B 2ZFPH 5GDSH 4J1YA 1TNIA 1YLCA 3EQ0H 3A82A 1CA0B 3RXOA 4NFFA 5LH8A 4DIHH 2ZC9H 1A5GH 1GBIA 4B6EA 3M35A 5FX5A 3MO9A 1GPZA 4LZ4B 2Z9KA 2BTCE 4BOHA 3K2UA 5EXNA 1GBFA 1PPCE 1J16A 2D2DA 3BTEE 1GVLA 4FU7A 1EZSC 3M7TA 3MNBA 1BMFD 1SI5H 2ZF0H 2JH6D 1O2MA 4I86A 2PTNA 3F9HA 1UMAH 5BPEA 1KSNA 1FDPA 1MTNC 1MABB 1S84A 1GHBG 2XNIA 1SB1H 4RT0A 1O38A 3BTHE 1PPZA 3M36A 1UJ1A 5AHGH 3EDXB 2P93A 1P2MA 1XXFA 2ZDMA 1AFQB 1LCYA 1JOUB 1K1IA 1V2PT 2AHME 1MU6B 2J92A 4OS7A 1AVXA 3LPRA 2OC7A 4I8LA 1O3JA 2P3FH 1O2JA 3F3BA 4A1XA 3A7YA 1P8VC 2NU4E 1QURH 5FHTA 2FDAA 4X6MA 2QN5T 4AFUA 4JZIA 3SOSA 1BITA 1GJ7B 4YOJA 1GGDC 1RRKA 1QBNA 1TGNA 4U32A 5HMAA 3MH7A 4KGAA 1BRBE 2VIQA 3FVFB 1OP8A 1CHOG 3F0OA 4THNH 5TJXA 1UW7A 1C4Y2 1C2EA 1TBRH 2ZU5A 1DLEA 2B0FA 2PLXA 2KX4A 1HAGE 1EXFA 3GY2A 3V3MA 1SFQB 4Y11E 1C5MD 1Y8TA 4CRGA 5J4QA 1V2MT 1C5OH 1O2QA 3LDXH 5DP9A 1C1RA 4UE7H 4ASHA 1NPMA 3A84A 4AGJA 1C1SA 5DSFA 2GDEH 3P8GA 2R0KA 1ZYOA 4IMZA 8KME2 4IGDA 1IQIA 1GI5A 1EAXA 2PR3A 1UTMA 1CE5A 2GMTB 2BLWA 1QR3E 4IMQA 1O37A 2H6MA 1W8BH 2IJOB 3U1JB 3FN8A 2Y5FA 4I8HA 4K2YA 2ZO3H 3GY5A 1GHAG 2STAE 1SLUB 2SGDE 3P6ZB 3F6UH 1HDTH 3H5CB 3SHCH 1QJ1B 1TX8A 1RIWC 5EXMA 1DPOA 4ABDA 1BTHH 5GCHG 1O2RA 3TJOA 1UTKA 2BD9A 2NU0E 4WMDA 1O2GH 2KM0A 3SZEA 3VPKA 2ZTXA 4MG3A 3LC3A 2CXVA 2TGAA 2UWPA 4Z1MD 5FX6A 2O8LA 1UTNA 4B2CA 2ZHDA 1O33A 2ANYA 3RXBA 4ABEA 2Z9IA 1VITH 2W26A 2PKAA 2OC1A 3KF2A 2DE8A 2ZEBA 3T26A 1KXAA 1OP2A 1C1OA 2BDBA 1S6LA 1TABE 5K7RA 1P2OA 1Z8RA 3KIDU 3ZZ4A 1H4WA 3UQOA 1NTPA 6ESTA 1MZAA 1NFWA 2GJGA 4U30A 4YTAA 3WY8A 2QGRA 1KXEA 1XKBC 3RLYH 1TWXB 1AKSA 1BJVA 3V0XA 4INLA 4DIIH 3R0FA 1A2CH 2C3SA 1X7AC 1VITF 3BEIB 1WOFA 1HAYB 4HGCA 1G37A 2ZG0H 3F0PA 3RMNH 4XOJA 3LGWA 3URCA 3D49H 4IN2A 3CP7A 2EC9H 4P00A 4WVPE 2IPQX 1O5GH 3QGJA 5FBIA 2QF4A 1DWBH 3F1SB 1D3PB 2W7SA 2XC5A 2ZFTA 3PYHA 1E1RD 1SC8U 2V35A 2FMJA 3VB4A 1GBTA 3I77A 2WYGA 2XNDD 3S9CA 1C1TA 1C5XB 4ISNA 3QZRA 3KNXA 3E91A 4MDSA 3EA8A 3SJ9A 4X2WA 5T3HA 5A8ZA 4JK6A 5AF9H 4DG4A 1GI8B 5IK2D 5C1YA 1GJ8B 2Z94A 3Q3KA 3LH1A 3DD2H 1GHBF 1NO9H 4SGAE 1L2EA 3VB3A 1NZQH 4B73A 4BAQB 1TX7A 1MTSA 5CHAC 1UK2A 4AZ2B 3BTFE 2YNBA 2ZTYA 4AYVB 