2BLWA

Trypsin after a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA02
1YBWA 2BXUH 2VGCB 2ZP0H 3ZVGA 1GG6B 1OWDA 1H1BA 2P8OB 5C1YA 5L2YH 1SHYA 4ISHH 5BPEA 1BTPA 5F03A 3Q3KA 1P09A 2BY6X 1ZTKA 1ZLRA 3M7QA 2CF8H 2BLOA 2C8XB 3PYHA 3VB3A 1FI8A 2C8ZB 5A8XA 4NGAH 2Y5HA 4BXSA 3HKIB 5DP4A 2HGTH 4I8LA 5H4IB 1OPHB 4CRFA 2VIDA 2V0BA 3L6PA 4Y8YA 1YPGH 1LTOA 2GZ9A 5JBAS 1FN6A 1HXEH 5JPMH 1FIZA 1SGNE 1TPAE 1ZHPA 2FPZA 3HK6B 2TGTA 1HNEE 1ZPZA 3CP7A 1S83A 1TNGA 1C1RA 1GCTC 3GDSA 1V2PT 1MH0A 2ZGHA 4VGCB 4AFUA 4X6MA 3U8RH 3V12A 2XC5A 5DO4H 1EPTB 2B9LA 1DANH 1ZRBA 4NFFA 1OKXA 2P93A 4MNYA 2CGAA 2AFQB 4X2WA 2ZKSA 3URCA 5L6NH 3BEFB 1JOUB 5DP7A 1MKWK 4LZ1H 1SLWB 4MNWA 5T6GA 5FAHA 1WYKA 4PROA 2FOBA 3GCOA 1B5GH 3BG8A 3EYDA 2HOBA 1XVMA 1GMDF 2ZFFH 4K3JA 2QIQA 1WCZA 1BHXF 4ZHLU 1FV9A 1L0ZA 1F92A 2BDYA 3O8RA 3RXGA 6GCHF 2BDAA 2WPLS 2UWLA 1FY1A 3T25A 2G51A 1QRXA 2LNCA 2PW8H 1OS8A 2JH5D 3I29A 3ZVFA 5C5NA 3E90B 3F9EA 2G00A 1FN8A 3O8DA 1SPJA 1O5GH 1F0UA 4OS2A 1HCGA 2P59A 1AVXA 1GJ4H 4CRBA 2ZA5A 2QF0A 1W3CA 1C5UA 1EJMA 4B75A 1EB2A 3QDZB 2GDDA 2Z9GA 1HAIH 3GCHB 4ISIH 4NA7A 5DPAA 1KXFA 1DY9A 2C90B 2QXJA 6ESTA 4DIIH 2BY5X 2BD8A 3RXDA 3OY5U 4WH8A 1WQVH 2Z6BD 1C5LH 1F0RA 1A46H 2SNWA 5C2ZA 3MFJA 2EA3A 2QY0B 4X1NU 4KELA 1Y5BT 2G52A 1Y59T 3BTQE 3Q3YA 2A5IA 3SOSA 3FFGA 2H1UA 8ESTE 3BIUH 1P9UA 2JETC 2XCNA 4OGYA 2SGQE 4I8JA 5GJ4B 5C67A 1LKAA 2TPIZ 2O9QA 3BIVH 1BOQA 1THRH 3LC3A 5EU8A 1TALA 4AG1A 2ZU1A 1V2UT 3ZZ3A 4AG2A 4UONA 1VCPA 1KTSB 3P6ZB 1MZAA 1TPPA 4KTCA 1O2HA 1QA7A 2FS8A 1BBRK 2W7UA 3D65E 5ABWA 1GVLA 1YC0A 2XC0A 4O9VA 1PQAA 5E0HA 1HV7A 3PMBB 2OC8A 1EZSC 2FESH 1AFQB 5FXLA 2HRVA 1QGFA 2W26A 4K2YA 2PFEA 1JIRA 4X8VH 1XMNB 1EUFA 4HFPB 3UNQA 1A7SA 2BQWB 3FP6E 4U01A 1HAVB 1GCDA 5EPNA 3SJOA 3TVJB 1V2QT 3ODFA 5SGAE 2FS9A 1LVOA 1O2GH 4NZLA 1J16A 1CBWC 1EZXC 2ODPA 4TWYA 3K6ZA 1FONA 4UD9H 2Q6FA 1BTYA 1T8LA 3AAUA 1HAXB 4GSOA 1JRTA 1PYTD 1NS3A 4M7GA 1C1UH 1FPCH 1UCYH 2ZU3A 1GI8B 3SU1A 1CHGA 4YTAA 3UWIA 1MMJN 3F9GA 1ZOMA 3M3SA 2OUAA 3NXPA 1RS0A 1EATA 1PPFE 1N6YA 1XM1A 4ABFA 2OXSA 4Z0KA 1HAPH 4OS6A 3BEIB 1DY8A 1O2QA 2YNAA 3VEQB 4WXVA 2VGCC 2IOTA 1O2NA 1VCWA 1UTQA 3V3MA 1O32A 2OLGA 2A31A 3L33A 2OD3B 3SNBA 1TRYA 1Y5UT 3RXTA 4IMQA 5CHAC 4B1TA 1ELEE 1GBTA 2H9EH 1Q2WA 1D3PB 4WVPE 4U30A 3GDUA 1VITF 3RXQA 5EG4A 2VVVA 5F8ZA 4CREA 2SGFE 2VIQA 1KXDA 3QWCH 1MUEB 3PLBA 5DKMA 4GAWA 1PPEE 3SQEE 3SNDA 3GY8A 1H9IE 4DCDA 3P8NA 1QB6A 3ZZAA 1SR5C 1BCUH 1DVAH 1V2WT 1V2LT 4YLUA 4X8UH 3SNAA 1FLEE 1GJ8B 4H42U 2R9PA 1Z8IB 5AHGH 3RMNH 5GIBA 3TJNA 1ELAA 3VGCB 2V3HH 4VGCC 5J4QA 3HKJB 3STIA 7LPRA 1CVWH 1O31A 2Z9KA 2XWAA 1MU8B 4ISOA 2BQ7B 4A6LA 1N1LA 1C1WH 5DP5A 1JMOH 3SJ8A 1G2LA 1NFWA 1UTMA 3SJKA 1CU1A 3UOUA 4Y11E 1QL9A 5LPRA 1L2EA 1FIWA 1SB1H 2A32A 4A92A 7KMEH 2WUCA 3MWIU 4ASHA 1O2VA 4F49A 4O03A 5F6MA 2Y5FA 2GGVB 2VWLA 2ALVA 3BV9B 1GI3A 1SGQE 4WWYA 2Z7FE 1KXEA 4Y76A 1O5EH 3RXEA 2PKAB 1XXDA 5DG6A 3ESTA 4ZKOU 2GD4B 1FQ3A 1RD3B 5J4SA 1ZSLA 3TJVA 1FPHH 1AB9C 1O3PB 1S85A 2J95A 1C2MA 3M37A 4DGJA 4RKJB 1TX7A 1FXYA 1C5WB 1PPGE 2PUQH 1GCTB 3STJA 1QBNA 4UEHH 1EJAA 3AVZA 1W13U 4FUBA 1KLJH 1GMDG 3T26A 4F4OC 2PV9B 1O3IA 2AGGX 2OC0A 1YKTA 1YM0A 3EA7A 3S7HB 3BG4C 3M7UA 1BIOA 1QL8A 3BTTE 1LPZB 4BAMB 3ZV9A 2P3UB 4NZQA 1PJPA 2PSYA 4ZKNU 1W12U 3QZQA 1GBHA 1EPTA 2W3IA 2UUYA 3EE0B 4CBNA 1HAOH 1MTSA 2VH6A 3RU4T 4DJZB 4X1PU 2ZO3H 1W14U 2ZTZA 4NSYA 1OP0A 2VWNA 3K6YA 3LKWA 3FP7E 1O0DH 3ZVAA 2ZIQH 1EP6A 3UIRA 5EODA 1W7XH 3KEEA 1BA8B 1SFIA 4YT7H 1QQUA 3MNXA 1UTKA 3PWCA 1A61H 1YPLH 1LO6A 2ZGCA 1O2SA 1GBJA 3UUZA 1T31A 1IQFA 1UK3A 2ZNKH 1QL7A 1BT7A 3AASA 2BLVA 5C1XA 4DVAU 1S6FA 1YPMH 1A5GH 1IOEA 5A0BA 4AB8A 4NA9H 3BF6H 2ZI2H 2GP9B 3T28A 4JK5A 4R8TB 4AYYB 1RJXB 1TQ7B 1H8DH 3CS7A 4Y7BA 1O5FH 1N8OC 4ZAEA 1DX5M 2ZU5A 4K1TA 4FVBA 3RXLA 4Q80A 1Y5AT 2Z3CA 4CH2B 4MG3A 4AORA 2FOHA 1MTUA 2Z9LA 4HI3A 1VZQH 4J2YB 1ETSH 1J8AA 2VINA 5C1UA 1WV7H 2FIRH 1MBMA 1P2MA 1V3XA 4CRGA 3RU4E 1VCQA 3TJUA 2Y7ZA 3NK8A 1XXFA 1IQEA 1D6WA 2QCYA 3KF2A 3SU0A 1P2NA 3E91A 4I7YH 2IN2A 4CRCA 3OY6U 1T8MA 2IPHA 2FO9A 1GI5A 2B5TB 1RGQA 3BTGE 4X0WU 1FY3A 2JETB 3JZ1B 4X2YA 3R3GB 2OC1A 2J34A 3IITA 2ZGJA 2WV4A 3SHCH 1HB0B 3UNRA 3KGPA 4INHA 3RXCA 4H6SB 5DP3A 1JBUH 2JH0D 2ZDLA 2O8MA 3LGWA 1C1TA 1HBTH 2JKHA 2D26C 1DLEA 2FM2A 1C1NA 1BJVA 1CE5A 5F8TA 4MNVA 3ATLA 1G32B 2J2UA 2A5KA 3U8TH 3U98H 1C5XB 4WMFA 5FCRA 5E2OA 1BITA 1SGRE 3GY4A 3LT3A 3LGVA 5HM2A 3HK3B 4MLFB 1QFKH 4NIVA 2EEKA 1C4Y2 3TK5A 1Q3XA 1O3GA 2GT8A 2FDAA 8GCHF 4AZ2B 1SSXA 2QF3A 3C1KA 4I8GA 4IC5A 2VVCA 1SHHB 3W95A 1HAHH 3MNSA 1CBWB 1PFXC 2F91A 1P2JA 1GI6A 1SGPE 2ZF0H 4ZXXH 5T6FA 3OSYA 1ZMLA 1TA6A 3D62A 3TNSA 1NRQH 1OWEA 2B7DH 4JYUH 1HAVA 1K1NA 1BTHH 2O8WA 1QRZA 1SGEE 1FMGA 1GJDB 1NRPH 2ZCKP 2OINA 4K69A 1OX1A 1AWHB 1BBRE 1QTFA 4NFEA 4O97A 4X6OA 2C8WB 1YPEH 2Y80A 3M5MA 3A87A 3EAJA 4K1SA 1QRWA 4Y10E 1VITG 4IW4E 1NO9H 