The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
198
|
structure length |
198
|
Chain Sequence |
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase (serine proteinase)
|
source organism |
Lysobacter enzymogenes
|
publication title |
Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb |
molecule keywords |
ALPHA-LYTIC PROTEASE
|
total genus |
51
|
structure length |
198
|
sequence length |
198
|
ec nomenclature |
ec
3.4.21.12: Alpha-lytic endopeptidase. |
pdb deposition date | 1995-09-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00089 | Trypsin | Trypsin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |