1QL7A

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Ph-Dependent Binding Modes Observed in Trypsin Crystals: Lessons for the Structure-Based Drug Design
pubmed doi rcsb
molecule tags Serine protease
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A02
1EPTA 2BVSH 3SGAE 1JXPA 3MNBA 1DUAA 3DFJA 1KTSB 1LQEA 3HKIB 1OKXA 1MKWK 1ESTA 1G30B 1ZJKA 2BDGA 1GHYH 1AUTC 1H1BA 2BYAX 2R9PA 5T6GA 1XXDA 5A0AE 4AORA 3PLPA 2QF0A 5C20A 1C2MA 3GCTG 1SFQB 1CHOG 1GDUA 1O36A 1UK3A 1KTTB 3GY4A 3CS0A 6LPRA 2GCHG 5DP3A 2YNBA 1AVWA 2A45B 3BTEE 5E0HA 3LGVA 5G4BA 4AFSA 1N6YA 4ABHA 1IQKA 1BUIA 2JH5D 3BF6H 2STBE 4IW4E 1HB0B 1ZSJA 2SNVA 4AG2A 5EOKA 4WXIA 4XE4A 3URDA 2A5KA 2BD9A 2OC0A 3RU4E 1C2HA 2BDHA 4K69A 3A7YA 5CHAB 1C5ZB 5GDSH 7LPRA 2XBXA 2ZIQH 1C1NA 2R3UA 1FZZA 1UJ1A 3BTME 1KLTA 2FS8A 3G01A 1ZZZA 5E8EH 1O32A 4I31A 3PV4A 1V2TT 3VFEA 1P01A 1O2MA 3RXMA 5A8XA 4NSYA 4WVPE 3RXLA 5DJ7A 3QWCH 2FP7B 1GMDF 2ZWLH 4B1TA 3MTYA 1TX8A 4DURA 4CBOA 2H9EH 1MTNC 1PFXC 1MD7A 2PLXA 4RN6A 3KGPA 2KAIA 3UQVA 4Q7ZA 1TNIA 1SB1H 4DIIH 1SLWB 3SHCH 4O03A 1C1MA 2EI6A 1SGDE 1F5RA 2A31A 3UR9A 4LZ1H 3SNBA 2OINA 4CRAA 3EE0B 5DP8A 4U2WA 2FIRH 4ABIA 2AMQA 3BTFE 2BD3A 2K1QA 2SGAA 4ABJA 2WPHS 1AZZA 1TBZH 2P3TB 4VGCB 1YLCA 5TCCA 1VGCB 2F83A 3C27B 4UONA 1GI2A 3SU1A 3NZIA 1JIMA 1AB9C 3A8DA 3EA7A 3P8FA 2ILNA 1HIAB 1TMUH 1Z6JH 2ZZUH 1LDTT 2XCNA 1LCYA 1DWDH 2GTBA 2C93B 1E34B 3PROA 7ESTE 2ZDNA 3L33A 1Z1JA 2WPKS 2YOLA 3DD2H 1OPHB 2Z3EA 2BB4A 2P93A 1UO6A 4DIHH 1FIWA 3MYWA 4ABAA 6CHAC 1BB0B 1GHBG 3D62A 2VWNA 2A4RA 3ZZDA 2PGQB 2GT8A 3SU2A 3P17H 1OWHA 1DX5M 5EPYA 3TU7H 3U8OH 4DW2U 1QY6A 3E0PB 4YOIA 2C8ZB 3U69H 1BDAA 4X2YA 3SU4A 3NWUA 1EOLA 9ESTA 3KEEA 1BRAA 4F49A 4FXGH 1A7SA 3RXVA 3E0NB 1NM6A 1TBQH 1FNIA 3PMAB 3C1KA 4JZ1A 3A84A 3A8BA 2FODA 2G52A 1NFWA 5GWZA 2W5EA 4OS4A 1Z8GA 4ZKRU 1O3NA 3LU9B 2W3IA 1A0JA 4FUEA 1QGFA 1K28D 2ANKH 3MU8A 4DT7B 1TALA 1W8BH 1TRMA 5LPEA 1A5IA 1GBBA 3IITA 5L30H 1Z7KA 2SNWA 2STAE 2F9OA 1GJDB 2WPMS 4FUJA 4KP0A 2H1UA 3ESTA 4IGDA 4A1TA 1E38B 3TPIZ 4SGAE 2ASUB 3OYPA 1X7AC 5FHTA 1K1PA 4ZKSU 1W2KH 1PPFE 4Z6AH 4WMFA 1RFNA 3U1IB 1GJ5H 2ZGBH 5HMAA 1W12U 2TRMA 5FAHA 2WPIS 1BTXA 1GI0A 1O5BB 3SJOA 5JB8S 2C90B 3SV2H 2QXGA 4ABEA 2AFQB 3K2UA 4GVUA 4BXWA 2F9PA 3MH4A 3VB5A 3IWMA 1HIAA 2ZF0H 5FPSA 1AFEH 4JZDH 1WAYB 3T29A 3UY9A 1GBJA 3KF2A 1C1WH 1MQ6A 5A2MH 1O3CA 1KY9A 2ZPQA 5FX6A 1E36B 2AH4X 2BVXH 3BTKE 5ESBA 3BSQA 5F6MA 3LT3A 2HNTE 5C1YA 2BLVA 1GMDG 5C1UA 1J15A 4E06H 1HJ9A 2I6SA 7KMEH 1E37B 2ZU2A 4IN1A 1SMFE 2NU2E 1O2NA 1MTWA 1YPLH 4IC6A 1VCWA 5DO4H 2OBQA 2Z9KA 1GL1A 1QA0A 1NRRH 1B0FA 1RIWB 1LHCH 5DP7A 4Y79A 3A85A 1HAXB 1BJUA 4Y8XA 1IAUA 4FUFA 2ZEBA 1GPZA 1O34A 3HK3B 3I29A 5DP5A 1TMBH 1L1NA 3KQBA 2FOAA 5EPNA 4UEHH 4BNRA 1N1LA 2Z3CA 2P95A 1O3EA 1SQAA 3GOVB 1YCPH 1NU7B 3TNTA 1QURH 4WJG2 1C2JA 1S6FA 1HJAB 4H6TA 2OP9A 4A5TS 4AFUA 1SGYE 1OP0A 2ZDAH 1TX6A 2A4QA 1WTHD 3P8NA 4LXBH 1BZXE 3ZYDA 4A1VA 4GSOA 3ZVGA 2RG3A 1OXGA 3ZZ7A 3UPEA 3TITA 1KXDA 3NK8A 2J4IA 2SGFE 1JRSA 1CHGA 5T6DA 1SSXA 2BOKA 1RTLA 3AAUA 2R2MB 3SN8A 2JKHA 5F03A 1OWDA 1G32B 3SUDA 3CP7A 4CRGA 2FYRA 2ZDKA 2CF9H 3ZYEA 4X8TH 1EAWA 2J2UA 2XC5A 1DICA 4CR9A 2D2DA 4Y10E 4ZHAA 2G8TA 3RXKA 3SJ8A 2B8OH 1VCPA 4X1SU 2FOCA 1P9SA 1O3DA 2OC8A 2AMDA 2QCYA 2O8MA 3EYDA 1V2NT 4HZHA 2P8OB 1GMCF 4WY3A 1DT2A 4K2YA 1IHSH 3K65B 1MTVA 1SI5H 2D1JA 1ELVA 3SNAA 1IQFA 1SC8U 1RTKA 1TGTA 1O3AA 2Z9IA 4ESTE 3ZZ8A 1AZ8A 4GAWA 3PMJA 1LQDB 4K1SA 1GHZA 2QYIA 1UK2A 1SQOA 1SGNE 1O2YA 5CMXH 3A7TA 4ABGA 3E8LA 4CRBA 3ATWA 1AQ7A 4IMQA 3ZZCA 1S6HA 2GCTB 3A8CA 2J94A 3MH7A 3UQOA 3P95A 4X6NA 5IYTA 1Q2WA 1NRQH 4GLYA 2ZDMA 2FX4A 2F3CE 1TPPA 1C5RA 1GI5A 1ZRBA 2VH6A 1NN6A 1BTZA 2PFEA 3KQDA 1PPCE 1QB9A 3EA9A 2W3KA 5TJXA 3SOSA 1GJ6A 2UWLA 2FDAA 1O33A 1TPOA 2AGGX 4BANB 4UE7H 5C5OA 3V12A 1DVAH 2NU0E 1HAZB 1PYTD 2HVXA 1UVTH 3T25A 5CHAC 1A2CH 2ALVA 3MHWU 1UTPA 2Q6GA 1CT0E 4K8YA 2RA0A 2HNTC 4MNVA 3SORA 2CHAC 3SO3A 4JYTA 5HGGA 1DPOA 1UVUH 3Q3XA 2TGAA 1BCUH 4ZH8A 1SQTA 1QQUA 4QT8C 2FESH 1BIOA 1GI8B 4Y7AA 3S0NA 2RCEA 1QL7A 2GDEH 1K2I1 2P3FH 3NKKA 5HM9A 1GWAA 1AI8H 4NIYA 3QGNB 4K5ZA 1ANBA 4NGAH 1FXYA 1O2VA 1QR3E 3AAVA 1MKWH 1FAKH 1D3TB 2ANWA 4H6SB 4X2VA 1A61H 4XBBA 2BHGA 1F0SA 1MKXK 1O3LA 3M5OA 4BTIB 4I8GA 1IQNA 1FY4A 4AGJA 3TJNA 1H8DH 3U8TH 2EI8A 2FOBA 2NU1E 2OQ5A 1GJCB 2ZI2H 2HPQH 3STIA 1LVBA 3LDXH 3ATKA 1O5EH 1C1SA 5EG4A 2ANYA 3O8CA 1KLJH 1Q3XA 4YLQH 3ATIA 2XW9A 1YPHE 2QIQA 4UFFH 3RXUA 1EJNA 4TYDA 1C9PA 4VGCC 3SUEA 1ZTKA 1A3BH 4CH2B 1VGCC 3ZV9A 1DDJA 2ODQA 2AMPA 1Y8TA 3LGUA 1C5OH 3S9AA 1CT4E 5A8YA 5EGMA 1TNKA 1P10A 2PGBB 2UUKB 3M36A 1V2OT 3DA9B 3SU6A 3MU4A 1PQ5A 1JRTA 1HCGA 1WBGB 4ISOA 1P8VC 3RC6A 1ZJDA 1NU9A 1P3EA 1TGNA 2ODPA 1SGTA 1Y59T 1QRWA 2Z9LA 1CA0B 1OSSA 2TGTA 2O8WA 1C5PA 2VH0A 3MFJA 1GMCG 3L3TA 3EAJA 1CT2E 2FXRA 1O3IA 3ZZ5A 3QTVH 2H9TH 5HM2A 1WUNH 2QGRA 1YP9A 3UFAA 2LPRA 1G36A 1TMTH 4HTCH 4TWYA 2XTTB 3GY7A 5C5NA 4INKA 2VIPA 3S7HB 4X1NU 1Z6EA 3W95A 3RMNH 3BTQE 1N8OC 4JK6A 1L1GA 2RA3A 3RXOA 1O5DH 2PTNA 1QNJA 1N6XA 3FP6E 3FP7E 1QBVH 2A32A 1SGFA 2F91A 