1QL7A

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Ph-Dependent Binding Modes Observed in Trypsin Crystals: Lessons for the Structure-Based Drug Design
pubmed doi rcsb
molecule tags Serine protease
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A02
2UWOA 3KCGH 1W13U 3ZYEA 2FOHA 4WVPE 3AVZA 2BDYA 4ABEA 1MCTA 3ATWA 2ZFFH 2ZKSA 1P9UA 1RJXB 2I6SA 2ZTZA 3LKWA 3SJIA 1TFXA 3H5CB 2FOCA 2BQ6B 4XBCA 3ENSB 1TX8A 2ZU2A 2VWNA 3GDUA 1C5NH 4B2CA 1TGCA 2C93B 4IN2A 1EZQA 3M37A 4NGAH 1S6FA 1KTSB 2IJOB 1BTWA 5JPMH 3E16B 1C1VH 2AMQA 1P2MA 3TJNA 3S69A 3M36A 3Q3XA 2FOMB 1PJPA 3GY5A 5F6MA 1LQDB 2HOBA 1QJ7B 1YF4A 1SLXB 4TPYA 2V3HH 3SGAE 2FLRH 1RD3B 5GPIB 1V6DA 3RC6A 1QB9A 4Y0ZE 1BRBE 1GI3A 1HIAA 5JBAS 2QXHA 1P2IA 5EPNA 5E8EH 4AFZA 3E3TA 3V12A 3RXTA 5JB8S 1P0SH 4AN7A 1O3NA 1H1BA 5LPRA 1TE0A 4IC5A 4JMYA 1KXDA 1CGJE 3LOXA 4YESB 2OCVB 5AF9H 2AMDA 3A7VA 3KQDA 1T7CA 1G3BA 1LKBA 1NESE 5FPYA 3SNDA 2A4GA 5CMXH 4X6NA 1EB1H 2AMPA 1ETTH 3S0NA 2D1JA 4D8NA 1KXEA 1K1JA 1IQJA 2VIPA 1NPMA 3RU4T 1MQ6A 1DY8A 1T31A 2W5EA 2ZHDA 1YPGH 1C2KA 4H4FA 2P3FH 1S0RA 3BEIB 1GJ4H 4Y8ZA 5ESTE 1QL8A 3RXHA 1CT4E 1VITF 2A7JA 5JBTA 2RG3A 4X1SU 4OGYA 4H6TA 1TALA 5L2YH 2WPKS 1DM4B 2ZGXH 1OSSA 1SBWA 1C5QA 3C1KA 1CBWC 1ZZZA 1ABJH 3S9AA 5GDSH 1CO7E 1AZZA 3V13A 1ARBA 4CH2B 4YT6H 1WAYB 3A87A 2ZDNA 3RU4E 2O8LA 1HV7A 1WV7H 4YOJA 1PYTC 4K69A 3D49H 1VJAU 1TA6A 4X6MA 3QLPH 2ZFSA 1J14A 1HAGE 3E0PB 4XE4A 1LPZB 1IQMA 1RTFB 3QO6A 3KHVA 1D3TB 1PPBH 1O5BB 1IQEA 1TMBH 1Y3WA 1JOUB 2R0LA 1BBRK 4D9QA 2THFB 4ZMAH 2ZNKH 3VB3A 3IWMA 3A89A 4RSPA 1SHHB 1XM1A 2ODPA 4KKDA 1BDAA 4AYYB 3Q3KA 4Y8YA 1VCQA 1SGYE 3RXGA 4X8VH 1P3EA 1A0LA 1TBRH 5DJ7A 1V3XA 3SU5A 2ZGCA 4CR5A 3U8TH 4DCDA 3SJ8A 3SZNA 2J9NA 2GT7A 2OQUA 3L33A 4WH8A 1OWKA 5E2PA 4ABIA 1DX5M 5F8ZA 3E6PH 4J2YB 1MBMA 1DLKB 1AKSA 1QB6A 6GCHG 4FU7A 2Z7FE 3IITA 4NIVA 4RKOB 2AIQA 2J4IA 4INKA 1OWJA 1DS2E 2UUFB 3AASA 3QK1A 3QZQA 3ESTA 5F8XA 3LPRA 1EPTA 2ANWA 4ZHAA 2OC7A 2FOFA 1HRTH 1IHTH 2AEIH 4MQAA 5E2OA 3MTYA 5LPFA 1LPKB 1MTVA 1MH0A 4GUXA 5J4QA 3EE0B 1XUKA 4D9RA 1MAYA 3VGCC 5DP5A 1V2OT 2OTVA 1O3AA 3SGQE 1C2MA 1NFWA 3I29A 4WXIA 1GVKB 2FS9A 1GCDA 6CHAB 3D65E 4SGAE 4HI3A 1QR3E 1A1RA 2FM2A 1V2WT 1BTUA 1CT2E 1A0HB 2Y7ZA 2GCHG 1QB1A 2GD4B 4BNRA 5DP7A 4E7RG 2Z9GA 1GPZA 1P12E 1DWDH 3JZ2B 4ZUHA 3UFAA 4X8SH 4WY3A 2NU1E 3QX5H 3GCTG 2Y5GA 1GJ5H 1F0UA 3DFLA 2VINA 2Q6GA 1IQIA 2R2WU 2SNVA 2JETC 3L3TA 3SJKA 1ZJDA 4ZHLU 4MLFB 1ESBA 3MU1A 3OTJE 3K9XB 2NWNA 2OINA 3LU9B 3LJJA 1GBAA 1XXFA 3FP7E 5TJXA 1O3HA 1O2OA 3NK8A 4WF8A 2GZ9A 4DOQA 1RFNA 1UTOA 2RA3A 1TOCB 1ZMNA 4SGBE 2ZP0H 1PFXC 2O8MA 1S5SA 4VGCB 4BTIB 1H8IH 1G37A 1DSTA 1ZSKA 1GJ6A 4ISLA 2ALPA 1A3BH 1HDTH 1AFEH 1UTJA 3A7XA 1TRNA 1C5YB 2PKSB 5DO4H 1KXAA 1UCYK 1O3PB 1EAWA 4YT7H 4DJZB 2HPQH 1P02A 1E35B 3IG6B 2VIDA 2BVSH 4X8UH 4E06H 2CGAA 5EQSA 5C1UA 4H42U 5ABWA 3RXRA 1HAVA 4AORA 5LPEA 2WPHS 3F9FA 4CHAB 1BQYA 1C1MA 3LGTA 5HM9A 5IDKA 2KAIB 4FVDA 2OP9A 4X6OA 2W7UA 3A8AA 2DE9A 4K2YA 2W7SA 1DY9A 2HPPH 4KP0A 3VB5A 2IOTA 2WUCA 4Q80A 5F03A 5L30H 2ZPQA 1GHVH 2PR3A 1XKBC 1O2SA 1V2ST 1C5LH 2SGPE 2UUJB 3MNBA 5C1YA 3PM3A 1ELAA 2ULLA 3PLKA 4HTCH 5EGMA 1MKWK 4ZH8A 1LHFH 3RXCA 1LDTT 1RTKA 2P3UB 1NC6A 3UREA 1MKXH 1DUAA 1EATA 5A0AE 1FUJA 2BLQA 4RKJB 5EXMA 5AHGH 1TMUH 4ABBA 1F0SA 1HNEE 1GMDG 1C2GA 1LKAA 3LDXH 4UEHH 3UOUA 4I33A 3ZVBA 1A5GH 1EXFA 3PMAB 1HIAB 5HGGA 2WPIS 3UOPA 3WY8A 1K2I1 1J17T 2FOAA 3BTFE 1TGSZ 5E0JA 3MH4A 5AFZH 1AVXA 1AQ7A 3MU8A 1EZXC 1RTLA 2BVXH 2BYAX 2JETB 2OQ5A 1AUTC 1S83A 3SV7A 1EZUC 2RA0A 4H6SB 4ZAEA 4OGXA 1UTNA 1O3JA 1ELVA 3MH7A 3URDA 2C3SA 2HNTE 1GDQA 3KL6A 1CHOF 5EW1H 1H9IE 3GCTF 4I8GA 3TU7H 1FY1A 4IW4E 1FIZA 4X1NU 1G30B 1SLUB 3A86A 1G3CA 2A2QH 4NZLA 1Y59T 2BZ6H 3FAOA 4K8BA 2BXTH 1CA0C 3PO1C 1AVWA 1T8OA 3Q76A 3ZVAA 1O2UA 5DGJA 1OP2A 3M5MA 2G4UA 3ZZ9A 1AIXH 4FUCA 3UY9A 1WUNH 2GZ8A 3NKKA 1EUFA 3TGJE 1NTPA 1T4VH 1O37A 1O5GH 1C5ZB 1Z7KA 3BIUH 1G32B 2OC8A 2V3OH 5GCHG 2BD9A 2NU3E 1TQ7B 3MO9A 3S9CA 2H9HA 4MPUA 1WTGH 5FXLA 2GX4A 1JRTA 2ZIQH 3MU4A 1VGCB 4UFDH 3O8CA 1Y5BT 2FYQA 1GBFA 2GGVB 1PPFE 3PTNA 1T32A 2GMTB 3TJUA 1O2QA 7GCHF 1GBHA 3SQHE 3BF6H 2CV3A 4ZKSU 4FUFA 2BDAA 1DWEH 4GLYA 5JYIA 5EQRA 1A4WH 2Y7XA 2FESH 3VXFH 5FCRA 5JBBS 1EJNA 2XBWA 2EA3A 2J92A 1A5HA 1TA2A 4GHQA 1C5WB 3EA9A 1EOJA 2EEKA 1C5PA 1AGJA 3M7TA 2G4TA 2QC2A 1SGRE 2HRVA 4UD9H 1J9CH 4JZ1A 1THSH 4NZQA 1GBTA 3V0XA 2J34A 2HNTC 4ABAA 1O2KA 1GBMA 5FAHA 5GXPA 4AFSA 3F1SB 4B73A 2UWLA 1AB9B 1C1WH 1AKSB 4ABJA 2A7HA 3A8DA 1GGDC 1P04A 1GHYH 2G00A 4R0IA 1PQ8A 1GBJA 2V35A 4I8LA 2ALVA 2SGAA 1NY22 1LHEH 1TONA 4JK5A 1QA0A 2GDEH 1O5AB 3TK6A 1G2LA 2ZDLA 4X2VA 3A82A 4DG4A 4I31A 1KIGH 1QJ6B 3MO6A 2A4OA 4D7GA 2ZCKP 4K1TA 1BMNH 2VGCB 3PB1E 1QRZA 1YBWA 1TYNA 5FX5A 4B76A 1BTYA 1VCWA 3CS0A 1HXFH 1YGCH 3GCHC 1H9HE 5HM2A 1S82A 2Z94A 1ETRH 1GMHF 1P2NA 2AGGX 1O2TA 1EZSC 2IN2A 2D26C 8GCHF 1YPHE 5G4BA 1DICA 1C1TA 2C90B 3RXDA 4AB9A 1WYKA 1AFQC 2ZTXA 4IMZA 1NU7B 1SHYA 3ZZBA 1ZHPA 4HGCA 1BTHH 1EAIA 1BITA 3PMHB 3MYWA 5I25A 5HYOA 4B75A 3BG4C 4YO9A 2FP7B 1SQAA 1FMGA 3OY5U 