1QL7A

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Ph-Dependent Binding Modes Observed in Trypsin Crystals: Lessons for the Structure-Based Drug Design
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql7A02
2SGDE 4ABGA 1AFEH 2P94A 3A8DA 1GBCA 2FOMB 2QXIA 1DANH 1NRPH 2G00A 3LC3A 3MO3A 2WPHS 1XVOA 2V6NA 1BMAA 1HCGA 4ZXYH 4UE7H 1EZXC 1L4ZA 1PPBH 1O3NA 2BB4A 2R0LA 3ZYEA 2YOLA 3LONA 1K1IA 5FPSA 1C2GA 1WUNH 1O2NA 3QK1A 2Y5GA 1P10A 3MH5A 2V3HH 3M5NA 1O35A 3MTYA 2WPLS 3LU9B 2V35A 1EZQA 3RXMA 1MAXA 3VXEH 1FAXA 3TJNA 2BZ6H 5F8TA 1W12U 5EG4A 1KLIH 4ZAEA 1SFQB 3VB3A 1OP8A 3KL6A 2XCFA 1C5SA 4E7RG 3BV9B 1C1OA 1P05A 3A89A 2P16A 1AHTH 1GMCG 1HB0B 1DS2E 1OYQA 3RXSA 2YNBA 2ZFRH 1C5NH 1O5FH 3FAOA 4O3UA 3U1JB 1G36A 2ZGHA 2FDAA 1XUKA 3ZVAA 1PPEE 1TMBH 2BXUH 3PYHA 3W95A 2PW8H 3ZZ4A 1KSNA 1Y3VA 4FXGH 3OY6U 4OS1A 2G52A 1BITA 3AW1A 1B7XB 1BJVA 1VZQH 3FP6E 1O37A 5FBIA 4R0IA 1LPZB 2XC5A 3SJ8A 2GT7A 2BOHB 2R3UA 2OXSA 1A0HB 3MMGA 2Z9LA 1D6RA 1F7ZA 1ARBA 4ZH8A 2HNTF 5ETXA 1ESBA 4NZLA 4HFPB 1UO6A 1GBBA 2FX6A 3LT3A 3ODDA 1V2VT 4CH2B 2OQ5A 1TGNA 2ZDVH 1O2MA 1SR5C 3EA8A 2QN5T 3Q3KA 3STJA 3TNSA 3S9BA 1O2GH 1ZJKA 1V2RT 1SFIA 1OWIA 2AERH 2PTNA 1V2LT 1SGIB 1G32B 2UUJB 1ETRH 1MQ5A 2ANKH 1MCVA 1GBEA 3UTUH 3ATIA 1BBRK 1O3BA 1BBRH 3F9EA 3M36A 4UFEH 1CHOF 1SGRE 2CN0H 1WCZA 1YPJH 2R2MB 4MQAA 5CHAB 2HOBA 1OKXA 1P06A 1OPHB 1SVPA 4B74A 1TRMA 3GISB 5C2ZA 3PV4A 3SJKA 1GBIA 1CBWC 3ZVBA 1UK3A 1BIOA 1HV7A 2IN2A 5EODA 4I8JA 4R8TB 1ZPBA 5C67A 1P03A 1GBDA 3BIVH 1FLEE 1G3DA 4YZUA 1SQTA 2Y7XA 5FCRA 1BZXE 1UVSH 1ZZZA 3KEEA 3QTOH 3BG4C 4NA7A 3S7HB 1VITF 5A8XA 1E0FD 5AVDA 1QL8A 1AVGH 2ZU3A 4WMDA 3NWUA 1ZTLA 2BY6X 5EQSA 1GWAA 2BD5A 5K0HA 1C5QA 4CRFA 1W7XH 1AB9B 4OS5A 1MKXK 1F92A 1QQUA 3RXRA 4FUCA 1MMJN 1NRQH 1OP2A 3M37A 4WXIA 1Y3WA 1VCPA 4THNH 2FLRH 3GY4A 3ZZ6A 1UTMA 1GJ5H 1Z1JA 1GBTA 1L1GA 3I77A 1Y3XA 4IC5A 3ZZAA 2TGPZ 4RKJB 1LKBA 3U8OH 1EAUA 2O8LA 4AFSA 1NO9H 3PLKA 2XYAA 2K1QA 5CMXH 5EU8A 4ZHLU 5AFYH 3MNXA 3S0NA 1QHRB 1HAVA 2FS9A 1BBRE 2UUFB 3DFLA 1FXYA 1O36A 1ORFA 4H6TA 2XBVA 2ASUB 1LPKB 1C5XB 3GCHB 2ANYA 1RTFB 1NFWA 3A87A 1JIRA 2FOHA 2BY8X 1L1NA 1EKBB 1WTGH 3GY6A 2UUYA 1P9UA 5F8ZA 1AN1E 1W7GH 4Y8ZA 1QGFA 1GVLA 1AWFH 2FO9A 3MNSA 2FI5E 4X1PU 1G3EA 3P8GA 3GY8A 3ZZDA 1GG6C 5JB8S 2C8ZB 7KMEH 3BTEE 3HGPA 3AAVA 3D23A 4X1QU 2AGGX 6LPRA 4FVBA 4LK4A 1C2KA 2HPPH 1J16A 1NT1A 2PKSB 2C93B 3CP7A 1EAXA 2ZPRA 3KQBA 1LHGH 1DOJA 1K1LA 1PPHE 1PQ5A 3QZRA 1GBLA 1Z7KA 4XBCA 2I6QA 3F9HA 1K1NA 3LGTA 1S82A 1GMCF 1TPAE 3SV7A 1O3CA 2ZFPH 3PTNA 2JH0D 1ESTA 4ABBA 2J94A 2CF9H 3RLWH 1ZMJA 1TBZH 1JWTA 1BTXA 3EE0B 1C5MD 2WPMS 2ZHDA 3TPIZ 4I8HA 1C1PA 2WPIS 1ZPZA 5T6GA 1O3LA 2ZWLH 1GGDB 3ESTA 1BMLA 4K8BA 1U6QA 4MPUA 1C9TA 4JZ1A 4WJG2 5EXNA 3H5CB 5C1XA 3WY8A 3PO1C 3TVJB 2FI3E 2Y5HA 3AW0A 1GHVH 3RXHA 1YF4A 4D7GA 1C5TA 2BD7A 1BRBE 4Y76A 2VGCB 1A1RA 2ZG0H 3LKWA 1WOFA 2C8XB 1HAZB 2CHAC 1MZDA 1GHWH 4Y7BA 2A5AA 1HPGA 1M9UA 3UR9A 1EZSC 1PFXC 1GHXH 1CO7E 2C8YB 3KQEA 2G8TA 2ZHEH 3ATLA 2PSXA 1DE7H 1LPGB 3RXQA 1IQHA 5EPYA 1ZGVA 1AUTC 1HJ8A 1AVXA 4XOJA 3EAJA 4A5TS 3BEUA 4NCYA 3MWIU 2FYQA 5LH8A 2QXHA 5A8YA 1CE5A 3MU5A 1BRAA 1V2OT 1N1LA 2AIPA 4Y6DA 3SJOA 4CRCA 1KXCA 1CVWH 5GXPA 2SGQE 3UPEA 2A0QB 1UK4A 3MU1A 1P11E 2FLBH 1S6FA 4TY7A 3RXBA 3TITA 3TJUA 1ZHMA 3RXGA 1VCWA 1H9HE 2GDDA 5LPRA 4JK6A 1TGTA 2PKAB 2Z9KA 1AIXH 2KAIA 1NM6A 4Y0YE 4AN7A 4WF8A 5DP3A 2EEKA 2SNWA 4BAQB 5I46H 1UTQA 3TH2H 1AY6H 2WUCA 3UNQA 2A45B 3M61U 3Q76A 3UWJH 1TWXB 3BTME 1QNJA 4Y11E 3UUZA 1HIAA 3M5MA 4J1YA 3M35A 3H7TA 1DPOA 1NN6A 2BZAA 4K1EA 4K5ZA 1FJSA 1T8MA 3TJOA 1TGBA 2QY0B 1BHXF 2I6SA 1BRCE 4AORA 4CH8B 2BDBA 4MPXA 4YM9A 1F0TA 3TU7H 1D3PB 3K6YA 2JKHA 4JYTA 1SQAA 4WWYA 2ZEBA 3A81A 3BEIB 5AHGH 2SFAA 2R0KA 1OP0A 1T32A 1WSSH 3RXKA 3SNBA 1O32A 1ZYOA 2GCHG 3SUFA 1Y5AT 2BQ6B 4OGYA 3SN8A 3ATWA 2XBYA 3BTDE 1P3CA 1VR1H 1BA8B 1ELAA 2Y81A 1OWEA 4E06H 1P01A 4DURA 2SGPE 3RXOA 1AZ8A 2G55A 3L6PA 4ISOA 1IHSH 3RXLA 5HM9A 2O8UA 1VITH 1QB9A 1D3TB 3EDXB 1YLDA 3W94A 4ISIH 3E0NB 4XBDA 2XCNA 1HIAB 2BD8A 1KIGH 5JB9S 1CA0B 1O2VA 1DITH 4FUIA 3SUEA 4YT7H 1ELVA 3LIWA 2P93A 3MU8A 4X1SU 2GP9B 2PWXA 5H4IB 4HGCA 1EB1H 4ABJA 1GI1A 4U30A 1QR3E 1T4UH 5TCAA 3T2NA 4KP0A 2BVRH 1GCDA 2FEQH 2PGQB 3GOVB 3BTKE 1FDPA 1ZHPA 3A7VA 4X2WA 1AFQB 1BTHH 2XW9A 5T6DA 1A5IA 3EYDA 2CGAA 4AFQA 2Q6DA 4X2VA 1GL1A 1O2TA 1QL7A 3SHAH 1FY8E 1MTNB 2GV6A 1C5PA 3GDSA 1HAHH 2QIQA 1O31A 1V2WT 2BYAX 5E0HA 1QL9A 4Y71A 3VB4A 3A85A 2EI7A 1TNGA 4YOIA 1QRWA 1SGFG 2FYRA 3E0PB 3IWMA 4AGJA 2D1JA 1XUGA 2AMQA 1EP6A 5EQQA 2BM2A 1P2OA 1YPHC 1L0ZA 1TMTH 1P2JA 1GBMA 2CF8H 1K22H 1O2HA 2JETB 1UCYK 1UCYH 1EUFA 2HNTC 1FPCH 1RRKA 2OP9A 1K1MA 1C1TA 4ABIA 1O3IA 4RSPA 1NRRH 3ZZCA 1S84A 2QXJA 4JK5A 1N6YA 1CHGA 1A3EH 1F2SE 1YCPM 2IPHA 4TWWA 3MH6A 2C90B 4FUFA 1O3OA 1SLVB 3UIRA 1ZSKA 1GBAA 1C5YB 3DA9B 2NU1E 4TY6A 2ZGCA 4WMEA 1HJ9A 3SV2H 2O8TA 1TPSA 2PLXA 2D2DA 3QGJA 5AF9H 1P2KA 4KTUA 3URCA 1DX5M 3ATKA 2ZCHP 4YOGA 4BTUB 2C4FH 3BG4B 2ZHWH 3LC5A 1E38B 3E6PH 3QX5H 2VVVA 1N8OB 5TCCA 2ZHFH 2P3FH 3VXFH 5C3NA 2OLGA 