4OS1A 1WTGH 2G5NA 1GHAF 4JK5A 2EI7A 2OC7A 3LH1A 1MMJN 1M9UA 1NT1A 1EJAA 1ZSKA 2WV5A 1P04A 1ZPZA 2QXIA 4I33A 4JZIA 2C8YB 1K1MA 3URCA 1O38A 3RMOH 2ZP0H 1C1RA 3F9HA 4INHA 2TGDA 1YCPM 3NUMA 3VB7A 1MH0A 4X8SH 2J38A 3M3SA 4LZ4B 4B2CA 1XKBC 5AVDA 3LIWA 1D6WA 2FPZA 1EP6A 1VITF 2TGPZ 4ZXYH 4XBCA 1AE5A 1GBCA 4NA9H 2Z7FE 2NU4E 2SGQE 1LMWB 2IJOB 1YKTA 2H2ZA 2ZCHP 5F8XA 2F9UA 4I8JA 1QL9A 3UOPA 5EW1H 2BLOA 3BTHE 1HDTH 1TNHA 1K1LA 2WUBA 1QIXB 1C1QA 5FXLA 4Y0YE 2BY6X 4FUIA 2AEIH 5T3HA 2PSYA 3TIUA 3U9AH 2ZGXH 2F9BH 2ZHEH 2VGCB 1C1TA 1LVYA 3E6PH 3A89A 3RXRA 5JBCS 2FOGA 5JBBS 2VWLA 3F9EA 5FCRA 3QO6A 1GJ7B 1G3CA 3T26A 1W10U 4ISIH 1O3GA 2R3YA 3EDXB 3H7OA 3Q00A 3E16B 1CSOE 1P06A 3PB1E 1DY9A 3RDZA 3RU4T 1OP2A 1TNLA 4GCHF 4JZEH 8ESTE 5I46H 3F6UH 2Y5HA 4Y76A 1RIWC 3KNXA 2BLQA 3SNCA 4B73A 4FVBA 1D3DB 2ZCKP 1YPEH 5EQQA 1XKAC 4ZAEA 1HYLA 2G4TA 1UVSH 5EXNA 1H9IE 1HPGA 2P16A 4YOJA 3DFLA 5F8TA 1C5XB 1T8LA 2UWPA 3UNRA 1PPBH 3MO9A 3P70B 2W7UA 1XUHA 2BQWB 3MNCA 1HJAC 1JMOH 2BXTH 1TNJA 1DWBH 4TPYA 3HGPA 2PKSC 2SGEE 3SV7A 1QJ6B 3AW0A 2G4UA 3RM0H 1TBRH 2ZNKH 1ELCA 1DSTA 3MU1A 4ZKNU 8LPRA 5K7RA 3BG8A 3DT0H 3D65E 3P8GA 2H5CA 2ZCLP 3OY6U 1BQYA 1W11U 4ZMAH 1THSH 6ESTA 4J1YA 1P03A 1HAVB 2GMTB 4ISHH 1AWHB 1EOJA 2VVCA 4MPUA 2NU3E 1GBTA 2P59A 1C2EA 4FUDA 3ODDA 5C3NA 1SOTA 2FOEA 4AZ2B 3ELAH 1F5KU 5GXPA 1ANCA 3O8BA 3SW2B 3ZVCA 1F92A 5EODA 4E7NA 3SV6A 1HXEH 3BTWE 5BPEA 3LGYA 3BEIB 1C2FA 1DSUA 1GHAG 2XWAA 1QL8A 4B2AA 1FUJA 4RKJB 3SUFA 3TLOA 2C8WB 5JBAS 1BTUA 2D26C 2ZECA 1AY6H 2QC2A 3S7KB 1VJAU 1FN8A 4JCNA 2GDDA 2BDIA 1Y5BT 4AYYB 1RTFB 3SU0A 2ZHFH 3U1JB 3A82A 4E05H 1VITG 1HRTH 4Q7YA 5EQRA 4MDSA 1LKBA 1MAXA 2BY8X 3M5LA 3EGKH 3SZNA 2PKAB 1TNGA 2QXJA 1GVLA 3SV9A 3LJJA 4FUCA 4NWKA 3RC5A 1B0EA 1HAHH 1G3BA 1BMAA 1FV9A 5J4SA 3GYLB 1GG6B 2OUAA 3HGNA 4NCYA 3QK1A 2J34A 2VB0A 4ISLA 2CN0H 1EZUC 3LC3A 3MO3A 2QF3A 1O2RA 1AUJA 1H9HE 1YPMH 1HXFH 5K0HA 3M5MA 1FY8E 1QA7A 3GY3A 1OX1A 4R0IA 2WV4A 1E35B 1K9OE 4WMDA 1S84A 1SLVB 3N7OA 1TPAE 2WYJA 1AVXA 1F0RA 2ALPA 1SLUB 1HAVA 3I78A 4FU8A 1K22H 1GBHA 1YPKH 2HWLB 3QDZB 4KTSA 1TOMH 1KIGH 2BMGB 3ZZ6A 4GCHG 1PQ7A 2TBSA 1GL0E 1GBIA 4K1EA 1NZQH 1P12E 1UTJA 5GJ4B 1GBEA 1S5SA 2A4OA 4MQAA 4WF8A 2Y81A 4Y71A 2BLWA 1BTWA 4D76A 2ZPSA 1LVOA 1UTKA 1H8IH 3TJVA 4INLA 1HV7A 3K6YA 3PYHA 1UMAH 1EB1H 4WMEA 2SGDE 3KL6A 4DY7B 4KELA 1L0ZA 2ZU1A 2FS9A 2GVFA 3GCOA 3PM3A 2PSXA 1ZGVA 1ABJH 3RXFA 1O5CB 4FUGA 1PPHE 2QV1A 3VEQB 1EZQA 4D7FA 4M7GA 1ETSH 3M7TA 1HNEE 4NIXA 1ID5H 4FVDA 2ZGHA 3A7WA 1TQ7B 1SHYA 2C8XB 1GGDB 1K1OA 2A5AA 3RXSA 1T31A 4PROA 5EW2H 1V2UT 1OP8A 1GJ4H 4NA7A 2J95A 2ZC9H 1NO9H 2Z3DA 1C5VA 4JYUH 4CH8B 4NFEA 2VINA 2XXLA 5TCAA 1HAGE 5CE1A 3ODFA 1K1JA 1O2HA 3BTDE 2J92A 2XBWA 2VIVA 3SQHE 2ZDVH 2GKVE 5DK1A 4NZLA 3WY8A 4D7GA 2BD5A 2F9VA 1FJSA 4Q80A 2ODYB 3MH5A 1V2PT 1BRUP 1J9CH 3RXQA 2BZAA 3LGIA 2VIDA 3B9FH 1LKAA 3P6ZB 3Q76A 1MKXH 1ZLRA 1BHXF 1O2ZA 1FPCH 4GHTA 1AFQB 3GDVA 1G37A 1SOZA 3GY5A 3BTTE 4K3JA 2QAAA 1VCQA 2BX4A 4NFFA 1GHWH 1EX3A 1CBWB 4YLUA 2P3UB 1DLKB 2G51A 1KXCA 2GP9B 1O3OA 1BTHH 3SJIA 1UVOA 1UTNA 3ZVEA 3BIVH 3VPKA 2M5TA 3U98H 3H5CB 1ZSLA 3RXGA 1AU8A 3HATH 3BN9A 2WUCA 4DCDA 2FI3E 2V3HH 1BBRK 1EB2A 1CU1A 4FU7A 1TRNA 3RLYH 2R0LA 3RXDA 4NSVA 2SFAA 2Y5GA 3QZRA 3ENSB 4RKOB 5LH8A 3FZZA 3RXEA 1ESBA 1OOKB 1WQSA 3FANA 1QB1A 5C67A 1Q31A 1O2XA 1W0ZU 2VVUA 2FMJA 2IPHA 1Y3UA 2ZFTA 3RMMH 1DY8A 1ZOMA 4ZKOU 1PQ8A 4CRFA 2PWXA 1EASA 3LH3A 4A6LA 1XUGA 3KQEA 1BITA 4AX9H 4NWLA 2O8LA 3HK6B 1L4ZA 2VWOA 2ZHDA 3GCNA 3VXFH 1WSSH 2A7CA 3TVJB 2FOFA 1O2KA 4X1RU 1EATA 1DLEA 1OYQA 4ZROA 2BD8A 4CBNA 1MTNB 4BTTB 1DXPA 3GDUA 2GX4A 1C2LA 4YM9A 1MU8B 1GJAB 3ZZBA 2BX3A 1ELFA 3PO1B 4TY7A 1P2KA 3B8JA 3FZDA 1HLTH 2HOBA 1NS3A 3PMBB 5JB9S 1SPJA 1WYKA 4CHAB 1AMHA 3GCHB 4U32A 5JBTA 4R8TB 4UFDH 1J17T 2V6NA 2BVRH 2HGTH 1K1NA 2ZTZA 1TA6A 4HFPB 1VJ9U 4LOYH 4MPWA 3SV8A 3T62A 4TPIZ 2TPIZ 1KSNA 1MZDA 3B23B 4X1QU 1AB9B 1AE8H 3JZ2B 2ZG0H 4WH8A 1UTQA 3ATLA 2ZDLA 4FUHA 4K8BA 3TH2H 4JYVH 3O8RA 4MTBA 4Y8ZA 1HFDA 1Y3VA 1BMLA 2JH0D 2XC4A 1O2JA 1SGFG 1FLEE 1C5LH 1TE0A 2PUQH 3A7XA 2ESTE 1O3PB 1MCVA 3UOUA 5FPTA 2V35A 3E3TA 2GMTC 4LK4A 2HLCA 2XYAA 4X6PA 3RXAA 1V3XA 1GMHF 3T27A 2BD2A 1BOQA 2FI5E 1O5AB 4UFEH 2ULLA 1THPB 3FVFB 1QFKH 2GGVB 5ABWA 4HGCA 2Y82A 1L1JA 1D3PB 2F9NA 2YNAA 4IN2A 4X2WA 1P11E 3RXPA 4CRDA 2OC1A 3EQ0H 4ZHLU 2BY9X 1D9IA 1F2SE 1V2RT 1O2UA 3PMHB 2ZFQH 2C3SA 1VR1H 3KQCA 3FP8E 1INCA 1TFXA 3GY8A 3NPSA 5DKMA 1EJMA 2V0BA 1C1PA 1V2QT 1TABE 3QZQA 2A7HA 1LTOA 3M3TA 4Z0KA 3A86A 1UTMA 1A4WH 4CRCA 3RLWH 1ELTA 1SBWA 2PTCE 4BAKB 1J14A 3MMGA 3P92A 1XXFA 1FONA 1DFPA 1OWJA 1WCZA 3D23A 1O35A 1P2JA 1XVOA 3BTGE 3L6PA 3SI4H 2BY7X 3VB4A 1YF4A 2FTLE 1LPGB 2HNTF 1KDQB 1SL3A 3LGWA 1GI3A 3TK9A 3A8AA 2A7JA 1O3FA 1XX9A 2B5TB 1HUTH 4KTUA 1SGPE 1B5GH 1AKSB 3TGIE 5A09A 2AS9A 3F1SB 5AFYH 3KIDU 4TY6A 1RRKA 2RDLA 1XVMA 3MOCA 1YBWA 4JZFH 4D9QA 1EAIA 2QN5T 2O8TA 3PTNA 1ESAA 1O5GH 2OQUA 3ZVBA 1LO6A 4WXVA 1EPTB 1L4DA 1RXPA 3AW1A 1P05A 1ZHPA 2GZ7A 1AO5A 1JOUB 1YGCH 1MQ5A 2ZQ1A 1BRBE 3IG6B 1RS0A 1ANDA 3RM2H 1GBAA 1SGRE 