3ZZ3A 1ELCA 2ZHWH 3RXEA 2BY5X 1ZYOA 1VITG 2D8WA 1GWAA 4IBLH 4JYUH 3MNXA 4TYDA 2BD8A 1UK3A 2PLXA 2ILNA 1ZRKA 3M5OA 3FANA 1FIWA 2P95A 4INLA 8KME2 1RRKA 1NT1A 2CN0H 1ID5H 3E90B 1LHDH 1YP9A 3MU5A 1C2JA 2PKAA 3L6PA 4TPIZ 1B5GH 2F3CE 2R9PA 1K22H 1CE5A 4A92A 3T5FH 2JH6D 1BJVA 2VIOA 1MTNC 2HGTH 2Z3DA 4A7IB 3HATH 3TH4H 3M35A 3OX7U 2O8WA 1HJAC 4I8KA 1EAUA 1OWIA 1C4Y2 1QY6A 3SHAH 7KMEH 5JBCS 6LPRA 1Q2WA 2GDDA 3EAJA 5FPTA 2WPLS 4FXGH 1ARCA 1DPOA 4JZIA 2F9NA 3PYHA 1DUEA 1UJ1A 2ZFTA 2ZZUH 1NS3A 1Z1JA 4KELA 2KAIA 1L1JA 3GY3A 4UDWH 4Y0YE 1C1UH 1GHBF 1QGFA 4IC6A 3NXPA 4KTUA 2ZCHP 1QFKH 1HAVB 4LOYH 5SGAE 1V2PT 1MU6B 1LMWB 2F9VA 4NIWA 1ZOMA 2A31A 1YKTA 1WQVH 2BLWA 2F9UA 1SGFA 3GY7A 1O2MA 4MPXA 1YPHC 5J4SA 2FZZA 1YM0A 4O9VA 1AE5A 1M9UA 2V0BA 3LC3A 1SOTA 1P2JA 1Y3UA 1ZSJA 3M7QA 4Y7AA 1GI8B 1Z71A 2SNWA 1E37B 3ZVDA 1FXYA 1C5MD 3GCHB 1SOZA 2JH5D 5DPAA 2DE8A 3AW0A 1E36B 1MD8A 2PV9B 3M7UA 4WWYA 3K65B 2XW9A 1SB1H 1K9OE 1YPKH 4D7FA 1O3EA 1UTMA 3PWBA 1HAPH 3PWCA 1F92A 1ZPCA 2AH4X 3LONA 1BIOA 2ZGBH 5DP8A 2WUBA 5FPSA 3B9FH 4MPWA 1GBIA 9ESTA 3RDZA 1QCPA 1KLJH 4ZXXH 3GICB 4X1RU 4AFQA 1K1IA 1QHRB 2AFQB 1XXDA 1SGQE 3PLBA 1O3OA 3PMBB 1GJ8B 1O2IA 1GI4A 2Z3EA 2A5AA 2G81E 3RXBA 2QIQA 4YOIA 1MUEB 1O5DH 1HAIH 3SU1A 3A7ZA 1YCPM 3P8OA 2CHAB 3ATKA 1O3FA 3LGYA 1Z1IA 2WYGA 4GCHF 1O5FH 4WMFA 1A3EH 1XX9A 3KEEA 8ESTE 3HKIB 3EDXB 3BTEE 1O3LA 2BVRH 2H1UA 3LC5A 1DOJA 4B2AA 2NU2E 3GY6A 3MOCA 4KTCA 1GBKA 4OS5A 1ZSLA 5CHAC 1C5VA 2PSXA 1VZQH 1EAXA 1SL3A 3DA9B 1TRMA 2IPHA 1O3KA 1T8MA 2FTMA 2VIWA 1GI0A 1HAHH 3D23A 1VJ9U 2OC0A 5DP6A 1K28D 4DURA 4UFFH 2Y80A 1IAUA 1AI8H 1YPEH 1G2MA 3LIWA 3RXFA 1W14U 1EOLA 1DANH 3SQEE 1L0ZA 1C2FA 1KDQA 1DVAH 1ANBA 3TITA 5A8ZA 3PMJA 2P94A 2BDBA 3ZVEA 1GDNA 3RXJA 4MPVA 3P17H 1BMAA 3KQBA 4Y8XA 3UQOA 2PWXA 1U6QA 2ZWLH 1HFDA 1TWXB 4U2WA 1ELBA 2OLGA 5PTPA 3U9AH 4YTAA 2FODA 1IQGA 3BIVH 2CMYA 2VWMA 2FX6A 3W94A 2W3IA 2ZA5A 1UTLM 1QA7A 2QF0A 1LPGB 1BJUA 1O31A 3RC4A 1LVOA 1ELEE 2Z3CA 1FLEE 1B0FA 1OP8A 1O2YA 1GHAF 3K6YA 1NRQH 4ABFA 3DUXH 2A4RA 4JK6A 2ESTE 4ABGA 4B71A 2FEQH 1GBBA 1W0YH 3FZZA 1FI8A 3SBKA 2A4QA 3GDSA 3R0FA 2XCFA 2ZGHA 1F5RA 1ZGIA 3BTME 3O8BA 2Q1JA 1WBGB 4O3TA 1ZTLA 2ANYA 8LPRA 1HBTH 1TGBA 3SV9A 3FVFB 2Q6FA 4ISHH 1T8LA 1SGCA 2GP9B 3T26A 4ZROA 1CBWB 1CHOG 3LGVA 1GG6C 3MO3A 4CBNA 1HCGA 2BLOA 1SLWB 4WXVA 1NFUA 3HPTB 2R0KA 3F9GA 1MZDA 4OS6A 1QBVH 1QL9A 1Z8GA 2J38A 1QL7A 3EYDA 4I32A 3SU6A 5A8YA 1GHZA 5JB9S 3ZZ4A 1O2VA 2ZQ2A 1BHXF 4FUGA 1C2EA 1O2GH 1GI7B 1C9PA 5C67A 5FBEA 2FXRA 4WMEA 2BDIA 1N1LA 4CRCA 4GPGA 5K0HA 3NPSA 3PROA 4UE7H 1AO5A 2FLBH 3RXQA 4ISIH 1DDJA 4NSYA 2TGAA 2BY6X 3ATMA 4FVBA 2ZHEH 4DIHH 1K1MA 1SVPA 2BD5A 2M5TA 1AUJA 1H4WA 3Q00A 1O2WA 5T3HA 3FP8E 4HFPB 4BOHA 2PKAB 2VJ1A 1ZMLA 1VCPA 1CGHA 3M3TA 3AAVA 5T6FA 3EA8A 1C4U2 7GCHG 1O2LA 3T62A 3GOVB 1ZPBA 3QDZB 2TGPZ 1LHCH 3M3SA 1GVZA 4E05H 4X1PU 3D62A 4DIIH 4MVNA 1GCTC 3KN2A 1C2LA 1WTHD 1GI5A 3ZZ5A 1WU1A 3MMGA 1BHXB 1GBLA 1HXEH 2ZPSA 5C2ZA 1GJCB 3T27A 1SR5C 3A8BA 1C5XB 1TPSA 1UVSH 1OWEA 3GISB 4FU9A 2OXSA 4WJG2 2ZI2H 1F2SE 5GJ4B 1KLTA 1W3CA 2AYWA 1JIMA 3RMLH 5EPYA 4TWWA 1C1QA 3VGCB 1DWCH 2H2ZA 3ZYDA 1TX7A 1AY6H 1V2KT 1OKXA 2WV4A 4IS5A 2GCTC 1FAXA 5HMAA 3I78A 3URCA 4MDSA 2TRMA 1BBRH 2FOEA 2HLCA 1AVGH 1SGEE 2Q6DA 2D2DA 1BBRE 3KNXA 2QY0B 1XKAC 1PYTD 2ZHFH 4IGDA 3ZV8A 2ZC9H 3BG8A 1AU8A 3HGPA 4AGJA 1F7ZA 4CRGA 1BB0B 1DXWA 2BZAA 1NRRH 1V2LT 3HK6B 3F6UH 1XUFA 3UR6A 3SNEA 1ZHRA 2OBOA 2BD4A 4BAHB 1BRCE 2BQWB 3UR9A 1V2TT 4ABDA 1BRUP 1ELFA 1N8OC 2UWPA 3BEUA 1TQ0B 2FPZA 5A0BA 5CE1A 2ZEBA 2BTCE 1FV9A 3SU0A 1O32A 3F9HA 1YCPK 4JCNA 2BOKA 1GMHG 1QQUA 1UHBA 3SUGA 2F9BH 1AWFH 1NRSH 1FY4A 2ANMH 8GCHG 2HVXA 4DY7B 1SLVB 1UTKA 4XOJA 2C4FH 2Z9LA 4JZDH 1EPTC 1P05A 1JIRA 3A80A 1JMOH 2ZECA 3BEFB 2J95A 4UFGH 1MQ5A 4Y79A 1Y5AT 1MAXA 3MHWU 2PGQB 4A1VA 1KYNA 3OYPA 2FIRH 1XVMA 1UVTH 1BTXA 1JRSA 3G01A 4XDEA 5C3NA 2ZO3H 2ZU3A 4DT7B 3P70B 4NFEA 1TX6A 3LT3A 5DP4A 1SSXA 5FBIA 3T2NA 1GCTB 1DXPA 4BTUB 1P11E 1C5OH 1HAOH 1UVPA 5GIBA 5DG6A 2XC4A 1INCA 3NUMA 3K2UA 5IYTA 3SNCA 3VB4A 2ZTYA 4NWLA 3ODFA 1C4V2 2FDAA 1ELGA 2Y81A 1XUJA 1Z6EA 4GAWA 2YNAA 3RU4D 2FOGA 2Y6TA 1K21H 2PTNA 1GVLA 1FJSA 1IQHA 1O38A 2H5CA 2QCYA 5EXLA 2FX4A 1GL1A 4Y71A 3TK9A 2GCTB 3BTHE 1SI5H 2OD3B 2WINI 1UO6A 2VU8E 1E38B 1KDQB 4IMQA 1YPJH 1BUIA 1GJ7B 4D76A 1G9IE 3DT0H 1C2HA 1GI2A 1GHBG 2VB0A 2O9QA 4AFUA 2BLVA 2R3YA 1EP6A 3HKJB 1GJAB 1OPHB 1OX1A 1P2OA 2PUQH 4FU8A 4A6LA 2EI8A 4AGKA 1AMHA 5L2ZH 2BD7A 4YLQH 1UCYH 1KTTB 1CSOE 1FQ3A 1O2HA 1LVYA 1P9SA 1VR1H 7ESTE 4BTTB 3UQVA 1UCYE 3RXPA 1OWHA 2P93A 1P09A 1S85A 2GKVE 3RLYH 3TH3H 2ZGJA 4ZXYH 5EG4A 3P8GA 1N8OB 1TNHA 3FP6E 2XXLA 3TNTA 4K1SA 4WMDA 1TBQH 1W11U 1NRPH 2B0FA 1O2NA 2ZDVH 2OBQA 4NSVA 1ESAA 1FY8E 1CA0B 4ISOA 3UNSA 2AIPA 3PO1B 4BXSA 3ZZAA 3ZVCA 3SUFA 4O3UA 3CP7A 3M5LA 4U01A 4ZHMU 1BTZA 1F5KU 1OOKB 2G8TA 1PQ7A 3GYMA 1O5CB 5B6OA 5GWZA 4UFEH 1AD8H 2PGBB 4FUHA 1SQTA 2SGQE 1L1NA 5DP3A 1ANCA 1MKWH 2HNTF 2WV5A 3SN8A 1FPHH 1N6XA 3A81A 1FZZA 3QWCH 3LGIA 5K7RA 1TOMH 3ZZCA 3HGNA 3O8DA 1ZR0A 1IQNA 1QURH 3UPEA 2XTTB 