3ZZCA 3BTME 1K9OE 3IG6B 4UDWH 1FY8E 1LMWB 1TNHA 2TGDA 1CGJE 2ANMH 4ZROA 4BXWA 1LKBA 3U1JB 2Y6TA 3M36A 1SLXB 2XBXA 2BVXH 3RXIA 1TNJA 2Z94A 2BX3A 5CHAB 3ZV8A 1A2CH 1EAIA 3GY5A 3KQCA 3V0XA 1EB1H 1DXPA 3UPEA 2CN0H 1K22H 3LGTA 1EXFA 1NY22 4JYTA 3U1IB 1LQDB 4UFFH 1HDTH 1UHBA 5EQRA 1UCYK 4YZUA 2O8TA 2FOEA 2FODA 3OTJE 2GKVE 1BUIA 1P3CA 1Y3UA 1BMLA 5C3NA 4FUCA 1DM4B 1QNJA 3E0PB 1MD7A 2ZU4A 1SGDE 4D76A 1CGHA 1H9HE 1GJ5H 1ZPBA 2H9TH 3EGKH 3M3TA 4AFZA 5K0HA 1XX9A 3VB4A 1DUEA 1KYNA 1UVTH 3MTYA 3KIDU 1YCPH 4CRAA 3QK1A 1WOFA 1P11E 4Q2KA 4AN7A 3RXFA 7GCHF 2OQUA 2NU3E 3TITA 4BAKB 3UQOA 2TRMA 1DDJA 2H5DA 5TCAA 3MO3A 1IQHA 2ZCHP 1YPKH 1C5MD 1TGBA 2KAIB 2BD4A 3CS0A 4HGCA 1AZ8A 3G01A 3P8GA 1DLKB 1CT0E 2BZ6H 2ODYB 1RFNA 2P16A 1WAYB 1O2WA 4D7FA 3KQEA 5FPSA 1E38B 1JXPA 3GY3A 1P8VC 1A1RA 2ZC9H 5FX6A 1QA0A 2F9PA 3QLPH 2V3OH 1UTNA 3NCLA 3U8OH 3DHKH 1AB9B 3O8CA 3E8LA 1OWIA 2XXLA 4ZHMU 4I8HA 2J4IA 2Z9IA 5FCKA 1K1OA 1C2DA 1TPOA 3MH7A 5TCCA 1C1SA 1FY5A 3OU0A 2GZ7A 2PKAA 1OSSA 4DW2U 1C5OH 4JMYA 3RLYH 1SQAA 4MPXA 2BZAA 3UR6A 3BSQA 4JZEH 3A84A 2BHGA 4OS4A 3BG4B 3BN9A 2XYAA 3BTFE 1UVSH 2ANKH 2VIWA 5FBEA 3VFEA 1EX3A 1MAXA 9LPRA 1V2OT 3Q3XA 1LQEA 1O3MA 4IMZA 1A5HA 2C8YB 3QTVH 3MO6A 3F9HA 1ELGA 1JRSA 2GCHF 2Q1JA 2W7SA 4CHAC 3VB5A 4Y79A 1S84A 4AYVB 2XRCA 8KME2 1A0LA 3AW1A 1CGIE 1O2RA 1RXPA 2XCFA 3E3TA 4YO9A 3KNXA 3GY7A 3ATIA 3KCGH 1OWJA 5HMAA 1XUFA 5EPYA 5L2ZH 3V7TA 2BQ6B 4GCHF 4DG4A 5GWZA 1S6HA 2A7HA 2SGPE 2DE9A 4ISNA 2HLCA 2RDLA 3SQHE 3BEUA 4ZKSU 1ANEA 1GPZA 2ZTYA 1C2GA 1RRKA 3NZIA 4Q7ZA 3TGIE 4YT6H 1Y3XA 2QC2A 2H9HA 5FHTA 1TPSA 1P01A 2BDBA 1ESAA 2WV5A 5GPIB 1BRBE 1Z8RA 3ZZ8A 1HAZB 4DOQA 2ZTXA 1J14A 2I6SA 3ZZBA 1IQKA 1K1IA 1N8OB 5HM9A 2ILNA 2J9NA 1ZJDA 9ESTA 1E36B 5AF9H 1A3BH 1CT4E 1F0SA 1Q31A 3PLKA 3MNCA 2C3SA 1MTVA 2W3KA 3B8JA 2BM2A 2AMQA 3SU3A 4INKA 3SU2A 3UTUH 1TGNA 3ZZ9A 3QGNB 1AI8H 2WYJA 3QX5H 1ZGVA 2AMPA 1AN1E 5HGGA 3ATKA 5JBTA 4FXGH 1C2KA 4KKDA 1NT1A 1O2YA 1SOTA 1J17T 3RXJA 4SGBE 1W10U 4XE4A 1RTLA 2ZDNA 4BAOB 1M9UA 1EAWA 2F9BH 4CBOA 3RP2A 3RC5A 3RMMH 5E0GA 2VWOA 2A45B 1BTUA 4RKOB 4CR9A 1HXFH 2A4OA 1GBKA 2FX4A 1YP9A 3EQ0H 3BTKE 3PMHB 5DP9A 1SQOA 3D23A 3S7KB 1MTWA 1ELVA 1S0RA 2OP9A 1PPHE 2BDIA 3F1SB 1W8BH 1QCPA 1GI4A 3LGYA 3MOCA 5IDKA 1P06A 8GCHG 5ESBA 3RXUA 2V35A 2VU8E 3S9AA 3RXRA 1NFUA 2TGPZ 2G5NA 4A1XA 4JYVH 1EASA 1O2LA 1ELFA 1QB9A 3RXMA 4D9RA 1G3EA 1C1PA 1P03A 1V2TT 1O33A 2BY9X 3UY9A 1G3CA 4A7IB 1BMNH 4MPWA 5FX5A 1O37A 2QXHA 1ABIH 2R0LA 4NG9H 2D1JA 4BTUB 2YOLA 1O5BB 5A8ZA 1TGSZ 4AFSA 3T27A 2EI6A 1O3CA 1UK2A 1MKXK 1D9IA 1HLTH 2OTVA 4MQAA 1S82A 3K9XB 4YM9A 2HVXA 2CMYA 4RN6A 4ABHA 5PTPA 2A7JA 1O2TA 3A8DA 2XBVA 1GMHF 1GHBF 2FYQA 1ZMJA 2XBWA 4THNH 1QJ1B 1XVOA 4E05H 2BB4A 1ZHMA 2BX4A 1O34A 1O38A 2XWBI 1BRUP 1AO5A 1V2KT 1A4WH 1W0YH 2I6QA 2GDEH 2VJ1A 4ABIA 2F3CE 3Q76A 4BTTB 2D8WA 3LU9B 3M5LA 2A0QB 1MQ5A 3H7OA 1P04A 3SU5A 4AOQA 2FOFA 1EJNA 1W7GH 2C4FH 1ELCA 4MPUA 1BQYA 2BYAX 3QZRA 1QBVH 1O3JA 1FAXA 1HJ8A 3TLOA 3PO1C 3MU1A 1C4V2 3TH4H 3RM0H 1ETTH 1C5VA 1GGDC 4ABGA 3GISB 4HZHA 2G5VA 5AFYH 1UVPA 4MDSA 2G4TA 2BD7A 4Y8ZA 1D3TB 1Z8JB 1DSTA 1YPHC 4HTCH 2FP7B 1C5YB 3M61U 3U69H 1PQ7A 1A0HB 3F68H 5GDSH 3T62A 2Y82A 3SGAE 2ZFPH 5DP8A 1K1MA 1C9TA 1OXGA 1HIAB 1UK4A 2ZHDA 2XW9A 4DT7B 7GCHG 4E7RG 2SGEE 1P0SH 2Z3EA 1TOMH 4K60A 2THFB 5G4BA 1TABE 3MH5A 4Y8XA 3FZZA 4B73A 1TBRH 1GDUA 2ULLA 1EZQA 3A85A 1G2MA 1Z1JA 1EOJA 1NRRH 2BVSH 2QA9E 1L1GA 2H5CA 5JB9S 3SO3A 2AEIH 2VIVA 3LOXA 3N7OA 1IHSH 3URDA 1AVWA 2SNVA 1K2I1 5LPEA 3RC6A 2GX4A 1LHGH 1V2ST 4YLQH 1O3HA 4I8KA 3ATWA 1H4WA 5FPTA 4D8NA 3M35A 3IWMA 2VWMA 2P94A 1JWTA 1Z7KA 1W11U 4BTIB 3AW0A 3ZZ6A 1TONA 4WY3A 1C5RA 2PUXB 3CENA 2NU2E 1DWEH 1ARBA 1O2MA 1P10A 1SLVB 4AFQA 4D9QA 1LHFH 1UCYE 2UUJB 4ABDA 1TIOA 3SJIA 1BJUA 2F9VA 2ZDMA 1Z71A 1O2JA 1SLUB 1GVKB 2TIOA 4WH6A 4MPVA 1GHAF 3BTHE 2Y7XA 1H9LB 6CHAC 3RXHA 3A8AA 1NPMA 2ZGXH 6LPRA 4TWWA 1SBWA 1UTPA 1GWAA 1S0QA 3UWJH 2AGIX 4E7NA 3MHWU 2GCHG 2ZECA 3ODDA 4X2VA 1IQMA 1YCPK 2GV6A 1O3OA 4GHTA 1UTOA 1TBZH 1D3QB 1QB1A 5LPFA 2NU0E 2QAAA 2PGBB 1IQGA 1ANBA 1TMTH 3RXVA 3SW2B 2OCVB 4Q7YA 3ZVEA 4RSPA 4MTBA 1KY9A 2FOGA 4GCHG 1HGTH 3KL6A 4UFDH 4KTSA 3A7WA 4X1QU 4B76A 2ZPQA 2ZQ2A 3A88A 1YYY1 1AY6H 1DPOA 2Q6GA 3RU4D 2R3YA 1CO7E 1OWKA 2UWOA 3ZZ4A 4CHAB 1OP2A 1THSH 2FZZA 1GHVH 4GVUA 1K28D 3UFAA 1LVBA 2F9OA 4CRDA 1GJ6A 1ZJKA 3FZDA 2P95A 1XUGA 2QXIA 4NWLA 4WF8A 5JYIA 4UFEH 1XKBC 3SU4A 1G9IE 1GMCF 1VR1H 1QJ6B 1SVPA 3NUMA 5EXMA 1KIGH 1TX6A 2D2DA 1F7ZA 1NZQH 2VIPA 1LPGB 1IHTH 2HPPH 2ZHEH 4AX9H 2K1QA 1GJCB 3VPKA 1DITH 5AFZH 1UVUH 2CHAC 2AIQA 1V2JT 2PKSB 1DWBH 2AH4X 3B9FH 2ZDVH 2DE8A 3V13A 1WUNH 5E8EH 2HNTC 3Q77A 3FANA 1AD8H 4DIHH 1V2NT 3PMAB 3GDVA 1SGTA 3PB1E 2VNTA 1AIXH 4XOJA 1MCVA 3PROA 1TX8A 1O2PA 3RLWH 3HGNA 1TA2A 1TNIA 1YLCA 1HRTH 2RA0A 1E0FD 1Z6EA 3SJ9A 4B2AA 1KXCA 2FOAA 3B23B 4UE7H 1L4DA 3SORA 2XNIA 3GCTG 1F5RA 