2WYGA 3CS7A 4AYVB 2CV3A 1FQ3A 5PTPA 4OS5A 1ZMNA 3QLPH 3DHKH 3SGBE 1GBLA 1C5WB 2B9LA 2Z9JA 2AIPA 3MI4A 1YLDA 1NPMA 2VVVA 1Y3XA 3QUMP 3ZVAA 1T4UH 2ZTXA 3RXCA 1FY5A 3BIUH 5A0BA 1NFUA 2GT7A 1GVZA 1P2OA 1IQMA 2FOMB 1WU1A 4OS7A 3KCGH 3LKWA 4MPVA 1A5HA 2H5DA 1SVPA 5FPYA 3M7QA 1HAIH 3UR6A 4B74A 1EXFA 2GZ9A 1P2MA 1GHXH 4I8HA 3OU0A 2A4GA 1PPZA 2AERH 3MU0A 1V2MT 1UK4A 3ZZAA 3V13A 2ZFRH 1MBQA 1XUIA 1CVWH 2GV7A 4B76A 1GMHG 1KDQA 1XMNB 1FAXA 5C2ZA 1NRSH 1CGHA 3BV9B 3TK6A 1QBOA 1UCYK 1Z1IA 3PLKA 1TX7A 3CENA 1RGQA 4I32A 1NY22 1ELEE 1IQHA 2Q1JA 2EC9H 1SG8B 4K60A 2KAIB 2VIQA 2XRCA 2ZHQH 1W7XH 2AGIX 1O2OA 1ZR0A 1O30A 5FBEA 1VITH 1EAXA 1ZRKA 3RUOA 1O2IA 3TH3H 4B71A 3TGJE 1MAYA 1GBKA 1A0HB 5LPRA 3M7UA 4NG9H 1TGBA 1QJ7B 4D9RA 2JETB 3KN2A 1GHVH 1A0LA 1C1OA 4O9VA 3V0XA 5SGAE 1AFQC 1E0FD 3K9XB 1YPHC 3AVZA 2UUFB 1TOCB 3UREA 1TGSZ 3RXBA 4AB8A 1Z71A 4ABBA 1TONA 1EUFA 1CBWC 2DE9A 1NFXA 1ETTH 4WH6A 2ZFSA 3VB6A 1S82A 1ETRH 1FY3A 1O31A 1YPGH 3A7VA 1IHTH 4O97A 2D8WA 1TGCA 2PR3A 4XFQA 2QXHA 3PLBA 4FU9A 4OS6A 3Q77A 2OTVA 2XWBI 1O2SA 2FO9A 5JPMH 1FDPA 1T8OA 5IDKA 1THRH 2FI4E 1ABIH 3FAOA 1LVMA 3QX5H 2BM2A 3AASA 1QQ4A 1XUFA 1G3EA 1O3KA 1GDNA 4GHQA 4OGXA 1KXEA 4XBDA 2G81E 5C1XA 2P8OC 4I8LA 3K6ZA 2LNCA 2ZTYA 2CHAB 2G55A 2Q6FA 4ZUHA 3QTOH 4MVNA 1BMNH 3F68H 5FCKA 2IN2A 1O2LA 4Q7XA 2VIWA 4CR5A 1GCDA 1MTUA 1IQJA 1Y5AT 2ZGCA 4THNH 3S9BA 1XUKA 4IS5A 3F9GA 1S0QA 1DS2E 2THFB 3I77A 3E90B 1BA8B 4AOQA 2B7DH 2GCTC 1FN6A 1C4Y2 1S83A 3PO1C 5HYOA 2WPJS 4AGKA 1QTFA 1A46H 3M3VA 5DP4A 2FWWA 1W14U 2CXVA 4NZQA 1F0UA 1QCPA 2VWMA 1Y3WA 3A83A 2PHBA 5ESTE 3SQEE 4Y11E 3ATMA 4CHAC 1ZTLA 3GCHC 1P57B 2Z94A 5F8ZA 3LOXA 4BAOB 1YC0A 2CF8H 2HRVA 1CGIE 1O2GH 1W7GH 1TYNA 1UCYE 1CGJE 1FY1A 1BBRH 1O2QA 1BRCE 2A5IA 4X6MA 1ELAA 1F5LA 2W7SA 2IOTA 3GICB 1C4U2 1W3CA 3Q3KA 1Z8RA 1DOJA 3UNQA 3RMLH 5E2OA 1V2ST 1Y5UT 2HALA 1B7XB 1O3HA 1BTPA 4A1XA 1O0DH 4BXSA 4DVAU 1HJ8A 1KYNA 2BQ6B 1KXAA 2BXUH 4XSKU 1LPZB 2FX6A 4MNXA 4X6OA 4OS2A 1G3DA 2XC0A 2GV6A 3SBKA 1S85A 5FX5A 4AN7A 4ASHA 3FFGA 4A7IB 3UNSA 1HGTH 2BZ6H 3ZZ4A 1K21H 1N8OB 1TLDA 5EQSA 3SU3A 1LHGH 1YM0A 3PTBA 1MUEB 4K1TA 1GVKB 2H9HA 1J8AA 1C2DA 1SHHB 4MPXA 2FTMA 2ZO3H 3STJA 2ZKSA 3M35A 4AB9A 1ZTJA 3SUGA 1GI4A 2FYQA 1P09A 1ZMLA 4TWWA 3UIRA 3T2NA 1GI9B 1CA8B 1SLXB 2BTCE 1EP5A 2BDBA 1AWFH 1IQEA 1SGCA 1IQIA 1OWIA 3TK5A 2Y6TA 2VNTA 3ZVFA 1GI1A 1C5MD 1J16A 2W26A 3A87A 5DPAA 1EZSC 1O37A 1T7CA 2PKAA 3MU5A 2BD4A 1PYTC 3M5NA 2WPLS 3NXPA 1GJBB 1V2KT 3KHVA 3V3MA 4Q2KA 2A2XH 1KXBA 3R3GB 2PW8H 1SFIA 1ELGA 1ARCA 3QGJA 3UTUH 1K1IA 3GY6A 4XOJA 4RSPA 1CA0C 1IQLA 2OCVB 3LONA 3VGCB 3R0FA 2C4FH 1GCTB 4KTCA 3T28A 3S9CA 1IQGA 3DUXH 1AGJA 1G9IE 4D8NA 5HXFA 1GI7B 1AIXH 4H42U 3LJOA 1C5QA 3RXJA 2R2WU 2ZU4A 1WQVH 5E0JA 3RXIA 3BG4B 1W0YH 3ZVDA 1O39A 1C1VH 4ABDA 1EPTC 4WWYA 1P3CA 2FOHA 1OWKA 4J2YB 3GDSA 4DOQA 2ANMH 2P94A 1O3BA 5EXMA 1UTLM 2R0KA 1TWXB 1WOFA 5JDUB 4ISNA 4AFQA 3NCLA 4YO9A 1NTPA 4YTAA 1QJ1B 1AVGH 1MU6B 3SNDA 5E2PA 5EXLA 1GBMA 3MNSA 3MWIU 7GCHF 1DE7H 2BD7A 1C1UH 4XDEA 4MNYA 4GUXA 1YPJH 5GIBA 3UWJH 1FPHH 2Y7XA 3M61U 1Z8IB 1TQ0B 1NROH 1FI8A 1RJXB 4YZUA 1XM1A 2PKSB 1V2LT 1PJPA 2ZU3A 4NA8A 5AHGH 4B2BA 3GY2A 2AGEX 3E91A 5A0CA 2CMYA 1VZQH 1PPEE 2XCFA 1OWEA 4BAHB 4IMZA 5L2ZH 3EA8A 1RD3B 1CQQA 3H7TA 1C2IA 2VGCC 1TIOA 2FLBH 3UWIA 6GCHF 4U01A 1TPSA 1UTOA 9LPRA 1UHBB 3ZZ3A 5EU8A 2G00A 2O9QA 1ACBE 1IOEA 4ZXXH 1EQ9A 2H6MA 3LC5A 4I7YH 3ZZ9A 2GZ8A 5H4IB 5A8ZA 2FLRH 2VU8E 5AF9H 2A2QH 1ZPCA 2Q6DA 2V3OH 4KKDA 2BDCA 3D49H 3BEUA 4Y8YA 1FIZA 3Q3YA 1GI6A 1A1RA 1ORFA 1QRZA 1OS8A 1D4PB 1GDQA 1OYTH 1C5NH 2VIOA 1GBDA 1WV7H 3SNEA 5GCHF 2O8UA 4YOGA 3ZV8A 1HAYB 2JETC 4SGBE 1KXFA 1ZMJA 5BRRE 2PUXB 3PWCA 1A5GH 2A1DB 4BAQB 1P2NA 4JMYA 1UVPA 1D6RA 1H4WA 2TIOA 1DWEH 2CJIA 1HAPH 1DANH 2QA9E 1LPKB 3MO6A 4E7RG 1S81A 2QY0B 4IBLH 1G2MA 1P2QA 5J4QA 3OTJE 3W94A 2UUJB 3O8DA 1LHFH 1V6DA 1XUJA 1MBMA 4I8KA 2DUCA 1AN1E 1GBFA 1T8NA 1O2PA 1P02A 1DXWA 4KGAA 3TH4H 2FZZA 3JZ1B 3SI3H 4FUBA 3A80A 3TJOA 3RU4D 1G2LA 1ELBA 4NIVA 6CHAB 1C5YB 1QBNA 4NIWA 1P0SH 2VJ1A 1PQAA 2ZFFH 4ZHMU 5L2YH 1UCYH 5FBIA 1P9UA 4B75A 1C5UA 2B0FA 2BY5X 1DM4B 1FMGA 1L2EA 2XNIA 2DE8A 5DG6A 1KLIH 1UHBA 4H4FA 1NC6A 1AD8H 1ARBA 2UWOA 8GCHF 1YYY1 3A81A 1ZHRA 1DWCH 1MD8A 3SJ9A 5DP6A 1LHDH 1BBRE 1NESE 1O5FH 1BMMH 4YT7H 2AYWA 2Y5FA 3OX7U 7GCHG 2ZPRA 2BQ7B 4BTUB 4OGYA 4GPGA 3RXTA 4BAMB 1YCPK 3GYMA 2OXSA 3V7TA 3HKJB 3M37A 1P2IA 4X8VH 4YESB 5LPFA 3SJKA 1BHXB 2OD3B 3LGTA 3MH6A 1ZGIA 3TJUA 3GCTF 5DGJA 1S0RA 2HPPH 2J9NA 1CHOF 1O3JA 4MG3A 4YT6H 3GISB 1C4V2 2GCHF 1JWTA 4O3TA 4BOHA 1DUEA 1GG6C 3ITIA 3VB3A 2BDYA 4X8UH 4X1PU 1GJ9B 2ZHWH 4U30A 2OBOA 2XBVA 1SGEE 2Y7ZA 2ZGJA 6GCHG 3RC4A 3UUZA 2AIQA 1C9TA 4DG4A 3SGQE 1BT7A 1MTSA 3MNXA 5DP9A 3T5FH 1C5SA 1D3QB 1SGIB 4UDWH 1CO7E 1JBUH 3RP2A 1TB6H 2PV9B 3P8OA 1PPGE 2Z9GA 4IC5A 3TNSA 3OSYA 3VXEH 5I25A 5JYIA 1QRXA 1AHTH 5ETXA 2EEKA 1SGQE 4MLFB 2SGPE 4O3UA 1C5TA 2OLGA 2Z6BD 1JIRA 1ANEA 5GCHG 5B6OA 1HAOH 1V2JT 2JH6D 3HPTB 4X2XA 4AFZA 1U6QA 8KME2 1QB6A 1Y3YA 4UD9H 2BDAA 5T6FA 2A0QB 3E1XB 1O2WA 1QHRB 1SR5C 1ZPBA 3U8RH 1EKBB 1NRNH 3TGKE 1TA2A 1ZYOA 1C2KA 1LHEH 5AFZH 3RXHA 5E0GA 2G5VA 1GJ8B 2BOHB 5LGOA 1T32A 1MCTA 4UFGH 4F4OC 3OY5U 3BEFB 1BJVA 1W13U 3PWBA 2NWNA 4ABFA 5L6NH 4X0WU 1O3MA 1CE5A 5GPIB 2ZA5A 3S69A 1NRPH 2ZQ2A 1DITH 1ELDE 2Y80A 2WINI 2ZU5A 1T8MA 1HBTH 3LPRA 4Y0ZE 1TRYA 3A88A 1GGDC 2CGAA 1F7ZA 2FM2A 1T4VH 1TAWA 1C2GA 3F9FA 4HI3A 3SHAH 2EA3A 2XBYA 4DGJA 3VGCC 4AG1A 1O2TA 3SU5A 1MZAA 1EZXC 1F0TA 1ZHMA 1GCTC 1V2WT 3A7ZA 4DJZB 1AKSA 4Y6DA 4CREA 2I6QA 1V2VT 1BTYA 2UUYA 2GD4B 3QN7A 1EAUA 4A92A 1A3EH 8GCHG 2ZFPH 4Y7BA 1H9LB 2FEQH 1GHBF 3BG4C 1NFYA 4MNWA 1Z8JB