2FI4E 1EQ9A 1UTQA 4E7NA 1ORFA 1DSUA 4XBDA 5E0HA 1TNIA 1G36A 1T8NA 1DITH 3U1JB 3PLPA 4BAKB 1VITH 3T28A 1GL0E 3RUOA 3RM2H 5H4IB 1A2CH 4PROA 4GCHG 3EA7A 1S84A 4AB8A 1Y8TA 3KGPA 4INHA 3STJA 2PFEA 3S7KB 3SNBA 4NIXA 3TJVA 4F4OC 1O33A 4X1QU 1RIWC 2ZPRA 2R2MB 3ZZ7A 1SQOA 1YLCA 3B23B 3GDVA 1YYY1 1Z6JH 1YCPH 2RDLA 3ELAH 3U8OH 1V2UT 3HK3B 1QNJA 1C5TA 3KQCA 3MFJA 4FUBA 4K60A 1TNLA 1LQEA 2A1DB 2XC0A 3QGJA 2GV7A 2SFAA 4Y7BA 3S7HB 4I7YH 1MU8B 1GI9B 4CR9A 2PW8H 1GGDB 1C5SA 1KXCA 3UUZA 1O3GA 3ZV9A 1ANEA 2QA9E 1OS8A 4UONA 4LXBH 1ACBE 2BXUH 1GBDA 1XMNB 2F9OA 3UNQA 2J2UA 4XSKU 3UNRA 1HJ9A 5A09A 3UIRA 2BOHB 1JBUH 4OS2A 2XCNA 1WOFA 3U69H 2WYJA 1SGPE 4YZUA 2EC9H 1TNGA 4X6PA 1D9IA 4AX9H 2H6MA 1W7XH 1KXBA 3A83A 1N6YA 1HAZB 1QQ4A 2K1QA 1J16A 1GHAG 3NCLA 3C27B 6ESTA 1ELTA 1TBZH 2Z6BD 4XBBA 4LZ4B 3BTTE 3BSQA 2BDGA 2XBVA 4LZ1H 1BZXE 2CJIA 2FOBA 5EQQA 1ZRBA 3MI4A 4OS4A 1AFQB 3VPKA 3RXVA 1K1NA 2Y82A 1D3QB 4K8YA 3VXEH 3MNCA 1A0JA 2Z9JA 1TGTA 1QBOA 3BG4B 2VVVA 3PTBA 1SFIA 2P59A 4K3JA 4OS1A 3QGNB 5A0CA 2HALA 3LJOA 3BTQE 2ZFPH 2PSYA 2W26A 2ASUB 2P3TB 1MZAA 1G3EA 1LCYA 1CHGA 3KQEA 2PUXB 4MNWA 3SO3A 4ASHA 2TPIZ 3MU0A 1ZHMA 1UK2A 1Y3YA 1UHBB 4ABHA 1CGIE 3A7YA 2CXVA 1RIWB 4Q7XA 4Z6AH 3SUEA 1ZMJA 2F9PA 3F9EA 3LH1A 2RCEA 2ZU5A 1MTNB 1FY5A 1P8VC 2WPMS 4X2YA 1KXFA 6CHAC 4ESTE 1C1NA 2VVUA 3QTOH 1HJAB 1O3MA 1D4PB 2BY9X 3TIUA 1O35A 1PPCE 2G5NA 3VB7A 4ISNA 2VWOA 4MNVA 5C5NA 1BMMH 1YPMH 4B74A 2XBYA 3SW2B 4CRAA 4GVUA 1EASA 1RS0A 1RGQA 1J15A 1SGFG 1O2PA 2B9LA 3R3GB 4MNXA 3RMNH 2P8OC 2WPJS 1GJ9B 4IN1A 1PPGE 1HB0B 2GZ7A 3VEQB 4THNH 4QT8C 3NZIA 1HLTH 1O34A 4FUJA 1SGTA 1BRAA 4XFQA 4BAOB 3TGIE 5BPEA 4O97A 1L4ZA 1Y3XA 1ZPZA 4I8HA 3NWUA 2DUCA 1O3CA 1LTOA 3H7TA 1QRXA 3ODDA 3H7OA 1KSNA 1GI1A 4AZ2B 4CREA 4ZKRU 3TLOA 4JYTA 1MKXK 3KIDU 2JH0D 3U1IB 1MTSA 2VNTA 1V2MT 2ZDAH 2H9EH 1FY3A 1GBEA 4VGCC 3RXOA 1K1PA 2G52A 3RMOH 2ZG0H 1W12U 4FUEA 1BOQA 1UK4A 1ELDE 1SFQB 1E0FD 4R8TB 5EODA 1BMLA 4JZFH 3RM0H 1O2RA 2PKSC 1YC0A 4AG1A 1XUHA 1L4DA 1AE8H 4MTBA 3SGBE 1HAYB 4YOGA 1TPOA 1DFPA 4TY7A 3E91A 3SORA 2SGFE 1NFYA 1YPLH 3A7TA 3DD2H 2BB4A 2V6NA 2C8YB 2J94A 1MBQA 3TPIZ 3QTVH 1GMCG 3RXKA 2ODYB 1V2RT 1AN1E 4GHTA 1D6RA 1Z8IB 2C8WB 5A8XA 1A7SA 3U8RH 1D3DB 4CHAC 1HGTH 3P92A 2B5TB 4X8TH 3RP2A 3RXIA 1FN8A 3SNAA 1B7XB 1DT2A 1E34B 2ANKH 3RLWH 5JDUB 1P3CA 3U98H 1ZGVA 2BX4A 1Q31A 5EU8A 5A2MH 2B7DH 2C8ZB 4NWKA 1JXPA 3E8LA 1TLDA 1SGDE 4AG2A 3P95A 3GYLB 4AOQA 3Q3YA 2QAAA 2UUYA 3V3MA 3P8FA 4NFFA 1O3IA 3UWJH 2ZCLP 2BHGA 4Y10E 3CS7A 4NCYA 3STIA 3Q77A 2A45B 2AERH 5CHAB 5TCCA 4RN6A 1NROH 2ZF0H 4CRFA 2GTBA 4NIYA 5L6NH 3SOSA 3EQ0H 3ZZ6A 4I8JA 1QIXB 2P8OB 1GBCA 5F8TA 1SPJA 1BTPA 3SUDA 4Y6DA 1V2JT 1XVOA 1EJMA 1Q3XA 4K5ZA 5FX6A 2JKHA 4Y11E 3TH2H 2A7CA 2STAE 2HWLB 2I6QA 1ABIH 1NU9A 2GVFA 1G3DA 1UTPA 3SJOA 2FI5E 1LHGH 1TB6H 4TY6A 2UUKB 1TMTH 1Z8JB 1FNIA 4WH6A 4TWYA 2H9TH 2AS9A 2H5DA 1B0EA 1ANDA 5ESBA 4X0WU 4O03A 5EW2H 3ZZ8A 1PQ5A 3SI3H 1C5RA 1O2JA 2FYRA 3ATLA 4Q7YA 3A88A 1JWTA 3GY8A 1EJAA 1ZTKA 1CQQA 2O8TA 1CT0E 2STBE 3SV2H 1EP5A 2R3UA 4CRDA 2XWBI 3TJOA 1AZ8A 1BA8B 4JYVH 1P57B 3A7WA 3RMMH 1Z8RA 1XUGA 3A8CA 4OS7A 2XRCA 1P03A 3SV8A 2ZFQH 2QF3A 1O5EH 3MH5A 1K1LA 3TK5A 1AWHB 1L1GA 1OYQA 2BDHA 1PPHE 3TGKE 5EXNA 3A84A 1P2KA 1VGCC 3W95A 5FCKA 5AFYH 3LGWA 1C2DA 1FDPA 2ZDKA 2GMTC 4X2WA 1C1PA 4GSOA 3M5NA 2CF9H 3UWIA 4B1TA 2F83A 2TIOA 2G5VA 1BCUH 3T29A 1UMAH 1T4UH 3AAUA 3TNSA 5C20A 3VFEA 1K1OA 1GI6A 1FONA 2QGRA 6GCHF 4A1XA 1HUTH 1GMCF 1S6HA 3MWIU 1O0DH 2GT8A 1TIOA 3GCOA 5ETXA 1C9TA 1W2KH 1GG6B 1X7AC 2ZHQH 3T25A 1ZTJA 2VH6A 1CU1A 2OC1A 1ZJKA 3BTWE 4A1TA 1SC8U 2F91A 9LPRA 2P16A 4X2XA 4KTSA 2B8OH 3SHCH 3FZDA 2XWAA 1AB9C 5E0GA 1LVBA 4JZEH 1O39A 1TPAE 2ZU1A 3ZZDA 3CENA 1TNJA 3A85A 1Y3VA 1GHXH 3ZVGA 1A61H 2EI6A 1C5UA 2GCHF 4KGAA 1HYLA 1O2XA 3I77A 1HPGA 2FS8A 3SJ9A 2SGEE 2VH0A 4Y76A 3M61U 1HJ8A 1S81A 3UTUH 2AGEX 1MTUA 2YNBA 3V7TA 3DFJA 2NU0E 2QXIA 4YLUA 4NA9H 4HZHA 3BV9B 1FPCH 3BTGE 1P2QA 1THPB 2VGCC 3E1XB 2QXGA 4F49A 2QV1A 1C2IA 1TNKA 1IHSH 3EGKH 4LK4A 2BD3A 5AVDA 3SU2A 4DGJA 2OUAA 5C5OA 5LH8A 1DLEA 1XUIA 1V2VT 4J1YA 2VVCA 3RC5A 3MH6A 1KY9A 1OWDA 1TAWA 1YLDA 2PTCE 1SGNE 2BDCA 1V2NT 1W0ZU 3F68H 4K1EA 2ZDMA 1DE7H 1F5LA 1TPPA 3OSYA 4ZKNU 1J8AA 1LO6A 2XC5A 2W3KA 3M3VA 2QYIA 3P8NA 2CF8H 3RXUA 1HAXB 1P10A 3LGUA 4AYVB 3RXAA 2FWWA 1O3DA 1SMFE 1FN6A 1A46H 4FUDA 5DP9A 4Z0KA 2Z9KA 2NU4E 3KF2A 3JZ1B 2GV6A 1W10U 1NRNH 3BTDE 4CBOA 1A5IA 2LNCA 1PQAA 4BAQB 2Y5FA 1DWBH 1EX3A 2AGIX 1IQKA 2XBXA 1L2EA 2Y5HA 3RXLA 5DKMA 4BAMB 1TABE 3SU3A 2XYAA 4A5TS 1OYTH 3QN7A 3VB6A 5EOKA 3RXSA 1AHTH 1GJBB 1P06A 2Z9IA 3BN9A 1RXPA 1H9LB 1SGIB 1C1OA 3ATIA 4U32A 4CRBA 3K6ZA 3S9BA 2A2XH 2A32A 2TBSA 3B8JA 5FHTA 7LPRA 1F0TA 3P6ZB 1P01A 4DVAU 2QXJA 2A0QB 3MNSA 2VWLA 4U30A 4YM9A 1V2QT 1LVMA 1S0QA 4NA8A 1CVWH 1GMDF 1TGNA 5BRRE 1EKBB 1EPTB 2VIVA 3SV6A 1GHWH 3QUMP 2A5IA 1KLIH 1O2ZA 2BM2A 3OY6U 3GY2A 1ESTA 2YOLA 4MG3A 1WSSH 2ZFRH 1PPZA 1O3BA 1WQSA 5I46H 3GY4A 5TCAA 3ZVFA 1NN6A 1PPEE 1WCZA 2BY8X 1W8BH 1C1SA 2ODQA 1BT7A 1QTFA 1EB2A 1O30A 1D6WA 1OP0A 3QZRA 2TGDA 2PHBA 1O36A 4FUIA 1FAKH 1Y5UT 4Q2KA 1UVOA 2EI7A 3LH3A 1GJDB 3OU0A 2BY7X 1F0RA 1MCVA 1D3PB 2A5KA 2FTLE 2XNIA 1QBNA 1MMJN 1ZLRA 4ZKOU 3GCNA 5HXFA 1NZQH 2C8XB 5DK1A 1QRWA 4B2BA 2SGDE 1IQFA 1C1RA 1UVUH 4MNYA 3SI4H 1SG8B 5T6GA 1NFXA 1IOEA 4NG9H 5LGOA 2LPRA 2TGTA 2BMGB 4Q7ZA 3N7OA 3SU4A 3RXMA 1QJ1B 3ITIA 2BQ7B 1TRYA 5GCHF 5T6DA 3FFGA 5C1XA 2G51A 1W7GH 2ZQ1A 3E0NB 2ZU4A 4DW2U 1ETSH 1CA8B 2FO9A 1MD7A 4NA7A 1NM6A 4BANB 3TVJB 1GDUA 1OXGA 2G55A 1THRH 4CH8B 3AW1A 3DHKH 2VIQA 1NO9H 4M7GA 1H8DH 2BX3A 2FI3E 2CHAC 2QN5T 3BTKE 2FMJA 1IQLA 2O8UA 4BXWA 2BD2A 3PV4A 1MTWA 3O8RA