3SV6A 2A7CA 1DANH 1N6YA 5EU8A 1KXFA 1TQ7B 3VGCC 4DVAU 3OE7D 2OXSA 2TGDA 4AN7A 1K0HA 1QIXB 1C5PA 3SUFA 3FANA 5AFYH 1WTHD 1D6WA 1GI4A 3MNCA 3KCGH 3N99A 2FS9A 1F0UA 5LPRA 3W95A 5DGJA 3GISB 1IHSH 2R9PA 3RXJA 2TGPZ 1TMTH 2PHBA 5F03A 2HOBA 1C1MA 2GTBA 1A5HA 2BDHA 2WPKS 2ZCHP 3UR9A 2BOHB 3M7UA 2ODPA 4AORA 1A5IA 1CHOF 2AEIH 5IYTA 3QN7A 1NESE 3SV9A 3TGJE 1BTXA 1BCUH 1YPGH 4B6FA 4OS6A 4D9RA 1MKXH 2ZP0H 1C5QA 4F49A 3U98H 4WF8A 3LH3A 2F9UA 3ATKA 2KCAA 2NU3E 2SNVA 1RD3B 2SGFE 1AB9C 1TA6A 3ZZ3A 1HIAA 1AGJA 1D6RA 1BB0B 1P06A 3RU4T 5L6NH 4JMYA 4B2AA 2FOMB 3N7OA 4TPYA 1GHAF 1FZZA 5DPAA 4ESTE 1V2OT 5L30H 4FXGH 2GZ9A 1FLEE 2Z3DA 3SO3A 4JYUH 2SGAA 3DFJA 1H9HE 3VFEA 1SR5C 3A8CA 2O8MA 2HNTE 3NXPA 2RCEA 1A3BH 5EQRA 1NRNH 1Y59T 5GCHF 1JRSA 1C1UH 3STJA 1GHYH 2FM2A 2VVCA 1LHGH 4CHAC 3HKJB 3RC5A 1V2LT 2RG3A 2TPIZ 1INCA 4BNRA 4B74A 2NU2E 1KDQB 2BLVA 4AG1A 5I25A 1TRNA 2P94A 2OQUA 1EOLA 5CE1A 2AIPA 3PWCA 1DWDH 3GYLB 3GOVB 4MPWA 1W7GH 3T28A 3M5OA 2VIPA 1ZGIA 4BTIB 2QXIA 1XUJA 1QCPA 2J98B 1NFXA 1OOKB 5B6LA 2WPJS 5HIZA 3AAUA 2VNTA 5DP4A 5A2MH 3SUEA 2FXRA 1PPGE 3F9EA 5BRRE 1VJ9U 4AG2A 1T31A 3HKIB 1NRQH 1SOZA 3MU4A 3RM2H 3KL6A 1WU1A 5E2PA 1BA8B 1GJ5H 1GG6B 2XBWA 1GDUA 3M7QA 4D9QA 1GL1A 2XWBI 2J97A 1QB9A 3E8LA 3TGKE 3VXFH 1P2QA 2VVUA 2CGAA 3MH6A 1SGCA 5I46H 1A7SA 3I29A 4PROA 2XCFA 1O3CA 1UTPA 4INKA 2FI5E 4X6OA 2LELA 1C5UA 1OWJA 2PGQB 1A0HB 3NZIA 1E35B 1WYKA 1YLNA 1ZRBA 3ZVBA 2ZFFH 3F2HA 1O3GA 2FLBH 4K69A 4KELA 1ZSLA 1D3QB 4ZXYH 1O31A 1WUNH 2ZU4A 3ENSB 3VB7A 1ID5H 1T32A 4AYYB 4YLQH 1AE5A 4WMFA 4FETA 1O2YA 3T2NA 1L1NA 1FQ3A 3ZZBA 4MTBA 2XBXA 1TLDA 3BN9A 4TY6A 1AFQC 1O3IA 1NROH 3K6ZA 1P2JA 1TX6A 1ZHMA 3S9AA 4HTCH 2VIWA 1RXPA 3BSQA 1QHRB 2ZGXH 1GJAB 4AFSA 2Y80A 4ZROA 4Q63A 1UCYH 3TJNA 2QIQA 3OYPA 4Y71A 4ABBA 5J4SA 3LJOA 2V0BA 4BAMB 1RFNA 3U8OH 2A1DB 1G30B 4XDEA 3DSOA 3RU4D 3GS9A 5KECA 2ZNKH 4KTCA 1LHEH 3ODFA 5DP6A 2LNCA 2EQNA 5JBTA 4YZUA 3SBKA 1ZMNA 1J8AA 5DO4H 3RXVA 3E0NB 1QL8A 2H5CA 1O3FA 1AWHB 3L3TA 2CMYA 1F5RA 5C20A 4M7GA 3WWBA 1JWTA 1KMHB 1F7ZA 2PKSB 1P04A 5FPTA 1UVPA 1GJDB 3SQHE 4MNXA 4ZXXH 1TGSZ 2A4OA 1E36B 3SGBE 3TK6A 2BHGA 1CGIE 2VB0A 1HAVB 