chains in the Genus database with same CATH superfamily
1EPTA 2BVSH 3SGAE 1JXPA 3MNBA 1DUAA 3DFJA 1KTSB 1LQEA 3HKIB 1OKXA 1MKWK 1ESTA 1G30B 1ZJKA 2BDGA 1GHYH 4F55A 1AUTC 1H1BA 2BYAX 2R9PA 5T6GA 1XXDA 5A0AE 4AORA 3PLPA 2QF0A 5C20A 1C2MA 3GCTG 1SFQB 1CHOG 4B6EA 1GDUA 1O36A 1UK3A 1KTTB 3GY4A 3CS0A 6LPRA 2QF5A 2GCHG 5DP3A 2YNBA 1AVWA 2A45B 3BTEE 5E0HA 3LGVA 5G4BA 4AFSA 1N6YA 4ABHA 1IQKA 1BUIA 2JH5D 3BF6H 2STBE 4IW4E 1HB0B 1ZSJA 5DN6D 2SNVA 4AG2A 5EOKA 4WXIA 4XE4A 3URDA 2A5KA 2J98A 2BD9A 2OC0A 3RU4E 1C2HA 2BDHA 2XOKD 4K69A 4XRNA 3A7YA 5CHAB 1C5ZB 5GDSH 1W0KD 7LPRA 2XBXA 2ZIQH 1C1NA 2R3UA 1FZZA 1UJ1A 3BTME 1KLTA 2FS8A 3G01A 1ZZZA 5E8EH 2IPQX 1O32A 4I31A 3PV4A 1V2TT 3VFEA 1P01A 1O2MA 3RXMA 5A8XA 4NSYA 4WVPE 3RXLA 5DJ7A 3QWCH 2FP7B 1GMDF 2ZWLH 4B1TA 3MTYA 1TX8A 4DURA 2XNDD 4CBOA 2H9EH 1MTNC 1PFXC 4FETA 1MD7A 2PLXA 4RN6A 3KGPA 2KAIA 3UQVA 4Q7ZA 1TNIA 1SB1H 4DIIH 1SLWB 3SHCH 4O03A 1C1MA 2EI6A 1SGDE 1F5RA 2A31A 3UR9A 4LZ1H 3SNBA 2OINA 4CRAA 3EE0B 5DP8A 4U2WA 2FIRH 4ABIA 2AMQA 3BTFE 2BD3A 2K1QA 2SGAA 4ABJA 2WPHS 1AZZA 1TBZH 2P3TB 4VGCB 1YLCA 5TCCA 1VGCB 2F83A 3C27B 4UONA 1GI2A 3SU1A 3NZIA 1JIMA 1AB9C 3A8DA 3EA7A 3P8FA 2ILNA 5C0TA 2LELA 1HIAB 1TMUH 1Z6JH 2ZZUH 1LDTT 2XCNA 1LCYA 1DWDH 2GTBA 2C93B 1E34B 3PROA 7ESTE 2ZDNA 3L33A 1Z1JA 2WPKS 2YOLA 3DD2H 1OPHB 2Z3EA 2BB4A 2P93A 1UO6A 4DIHH 1FIWA 3MYWA 4ABAA 6CHAC 1BB0B 1GHBG 3D62A 2VWNA 2A4RA 3ZZDA 2PGQB 2GT8A 1E1QD 3P17H 1OWHA 3SU2A 1DX5M 5EPYA 3TU7H 2WZQA 3U8OH 4DW2U 1QY6A 3E0PB 4YOIA 2C8ZB 3U69H 1BDAA 4X2YA 3SU4A 3NWUA 1EOLA 9ESTA 3KEEA 1BRAA 4F49A 4FXGH 1A7SA 3RXVA 3E0NB 1NM6A 1TBQH 1FNIA 3PMAB 3C1KA 4JZ1A 3A84A 3A8BA 2FODA 2G52A 1NFWA 5GWZA 2W5EA 4OS4A 1Z8GA 4ZKRU 1O3NA 3LU9B 2W3IA 1A0JA 4FUEA 1QGFA 1K28D 1WDIA 2ANKH 3MU8A 4DT7B 1TALA 1W8BH 1TRMA 5LPEA 3PRDA 1A5IA 1GBBA 3IITA 5L30H 1Z7KA 2SNWA 2STAE 2F9OA 1GJDB 2WPMS 4FUJA 4KP0A 2H1UA 3ESTA 4IGDA 4A1TA 1E38B 3TPIZ 4SGAE 2ASUB 3OYPA 1X7AC 5FHTA 1K1PA 4FOUC 4ZKSU 1W2KH 1PPFE 4Z6AH 4WMFA 1RFNA 3U1IB 1GJ5H 2ZGBH 5HMAA 1W12U 2TRMA 5FAHA 2WPIS 1BTXA 1GI0A 2CK3D 1O5BB 3KYFA 3SJOA 5JB8S 2C90B 3SV2H 2L74A 2QXGA 4ABEA 2AFQB 3K2UA 4GVUA 4BXWA 2F9PA 3MH4A 3VB5A 3IWMA 1HIAA 2ZF0H 5FPSA 1AFEH 4JZDH 1WAYB 3T29A 3SZEA 3UY9A 1GBJA 3F2HA 3KF2A 1C1WH 1MQ6A 3CNRA 5A2MH 1O3CA 1KY9A 2ZPQA 5FX6A 1E36B 2AH4X 2K0QA 2BVXH 3BTKE 5ESBA 3BSQA 5F6MA 3LT3A 2HNTE 5C1YA 2BLVA 1GMDG 2JDID 5C1UA 1J15A 4E06H 2OK5A 1HJ9A 2I6SA 7KMEH 1E37B 2ZU2A 3F0OA 4IN1A 1SMFE 2NU2E 1O2NA 2JIZD 2WHXA 1MTWA 1YPLH 4IC6A 1VCWA 5DO4H 2OBQA 2Z9KA 1GL1A 2PP6A 1QA0A 1NRRH 1B0FA 1RIWB 1LHCH 5DP7A 4Y79A 3A85A 1HAXB 1BJUA 4Y8XA 1IAUA 4FUFA 2ZEBA 1GPZA 1O34A 3HK3B 3I29A 5DP5A 1TMBH 1L1NA 3KQBA 2FOAA 5EPNA 4UEHH 4BNRA 1N1LA 2Z3CA 2P95A 1O3EA 1SQAA 3GOVB 1YCPH 1NU7B 3TNTA 1QURH 4WJG2 1C2JA 1S6FA 1HJAB 4H6TA 2OP9A 4A5TS 4AFUA 1SGYE 1OP0A 2ZDAH 1TX6A 2A4QA 1WTHD 3P8NA 4LXBH 1BZXE 3ZYDA 4A1VA 4GSOA 3ZVGA 2RG3A 1OXGA 1W0JD 3ZZ7A 3UPEA 3TITA 1KXDA 3NK8A 2J4IA 2SGFE 1JRSA 1CHGA 5T6DA 1SSXA 2BOKA 1RTLA 3AAUA 2R2MB 3SN8A 2JKHA 5F03A 1OWDA 1G32B 3SUDA 3CP7A 4CRGA 2FYRA 2ZDKA 2CF9H 3ZYEA 4X8TH 1EAWA 2J2UA 2XC5A 1DICA 4CR9A 2D2DA 4Y10E 4ZHAA 2G8TA 3RXKA 3SJ8A 2B8OH 1VCPA 4X1SU 2FOCA 3F2FA 1P9SA 1O3DA 2OC8A 2AMDA 2QCYA 2O8MA 2RDEA 2WSSD 3EYDA 3NRLA 1V2NT 4HZHA 2P8OB 1GMCF 4WY3A 1DT2A 4K2YA 1IHSH 3K65B 1MTVA 1SI5H 2D1JA 1ELVA 3SNAA 1IQFA 1SC8U 1RTKA 1TGTA 1O3AA 4M9FA 2Z9IA 4ESTE 3ZZ8A 1AZ8A 3KQ5A 4GAWA 3PMJA 1H8ED 1LQDB 4K1SA 1GHZA 2QYIA 1UK2A 1SQOA 5KGOA 1SGNE 2GJGA 1O2YA 5CMXH 5C94A 3A7TA 4ABGA 3E8LA 4CRBA 3ATWA 1AQ7A 3N7EA 4IMQA 3ZZCA 1S6HA 2GCTB 3A8CA 2J94A 3MH7A 3UQOA 3P95A 4X6NA 5IYTA 1Q2WA 1NRQH 4GLYA 2ZDMA 2FX4A 2F3CE 1TPPA 1SQRA 3OTPA 1C5RA 1GI5A 1ZRBA 2VH6A 1NN6A 1BTZA 2PFEA 3KQDA 1PPCE 1QB9A 3EA9A 2W3KA 2RFKC 5TJXA 3SOSA 1GJ6A 2UWLA 2FDAA 1O33A 1TPOA 2AGGX 4Z1MD 4BANB 4UE7H 5C5OA 3V12A 1DVAH 2NU0E 1HAZB 1PYTD 2HVXA 1UVTH 2VBCA 3T25A 5CHAC 1A2CH 2ALVA 4ASUD 3MHWU 1UTPA 2Q6GA 1CT0E 4K8YA 2RA0A 2HNTC 4MNVA 3SORA 2CHAC 3SO3A 4JYTA 5HGGA 1DPOA 1UVUH 3Q3XA 2TGAA 1BCUH 4ZH8A 1SQTA 1QQUA 2L6OA 4QT8C 2FESH 1BIOA 1GI8B 4Y7AA 3S0NA 2RCEA 1QL7A 2GDEH 1K2I1 2P3FH 3NKKA 5HM9A 1GWAA 1AI8H 4NIYA 3QGNB 4K5ZA 1ANBA 4NGAH 1FXYA 1O2VA 1QR3E 3AAVA 1MKWH 1FAKH 1D3TB 1K0HA 2ANWA 4H6SB 4X2VA 1A61H 3PV5A 4XBBA 2BHGA 1F0SA 1MKXK 1O3LA 3M5OA 4BTIB 4I8GA 1IQNA 1FY4A 4AGJA 3TJNA 1H8DH 3U8TH 2EI8A 2FOBA 2NU1E 2OQ5A 1GJCB 2ZI2H 2HPQH 3STIA 1LVBA 3LDXH 3ATKA 1O5EH 1C1SA 5EG4A 2ANYA 3O8CA 1KLJH 1Q3XA 4YLQH 2WV9A 3ATIA 2XW9A 1YPHE 2QIQA 4UFFH 3RXUA 1EJNA 4TYDA 1C9PA 4VGCC 4ACBA 3SUEA 1ZTKA 1A3BH 4CH2B 1VGCC 3F2GA 3ZV9A 1DDJA 2KX4A 2ODQA 2AMPA 1Y8TA 3LGUA 1C5OH 3S9AA 2KCPA 1CT4E 5A8YA 5EGMA 3AK5A 1TNKA 1P10A 2PGBB 2UUKB 3M36A 1V2OT 3DA9B 3SU6A 3MU4A 1PQ5A 1JRTA 1HCGA 1WBGB 4ISOA 1P8VC 3RC6A 1ZJDA 1NU9A 1P3EA 1TGNA 2ODPA 1SGTA 1Y59T 1QRWA 2Z9LA 1CA0B 1OSSA 2TGTA 2O8WA 1C5PA 2VH0A 3MFJA 1GMCG 3L3TA 3EAJA 1CT2E 2FXRA 1O3IA 3ZZ5A 3QTVH 2H9TH 5HM2A 1WUNH 2QGRA 1YP9A 3UFAA 2LPRA 1G36A 1TMTH 4HTCH 4TWYA 2XTTB 3GY7A 5C5NA 4INKA 2VIPA 3S7HB 4X1NU 1Z6EA 3W95A 3RMNH 4AC9A 3BTQE 1N8OC 4JK6A 1L1GA 2RA3A 3RXOA 1O5DH 2PTNA 1QNJA 1N6XA 3FP6E 3FP7E 1QBVH 2A32A 1SGFA 2F91A 4OS1A 1WTGH 2G5NA 1GHAF 4JK5A 2EI7A 2OC7A 3LH1A 1MMJN 5DSFA 1M9UA 1NT1A 3OAAD 1EJAA 1ZSKA 2WV5A 1P04A 1ZPZA 2QXIA 4I33A 4JZIA 2C8YB 1K1MA 3URCA 1O38A 3RMOH 2ZP0H 1C1RA 3F9HA 4INHA 2TGDA 1YCPM 3NUMA 3VB7A 1MH0A 4X8SH 2J38A 3M3SA 5F53A 4LZ4B 4B2CA 1XKBC 5AVDA 3LIWA 1D6WA 2FPZA 1EP6A 1VITF 2TGPZ 2YMSC 5C17A 4ZXYH 4XBCA 1AE5A 1GBCA 4NA9H 2Z7FE 2NU4E 2SGQE 1LMWB 3F3BA 2IJOB 1YKTA 2H2ZA 2ZCHP 5F8XA 2F9UA 4I8JA 1QL9A 3UOPA 5EW1H 2BLOA 3BTHE 1HDTH 1TNHA 1K1LA 2WUBA 1QIXB 1C1QA 5FXLA 4Y0YE 2BY6X 4FUIA 2AEIH 5T3HA 2PSYA 3TIUA 3U9AH 2ZGXH 2F4LA 2F9BH 2ZHEH 2VGCB 1C1TA 1LVYA 5B6LA 3E6PH 3A89A 4B6FA 3RXRA 5JBCS 2FOGA 5JBBS 2VWLA 3F9EA 5FCRA 3QO6A 1GJ7B 1G3CA 3T26A 1W10U 2HVYB 1YLNA 4ISIH 1O3GA 2R3YA 3EDXB 3H7OA 3Q00A 3E16B 1CSOE 1P06A 3PB1E 1DY9A 3RDZA 3RU4T 1OP2A 1TNLA 4GCHF 4JZEH 8ESTE 5I46H 3F6UH 2Y5HA 4Y76A 1RIWC 3KNXA 2BLQA 3SNCA 4B73A 4FVBA 1D3DB 2ZCKP 1YPEH 5EQQA 1XKAC 4ZAEA 1HYLA 2G4TA 1UVSH 5EXNA 1H9IE 1HPGA 2P16A 4YOJA 3DFLA 5F8TA 1C5XB 1T8LA 2UWPA 3UNRA 1PPBH 3MO9A 3P70B 2W7UA 1XUHA 2BQWB 3MNCA 1HJAC 1JMOH 2BXTH 1TNJA 1DWBH 4TPYA 3HGPA 2EQNA 2PKSC 2SGEE 3SV7A 1QJ6B 2KFWA 3AW0A 2G4UA 3RM0H 1TBRH 2ZNKH 1ELCA 1DSTA 3MU1A 4ZKNU 8LPRA 5K7RA 3BG8A 3DT0H 1KMHB 3D65E 3P8GA 2H5CA 2ZCLP 3OY6U 1BQYA 1W11U 4ZMAH 1THSH 6ESTA 4J1YA 1P03A 1HAVB 2GMTB 4ISHH 1AWHB 1EOJA 2VVCA 4MPUA 2NU3E 1GBTA 2P59A 1C2EA 4FUDA 3ODDA 5C3NA 1SOTA 2FOEA 4AZ2B 3ELAH 1F5KU 5GXPA 1ANCA 3O8BA 3SW2B 3ZVCA 1F92A 5EODA 4E7NA 3SV6A 5FL7D 1HXEH 3U28C 3BTWE 5BPEA 3LGYA 5CDFE 3BEIB 1C2FA 1DSUA 1GHAG 2XWAA 1QL8A 4B2AA 1FUJA 4RKJB 3SUFA 3TLOA 2C8WB 5JBAS 1BTUA 2D26C 2ZECA 1AY6H 2QC2A 3S7KB 4F48B 1VJAU 1FN8A 4JCNA 2GDDA 2BDIA 1Y5BT 4AYYB 1RTFB 3SU0A 2V3MA 2ZHFH 3U1JB 3A82A 4E05H 4TSFD 1VITG 1HRTH 4Q7YA 5EQRA 4MDSA 1LKBA 1MAXA 2BY8X 3M5LA 3EGKH 3SZNA 2PKAB 1TNGA 2QXJA 1GVLA 3SV9A 3LJJA 4DT4A 4FUCA 4NWKA 4RT0A 1B0EA 3RC5A 1HAHH 1G3BA 1BMAA 1FV9A 5J4SA 3GYLB 3OE7D 1GG6B 2OUAA 3HGNA 4RT1A 4NCYA 3QK1A 2J34A 2VB0A 4ISLA 2CN0H 1EZUC 3LC3A 3MO3A 2QF3A 1O2RA 1AUJA 1H9HE 1YPMH 1HXFH 5K0HA 3M5MA 1FY8E 1QA7A 3GY3A 1OX1A 4R0IA 2F43B 2WV4A 1E35B 1K9OE 4WMDA 1S84A 1SLVB 3N7OA 1TPAE 2WYJA 1AVXA 1F0RA 2ALPA 1SLUB 1HAVA 3I78A 4FU8A 1K22H 1GBHA 1YPKH 2HWLB 3QDZB 4KTSA 1TOMH 1KIGH 2BMGB 3ZZ6A 4GCHG 1PQ7A 5EJZA 2TBSA 1GL0E 1GBIA 4K1EA 1NZQH 1P12E 1UTJA 5GJ4B 1GBEA 1S5SA 2A4OA 4MQAA 4WF8A 2Y81A 4Y71A 2BLWA 1BTWA 4D76A 2ZPSA 1LVOA 1UTKA 1H8IH 3TJVA 4INLA 1HV7A 3K6YA 3PYHA 1UMAH 1EB1H 4WMEA 2SGDE 3KL6A 4DY7B 4KELA 1L0ZA 2ZU1A 2FS9A 1H8HD 2GVFA 3GCOA 3PM3A 2PSXA 1ZGVA 1ABJH 3RXFA 1O5CB 4FUGA 1PPHE 2QV1A 3VEQB 1BMFD 1EZQA 4D7FA 3FKSD 4M7GA 1ETSH 3M7TA 1HNEE 4NIXA 1ID5H 4FVDA 1FX0B 2ZGHA 3A7WA 1TQ7B 1SHYA 2C8XB 2IJD1 1GGDB 1K1OA 2A5AA 3RXSA 1T31A 4PROA 5EW2H 1V2UT 1OP8A 1GJ4H 4NA7A 2J95A 2ZC9H 1NO9H 2Z3DA 1C5VA 4JYUH 4CH8B 4NFEA 2VINA 2XXLA 5TCAA 1HAGE 5CE1A 3ODFA 1K1JA 1O2HA 3BTDE 2J92A 2XBWA 2VIVA 3DSPA 3SQHE 2ZDVH 2GKVE 5DK1A 4NZLA 3WY8A 4D7GA 2BD5A 2F9VA 1FJSA 4Q80A 2ODYB 3MH5A 1V2PT 1BRUP 1J9CH 3RXQA 2BZAA 3LGIA 2VIDA 3B9FH 1LKAA 3P6ZB 3Q76A 1NBMD 1MKXH 1ZLRA 1BHXF 1O2ZA 1FPCH 4GHTA 1AFQB 3GDVA 2J97A 1G37A 1SOZA 3GY5A 3MQKC 4ACAA 3BTTE 4K3JA 2QAAA 1VCQA 2BX4A 4I86A 1GHWH 1EX3A 4NFFA 1CBWB 4YLUA 2P3UB 1DLKB 2G51A 1KXCA 2GP9B 1O3OA 1BTHH 3SJIA 1UVOA 1UTNA 3ZVEA 3BIVH 3VPKA 2M5TA 3U98H 3H5CB 1ZSLA 3RXGA 1AU8A 3HATH 3BN9A 2WUCA 4DCDA 2FI3E 2V3HH 5GNDA 1BBRK 1EB2A 1CU1A 4FU7A 1TRNA 3RLYH 2R0LA 3RXDA 3KYGA 4NSVA 2SFAA 2Y5GA 3QZRA 3ENSB 4RKOB 5LH8A 3FZZA 3RXEA 1ESBA 1OOKB 1WQSA 3FANA 1QB1A 5C67A 1Q31A 1O2XA 1W0ZU 2VVUA 2FMJA 2IPHA 1Y3UA 2ZFTA 3RMMH 1DY8A 1ZOMA 4ZKOU 1PQ8A 4CRFA 2PWXA 1EASA 3LH3A 4A6LA 1XUGA 3KQEA 1BITA 4AX9H 4NWLA 2O8LA 3HK6B 1L4ZA 2VWOA 2ZHDA 3GCNA 1OHHD 3VXFH 5IK2D 1WSSH 2A7CA 3TVJB 2FOFA 1O2KA 4X1RU 1EATA 1DLEA 1OYQA 4ZROA 3N99A 2BD8A 2HLDD 4CBNA 1MTNB 4BTTB 1DXPA 3GDUA 2GX4A 1C2LA 4YM9A 1YY3A 1MU8B 1GJAB 3ZZBA 2BX3A 1ELFA 3PO1B 4TY7A 1P2KA 3B8JA 5KEDA 3FZDA 1HLTH 2HOBA 1NS3A 3PMBB 2QE7D 5JB9S 1SPJA 1WYKA 4CHAB 1AMHA 3GCHB 4U32A 5JBTA 4R8TB 4UFDH 1J17T 2V6NA 2BVRH 2HGTH 1K1NA 2ZTZA 1TA6A 4HFPB 1VJ9U 4LOYH 4MPWA 3SV8A 3T62A 4TPIZ 2TPIZ 1KSNA 1MZDA 2KM0A 3B23B 4X1QU 1AB9B 1AE8H 3JZ2B 2ZG0H 4TT3D 4WH8A 1UTQA 3ATLA 2ZDLA 4FUHA 4K8BA 3TH2H 4JYVH 3O8RA 4MTBA 4Y8ZA 1HFDA 1Y3VA 