1ID5H 1O2UA 5JBBS 1TB6H 2TGAA 1LHCH 5T6DA 4UFGH 1O2KA 1DFPA 1AE5A 4U2WA 3HPTB 5A09A 1CT2E 4A5TS 1DSUA 3W94A 1X7AC 2M5TA 2XBYA 3GY2A 2OBQA 4XDEA 1ELBA 1TMBH 4BANB 1ZHRA 1B7XB 3ZZ7A 3FVFB 1ANDA 3P92A 3E0NB 3A7YA 1WU1A 4OGXA 3PWBA 2JH6D 2FLRH 1IQJA 3TPIZ 1TAWA 2G4UA 1C5PA 2G55A 1T4VH 2J94A 1TE0A 4ESTE 1TOCB 1E37B 4FUFA 4NIYA 4K5ZA 3K65B 5LGOA 1GBIA 4KP0A 4MVNA 2QGRA 4TPIZ 3DFLA 2FMJA 1O5CB 2H6MA 4NWKA 4QT8C 4R0IA 5C20A 4Y0ZE 1PYTC 7ESTE 3RDZA 1SGCA 1GMHG 1ABJH 1GHBG 1UTJA 2FXRA 1C2LA 3UNSA 3H7TA 1SGFG 3S69A 5FBIA 4GUXA 4U32A 1CSOE 3T5FH 3DT0H 2EC9H 4X1SU 4ABAA 2ZEBA 1TNKA 3ITIA 1GL1A 1DUAA 1YPHE 1FUJA 2F9UA 2FOMB 1O36A 1PQ5A 1UTLM 5ESTE 2FI3E 4Y6DA 1IQLA 1TFXA 1MCTA 3EA9A 4INLA 4KGAA 4YOGA 1F5LA 1CA0C 2SFAA 1G36A 4ZMAH 2GTBA 2TBSA 1K1PA 4ZHAA 3SV2H 1GJBB 2Q6DA 4K1EA 1ACBE 1P2QA 1NN6A 1HJAB 1PPBH 3F9FA 1PQ8A 3MU8A 5EQSA 2ZG0H 2ZFSA 1XUJA 3TH3H 2BDHA 3VXFH 3LGUA 1EOLA 3KHVA 3SN8A 3DD2H 1T8OA 3A7ZA 1LHEH 1WSSH 3PTBA 3ENSB 1NFXA 1C1QA 1WQSA 1BTZA 3PO1B 5A8YA 1F2SE 4FUGA 1KLIH 1SG8B 5GCHG 5A2MH 1GGDB 2GZ8A 1TLDA 5L30H 1O30A 4ABJA 2QXGA 1H8IH 3VXEH 1Y3WA 3LJOA 3MU4A 3ZZ5A 4XBDA 1HFDA 2OC7A 2A5AA 1CQQA 1ZYOA 2ZCLP 1F5KU 2F83A 4NA8A 5E2PA 3SUEA 4IN2A 1MAYA 1WBGB 4GPGA 1FDPA 1V2RT 1DT2A 4NIXA 2GV7A 2UUFB 1TRMA 4O3TA 3TGKE 3RXOA 2BY7X 1B0EA 1O3AA 2SGDE 5EQQA 1VGCC 5I46H 1C5ZB 1ANCA 4LXBH 2AYWA 3SUGA 3E16B 2AGEX 4XBBA 1T7CA 2G8TA 3ZZDA 1ARCA 1GI0A 4ZKRU 2WPHS 2EI7A 1ORFA 4ISLA 5EW2H 1NRNH 1ELTA 1HIAA 4WMDA 2ASUB 1TRNA 1C1VH 2FLBH 3MNBA 1BTXA 1EP5A 4KTUA 4CR5A 1IQIA 2J38A 5DJ7A 3QTOH 4FUDA 3A8BA 2ZFRH 1KDQB 3SI4H 1E34B 1ZMNA 1GJ9B 5JB8S 2WINI 4O3UA 4TY6A 4OS7A 2R0KA 3TU7H 5T3HA 2Y81A 1EQ9A 2PWXA 1YPJH 3P17H 1Z6JH 1GHAG 2ZPRA 1BDAA 3MYWA 4AGJA 4ABEA 1NTPA 2FI5E 1VJ9U 1UMAH 3ZVBA 1EKBB 1GHZA 1UJ1A 2R2MB 2EI8A 2ZDKA 4WXIA 1FY4A 1S81A 3R0FA 1GBEA 1IQNA 1VJAU 1TQ0B 1QBOA 1TGCA 2GVFA 1K1LA 3QUMP 1L1NA 3SV8A 1K1JA 2ALPA 2NU4E 2P3TB 1P12E 2VVUA 2GCTB 1G3DA 6CHAB 2ZHWH 1TBQH 2DUCA 5TJXA 3MH4A 2UWPA 2R3UA 2SGAA 3SI3H 3SNEA 3TH2H 5IYTA 1ZPCA 3GICB 1BMAA 1TWXB 3PTNA 1OP8A 4FUJA 1P2OA 2YNBA 3A86A 3TGJE 1AHTH 2PKSC 1HAYB 2ZQ1A 3LGIA 1O3LA 4Y0YE 1GHXH 4JZIA 2NU1E 3M5OA 1O3BA 2GMTB 3PM3A 2F9NA 1GMCG 1ZR0A 2HNTE 1AUJA 3RXPA 1A3EH 2PLXA 3DA9B 2BD2A 4J1YA 4OS5A 2VH0A 3UOPA 3RUOA 5JDUB 1P57B 4BAQB 4XBCA 4AGKA 1C9PA 1GJ7B 4XSKU 3I78A 1RTFB 1LPKB 2GT7A 3MI4A 2BD9A 3LH1A 1QURH 3KQDA 1O3DA 4WMEA 1QJ7B 3ZYEA 1SL3A 3GY6A 4X2XA 3SBKA 3RXAA 5I25A 2STAE 2UUKB 1LVYA 2ZFTA 4B74A 4X8SH 1LDTT 1BZXE 1NC6A 1UO6A 1FZZA 4GLYA 2LPRA 1S5SA 2PTNA 2G81E 4NSVA 2VIOA 4H6TA 1AZZA 1XUHA 3GCTF 2FX6A 1LCYA 3A7XA 3HGPA 1AGJA 2BD5A 2WYGA 4OS1A 2ZHQH 2CHAB 3PMJA 4TYDA 3P95A 1MBQA 3RXBA 3A80A 3UQVA 1AKSB 2VB0A 3UREA 1CHOF 4FUHA 2BLQA 1T32A 4D7GA 1QIXB 4NIWA 3KN2A 3L3TA 3VB7A 2BVRH 3JZ2B 1ZZZA 4CH8B 1C2EA 1RIWB 1MZDA 3AAVA 1O3EA 1GDNA 5EXLA 3A82A 4FU8A 1O3FA 1HJ9A 3MMGA 2B8OH 2Z3DA 3M5NA 2RG3A 1YLDA 3S9BA 1O3KA 3RMLH 1FAKH 1J9CH 1P2IA 5F8XA 4DURA 5K7RA 1FJSA 2NWNA 3SV7A 3RC4A 1GVZA 4K8BA 2WPIS 2CV3A 1NM6A 1ETRH 5EW1H 3LIWA 1BRCE 2XTTB 3LONA 1GG6C 1ESTA 2FYRA 2P8OC 4FU9A 1L1JA 2HPQH 1DICA 3UR9A 2FTMA 4FUEA 1C5QA 1UHBB 3ATMA 3MH6A 4BOHA 1KXBA 1MKWH 1TGTA 1GHYH 2H2ZA 2WUBA 1AVGH 2ANYA 4X6PA 2STBE 4AB9A 1C5NH 1O2XA 1HJAC 1ELDE 2XC4A 2A2XH 4GHQA 2IJOB 3LJJA 1SGIB 2ZZUH 1MTNB 3E1XB 1BRAA 3KQBA 3TIUA 1MQ6A 1PPZA 3MU0A 1W2KH 4E06H 3SUDA 1J15A 3U9AH 2AS9A 4XFQA 1SQTA 3T29A 2BOHB 5DP6A 3RXSA 4I33A 2BY8X 3GCNA 4ZXYH 3FAOA 2PR3A 4I32A 1T4UH 2ANWA 4X6NA 4JZDH 3M7TA 4FUIA 3LC5A 3QGJA 4IBLH 4Q7XA 2RCEA 2ZWLH 1Y3YA 1MU6B 1EPTC 1SGFA 2QN5T 1NFYA 1OYQA 5B6OA 2BMGB 5GCHF 1O2IA 1AE8H 2O8LA 2ZFQH 3DUXH 2Z9JA 1CA0B 2OQ5A 1G30B 1K21H 1GBMA 3SV9A 2P3FH 1AFEH 1D4PB 3C27B 3SU6A 1VITH 4I31A 1CA8B 1GBBA 2B0FA 3TK6A 1XUIA 1QR3E 1FNIA 1OYTH 1RTKA 3H5CB 1GJAB 4BAHB 1GL0E 2FOCA 3NKKA 3EDXB 5LH8A 2ODQA 5CMXH 2AERH 5GXPA 1LVMA 4JK6A 2ESTE 1DXWA 5DGJA 3ZVDA 1OOKB 1WTGH 1AWFH 2WPMS 1EZUC 2FEQH 1G3BA 1V6DA 1O5DH 2PTCE 5ETXA 3SHAH 4B2CA 3DFJA 1T8NA 2AMDA 2WPJS 1Z8GA 1BHXB 3TJOA 3VB6A 1Y8TA 3BTWE 1JIMA 1O2OA 2HWLB 5BRRE 4SGAE 2BTCE 2OBOA 1P3EA 1GI7B 1NESE 3MU5A 3QN7A 3LPRA 6GCHG 1QHRB 4YESB 3E6PH 3P8FA 1XUKA 1BBRH 1UVOA 4JCNA 4K8YA 2O8UA 3GCHC 4H4FA 3SZNA 2FI4E 1VGCB 2KAIA 3WY8A 3O8BA 3S0NA 1BMMH 2FWWA 2GCTC 5C5OA 2W5EA 1TYNA 1V2MT 1ZTLA 1KSNA 4YOIA 1O35A 1SI5H 1NU7B 3MO9A 1THPB 4FU7A 1ZTJA 4ZH8A 1Y3VA 5HXFA 3ZVCA 5A0CA 2ZHFH 1Z1IA 5AVDA 2AIPA 1D6RA 2GMTC 1IAUA 1P2KA 2ZGBH 3A81A 4FVDA 3SGBE 3GYMA 3NPSA 1DWCH 1P02A 3A7VA 2A4QA 1GBDA 1W0ZU 4BNRA 4YOJA 3A8CA 1KDQA 4LK4A 1YF4A 3OYPA 1AUTC 1C4U2 1EAXA 3A83A 3TNTA 1TMUH 3QO6A 5CE1A 1ZSJA 4DY7B 1A5IA 1QQ4A 5EGMA 3GYLB 1GBFA 2V6NA 3I77A 4B71A 2BXTH 1KTTB 2A2QH 2CXVA 1V2VT 3PLPA 4IGDA 1C5TA 1KLTA 2ZPSA 2A4RA 3ELAH 3RMOH 1HAGE 1AFQC 1LHDH 3P8OA 1SFQB 3GOVB 2BOKA 2A4GA 1AMHA 2WPKS 3RXKA 