chains in the Genus database with same CATH superfamily
2UWOA 3KCGH 1W13U 3ZYEA 2FOHA 4WVPE 3AVZA 2BDYA 4ABEA 1MCTA 3ATWA 2ZFFH 2ZKSA 1P9UA 1RJXB 2I6SA 2ZTZA 3LKWA 3SJIA 1TFXA 3H5CB 2FOCA 2JJ2D 2BQ6B 4XBCA 3ENSB 1TX8A 2ZU2A 2VWNA 3GDUA 1C5NH 4B2CA 1TGCA 3VG8A 2C93B 4IN2A 1EZQA 3M37A 4NGAH 1S6FA 1KTSB 2IJOB 1BTWA 2KCPA 3E16B 5JPMH 1C1VH 2AMQA 1P2MA 3TJNA 3S69A 3M36A 3Q3XA 2FOMB 1PJPA 3GY5A 5F6MA 1LQDB 2HOBA 1QJ7B 1YF4A 1SLXB 4TPYA 2V3HH 3SGAE 4P02A 2FLRH 1RD3B 5GPIB 1V6DA 3RC6A 1QB9A 4Y0ZE 1BRBE 1GI3A 1HIAA 2LP6A 5JBAS 2QXHA 1P2IA 5EPNA 4I86A 5E8EH 4AFZA 3E3TA 3V12A 3RXTA 5JB8S 1P0SH 4AN7A 1O3NA 1H1BA 5LPRA 1TE0A 4IC5A 4JMYA 1KXDA 1CGJE 3LOXA 4YESB 2OCVB 5AF9H 2AMDA 3A7VA 3KQDA 1T7CA 1G3BA 1LKBA 1NESE 5FPYA 3SNDA 2A4GA 5CMXH 4X6NA 1EB1H 2AMPA 1ETTH 2KX4A 3S0NA 2D1JA 4D8NA 1KXEA 1K1JA 1IQJA 2VIPA 1NPMA 3RU4T 1MQ6A 1DY8A 1T31A 2W5EA 2ZHDA 1YPGH 1C2KA 3PRBA 4H4FA 2P3FH 1S0RA 3BEIB 1YY3A 1GJ4H 4Y8ZA 5ESTE 1QL8A 3RXHA 1CT4E 1VITF 2A7JA 5JBTA 2RG3A 4X1SU 4OGYA 4H6TA 2IJD1 1TALA 5L2YH 2WPKS 3U28C 1DM4B 2ZGXH 1OSSA 1SBWA 1C5QA 3C1KA 1CBWC 1ZZZA 1ABJH 3S9AA 5GDSH 1CO7E 1AZZA 3V13A 4TT3D 1ARBA 4CH2B 4YT6H 1WAYB 3A87A 2ZDNA 3RU4E 2O8LA 1HV7A 1WV7H 4YOJA 1PYTC 4K69A 3D49H 1VJAU 1TA6A 4X6MA 3QLPH 2ZFSA 1J14A 1HAGE 3E0PB 4XE4A 1LPZB 1IQMA 2WV9A 1RTFB 3QO6A 3KHVA 1D3TB 1PPBH 1O5BB 5FL7D 1IQEA 1TMBH 1Y3WA 1JOUB 2R0LA 1BBRK 4D9QA 2THFB 4ZMAH 2ZNKH 3VB3A 3IWMA 3A89A 4RSPA 1SHHB 1XM1A 2ODPA 4KKDA 1BDAA 4AYYB 3WWFA 3Q3KA 4Y8YA 1VCQA 1SGYE 3RXGA 4X8VH 1P3EA 1A0LA 3FKSD 1TBRH 5DJ7A 1V3XA 3SU5A 2ZGCA 4CR5A 3U8TH 4DCDA 3SJ8A 3SZNA 2J9NA 2GT7A 2OQUA 1WDIA 3L33A 4WH8A 1OWKA 5E2PA 4ABIA 1DX5M 5F8ZA 4RT0A 3E6PH 4J2YB 1MBMA 1DLKB 1AKSA 1QB6A 6GCHG 4FU7A 2Z7FE 3IITA 4NIVA 4RKOB 2AIQA 2J4IA 4INKA 1OWJA 1DS2E 2UUFB 3AASA 3QK1A 1E1QD 3QZQA 3ESTA 5F8XA 3LPRA 4XD7D 1EPTA 2ANWA 4ZHAA 2OC7A 1NBME 2FOFA 1HRTH 1IHTH 2AEIH 4MQAA 5E2OA 3MTYA 5LPFA 1LPKB 1MTVA 1MH0A 4GUXA 5J4QA 3EE0B 1XUKA 4D9RA 1MAYA 3VGCC 5DP5A 1V2OT 2OTVA 1O3AA 3SGQE 1C2MA 1NFWA 3I29A 4WXIA 1GVKB 3UAIC 2FS9A 1GCDA 6CHAB 3D65E 4SGAE 4HI3A 1QR3E 1A1RA 2FM2A 1V2WT 1BTUA 1CT2E 1A0HB 2Y7ZA 3DSOA 2GCHG 1QB1A 2GD4B 4BNRA 4RI0A 5DP7A 2Z9GA 4E7RG 1GPZA 1P12E 1DWDH 3JZ2B 4ZUHA 3UFAA 4X8SH 4WY3A 2NU1E 2W6JD 3QX5H 4DT4A 3GCTG 2Y5GA 4YXWD 1GJ5H 1F0UA 3DFLA 2VINA 2WZQA 2Q6GA 1IQIA 2R2WU 2SNVA 2JETC 3L3TA 3SJKA 1ZJDA 4ZHLU 2KCOA 4MLFB 1ESBA 3MU1A 3OTJE 3PV2A 3K9XB 2NWNA 2OINA 3LU9B 3LJJA 1GBAA 2F4LA 1XXFA 3FP7E 5TJXA 1O3HA 1O2OA 3DSPA 3NK8A 4WF8A 2GZ9A 4DOQA 1RFNA 1UTOA 2RA3A 1TOCB 3WWBA 1ZMNA 4SGBE 2ZP0H 1PFXC 2O8MA 1S5SA 4VGCB 4BTIB 1H8IH 1G37A 1DSTA 1ZSKA 1GJ6A 4ISLA 2ALPA 1A3BH 1HDTH 1AFEH 1UTJA 3A7XA 1TRNA 1C5YB 2PKSB 5DO4H 1KXAA 1UCYK 1O3PB 1EAWA 4YT7H 4DJZB 2HPQH 1P02A 1E35B 3IG6B 2VIDA 2BVSH 4X8UH 2K8IA 4E06H 2CGAA 5EQSA 5C1UA 4H42U 5ABWA 3RXRA 3OTPA 2QF4A 1HAVA 4AORA 5LPEA 2WPHS 3F9FA 4CHAB 1BQYA 1C1MA 3LGTA 5HM9A 5IDKA 2KAIB 4FVDA 2OP9A 4X6OA 2W7UA 3A8AA 2DE9A 4K2YA 2W7SA 1DY9A 2HPPH 4KP0A 3VB5A 2IOTA 5HKKD 2WUCA 4Q80A 5F03A 5L30H 2ZPQA 1GHVH 2PR3A 2KR7A 1XKBC 1O2SA 1V2ST 1C5LH 2SGPE 2UUJB 3MNBA 5C1YA 3PM3A 1ELAA 2ULLA 3PLKA 4HTCH 5EGMA 1MKWK 4ZH8A 1K0HA 1LHFH 3RXCA 1LDTT 1RTKA 2P3UB 1NC6A 3UREA 1MKXH 1DUAA 1EATA 5A0AE 1FUJA 2BLQA 4RKJB 5EXMA 5AHGH 1TMUH 4ABBA 1F0SA 1HNEE 1GMDG 1C2GA 1LKAA 3LDXH 3WW7A 4UEHH 3UOUA 4I33A 3ZVBA 1A5GH 1EXFA 3PMAB 1HIAB 5HGGA 2WPIS 3UOPA 3WY8A 1K2I1 1J17T 2FOAA 3BTFE 1TGSZ 5E0JA 3MH4A 5AFZH 1AVXA 1AQ7A 3MU8A 1EZXC 1RTLA 2BVXH 2BYAX 2JETB 2OQ5A 1AUTC 1S83A 4AC9A 3SV7A 1EZUC 2RA0A 4H6SB 4ZAEA 2HVYB 4OGXA 1UTNA 1O3JA 1ELVA 3MH7A 3URDA 2C3SA 2HNTE 1GDQA 3KL6A 1CHOF 5EW1H 1H9IE 3GCTF 4I8GA 3TU7H 1FY1A 4IW4E 1FIZA 4X1NU 1G30B 1SLUB 3A86A 1G3CA 2A2QH 4NZLA 1Y59T 2BZ6H 2KZ4A 5C94A 3FAOA 4K8BA 2BXTH 1CA0C 3PO1C 1AVWA 1T8OA 3Q76A 3ZVAA 1O2UA 5DGJA 1OP2A 3M5MA 2G4UA 3ZZ9A 1AIXH 4FUCA 3UY9A 1WUNH 2GZ8A 3NKKA 1EUFA 3TGJE 1NTPA 1T4VH 1O37A 1O5GH 1C5ZB 1Z7KA 3BIUH 1G32B 2OC8A 2V3OH 5GCHG 2BD9A 2NU3E 1TQ7B 3MO9A 3S9CA 2H9HA 4MPUA 2OK5A 1WTGH 5FXLA 2GX4A 1JRTA 2ZIQH 3MU4A 3NRLA 1VGCB 4UFDH 3O8CA 1Y5BT 1S6LA 2FYQA 1GBFA 2GGVB 1PPFE 3PTNA 1T32A 2GMTB 3TJUA 1O2QA 7GCHF 1GBHA 3SQHE 3BF6H 2CV3A 4ZKSU 4FUFA 3DCLA 2BDAA 1DWEH 4GLYA 5JYIA 5EQRA 1A4WH 2Y7XA 2FESH 3VXFH 5FCRA 5JBBS 1EJNA 2J5UA 2XBWA 2EA3A 2J92A 1A5HA 1TA2A 4GHQA 1C5WB 3EA9A 1EOJA 2EEKA 1C5PA 1AGJA 3N7DA 3M7TA 2G4TA 2QC2A 2HLDD 1SGRE 2HRVA 4UD9H 1J9CH 4JZ1A 1THSH 