1BMLA 2JH0D 2XC4A 1O2JA 1SGFG 1FLEE 1C5LH 4HG6A 1TE0A 2PUQH 3A7XA 2ESTE 1O3PB 1MCVA 3UOUA 5FPTA 2V35A 3E3TA 2GMTC 2KR7A 4LK4A 2HLCA 2XYAA 4X6PA 3RXAA 1V3XA 1GMHF 3T27A 2BD2A 1BOQA 2FI5E 1O5AB 4UFEH 2ULLA 1THPB 3FVFB 1QFKH 2GGVB 5ABWA 4HGCA 2Y82A 1L1JA 1D3PB 2F9NA 2YNAA 4IN2A 4X2WA 1P11E 3RXPA 4CRDA 2OC1A 3EQ0H 4ZHLU 1EFRD 2BY9X 2K8IA 1D9IA 3GS9A 5KECA 1F2SE 1V2RT 1O2UA 3PMHB 2ZFQH 2C3SA 1VR1H 3KQCA 3FP8E 1INCA 1TFXA 3GY8A 3NPSA 5DKMA 1SKYE 1EJMA 2V0BA 1C1PA 1V2QT 1TABE 3QZQA 2A7HA 1LTOA 3M3TA 4Z0KA 3A86A 1UTMA 1A4WH 4CRCA 3RLWH 1ELTA 1SBWA 2PTCE 4BAKB 1J14A 3MMGA 3P92A 3OEED 1XXFA 1FONA 1DFPA 1OWJA 1WCZA 3D23A 1O35A 1P2JA 1XVOA 3BTGE 3L6PA 3SI4H 2BY7X 3VB4A 1YF4A 2FTLE 1LPGB 2HNTF 1KDQB 1SL3A 2JJ2D 3LGWA 1GI3A 3TK9A 3A8AA 2A7JA 1O3FA 1XX9A 2B5TB 3OEHD 1HUTH 4KTUA 1SGPE 1B5GH 1AKSB 2WPDD 3TGIE 5A09A 2AS9A 3F1SB 5AFYH 3KIDU 4TY6A 1RRKA 2RDLA 1XVMA 3MOCA 1YBWA 4JZFH 4D9QA 1EAIA 2QN5T 2O8TA 3PTNA 1ESAA 1O5GH 2OQUA 3ZVBA 1LO6A 4WXVA 1EPTB 1L4DA 1RXPA 3AW1A 1P05A 4P00A 1ZHPA 2GZ7A 1AO5A 1JOUB 1YGCH 1MQ5A 2ZQ1A 1BRBE 3IG6B 1RS0A 1ANDA 3RM2H 1GBAA 1SGRE 2WYGA 3CS7A 4AYVB 1NBME 2CV3A 1FQ3A 5PTPA 4OS5A 1ZMNA 3QLPH 3DHKH 1S6LA 3SGBE 1GBLA 1C5WB 2B9LA 2Z9JA 2AIPA 3FN8A 3MI4A 1YLDA 1NPMA 2VVVA 1Y3XA 3QUMP 3ZVAA 3F0PA 1MABB 1T4UH 2ZTXA 3RXCA 1FY5A 3BIUH 2V7QD 5A0BA 1NFUA 2GT7A 1GVZA 1P2OA 1IQMA 2FOMB 1WU1A 3UB0A 4OS7A 3KCGH 3PRBA 3LKWA 4MPVA 1A5HA 2H5DA 1SVPA 5CHBA 5FPYA 3M7QA 1HAIH 3UR6A 4B74A 1EXFA 2GZ9A 1P2MA 1GHXH 4I8HA 3OU0A 2A4GA 1PPZA 2AERH 3MU0A 1V2MT 1UK4A 3ZZAA 3V13A 2ZFRH 1MBQA 1XUIA 1CVWH 2GV7A 2LP6A 4B76A 1GMHG 1KDQA 1XMNB 1FAXA 5C2ZA 1NRSH 1CGHA 3BV9B 3TK6A 1QBOA 1UCYK 1Z1IA 3PLKA 1TX7A 3CENA 1RGQA 4I32A 1NY22 1ELEE 1IQHA 2Q1JA 2EC9H 1SG8B 4K60A 2KAIB 2VIQA 2XRCA 2ZHQH 1W7XH 2AGIX 1O2OA 1ZR0A 1O30A 5FBEA 1VITH 1EAXA 1ZRKA 3RUOA 1O2IA 3TH3H 4B71A 3TGJE 1MAYA 1GBKA 2QF4A 1A0HB 5LPRA 3M7UA 4NG9H 1TGBA 1QJ7B 4D9RA 2JETB 3KN2A 1GHVH 1A0LA 1C1OA 4O9VA 3V0XA 5SGAE 1AFQC 1E0FD 3K9XB 1YPHC 4RI0A 3AVZA 2UUFB 1TOCB 4XD7D 3UREA 1TGSZ 3RXBA 4AB8A 1Z71A 4ABBA 1TONA 1EUFA 1CBWC 2DE9A 1COWD 1NFXA 1ETTH 1UW7A 4WH6A 2ZFSA 3VB6A 1S82A 1ETRH 1FY3A 1O31A 1YPGH 3DSGA 3A7VA 1IHTH 4O97A 2D8WA 1TGCA 2PR3A 4XFQA 2QXHA 3PLBA 4FU9A 4OS6A 3Q77A 2OTVA 2XWBI 1O2SA 2FO9A 5JPMH 2J5UA 1FDPA 1T8OA 5IDKA 1THRH 2FI4E 1ABIH 3FAOA 1LVMA 3QX5H 2BM2A 3AASA 1QQ4A 1XUFA 1G3EA 1O3KA 1GDNA 4GHQA 4OGXA 1KXEA 4XBDA 2G81E 5C1XA 3PV2A 2P8OC 4I8LA 3K6ZA 2LNCA 2ZTYA 2CHAB 2G55A 3OFND 2Q6FA 4ZUHA 3QTOH 4MVNA 1BMNH 3F68H 5FCKA 2IN2A 1O2LA 4Q7XA 2VIWA 4CR5A 3EE7A 1GCDA 1MTUA 1IQJA 1Y5AT 2ZGCA 4THNH 3S9BA 1XUKA 4IS5A 3F9GA 1S0QA 1DS2E 1WXRA 2THFB 3I77A 3E90B 1BA8B 4AOQA 2B7DH 2GCTC 1FN6A 1C4Y2 1S83A 3PO1C 5HYOA 2WPJS 4AGKA 1QTFA 1A46H 3M3VA 5DP4A 2FWWA 1W14U 2CXVA 4NZQA 1F0UA 1QCPA 2VWMA 1Y3WA 3A83A 2PHBA 5ESTE 3SQEE 4Y11E 3ATMA 4CHAC 1ZTLA 2KCOA 3GCHC 1P57B 2Z94A 5F8ZA 3LOXA 4BAOB 1YC0A 2CF8H 2HRVA 1CGIE 1O2GH 1W7GH 1TYNA 1UCYE 1CGJE 1FY1A 1BBRH 1O2QA 1BRCE 2A5IA 3N7DA 4X6MA 1ELAA 1F5LA 2W7SA 2IOTA 2YMSD 3GICB 1C4U2 1W3CA 3Q3KA 1Z8RA 5C0UA 1DOJA 1VKYA 3UNQA 3RMLH 5E2OA 1V2ST 1Y5UT 3SYJA 2HALA 1B7XB 1O3HA 1BTPA 4A1XA 1O0DH 4BXSA 4DVAU 1HJ8A 1KYNA 2BQ6B 1KXAA 2BXUH 4XSKU 1LPZB 2FX6A 2KZ4A 4MNXA 4X6OA 4OS2A 1G3DA 2XC0A 2GV6A 3SBKA 3FOAA 1S85A 1QZ8A 5FX5A 4AN7A 4ASHA 3FFGA 4A7IB 3UNSA 1HGTH 2BZ6H 3ZZ4A 1K21H 1N8OB 1TLDA 2AHME 5EQSA 3SU3A 4ZCNA 1LHGH 2EY4C 1YM0A 3PTBA 1MUEB 4K1TA 1GVKB 2H9HA 1J8AA 1C2DA 1SHHB 4MPXA 2FTMA 2ZO3H 3STJA 2ZKSA 3M35A 4AB9A 1ZTJA 3SUGA 1GI4A 2FYQA 1P09A 1ZMLA 4TWWA 3UIRA 3T2NA 1GI9B 1CA8B 1SLXB 2BTCE 1EP5A 2BDBA 1AWFH 1IQEA 1SGCA 1IQIA 1OWIA 3TK5A 2Y6TA 2VNTA 3ZVFA 1GI1A 1C5MD 1J16A 2W26A 3A87A 5DPAA 1EZSC 1O37A 2YMSB 1T7CA 2PKAA 3MU5A 2BD4A 1PYTC 3M5NA 2WPLS 3NXPA 1GJBB 1V2KT 3KHVA 3V3MA 4Q2KA 2A2XH 1KXBA 3R3GB 2PW8H 1SFIA 1ELGA 1ARCA 2KCYA 3QGJA 3UTUH 1K1IA 3GY6A 4XOJA 4RSPA 1CA0C 1IQLA 2OCVB 3LONA 3VGCB 3R0FA 2C4FH 4P02A 1GCTB 4KTCA 3T28A 3S9CA 1IQGA 3DUXH 1AGJA 1G9IE 4D8NA 5HXFA 1GI7B 1AIXH 4H42U 3LJOA 1C5QA 2W6JD 3RXJA 2R2WU 2ZU4A 1WQVH 5E0JA 3RXIA 3BG4B 1W0YH 3ZVDA 1O39A 1C1VH 4ABDA 1EPTC 4WWYA 1P3CA 2FOHA 1OWKA 5EJ1A 4J2YB 3GDSA 1E79D 4DOQA 2ANMH 2P94A 1O3BA 5EXMA 1UTLM 2R0KA 1TWXB 1WOFA 5JDUB 4ISNA 4AFQA 3NCLA 4YO9A 1NTPA 4YTAA 1QJ1B 1AVGH 1MU6B 3SNDA 5E2PA 5EXLA 1GBMA 3MNSA 3MWIU 7GCHF 5HIZA 1DE7H 2BD7A 1C1UH 4XDEA 4MNYA 4GUXA 1YPJH 5GIBA 3UWJH 1FPHH 2Y7XA 2JJ1D 3M61U 1Z8IB 1TQ0B 1NROH 1FI8A 1RJXB 4YZUA 1XM1A 2PKSB 1V2LT 1PJPA 2ZU3A 4NA8A 5AHGH 4B2BA 3GY2A 3VG8A 4YXWD 2AGEX 3E91A 5A0CA 2CMYA 1VZQH 1PPEE 2XCFA 1OWEA 4BAHB 4IMZA 5L2ZH 3EA8A 1RD3B 1CQQA 3H7TA 1YWUA 1C2IA 2VGCC 1TIOA 2FLBH 3UWIA 6GCHF 4U01A 1TPSA 1UTOA 9LPRA 1UHBB 3ZZ3A 5EU8A 2G00A 3H09A 2O9QA 1ACBE 1IOEA 4ZXXH 1EQ9A 2H6MA 3LC5A 4I7YH 2W6ID 3ZZ9A 2GZ8A 5H4IB 5A8ZA 5HIYA 2FLRH 2VU8E 5AF9H 2A2QH 1ZPCA 2Q6DA 2V3OH 4KKDA 2BDCA 3D49H 3BEUA 4Y8YA 1FIZA 5EJLA 3Q3YA 1GI6A 1A1RA 1ORFA 1QRZA 1OS8A 1D4PB 1GDQA 1OYTH 1C5NH 3FO8D 2VIOA 1GBDA 1WV7H 3SNEA 5GCHF 2O8UA 4YOGA 