2BDCA 4A1TA 3SGQE 1GI2A 1A0JA 1F0TA 4ABBA 2ZDAH 3FP8E 1YCPM 1MKXH 1GBCA 4MNXA 3S9CA 4TY7A 1DS2E 1GBLA 2PHBA 1C1MA 1HPGA 4Z6AH 1DWDH 1C2HA 4NCYA 2Y5GA 2CJIA 1KXAA 3SNCA 1RIWC 2CF9H 1GI1A 1C1OA 1O3NA 5HYOA 1OWHA 1ZGIA 1G37A 2A7CA 3PV4A 3RM2H 1GI9B 3D49H 1C5SA 5DK1A 3BTDE 3A7TA 2PSXA 5EOKA 1AQ7A 1O39A 4JZ1A 1PPCE 1CHOG 1GHWH 1ZRKA 4IC6A 1BTWA 4JZFH 1O5AB 4WJG2 1O2ZA 4TPYA 2HALA 1NROH 2HNTF 1SGYE 1BB0B 3Q00A 1GDQA 2A1DB 1L4ZA 1E35B 3BTEE 4ZUHA 1ZSKA 1C2IA 2J92A 2BDGA 1DE7H 3HATH 1P9SA 4B2BA 1SOZA 1B0FA 2QV1A 4X8TH 4LZ4B 3NWUA 3A89A 3P70B 1GBAA 3M3VA 5E0JA 1N6XA 3ZYDA 1QY6A 3F6UH 1INCA 1DOJA 2BLWA 2RA3A 4LOYH 5EXNA 1P05A 1U6QA 5A0AE 1MTNC 4Y7AA 1C2FA 4A1VA 2ZU2A 1YGCH 1SMFE 3EA8A 1HYLA 1TNLA 2PGQB 1AKSA 5FPYA 1XKAC 1MD8A 2R2WU 4IS5A 3LH3A 2BD3A 1EAUA 4Y71A 1C2JA 2C93B 3LDXH 5JBCS 2QYIA 1NRSH 1SC8U 1AU8A 1HUTH 3SUFA 3TK9A 1NU9A 3OX7U 1D3DB 4X1RU 8LPRA 3T2NA 3VGCC 3SV6A 3K2UA 1WTHD 2FTLE 1ESBA 4IN1A
chains in the Genus database with same CATH superfamily
1YBWA 2BXUH 2VGCB 2ZP0H 3ZVGA 1GG6B 1OWDA 1H1BA 2P8OB 5C1YA 5L2YH 1SHYA 4ISHH 5BPEA 1BTPA 5F03A 3VG8A 3Q3KA 1P09A 2BY6X 1ZTKA 1ZLRA 3M7QA 2CF8H 2BLOA 2C8XB 3PYHA 3VB3A 1FI8A 2C8ZB 5A8XA 4NGAH 2Y5HA 4BXSA 3HKIB 2HLDD 5DP4A 2HGTH 4I8LA 5H4IB 1OPHB 4CRFA 2VIDA 2V0BA 3L6PA 4Y8YA 1YPGH 1LTOA 2GZ9A 4Q63A 5JBAS 1FN6A 1HXEH 5JPMH 1FIZA 1SGNE 1TPAE 1ZHPA 2FPZA 3HK6B 2TGTA 1HNEE 1ZPZA 3CP7A 1S83A 1TNGA 1C1RA 1GCTC 3GDSA 1V2PT 1MH0A 2ZGHA 5KECA 4VGCB 4AFUA 4X6MA 3U8RH 3V12A 2XC5A 3SYJA 5DO4H 1EPTB 2B9LA 1DANH 1ZRBA 4NFFA 1OKXA 2P93A 4MNYA 2CGAA 2AFQB 2CK3D 4X2WA 2ZKSA 3URCA 5L6NH 3BEFB 2YMSD 1JOUB 5DP7A 1MKWK 4LZ1H 1SLWB 4MNWA 5T6GA 5FAHA 1WYKA 4PROA 2FOBA 3GCOA 1B5GH 5C17A 3BG8A 3EYDA 2QE7D 2HOBA 1XVMA 1GMDF 2ZFFH 4K3JA 2QIQA 1WCZA 1BHXF 4ZHLU 1FV9A 1L0ZA 1F92A 2BDYA 3O8RA 1FX0B 3RXGA 6GCHF 2BDAA 2WPLS 2UWLA 1FY1A 3T25A 2G51A 1QRXA 2LNCA 2PW8H 1OS8A 2JH5D 3I29A 3ZVFA 5C5NA 3E90B 3F9EA 2G00A 1FN8A 3O8DA 1SPJA 1O5GH 1F0UA 4OS2A 1HCGA 1W0KD 4FETA 2P59A 1AVXA 1GJ4H 5CHBA 4CRBA 2ZA5A 2QF0A 1W3CA 1C5UA 1EJMA 4B75A 1EB2A 3QDZB 2GDDA 2Z9GA 1HAIH 3GCHB 4ISIH 4NA7A 5DPAA 1KXFA 1DY9A 2C90B 2QXJA 6ESTA 4DIIH 2BY5X 2BD8A 3RXDA 3OY5U 4WH8A 1WQVH 2Z6BD 1C5LH 1F0RA 2L6OA 1A46H 2SNWA 5C2ZA 3MFJA 2EA3A 2QY0B 4X1NU 4KELA 1Y5BT 2G52A 1Y59T 3BTQE 4RT1A 3Q3YA 2A5IA 3SOSA 3FFGA 2H1UA 8ESTE 3BIUH 1P9UA 4P02A 2JETC 2XCNA 1EFRD 4OGYA 2SGQE 4I8JA 5GJ4B 5C67A 1LKAA 2TPIZ 2O9QA 3BIVH 1BOQA 1THRH 3LC3A 5EU8A 1TALA 2K0QA 2ZU1A 4AG1A 1V2UT 3ZZ3A 4AG2A 4UONA 1VCPA 1KTSB 3P6ZB 1MZAA 1TPPA 4KTCA 3OFND 1O2HA 1QA7A 2FS8A 1BBRK 2W7UA 3D65E 5ABWA 1GVLA 1YC0A 2XC0A 4O9VA 1PQAA 2V3MA 5E0HA 1HV7A 3PMBB 2OC8A 1EZSC 2FESH 1AFQB 5FXLA 2HRVA 1QGFA 2W26A 4K2YA 2PFEA 1JIRA 4X8VH 1XMNB 1EUFA 4HFPB 3UNQA 1A7SA 2KCYA 2BQWB 3FP6E 4U01A 1HAVB 1GCDA 5EPNA 3SJOA 3TVJB 1V2QT 3ODFA 5SGAE 2FS9A 1LVOA 5EJZA 1O2GH 4NZLA 1J16A 1CBWC 1EZXC 2ODPA 4TWYA 3K6ZA 1COWD 1FONA 4UD9H 2Q6FA 1BTYA 1T8LA 3AAUA 1HAXB 3FO8D 4GSOA 1JRTA 1PYTD 1NS3A 4M7GA 1C1UH 1FPCH 1UCYH 2ZU3A 1GI8B 3SU1A 1CHGA 4YTAA 3UWIA 1MMJN 3F9GA 1ZOMA 3M3SA 2OUAA 3NXPA 1RS0A 1EATA 1PPFE 1N6YA 1XM1A 4ABFA 2OXSA 4Z0KA 1HAPH 4OS6A 3BEIB 1DY8A 1O2QA 2YNAA 3VEQB 4WXVA 2VGCC 2IOTA 1O2NA 1VCWA 1UTQA 3V3MA 1O32A 2OLGA 2A31A 3L33A 2OD3B 3SNBA 1TRYA 1Y5UT 3OE7D 3RXTA 4OM9A 4IMQA 5CHAC 4B1TA 1ELEE 1GBTA 2H9EH 1Q2WA 1D3PB 4WVPE 4U30A 3GDUA 1VITF 3RXQA 5EG4A 2VVVA 3OEHD 5F8ZA 4CREA 2JJ2D 2SGFE 2VIQA 1KXDA 3QWCH 1MUEB 3PLBA 5DKMA 4GAWA 1PPEE 3SQEE 3SNDA 3GY8A 1H9IE 4DCDA 3P8NA 1QB6A 3ZZAA 1SR5C 1BCUH 1DVAH 1V2WT 1V2LT 4YLUA 4X8UH 3SNAA 1FLEE 1GJ8B 4H42U 2R9PA 1Z8IB 5AHGH 3RMNH 5GIBA 3TJNA 1ELAA 3VGCB 2V3HH 4VGCC 5J4QA 3HKJB 3STIA 7LPRA 1CVWH 1O31A 2Z9KA 2XWAA 1MU8B 4ISOA 2BQ7B 4A6LA 1N1LA 1C1WH 5DP5A 1JMOH 3SJ8A 1G2LA 1NFWA 1UTMA 3SJKA 1CU1A 3UOUA 4Y11E 1QL9A 5LPRA 1L2EA 1FIWA 1SB1H 2A32A 4A92A 7KMEH 2WUCA 3MWIU 4ASHA 1O2VA 4F49A 4O03A 5F6MA 2Y5FA 2GGVB 2VWLA 2ALVA 3BV9B 1GI3A 3H09A 1SGQE 4WWYA 2Z7FE 1MABB 1KXEA 4Y76A 2KM0A 1O5EH 3RXEA 2PKAB 1XXDA 5DG6A 3ESTA 4ZKOU 2GD4B 1FQ3A 1RD3B 5J4SA 1ZSLA 3TJVA 1FPHH 1AB9C 1O3PB 1S85A 2J95A 1C2MA 3M37A 4DGJA 4RKJB 1TX7A 1FXYA 1C5WB 1PPGE 2PUQH 1GCTB 3STJA 1QBNA 4UEHH 1EJAA 3AVZA 1W13U 4FUBA 2VBCA 1KLJH 1GMDG 3T26A 4F4OC 2PV9B 1O3IA 2AGGX 2OC0A 1YKTA 1YM0A 2L74A 3EA7A 3S7HB 3BG4C 3M7UA 1BIOA 1QL8A 3BTTE 1LPZB 4BAMB 3ZV9A 2P3UB 4NZQA 1H8HD 1PJPA 2PSYA 4ZKNU 1W12U 3QZQA 1GBHA 1EPTA 2W3IA 2UUYA 3EE0B 4CBNA 1HAOH 1MTSA 2VH6A 3RU4T 4DJZB 4X1PU 2ZO3H 1W14U 2ZTZA 1WDIA 4NSYA 1OP0A 2VWNA 2WPDD 3K6YA 3LKWA 4M9FA 3FP7E 1O0DH 3ZVAA 2ZIQH 1EP6A 3UIRA 2F4LA 1W7XH 3KEEA 5EODA 1BA8B 1SFIA 4YT7H 1QQUA 2EY4C 3MNXA 4ACBA 1UTKA 3PWCA 1A61H 2AHME 1YPLH 1LO6A 2ZGCA 1O2SA 5T1VA 1GBJA 3UUZA 1T31A 1IQFA 1UK3A 3FKSD 2ZNKH 1QL7A 1BT7A 3AASA 2BLVA 5C1XA 4DVAU 1S6FA 1YPMH 1A5GH 1IOEA 5A0BA 4AB8A 4NA9H 3BF6H 2ZI2H 2GP9B 3T28A 4JK5A 4R8TB 4AYYB 1RJXB 1TQ7B 1H8DH 3CS7A 4Y7BA 1O5FH 1N8OC 4ZAEA 1DX5M 2ZU5A 4K1TA 4FVBA 3RXLA 4Q80A 1Y5AT 2Z3CA 4CH2B 4MG3A 4AORA 2FOHA 1MTUA 2Z9LA 4HI3A 1VZQH 4J2YB 1ETSH 1J8AA 2VINA 5C1UA 1WV7H 2FIRH 1MBMA 1P2MA 1V3XA 4CRGA 3RU4E 1VCQA 3TJUA 2Y7ZA 3NK8A 1XXFA 1IQEA 1D6WA 2QCYA 3KF2A 3SU0A 1P2NA 3E91A 4I7YH 2IN2A 4CRCA 3OY6U 1T8MA 2IPHA 3F0PA 2FO9A 1GI5A 2B5TB 1RGQA 3BTGE 4X0WU 1FY3A 2JETB 3GS9A 3JZ1B 4X2YA 3R3GB 2OC1A 3DCLA 2J34A 3IITA 2ZGJA 2WV4A 4XRNA 3SHCH 1HB0B 3UNRA 3KGPA 4INHA 2GJGA 3RXCA 4H6SB 5DP3A 1JBUH 2JH0D 2ZDLA 2O8MA 3LGWA 1C1TA 1HBTH 2JKHA 2D26C 2K8IA 1DLEA 2FM2A 1C1NA 1BJVA 1VKYA 1CE5A 5F8TA 4MNVA 3ATLA 1G32B 4Z1MD 2J2UA 2A5KA 3U8TH 4ACAA 3U98H 1C5XB 4WMFA 5FCRA 5E2OA 1BITA 1SGRE 3GY4A 3LT3A 3LGVA 5HM2A 3HK3B 4MLFB 3SZEA 1QFKH 4NIVA 2EEKA 3OTPA 1C4Y2 3TK5A 1Q3XA 2PP6A 1O3GA 2GT8A 2FDAA 8GCHF 4AZ2B 1SSXA 2JJ1D 2QF3A 3C1KA 4I8GA 4IC5A 2VVCA 1SHHB 3W95A 1HAHH 3MNSA 1CBWB 1PFXC 2F91A 1P2JA 1GI6A 1SGPE 2ZF0H 4ZXXH 5T6FA 3OSYA 1ZMLA 1TA6A 3D62A 3TNSA 1NRQH 1OWEA 2B7DH 4JYUH 1HAVA 1K1NA 1BTHH 2O8WA 1QRZA 1SGEE 1FMGA 1GJDB 1NRPH 2ZCKP 2KFWA 2OINA 1OX1A 4K69A 1AWHB 1BBRE 1QTFA 4NFEA 4O97A 4X6OA 2C8WB 1YPEH 2Y80A 3M5MA 3A87A 3EAJA 4K1SA 1QRWA 4Y10E 1VITG 4IW4E 1NO9H 3ZZCA 3BTME 1K9OE 3IG6B 4UDWH 1FY8E 1LMWB 4B6FA 1TNHA 2TGDA 1CGJE 2ANMH 4ZROA 4BXWA 1LKBA 3U1JB 2Y6TA 3M36A 1SLXB 2XBXA 2BVXH 3RXIA 1TNJA 2Z94A 2BX3A 5CHAB 3ZV8A 1A2CH 1EAIA 3GY5A 3KQCA 3V0XA 1EB1H 1DXPA 3UPEA 2CN0H 1K22H 3LGTA 2W6JD 1EXFA 1NY22 4JYTA 3U1IB 1LQDB 4UFFH 1HDTH 1UHBA 5EQRA 1UCYK 4YZUA 2O8TA 2FOEA 2FODA 3OTJE 2GKVE 1BUIA 1P3CA 1Y3UA 1BMLA 5C3NA 4FUCA 1DM4B 1QNJA 3E0PB 1MD7A 3DSOA 2ZU4A 1SGDE 4D76A 1CGHA 1H9HE 1GJ5H 1ZPBA 2H9TH 3EGKH 3M3TA 4AFZA 5K0HA 1XX9A 2IJD1 3VB4A 1DUEA 1KYNA 1UVTH 3MTYA 3KIDU 1YCPH 4CRAA 3QK1A 1WOFA 1P11E 4Q2KA 4AN7A 3RXFA 7GCHF 2OQUA 2NU3E 3TITA 4BAKB 3UQOA 2TRMA 1DDJA 2H5DA 5TCAA 3MO3A 1IQHA 4FOUC 2ZCHP 1YPKH 1C5MD 1TGBA 2KAIB 2BD4A 5C0UA 3CS0A 4HGCA 1AZ8A 3G01A 3P8GA 1DLKB 1CT0E 2BZ6H 2ODYB 4HG6A 1RFNA 2P16A 1WAYB 1O2WA 4D7FA 3KQEA 5FPSA 1E38B 1JXPA 3GY3A 1P8VC 1A1RA 2ZC9H 5FX6A 1QA0A 2F9PA 3QLPH 2V3OH 1UTNA 3NCLA 3U8OH 3DHKH 1AB9B 3O8CA 3E8LA 2IPQX 1OWIA 2XXLA 4ZHMU 4I8HA 2J4IA 2Z9IA 5FCKA 1K1OA 1C2DA 1TPOA 3MH7A 5TCCA 1C1SA 1FY5A 3OU0A 2GZ7A 2PKAA 1OSSA 4DW2U 1C5OH 4JMYA 3RLYH 1SQAA 4MPXA 2BZAA 3UR6A 3BSQA 4JZEH 3A84A 2BHGA 4OS4A 3BG4B 3BN9A 2XYAA 3BTFE 1UVSH 2ANKH 2VIWA 5FBEA 3VFEA 1EX3A 1MAXA 9LPRA 1V2OT 5HIZA 3Q3XA 1LQEA 1O3MA 4IMZA 1A5HA 2C8YB 3QTVH 3MO6A 3F9HA 5HIYA 1ELGA 1JRSA 2GCHF 2Q1JA 2W7SA 4CHAC 3VB5A 4Y79A 1S84A 4AYVB 2XRCA 8KME2 1A0LA 3AW1A 1CGIE 2WV9A 4RI0A 1O2RA 1RXPA 2XCFA 3E3TA 4YO9A 3KNXA 2J98A 3GY7A 3ATIA 3KCGH 1OWJA 5HMAA 1XUFA 5EPYA 5L2ZH 3V7TA 2BQ6B 4GCHF 4DG4A 5GWZA 1S6HA 2A7HA 2SGPE 2DE9A 4ISNA 2HLCA 2RDLA 3SQHE 3BEUA 4ZKSU 1ANEA 1GPZA 2ZTYA 1C2GA 1RRKA 3NZIA 4Q7ZA 3TGIE 4YT6H 1Y3XA 3F2GA 2QC2A 3KQ5A 2H9HA 5FHTA 1TPSA 1P01A 2BDBA 1ESAA 2WV5A 5GPIB 1BRBE 1Z8RA 3ZZ8A 1HAZB 4DOQA 2ZTXA 1J14A 2I6SA 3ZZBA 1IQKA 1K1IA 1N8OB 5HM9A 2ILNA 2J9NA 1ZJDA 9ESTA 1E36B 5AF9H 1A3BH 1CT4E 1F0SA 1Q31A 3PLKA 3MNCA 2C3SA 1MTVA 2W3KA 3B8JA 2BM2A 2AMQA 3SU3A 4INKA 3SU2A 3UTUH 1TGNA 3ZZ9A 3QGNB 1AI8H 2WYJA 3QX5H 1ZGVA 2AMPA 1AN1E 5HGGA 3ATKA 5JBTA 4FXGH 1C2KA 4KKDA 1NT1A 1O2YA 1SOTA 1J17T 3RXJA 4SGBE 1W10U 4XE4A 1RTLA 2ZDNA 4BAOB 1M9UA 1EAWA 2F9BH 4CBOA 3RP2A 3RC5A 3RMMH 5E0GA 2VWOA 2A45B 1BTUA 4RKOB 4CR9A 1HXFH 2A4OA 1GBKA 2FX4A 1YP9A 3EQ0H 3BTKE 3PMHB 5DP9A 1SQOA 3D23A 3S7KB 1MTWA 1ELVA 1S0RA 1W0JD 2OP9A 1PPHE 2BDIA 3F1SB 1W8BH 1QCPA 1GI4A 3LGYA 3MOCA 5IDKA 1P06A 8GCHG 5ESBA 3RXUA 2V35A 2VU8E 3S9AA 3RXRA 1NFUA 2TGPZ 3CNRA 2G5NA 4A1XA 2M2AA 4JYVH 1EASA 1O2LA 1ELFA 1QB9A 3RXMA 4D9RA 1G3EA 1C1PA 1P03A 1V2TT 1O33A 2BY9X 3PV5A 3UY9A 1G3CA 4A7IB 2RFKC 1BMNH 4MPWA 5FX5A 1O37A 2QXHA 1UW7A 1ABIH 2R0LA 3F0OA 4NG9H 2D1JA 4BTUB 2YOLA 1O5BB 5A8ZA 1TGSZ 4AFSA 3T27A 2EI6A 1O3CA 5EJ1A 1UK2A 2KZ4A 1MKXK 1D9IA 1HLTH 2OTVA 4MQAA 1S82A 3K9XB 4YM9A 2HVXA 2CMYA 4RN6A 4ABHA 5PTPA 2A7JA 1O2TA 1KMHB 3A8DA 2KCAA 2XBVA 1GMHF 1GHBF 2FYQA 1ZMJA 2XBWA 4THNH 1QJ1B 1XVOA 4E05H 2BB4A 1ZHMA 2BX4A 1O34A 1O38A 2XWBI 1BRUP 1AO5A 1V2KT 1A4WH 1W0YH 2I6QA 2GDEH 2VJ1A 4ABIA 2F3CE 3Q76A 4BTTB 2D8WA 3LU9B 3M5LA 2A0QB 1MQ5A 3H7OA 1P04A 3SU5A 4AOQA 2FOFA 1EJNA 1W7GH 2C4FH 1ELCA 3WW7A 4MPUA 1BQYA 2BYAX 3QZRA 1QBVH 1O3JA 1YY3A 1FAXA 1HJ8A 3TLOA 3PO1C 3MU1A 1C4V2 3TH4H 3RM0H 1ETTH 1C5VA 1GGDC 4ABGA 3GISB 4HZHA 2G5VA 1E1QD 1UVPA 4MDSA 5AFYH 2G4TA 2BD7A 4Y8ZA 1D3TB 1Z8JB 1DSTA 1YLNA 1YPHC 4HTCH 2FP7B 1C5YB 3M61U 3U69H 1PQ7A 5F53A 1A0HB 3F68H 2XNDD 5GDSH 3T62A 2Y82A 3SGAE 2ZFPH 5DP8A 1K1MA 1C9TA 1OXGA 1HIAB 3UAIC 1UK4A 2ZHDA 2XW9A 5DN6D 1SQRA 4DT7B 7GCHG 4E7RG 2SGEE 1P0SH 2Z3EA 1TOMH 4K60A 2THFB 5G4BA 1TABE 3MH5A 4Y8XA 3FZZA 4B73A 1TBRH 