4NZQA 1PQAA 2Y7ZA 4E7NA 4UFGH 3H7OA 2FMJA 3KF2A 3FZDA 1HJAC 1MBMA 4X8VH 6GCHG 2P8OB 1GI2A 1Q31A 1TX7A 3LOXA 1TAWA 2G5NA 1TQ7B 1EOLA 4O97A 1NRSH 3ENSB 1FN6A 1TGCA 2HGTH 3A82A 1D6WA 3MU0A 3L3TA 1O3DA 5A0AE 1DWCH 2AGIX 1W3CA 3V0XA 3VB6A 4MLFB 2BDHA 1GCTC 3OU0A 4ZHMU 2VWOA 2VIWA 2QCYA 4CR5A 1QBVH 3EGKH 1G2MA 2BQWB 1W0YH 3MH4A 1GHBG 5JYIA 1UCYE 1O3PB 2UWPA 2ZTZA 2NU0E 3HK3B 4X6MA 1SL3A 1TA2A 1CGJE 3FANA 1G3CA 1ZJDA 2Z7FE 3U69H 1IQEA 4DG4A 2VIVA 3A7WA 4YLUA 1SGYE 2BY9X 4MPVA 2W3KA 4AX9H 2GZ8A 2J92A 3B9FH 1O3MA 3PMBB 3A8BA 3VEQB 1GI7B 1ACBE 2Y80A 4O9VA 2ZHQH 4X6PA 4RN6A 1JOUB 1O3AA 4GUXA 3FFGA 3CS0A 3ZZ3A 1QQ4A 4GCHG 2G4TA 2OQUA 1NESE 2ZI2H 3TH3H 2JH6D 2ZDNA 1C5UA 2GCHF 4DIHH 4FU8A 1UVTH 1EPTA 1YC0A 3V13A 3F6UH 1TNIA 4X8SH 1RIWB 1G2LA 3RXVA 1P57B 4SGAE 5C20A 5A8ZA 4MTBA 1HDTH 3RMOH 2ZDKA 4SGBE 1RJXB 5LPFA 2GMTB 2VIPA 3SV9A 1NZQH 3RXCA 1EAWA 1OSSA 3VB7A 1GMHG 5C5NA 3O8CA 2H1UA 2NU3E 2H5DA 4Q7ZA 4ZHAA 2FTMA 3GCOA 1WV7H 3SU5A 1Y5UT 1TMUH 4ISLA 1XUJA 4HZHA 1TLDA 3KN2A 1VJAU 4VGCC 1S0RA 1THSH 3KGPA 1Y5BT 4ABAA 1O2XA 1T8OA 1D9IA 3B23B 1EPTB 2J2UA 2PUXB 4A92A 5L6NH 3SU3A 3SJ9A 3VGCC 1ZHRA 3D62A 3UOUA 1VJ9U 1O2QA 3PO1B 1OYTH 3BTWE 4FUBA 4LZ4B 3UY9A 2BLOA 2ZFFH 1LHCH 1O2YA 3K2UA 4NIWA 1LVOA 1J17T 3QZQA 2VB0A 4KKDA 1DSUA 1T7CA 1B0EA 4MPWA 4B75A 5EW1H 4I32A 3KQCA 3LH3A 1UJ1A 3SORA 1FIWA 4NWLA 1RXPA 1EJAA 3ELAH 1WQVH 4M7GA 2WV5A 1V2ST 1Z8IB 3SBKA 1HLTH 7GCHF 2HLCA 3M7UA 3RM2H 2CHAB 2J34A 1IAUA 2TGAA 3A86A 3VFEA 1MTUA 1O2RA 1CSOE 5FPTA 1EB2A 1O30A 3C27B 3ZVCA 1SBWA 1V2NT 4BTIB 2QAAA 2OTVA 4B2AA 2FP7B 1FUJA 5JBTA 2A4OA 1GHYH 2GZ7A 2GCTB 1P2MA 2DUCA 3A7YA 3MFJA 1SOZA 1O2OA 1GBJA 1O2SA 1FV9A 1VGCC 5EW2H 1HNEE 1S83A 3EA9A 4KTSA 5GPIB 2ZA5A 5HM2A 1GI9B 2FOAA 1CGHA 3SGAE 2CMYA 3S69A 2HPQH 3VB5A 5E2PA 3RU4T 3BTHE 6GCHF 1FY4A 1MKXH 4XDEA 1C5VA 1O2LA 1P02A 5DP4A 3I29A 4AG1A 4X2XA 2A4QA 1OWJA 2GV7A 3IG6B 2FM2A 1SHHB 1ANCA 4NIYA 3ZVGA 1FONA 4FVDA 3SOSA 3AAUA 1O38A 3M3TA 2TGTA 3SZNA 6CHAC 1EXFA 3T25A 2M5TA 1FN8A 2DE8A 4UFDH 3NPSA 1LO6A 1DDJA 1DSTA 1SPJA 1GJ4H 2Z9GA 2SGAA 1KXDA 2PTCE 3RC4A 1W8BH 1DWDH 1YLCA 3URDA 4JYUH 4A1XA 5G4BA 1HAOH 2ZU5A 5DO4H 1BMNH 3PMJA 1C1UH 1UK2A 1FIZA 1MKWK 1SGFA 2A7HA 3UQVA 3R0FA 1THPB 1TNJA 3OX7U 4WH8A 1X7AC 4AYVB 4IGDA 1O3JA 1GBHA 3LGYA 3OSYA 4JYVH 2F3CE 1BTPA 2Z9IA 3MO6A 4ISNA 2ESTE 3U9AH 1DXWA 2OD3B 3DD2H 1RD3B 1ELBA 3HATH 2A1DB 4KELA 2BLVA 1HAIH 3TJVA 2LNCA 3ITIA 1MTVA 2V0BA 1IQNA 2ULLA 1QURH 3P6ZB 1XXFA 2LPRA 2FPZA 1ARCA 1S85A 1TX6A 4XSKU 4TYDA 4ESTE 1QJ1B 1F0SA 4MNVA 2BX4A 2VWLA 3RXFA 1S81A 4Z0KA 1UVPA 2Y6TA 3SNDA 1SGCA 4NIXA 3TIUA 1H4WA 1XUIA 4OGXA 1GMHF 1K1JA 3RU4E 4JZDH 3RLYH 1BT7A 3KQDA 4NG9H 1BOQA 1NPMA 4IMQA 2F9BH 3QDZB 4JMYA 1HAYB 3M7TA 3RMNH 1NTPA 3SU1A 1V6DA 3Q3YA 3SV8A 2XC0A 3LH1A 1QBOA 5B6OA 4CBOA 1UTNA 3JZ2B 5SGAE 5GIBA 3BTFE 5LGOA 3QO6A 2YNAA 5C5OA 1TRNA 4Q7YA 1YBWA 1SGPE 1V2MT 1UVUH 1XMNB 2OUAA 3MU4A 1H8IH 2PR3A 1MUEB 3QLPH 5FCKA 1KXEA 1K9OE 1LQEA 1GJ7B 3GDVA 1J9CH 4CRBA 2PKAA 1HGTH 3RXTA 1O33A 1G9IE 2FIRH 1SQOA 5E0GA 5K7RA 2BY5X 5J4QA 3SGQE 1MZAA 1A5GH 1WAYB 2GD4B 4CRGA 1V2KT 2BD9A 4IS5A 4NGAH 4D8NA 1W0ZU 5DP6A 4INLA 1CT0E 4AFUA 4NA9H 1QBNA 2C8WB 1YM0A 1P2NA 1DICA 2VNTA 1D4PB 5TJXA 3ZZBA 2ZNKH 5HMAA 1TRYA 1C5RA 1H9IE 5FHTA 1SC8U 1EX3A 1AWHB 4RKOB 2ZFSA 2ZGXH 1O3KA 1LHDH 5E8EH 1S0QA 1TA6A 3RMLH 1V2TT 1ABJH 2W26A 1C1QA 2PV9B 2FOEA 5CHAC 1AD8H 2BY7X 1O5EH 2ANMH 3QTVH 4TPIZ 1CU1A 2ZTXA 3MH7A 4IW4E 1RTLA 1GJCB 1P12E 4YT6H 2J9NA 3DHKH 1MBQA 1QB6A 1K28D 1T31A 2BOKA 5C1UA 1AKSB 1LQDB 5AFZH 2SGFE 4K8YA 3F68H 3M5LA 1ELCA 3KNXA 2Z3DA 3TH4H 2SNVA 4YOJA 1XVMA 4J2YB 2QA9E 2TBSA 4X1RU 4CHAB 1Z6JH 1GI4A 2F91A 4INKA 4UDWH 3V12A 4DJZB 1SLUB 4AB9A 4AB8A 3UNRA 3SQHE 2AIQA 1V3XA 2VU8E 3M3SA 3O8DA 1IQFA 1AB9C 3A8AA 2G81E 2AMDA 1C5OH 4I8KA 2THFB 2VWNA 1KXAA 5ESTE 1HRTH 2DE9A 4IMZA 2FI4E 2ZC9H 2XC4A 3BN9A 1GI6A 1IQMA 3HKIB 1J8AA 2HRVA 4TPYA 3A7TA 1VCQA 2PHBA 1EAIA 2B9LA 1Y3YA 1NC6A 3GY5A 1T4VH 1HUTH 1C2HA 3M5OA 1WU1A 1HBTH 5JDUB 1HAGE 2BLWA 1P09A 3ZZ5A 1O3HA 2OINA 2ZPSA 2F83A 3PLBA 2AH4X 3E8LA 3PTBA 3ZV9A 1WQSA 1EJNA 1FNIA 3P8FA 2ZIQH 2G5VA 3KHVA 4GSOA 1F0RA 3UREA 1O2JA 5JPMH 1GPZA 3GCHC 1G30B 3PMAB 2TIOA 2Z3EA 1SLXB 2A5IA 3SU0A 4FUHA 1YPLH 1P3EA 4CRDA 5BPEA 2GKVE 1C5WB 5A0BA 1BMMH 2Z3CA 4E05H 1W11U 1GJ8B 4BAMB 1TQ0B 3T5FH 3UR6A 1Z8RA 3ZVDA 3OY5U 1MU6B 1Y8TA 3GICB 5DP5A 2W7SA 1EQ9A 4HI3A 1P04A 2IOTA 2OC0A 3SUGA 3KIDU 4LXBH 2D26C 1TABE 4ZXXH 4A7IB 1GBKA 2F9NA 3NUMA 4I8LA 1SI5H 5DJ7A 4DIIH 1W2KH 3T26A 4Y8XA 2NU2E 2W5EA 1YCPK 2UWOA 3RC5A 1TPPA 1AUJA 1SOTA 1YCPH 5F03A 3PWCA 3MO9A 1C5ZB 2O8WA 2BMGB 4YTAA 2J38A 1E36B 1KXFA 2GZ9A 4D9RA 2FOGA 2R2WU 1PPFE 4AZ2B 3TGIE 3ZZ7A 2PSYA 1DWBH 1C1NA 4FUGA 1ELDE 3BTGE 3UWIA 3P17H 2FS8A 2ZCKP 4TWYA 1JRSA 1IQKA 2F9VA 1GGDC 1K1OA 1O3GA 1YYY1 2BHGA 1TBQH 3QUMP 4I8GA 1PYTD 1A3BH 4IBLH 9LPRA 3TK9A 1AMHA 1BTUA 1CBWB 3BF6H 1NFUA 4DGJA 5FAHA 4LOYH 1QCPA 2A4GA 3RXAA 5HXFA 4I31A 3BTQE 3A83A 1MH0A 4MVNA 2VGCC 4F49A 5EGMA 2EA3A 3TNTA 1FY5A 3C1KA 2ZGJA 1N6XA 2GVFA 1D3DB 5DGJA 1A7SA 5DKMA 