3ZV8A 1HAYB 2JETC 4SGBE 1KXFA 5T1VA 1ZMJA 5BRRE 2PUXB 3PWCA 1A5GH 2A1DB 4BAQB 1P2NA 4JMYA 1UVPA 1D6RA 1H4WA 2TIOA 1DWEH 2CJIA 1HAPH 1DANH 2QA9E 1LPKB 3MO6A 4E7RG 1S81A 2QY0B 4IBLH 1G2MA 1P2QA 5J4QA 3OTJE 3W94A 2UUJB 3O8DA 1LHFH 1V6DA 2M2AA 1XUJA 1MBMA 4I8KA 2DUCA 1AN1E 5HKKD 1GBFA 1T8NA 1O2PA 1P02A 1DXWA 4KGAA 3TH4H 2FZZA 3JZ1B 3SI3H 3UAIC 4FUBA 3A80A 3TJOA 3RU4D 1G2LA 1ELBA 4NIVA 3WWBA 6CHAB 1C5YB 1QBNA 4NIWA 1P0SH 2VJ1A 1PQAA 2ZFFH 4ZHMU 5L2YH 1UCYH 5FBIA 1P9UA 4B75A 1C5UA 2B0FA 2BY5X 1DM4B 1FMGA 1L2EA 2XNIA 2DE8A 5DG6A 1KLIH 1UHBA 4H4FA 1NC6A 1AD8H 1ARBA 2KCAA 2UWOA 8GCHF 1YYY1 3A81A 1ZHRA 1DWCH 1MD8A 3SJ9A 4OM9A 5DP6A 1LHDH 1BBRE 1NESE 1O5FH 1BMMH 4YT7H 2AYWA 2Y5FA 3OX7U 7GCHG 2ZPRA 2BQ7B 4BTUB 4OGYA 4GPGA 3RXTA 4BAMB 1YCPK 3GYMA 2OXSA 3V7TA 3HKJB 3M37A 1P2IA 4X8VH 4YESB 5LPFA 3SJKA 1BHXB 2OD3B 3LGTA 3MH6A 1ZGIA 3TJUA 3GCTF 5DGJA 1S0RA 2HPPH 2J9NA 1CHOF 1O3JA 4MG3A 4YT6H 3GISB 1C4V2 2GCHF 1JWTA 4O3TA 4BOHA 1DUEA 1GG6C 3ITIA 3VB3A 2BDYA 4X8UH 4X1PU 1GJ9B 2ZHWH 4U30A 2OBOA 2XBVA 1SGEE 2Y7ZA 2ZGJA 4Q4LA 6GCHG 3RC4A 3UUZA 2AIQA 1C9TA 4DG4A 3SGQE 1BT7A 1MTSA 3MNXA 5DP9A 3T5FH 1C5SA 1D3QB 1SGIB 4UDWH 1CO7E 1JBUH 3RP2A 3WW7A 1TB6H 2PV9B 3P8OA 1PPGE 2Z9GA 4IC5A 3TNSA 3OSYA 3VXEH 5I25A 5JYIA 1QRXA 1AHTH 5ETXA 2EEKA 1SGQE 4MLFB 2SGPE 4O3UA 1C5TA 2OLGA 2Z6BD 3WWFA 1JIRA 1ANEA 5GCHG 5B6OA 1HAOH 1E1RD 1V2JT 2JH6D 3HPTB 4X2XA 4AFZA 1U6QA 8KME2 1QB6A 1Y3YA 4UD9H 2BDAA 5T6FA 2A0QB 3E1XB 1O2WA 1QHRB 1SR5C 1ZPBA 3U8RH 1EKBB 1NRNH 3TGKE 1TA2A 1ZYOA 1C2KA 1LHEH 5AFZH 3RXHA 5E0GA 2G5VA 1GJ8B 2BOHB 3DCLA 5LGOA 1T32A 4Q63A 1MCTA 4UFGH 4F4OC 3OY5U 3BEFB 1BJVA 2J98B 1W13U 3PWBA 2NWNA 4ABFA 5L6NH 4X0WU 1O3MA 1CE5A 5GPIB 2ZA5A 3S69A 1NRPH 2ZQ2A 1DITH 1ELDE 2Y80A 3DSOA 2WINI 2ZU5A 3W1EA 1T8MA 1HBTH 3LPRA 4Y0ZE 1TRYA 3A88A 1GGDC 2CGAA 1F7ZA 2FM2A 1T4VH 1TAWA 1C2GA 3F9FA 4HI3A 3SHAH 2EA3A 2XBYA 4DGJA 5EIYA 3VGCC 4AG1A 1O2TA 3SU5A 1MZAA 1EZXC 1F0TA 1ZHMA 1GCTC 1V2WT 3A7ZA 4DJZB 1AKSA 4Y6DA 4CREA 2I6QA 1V2VT 1BTYA 2UUYA 2GD4B 3QN7A 1EAUA 4A92A 1A3EH 3ZIAD 8GCHG 2ZFPH 4Y7BA 1H9LB 2FEQH 1GHBF 3BG4C 1NFYA 4MNWA 1Z8JB
chains in the Genus database with same CATH topology
1EPTA 2BVSH 3SGAE 1JXPA 3MNBA 1DUAA 3DFJA 1KTSB 1LQEA 3HKIB 1OKXA 1MKWK 1ESTA 1G30B 1ZJKA 2BDGA 1GHYH 1AUTC 1H1BA 2BYAX 2R9PA 5T6GA 1XXDA 5A0AE 4AORA 3PLPA 2QF0A 5C20A 1C2MA 3GCTG 1SFQB 1CHOG 1GDUA 1O36A 1UK3A 1KTTB 3GY4A 3CS0A 6LPRA 2GCHG 5DP3A 2YNBA 1AVWA 2A45B 3BTEE 5E0HA 3LGVA 5G4BA 4AFSA 1N6YA 4ABHA 1IQKA 1BUIA 2JH5D 3BF6H 2STBE 4IW4E 1HB0B 1ZSJA 2SNVA 4AG2A 5EOKA 4WXIA 4XE4A 3URDA 2A5KA 2BD9A 2OC0A 3RU4E 1C2HA 2BDHA 4K69A 3A7YA 5CHAB 1C5ZB 5GDSH 7LPRA 2XBXA 2ZIQH 1C1NA 2R3UA 1FZZA 1UJ1A 3BTME 1KLTA 2FS8A 3G01A 1ZZZA 5E8EH 1O32A 4I31A 3PV4A 1V2TT 3VFEA 1P01A 1O2MA 3RXMA 5A8XA 4NSYA 4WVPE 3RXLA 5DJ7A 3QWCH 2FP7B 1GMDF 2ZWLH 4B1TA 3MTYA 1TX8A 4DURA 4CBOA 2H9EH 1MTNC 1PFXC 1MD7A 2PLXA 4RN6A 3KGPA 2KAIA 3UQVA 4Q7ZA 1TNIA 1SB1H 4DIIH 1SLWB 3SHCH 4O03A 1C1MA 2EI6A 1SGDE 1F5RA 2A31A 3UR9A 4LZ1H 3SNBA 2OINA 4CRAA 3EE0B 5DP8A 4U2WA 2FIRH 4ABIA 2AMQA 3BTFE 2BD3A 2K1QA 2SGAA 4ABJA 2WPHS 1AZZA 1TBZH 2P3TB 4VGCB 1YLCA 5TCCA 1VGCB 2F83A 3C27B 4UONA 1GI2A 3SU1A 3NZIA 1JIMA 1AB9C 3A8DA 3EA7A 3P8FA 2ILNA 1HIAB 1TMUH 1Z6JH 2ZZUH 1LDTT 2XCNA 1LCYA 1DWDH 2GTBA 2C93B 1E34B 3PROA 7ESTE 2ZDNA 3L33A 1Z1JA 2WPKS 2YOLA 3DD2H 1OPHB 2Z3EA 2BB4A 2P93A 1UO6A 4DIHH 1FIWA 3MYWA 4ABAA 6CHAC 1BB0B 1GHBG 3D62A 2VWNA 2A4RA 3ZZDA 2PGQB 2GT8A 3SU2A 3P17H 1OWHA 1DX5M 5EPYA 3TU7H 3U8OH 4DW2U 1QY6A 3E0PB 4YOIA 2C8ZB 3U69H 1BDAA 4X2YA 3SU4A 3NWUA 1EOLA 9ESTA 3KEEA 1BRAA 4F49A 4FXGH 1A7SA 3RXVA 3E0NB 1NM6A 1TBQH 1FNIA 3PMAB 3C1KA 4JZ1A 3A84A 3A8BA 2FODA 2G52A 1NFWA 5GWZA 2W5EA 4OS4A 1Z8GA 4ZKRU 1O3NA 3LU9B 2W3IA 1A0JA 4FUEA 1QGFA 1K28D 2ANKH 3MU8A 4DT7B 1TALA 1W8BH 1TRMA 5LPEA 1A5IA 1GBBA 3IITA 5L30H 1Z7KA 2SNWA 2STAE 2F9OA 1GJDB 2WPMS 4FUJA 4KP0A 2H1UA 3ESTA 4IGDA 4A1TA 1E38B 3TPIZ 4SGAE 2ASUB 3OYPA 1X7AC 5FHTA 1K1PA 4ZKSU 1W2KH 1PPFE 4Z6AH 4WMFA 1RFNA 3U1IB 1GJ5H 2ZGBH 5HMAA 1W12U 2TRMA 5FAHA 2WPIS 1BTXA 1GI0A 1O5BB 3SJOA 5JB8S 2C90B 3SV2H 2QXGA 4ABEA 2AFQB 3K2UA 4GVUA 4BXWA 2F9PA 3MH4A 3VB5A 3IWMA 1HIAA 2ZF0H 5FPSA 1AFEH 4JZDH 1WAYB 3T29A 3UY9A 1GBJA 3KF2A 1C1WH 1MQ6A 5A2MH 1O3CA 1KY9A 2ZPQA 5FX6A 1E36B 2AH4X 2BVXH 3BTKE 5ESBA 3BSQA 5F6MA 3LT3A 2HNTE 5C1YA 2BLVA 1GMDG 5C1UA 1J15A 4E06H 1HJ9A 2I6SA 7KMEH 1E37B 2ZU2A 4IN1A 1SMFE 2NU2E 1O2NA 1MTWA 1YPLH 4IC6A 1VCWA 5DO4H 2OBQA 2Z9KA 1GL1A 1QA0A 1NRRH 1B0FA 1RIWB 1LHCH 5DP7A 4Y79A 3A85A 1HAXB 1BJUA 4Y8XA 1IAUA 4FUFA 2ZEBA 1GPZA 1O34A 3HK3B 3I29A 5DP5A 1TMBH 1L1NA 3KQBA 2FOAA 5EPNA 4UEHH 4BNRA 1N1LA 2Z3CA 2P95A 1O3EA 1SQAA 3GOVB 1YCPH 1NU7B 3TNTA 1QURH 4WJG2 1C2JA 1S6FA 1HJAB 4H6TA 2OP9A 4A5TS 4AFUA 1SGYE 1OP0A 2ZDAH 1TX6A 2A4QA 1WTHD 3P8NA 4LXBH 1BZXE 3ZYDA 4A1VA 4GSOA 3ZVGA 2RG3A 1OXGA 3ZZ7A 3UPEA 3TITA 1KXDA 3NK8A 2J4IA 2SGFE 1JRSA 1CHGA 5T6DA 1SSXA 2BOKA 1RTLA 3AAUA 2R2MB 3SN8A 2JKHA 5F03A 1OWDA 1G32B 3SUDA 3CP7A 4CRGA 2FYRA 2ZDKA 2CF9H 3ZYEA 4X8TH 1EAWA 