2KCOA 3LGVA 3RXHA 5T1VA 1LVYA 4X8UH 1L1GA 4F48B 5C2ZA 1YPMH 4A7IB 1HAHH 1SLXB 2FOAA 2AGIX 4CBNA 2WHXA 3ESTA 4X6PA 4X6NA 3U8RH 1AN1E 4X1NU 2A7JA 1GI2A 1RTKA 2B8OH 3RXMA 2F43B 5HIYA 2A5AA 4NSYA 2H5DA 2Z9LA 4X2XA 1C1PA 1MKWK 1HNEE 1UVUH 1DDJA 1K1OA 3S69A 2ZCKP 3T62A 3TLOA 3MH4A 5E2OA 1MTVA 5LGOA 2EI8A 5HM2A 1S85A 4NWLA 2ZHQH 1O2NA 1SVPA 2F9PA 1HYLA 1XUKA 4I8KA 3EYDA 3PV5A 1ZRKA 1Z71A 3HGPA 3ODDA 4ZH8A 4UEHH 1LPKB 3A88A 3UOPA 2JETB 4INHA 1PPEE 1NY22 1HUTH 1MQ6A 4F4OC 8GCHG 2HRVA 1ARCA 1TMBH 2YMSD 3A86A 2WV4A 5LPEA 2QXGA 1THSH 2GCTC 2ZKSA 1GCTB 1SG8B 1DITH 4UFDH 1TBQH 3B23B 3GDVA 3R3GB 3UIRA 1SMFE 1K28D 2CHAC 2QXHA 5EPNA 3SJOA 2JIZD 3B8JA 1BMLA 1E38B 4Q7XA 1O34A 1C4U2 4TSFD 1TGBA 2FESH 1HCGA 1GCDA 1KLJH 2ASUB 2WV9A 1Z8JB 4NA7A 3LONA 4DT4A 3RMLH 4GAWA 4CRAA 1W3CA 1K21H 4MLFB 2PUQH 3SU5A 3RC6A 2A2XH 4NIXA 3QGNB 1H8DH 4BTTB 3A7TA 1BJUA 3PWBA 2ZZUH 1GVKB 1W13U 1CBWB 2G5NA 3RXEA 3W94A 2HLCA 4Q4LA 2O8UA 4Q7ZA 3ZVAA 1EUFA 3LC5A 1EX3A 3NCLA 2VGCB 4MPUA 5EPYA 3SQEE 3UUZA 1WDIA 3RUOA 2VVVA 5E0HA 1GBEA 3H09A 3PLBA 1YYY1 5K0HA 2ZHEH 1O3DA 3F2FA 1ACBE 1SGNE 3OTJE 4LK4A 3PMJA 4OGYA 4GUXA 2V3MA 2BQWB 4X1PU 2G4TA 6CHAB 4K1EA 1MTUA 1WXRA 4ZHMU 3AW0A 3U28C 2FLRH 3SNAA 4BAOB 1BBRK 1YBWA 1S0RA 4Y8XA 5C67A 3MH5A 1YM0A 2BZAA 3LJJA 1QTFA 4XBCA 4XSKU 1GWAA 1KXDA 1AZZA 3EGKH 1ZLRA 4HG6A 1OWDA 4A1VA 2PWXA 3ITIA 3SUGA 4AB9A 4BAKB 4B75A 3PRBA 1P12E 2ZDNA 2A45B 3SNCA 1K1PA 1FY1A 1BTWA 1DICA 4OS2A 1WQVH 4X2VA 4E7RG 4JZDH 1ZJKA 1TNHA 1ZMJA 1P09A 2A0QB 1VZQH 1O5EH 1DXPA 3GY3A 2Y82A 1QL9A 2RDEA 1F2SE 2FYQA 3U1IB 3ZVDA 5C3NA 1P3EA 4AOQA 4VGCC 5AVDA 1TNKA 3MTYA 3G01A 4H6TA 4FUJA 4X8SH 2VWOA 5EQSA 1FXYA 1SPJA 2F9OA 3IWMA 1O32A 1V2RT 2VINA 2FP7B 2J38A 3BTTE 3KEEA 3PTNA 1W14U 1UTLM 1G3EA 1BTPA 1OWEA 1W11U 3MYWA 2C90B 1LHCH 3A7XA 3LIWA 4DGJA 4YM9A 3HPTB 1DWEH 1ETTH 4ABIA 2ZPRA 3TH3H 3O8CA 2BZ6H 3KHVA 1FONA 3NUMA 5A0BA 1GBBA 3ZZ6A 1UK4A 2BLQA 2FX6A 4WJG2 3UNQA 5EW2H 2BY9X 1O3PB 3A85A 1DUEA 3M37A 2QF3A 2WPLS 5AFZH 4CRDA 2VIDA 3FO8D 1COWD 1CU1A 1Y5AT 3MWIU 4U01A 2K0QA 5EXLA 1GJ4H 1GI1A 2ZHWH 1MMJN 1NRSH 2HNTC 3E0PB 1WBGB 2J4IA 4GVUA 1VGCC 5CMXH 2HVXA 2G4UA 