4NZQA 1GBTA 3V0XA 2J34A 2HNTC 4ABAA 1O2KA 1GBMA 5FAHA 5GXPA 4AFSA 3F1SB 4B73A 2UWLA 1AB9B 1C1WH 1AKSB 4ABJA 2A7HA 3A8DA 1GGDC 1P04A 1GHYH 3KYGA 2G00A 4R0IA 1PQ8A 1GBJA 2V35A 4I8LA 2ALVA 2SGAA 1NY22 1LHEH 1TONA 4JK5A 1QA0A 2GDEH 1O5AB 3DSGA 3OEED 3TK6A 1G2LA 4TSFD 2ZDLA 4X2VA 3A82A 4DG4A 4I31A 1KIGH 5T1VA 1QJ6B 3MO6A 2A4OA 4D7GA 2ZCKP 4K1TA 1BMNH 2VGCB 3PB1E 1QRZA 1YBWA 1TYNA 5FX5A 4B76A 1BTYA 1VCWA 3CS0A 1HXFH 1YGCH 3H09A 3GCHC 1H9HE 5HM2A 1S82A 2Z94A 1ETRH 1GMHF 1P2NA 2AGGX 1O2TA 1EZSC 2IN2A 3FOAA 2D26C 8GCHF 1YPHE 5G4BA 1DICA 1C1TA 2C90B 3RXDA 4AB9A 1WYKA 1AFQC 2ZTXA 4IMZA 1NU7B 1SHYA 3ZZBA 1ZHPA 4HGCA 1BTHH 3F3BA 1EAIA 1BITA 3PMHB 3MYWA 5I25A 5HYOA 4B75A 3BG4C 4YO9A 2FP7B 1SQAA 1FMGA 3OY5U 3ZZ3A 1ELCA 2QF5A 2ZHWH 3RXEA 2BY5X 1ZYOA 1VITG 2D8WA 1GWAA 4IBLH 4JYUH 3MNXA 2RFKC 4TYDA 1VKYA 2BD8A 1UK3A 2PLXA 2ILNA 1ZRKA 3M5OA 3FANA 1FIWA 2IPQX 2P95A 4INLA 8KME2 1RRKA 1NT1A 2CN0H 1ID5H 3E90B 4OM9A 1LHDH 1YP9A 3MU5A 1C2JA 2PKAA 3L6PA 4TPIZ 1B5GH 5KGOA 2F3CE 2R9PA 1K22H 1CE5A 4A92A 3T5FH 2JH6D 1BJVA 2VIOA 1MTNC 2HGTH 2Z3DA 4A7IB 3HATH 3TH4H 3M35A 3OX7U 1COWD 2O8WA 1HJAC 4I8KA 1EAUA 1OWIA 1C4Y2 1QY6A 3SHAH 7KMEH 5JBCS 6LPRA 1Q2WA 2GDDA 3EAJA 5FPTA 2WPLS 4FXGH 1ARCA 1DPOA 4JZIA 2F9NA 3PYHA 1DUEA 1UJ1A 2ZFTA 2ZZUH 1NS3A 1Z1JA 4KELA 2KAIA 1L1JA 3GY3A 4UDWH 4Y0YE 1C1UH 1GHBF 1QGFA 4IC6A 3NXPA 4KTUA 2ZCHP 1QFKH 1HAVB 2JDID 4LOYH 5SGAE 1V2PT 1MU6B 1LMWB 2KCAA 2F9VA 4NIWA 1ZOMA 2A31A 1YKTA 1WQVH 2BLWA 2F9UA 1SGFA 3GY7A 1O2MA 4MPXA 1YPHC 5J4SA 2FZZA 1YM0A 4O9VA 1AE5A 1M9UA 2WSSD 2V0BA 3LC3A 1SOTA 1P2JA 1Y3UA 1ZSJA 3M7QA 4Y7AA 1GI8B 1Z71A 2SNWA 3UB0A 1E37B 3ZVDA 1FXYA 1C5MD 3GCHB 1SOZA 2JH5D 5DPAA 2DE8A 3AW0A 1E36B 1MD8A 2PV9B 3M7UA 4WWYA 3K65B 2XW9A 1SB1H 1K9OE 1YPKH 1SKYE 4D7FA 1O3EA 4M9FA 1UTMA 3PWBA 1HAPH 3PWCA 1F92A 1ZPCA 2AH4X 3LONA 1BIOA 2ZGBH 5DP8A 2WUBA 5FPSA 3B9FH 4MPWA 1GBIA 9ESTA 3RDZA 1QCPA 1KLJH 4ZXXH 3GICB 4X1RU 4AFQA 5CDFE 1K1IA 1QHRB 2AFQB 1XXDA 1SGQE 3PLBA 1O3OA 3PMBB 1GJ8B 4HG6A 1O2IA 1GI4A 2Z3EA 2A5AA 2G81E 3RXBA 2QIQA 4YOIA 1MUEB 1O5DH 1HAIH 3SU1A 3A7ZA 1YCPM 3P8OA 2CHAB 3ATKA 1O3FA 3LGYA 1Z1IA 2WYGA 4GCHF 1O5FH 4WMFA 1A3EH 1XX9A 3KEEA 8ESTE 3HKIB 3EDXB 3BTEE 1O3LA 1UW7A 2BVRH 2H1UA 3LC5A 1DOJA 4B2AA 2NU2E 3GY6A 3MOCA 4KTCA 1GBKA 4OS5A 1ZSLA 5CHAC 1C5VA 2PSXA 1VZQH 1EAXA 1SL3A 3DA9B 1TRMA 2IPHA 1O3KA 1T8MA 2FTMA 5EJLA 2VIWA 1GI0A 1HAHH 3D23A 1VJ9U 2OC0A 5DP6A 1K28D 4DURA 4UFFH 2Y80A 1IAUA 4FOUC 1AI8H 1YPEH 1G2MA 3LIWA 3RXFA 1W14U 1EOLA 1DANH 3SQEE 1L0ZA 1C2FA 1KDQA 1DVAH 1ANBA 3TITA 5A8ZA 3PMJA 2P94A 2BDBA 3ZVEA 1GDNA 3RXJA 4MPVA 4B6EA 5CHBA 3P17H 1BMAA 3KQBA 4Y8XA 3N7EA 3UQOA 2PWXA 1U6QA 2ZWLH 1HFDA 1TWXB 4U2WA 1ELBA 2OLGA 5PTPA 3U9AH 4YTAA 2FODA 1IQGA 3BIVH 2CMYA 2VWMA 2FX6A 3W94A 2W3IA 2ZA5A 1UTLM 1QA7A 2QF0A 1LPGB 1BJUA 5C0TA 1O31A 3F0OA 3RC4A 1LVOA 1ELEE 2Z3CA 1FLEE 1B0FA 1OP8A 1O2YA 1GHAF 3K6YA 1NRQH 4ABFA 3DUXH 2A4RA 4JK6A 2ESTE 4ABGA 5DN6D 3N99A 4Q63A 4B71A 2J98B 2FEQH 1GBBA 1W0YH 3FZZA 1FI8A 3SBKA 2A4QA 3GDSA 3R0FA 2XCFA 2ZGHA 1F5RA 1ZGIA 3BTME 3O8BA 2Q1JA 1WBGB 4O3TA 1ZTLA 2ANYA 8LPRA 1HBTH 1TGBA 3SV9A 3FVFB 2Q6FA 4ISHH 1T8LA 1E79D 1SGCA 2GP9B 3T26A 4ZROA 1CBWB 1CHOG 3LGVA 1GG6C 3MO3A 4CBNA 1HCGA 2BLOA 1SLWB 4WXVA 1NFUA 3HPTB 2R0KA 3F9GA 1MZDA 4XRNA 4OS6A 4ACBA 1QBVH 1QL9A 1Z8GA 2J38A 1QL7A 3EYDA 4I32A 3SU6A 5A8YA 1GHZA 5JB9S 3ZZ4A 1O2VA 1SQRA 2ZQ2A 1BHXF 4FUGA 1C2EA 1O2GH 1GI7B 1C9PA 5C67A 5FBEA 2FXRA 4WMEA 2BDIA 1N1LA 4CRCA 4GPGA 5K0HA 3NPSA 3PROA 4UE7H 1AO5A 2FLBH 3RXQA 4ISIH 1DDJA 4NSYA 2TGAA 2BY6X 3ATMA 4FVBA 2ZHEH 4DIHH 1K1MA 1SVPA 2BD5A 2M5TA 1AUJA 1H4WA 3Q00A 1O2WA 5T3HA 3FP8E 4HFPB 4BOHA 4RT1A 2PKAB 2VJ1A 1ZMLA 1VCPA 1CGHA 3M3TA 3AAVA 5T6FA 3EA8A 1C4U2 7GCHG 1O2LA 3T62A 3GOVB 1ZPBA 3QDZB 2TGPZ 1LHCH 3M3SA 1GVZA 4E05H 4X1PU 3D62A 4DIIH 4MVNA 1GCTC 3KN2A 1C2LA 1WTHD 1GI5A 3ZZ5A 1WU1A 3MMGA 1BHXB 1GBLA 1HXEH 2ZPSA 2PP6A 5C2ZA 1GJCB 3T27A 1SR5C 3A8BA 1C5XB 1TPSA 1UVSH 1OWEA 2EQNA 3GISB 4FU9A 2OXSA 4WJG2 2ZI2H 1F2SE 5GJ4B 1KLTA 1W3CA 2AYWA 1JIMA 1E1RD 3RMLH 5EPYA 4TWWA 1C1QA 3VGCB 1DWCH 2H2ZA 3ZYDA 1TX7A 1AY6H 1V2KT 1OKXA 2WV4A 4IS5A 2GCTC 1FAXA 5HMAA 3I78A 3URCA 4MDSA 2TRMA 1BBRH 2FOEA 3OEHD 2HLCA 1AVGH 1SGEE 2Q6DA 2D2DA 1BBRE 3KNXA 2QY0B 1XKAC 1PYTD 2ZHFH 3EE7A 4IGDA 3ZV8A 2ZC9H 3BG8A 1AU8A 3HGPA 4AGJA 1F7ZA 4CRGA 1BB0B 1DXWA 2BZAA 1NRRH 1V2LT 3HK6B 3F6UH 1XUFA 3UR6A 3SNEA 1ZHRA 2OBOA 2BD4A 4BAHB 1BRCE 2BQWB 3OAAD 3UR9A 1V2TT 4ABDA 1BRUP 1ELFA 1N8OC 2UWPA 3BEUA 1TQ0B 2FPZA 5A0BA 4Q4LA 5CE1A 2ZEBA 2BTCE 1FV9A 3SU0A 1O32A 3F9HA 1YCPK 4JCNA 2BOKA 1GMHG 1QQUA 1UHBA 3SUGA 2F9BH 1AWFH 1NRSH 1FY4A 2ANMH 8GCHG 2HVXA 4DY7B 1SLVB 1UTKA 4XOJA 2C4FH 2Z9LA 4JZDH 1EPTC 1P05A 1JIRA 3A80A 1JMOH 2ZECA 3BEFB 2J95A 4UFGH 1MQ5A 4Y79A 1Y5AT 1MAXA 3MHWU 2PGQB 4A1VA 1KYNA 3OYPA 2FIRH 1XVMA 2XOKD 1UVTH 1BTXA 1JRSA 2M2AA 3G01A 4XDEA 5C3NA 2ZO3H 2ZU3A 4DT7B 3P70B 4NFEA 1TX6A 3LT3A 5DP4A 1SSXA 5FBIA 3T2NA 1GCTB 1DXPA 3OE7D 1P11E 4BTUB 1C5OH 1HAOH 1UVPA 5GIBA 5DG6A 2XC4A 1INCA 3NUMA 3K2UA 5IYTA 3SNCA 3VB4A 