1PQ7A 1OXGA 2J4IA 1P0SH 2FESH 1TYNA 4NA8A 3GCTG 4B73A 4B76A 1SGNE 1EATA 3QWCH 5L2ZH 1OOKB 3NK8A 4BANB 2A2QH 2BDCA 1B5GH 2O9QA 1A5HA 2OC1A 1ZR0A 3CENA 1GI0A 4XE4A 4XBBA 2CXVA 1V2QT 1LMWB 4A6LA 1UTOA 2AYWA 4B2CA 3RXEA 2BVXH 5EXLA 1MD7A 4GLYA 4OS6A 4WVPE 2ZECA 4Q7XA 3SNAA 1NROH 1KDQA 2A31A 3DT0H 3AASA 5EOKA 5E2OA 1JBUH 3GY2A 2H9TH 1NY22 8ESTE 3I78A 4ZMAH 1C9PA 3NKKA 1FPHH 3SU4A 4ABDA 1LCYA 1C4V2 1C1RA 1C1WH 3T62A 5DP8A 5F6MA 1TOMH 2BDYA 1F5RA 1UVOA 1C2DA 4D76A 8LPRA 4U01A 3K9XB 2ILNA 3SNEA 3SGBE 1W14U 3T28A 1HAPH 2UUKB 2ODYB 2VJ1A 2ALPA 1CQQA 2RA0A 2VVUA 2ZFTA 3A88A 2NU4E 3ATMA 1BB0B 3A84A 4A1VA 3VPKA 2ZU2A 2RCEA 2XWAA 2A4RA 1LVYA 1RTKA 2FOFA 3RDZA 1KTSB 4ASHA 4DVAU 1Y3UA 4H6SB 4NSYA 3AVZA 2H5CA 4IC6A 5FPYA 4NWKA 1GG6B 2ZDAH 1O2KA 3OYPA 1FY1A 2RA3A 3LGUA 2H9EH 1GHZA 1FAKH 5JBBS 4Y10E 1JIMA 1KDQB 1BJUA 3F1SB 2VIQA 4GPGA 2ODPA 1GJBB 1TPOA 2XWBI 4BXWA 1BUIA 3U98H 3SHCH 4BOHA 2B8OH 2STBE 1DLEA 2BX3A 5LPEA 3T27A 3HK6B 1QTFA 1D3QB 1ZOMA 2A32A 1DWEH 3UNSA 5IDKA 1L4DA 1GJAB 2ZZUH 1J14A 1FY3A 1ZTJA 2FTLE 1UTPA 5EQRA 1ZRKA 4NIVA 1P2IA 1CA0C 1A61H 3E90B 1PPCE 1XXDA 3LJJA 2WYJA 4OS2A 2GDEH 5EPNA 1MU8B 2AS9A 1AFQC 2BLQA 1JMOH 1DY9A 1FI8A 1QA0A 1TNHA 3GDUA 3RU4D 3MHWU 2QXGA 1TFXA 2ODQA 2ZDMA 1WBGB 2A7CA 1GHAG 5F8XA 1F0UA 2JH5D 3P8NA 2BD3A 1MTNC 1WTHD 3V3MA 3RP2A 1ZSLA 1LVBA 3NCLA 2WINI 1O2WA 4K3JA 4X6NA 3E16B 5A0CA 3NZIA 5EXMA 1C2IA 2WPKS 3TK5A 1BTWA 4IN2A 1W13U 2ALVA 3CS7A 4CREA 9ESTA 3LGWA 4Y8YA 4HTCH 8GCHG 1NU9A 1T8NA 4Y7AA 4I33A 5DK1A 2JETC 2P3TB 1S5SA 2HWLB 2GT8A 3SUDA 2OCVB 3K65B 1BTYA 1Y59T 1G3BA 1O2IA 1PYTC 4U32A 3HGNA 5L2YH 4FU7A 2OBQA 1O2UA 2RDLA 3RXJA 1H9LB 2GX4A 4FUJA 3SJIA 4MNWA 1O3EA 1LTOA 4NSVA 3P8OA 1GI8B 3BTTE 3NXPA 1F5KU 3LGIA 1OX1A 2G4UA 3RXDA 3STIA 2H6MA 3LDXH 4WH6A 4X8TH 5T6FA 1MD8A 5L30H 4LZ1H 1L2EA 3GCTF 2C3SA 1EZUC 4O03A 3B8JA 1AZZA 3RMMH 4ZKRU 1MQ6A 1E35B 2P59A 1K21H 4YESB 3A7ZA 2WYGA 4WMFA 2R9PA 1YKTA 1PQ8A 1GI3A 4UEHH 3V7TA 1C4U2 1OWDA 1N8OC 2FXRA 2BQ7B 1SGDE 5E0JA 4AGKA 3GCNA 1BTZA 3GYLB 2CJIA 1F5LA 3ZV8A 2VIOA 2GTBA 2P8OC 2PFEA 1GHBF 5ESBA 3SQEE 3U8TH 2Z6BD 1CA8B 1YPKH 1O34A 1Z6EA 1YPGH 2FOCA 1CT4E 3S9AA 2AEIH 5GJ4B 1GJ9B 2VINA 1DUEA 1Z1IA 4X8UH 3M3VA 3LPRA 1C5LH 4UFFH 3G01A 1MKWH 1XM1A 1TOCB 4Y79A 1AI8H 5ABWA 1GMDG 2QGRA 4GAWA 4DCDA 1QRXA 4FUEA 3GY7A 1HAXB 5FX5A 1C2EA 5JBCS 1LVMA 1GDUA 1KLTA 4GCHF 1DM4B 4KGAA 2FX4A 2R3YA 4FU9A 1V2PT 2VH0A 1KXBA 4K69A 4PROA 1GVKB 3P92A 4ZKOU 2W7UA 2XNIA 1P2QA 1P8VC 2B5TB 2XBWA 2UWLA 4H4FA 3UFAA 4KTCA 5JBAS 3SO3A 5T3HA 3O8BA 2ZTYA 1LHFH 1QRZA 1HXEH 1BRUP 1ZLRA 1A4WH 3MNBA 1SMFE 2P3UB 1O3FA 5C1YA 4F4OC 1PPGE 1LKAA 3F9FA 7LPRA 2BDGA 1Q2WA 1DT2A 3FVFB 3S7KB 1TNKA 1RGQA 4K2YA 1QIXB 2ANWA 3SNCA 1RIWC 3RM0H 3ZYDA 2O8MA 1QJ6B 4B71A 1GBFA 1NRNH 1IHTH 5GCHG 4ZKSU 1J15A 4NFFA 2GMTC 3K6ZA 4GVUA 1O5BB 2FWWA 8KME2 1HAVB 1V2JT 2RG3A 1GDQA 4B2BA 1KTTB 2Z9JA 1BQYA 2P95A 1AVWA 1ANDA 3JZ1B 2B0FA 3MI4A 3E3TA 1DY8A 1O0DH 2NWNA 1W10U 1AO5A 2GGVB 1IQIA 2OBOA 2W3IA 4CBNA 1T8LA 2F9PA 2J95A 4UONA 3N7OA 3KCGH 1CT2E 1GJDB 2ZQ2A 1GHAF 1V2UT 1O2PA 3MNCA 4BAOB 1ELGA 1EPTC 2A2XH 1SLWB 2ZPQA 1GVZA 1SG8B 3TGKE 3FP8E 1TONA 3BG8A 4K1SA 1AKSA 4JZIA 2F9OA 3TLOA 1EOJA 3RUOA 1AE5A 4AG2A 1UTKA 4YLQH 3GY3A 2STAE 1K1PA 4BTTB 3PWBA 3SV6A 1C2FA 5FBEA 1TX8A 4U2WA 8GCHF 2XTTB 1A46H 4DW2U 1LDTT 2BTCE 1ETTH 4DT7B 1UMAH 4ISHH 2BDIA 3QGNB 3RXIA 1HYLA 5DP7A 1YP9A 2QC2A 1IQLA 3UOPA 3A8CA 1RS0A 3ZZ9A 4ABFA 1HXFH 1Z8GA 1C1SA 1DXPA 3ZVFA 2VIDA 1NFYA 1XUFA 2Y82A 4CR9A 1HJAB 2OC7A 1SGQE 1ANBA 2EI6A 4I7YH 2BXTH 1XKAC 5A09A 4AFZA 2H9HA 1YPEH 4CRAA 2FODA 1GJ6A 2TPIZ 3TGJE 1GCTB 3RC6A 1ANEA 1ZGIA 2WUBA 1E37B 1ZPCA 2CV3A 3BSQA 2GCTC 3PB1E 3BIUH 5CE1A 3IITA 6ESTA 3D49H 3T29A 1LHEH 2Q6FA 5FX6A 3S9CA 5DPAA 3U8RH 3RXPA 1ELEE 3OTJE 2V3OH 1CGIE 1A0JA 2FZZA 1KY9A 4Q2KA 4ZROA 4NFEA 3A7XA 4WXVA 1WYKA 4BAHB 3SU6A 3SW2B 1TALA 1H8DH 2G51A 1DFPA 2ZFQH 2AGEX 3O8RA 3Q77A 3SI3H 1A0LA 5IYTA 2BVSH 1K2I1 2ZP0H 3U1IB 4ABEA 2ZQ1A 1AQ7A 1ZMNA 2QF3A 5GDSH 4INHA 4X1NU 4D7FA 2Y5FA 5FXLA 1BCUH 2ZKSA 4DY7B 3PMHB 2Q6GA 3LGVA 1GMDF 1OS8A 4GHQA 5I25A 3MOCA 2IJOB 1XKBC 3QN7A 2ZGBH 3EA7A 4H42U 1O5AB 1TNLA 2Q1JA 3UQOA 4D9QA 1RFNA 1IQGA 4FUDA 1BDAA 1KYNA 1NU7B 2KAIB 2BD4A 2TGDA 1Z71A 1TIOA 4Z6AH 4ZUHA 1AE8H 4A1TA 2WV4A 1C4Y2 2ZU4A 5HGGA 3PROA 1ETSH 4MDSA 2ZF0H 4VGCB 3E1XB 1O39A 1ZMLA 1A2CH 2XXLA 2A5KA 1YPHE 3MYWA 2WPJS 4QT8C 2A7JA 3VGCB 5GWZA 1FZZA 3SI4H 2QV1A 1O5CB 3HKJB 4X6OA 5GCHF 2PKSC 4BNRA 1QA7A 2HNTE 4MNXA 1DLKB 4UD9H 2EC9H 1ELTA 1C2LA 4XFQA 1ABIH 1YPMH 3Q00A 1C1MA 1S6HA 1Q3XA 2HVXA 1AU8A 3ZVEA 3A80A 1C1VH 2VH6A 2BDAA 1B0FA 1SGTA 3BEFB 3FZZA 1MTSA 1Z8JB 1C2JA 4WY3A 2TRMA 2XRCA 4ABHA 1SSXA 5BRRE 3P95A 2ZCLP 3PLPA 1C2MA 1PJPA 1O5DH 4B1TA 1YGCH 2D8WA 1TBRH 2VVCA 4JZEH 4JZFH 7GCHG 4YO9A 7ESTE 1ZTKA 1P9SA 1QY6A 2XBXA 4K1TA 1ESAA 4O3TA 1E34B 3DFJA 3EQ0H 1UTLM 1CHOG 5A2MH 1SGEE 3P70B 4MNYA 1VGCB 1L1JA 2Z94A 4MG3A 1MTWA 1XX9A 3DUXH 3D65E 1FMGA 1GI5A 1TB6H 1PPZA 2ZO3H 2BD2A 3Q3XA 1TE0A 4JCNA 5J4SA 4AOQA 4AYYB 4DOQA 1G37A 4K60A 3R3GB 1OWHA 1QFKH 2PUQH 2AMPA 1DUAA 1UTJA 1KLJH 1ZRBA 1EJMA 1NFXA 1UHBA 2H2ZA 5DP9A 1EASA 1VITG 1ZSJA 1MAYA 2HALA 1XUHA 3F9GA 6CHAB 1DVAH 3LJOA 1TGSZ 2OC8A 2VWMA 2SGEE 2QF0A 3L33A 1HFDA 1QJ7B 3PM3A 2ZU1A 1SB1H 4GHTA 1THRH 4IN1A 3FP7E 1H1BA 4BXSA 1EP5A 3M7QA 3ODFA 2FOBA 1OWKA 3ZZ8A 1ELFA 1ID5H 3RXUA 4OS4A 1IQJA 5HYOA 4X2YA 1QB1A 1FQ3A 4OS7A 1BHXB 1JRTA 1NS3A 4BAKB 3HPTB 1JXPA 4X0WU 2QYIA 4ZKNU 1MCTA 2AFQB 1GDNA 1GL0E 1O5GH 5DG6A 4CHAC 2ZDLA 1O2ZA 1UHBB 3TK6A 4Y0ZE 2PGBB 2F9UA 2EI8A 1AGJA 1IOEA 5PTPA 3GYMA 3E91A 2B7DH 1SHYA 4Q80A 3SU2A 1INCA
chains in the Genus database with same CATH superfamily
2SGDE 4ABGA 1AFEH 2P94A 3A8DA 1GBCA 2FOMB 2QXIA 1DANH 1NRPH 2G00A 3LC3A 3MO3A 2WPHS 1XVOA 2V6NA 1BMAA 1HCGA 4ZXYH 4UE7H 1EZXC 1L4ZA 1PPBH 1KMHB 1O3NA 2BB4A 2R0LA 3ZYEA 2YOLA 3LONA 1K1IA 5FPSA 1C2GA 1WUNH 1O2NA 3QK1A 2Y5GA 1P10A 3MH5A 2V3HH 3M5NA 1O35A 3MTYA 2WPLS 3LU9B 2V35A 1EZQA 3RXMA 1MAXA 3VXEH 1FAXA 3TJNA 2BZ6H 5F8TA 1W12U 5EG4A 1KLIH 4ZAEA 1SFQB 3VB3A 1OP8A 3KL6A 2XCFA 1C5SA 4E7RG 3BV9B 1C1OA 2KX4A 1P05A 3A89A 2P16A 1AHTH 1GMCG 1HB0B 1DS2E 1OYQA 3RXSA 2YNBA 2ZFRH 1C5NH 1O5FH 3FAOA 4O3UA 3U1JB 1G36A 2ZGHA 2FDAA 1XUKA 3ZVAA 1PPEE 1TMBH 2BXUH 3PYHA 3W95A 2PW8H 3KYGA 3ZZ4A 1KSNA 1Y3VA 4FXGH 3OY6U 4OS1A 2G52A 1BITA 3AW1A 1B7XB 1BJVA 1VZQH 3FP6E 1O37A 5FBIA 4R0IA 1LPZB 2XC5A 3SJ8A 2GT7A 2BOHB 2R3UA 2OXSA 1A0HB 3MMGA 2Z9LA 1D6RA 1F7ZA 1ARBA 4ZH8A 2HNTF 5ETXA 1ESBA 4NZLA 4HFPB 1UO6A 1GBBA 2FX6A 3LT3A 3ODDA 1V2VT 4CH2B 4XD7D 2OQ5A 1TGNA 2ZDVH 1O2MA 4ZCNA 1SR5C 3EA8A 2QN5T 3Q3KA 3STJA 3TNSA 3S9BA 1O2GH 1ZJKA 1V2RT 1SFIA 1OWIA 2AERH 2PTNA 1V2LT 1SGIB 1G32B 2UUJB 1ETRH 2W6ID 1MQ5A 2ANKH 1MCVA 1GBEA 3UTUH 3ATIA 1BBRK 1O3BA 1BBRH 3F9EA 3M36A 4UFEH 1CHOF 4ACBA 1SGRE 2CN0H 1WCZA 1YPJH 2R2MB 4MQAA 5CHAB 2HOBA 1OKXA 1P06A 1OPHB 1SVPA 4B74A 1TRMA 3GISB 5C2ZA 3PV4A 2KM0A 3SJKA 1GBIA 1CBWC 2EY4C 3ZVBA 1UK3A 1BIOA 1HV7A 2IN2A 5EODA 4I8JA 4R8TB 1ZPBA 5C67A 1P03A 1GBDA 3BIVH 1FLEE 1G3DA 2J98A 4YZUA 1SQTA 2Y7XA 5FCRA 1BZXE 2JJ1D 1UVSH 5GNDA 1ZZZA 3KEEA 3QTOH 3BG4C 4NA7A 3S7HB 1VITF 5A8XA 1E0FD 5AVDA 1QL8A 1AVGH 2ZU3A 4WMDA 3NWUA 1ZTLA 2BY6X 5EQSA 1GWAA 2BD5A 5K0HA 1C5QA 4CRFA 1W7XH 1AB9B 4OS5A 2KCYA 1MKXK 1F92A 1QQUA 3RXRA 4FUCA 1MMJN 1NRQH 1OP2A 3M37A 4WXIA 4ACAA 1Y3WA 1VCPA 4THNH 2FLRH 3GY4A 3ZZ6A 1UTMA 1GJ5H 1Z1JA 2XOKD 2RFKC 2W6JD 1GBTA 1L1GA 3I77A 1Y3XA 2K8IA 1VKYA 4IC5A 3ZZAA 1W0KD 2TGPZ 4RKJB 1LKBA 3U8OH 1EAUA 4FETA 2O8LA 4AFSA 1NO9H 3PLKA 2XYAA 2K1QA 5CMXH 5EU8A 4ZHLU 5AFYH 3MNXA 3S0NA 1QHRB 1HAVA 2FS9A 1BBRE 2UUFB 3DFLA 1FXYA 1O36A 1ORFA 4H6TA 2XBVA 2ASUB 1LPKB 1C5XB 3GCHB 2ANYA 1RTFB 1NFWA 3A87A 1JIRA 2FOHA 2BY8X 1L1NA 1EKBB 1WTGH 3GY6A 2UUYA 1P9UA 5F8ZA 1AN1E 1W7GH 4Y8ZA 1QGFA 1GVLA 1AWFH 2FO9A 3MNSA 2FI5E 2LELA 4X1PU 1G3EA 3P8GA 3GY8A 3ZZDA 1GG6C 5JB8S 2C8ZB 7KMEH 3BTEE 3HGPA 3AAVA 3D23A 4X1QU 2AGGX 6LPRA 4FVBA 4LK4A 1C2KA 2HPPH 1J16A 1NT1A 2PKSB 2C93B 3CP7A 1EAXA 2ZPRA 3KQBA 1LHGH 1DOJA 1K1LA 1PPHE 1PQ5A 3QZRA 1GBLA 1Z7KA 4XBCA 2I6QA 3F9HA 1K1NA 3LGTA 1S82A 1GMCF 1TPAE 3F0OA 3SV7A 1O3CA 2ZFPH 3PTNA 2IPQX 2JH0D 1ESTA 3N7EA 4ABBA 2J94A 2CF9H 3RLWH 1ZMJA 1TBZH 1JWTA 1BTXA 3EE0B 1C5MD 2WPMS 2ZHDA 3TPIZ 4I8HA 1C1PA 2RDEA 2WPIS 1ZPZA 5T6GA 1O3LA 2ZWLH 1GGDB 3ESTA 1BMLA 4K8BA 1U6QA 4MPUA 1C9TA 4JZ1A 4WJG2 5EXNA 3H5CB 3UB0A 5C1XA 3OFND 3WY8A 3PO1C 3TVJB 2FI3E 2Y5HA 3AW0A 1GHVH 3RXHA 1YF4A 4D7GA 1C5TA 2BD7A 1BRBE 4Y76A 3FO8D 2VGCB 1A1RA 2ZG0H 3LKWA 1WOFA 2C8XB 5C0UA 1HAZB 2CHAC 1MZDA 1GHWH 4Y7BA 2A5AA 1HPGA 1M9UA 3UR9A 1EZSC 1PFXC 1GHXH 1CO7E 2C8YB 3KQEA 2G8TA 2ZHEH 3ATLA 2PSXA 1DE7H 1LPGB 3RXQA 1IQHA 5EPYA 1ZGVA 2V3MA 2KFWA 1AUTC 1HJ8A 2WSSD 1AVXA 4XOJA 3EAJA 4A5TS 4ASUD 3BEUA 2EQNA 4NCYA 3MWIU 2FYQA 5LH8A 2QXHA 5A8YA 1CE5A 3MU5A 5KGOA 1BRAA 1V2OT 1N1LA 2AIPA 4Y6DA 3SJOA 4CRCA 1KXCA 1CVWH 5GXPA 2SGQE 3UPEA 2A0QB 1UK4A 3MU1A 5DSFA 1P11E 2FLBH 1S6FA 4TY7A 3RXBA 3TITA 3TJUA 1ZHMA 3RXGA 1VCWA 1H9HE 2GDDA 5LPRA 4JK6A 1TGTA 2PKAB 2Z9KA 1AIXH 2KAIA 1NM6A 4Y0YE 4AN7A 4WF8A 5DP3A 2EEKA 2SNWA 4BAQB 5I46H 1UTQA 3TH2H 1AY6H 2WUCA 3UNQA 2A45B 3M61U 3Q76A 3UWJH 1TWXB 3BTME 1QNJA 4Y11E 3UUZA 1HIAA 3M5MA 4J1YA 3M35A 3H7TA 1DPOA 1NN6A 2BZAA 4K1EA 4K5ZA 1FJSA 1T8MA 3TJOA 1TGBA 2QY0B 1BHXF 2I6SA 1BRCE 4AORA 4CH8B 2BDBA 4MPXA 4YM9A 1F0TA 3TU7H 1D3PB 3K6YA 2JKHA 4JYTA 1SQAA 4WWYA 2ZEBA 3A81A 3BEIB 5AHGH 2SFAA 2R0KA 1OP0A 1T32A 1WSSH 3RXKA 3SNBA 1O32A 1ZYOA 2GCHG 3SUFA 1Y5AT 2BQ6B 5EIYA 4OGYA 3SN8A 3ATWA 2XBYA 3BTDE 1P3CA 1VR1H 1BA8B 1ELAA 2Y81A 1OWEA 4E06H 1P01A 4DURA 2SGPE 3RXOA 1AZ8A 2G55A 3L6PA 4ISOA 1IHSH 3RXLA 5HM9A 2O8UA 1VITH 1QB9A 1D3TB 3EDXB 1YLDA 3W94A 4ISIH 3E0NB 4XBDA 2XCNA 1HIAB 2BD8A 1KIGH 5JB9S 1CA0B 1O2VA 1DITH 4FUIA 3SUEA 4YT7H 1ELVA 3LIWA 2P93A 3MU8A 4X1SU 2GP9B 2PWXA 5H4IB 4HGCA 1EB1H 4ABJA 1GI1A 4U30A 2JIZD 1QR3E 1T4UH 5TCAA 3T2NA 4KP0A 2BVRH 1GCDA 2FEQH 2PGQB 3GOVB 3BTKE 1FDPA 1ZHPA 3DSPA 3A7VA 4X2WA 1AFQB 1H8ED 1BTHH 2XW9A 5T6DA 1A5IA 3EYDA 2CGAA 4AFQA 2Q6DA 4X2VA 1WXRA 1GL1A 1O2TA 1QL7A 5EJLA 3SHAH 1FY8E 1MTNB 2GV6A 1C5PA 3GDSA 1HAHH 