1QGFA 3A7ZA 1TPPA 4UFEH 3V7TA 2D8WA 2XOKD 2ZU2A 1EZXC 2VH6A 3CENA 1N8OB 1TBZH 4NSVA 1J14A 2ZECA 5GNDA 5C0TA 3KQCA 2ULLA 5JB9S 3RU4E 3MFJA 2F4LA 2GCHG 3GY7A 4Y8YA 1LVOA 3RM0H 2EY4C 1XVMA 4TT3D 8GCHF 1HB0B 4J2YB 2W5EA 1ZR0A 2AERH 3H7OA 2BX3A 3WWFA 4KTSA 3GCOA 2VH0A 1GG6C 1ANCA 3GCNA 1Z1IA 1C5WB 1NRRH 1L1JA 1IOEA 2FS8A 1O3NA 1QBVH 3NK8A 1ETRH 1CT0E 1LPZB 3T29A 2R0LA 1TA2A 1CA8B 3F9GA 4OS4A 3BTKE 1B0EA 3PV4A 2G52A 1HJAB 1TAWA 1P2KA 1BMMH 1SGFA 4OS5A 2AFQB 2ZPQA 1MTWA 4FUDA 4H4FA 1UTQA 4AB8A 4K5ZA 2A31A 1YPKH 1ETSH 4MVNA 1ZTJA 2LP6A 1BRAA 2XBVA 3JZ2B 4Y0ZE 1MD8A 2OUAA 2P8OB 5HYOA 3AW1A 1OYTH 1ANBA 2F91A 1AQ7A 1MD7A 4Z6AH 2OP9A 1MBMA 1SKYE 2OCVB 1BQYA 2QF0A 4R8TB 1O39A 3LOXA 5DJ7A 4X1RU 3PMHB 1O3LA 1PQ7A 1IQFA 1S5SA 1V2TT 4K1SA 1FAXA 3O8RA 3SV8A 1ZPBA 1C9PA 2FPZA 3OEHD 1C2MA 2UUFB 2UUYA 2KCYA 3SI4H 1EPTC 2I6SA 2IPHA 5DP7A 1YPHE 4I8JA 1UVSH 1QQUA 3RXQA 4ABGA 5EG4A 1YLDA 2TRMA 1HPGA 2HGTH 2PUXB 2WSSD 4IW4E 3RXDA 3LGUA 2FEQH 1OXGA 5F8TA 1GBKA 3K6YA 3QZQA 1C9TA 1PQ5A 5IDKA 3UPEA 4O9VA 2RA3A 3EA9A 4UDWH 2XRCA 3FP6E 3LGTA 5CHBA 5B6OA 3RXPA 1PYTD 1A46H 1M9UA 2QC2A 1LQEA 3ZVGA 1P57B 3TITA 3UR6A 2PKAB 1LVBA 3SNBA 1FMGA 2BVRH 4GSOA 3P95A 2YMSB 1P05A 1W10U 1THRH 3L33A 2XBYA 4HI3A 4R0IA 4FVDA 2GT8A 3TJVA 2FOEA 1Z8IB 2R3UA 5GIBA 3GCHB 1BTUA 3O8BA 1Y5BT 3UAIC 4Y76A 1GJBB 1AKSB 1O2XA 1O0DH 2ESTE 4MQAA 3ZYEA 3BEFB 1NM6A 1LHFH 4DOQA 1IQMA 2BDYA 3ZZDA 1GBAA 4XE4A 1FY3A 1FN6A 1T4VH 1J9CH 1KDQA 2ZTZA 7KMEH 1NT1A 1TGTA 2FX4A 3M3TA 4NZLA 2WUCA 4K1TA 1PQAA 3MU8A 1TFXA 1Z6EA 1D3TB 4JYTA 1FV9A 2NWNA 2GGVB 1K1NA 5ESTE 1MTNB 3AK5A 3I78A 1Y3YA 4GCHG 2PSXA 1UO6A 4FU9A 9ESTA 1LMWB 4DT7B 4X8VH 3U8TH 3EE0B 1AFEH 1MBQA 1MCTA 2Y81A 2Z6BD 4RKJB 1GJ9B 1B7XB 4WXVA 3HK6B 2XTTB 3U9AH 3ZZAA 1GCTC 1GDNA 3S0NA 5EOKA 4X1QU 4ABAA 2ZA5A 1Z8GA 2BQ6B 3SYJA 4AFQA 2FO9A 1LDTT 1YCPK 3PTBA 4IC6A 3OY5U 2F9BH 2BYAX 2OK5A 2GCHF 4RKOB 7ESTE 1XM1A 3AASA 5HXFA 3CS0A 2QY0B 3Q3XA 4CH2B 2P16A 5F8ZA 2Y5HA 2B7DH 1GGDB 1TPSA 1QA0A 5C17A 4K8YA 1MUEB 5JBCS 3SJKA 2FOCA 5JPMH 2DUCA 4FUIA 5C1UA 3ZZCA 1OP0A 3A8BA 1HAOH 2WINI 1A0JA 1SBWA 4LOYH 3UQVA 1CBWC 3PRDA 3HATH 3SUDA 4CRCA 3QWCH 