1GDUA 2ULLA 4RT0A 1EZQA 3A85A 1G2MA 1Z1JA 1EOJA 1NRRH 2BVSH 2QA9E 1L1GA 2H5CA 5JB9S 5KEDA 3SO3A 2AEIH 2VIVA 3LOXA 3N7OA 1IHSH 3URDA 1AVWA 2SNVA 5B6LA 1K2I1 5LPEA 3RC6A 2GX4A 1LHGH 1V2ST 4YLQH 4I86A 1O3HA 4I8KA 3ATWA 1H4WA 1SKYE 5FPTA 4D8NA 3M35A 3IWMA 2VWMA 2P94A 1JWTA 1Z7KA 3OAAD 1W11U 4BTIB 3AW0A 3ZZ6A 1TONA 4WY3A 1C5RA 2PUXB 3CENA 2NU2E 1DWEH 1ARBA 1O2MA 1P10A 1SLVB 4AFQA 4D9QA 1LHFH 1UCYE 2UUJB 4ABDA 1TIOA 3SJIA 1BJUA 2F9VA 2ZDMA 1Z71A 1O2JA 1SLUB 5HKKD 3N7EA 1GVKB 2TIOA 4WH6A 2YMSC 4MPVA 3DSPA 1GHAF 3BTHE 2Y7XA 1H9LB 6CHAC 3RXHA 3A8AA 1NPMA 2ZGXH 6LPRA 1NBMD 4TWWA 1SBWA 1UTPA 1GWAA 1S0QA 3UWJH 2AGIX 4E7NA 1NBME 3MHWU 5EIYA 2GCHG 2ZECA 3ODDA 4X2VA 1IQMA 1YCPK 2GV6A 1O3OA 4GHTA 1UTOA 1TBZH 1D3QB 1QB1A 2F43B 5LPFA 2NU0E 2QAAA 2PGBB 1IQGA 1ANBA 1TMTH 3RXVA 3SW2B 2OCVB 4Q7YA 3ZVEA 4RSPA 4MTBA 1KY9A 2FOGA 4GCHG 1HGTH 3KL6A 4UFDH 5C0TA 4KTSA 3A7WA 4X1QU 4B76A 2ZPQA 2ZQ2A 3A88A 1YYY1 1AY6H 1DPOA 2Q6GA 3RU4D 2R3YA 1CO7E 1OWKA 2UWOA 3ZZ4A 4CHAB 4DT4A 1OP2A 1THSH 2FZZA 1GHVH 4GVUA 1K28D 3UFAA 1LVBA 2F9OA 4CRDA 1GJ6A 1ZJKA 3FZDA 2P95A 1XUGA 2QXIA 4NWLA 4WF8A 5JYIA 1BMFD 4UFEH 1XKBC 3SU4A 1G9IE 1GMCF 1VR1H 1QJ6B 1SVPA 3NUMA 5EXMA 1KIGH 1TX6A 2D2DA 1F7ZA 1NZQH 2VIPA 2KCOA 1LPGB 1IHTH 2HPPH 2ZHEH 4AX9H 2K1QA 5GNDA 1GJCB 3VPKA 1DITH 5AFZH 1UVUH 2CHAC 2AIQA 1V2JT 2PKSB 1DWBH 2AH4X 3B9FH 2ZDVH 2DE8A 3V13A 2QF4A 1WUNH 5E8EH 2HNTC 3Q77A 3FANA 1AD8H 4DIHH 1V2NT 3PMAB 3GDVA 1SGTA 3PB1E 2VNTA 1AIXH 4XOJA 1MCVA 3PROA 1TX8A 1O2PA 3RLWH 3HGNA 1TA2A 1TNIA 1YLCA 1HRTH 2RA0A 1E0FD 1Z6EA 3SJ9A 4B2AA 1KXCA 2FOAA 3B23B 4UE7H 1L4DA 3SORA 2XNIA 3GCTG 1F5RA 1ID5H 1O2UA 5JBBS 4TSFD 1TB6H 2TGAA 1LHCH 5T6DA 4P00A 4ASUD 4UFGH 1O2KA 1DFPA 1AE5A 5FL7D 4U2WA 4TT3D 3HPTB 5A09A 1CT2E 4A5TS 1DSUA 3W94A 1X7AC 2M5TA 2XBYA 3GY2A 2OBQA 4XDEA 1ELBA 1TMBH 4BANB 1ZHRA 1B7XB 3ZZ7A 3FVFB 1ANDA 3P92A 3WWFA 3E0NB 3A7YA 1WU1A 4OGXA 3PWBA 2JH6D 2FLRH 1IQJA 3TPIZ 1TAWA 2G4UA 1C5PA 2G55A 1T4VH 2J94A 1TE0A 4ESTE 1TOCB 1E37B 4FUFA 4NIYA 4K5ZA 3K65B 5LGOA 1GBIA 4KP0A 4MVNA 2QGRA 4TPIZ 3DFLA 2FMJA 1O5CB 2H6MA 4NWKA 4QT8C 3KYFA 4R0IA 5C20A 4Y0ZE 1PYTC 7ESTE 3RDZA 1SGCA 1GMHG 1ABJH 1GHBG 1UTJA 2FXRA 1C2LA 3UNSA 3H7TA 1SGFG 3S69A 5FBIA 4GUXA 4U32A 1CSOE 3T5FH 3DT0H 2EC9H 4X1SU 4ABAA 2ZEBA 1TNKA 3ITIA 1GL1A 1DUAA 1YPHE 1FUJA 2F9UA 2FOMB 1O36A 1PQ5A 1UTLM 5ESTE 2FI3E 4Y6DA 1IQLA 1TFXA 1MCTA 3EA9A 4INLA 4KGAA 4YOGA 1F5LA 1CA0C 5KGOA 2QF5A 2SFAA 1G36A 4ZMAH 2GTBA 2TBSA 1K1PA 4ZHAA 3SV2H 1GJBB 2Q6DA 4K1EA 1ACBE 1P2QA 1NN6A 1E79D 1HJAB 1PPBH 3F9FA 1PQ8A 2W6ID 3MU8A 5EQSA 2ZG0H 2ZFSA 1XUJA 3TH3H 2BDHA 3VXFH 3LGUA 1EOLA 3KHVA 3SN8A 3DD2H 1T8OA 3A7ZA 1LHEH 1WSSH 3PTBA 3ENSB 1NFXA 1C1QA 1WQSA 1BTZA 3PO1B 5A8YA 1F2SE 4FUGA 1KLIH 1SG8B 5GCHG 5A2MH 1GGDB 2GZ8A 1TLDA 5L30H 1O30A 4ABJA 2QXGA 1H8IH 3VXEH 1Y3WA 3LJOA 3MU4A 3ZZ5A 4XBDA 1HFDA 2OC7A 5C94A 2A5AA 1CQQA 1ZYOA 2ZCLP 1F5KU 2F83A 4NA8A 5E2PA 3SUEA 4IN2A 1MAYA 1WBGB 4GPGA 1FDPA 1V2RT 1DT2A 2LELA 4NIXA 3UB0A 2GV7A 2UUFB 1TRMA 4O3TA 3TGKE 3RXOA 2BY7X 1B0EA 1O3AA 2SGDE 5EQQA 1VGCC 5I46H 1C5ZB 1ANCA 4LXBH 2AYWA 3SUGA 3E16B 2AGEX 4XBBA 1T7CA 2G8TA 3ZZDA 1ARCA 1GI0A 3F2FA 4ZKRU 5CDFE 2WPHS 2EI7A 1ORFA 4ISLA 5EW2H 1NRNH 1ELTA 4F55A 1HIAA 4WMDA 2ASUB 5IK2D 1TRNA 1C1VH 2FLBH 3MNBA 1BTXA 1EP5A 4KTUA 4CR5A 1IQIA 2J38A 5DJ7A 3QTOH 4FUDA 3A8BA 2ZFRH 1KDQB 3SI4H 1E34B 1ZMNA 1GJ9B 5JB8S 2WINI 4O3UA 4TY6A 4OS7A 2R0KA 3TU7H 5T3HA 2Y81A 1EQ9A 2PWXA 1YPJH 1QZ8A 3P17H 1Z6JH 1GHAG 2ZPRA 1BDAA 3MYWA 4AGJA 4ABEA 1NTPA 2FI5E 3U28C 1VJ9U 1UMAH 3ZVBA 1EKBB 1GHZA 1UJ1A 2R2MB 2EI8A 2ZDKA 4WXIA 1FY4A 1S81A 3R0FA 1GBEA 1IQNA 1VJAU 2KCPA 1TQ0B 1QBOA 1TGCA 2GVFA 1K1LA 3QUMP 1L1NA 3SV8A 1K1JA 2ALPA 2YMSB 2NU4E 2P3TB 1P12E 2VVUA 2EQNA 2GCTB 1G3DA 6CHAB 2ZHWH 1TBQH 2DUCA 3EE7A 5TJXA 3MH4A 2UWPA 2R3UA 2SGAA 3SI3H 3SNEA 3TH2H 5IYTA 1ZPCA 3GICB 1BMAA 1TWXB 3PTNA 1OP8A 4FUJA 1P2OA 2YNBA 3A86A 3TGJE 1AHTH 2PKSC 1HAYB 2ZQ1A 3LGIA 1O3LA 4Y0YE 1GHXH 4JZIA 2NU1E 3M5OA 1O3BA 2GMTB 3PM3A 2F9NA 1GMCG 1ZR0A 2HNTE 1AUJA 3RXPA 1A3EH 2PLXA 3DA9B 2BD2A 4J1YA 4OS5A 2VH0A 3UOPA 3RUOA 5JDUB 1P57B 4BAQB 4XBCA 4AGKA 1C9PA 1GJ7B 4XSKU 3I78A 1RTFB 1LPKB 2GT7A 2LP6A 3MI4A 2BD9A 3LH1A 1QURH 3KQDA 1O3DA 4WMEA 1QJ7B 3ZYEA 1SL3A 3GY6A 4X2XA 3SBKA 3RXAA 5I25A 2STAE 2UUKB 1LVYA 2ZFTA 4B74A 4X8SH 1LDTT 1BZXE 1NC6A 1UO6A 1FZZA 4GLYA 2LPRA 1S5SA 2PTNA 2G81E 4NSVA 2VIOA 4H6TA 1AZZA 1XUHA 3GCTF 2FX6A 1LCYA 3A7XA 3HGPA 1AGJA 2BD5A 2WYGA 4OS1A 2WZQA 2ZHQH 3OEED 2CHAB 3PMJA 4TYDA 3P95A 1MBQA 3RXBA 3A80A 3UQVA 1H8ED 1AKSB 2VB0A 3UREA 1CHOF 4FUHA 2BLQA 1T32A 4D7GA 1QIXB 4NIWA 3KN2A 3L3TA 3VB7A 2BVRH 3JZ2B 3KYGA 1ZZZA 4CH8B 1C2EA 1RIWB 1MZDA 3AAVA 1O3EA 1K0HA 1GDNA 5EXLA 3A82A 3F3BA 1O3FA 4FU8A 1HJ9A 4YXWD 4B6EA 2HVYB 3MMGA 2B8OH 2Z3DA 3M5NA 2RG3A 1YLDA 3S9BA 1O3KA 3RMLH 1FAKH 1J9CH 1P2IA 5F8XA 4DURA 5K7RA 1FJSA 2NWNA 