2QIQA 1O31A 1V2WT 2BYAX 5E0HA 1QL9A 4Y71A 3VB4A 3A85A 2EI7A 1TNGA 4YOIA 1QRWA 1SGFG 2FYRA 3E0PB 3IWMA 4AGJA 2D1JA 1XUGA 2AMQA 1EP6A 5EQQA 2BM2A 1P2OA 1YPHC 1L0ZA 1TMTH 1P2JA 1GBMA 2CF8H 1K22H 1O2HA 2JETB 1UCYK 1UCYH 1EUFA 2HNTC 1FPCH 1RRKA 2OP9A 1K1MA 1C1TA 4ABIA 1O3IA 1NBME 4RSPA 1NRRH 5C0TA 3ZZCA 1S84A 2QXJA 4JK5A 1N6YA 1CHGA 1YY3A 1A3EH 1F2SE 1YCPM 2IPHA 4TWWA 3MH6A 2C90B 4FUFA 1O3OA 1SLVB 3UIRA 1ZSKA 1GBAA 3FOAA 1C5YB 3DA9B 2NU1E 2V7QD 4TY6A 2ZGCA 4WMEA 1HJ9A 3SV2H 2O8TA 1TPSA 4B6EA 2PLXA 2D2DA 1S6LA 3QGJA 5AF9H 1P2KA 4KTUA 3URCA 1DX5M 3ATKA 2ZCHP 4YOGA 4BTUB 2C4FH 3BG4B 2ZHWH 3LC5A 1E38B 3E6PH 3QX5H 2VVVA 1N8OB 5TCCA 2ZHFH 2P3FH 3VXFH 5C3NA 3AK5A 2OLGA 4NZQA 1PQAA 2Y7ZA 4E7NA 4UFGH 3H7OA 2FMJA 3KF2A 3WWFA 3FZDA 1HJAC 1MBMA 4X8VH 6GCHG 2P8OB 1GI2A 1Q31A 1TX7A 3LOXA 1TAWA 2G5NA 1TQ7B 1EOLA 4O97A 1NRSH 3ENSB 1FN6A 1TGCA 2HGTH 3A82A 1D6WA 3MU0A 3L3TA 4TSFD 1O3DA 5A0AE 1DWCH 2AGIX 1W3CA 3V0XA 3VB6A 4MLFB 2BDHA 1GCTC 3OU0A 4ZHMU 2VWOA 2VIWA 2QCYA 4CR5A 1QBVH 3EGKH 1G2MA 2BQWB 1W0YH 3MH4A 1GHBG 5JYIA 1UCYE 1O3PB 2UWPA 2ZTZA 2NU0E 3HK3B 4X6MA 1SL3A 1TA2A 1CGJE 3FANA 1G3CA 1ZJDA 2Z7FE 3PV2A 3U69H 1IQEA 4DG4A 2VIVA 3A7WA 4YLUA 3F2FA 1SGYE 2BY9X 4MPVA 2W3KA 4AX9H 2GZ8A 2J92A 3B9FH 5CDFE 1O3MA 3PMBB 3A8BA 3VEQB 1GI7B 1ACBE 2Y80A 4O9VA 2ZHQH 4X6PA 4RN6A 4RI0A 3H09A 1JOUB 1O3AA 4GUXA 3FFGA 3CS0A 3ZZ3A 1QQ4A 4GCHG 2G4TA 2OQUA 1NESE 2ZI2H 4TT3D 3TH3H 2JH6D 2ZDNA 1C5UA 2GCHF 4DIHH 4FU8A 1UVTH 1EPTA 1YC0A 3V13A 3F6UH 1TNIA 4X8SH 1RIWB 1G2LA 3RXVA 1P57B 4SGAE 5C20A 2K0QA 5A8ZA 4MTBA 1HDTH 3RMOH 2ZDKA 4SGBE 1RJXB 5LPFA 2GMTB 2VIPA 3SV9A 1NZQH 3RXCA 1EAWA 3U28C 1OSSA 2J97A 3VB7A 1GMHG 5CHBA 5C5NA 3O8CA 2H1UA 2NU3E 2H5DA 4Q7ZA 4ZHAA 2FTMA 3GCOA 1WV7H 3SU5A 1Y5UT 1TMUH 4ISLA 1XUJA 4HZHA 1TLDA 3KN2A 1VJAU 4VGCC 1S0RA 1THSH 3KGPA 1Y5BT 4ABAA 1O2XA 1T8OA 1D9IA 3B23B 1EPTB 2J2UA 2PUXB 4A92A 5L6NH 3SU3A 3SJ9A 3VGCC 1ZHRA 3D62A 3UOUA 1VJ9U 1O2QA 3PO1B 1OYTH 3BTWE 4FUBA 4LZ4B 3UY9A 2BLOA 2ZFFH 1LHCH 1O2YA 3K2UA 4NIWA 1LVOA 1J17T 3QZQA 2VB0A 4KKDA 1DSUA 1T7CA 1B0EA 4MPWA 4B75A 5EW1H 4I32A 3KQCA 3LH3A 1UJ1A 3SORA 1FIWA 4NWLA 1RXPA 1EJAA 3ELAH 1WQVH 4M7GA 2WV5A 1V2ST 1Z8IB 3SBKA 1HLTH 3SZEA 7GCHF 2HLCA 3M7UA 3RM2H 2CHAB 2J34A 3PRDA 1IAUA 2TGAA 3A86A 3VFEA 1MTUA 1O2RA 1CSOE 5FPTA 1EB2A 4RT0A 1O30A 3C27B 3ZVCA 1SBWA 1V2NT 3WW7A 4BTIB 2QAAA 2OTVA 2VBCA 4B2AA 2FP7B 1FUJA 5JBTA 2A4OA 1GHYH 2GZ7A 5EJZA 2GCTB 1P2MA 2DUCA 3A7YA 3MFJA 3UAIC 1SOZA 1O2OA 1GBJA 1O2SA 1FV9A 5HKKD 1VGCC 5EW2H 1HNEE 1S83A 3EA9A 4KTSA 5KEDA 5GPIB 2ZA5A 5HM2A 1GI9B 2FOAA 1CGHA 3N99A 3SGAE 2CMYA 3S69A 2HPQH 3VB5A 5E2PA 3RU4T 3BTHE 6GCHF 1FY4A 1MKXH 3DCLA 4XDEA 1C5VA 1O2LA 1P02A 5DP4A 3I29A 4AG1A 4X2XA 1BMFD 1OWJA 2A4QA 2GV7A 3IG6B 2FM2A 1SHHB 1ANCA 4NIYA 3ZVGA 1FONA 4FVDA 3SOSA 3OEED 3AAUA 1O38A 3M3TA 2TGTA 3SZNA 6CHAC 1EXFA 3T25A 2M5TA 1FN8A 2DE8A 4P02A 4UFDH 3NPSA 1LO6A 3WWBA 1DDJA 1DSTA 1SPJA 1GJ4H 2Z9GA 2KR7A 2SGAA 1KXDA 2PTCE 3RC4A 3KQ5A 1W8BH 1DWDH 1YLCA 3URDA 4JYUH 4A1XA 5G4BA 1HAOH 2ZU5A 2HLDD 5DO4H 1BMNH 3PMJA 1C1UH 1UK2A 2WHXA 1FIZA 1MKWK 3EE7A 1SGFA 2A7HA 3UQVA 3R0FA 1THPB 1TNJA 3OX7U 4WH8A 1X7AC 4AYVB 4IGDA 1EFRD 1O3JA 1GBHA 3LGYA 3OSYA 4JYVH 2F3CE 1BTPA 2Z9IA 3MO6A 4ISNA 1H8HD 2ESTE 3U9AH 1DXWA 2OD3B 3DD2H 1RD3B 1ELBA 3HATH 2A1DB 4KELA 2BLVA 1HAIH 3TJVA 2LNCA 3ITIA 1MTVA 2V0BA 1IQNA 2ULLA 1QURH 3P6ZB 1XXFA 2LPRA 2FPZA 1ARCA 1S85A 1TX6A 4XSKU 4TYDA 2M2AA 4ESTE 1QJ1B 1F0SA 4MNVA 2BX4A 2VWLA 3RXFA 1S81A 4Z0KA 1UVPA 2Y6TA 3SNDA 1SGCA 4NIXA 3TIUA 1H4WA 1XUIA 4OGXA 1W0JD 5DN6D 1GMHF 1K1JA 3RU4E 4JZDH 3RLYH 1BT7A 3KQDA 4NG9H 1BOQA 1NPMA 1UW7A 4IMQA 2F9BH 3QDZB 4JMYA 1HAYB 3M7TA 3RMNH 1NTPA 3SU1A 1V6DA 3MQKC 3Q3YA 3SV8A 2XC0A 3LH1A 1QBOA 5B6OA 4CBOA 1UTNA 3JZ2B 5SGAE 5GIBA 3BTFE 5LGOA 3QO6A 3FKSD 2YNAA 5C5OA 1TRNA 4Q7YA 1YBWA 1SGPE 1V2MT 1UVUH 1XMNB 2OUAA 3MU4A 1H8IH 2PR3A 1MUEB 3QLPH 5FCKA 1KXEA 1K9OE 1LQEA 1GJ7B 1YLNA 3GDVA 1J9CH 4CRBA 2PKAA 1HGTH 3RXTA 1O33A 1G9IE 2FIRH 1SQOA 5E0GA 5K7RA 2BY5X 5J4QA 3SGQE 1MZAA 1A5GH 1WAYB 2GD4B 4CRGA 1V2KT 2BD9A 4IS5A 4NGAH 4D8NA 1W0ZU 5DP6A 4INLA 1CT0E 4AFUA 4NA9H 1QBNA 2C8WB 1YM0A 1P2NA 1DICA 2VNTA 1NBMD 1D4PB 5TJXA 3ZZBA 2ZNKH 3ZIAD 5HMAA 1TRYA 1C5RA 1H9IE 5FHTA 1SC8U 1EX3A 1AWHB 4RKOB 2ZFSA 1YWUA 1O3KA 1LHDH 2ZGXH 1S0QA 1TA6A 5E8EH 3RMLH 1V2TT 1E1RD 1ABJH 2W26A 1C1QA 2PV9B 2FOEA 5CHAC 1AD8H 2BY7X 1O5EH 2ANMH 3QTVH 4TPIZ 1CU1A 2ZTXA 3MH7A 4IW4E 1RTLA 1GJCB 1P12E 4YT6H 2J9NA 3DHKH 1MBQA 1QB6A 1K28D 1T31A 2BOKA 5C1UA 1AKSB 1LQDB 5AFZH 2SGFE 4K8YA 3F68H 5FL7D 3M5LA 1ELCA 3KNXA 2Z3DA 3TH4H 2SNVA 4YOJA 1XVMA 4J2YB 2QA9E 2TBSA 4X1RU 4CHAB 1Z6JH 1GI4A 2F91A 4INKA 4UDWH 3V12A 4DJZB 1SLUB 4AB9A 4AB8A 3UNRA 3SQHE 1SKYE 2AIQA 1V3XA 2VU8E 3M3SA 3O8DA 1IQFA 1AB9C 3A8AA 2G81E 2L74A 2AMDA 1C5OH 4I8KA 2THFB 2VWNA 1KXAA 5ESTE 1HRTH 1E1QD 2DE9A 4IMZA 2FI4E 2ZC9H 5C17A 2XC4A 3BN9A 1GI6A 1IQMA 3HKIB 1J8AA 2HRVA 4TPYA 3A7TA 1VCQA 2PHBA 1EAIA 2B9LA 1Y3YA 1NC6A 3GY5A 5T1VA 1T4VH 1HUTH 1C2HA 3M5OA 1WU1A 1HBTH 5JDUB 1HAGE 2BLWA 1P09A 