3A8DA 1GI3A 1SLWB 2ILNA 1EB2A 1O30A 1E37B 2TIOA 4SGBE 1IQLA 2SFAA 1TGCA 4CREA 1BUIA 2YNAA 3Q00A 5ETXA 4MNYA 3SU0A 1OHHD 2CN0H 4D8NA 2FWWA 3ZZ8A 2W7UA 2JJ2D 1SGQE 1VCPA 2PSYA 4MPXA 5DP8A 1EQ9A 2OLGA 4FUGA 1CA0C 3TVJB 3WW7A 1L0ZA 1O5DH 1PPBH 6CHAC 5DP3A 1ABJH 1V2QT 3M3VA 4ISOA 1HGTH 4RN6A 3F9FA 1FJSA 1OS8A 1EPTA 1JXPA 1YKTA 1HIAB 1P10A 2BY5X 3V12A 2WV5A 1Y5UT 2C8XB 4A1TA 2C4FH 4O3TA 2P3TB 4JCNA 4A6LA 4TWYA 7GCHG 4GLYA 3SNDA 5T6GA 3ZYDA 1EAIA 3SN8A 3NKKA 4IBLH 5TCAA 1Z6JH 1ZZZA 2BLOA 1P3CA 3KN2A 2BY7X 2DE9A 1Y3WA 2GX4A 1O3BA 2SGQE 8ESTE 1A0LA 1Y3VA 1NU7B 3QK1A 1O5FH 1TPAE 2QXJA 4H6SB 2G5VA 2XWAA 5ESBA 2V6NA 1LVMA 1RTFB 4Q80A 1LTOA 2ZGHA 1P9SA
chains in the Genus database with same CATH topology
5E0GA 3CS7A 2BY8X 2C8WB 2BMGB 2O8TA 2Z3EA 4CR9A 3IITA 2SNWA 3ZZ7A 3LU9B 3D62A 1CQQA 3K65B 1DLKB 1DVAH 1B5GH 1IQGA 2CF9H 1TNGA 3RMOH 1PJPA 1C2DA 4Y7BA 3FZDA 3NPSA 2AS9A 2ZWLH 1C5YB 1E0FD 1UVOA 3C1KA 1A1RA 2Q6DA 4ZKRU 1AUJA 1C2LA 1RGQA 2A4QA 1IAUA 4ZHAA 4WY3A 2H9HA 2B5TB 1THPB 1C2FA 2IN2A 3RMMH 2GVFA 1MAYA 3GCTG 1GVZA 2OINA 2G8TA 3K9XB 2F3CE 1A4WH 1GJ6A 5T6DA 1UVTH 1Z7KA 1XMNB 2P59A 2EI7A 2GMTC 2Z9GA 3MO3A 3JZ1B 3MU5A 4YO9A 3QTOH 5JBAS 4ABHA 2BY6X 1FN8A 1K1LA 1O2PA 4D7GA 2XC0A 4UFGH 5FAHA 4I32A 3GY6A 3O8DA 1GMHG 1HRTH 5TCCA 1WSSH 1UHBA 2EI6A 8LPRA 1Q2WA 1AVWA 1H9IE 1MQ5A 4GCHF 1BZXE 4UFFH 5CHAB 4ISHH 1GI7B 2LPRA 4BTUB 1Q3XA 1IQNA 4DURA 1DSUA 1D3DB 3TH2H 1D4PB 1HBTH 1GMDG 1K22H 1AD8H 4LZ1H 1VCQA 1ZPZA 4GPGA 2BDAA 1AZ8A 2FYRA 1IQHA 1CT4E 1FPHH 1RS0A 1JIMA 3QTVH 1DFPA 1VJAU 1BIOA 1ELAA 4YOIA 1KYNA 4HZHA 4ISIH 1QJ7B 4E06H 4HFPB 1O2LA 3V13A 1TOCB 4MPVA 5ABWA 3QX5H 2FI3E 3TPIZ 4E05H 2KAIA 3LKWA 1GI6A 1ABIH 3RXKA 1GHWH 3IG6B 2G51A 3A89A 1D9IA 2A2QH 3BG4B 2AH4X 2BD2A 3ATWA 2CV3A 1GL0E 2P8OC 3TK9A 2J34A 1FY8E 3LGYA 1PQ8A 1SGYE 3M61U 1XUHA 5E8EH 4TPIZ 3P8NA 5A0CA 1NC6A 2W3IA 1AB9B 1EB1H 4X1SU 1AUTC 1ZHPA 1KY9A 3RP2A 1JIRA 1QB6A 1O3KA 4NZQA 3Q77A 2GV6A 2ZDVH 3RXLA 4MNVA 1AI8H 1UTOA 3UTUH 4KTUA 3MU0A 2F9VA 1NN6A 3RXUA 1ELFA 2BD8A 5GWZA 4QT8C 2A5IA 1QY6A 1EP5A 2XYAA 3F68H 1OPHB 3MOCA 1GMCG 3SGQE 1W0ZU 2A32A 1GHZA 3AAVA 1YPHC 5A09A 1C5VA 