2ZTYA 4NWLA 3ODFA 1C4V2 2FDAA 1ELGA 2Y81A 1XUJA 1Z6EA 4GAWA 2YNAA 3RU4D 2FOGA 2Y6TA 1K21H 2PTNA 1GVLA 1FJSA 1IQHA 1O38A 2H5CA 2QCYA 5EXLA 2FX4A 1GL1A 4Y71A 3TK9A 2KM0A 2GCTB 3BTHE 1SI5H 2OD3B 2WINI 1UO6A 2VU8E 1E38B 2XNDD 1KDQB 4IMQA 1YPJH 1BUIA 1GJ7B 4D76A 1G9IE 3DT0H 1C2HA 1GI2A 1GHBG 2VB0A 2O9QA 4AFUA 2BLVA 2R3YA 1EP6A 3HKJB 1GJAB 1OPHB 1OX1A 1P2OA 2PUQH 4FU8A 4A6LA 2EI8A 4AGKA 1AMHA 5L2ZH 2BD7A 4YLQH 1UCYH 1KTTB 1CSOE 1FQ3A 1O2HA 1LVYA 1P9SA 1VR1H 7ESTE 4BTTB 3UQVA 1UCYE 3RXPA 1OWHA 2P93A 1P09A 1S85A 2GKVE 3RLYH 3TH3H 2ZGJA 4ZXYH 5EG4A 3P8GA 1N8OB 2J98A 1TNHA 3FP6E 2XXLA 3TNTA 4K1SA 4WMDA 1TBQH 1W11U 1NRPH 2B0FA 1O2NA 2ZDVH 2OBQA 4NSVA 1ESAA 1FY8E 1CA0B 4ISOA 3UNSA 2AIPA 3PO1B 4BXSA 3ZZAA 3ZVCA 3SUFA 1NBMD 4O3UA 3CP7A 3M5LA 4U01A 5IK2D 4ZHMU 1BTZA 1F5KU 1OOKB 2G8TA 1PQ7A 3GYMA 1O5CB 5B6OA 5GWZA 4UFEH 1AD8H 3F2FA 2PGBB 4FUHA 1SQTA 2SGQE 1L1NA 5DP3A 1ANCA 1MKWH 2HNTF 2WHXA 2WV5A 3SN8A 1FPHH 1N6XA 3A81A 1FZZA 3QWCH 1H8HD 3LGIA 5K7RA 1TOMH 4B6FA 3ZZCA 3HGNA 3O8DA 1ZR0A 2YMSC 1IQNA 1QURH 3OFND 2XTTB 3UPEA 2FI4E 1EQ9A 1UTQA 4E7NA 1ORFA 1DSUA 4XBDA 5E0HA 1TNIA 1G36A 1T8NA 1DITH 3U1JB 3PLPA 4BAKB 1VITH 3T28A 1GL0E 1OHHD 2J97A 2K0QA 3RUOA 3RM2H 3PV5A 5H4IB 1A2CH 5B6LA 4PROA 4GCHG 2L74A 1S84A 3EA7A 1Y8TA 4AB8A 3KGPA 4INHA 2V7QD 3STJA 2PFEA 3S7KB 3SNBA 4NIXA 3TJVA 4F4OC 1O33A 4X1QU 1RIWC 2ZPRA 2R2MB 3ZZ7A 1SQOA 1YLCA 3B23B 5GNDA 2JIZD 2JJ1D 3GDVA 1YYY1 1Z6JH 1YCPH 2RDLA 3ELAH 3U8OH 1V2UT 3HK3B 4F55A 1QNJA 1C5TA 3KQCA 3MFJA 4FUBA 4K60A 1TNLA 1LQEA 2A1DB 2XC0A 3QGJA 2GV7A 2SFAA 4Y7BA 3S7HB 4I7YH 1MU8B 1GI9B 4CR9A 2PW8H 1GGDB 1C5SA 1KXCA 3UUZA 1O3GA 4ZCNA 3ZV9A 1ANEA 1YWUA 3MQKC 2QA9E 1OS8A 4UONA 4LXBH 1ACBE 1BMFD 2V3MA 2BXUH 1GBDA 1XMNB 2F9OA 3UNQA 2J2UA 4XSKU 3UNRA 1HJ9A 5A09A 3UIRA 2BOHB 1YLNA 2AHME 5DSFA 1JBUH 5EJZA 4OS2A 2XCNA 1WOFA 2W6ID 3U69H 2WYJA 1SGPE 4YZUA 2EC9H 1TNGA 4X6PA 1D9IA 4AX9H 2H6MA 1W7XH 1KXBA 3A83A 1N6YA 1HAZB 1QQ4A 2K1QA 1J16A 1GHAG 3NCLA 3C27B 6ESTA 3ZIAD 1ELTA 1TBZH 5EJ1A 2Z6BD 4XBBA 4LZ4B 3BTTE 3BSQA 2BDGA 2XBVA 4LZ1H 1BZXE 2CJIA 2FOBA 3F0PA 1ZRBA 3MI4A 4OS4A 5EQQA 1AFQB 3VPKA 5F53A 3RXVA 1K1NA 2Y82A 1D3QB 4K8YA 3VXEH 3MNCA 2YMSB 1A0JA 2Z9JA 1TGTA 1QBOA 3BG4B 2VVVA 3PTBA 1SFIA 2P59A 4K3JA 4OS1A 3QGNB 5A0CA 2HALA 3LJOA 3BTQE 2ZFPH 2PSYA 2W26A 2ASUB 2P3TB 1MZAA 1G3EA 4P00A 5KEDA 1LCYA 1CHGA 3KQEA 2PUXB 4MNWA 3SO3A 4ASHA 2TPIZ 3GS9A 3MU0A 1ZHMA 1UK2A 1Y3YA 1UHBB 4ABHA 5EIYA 2LELA 1CGIE 3A7YA 2CXVA 1RIWB 4Q7XA 4Z6AH 3SUEA 1ZMJA 2F9PA 3F2HA 3F9EA 3LH1A 2RCEA 2ZU5A 4F48B 1MTNB 1FY5A 1P8VC 2WPMS 4X2YA 1KXFA 6CHAC 4ESTE 1C1NA 2VVUA 3QTOH 1HJAB 1O3MA 1D4PB 2BY9X 3TIUA 1O35A 1PPCE 2G5NA 3VB7A 4ISNA 2VWOA 4MNVA 5C5NA 1BMMH 1YPMH 4B74A 2XBYA 3SW2B 4CRAA 4GVUA 1EASA 1RS0A 1RGQA 1J15A 1SGFG 1O2PA 2B9LA 3R3GB 4MNXA 3RMNH 2P8OC 2WPJS 1GJ9B 4IN1A 1PPGE 1HB0B 2GZ7A 3VEQB 4THNH 4QT8C 3NZIA 1HLTH 1O34A 4FUJA 1SGTA 1BRAA 4XFQA 4BAOB 3TGIE 5BPEA 4O97A 1L4ZA 1Y3XA 3KYFA 1ZPZA 4I8HA 3NWUA 2DUCA 1O3CA 1LTOA 3H7TA 1QRXA 3ODDA 3H7OA 1KSNA 1GI1A 4AZ2B 4CREA 1H8ED 4ZKRU 3TLOA 4JYTA 1MKXK 3KIDU 4Z1MD 2JH0D 3U1IB 1MTSA 2YMSD 2VNTA 1V2MT 2ZDAH 2H9EH 1FY3A 1GBEA 4VGCC 3RXOA 1K1PA 2G52A 3RMOH 2ZG0H 1W12U 4FUEA 1BOQA 1UK4A 1ELDE 1SFQB 1E0FD 4R8TB 5EODA 1BMLA 4JZFH 3RM0H 1O2RA 2PKSC 1YC0A 4AG1A 1XUHA 1L4DA 1AE8H 4MTBA 3SGBE 1HAYB 4YOGA 1TPOA 1DFPA 2KCYA 4TY7A 3AK5A 3E91A 3SORA 2SGFE 1NFYA 1YPLH 3A7TA 3DD2H 2BB4A 2V6NA 2C8YB 2J94A 1MBQA 3TPIZ 3QTVH 1GMCG 3RXKA 2WPDD 5KECA 2ODYB 1V2RT 1AN1E 4GHTA 1D6RA 1Z8IB 2C8WB 5A8XA 1A7SA 3U8RH 1D3DB 4CHAC 1HGTH 3P92A 2B5TB 4X8TH 3RP2A 3RXIA 1FN8A 2QE7D 3F2GA 1B7XB 1DT2A 1E34B 2ANKH 3SNAA 2F43B 2EY4C 3RLWH 5JDUB 1P3CA 3U98H 1ZGVA 2BX4A 1Q31A 5EU8A 5A2MH 2B7DH 2C8ZB 4NWKA 1JXPA 3E8LA 1TLDA 1SGDE 4AG2A 3P95A 3GYLB 4AOQA 3Q3YA 2QAAA 2UUYA 3V3MA 3P8FA 4NFFA 1O3IA 3UWJH 2ZCLP 2BHGA 4Y10E 3CS7A 4NCYA 3STIA 3Q77A 2A45B 2AERH 5CHAB 5TCCA 4RN6A 1NROH 2ZF0H 4CRFA 2GTBA 4NIYA 5L6NH 3SOSA 3EQ0H 3ZZ6A 4I8JA 1QIXB 2P8OB 1GBCA 5F8TA 1SPJA 1BTPA 3SUDA 4Y6DA 1V2JT 1XVOA 1EJMA 1Q3XA 4K5ZA 5FX6A 2JKHA 4Y11E 3TH2H 2A7CA 2STAE 2HWLB 2I6QA 1ABIH 1NU9A 2GVFA 1G3DA 1UTPA 3SJOA 2FI5E 1LHGH 1TB6H 4TY6A 2UUKB 1TMTH 1Z8JB 1FNIA 4WH6A 4TWYA 2H9TH 2AS9A 2H5DA 1B0EA 1ANDA 5ESBA 4X0WU 3FN8A 4O03A 5EW2H 3ZZ8A 1PQ5A 3SI3H 1C5RA 1O2JA 2FYRA 3ATLA 4Q7YA 3A88A 1JWTA 3GY8A 1EJAA 1ZTKA 1CQQA 2O8TA 1CT0E 1WXRA 2STBE 3SV2H 1EP5A 2R3UA 4CRDA 2XWBI 3TJOA 1AZ8A 1BA8B 4JYVH 1P57B 3A7WA 3RMMH 1Z8RA 1XUGA 3A8CA 4OS7A 2XRCA 1P03A 3SV8A 2ZFQH 2QF3A 1O5EH 3MH5A 1K1LA 3TK5A 1AWHB 1L1GA 1OYQA 1MABB 2BDHA 2VBCA 1PPHE 3TGKE 5EXNA 3A84A 1P2KA 1VGCC 3W95A 5FCKA 5AFYH 3LGWA 1C2DA 1FDPA 4ACAA 2ZDKA 2GMTC 4X2WA 1C1PA 4GSOA 3M5NA 2CF9H 3UWIA 4B1TA 2F83A 2TIOA 2G5VA 1BCUH 3T29A 1UMAH 1T4UH 2GJGA 3AAUA 3TNSA 5C20A 3VFEA 1K1OA 1GI6A 1FONA 2QGRA 6GCHF 4A1XA 1HUTH 1GMCF 1S6HA 3MWIU 1O0DH 2GT8A 1FX0B 1TIOA 3GCOA 5ETXA 1C9TA 1W2KH 1GG6B 1X7AC 2ZHQH 3T25A 1ZTJA 2VH6A 1CU1A 2OC1A 3W1EA 1ZJKA 3BTWE 3SYJA 4A1TA 1SC8U 2F91A 9LPRA 2P16A 4X2XA 4KTSA 2B8OH 