3ZZ5A 1O3HA 2OINA 2ZPSA 2JJ2D 2F83A 3PLBA 2AH4X 3E8LA 3PTBA 3ZV9A 1WQSA 1EJNA 1FNIA 2YMSD 3P8FA 2ZIQH 4B6FA 2G5VA 3KHVA 4GSOA 1F0RA 3UREA 1O2JA 5JPMH 1GPZA 1WDIA 3GCHC 1G30B 3PMAB 2TIOA 2Z3EA 1SLXB 2A5IA 3SU0A 4FUHA 1YPLH 1P3EA 4CRDA 5BPEA 2GKVE 1C5WB 5A0BA 1BMMH 2Z3CA 4E05H 1W11U 1GJ8B 4BAMB 1TQ0B 3T5FH 3UR6A 1Z8RA 3ZVDA 3OY5U 1MU6B 1Y8TA 3GICB 5DP5A 2W7SA 1EQ9A 4HI3A 1P04A 2IOTA 2OC0A 3SUGA 3KIDU 4LXBH 4Z1MD 2D26C 1TABE 4ZXXH 4A7IB 1GBKA 2F9NA 3NUMA 4I8LA 1SI5H 5DJ7A 4DIIH 1W2KH 3T26A 4Y8XA 2NU2E 2W5EA 1YCPK 2UWOA 3RC5A 1TPPA 1AUJA 1SOTA 2KCAA 1YCPH 5F03A 3PWCA 3MO9A 1C5ZB 2O8WA 2BMGB 4YTAA 2J38A 1E36B 4YXWD 1KXFA 2GZ9A 4D9RA 2FOGA 2R2WU 2HVYB 1PPFE 4AZ2B 3TGIE 3ZZ7A 2PSYA 1DWBH 3F2GA 1C1NA 4FUGA 1ELDE 3BTGE 2F4LA 3UWIA 3P17H 2FS8A 2ZCKP 4TWYA 1JRSA 1IQKA 2F9VA 1GGDC 1K1OA 1O3GA 1YYY1 2BHGA 1TBQH 3QUMP 4I8GA 1PYTD 1A3BH 4IBLH 2WPDD 3TK9A 9LPRA 1AMHA 1BTUA 1CBWB 3BF6H 1NFUA 4DGJA 5FAHA 2KZ4A 4LOYH 1QCPA 2A4GA 3RXAA 3DSGA 5HXFA 4I31A 3BTQE 3A83A 1MH0A 4MVNA 2VGCC 4F49A 5EGMA 2EA3A 3TNTA 2LP6A 1FY5A 3C1KA 2ZGJA 1N6XA 2GVFA 1D3DB 5DGJA 1A7SA 5DKMA 1PQ7A 3CNRA 1OXGA 2J4IA 1P0SH 2FESH 1TYNA 4FOUC 4NA8A 3GCTG 4B73A 4B76A 1SGNE 1EATA 3QWCH 5L2ZH 1OOKB 3NK8A 4BANB 2A2QH 4F55A 2BDCA 1B5GH 2O9QA 1A5HA 2OC1A 1ZR0A 3CENA 1GI0A 4XE4A 4XBBA 5B6LA 2CXVA 1V2QT 1LMWB 4A6LA 1UTOA 2AYWA 4B2CA 3RXEA 2BVXH 5EXLA 1MD7A 4Q4LA 4GLYA 4OS6A 4WVPE 2ZECA 4Q7XA 3SNAA 1NROH 1QZ8A 1KDQA 2A31A 3DT0H 3AASA 5EOKA 5E2OA 1JBUH 3GY2A 2H9TH 1NY22 8ESTE 3I78A 4ZMAH 1C9PA 3NKKA 1FPHH 3SU4A 4ABDA 1LCYA 1C4V2 1C1RA 1C1WH 3T62A 5DP8A 5F6MA 1TOMH 2BDYA 1F5RA 1UVOA 1C2DA 4D76A 8LPRA 4U01A 3K9XB 2ILNA 3SNEA 3SGBE 2QF5A 1W14U 3T28A 1HAPH 2UUKB 2ODYB 2VJ1A 2ALPA 1CQQA 2RA0A 2VVUA 2ZFTA 3A88A 2NU4E 1OHHD 3ATMA 3F3BA 1BB0B 3A84A 4A1VA 3VPKA 2ZU2A 2RCEA 2XWAA 3NRLA 2A4RA 1LVYA 1RTKA 2FOFA 3RDZA 1KTSB 4ASHA 4DVAU 1Y3UA 4H6SB 4NSYA 3AVZA 2H5CA 4IC6A 5FPYA 4NWKA 1GG6B 2ZDAH 1O2KA 3OYPA 1FY1A 2RA3A 3LGUA 2H9EH 1GHZA 1FAKH 5JBBS 4Y10E 1JIMA 1KDQB 1BJUA 3F1SB 2VIQA 4GPGA 2F43B 2ODPA 1GJBB 1TPOA 2XWBI 4BXWA 1BUIA 3U98H 3SHCH 2WV9A 4BOHA 2B8OH 2QF4A 2STBE 1DLEA 2BX3A 5LPEA 3T27A 3HK6B 1QTFA 1D3QB 1ZOMA 2A32A 1DWEH 2YMSC 3UNSA 5IDKA 1L4DA 1GJAB 2ZZUH 1J14A 1FY3A 1ZTJA 4I86A 2FTLE 1UTPA 5EQRA 1ZRKA 4NIVA 2PP6A 1P2IA 1CA0C 1A61H 3E90B 1PPCE 1XXDA 3LJJA 2WYJA 4OS2A 2GDEH 5EPNA 1MU8B 2AS9A 1AFQC 2BLQA 1JMOH 1DY9A 1FI8A 1QA0A 1TNHA 3GDUA 3RU4D 3MHWU 2QXGA 1TFXA 2ODQA 2ZDMA 1WBGB 2A7CA 1GHAG 5F8XA 1F0UA 2JH5D 3P8NA 2BD3A 1MTNC 1WTHD 4XRNA 3V3MA 3RP2A 3FN8A 1ZSLA 1LVBA 3NCLA 2WINI 1O2WA 4K3JA 4X6NA 3E16B 5A0CA 3NZIA 5EXMA 1C2IA 2WPKS 3TK5A 1BTWA 4IN2A 1E79D 1W13U 3F0PA 2ALVA 3CS7A 4CREA 9ESTA 3LGWA 4Y8YA 4HTCH 8GCHG 1NU9A 1T8NA 4Y7AA 4I33A 5DK1A 2JETC 2KCOA 2P3TB 3KYFA 1SQRA 1S5SA 2HWLB 2GT8A 3SUDA 2OCVB 3K65B 1BTYA 1Y59T 3PRBA 1G3BA 1O2IA 1PYTC 4U32A 3HGNA 5L2YH 4FU7A 2OBQA 1O2UA 2RDLA 3RXJA 1H9LB 2GX4A 4FUJA 1COWD 3SJIA 4MNWA 1O3EA 1LTOA 4NSVA 3P8OA 4AC9A 1GI8B 3BTTE 3NXPA 1F5KU 3F2HA 3LGIA 1OX1A 2G4UA 3RXDA 3STIA 2H6MA 3LDXH 4WH6A 4X8TH 5T6FA 1MD8A 5L30H 4LZ1H 1L2EA 3GCTF 2C3SA 1EZUC 4O03A 2WZQA 3B8JA 1AZZA 3RMMH 4ZKRU 1MQ6A 1E35B 2P59A 1K21H 4YESB 3A7ZA 2WYGA 1MABB 2R9PA 4WMFA 1YKTA 1K0HA 1PQ8A 1FX0B 1GI3A 4UEHH 3V7TA 1C4U2 1OWDA 1N8OC 2FXRA 2BQ7B 1SGDE 5E0JA 4AGKA 3GCNA 1BTZA 3GYLB 2CJIA 1F5LA 3ZV8A 2VIOA 2GTBA 2P8OC 2PFEA 1GHBF 5ESBA 3SQEE 3U8TH 2Z6BD 1CA8B 1YPKH 1O34A 1Z6EA 1YPGH 2FOCA 1CT4E 3S9AA 2AEIH 5GJ4B 1GJ9B 2VINA 1DUEA 1Z1IA 4X8UH 3M3VA 3LPRA 4Q63A 1C5LH 4UFFH 3G01A 1MKWH 2L6OA 1XM1A 1TOCB 4Y79A 1AI8H 5ABWA 1GMDG 2QGRA 4GAWA 4DCDA 1QRXA 4FUEA 3GY7A 2J98B 5KECA 1HAXB 5FX5A 1C2EA 5JBCS 1LVMA 1GDUA 1KLTA 4GCHF 1DM4B 4KGAA 2FX4A 2R3YA 2CK3D 4FU9A 1V2PT 2VH0A 1KXBA 4K69A 4PROA 1GVKB 3P92A 4ZKOU 2W7UA 2XNIA 1P2QA 1P8VC 2B5TB 2XBWA 2UWLA 4H4FA 3UFAA 4KTCA 5JBAS 3SO3A 5T3HA 3O8BA 2ZTYA 1LHFH 1QRZA 1HXEH 1BRUP 1ZLRA 1A4WH 3MNBA 1SMFE 2P3UB 1O3FA 5C1YA 4F4OC 1PPGE 1LKAA 3F9FA 7LPRA 2BDGA 1Q2WA 1DT2A 3FVFB 3S7KB 1TNKA 1RGQA 4K2YA 1QIXB 2ANWA 3SNCA 1RIWC 3RM0H 3ZYDA 2GJGA 2O8MA 1QJ6B 4B71A 1GBFA 1NRNH 1IHTH 5GCHG 4ZKSU 1J15A 4NFFA 2GMTC 3K6ZA 4GVUA 1O5BB 2FWWA 8KME2 1HAVB 1V2JT 2KCPA 2RG3A 1GDQA 4B2BA 1KTTB 2Z9JA 1BQYA 2P95A 1AVWA 1ANDA 3JZ1B 4OM9A 2B0FA 3MI4A 3E3TA 1DY8A 1O0DH 2NWNA 1W10U 1AO5A 2GGVB 1IQIA 2OBOA 2W3IA 4CBNA 1T8LA 2F9PA 2J95A 4UONA 3N7OA 3KCGH 1CT2E 1GJDB 2ZQ2A 1GHAF 1V2UT 1O2PA 3MNCA 4BAOB 1ELGA 1EPTC 2A2XH 1SLWB 2ZPQA 1GVZA 1SG8B 3TGKE 3FP8E 1TONA 3BG8A 4K1SA 1AKSA 4JZIA 4HG6A 2F9OA 3TLOA 1EOJA 3RUOA 1AE5A 4AG2A 1UTKA 4YLQH 3GY3A 2STAE 2XNDD 1K1PA 4BTTB 3PWBA 3SV6A 1C2FA 5FBEA 1TX8A 4U2WA 8GCHF 2XTTB 1A46H 5F53A 4DW2U 1LDTT 2BTCE 1ETTH 4DT7B 1UMAH 4ISHH 2BDIA 3QGNB 3RXIA 1HYLA 5DP7A 1YP9A 2QC2A 1IQLA 3UOPA 3A8CA 1RS0A 3ZZ9A 4ABFA 1HXFH 1Z8GA 1C1SA 1DXPA 3ZVFA 2VIDA 1NFYA 1XUFA 2Y82A 4CR9A 1HJAB 2OC7A 1SGQE 1ANBA 2EI6A 4I7YH 2BXTH 1XKAC 5A09A 4AFZA 2H9HA 1YPEH 4CRAA 2FODA 1GJ6A 2TPIZ 3TGJE 2J5UA 1GCTB 3OEHD 3RC6A 1ANEA 1ZGIA 2WUBA 1E37B 