3RXSA 1TMUH 2ZFRH 7GCHF 4A5TS 3E1XB 1GHVH 3KGPA 5JB8S 3TJUA 3UNSA 1Z1JA 3TH4H 2VWLA 3GYMA 1SLVB 2VWMA 3A80A 4Q7YA 3BTDE 1YPLH 5FCRA 4WMEA 3RXRA 3HGNA 2OBQA 1AE8H 1DY9A 3OY6U 3PMBB 1ZTKA 2AGGX 1F0TA 1V2KT 1YPJH 2IOTA 4U2WA 1AIXH 2UUJB 1O36A 1O35A 2OBOA 1HAZB 2H2ZA 2BXTH 3KQBA 4WWYA 3GCHC 2Q6GA 3UWJH 3A7WA 1OWHA 2HNTF 5FPSA 1LKAA 2GDDA 4Y8ZA 1XUGA 1YP9A 1W12U 1ZOMA 4BXSA 1BRCE 3TU7H 3ZVEA 3Q76A 3DUXH 4NIVA 4FUCA 2J9NA 4JK5A 1KLIH 6GCHG 3SHAH 2R2MB 3RDZA 2GZ8A 2HALA 1MU8B 5DP5A 3A8AA 1G3BA 1GI9B 2QV1A 3ATIA 5C5OA 1P01A 4KP0A 1L4ZA 1ORFA 2FOBA 1DS2E 1QFKH 2ANKH 3GCTF 1C2KA 3GY4A 2UWOA 3A83A 3NWUA 1C5LH 1E34B 4JZ1A 1TIOA 2ANMH 4I8GA 1AO5A 2BXUH 1TQ0B 3RXIA 2ODQA 4WXIA 1EZUC 2ZDKA 4Y0YE 3U69H 4K3JA 2BVSH 1U6QA 1DE7H 1V2UT 9LPRA 2C8ZB 1O2UA 1NRPH 1V2NT 2FOFA 2FZZA 2J2UA 4B71A 1GMHF 4CBOA 1MKXK 2V3HH 3EA7A 4XBDA 1Y3UA 4TYDA 1C5NH 1ESAA 3SU6A 3A87A 1BT7A 1QQ4A 4UD9H 1QB1A 2FTMA 4XFQA 1OWKA 4Y10E 3PO1B 1GMDF 2ZQ1A 1SQAA 2VJ1A 1EZQA 5GJ4B 2AGEX 1FAKH 1VR1H 1QJ6B 4YT7H 1OWIA 3S7HB 4O97A 4DY7B 4K8BA 2RDLA 4Q2KA 1FNIA 3SU3A 1OX1A 3QUMP 1HJ9A 4NFEA 4I7YH 1NS3A 1SGIB 2WYJA 1MKWH 1ESBA 2P95A 2J95A 1N1LA 4FUEA 1SQOA 1C5TA 2PV9B 2H9TH 5T6FA 4AGKA 4AX9H 1IHTH 4NGAH 1O2WA 3SW2B 2Q6FA 1WV7H 3GY8A 3E90B 1LKBA 4WH6A 1GBHA 4X2YA 2BOKA 3AVZA 1GDQA 2Y5GA 2FI4E 3A81A 1ESTA 5JBBS 5C5NA 3SU4A 1O2TA 1SHYA 1BOQA 2ZU3A 1S0QA 4I31A 2F9NA 2RA0A 1MH0A 4YLUA 1FI8A 2XXLA 1O3AA 1A3EH 1QRXA 1G9IE 1W7XH 3RLWH 4WH8A 1QA7A 2A4GA 2UWLA 1O5BB 1TB6H 1GMCF 1NFYA 2A5KA 3MMGA 1ARBA 1O2ZA 1G2LA 4JZFH 5A8XA 1KTTB 1P11E 1T8OA 1WTGH 2THFB 1IQKA 3EAJA 1MCVA 1UCYE 4E7NA 5HGGA 1C4V2 3S9BA 1GJCB 2W3KA 1HV7A 4ABFA 3ZV8A 1DY8A 1WQSA 3QO6A 1G32B 1JBUH 2PGBB 1AHTH 2ZGJA 3BTGE 3PLKA 4GHQA 2FOHA 2GCTB 1KXCA 2O9QA 1XUIA 2EEKA 1CSOE 4NIWA 4KKDA 1YF4A 3FAOA 3E16B 1CVWH 1H1BA 2R3YA 4CH8B 2CHAB 1HAIH 3SJIA 1SOTA 4DW2U 3SGAE 4MNWA 2PKSC 3ZZ9A 5F8XA 1GBDA 2ZU1A 1CO7E 1EAUA 2WUBA 1TNLA 3SV7A 1G36A 3M5NA 1UCYK 2BD5A 1CGHA 1RTLA 1SGRE 2XCNA 1RJXB 2TBSA 1V2JT 5FCKA 6GCHF 1BHXF 2BDIA 2YOLA 1BBRH 1OYQA 5G4BA 2Y7XA 3Q3YA 1O5CB 2SGPE 1OKXA 1DSTA 1F0SA 3MNSA 3ZVCA 1Q31A 1K2I1 4FU8A 6LPRA 1S6FA 