3SV7A 3RC4A 1GVZA 4K8BA 2WPIS 2CV3A 1NM6A 1ETRH 5EW1H 3LIWA 1BRCE 2XTTB 3LONA 1GG6C 1ESTA 2FYRA 2P8OC 4FU9A 1L1JA 2HPQH 1DICA 3UR9A 2FTMA 4FUEA 1C5QA 1UHBB 3ATMA 3MH6A 3W1EA 4BOHA 1KXBA 1MKWH 1TGTA 1GHYH 2H2ZA 2WUBA 1AVGH 2ANYA 4X6PA 2STBE 2KX4A 4AB9A 1C5NH 1O2XA 1HJAC 1ELDE 2XC4A 2A2XH 4GHQA 2IJOB 3LJJA 1SGIB 2ZZUH 1MTNB 3E1XB 1BRAA 3KQBA 3TIUA 1MQ6A 1PPZA 3MU0A 1W2KH 4E06H 3SUDA 1J15A 3U9AH 2AS9A 4XFQA 1SQTA 3T29A 2BOHB 5DP6A 3RXSA 4I33A 2BY8X 2WHXA 3PRDA 4Q4LA 3GCNA 4ZXYH 3FAOA 2PR3A 4I32A 1T4UH 2XOKD 3AK5A 2ANWA 4X6NA 4JZDH 3M7TA 4FUIA 3LC5A 3QGJA 4IBLH 4Q7XA 2RCEA 2ZWLH 1Y3YA 1MU6B 1EPTC 1SGFA 2QN5T 2J5UA 1NFYA 1OYQA 5B6OA 2BMGB 5GCHF 1O2IA 1AE8H 2J97A 2O8LA 2ZFQH 3DUXH 2Z9JA 1CA0B 2OQ5A 1G30B 1K21H 1GBMA 3SV9A 2P3FH 1AFEH 1D4PB 3C27B 3SU6A 1VITH 4I31A 3NRLA 1CA8B 1GBBA 2B0FA 3TK6A 1XUIA 1QR3E 1FNIA 1OYTH 1RTKA 3H5CB 1GJAB 4BAHB 1GL0E 2FOCA 3NKKA 3EDXB 5LH8A 2ODQA 5CMXH 2AERH 5GXPA 1LVMA 4JK6A 2ESTE 1WXRA 1DXWA 2KR7A 5DGJA 3ZVDA 1OOKB 1WTGH 1AWFH 2WPMS 1EZUC 2FEQH 1G3BA 1V6DA 1O5DH 2PTCE 5ETXA 3MQKC 3SHAH 4B2CA 3DFJA 1T8NA 2AMDA 2WPJS 1Z8GA 1BHXB 3TJOA 3VB6A 1Y8TA 3BTWE 1JIMA 1O2OA 2HWLB 5BRRE 4SGAE 2BTCE 3DSGA 2OBOA 1P3EA 1GI7B 1NESE 3MU5A 3QN7A 3LPRA 6GCHG 1QHRB 4YESB 3E6PH 3P8FA 1XUKA 1BBRH 1UVOA 4JCNA 4K8YA 2J98B 2O8UA 3GCHC 4H4FA 3SZNA 2FI4E 1VGCB 2KAIA 3WY8A 3O8BA 3S0NA 1BMMH 2FWWA 1YWUA 2GCTC 5C5OA 2W5EA 1TYNA 1V2MT 1ZTLA 1KSNA 4YOIA 1O35A 3N99A 1SI5H 1NU7B 3MO9A 1THPB 3WWBA 2JDID 4FU7A 1ZTJA 4ZH8A 1Y3VA 5HXFA 3ZVCA 5A0CA 2ZHFH 1Z1IA 5AVDA 2AIPA 1D6RA 2GMTC 1IAUA 1P2KA 2ZGBH 3A81A 4FVDA 3SGBE 3GYMA 3NPSA 1DWCH 1P02A 3A7VA 2A4QA 1GBDA 1W0ZU 4BNRA 4YOJA 3A8CA 1KDQA 4LK4A 1YF4A 3OYPA 1AUTC 1C4U2 1EAXA 3A83A 3TNTA 1TMUH 3QO6A 5CE1A 1ZSJA 4DY7B 1A5IA 1QQ4A 5EGMA 3GYLB 1GBFA 2V6NA 3I77A 4B71A 2JIZD 2OK5A 2BXTH 1KTTB 2A2QH 2CXVA 3PRBA 1V2VT 3PLPA 4IGDA 1C5TA 1KLTA 2ZPSA 2A4RA 3ELAH 3RMOH 1HAGE 1AFQC 1LHDH 3P8OA 1SFQB 2WSSD 3GOVB 2BOKA 2A4GA 1AMHA 2WPKS 4F48B 3RXKA 2BDCA 4A1TA 3SGQE 1GI2A 1A0JA 1F0TA 4ABBA 2ZDAH 3FP8E 1YCPM 1MKXH 1GBCA 4MNXA 3S9CA 4TY7A 1DS2E 4ZCNA 1GBLA 2PHBA 1C1MA 1HPGA 4Z6AH 1DWDH 1C2HA 4NCYA 2Y5GA 2CJIA 1KXAA 3SNCA 1RIWC 3F2HA 2CF9H 1GI1A 1C1OA 4AC9A 1O3NA 5HYOA 1OWHA 1ZGIA 1G37A 2A7CA 3PV4A 3RM2H 1GI9B 3D49H 1C5SA 5DK1A 5DSFA 3BTDE 3A7TA 2PSXA 5EOKA 1AQ7A 1O39A 4JZ1A 1PPCE 1CHOG 1GHWH 1ZRKA 4IC6A 1BTWA 4JZFH 1O5AB 4WJG2 1O2ZA 4TPYA 2HALA 3FN8A 1NROH 2HNTF 1SGYE 3FOAA 1BB0B 1OHHD 3Q00A 1S6LA 1GDQA 2A1DB 1L4ZA 1E35B 3BTEE 4ZUHA 1ZSKA 1C2IA 2J92A 2RDEA 2BDGA 1DE7H 3HATH 1P9SA 4B2BA 1SOZA 1B0FA 2QV1A 4X8TH 4LZ4B 3NWUA 3A89A 3PV2A 5EJLA 3P70B 1GBAA 3M3VA 5E0JA 1N6XA 3ZYDA 1QY6A 3N7DA 2V7QD 3F6UH 1INCA 1DOJA 2BLWA 2RA3A 4LOYH 5EXNA 1P05A 1U6QA 4XD7D 5A0AE 1MTNC 4Y7AA 1C2FA 3ZIAD 4A1VA 2ZU2A 1YGCH 1SMFE 3EA8A 1HYLA 1E1RD 1TNLA 2PGQB 1AKSA 5FPYA 1XKAC 1MD8A 2R2WU 4IS5A 3LH3A 2BD3A 1EAUA 4Y71A 1C2JA 2C93B 3LDXH 5JBCS 2QYIA 1NRSH 1SC8U 1AU8A 1HUTH 3SUFA 3TK9A 1NU9A 3OX7U 1D3DB 4X1RU 8LPRA 3T2NA 3VGCC 3SV6A 3K2UA 1WTHD 2FTLE 1ESBA 4IN1A
chains in the Genus database with same CATH topology
1YBWA 2BXUH 2VGCB 2ZP0H 3ZVGA 1GG6B 1OWDA 1H1BA 2P8OB 5C1YA 5L2YH 1SHYA 4ISHH 5BPEA 1BTPA 5F03A 3Q3KA 1P09A 2BY6X 1ZTKA 1ZLRA 3M7QA 2CF8H 2BLOA 2C8XB 3PYHA 3VB3A 1FI8A 2C8ZB 5A8XA 4NGAH 2Y5HA 4BXSA 3HKIB 5DP4A 2HGTH 4I8LA 5H4IB 1OPHB 4CRFA 2VIDA 2V0BA 3L6PA 4Y8YA 1YPGH 1LTOA 2GZ9A 5JBAS 1FN6A 1HXEH 5JPMH 1FIZA 1SGNE 1TPAE 1ZHPA 2FPZA 3HK6B 2TGTA 1HNEE 1ZPZA 3CP7A 1S83A 1TNGA 1C1RA 1GCTC 3GDSA 1V2PT 1MH0A 2ZGHA 4VGCB 4AFUA 4X6MA 3U8RH 3V12A 2XC5A 5DO4H 1EPTB 2B9LA 1DANH 1ZRBA 4NFFA 1OKXA 2P93A 4MNYA 2CGAA 2AFQB 4X2WA 2ZKSA 3URCA 5L6NH 3BEFB 1JOUB 5DP7A 1MKWK 4LZ1H 1SLWB 4MNWA 5T6GA 5FAHA 1WYKA 4PROA 2FOBA 3GCOA 1B5GH 3BG8A 3EYDA 2HOBA 1XVMA 1GMDF 2ZFFH 4K3JA 2QIQA 1WCZA 1BHXF 4ZHLU 1FV9A 1L0ZA 1F92A 2BDYA 3O8RA 3RXGA 6GCHF 2BDAA 2WPLS 2UWLA 1FY1A 3T25A 2G51A 1QRXA 2LNCA 2PW8H 1OS8A 2JH5D 3I29A 3ZVFA 5C5NA 3E90B 3F9EA 2G00A 1FN8A 3O8DA 1SPJA 1O5GH 1F0UA 4OS2A 1HCGA 2P59A 1AVXA 1GJ4H 4CRBA 2ZA5A 2QF0A 1W3CA 1C5UA 1EJMA 4B75A 1EB2A 3QDZB 2GDDA 2Z9GA 1HAIH 3GCHB 4ISIH 4NA7A 5DPAA 1KXFA 1DY9A 2C90B 2QXJA 6ESTA 4DIIH 2BY5X 2BD8A 3RXDA 3OY5U 4WH8A 1WQVH 2Z6BD 1C5LH 1F0RA 1A46H 2SNWA 5C2ZA 3MFJA 2EA3A 2QY0B 4X1NU 4KELA 1Y5BT 2G52A 1Y59T 3BTQE 3Q3YA 2A5IA 3SOSA 3FFGA 2H1UA 8ESTE 3BIUH 1P9UA 2JETC 2XCNA 4OGYA 2SGQE 4I8JA 5GJ4B 5C67A 1LKAA 2TPIZ 2O9QA 3BIVH 1BOQA 1THRH 3LC3A 5EU8A 1TALA 4AG1A 2ZU1A 1V2UT 3ZZ3A 4AG2A 4UONA 1VCPA 1KTSB 3P6ZB 1MZAA 1TPPA 4KTCA 1O2HA 1QA7A 2FS8A 1BBRK 2W7UA 3D65E 5ABWA 1GVLA 1YC0A 2XC0A 4O9VA 1PQAA 5E0HA 1HV7A 3PMBB 2OC8A 1EZSC 2FESH 1AFQB 5FXLA 2HRVA 1QGFA 2W26A 4K2YA 2PFEA 1JIRA 4X8VH 1XMNB 1EUFA 4HFPB 3UNQA 1A7SA 2BQWB 3FP6E 4U01A 1HAVB 1GCDA 5EPNA 3SJOA 3TVJB 1V2QT 3ODFA 5SGAE 2FS9A 1LVOA 1O2GH 4NZLA 1J16A 