1ZPCA 2CV3A 3BSQA 2GCTC 3PB1E 3BIUH 5CE1A 3OTPA 3IITA 6ESTA 3D49H 3T29A 1LHEH 2Q6FA 5FX6A 3S9CA 2AHME 5DPAA 3U8RH 3RXPA 1ELEE 3OTJE 2V3OH 1CGIE 1A0JA 2FZZA 1KY9A 4Q2KA 4ZROA 4NFEA 3A7XA 4WXVA 1WYKA 4BAHB 4M9FA 3SU6A 3SW2B 1TALA 1H8DH 2G51A 1DFPA 2ZFQH 2AGEX 3O8RA 3Q77A 3SI3H 1A0LA 5IYTA 2BVSH 1K2I1 2ZP0H 3U1IB 4ABEA 2ZQ1A 1AQ7A 1ZMNA 2QF3A 5GDSH 4INHA 4X1NU 4D7FA 2Y5FA 5FXLA 1BCUH 2ZKSA 4DY7B 3PMHB 2Q6GA 3LGVA 1GMDF 1OS8A 4GHQA 5I25A 3MOCA 2IJOB 1XKBC 3QN7A 5HIYA 2ZGBH 3EA7A 4H42U 1O5AB 1TNLA 2Q1JA 3UQOA 4D9QA 1RFNA 3SYJA 1IQGA 4FUDA 3N7DA 1BDAA 1KYNA 1NU7B 2KAIB 2BD4A 2TGDA 1Z71A 1TIOA 4Z6AH 4ZUHA 2YMSB 1AE8H 4A1TA 2WV4A 3DSOA 1C4Y2 2ZU4A 5HGGA 3PROA 4RT1A 5HIZA 1ETSH 4MDSA 2ZF0H 4VGCB 3E1XB 1O39A 1ZMLA 1A2CH 2XXLA 2A5KA 1YPHE 3MYWA 2WPJS 4QT8C 2A7JA 3VGCB 5GWZA 1FZZA 2OK5A 3SI4H 2QV1A 1O5CB 3HKJB 4X6OA 5GCHF 2PKSC 3OAAD 4BNRA 1QA7A 3GS9A 2HNTE 4MNXA 1DLKB 4UD9H 2EC9H 1ELTA 1C2LA 4XFQA 1ABIH 1YPMH 3Q00A 1C1MA 1S6HA 1Q3XA 2HVXA 1AU8A 3ZVEA 3A80A 1C1VH 2VH6A 2BDAA 1B0FA 1SGTA 3BEFB 3FZZA 1MTSA 1Z8JB 1C2JA 4WY3A 2TRMA 2XRCA 4ABHA 1SSXA 5BRRE 3P95A 2ZCLP 3PLPA 1C2MA 1PJPA 1O5DH 4B1TA 1YGCH 2D8WA 1TBRH 2VVCA 4JZEH 4JZFH 7GCHG 4YO9A 3OE7D 7ESTE 1ZTKA 1P9SA 1QY6A 2XBXA 4K1TA 1ESAA 4O3TA 1E34B 3DFJA 3EQ0H 1UTLM 1CHOG 5A2MH 1SGEE 3P70B 4MNYA 1VGCB 1L1JA 2QE7D 2Z94A 4MG3A 1MTWA 1XX9A 3DUXH 3D65E 1FMGA 1GI5A 1TB6H 1PPZA 2JDID 2ZO3H 2BD2A 3Q3XA 1TE0A 4JCNA 5J4SA 4AOQA 5EJ1A 4AYYB 4DOQA 1G37A 4K60A 3R3GB 1OWHA 1QFKH 4F48B 2PUQH 2AMPA 1DUAA 1UTJA 1KLJH 3VG8A 1ZRBA 1EJMA 1NFXA 1UHBA 2H2ZA 5DP9A 1EASA 2IJD1 1VITG 1ZSJA 1MAYA 2HALA 1XUHA 3F9GA 6CHAB 1DVAH 3LJOA 3W1EA 1TGSZ 2OC8A 2VWMA 2SGEE 2QF0A 3L33A 1HFDA 1QJ7B 3PM3A 2ZU1A 1SB1H 4GHTA 1THRH 4IN1A 3FP7E 1H1BA 4BXSA 1EP5A 3M7QA 3ODFA 2FOBA 1OWKA 3ZZ8A 1ELFA 1ID5H 3RXUA 4OS4A 1IQJA 5HYOA 4X2YA 4P00A 3PV5A 1QB1A 1FQ3A 4OS7A 1BHXB 4DT4A 1JRTA 1NS3A 4BAKB 5IK2D 3HPTB 1JXPA 4X0WU 2QYIA 4ZKNU 1MCTA 2AFQB 1GDNA 1GL0E 1O5GH 5DG6A 4CHAC 2ZDLA 1O2ZA 1UHBB 3TK6A 4Y0ZE 2PGBB 2F9UA 2EI8A 1AGJA 1IOEA 5PTPA 3GYMA 5C94A 3E91A 2B7DH 1SHYA 4Q80A 3SU2A 1INCA
chains in the Genus database with same CATH topology
2SGDE 4ABGA 1AFEH 2P94A 3A8DA 1GBCA 2FOMB 2QXIA 1DANH 1NRPH 2G00A 3LC3A 3MO3A 2WPHS 1XVOA 2V6NA 1BMAA 1HCGA 4ZXYH 4UE7H 1EZXC 1L4ZA 1PPBH 1O3NA 2BB4A 2R0LA 3ZYEA 2YOLA 3LONA 1K1IA 5FPSA 1C2GA 1WUNH 1O2NA 3QK1A 2Y5GA 1P10A 3MH5A 2V3HH 3M5NA 1O35A 3MTYA 2WPLS 3LU9B 2V35A 1EZQA 3RXMA 1MAXA 3VXEH 1FAXA 3TJNA 2BZ6H 5F8TA 1W12U 5EG4A 1KLIH 4ZAEA 1SFQB 3VB3A 1OP8A 3KL6A 2XCFA 1C5SA 4E7RG 3BV9B 1C1OA 1P05A 3A89A 2P16A 1AHTH 1GMCG 1HB0B 1DS2E 1OYQA 3RXSA 2YNBA 2ZFRH 1C5NH 1O5FH 3FAOA 4O3UA 3U1JB 1G36A 2ZGHA 2FDAA 1XUKA 3ZVAA 1PPEE 1TMBH 2BXUH 3PYHA 3W95A 2PW8H 3ZZ4A 1KSNA 1Y3VA 4FXGH 3OY6U 4OS1A 2G52A 1BITA 3AW1A 1B7XB 1BJVA 1VZQH 3FP6E 1O37A 5FBIA 4R0IA 1LPZB 2XC5A 3SJ8A 2GT7A 2BOHB 2R3UA 2OXSA 1A0HB 3MMGA 2Z9LA 1D6RA 1F7ZA 1ARBA 4ZH8A 2HNTF 5ETXA 1ESBA 4NZLA 4HFPB 1UO6A 1GBBA 2FX6A 3LT3A 3ODDA 1V2VT 4CH2B 2OQ5A 1TGNA 2ZDVH 1O2MA 1SR5C 3EA8A 2QN5T 3Q3KA 3STJA 3TNSA 3S9BA 1O2GH 1ZJKA 1V2RT 1SFIA 1OWIA 2AERH 2PTNA 1V2LT 1SGIB 1G32B 2UUJB 1ETRH 1MQ5A 2ANKH 1MCVA 1GBEA 3UTUH 3ATIA 1BBRK 1O3BA 1BBRH 3F9EA 3M36A 4UFEH 1CHOF 1SGRE 2CN0H 1WCZA 1YPJH 2R2MB 4MQAA 5CHAB 2HOBA 1OKXA 1P06A 1OPHB 1SVPA 4B74A 1TRMA 3GISB 5C2ZA 3PV4A 3SJKA 1GBIA 1CBWC 3ZVBA 1UK3A 1BIOA 1HV7A 2IN2A 5EODA 4I8JA 4R8TB 1ZPBA 5C67A 1P03A 1GBDA 3BIVH 1FLEE 1G3DA 4YZUA 1SQTA 2Y7XA 5FCRA 1BZXE 1UVSH 1ZZZA 3KEEA 3QTOH 3BG4C 4NA7A 3S7HB 1VITF 5A8XA 1E0FD 5AVDA 1QL8A 1AVGH 2ZU3A 4WMDA 3NWUA 1ZTLA 2BY6X 5EQSA 1GWAA 2BD5A 5K0HA 1C5QA 4CRFA 1W7XH 1AB9B 4OS5A 1MKXK 1F92A 1QQUA 3RXRA 4FUCA 1MMJN 1NRQH 1OP2A 3M37A 4WXIA 1Y3WA 1VCPA 4THNH 2FLRH 3GY4A 3ZZ6A 1UTMA 1GJ5H 1Z1JA 1GBTA 1L1GA 3I77A 1Y3XA 4IC5A 3ZZAA 2TGPZ 4RKJB 1LKBA 3U8OH 1EAUA 2O8LA 4AFSA 1NO9H 3PLKA 2XYAA 2K1QA 5CMXH 5EU8A 4ZHLU 5AFYH 3MNXA 3S0NA 1QHRB 1HAVA 2FS9A 1BBRE 2UUFB 3DFLA 1FXYA 1O36A 1ORFA 4H6TA 2XBVA 2ASUB 1LPKB 1C5XB 3GCHB 2ANYA 1RTFB 1NFWA 3A87A 1JIRA 2FOHA 2BY8X 1L1NA 1EKBB 1WTGH 3GY6A 2UUYA 1P9UA 5F8ZA 1AN1E 1W7GH 4Y8ZA 1QGFA 1GVLA 1AWFH 2FO9A 3MNSA 2FI5E 4X1PU 1G3EA 3P8GA 3GY8A 3ZZDA 1GG6C 5JB8S 2C8ZB 7KMEH 3BTEE 3HGPA 3AAVA 3D23A 4X1QU 2AGGX 6LPRA 4FVBA 4LK4A 1C2KA 2HPPH 1J16A 1NT1A 2PKSB 2C93B 3CP7A 1EAXA 2ZPRA 3KQBA 1LHGH 1DOJA 1K1LA 1PPHE 1PQ5A 3QZRA 1GBLA 1Z7KA 4XBCA 2I6QA 3F9HA 1K1NA 3LGTA 1S82A 1GMCF 1TPAE 3SV7A 1O3CA 2ZFPH 3PTNA 2JH0D 1ESTA 4ABBA 2J94A 2CF9H 3RLWH 1ZMJA 1TBZH 1JWTA 1BTXA 3EE0B 1C5MD 2WPMS 2ZHDA 3TPIZ 4I8HA 1C1PA 2WPIS 1ZPZA 5T6GA 1O3LA 2ZWLH 1GGDB 3ESTA 1BMLA 4K8BA 1U6QA 4MPUA 1C9TA 4JZ1A 4WJG2 5EXNA 3H5CB 5C1XA 3WY8A 3PO1C 3TVJB 2FI3E 2Y5HA 3AW0A 1GHVH 3RXHA 1YF4A 4D7GA 1C5TA 2BD7A 1BRBE 4Y76A 2VGCB 1A1RA 2ZG0H 3LKWA 1WOFA 2C8XB 1HAZB 2CHAC 1MZDA 1GHWH 4Y7BA 2A5AA 1HPGA 1M9UA 3UR9A 1EZSC 1PFXC 1GHXH 1CO7E 2C8YB 3KQEA 2G8TA 2ZHEH 3ATLA 2PSXA 1DE7H 1LPGB 3RXQA 1IQHA 5EPYA 1ZGVA 1AUTC 1HJ8A 1AVXA 4XOJA 3EAJA 4A5TS 3BEUA 4NCYA 3MWIU 