3SHCH 3FZDA 5HIYA 2XWAA 1AB9C 5E0GA 1LVBA 4JZEH 1O39A 1TPAE 2ZU1A 3ZZDA 4FETA 3CENA 1TNJA 3A85A 1Y3VA 1GHXH 3ZVGA 1A61H 2EI6A 1C5UA 2GCHF 4KGAA 1HYLA 1O2XA 3I77A 1HPGA 2FS8A 3SJ9A 2SGEE 2VH0A 4Y76A 3M61U 1HJ8A 1S81A 3UTUH 2AGEX 1MTUA 2YNBA 3V7TA 3DFJA 2NU0E 2QXIA 4YLUA 4NA9H 4HZHA 3BV9B 1FPCH 3BTGE 1P2QA 1THPB 2VGCC 3E1XB 2QXGA 4F49A 2QV1A 1C2IA 1TNKA 1IHSH 3EGKH 4LK4A 2BD3A 5AVDA 3SU2A 4DGJA 2OUAA 5C5OA 5LH8A 1DLEA 1XUIA 1V2VT 4J1YA 2VVCA 5C0UA 3RC5A 3MH6A 1KY9A 1OWDA 1TAWA 1YLDA 2PTCE 1SGNE 2BDCA 1V2NT 3SZEA 3PRDA 1W0ZU 3F68H 4K1EA 2ZDMA 1DE7H 1F5LA 1TPPA 3OSYA 4ZKNU 1J8AA 1LO6A 2XC5A 2KFWA 2W3KA 3M3VA 2QYIA 3P8NA 2CF8H 3FO8D 3RXUA 1HAXB 1P10A 3LGUA 4AYVB 3RXAA 2FWWA 1O3DA 1SMFE 1FN6A 1A46H 4FUDA 5DP9A 4Z0KA 2Z9KA 2NU4E 3KF2A 3JZ1B 2GV6A 1W10U 1NRNH 3BTDE 4CBOA 1A5IA 2LNCA 1PQAA 2CK3D 4BAQB 2Y5FA 1DWBH 1EX3A 2AGIX 1IQKA 2XBXA 1L2EA 2Y5HA 3RXLA 5DKMA 4BAMB 5C17A 1TABE 3SU3A 2XYAA 4A5TS 4ASUD 1OYTH 3QN7A 3VB6A 5EOKA 3RXSA 1AHTH 1GJBB 1P06A 2Z9IA 3BN9A 1RXPA 1H9LB 1SGIB 1C1OA 3ATIA 4U32A 4CRBA 3K6ZA 3S9BA 2A2XH 2A32A 2TBSA 3B8JA 5FHTA 7LPRA 1F0TA 3P6ZB 1P01A 4DVAU 2QXJA 2A0QB 3MNSA 2VWLA 4U30A 4YM9A 1V2QT 1LVMA 1S0QA 4NA8A 1CVWH 1GMDF 1TGNA 5BRRE 1EKBB 1EPTB 2VIVA 3SV6A 1GHWH 3QUMP 2A5IA 1KLIH 1O2ZA 2BM2A 3OY6U 3GY2A 1ESTA 2YOLA 4MG3A 1WSSH 2ZFRH 1PPZA 1O3BA 1WQSA 5I46H 3GY4A 5TCAA 3ZVFA 1NN6A 1PPEE 1WCZA 2BY8X 3CNRA 1W8BH 1C1SA 2ODQA 1BT7A 1QTFA 1EB2A 1O30A 1D6WA 1OP0A 3QZRA 2TGDA 2PHBA 1O36A 4FUIA 1FAKH 1Y5UT 4Q2KA 1UVOA 2EI7A 3LH3A 1GJDB 3OU0A 2BY7X 1F0RA 1MCVA 1D3PB 2A5KA 2FTLE 1QZ8A 2XNIA 1QBNA 1MMJN 1ZLRA 4ZKOU 5HIZA 3GCNA 3KQ5A 1W0KD 5HXFA 1NZQH 2C8XB 5DK1A 1QRWA 4B2BA 2SGDE 1IQFA 1W0JD 1C1RA 1UVUH 4MNYA 3SI4H 1SG8B 5T6GA 1NFXA 1IOEA 4NG9H 5LGOA 2LPRA 2TGTA 2BMGB 4Q7ZA 3N7OA 3SU4A 3RXMA 2L6OA 1QJ1B 3ITIA 2BQ7B 1TRYA 5GCHF 5T6DA 1EFRD 3FFGA 5C1XA 2G51A 1W7GH 2ZQ1A 3E0NB 2ZU4A 4DW2U 1ETSH 1CA8B 2FO9A 1MD7A 4NA7A 1NM6A 2RDEA 4BANB 3TVJB 1GDUA 1OXGA 2G55A 1THRH 4CH8B 3AW1A 3DHKH 2VIQA 1NO9H 4M7GA 1H8DH 2BX3A 2FI3E 2CHAC 2QN5T 3BTKE 2FMJA 1IQLA 2O8UA 4BXWA 1KMHB 2BD2A 3PV4A 1MTWA 3O8RA
chains in the Genus database with same CATH topology
2UWOA 3KCGH 1W13U 3ZYEA 2FOHA 4WVPE 3AVZA 2BDYA 4ABEA 1MCTA 3ATWA 2ZFFH 2ZKSA 1P9UA 1RJXB 2I6SA 2ZTZA 3LKWA 3SJIA 1TFXA 3H5CB 2FOCA 2BQ6B 4XBCA 3ENSB 1TX8A 2ZU2A 2VWNA 3GDUA 1C5NH 4B2CA 1TGCA 2C93B 4IN2A 1EZQA 3M37A 4NGAH 1S6FA 1KTSB 2IJOB 1BTWA 5JPMH 3E16B 1C1VH 2AMQA 1P2MA 3TJNA 3S69A 3M36A 3Q3XA 2FOMB 1PJPA 3GY5A 5F6MA 1LQDB 2HOBA 1QJ7B 1YF4A 1SLXB 4TPYA 2V3HH 3SGAE 2FLRH 1RD3B 5GPIB 1V6DA 3RC6A 1QB9A 4Y0ZE 1BRBE 1GI3A 1HIAA 5JBAS 2QXHA 1P2IA 5EPNA 5E8EH 4AFZA 3E3TA 3V12A 3RXTA 5JB8S 1P0SH 4AN7A 1O3NA 1H1BA 5LPRA 1TE0A 4IC5A 4JMYA 1KXDA 1CGJE 3LOXA 4YESB 2OCVB 5AF9H 2AMDA 3A7VA 3KQDA 1T7CA 1G3BA 1LKBA 1NESE 5FPYA 3SNDA 2A4GA 5CMXH 4X6NA 1EB1H 2AMPA 1ETTH 3S0NA 2D1JA 4D8NA 1KXEA 1K1JA 1IQJA 2VIPA 1NPMA 3RU4T 1MQ6A 1DY8A 1T31A 2W5EA 2ZHDA 1YPGH 1C2KA 4H4FA 2P3FH 1S0RA 3BEIB 1GJ4H 4Y8ZA 5ESTE 1QL8A 3RXHA 1CT4E 1VITF 2A7JA 5JBTA 2RG3A 4X1SU 4OGYA 4H6TA 1TALA 5L2YH 2WPKS 1DM4B 2ZGXH 1OSSA 1SBWA 1C5QA 3C1KA 1CBWC 1ZZZA 1ABJH 3S9AA 5GDSH 1CO7E 1AZZA 3V13A 1ARBA 4CH2B 4YT6H 1WAYB 3A87A 2ZDNA 3RU4E 2O8LA 1HV7A 1WV7H 4YOJA 1PYTC 4K69A 3D49H 1VJAU 1TA6A 4X6MA 3QLPH 2ZFSA 1J14A 1HAGE 3E0PB 4XE4A 1LPZB 1IQMA 1RTFB 3QO6A 3KHVA 1D3TB 1PPBH 1O5BB 1IQEA 1TMBH 1Y3WA 1JOUB 2R0LA 1BBRK 4D9QA 2THFB 4ZMAH 2ZNKH 3VB3A 3IWMA 3A89A 4RSPA 1SHHB 1XM1A 2ODPA 4KKDA 1BDAA 4AYYB 3Q3KA 4Y8YA 1VCQA 1SGYE 3RXGA 4X8VH 1P3EA 1A0LA 1TBRH 5DJ7A 1V3XA 3SU5A 2ZGCA 4CR5A 3U8TH 4DCDA 3SJ8A 3SZNA 2J9NA 2GT7A 2OQUA 3L33A 4WH8A 1OWKA 5E2PA 4ABIA 1DX5M 5F8ZA 3E6PH 4J2YB 1MBMA 1DLKB 1AKSA 1QB6A 6GCHG 4FU7A 2Z7FE 3IITA 4NIVA 4RKOB 2AIQA 2J4IA 4INKA 1OWJA 1DS2E 2UUFB 3AASA 3QK1A 3QZQA 3ESTA 5F8XA 3LPRA 1EPTA 2ANWA 4ZHAA 2OC7A 2FOFA 1HRTH 1IHTH 2AEIH 4MQAA 5E2OA 3MTYA 5LPFA 1LPKB 1MTVA 1MH0A 4GUXA 5J4QA 3EE0B 1XUKA 4D9RA 1MAYA 3VGCC 5DP5A 1V2OT 2OTVA 1O3AA 3SGQE 1C2MA 1NFWA 3I29A 4WXIA 1GVKB 2FS9A 1GCDA 6CHAB 3D65E 4SGAE 4HI3A 1QR3E 1A1RA 2FM2A 1V2WT 1BTUA 1CT2E 1A0HB 2Y7ZA 2GCHG 1QB1A 2GD4B 4BNRA 5DP7A 4E7RG 2Z9GA 1GPZA 1P12E 1DWDH 3JZ2B 4ZUHA 3UFAA 4X8SH 4WY3A 2NU1E 3QX5H 3GCTG 2Y5GA 1GJ5H 1F0UA 3DFLA 2VINA 2Q6GA 1IQIA 2R2WU 2SNVA 2JETC 3L3TA 3SJKA 1ZJDA 4ZHLU 4MLFB 1ESBA 3MU1A 3OTJE 3K9XB 2NWNA 2OINA 3LU9B 3LJJA 1GBAA 1XXFA 3FP7E 5TJXA 1O3HA 1O2OA 3NK8A 4WF8A 2GZ9A 4DOQA 1RFNA 1UTOA 2RA3A 1TOCB 1ZMNA 4SGBE 2ZP0H 1PFXC 2O8MA 1S5SA 4VGCB 4BTIB 1H8IH 1G37A 1DSTA 1ZSKA 1GJ6A 4ISLA 2ALPA 1A3BH 1HDTH 1AFEH 1UTJA 3A7XA 1TRNA 1C5YB 2PKSB 5DO4H 1KXAA 1UCYK 1O3PB 1EAWA 4YT7H 4DJZB 2HPQH 1P02A 1E35B 3IG6B 2VIDA 2BVSH 4X8UH 4E06H 2CGAA 5EQSA 5C1UA 4H42U 5ABWA 3RXRA 1HAVA 4AORA 5LPEA 2WPHS 3F9FA 4CHAB 1BQYA 1C1MA 3LGTA 5HM9A 5IDKA 2KAIB 4FVDA 2OP9A 4X6OA 2W7UA 3A8AA 2DE9A 4K2YA 2W7SA 1DY9A 2HPPH 4KP0A 3VB5A 2IOTA 2WUCA 4Q80A 5F03A 5L30H 2ZPQA 1GHVH 2PR3A 1XKBC 1O2SA 1V2ST 1C5LH 2SGPE 2UUJB 3MNBA 5C1YA 3PM3A 1ELAA 2ULLA 3PLKA 