2J2UA 2XC5A 1DICA 4CR9A 2D2DA 4Y10E 4ZHAA 2G8TA 3RXKA 3SJ8A 2B8OH 1VCPA 4X1SU 2FOCA 1P9SA 1O3DA 2OC8A 2AMDA 2QCYA 2O8MA 3EYDA 1V2NT 4HZHA 2P8OB 1GMCF 4WY3A 1DT2A 4K2YA 1IHSH 3K65B 1MTVA 1SI5H 2D1JA 1ELVA 3SNAA 1IQFA 1SC8U 1RTKA 1TGTA 1O3AA 2Z9IA 4ESTE 3ZZ8A 1AZ8A 4GAWA 3PMJA 1LQDB 4K1SA 1GHZA 2QYIA 1UK2A 1SQOA 1SGNE 1O2YA 5CMXH 3A7TA 4ABGA 3E8LA 4CRBA 3ATWA 1AQ7A 4IMQA 3ZZCA 1S6HA 2GCTB 3A8CA 2J94A 3MH7A 3UQOA 3P95A 4X6NA 5IYTA 1Q2WA 1NRQH 4GLYA 2ZDMA 2FX4A 2F3CE 1TPPA 1C5RA 1GI5A 1ZRBA 2VH6A 1NN6A 1BTZA 2PFEA 3KQDA 1PPCE 1QB9A 3EA9A 2W3KA 5TJXA 3SOSA 1GJ6A 2UWLA 2FDAA 1O33A 1TPOA 2AGGX 4BANB 4UE7H 5C5OA 3V12A 1DVAH 2NU0E 1HAZB 1PYTD 2HVXA 1UVTH 3T25A 5CHAC 1A2CH 2ALVA 3MHWU 1UTPA 2Q6GA 1CT0E 4K8YA 2RA0A 2HNTC 4MNVA 3SORA 2CHAC 3SO3A 4JYTA 5HGGA 1DPOA 1UVUH 3Q3XA 2TGAA 1BCUH 4ZH8A 1SQTA 1QQUA 4QT8C 2FESH 1BIOA 1GI8B 4Y7AA 3S0NA 2RCEA 1QL7A 2GDEH 1K2I1 2P3FH 3NKKA 5HM9A 1GWAA 1AI8H 4NIYA 3QGNB 4K5ZA 1ANBA 4NGAH 1FXYA 1O2VA 1QR3E 3AAVA 1MKWH 1FAKH 1D3TB 2ANWA 4H6SB 4X2VA 1A61H 4XBBA 2BHGA 1F0SA 1MKXK 1O3LA 3M5OA 4BTIB 4I8GA 1IQNA 1FY4A 4AGJA 3TJNA 1H8DH 3U8TH 2EI8A 2FOBA 2NU1E 2OQ5A 1GJCB 2ZI2H 2HPQH 3STIA 1LVBA 3LDXH 3ATKA 1O5EH 1C1SA 5EG4A 2ANYA 3O8CA 1KLJH 1Q3XA 4YLQH 3ATIA 2XW9A 1YPHE 2QIQA 4UFFH 3RXUA 1EJNA 4TYDA 1C9PA 4VGCC 3SUEA 1ZTKA 1A3BH 4CH2B 1VGCC 3ZV9A 1DDJA 2ODQA 2AMPA 1Y8TA 3LGUA 1C5OH 3S9AA 1CT4E 5A8YA 5EGMA 1TNKA 1P10A 2PGBB 2UUKB 3M36A 1V2OT 3DA9B 3SU6A 3MU4A 1PQ5A 1JRTA 1HCGA 1WBGB 4ISOA 1P8VC 3RC6A 1ZJDA 1NU9A 1P3EA 1TGNA 2ODPA 1SGTA 1Y59T 1QRWA 2Z9LA 1CA0B 1OSSA 2TGTA 2O8WA 1C5PA 2VH0A 3MFJA 1GMCG 3L3TA 3EAJA 1CT2E 2FXRA 1O3IA 3ZZ5A 3QTVH 2H9TH 5HM2A 1WUNH 2QGRA 1YP9A 3UFAA 2LPRA 1G36A 1TMTH 4HTCH 4TWYA 2XTTB 3GY7A 5C5NA 4INKA 2VIPA 3S7HB 4X1NU 1Z6EA 3W95A 3RMNH 3BTQE 1N8OC 4JK6A 1L1GA 2RA3A 3RXOA 1O5DH 2PTNA 1QNJA 1N6XA 3FP6E 3FP7E 1QBVH 2A32A 1SGFA 2F91A 4OS1A 1WTGH 2G5NA 1GHAF 4JK5A 2EI7A 2OC7A 3LH1A 1MMJN 1M9UA 1NT1A 1EJAA 1ZSKA 2WV5A 1P04A 1ZPZA 2QXIA 4I33A 4JZIA 2C8YB 1K1MA 3URCA 1O38A 3RMOH 2ZP0H 1C1RA 3F9HA 4INHA 2TGDA 1YCPM 3NUMA 3VB7A 1MH0A 4X8SH 2J38A 3M3SA 4LZ4B 4B2CA 1XKBC 5AVDA 3LIWA 1D6WA 2FPZA 1EP6A 1VITF 2TGPZ 4ZXYH 4XBCA 1AE5A 1GBCA 4NA9H 2Z7FE 2NU4E 2SGQE 1LMWB 2IJOB 1YKTA 2H2ZA 2ZCHP 5F8XA 2F9UA 4I8JA 1QL9A 3UOPA 5EW1H 2BLOA 3BTHE 1HDTH 1TNHA 1K1LA 2WUBA 1QIXB 1C1QA 5FXLA 4Y0YE 2BY6X 4FUIA 2AEIH 5T3HA 2PSYA 3TIUA 3U9AH 2ZGXH 2F9BH 2ZHEH 2VGCB 1C1TA 1LVYA 3E6PH 3A89A 3RXRA 5JBCS 2FOGA 5JBBS 2VWLA 3F9EA 5FCRA 3QO6A 1GJ7B 1G3CA 3T26A 1W10U 4ISIH 1O3GA 2R3YA 3EDXB 3H7OA 3Q00A 3E16B 1CSOE 1P06A 3PB1E 1DY9A 3RDZA 3RU4T 1OP2A 1TNLA 4GCHF 4JZEH 8ESTE 5I46H 3F6UH 2Y5HA 4Y76A 1RIWC 3KNXA 2BLQA 3SNCA 4B73A 4FVBA 1D3DB 2ZCKP 1YPEH 5EQQA 1XKAC 4ZAEA 1HYLA 2G4TA 1UVSH 5EXNA 1H9IE 1HPGA 2P16A 4YOJA 3DFLA 5F8TA 1C5XB 1T8LA 2UWPA 3UNRA 1PPBH 3MO9A 3P70B 2W7UA 1XUHA 2BQWB 3MNCA 1HJAC 1JMOH 2BXTH 1TNJA 1DWBH 4TPYA 3HGPA 2PKSC 2SGEE 3SV7A 1QJ6B 3AW0A 2G4UA 3RM0H 1TBRH 2ZNKH 1ELCA 1DSTA 3MU1A 4ZKNU 8LPRA 5K7RA 3BG8A 3DT0H 3D65E 3P8GA 2H5CA 2ZCLP 3OY6U 1BQYA 1W11U 4ZMAH 1THSH 6ESTA 4J1YA 1P03A 1HAVB 2GMTB 4ISHH 1AWHB 1EOJA 2VVCA 4MPUA 2NU3E 1GBTA 2P59A 1C2EA 4FUDA 3ODDA 5C3NA 1SOTA 2FOEA 4AZ2B 3ELAH 1F5KU 5GXPA 1ANCA 3O8BA 3SW2B 3ZVCA 1F92A 5EODA 4E7NA 3SV6A 1HXEH 3BTWE 5BPEA 3LGYA 3BEIB 1C2FA 1DSUA 1GHAG 2XWAA 1QL8A 4B2AA 1FUJA 4RKJB 3SUFA 3TLOA 2C8WB 5JBAS 1BTUA 2D26C 2ZECA 1AY6H 2QC2A 3S7KB 1VJAU 1FN8A 4JCNA 2GDDA 2BDIA 1Y5BT 4AYYB 1RTFB 3SU0A 2ZHFH 3U1JB 3A82A 4E05H 1VITG 1HRTH 4Q7YA 5EQRA 4MDSA 1LKBA 1MAXA 2BY8X 3M5LA 3EGKH 3SZNA 2PKAB 1TNGA 2QXJA 1GVLA 3SV9A 3LJJA 4FUCA 4NWKA 3RC5A 1B0EA 1HAHH 1G3BA 1BMAA 1FV9A 5J4SA 3GYLB 1GG6B 2OUAA 3HGNA 4NCYA 3QK1A 2J34A 2VB0A 4ISLA 2CN0H 1EZUC 3LC3A 3MO3A 2QF3A 1O2RA 1AUJA 1H9HE 1YPMH 1HXFH 5K0HA 3M5MA 1FY8E 1QA7A 3GY3A 1OX1A 4R0IA 2WV4A 1E35B 1K9OE 4WMDA 1S84A 1SLVB 3N7OA 1TPAE 2WYJA 1AVXA 1F0RA 2ALPA 1SLUB 1HAVA 3I78A 4FU8A 1K22H 1GBHA 1YPKH 2HWLB 3QDZB 4KTSA 1TOMH 1KIGH 2BMGB 3ZZ6A 4GCHG 1PQ7A 2TBSA 1GL0E 1GBIA 4K1EA 1NZQH 1P12E 1UTJA 5GJ4B 1GBEA 1S5SA 2A4OA 4MQAA 4WF8A 2Y81A 4Y71A 2BLWA 1BTWA 4D76A 2ZPSA 1LVOA 1UTKA 1H8IH 3TJVA 4INLA 1HV7A 3K6YA 3PYHA 1UMAH 1EB1H 4WMEA 2SGDE 3KL6A 4DY7B 4KELA 1L0ZA 2ZU1A 2FS9A 2GVFA 3GCOA 3PM3A 2PSXA 1ZGVA 1ABJH 3RXFA 1O5CB 4FUGA 1PPHE 2QV1A 3VEQB 1EZQA 4D7FA 4M7GA 1ETSH 3M7TA 1HNEE 4NIXA 1ID5H 4FVDA 2ZGHA 3A7WA 1TQ7B 1SHYA 2C8XB 1GGDB 1K1OA 2A5AA 3RXSA 1T31A 4PROA 5EW2H 1V2UT 1OP8A 1GJ4H 4NA7A 2J95A 2ZC9H 1NO9H 2Z3DA 1C5VA 4JYUH 4CH8B 4NFEA 2VINA 2XXLA 5TCAA 1HAGE 5CE1A 3ODFA 1K1JA 1O2HA 3BTDE 2J92A 2XBWA 2VIVA 3SQHE 2ZDVH 2GKVE 5DK1A 4NZLA 3WY8A 4D7GA 2BD5A 2F9VA 1FJSA 4Q80A 2ODYB 3MH5A 1V2PT 1BRUP 1J9CH 3RXQA 2BZAA 3LGIA 2VIDA 3B9FH 1LKAA 3P6ZB 3Q76A 1MKXH 1ZLRA 1BHXF 1O2ZA 1FPCH 4GHTA 1AFQB 3GDVA 1G37A 1SOZA 3GY5A 3BTTE 4K3JA 2QAAA 1VCQA 2BX4A 4NFFA 1GHWH 1EX3A 1CBWB 4YLUA 2P3UB 1DLKB 2G51A 1KXCA 2GP9B 1O3OA 1BTHH 3SJIA 1UVOA 1UTNA 3ZVEA 3BIVH 3VPKA 2M5TA 3U98H 3H5CB 1ZSLA 3RXGA 1AU8A 3HATH 3BN9A