4K60A 2ZFQH 1G2MA 3PMAB 4FUFA 1GBCA 2VU8E 2ODYB 1H9LB 1KLTA 2QCYA 2BD4A 2P3UB 2OC0A 4A92A 1P2NA 3B9FH 1XKAC 3FFGA 1UTJA 3BEUA 3MI4A 1BMNH 1H8IH 2SGEE 4NIYA 3GDSA 2XW9A 1HLTH 1EKBB 3GICB 5EQQA 3PB1E 2UUKB 2ANWA 1LHDH 2H9EH 1SSXA 1PFXC 5EODA 1C2JA 3L6PA 5A0AE 2AMQA 4D76A 5EGMA 1ZPCA 3D23A 3P17H 1O3EA 7LPRA 3BG8A 1V2WT 3DT0H 2ALPA 1PYTC 1NFUA 2JETC 4XBBA 1AVGH 3ELAH 3UFAA 1O2KA 1N6XA 2BX4A 2D26C 3C27B 2HPPH 3RXTA 1O3HA 3TK5A 3ZZ5A 1ANDA 3FP7E 3BG4C 1LQDB 1TONA 1DXWA 1XVOA 5HM9A 1SFIA 4NWKA 4TWWA 3E3TA 1TOMH 2ZFSA 4ZAEA 3UY9A 4DJZB 1PPHE 1O3MA 4FUBA 1OSSA 4VGCB 1FPCH 1P2IA 1SGFG 1A61H 1C5RA 3S7KB 4BXWA 2ZI2H 4ZKSU 2PTCE 3MNXA 2Z7FE 1LO6A 1SL3A 3UWIA 1C5ZB 2Y7ZA 2A7HA 3M5LA 1ZGVA 1FUJA 2STBE 3SU1A 1ZTLA 2OC8A 5GPIB 1ANEA 3SZNA 1DWCH 2CJIA 4O03A 1BRUP 3SU2A 3D65E 1HFDA 1C1VH 1XX9A 1ZHRA 1O2SA 1O2OA 3BV9B 1FIZA 4ZMAH 1BTYA 2WPIS 3FZZA 2JKHA 4ZKOU 2VIVA 1C1QA 1XXDA 1TE0A 2GZ7A 1DUAA 5EW1H 1F0RA 3ZV9A 2HPQH 1ELBA 4X8TH 5DK1A 3BF6H 4GHTA 5FXLA 1HJ8A 3BTQE 2VGCC 3VXEH 1K9OE 1C2GA 1VGCB 1CGJE 5L2YH 1ELCA 2FOGA 2OD3B 3OSYA 1LPGB 1ELGA 4OS1A 2Y6TA 3ATLA 1HAPH 4YT6H 1SGDE 3RXCA 1JRTA 3URDA 3UOUA 1ELTA 1F92A 1KXBA 1RIWB 4B1TA 3OU0A 4ZKNU 2ZPSA 1C2IA 1ELVA 2Z3CA 2PFEA 1PPFE 2D1JA 1J15A 2ZHFH 4FVBA 4I33A 1P03A 1QRZA 2BD7A 5C1XA 1V6DA 2R2WU 1HAVA 2AMDA 2QAAA 1BTZA 2H1UA 1C1NA 1YGCH 3TGIE 5JDUB 4ZUHA 2I6QA 4JZEH 2FTLE 4BAHB 2HWLB 1T4UH 3BIVH 1EATA 4Y79A 3A7VA 5L2ZH 1ELDE 1O3OA 1SGEE 1G3DA 2BB4A 3BTME 5FPYA 4AFZA 3MHWU 1TRYA 2AMPA 2EA3A 1GBLA 3M3SA 1DOJA 1IQJA 1O2IA 1B0FA 3UREA 4ZHLU 1KTSB 5FBEA 3T27A 2Q1JA 4NA9H 1SQTA 4UONA 2K1QA 1EP6A 5E0JA 3RXAA 1TYNA 1W2KH 2BD3A 2GV7A 1CHGA 2F83A 1C5SA 1GI0A 1FIWA 1GBJA 1F5LA 1KIGH 3OX7U 3RXFA 3HK3B 1TRMA 3MO6A 4H42U 1DM4B 1HAXB 2WPMS 2ZGCA 1VCWA 3QLPH 3VEQB 2AIQA 1YCPM 2QYIA 3VB6A 2ZIQH 2FODA 2BVXH 3E6PH 4IC5A 3SV2H 1S6HA 3P8OA 3SNEA 5F6MA 2G55A 3PO1C 1EPTB 1EJMA 1J17T 2BDGA 3ZVFA 4B2BA 3DHKH 1WAYB 5A8YA 3LGIA 4Y7AA 1S82A 1MAXA 2BQ7B 5JYIA 2QA9E 1AMHA 1O2HA 1P02A 1EAWA 1YC0A 5H4IB 4X0WU 3P8FA 1GBMA 1P9UA 4DCDA 1FY4A 1N8OC 1JMOH 1XUFA 4Y6DA 4FUHA 4JYVH 2Z9JA 2PW8H 1O2VA 4IS5A 3TIUA 2ALVA 3T25A 