4HTCH 5EGMA 1MKWK 4ZH8A 1LHFH 3RXCA 1LDTT 1RTKA 2P3UB 1NC6A 3UREA 1MKXH 1DUAA 1EATA 5A0AE 1FUJA 2BLQA 4RKJB 5EXMA 5AHGH 1TMUH 4ABBA 1F0SA 1HNEE 1GMDG 1C2GA 1LKAA 3LDXH 4UEHH 3UOUA 4I33A 3ZVBA 1A5GH 1EXFA 3PMAB 1HIAB 5HGGA 2WPIS 3UOPA 3WY8A 1K2I1 1J17T 2FOAA 3BTFE 1TGSZ 5E0JA 3MH4A 5AFZH 1AVXA 1AQ7A 3MU8A 1EZXC 1RTLA 2BVXH 2BYAX 2JETB 2OQ5A 1AUTC 1S83A 3SV7A 1EZUC 2RA0A 4H6SB 4ZAEA 4OGXA 1UTNA 1O3JA 1ELVA 3MH7A 3URDA 2C3SA 2HNTE 1GDQA 3KL6A 1CHOF 5EW1H 1H9IE 3GCTF 4I8GA 3TU7H 1FY1A 4IW4E 1FIZA 4X1NU 1G30B 1SLUB 3A86A 1G3CA 2A2QH 4NZLA 1Y59T 2BZ6H 3FAOA 4K8BA 2BXTH 1CA0C 3PO1C 1AVWA 1T8OA 3Q76A 3ZVAA 1O2UA 5DGJA 1OP2A 3M5MA 2G4UA 3ZZ9A 1AIXH 4FUCA 3UY9A 1WUNH 2GZ8A 3NKKA 1EUFA 3TGJE 1NTPA 1T4VH 1O37A 1O5GH 1C5ZB 1Z7KA 3BIUH 1G32B 2OC8A 2V3OH 5GCHG 2BD9A 2NU3E 1TQ7B 3MO9A 3S9CA 2H9HA 4MPUA 1WTGH 5FXLA 2GX4A 1JRTA 2ZIQH 3MU4A 1VGCB 4UFDH 3O8CA 1Y5BT 2FYQA 1GBFA 2GGVB 1PPFE 3PTNA 1T32A 2GMTB 3TJUA 1O2QA 7GCHF 1GBHA 3SQHE 3BF6H 2CV3A 4ZKSU 4FUFA 2BDAA 1DWEH 4GLYA 5JYIA 5EQRA 1A4WH 2Y7XA 2FESH 3VXFH 5FCRA 5JBBS 1EJNA 2XBWA 2EA3A 2J92A 1A5HA 1TA2A 4GHQA 1C5WB 3EA9A 1EOJA 2EEKA 1C5PA 1AGJA 3M7TA 2G4TA 2QC2A 1SGRE 2HRVA 4UD9H 1J9CH 4JZ1A 1THSH 4NZQA 1GBTA 3V0XA 2J34A 2HNTC 4ABAA 1O2KA 1GBMA 5FAHA 5GXPA 4AFSA 3F1SB 4B73A 2UWLA 1AB9B 1C1WH 1AKSB 4ABJA 2A7HA 3A8DA 1GGDC 1P04A 1GHYH 2G00A 4R0IA 1PQ8A 1GBJA 2V35A 4I8LA 2ALVA 2SGAA 1NY22 1LHEH 1TONA 4JK5A 1QA0A 2GDEH 1O5AB 3TK6A 1G2LA 2ZDLA 4X2VA 3A82A 4DG4A 4I31A 1KIGH 1QJ6B 3MO6A 2A4OA 4D7GA 2ZCKP 4K1TA 1BMNH 2VGCB 3PB1E 1QRZA 1YBWA 1TYNA 5FX5A 4B76A 1BTYA 1VCWA 3CS0A 1HXFH 1YGCH 3GCHC 1H9HE 5HM2A 1S82A 2Z94A 1ETRH 1GMHF 1P2NA 2AGGX 1O2TA 1EZSC 2IN2A 2D26C 8GCHF 1YPHE 5G4BA 1DICA 1C1TA 2C90B 3RXDA 4AB9A 1WYKA 1AFQC 2ZTXA 4IMZA 1NU7B 1SHYA 3ZZBA 1ZHPA 4HGCA 1BTHH 1EAIA 1BITA 3PMHB 3MYWA 5I25A 5HYOA 4B75A 3BG4C 4YO9A 2FP7B 1SQAA 1FMGA 3OY5U 3ZZ3A 1ELCA 2ZHWH 3RXEA 2BY5X 1ZYOA 1VITG 2D8WA 1GWAA 4IBLH 4JYUH 3MNXA 4TYDA 2BD8A 1UK3A 2PLXA 2ILNA 1ZRKA 3M5OA 3FANA 1FIWA 2P95A 4INLA 8KME2 1RRKA 1NT1A 2CN0H 1ID5H 3E90B 1LHDH 1YP9A 3MU5A 1C2JA 2PKAA 3L6PA 4TPIZ 1B5GH 2F3CE 2R9PA 1K22H 1CE5A 4A92A 3T5FH 2JH6D 1BJVA 2VIOA 1MTNC 2HGTH 2Z3DA 4A7IB 3HATH 3TH4H 3M35A 3OX7U 2O8WA 1HJAC 4I8KA 1EAUA 1OWIA 1C4Y2 1QY6A 3SHAH 7KMEH 5JBCS 6LPRA 1Q2WA 2GDDA 3EAJA 5FPTA 2WPLS 4FXGH 1ARCA 1DPOA 4JZIA 2F9NA 3PYHA 1DUEA 1UJ1A 2ZFTA 2ZZUH 1NS3A 1Z1JA 4KELA 2KAIA 1L1JA 3GY3A 4UDWH 4Y0YE 1C1UH 1GHBF 1QGFA 4IC6A 3NXPA 4KTUA 2ZCHP 1QFKH 1HAVB 4LOYH 5SGAE 1V2PT 1MU6B 1LMWB 2F9VA 4NIWA 1ZOMA 2A31A 1YKTA 1WQVH 2BLWA 2F9UA 1SGFA 3GY7A 1O2MA 4MPXA 1YPHC 5J4SA 2FZZA 1YM0A 4O9VA 1AE5A 1M9UA 2V0BA 3LC3A 1SOTA 1P2JA 1Y3UA 1ZSJA 3M7QA 4Y7AA 1GI8B 1Z71A 2SNWA 1E37B 3ZVDA 1FXYA 1C5MD 3GCHB 1SOZA 2JH5D 5DPAA 2DE8A 3AW0A 1E36B 1MD8A 2PV9B 3M7UA 4WWYA 3K65B 2XW9A 1SB1H 1K9OE 1YPKH 4D7FA 1O3EA 1UTMA 3PWBA 1HAPH 3PWCA 1F92A 1ZPCA 2AH4X 3LONA 1BIOA 2ZGBH 5DP8A 2WUBA 5FPSA 3B9FH 4MPWA 1GBIA 9ESTA 3RDZA 1QCPA 1KLJH 4ZXXH 3GICB 4X1RU 4AFQA 1K1IA 1QHRB 2AFQB 1XXDA 1SGQE 3PLBA 1O3OA 3PMBB 1GJ8B 1O2IA 1GI4A 2Z3EA 2A5AA 2G81E 3RXBA 2QIQA 4YOIA 1MUEB 1O5DH 1HAIH 3SU1A 3A7ZA 1YCPM 3P8OA 2CHAB 3ATKA 1O3FA 3LGYA 1Z1IA 2WYGA 4GCHF 1O5FH 4WMFA 1A3EH 1XX9A 3KEEA 8ESTE 3HKIB 3EDXB 3BTEE 1O3LA 2BVRH 2H1UA 3LC5A 1DOJA 4B2AA 2NU2E 3GY6A 3MOCA 4KTCA 1GBKA 4OS5A 1ZSLA 5CHAC 1C5VA 2PSXA 1VZQH 1EAXA 1SL3A 3DA9B 1TRMA 2IPHA 1O3KA 1T8MA 2FTMA 2VIWA 1GI0A 1HAHH 3D23A 1VJ9U 2OC0A 5DP6A 1K28D 4DURA 4UFFH 2Y80A 1IAUA 1AI8H 1YPEH 1G2MA 3LIWA 3RXFA 1W14U 1EOLA 1DANH 3SQEE 1L0ZA 1C2FA 1KDQA 1DVAH 1ANBA 3TITA 5A8ZA 3PMJA 2P94A 2BDBA 3ZVEA 1GDNA 3RXJA 4MPVA 3P17H 1BMAA 3KQBA 4Y8XA 3UQOA 2PWXA 1U6QA 2ZWLH 1HFDA 1TWXB 4U2WA 1ELBA 2OLGA 5PTPA 3U9AH 4YTAA 2FODA 1IQGA 3BIVH 2CMYA 2VWMA 2FX6A 3W94A 2W3IA 2ZA5A 1UTLM 1QA7A 2QF0A 1LPGB 1BJUA 1O31A 3RC4A 1LVOA 1ELEE 2Z3CA 1FLEE 1B0FA 1OP8A 1O2YA 1GHAF 3K6YA 1NRQH 4ABFA 3DUXH 2A4RA 4JK6A 2ESTE 4ABGA 4B71A 2FEQH 1GBBA 1W0YH 3FZZA 1FI8A 3SBKA 2A4QA 3GDSA 3R0FA 2XCFA 2ZGHA 1F5RA 1ZGIA 3BTME 3O8BA 2Q1JA 1WBGB 4O3TA 1ZTLA 2ANYA 8LPRA 1HBTH 1TGBA 3SV9A 3FVFB 2Q6FA 4ISHH 1T8LA 1SGCA 2GP9B 3T26A 4ZROA 1CBWB 1CHOG 3LGVA 1GG6C 3MO3A 4CBNA 1HCGA 2BLOA 1SLWB 4WXVA 1NFUA 3HPTB 2R0KA 3F9GA 1MZDA 4OS6A 1QBVH 1QL9A 1Z8GA 2J38A 1QL7A 3EYDA 4I32A 3SU6A 5A8YA 1GHZA 5JB9S 3ZZ4A 1O2VA 2ZQ2A 1BHXF 4FUGA 1C2EA 1O2GH 1GI7B 1C9PA 5C67A 5FBEA 2FXRA 4WMEA 2BDIA 1N1LA 4CRCA 4GPGA 5K0HA 3NPSA 3PROA 4UE7H 1AO5A 2FLBH 3RXQA 4ISIH 1DDJA 4NSYA 2TGAA 2BY6X 3ATMA 4FVBA 2ZHEH 4DIHH 1K1MA 1SVPA 2BD5A 2M5TA 1AUJA 1H4WA 3Q00A 1O2WA 5T3HA 3FP8E 4HFPB 4BOHA 2PKAB 2VJ1A 1ZMLA 1VCPA 1CGHA 3M3TA 3AAVA 5T6FA 3EA8A 1C4U2 7GCHG 1O2LA 3T62A 3GOVB 1ZPBA 3QDZB 2TGPZ 1LHCH 3M3SA 1GVZA 4E05H 4X1PU 3D62A 4DIIH 4MVNA 1GCTC 3KN2A 1C2LA 1WTHD 1GI5A 3ZZ5A 1WU1A 3MMGA 1BHXB 1GBLA 1HXEH 2ZPSA 5C2ZA 1GJCB 3T27A 1SR5C 3A8BA 1C5XB 1TPSA 1UVSH 1OWEA 3GISB 4FU9A 2OXSA 4WJG2 2ZI2H 1F2SE 5GJ4B 1KLTA 1W3CA 2AYWA 1JIMA 3RMLH 5EPYA 4TWWA 1C1QA 3VGCB 1DWCH 2H2ZA 3ZYDA 1TX7A