2FYQA 5LH8A 2QXHA 5A8YA 1CE5A 3MU5A 1BRAA 1V2OT 1N1LA 2AIPA 4Y6DA 3SJOA 4CRCA 1KXCA 1CVWH 5GXPA 2SGQE 3UPEA 2A0QB 1UK4A 3MU1A 1P11E 2FLBH 1S6FA 4TY7A 3RXBA 3TITA 3TJUA 1ZHMA 3RXGA 1VCWA 1H9HE 2GDDA 5LPRA 4JK6A 1TGTA 2PKAB 2Z9KA 1AIXH 2KAIA 1NM6A 4Y0YE 4AN7A 4WF8A 5DP3A 2EEKA 2SNWA 4BAQB 5I46H 1UTQA 3TH2H 1AY6H 2WUCA 3UNQA 2A45B 3M61U 3Q76A 3UWJH 1TWXB 3BTME 1QNJA 4Y11E 3UUZA 1HIAA 3M5MA 4J1YA 3M35A 3H7TA 1DPOA 1NN6A 2BZAA 4K1EA 4K5ZA 1FJSA 1T8MA 3TJOA 1TGBA 2QY0B 1BHXF 2I6SA 1BRCE 4AORA 4CH8B 2BDBA 4MPXA 4YM9A 1F0TA 3TU7H 1D3PB 3K6YA 2JKHA 4JYTA 1SQAA 4WWYA 2ZEBA 3A81A 3BEIB 5AHGH 2SFAA 2R0KA 1OP0A 1T32A 1WSSH 3RXKA 3SNBA 1O32A 1ZYOA 2GCHG 3SUFA 1Y5AT 2BQ6B 4OGYA 3SN8A 3ATWA 2XBYA 3BTDE 1P3CA 1VR1H 1BA8B 1ELAA 2Y81A 1OWEA 4E06H 1P01A 4DURA 2SGPE 3RXOA 1AZ8A 2G55A 3L6PA 4ISOA 1IHSH 3RXLA 5HM9A 2O8UA 1VITH 1QB9A 1D3TB 3EDXB 1YLDA 3W94A 4ISIH 3E0NB 4XBDA 2XCNA 1HIAB 2BD8A 1KIGH 5JB9S 1CA0B 1O2VA 1DITH 4FUIA 3SUEA 4YT7H 1ELVA 3LIWA 2P93A 3MU8A 4X1SU 2GP9B 2PWXA 5H4IB 4HGCA 1EB1H 4ABJA 1GI1A 4U30A 1QR3E 1T4UH 5TCAA 3T2NA 4KP0A 2BVRH 1GCDA 2FEQH 2PGQB 3GOVB 3BTKE 1FDPA 1ZHPA 3A7VA 4X2WA 1AFQB 1BTHH 2XW9A 5T6DA 1A5IA 3EYDA 2CGAA 4AFQA 2Q6DA 4X2VA 1GL1A 1O2TA 1QL7A 3SHAH 1FY8E 1MTNB 2GV6A 1C5PA 3GDSA 1HAHH 2QIQA 1O31A 1V2WT 2BYAX 5E0HA 1QL9A 4Y71A 3VB4A 3A85A 2EI7A 1TNGA 4YOIA 1QRWA 1SGFG 2FYRA 3E0PB 3IWMA 4AGJA 2D1JA 1XUGA 2AMQA 1EP6A 5EQQA 2BM2A 1P2OA 1YPHC 1L0ZA 1TMTH 1P2JA 1GBMA 2CF8H 1K22H 1O2HA 2JETB 1UCYK 1UCYH 1EUFA 2HNTC 1FPCH 1RRKA 2OP9A 1K1MA 1C1TA 4ABIA 1O3IA 4RSPA 1NRRH 3ZZCA 1S84A 2QXJA 4JK5A 1N6YA 1CHGA 1A3EH 1F2SE 1YCPM 2IPHA 4TWWA 3MH6A 2C90B 4FUFA 1O3OA 1SLVB 3UIRA 1ZSKA 1GBAA 1C5YB 3DA9B 2NU1E 4TY6A 2ZGCA 4WMEA 1HJ9A 3SV2H 2O8TA 1TPSA 2PLXA 2D2DA 3QGJA 5AF9H 1P2KA 4KTUA 3URCA 1DX5M 3ATKA 2ZCHP 4YOGA 4BTUB 2C4FH 3BG4B 2ZHWH 3LC5A 1E38B 3E6PH 3QX5H 2VVVA 1N8OB 5TCCA 2ZHFH 2P3FH 3VXFH 5C3NA 2OLGA 4NZQA 1PQAA 2Y7ZA 4E7NA 4UFGH 3H7OA 2FMJA 3KF2A 3FZDA 1HJAC 1MBMA 4X8VH 6GCHG 2P8OB 1GI2A 1Q31A 1TX7A 3LOXA 1TAWA 2G5NA 1TQ7B 1EOLA 4O97A 1NRSH 3ENSB 1FN6A 1TGCA 2HGTH 3A82A 1D6WA 3MU0A 3L3TA 1O3DA 5A0AE 1DWCH 2AGIX 1W3CA 3V0XA 3VB6A 4MLFB 2BDHA 1GCTC 3OU0A 4ZHMU 2VWOA 2VIWA 2QCYA 4CR5A 1QBVH 3EGKH 1G2MA 2BQWB 1W0YH 3MH4A 1GHBG 5JYIA 1UCYE 1O3PB 2UWPA 2ZTZA 2NU0E 3HK3B 4X6MA 1SL3A 1TA2A 1CGJE 3FANA 1G3CA 1ZJDA 2Z7FE 3U69H 1IQEA 4DG4A 2VIVA 3A7WA 4YLUA 1SGYE 2BY9X 4MPVA 2W3KA 4AX9H 2GZ8A 2J92A 3B9FH 1O3MA 3PMBB 3A8BA 3VEQB 1GI7B 1ACBE 2Y80A 4O9VA 2ZHQH 4X6PA 4RN6A 1JOUB 1O3AA 4GUXA 3FFGA 3CS0A 3ZZ3A 1QQ4A 4GCHG 2G4TA 2OQUA 1NESE 2ZI2H 3TH3H 2JH6D 2ZDNA 1C5UA 2GCHF 4DIHH 4FU8A 1UVTH 1EPTA 1YC0A 3V13A 3F6UH 1TNIA 4X8SH 1RIWB 1G2LA 3RXVA 1P57B 4SGAE 5C20A 5A8ZA 4MTBA 1HDTH 3RMOH 2ZDKA 4SGBE 1RJXB 5LPFA 2GMTB 2VIPA 3SV9A 1NZQH 3RXCA 1EAWA 1OSSA 3VB7A 1GMHG 5C5NA 3O8CA 2H1UA 2NU3E 2H5DA 4Q7ZA 4ZHAA 2FTMA 3GCOA 1WV7H 3SU5A 1Y5UT 1TMUH 4ISLA 1XUJA 4HZHA 1TLDA 3KN2A 1VJAU 4VGCC 1S0RA 1THSH 3KGPA 1Y5BT 4ABAA 1O2XA 1T8OA 1D9IA 3B23B 1EPTB 2J2UA 2PUXB 4A92A 5L6NH 3SU3A 3SJ9A 3VGCC 1ZHRA 3D62A 3UOUA 1VJ9U 1O2QA 3PO1B 1OYTH 3BTWE 4FUBA 4LZ4B 3UY9A 2BLOA 2ZFFH 1LHCH 1O2YA 3K2UA 4NIWA 1LVOA 1J17T 3QZQA 2VB0A 4KKDA 1DSUA 1T7CA 1B0EA 4MPWA 4B75A 5EW1H 4I32A 3KQCA 3LH3A 1UJ1A 3SORA 1FIWA 4NWLA 1RXPA 1EJAA 3ELAH 1WQVH 4M7GA 2WV5A 1V2ST 1Z8IB 3SBKA 1HLTH 7GCHF 2HLCA 3M7UA 3RM2H 2CHAB 2J34A 1IAUA 2TGAA 3A86A 3VFEA 1MTUA 1O2RA 1CSOE 5FPTA 1EB2A 1O30A 3C27B 3ZVCA 1SBWA 1V2NT 4BTIB 2QAAA 2OTVA 4B2AA 2FP7B 1FUJA 5JBTA 2A4OA 1GHYH 2GZ7A 2GCTB 1P2MA 2DUCA 3A7YA 3MFJA 1SOZA 1O2OA 1GBJA 1O2SA 1FV9A 1VGCC 5EW2H 1HNEE 1S83A 3EA9A 4KTSA 5GPIB 2ZA5A 5HM2A 1GI9B 2FOAA 1CGHA 3SGAE 2CMYA 3S69A 2HPQH 3VB5A 5E2PA 3RU4T 3BTHE 6GCHF 1FY4A 1MKXH 4XDEA 1C5VA 1O2LA 1P02A 5DP4A 3I29A 4AG1A 4X2XA 2A4QA 1OWJA 2GV7A 3IG6B 2FM2A 1SHHB 1ANCA 4NIYA 3ZVGA 1FONA 4FVDA 3SOSA 3AAUA 1O38A 3M3TA 2TGTA 3SZNA 6CHAC 1EXFA 3T25A 2M5TA 1FN8A 2DE8A 4UFDH 3NPSA 1LO6A 1DDJA 1DSTA 1SPJA 1GJ4H 2Z9GA 2SGAA 1KXDA 2PTCE 3RC4A 1W8BH 1DWDH 1YLCA 3URDA 4JYUH 4A1XA 5G4BA 1HAOH 2ZU5A 5DO4H 1BMNH 3PMJA 1C1UH 1UK2A 1FIZA 1MKWK 1SGFA 2A7HA 3UQVA 3R0FA 1THPB 1TNJA 3OX7U 4WH8A 1X7AC 4AYVB 4IGDA 1O3JA 1GBHA 3LGYA 3OSYA 4JYVH 2F3CE 1BTPA 2Z9IA 3MO6A 4ISNA 2ESTE 3U9AH 1DXWA 2OD3B 3DD2H 1RD3B 1ELBA 3HATH 2A1DB 4KELA 2BLVA 1HAIH 3TJVA 2LNCA 3ITIA 1MTVA 2V0BA 1IQNA 2ULLA 1QURH 3P6ZB 1XXFA 2LPRA 2FPZA 1ARCA 1S85A 1TX6A 4XSKU 4TYDA 4ESTE 1QJ1B 1F0SA 4MNVA 2BX4A 2VWLA 3RXFA 1S81A 4Z0KA 1UVPA 2Y6TA 3SNDA 1SGCA 4NIXA 3TIUA 1H4WA 1XUIA 4OGXA 1GMHF 1K1JA 3RU4E 4JZDH 3RLYH 1BT7A 3KQDA 4NG9H 1BOQA 1NPMA 4IMQA 2F9BH 3QDZB 4JMYA 1HAYB 3M7TA 3RMNH 1NTPA 3SU1A 1V6DA 3Q3YA 3SV8A 2XC0A 3LH1A 1QBOA 5B6OA 4CBOA 1UTNA 3JZ2B 5SGAE 5GIBA 3BTFE 5LGOA 3QO6A 2YNAA 5C5OA 1TRNA 4Q7YA 1YBWA 1SGPE 1V2MT 1UVUH 1XMNB 2OUAA 3MU4A 1H8IH 2PR3A 1MUEB 3QLPH 5FCKA 1KXEA 1K9OE 1LQEA 1GJ7B 3GDVA 1J9CH 4CRBA 2PKAA 1HGTH 3RXTA 1O33A 1G9IE 2FIRH 1SQOA 5E0GA 5K7RA 2BY5X 5J4QA 3SGQE 1MZAA 1A5GH 1WAYB 2GD4B 4CRGA 1V2KT