2VIOA 1AWFH 4OGXA 3P92A 1V2ST 5GXPA 4CRBA 4ISLA 3VGCB 2ZDLA 3GDUA 2JH5D 1HXFH 1ZSKA 1T8MA 2C8YB 2O8WA 1P0SH 1W0YH 4Z0KA 2GKVE 1V3XA 4BANB 3LT3A 1ELEE 2CF8H 3DFLA 1YPEH 3MU1A 1ZMLA 2GP9B 2WPHS 1HJAC 5PTPA 1GHXH 4ABJA 1G3CA 4CRFA 3STIA 3ATMA 1T7CA 3H7TA 2AYWA 2J94A 3FP8E 2ZQ2A 3BIUH 1YCPH 5LPFA 1AY6H 2XC4A 5DKMA 4RSPA 1MZDA 3KQEA 1C1WH 1K1MA 1L4DA 3TNTA 2BDCA 2ZGBH 2GT7A 1EJAA 1CT2E 2G00A 1TPOA 2OTVA 3SJ8A 3PM3A 1V2VT 2ZDAH 3T5FH 1S83A 3KQDA 1UK3A 4O3UA 3QDZB 4IN1A 1O5AB 1S81A 1UHBB 4TY7A 4B76A 3SORA 1BHXB 1EASA 3RXGA 3SI3H 1F5KU 3P70B 4NCYA 1EJNA 3DA9B 1K1JA 1BDAA 1QBOA 3VB5A 5SGAE 2BM2A 1TALA 4CHAB 4YOGA 4YESB 4NA8A 1BBRE 1T8LA 1WCZA 1EOJA 3PLPA 1ZSJA 1TNJA 1DX5M 2TGTA 1NU9A 1SHHB 3UNRA 2FIRH 1C2HA 2JH0D 2OQ5A 1HXEH 2NU1E 5DG6A 3RC4A 2ZCLP 1SGTA 3BTWE 2V3OH 1DT2A 4LXBH 2VWNA 1T8NA 1VITG 2B9LA 2M5TA 1FY5A 2KAIB 2A4RA 2C93B 1Y3XA 1AU8A 2G81E 3TNSA 4D7FA 1QNJA 1SGPE 3M5MA 1ZJDA 4NG9H 4CR5A 1QL7A 1IQEA 1BMAA 1QRWA 3PROA 2GD4B 2ZFPH 5GDSH 4J1YA 1TNIA 1YLCA 3EQ0H 3A82A 1CA0B 3RXOA 4NFFA 5LH8A 4DIHH 2ZC9H 1A5GH 1GBIA 3M35A 5FX5A 3MO9A 1GPZA 4LZ4B 2Z9KA 2BTCE 4BOHA 3K2UA 5EXNA 1GBFA 1PPCE 1J16A 2D2DA 3BTEE 1GVLA 4FU7A 1EZSC 3M7TA 3MNBA 1SI5H 2ZF0H 2JH6D 1O2MA 2PTNA 3F9HA 1UMAH 5BPEA 1KSNA 1FDPA 1MTNC 1S84A 1GHBG 2XNIA 1SB1H 1O38A 3BTHE 1PPZA 3M36A 1UJ1A 5AHGH 3EDXB 2P93A 1P2MA 1XXFA 2ZDMA 1AFQB 1LCYA 1JOUB 1K1IA 1V2PT 1MU6B 2J92A 4OS7A 1AVXA 3LPRA 2OC7A 4I8LA 1O3JA 2P3FH 1O2JA 4A1XA 3A7YA 1P8VC 2NU4E 1QURH 5FHTA 2FDAA 4X6MA 2QN5T 4AFUA 4JZIA 3SOSA 1BITA 1GJ7B 4YOJA 1GGDC 1RRKA 1QBNA 1TGNA 4U32A 5HMAA 3MH7A 4KGAA 1BRBE 2VIQA 3FVFB 1OP8A 1CHOG 4THNH 5TJXA 1C4Y2 1C2EA 1TBRH 2ZU5A 1DLEA 2B0FA 2PLXA 1HAGE 1EXFA 3GY2A 3V3MA 1SFQB 4Y11E 1C5MD 1Y8TA 4CRGA 5J4QA 1V2MT 1C5OH 1O2QA 3LDXH 5DP9A 1C1RA 4UE7H 4ASHA 1NPMA 3A84A 4AGJA 1C1SA 2GDEH 3P8GA 2R0KA 1ZYOA 4IMZA 8KME2 4IGDA 1IQIA 1GI5A 1EAXA 2PR3A 1UTMA 1CE5A 2GMTB 2BLWA 1QR3E 4IMQA 1O37A 2H6MA 1W8BH 2IJOB 3U1JB 4I8HA 2Y5FA 4K2YA 2ZO3H 3GY5A 1GHAG 2STAE 1SLUB 2SGDE 3P6ZB 3F6UH 1HDTH 3H5CB 3SHCH 1QJ1B 1TX8A 1RIWC 5EXMA 1DPOA 4ABDA 1BTHH 5GCHG 1O2RA 3TJOA 1UTKA 2BD9A 2NU0E 4WMDA