1CBWC 1EZXC 2ODPA 4TWYA 3K6ZA 1FONA 4UD9H 2Q6FA 1BTYA 1T8LA 3AAUA 1HAXB 4GSOA 1JRTA 1PYTD 1NS3A 4M7GA 1C1UH 1FPCH 1UCYH 2ZU3A 1GI8B 3SU1A 1CHGA 4YTAA 3UWIA 1MMJN 3F9GA 1ZOMA 3M3SA 2OUAA 3NXPA 1RS0A 1EATA 1PPFE 1N6YA 1XM1A 4ABFA 2OXSA 4Z0KA 1HAPH 4OS6A 3BEIB 1DY8A 1O2QA 2YNAA 3VEQB 4WXVA 2VGCC 2IOTA 1O2NA 1VCWA 1UTQA 3V3MA 1O32A 2OLGA 2A31A 3L33A 2OD3B 3SNBA 1TRYA 1Y5UT 3RXTA 4IMQA 5CHAC 4B1TA 1ELEE 1GBTA 2H9EH 1Q2WA 1D3PB 4WVPE 4U30A 3GDUA 1VITF 3RXQA 5EG4A 2VVVA 5F8ZA 4CREA 2SGFE 2VIQA 1KXDA 3QWCH 1MUEB 3PLBA 5DKMA 4GAWA 1PPEE 3SQEE 3SNDA 3GY8A 1H9IE 4DCDA 3P8NA 1QB6A 3ZZAA 1SR5C 1BCUH 1DVAH 1V2WT 1V2LT 4YLUA 4X8UH 3SNAA 1FLEE 1GJ8B 4H42U 2R9PA 1Z8IB 5AHGH 3RMNH 5GIBA 3TJNA 1ELAA 3VGCB 2V3HH 4VGCC 5J4QA 3HKJB 3STIA 7LPRA 1CVWH 1O31A 2Z9KA 2XWAA 1MU8B 4ISOA 2BQ7B 4A6LA 1N1LA 1C1WH 5DP5A 1JMOH 3SJ8A 1G2LA 1NFWA 1UTMA 3SJKA 1CU1A 3UOUA 4Y11E 1QL9A 5LPRA 1L2EA 1FIWA 1SB1H 2A32A 4A92A 7KMEH 2WUCA 3MWIU 4ASHA 1O2VA 4F49A 4O03A 5F6MA 2Y5FA 2GGVB 2VWLA 2ALVA 3BV9B 1GI3A 1SGQE 4WWYA 2Z7FE 1KXEA 4Y76A 1O5EH 3RXEA 2PKAB 1XXDA 5DG6A 3ESTA 4ZKOU 2GD4B 1FQ3A 1RD3B 5J4SA 1ZSLA 3TJVA 1FPHH 1AB9C 1O3PB 1S85A 2J95A 1C2MA 3M37A 4DGJA 4RKJB 1TX7A 1FXYA 1C5WB 1PPGE 2PUQH 1GCTB 3STJA 1QBNA 4UEHH 1EJAA 3AVZA 1W13U 4FUBA 1KLJH 1GMDG 3T26A 4F4OC 2PV9B 1O3IA 2AGGX 2OC0A 1YKTA 1YM0A 3EA7A 3S7HB 3BG4C 3M7UA 1BIOA 1QL8A 3BTTE 1LPZB 4BAMB 3ZV9A 2P3UB 4NZQA 1PJPA 2PSYA 4ZKNU 1W12U 3QZQA 1GBHA 1EPTA 2W3IA 2UUYA 3EE0B 4CBNA 1HAOH 1MTSA 2VH6A 3RU4T 4DJZB 4X1PU 2ZO3H 1W14U 2ZTZA 4NSYA 1OP0A 2VWNA 3K6YA 3LKWA 3FP7E 1O0DH 3ZVAA 2ZIQH 1EP6A 3UIRA 5EODA 1W7XH 3KEEA 1BA8B 1SFIA 4YT7H 1QQUA 3MNXA 1UTKA 3PWCA 1A61H 1YPLH 1LO6A 2ZGCA 1O2SA 1GBJA 3UUZA 1T31A 1IQFA 1UK3A 2ZNKH 1QL7A 1BT7A 3AASA 2BLVA 5C1XA 4DVAU 1S6FA 1YPMH 1A5GH 1IOEA 5A0BA 4AB8A 4NA9H 3BF6H 2ZI2H 2GP9B 3T28A 4JK5A 4R8TB 4AYYB 1RJXB 1TQ7B 1H8DH 3CS7A 4Y7BA 1O5FH 1N8OC 4ZAEA 1DX5M 2ZU5A 4K1TA 4FVBA 3RXLA 4Q80A 1Y5AT 2Z3CA 4CH2B 4MG3A 4AORA 2FOHA 1MTUA 2Z9LA 4HI3A 1VZQH 4J2YB 1ETSH 1J8AA 2VINA 5C1UA 1WV7H 2FIRH 1MBMA 1P2MA 1V3XA 4CRGA 3RU4E 1VCQA 3TJUA 2Y7ZA 3NK8A 1XXFA 1IQEA 1D6WA 2QCYA 3KF2A 3SU0A 1P2NA 3E91A 4I7YH 2IN2A 4CRCA 3OY6U 1T8MA 2IPHA 2FO9A 1GI5A 2B5TB 1RGQA 3BTGE 4X0WU 1FY3A 2JETB 3JZ1B 4X2YA 3R3GB 2OC1A 2J34A 3IITA 2ZGJA 2WV4A 3SHCH 1HB0B 3UNRA 3KGPA 4INHA 3RXCA 4H6SB 5DP3A 1JBUH 2JH0D 2ZDLA 2O8MA 3LGWA 1C1TA 1HBTH 2JKHA 2D26C 1DLEA 2FM2A 1C1NA 1BJVA 1CE5A 5F8TA 4MNVA 3ATLA 1G32B 2J2UA 2A5KA 3U8TH 3U98H 1C5XB 4WMFA 5FCRA 5E2OA 1BITA 1SGRE 3GY4A 3LT3A 3LGVA 5HM2A 3HK3B 4MLFB 1QFKH 4NIVA 2EEKA 1C4Y2 3TK5A 1Q3XA 1O3GA 2GT8A 2FDAA 8GCHF 4AZ2B 1SSXA 2QF3A 3C1KA 4I8GA 4IC5A 2VVCA 1SHHB 3W95A 1HAHH 3MNSA 1CBWB 1PFXC 2F91A 1P2JA 1GI6A 1SGPE 2ZF0H 4ZXXH 5T6FA 3OSYA 1ZMLA 1TA6A 3D62A 3TNSA 1NRQH 1OWEA 2B7DH 4JYUH 1HAVA 1K1NA 1BTHH 2O8WA 1QRZA 1SGEE 1FMGA 1GJDB 1NRPH 2ZCKP 2OINA 4K69A 1OX1A 1AWHB 1BBRE 1QTFA 4NFEA 4O97A 4X6OA 2C8WB 1YPEH 2Y80A 3M5MA 3A87A 3EAJA 4K1SA 1QRWA 4Y10E 1VITG 4IW4E 1NO9H 3ZZCA 3BTME 1K9OE 3IG6B 4UDWH 1FY8E 1LMWB 1TNHA 2TGDA 1CGJE 2ANMH 4ZROA 4BXWA 1LKBA 3U1JB 2Y6TA 3M36A 1SLXB 2XBXA 2BVXH 3RXIA 1TNJA 2Z94A 2BX3A 5CHAB 3ZV8A 1A2CH 1EAIA 3GY5A 3KQCA 3V0XA 1EB1H 1DXPA 3UPEA 2CN0H 1K22H 3LGTA 1EXFA 1NY22 4JYTA 3U1IB 1LQDB 4UFFH 1HDTH 1UHBA 5EQRA 1UCYK 4YZUA 2O8TA 2FOEA 2FODA 3OTJE 2GKVE 1BUIA 1P3CA 1Y3UA 1BMLA 5C3NA 4FUCA 1DM4B 1QNJA 3E0PB 1MD7A 2ZU4A 1SGDE 4D76A 1CGHA 1H9HE 1GJ5H 1ZPBA 2H9TH 3EGKH 3M3TA 4AFZA 5K0HA 1XX9A 3VB4A 1DUEA 1KYNA 1UVTH 3MTYA 3KIDU 1YCPH 4CRAA 3QK1A 1WOFA 1P11E 4Q2KA 4AN7A 3RXFA 7GCHF 2OQUA 2NU3E 3TITA 4BAKB 3UQOA 2TRMA 1DDJA 2H5DA 5TCAA 3MO3A 1IQHA 2ZCHP 1YPKH 1C5MD 1TGBA 2KAIB 2BD4A 3CS0A 4HGCA 1AZ8A 3G01A 3P8GA 1DLKB 1CT0E 2BZ6H 2ODYB 1RFNA 2P16A 1WAYB 1O2WA 4D7FA 3KQEA 5FPSA 1E38B 1JXPA 3GY3A 1P8VC 1A1RA 2ZC9H 5FX6A 1QA0A 2F9PA 3QLPH 2V3OH 1UTNA 3NCLA 3U8OH 3DHKH 1AB9B 3O8CA 3E8LA 1OWIA 2XXLA 4ZHMU 4I8HA 2J4IA 2Z9IA 5FCKA 1K1OA 1C2DA 1TPOA 3MH7A 5TCCA 1C1SA 1FY5A 3OU0A 2GZ7A 2PKAA 1OSSA 4DW2U 1C5OH 4JMYA 3RLYH 1SQAA 4MPXA 2BZAA 3UR6A 3BSQA 4JZEH 3A84A 2BHGA 4OS4A 3BG4B 3BN9A 2XYAA 3BTFE 1UVSH 2ANKH 2VIWA 5FBEA 3VFEA 1EX3A 1MAXA 9LPRA 1V2OT 3Q3XA 1LQEA 1O3MA 4IMZA 1A5HA 2C8YB 3QTVH 3MO6A 3F9HA 1ELGA 1JRSA 2GCHF 2Q1JA 2W7SA 4CHAC 3VB5A 4Y79A 1S84A 4AYVB 2XRCA 8KME2 1A0LA 3AW1A 1CGIE 1O2RA 1RXPA 2XCFA 3E3TA 4YO9A 3KNXA 3GY7A 3ATIA 3KCGH 1OWJA 5HMAA 1XUFA 5EPYA 5L2ZH 3V7TA 2BQ6B 4GCHF 4DG4A 5GWZA 1S6HA 2A7HA 2SGPE 2DE9A 4ISNA 2HLCA 2RDLA 3SQHE 3BEUA 4ZKSU 1ANEA 1GPZA 2ZTYA 1C2GA 1RRKA 3NZIA 4Q7ZA 3TGIE 4YT6H 1Y3XA 2QC2A 2H9HA 5FHTA 1TPSA 1P01A 2BDBA 1ESAA 2WV5A 5GPIB 1BRBE 1Z8RA 3ZZ8A 1HAZB 4DOQA 2ZTXA 1J14A 2I6SA 3ZZBA 1IQKA 1K1IA 1N8OB 5HM9A 2ILNA 2J9NA 1ZJDA 9ESTA 1E36B 5AF9H 1A3BH 1CT4E 1F0SA 1Q31A 3PLKA 3MNCA 2C3SA 1MTVA 2W3KA 3B8JA 2BM2A 2AMQA 3SU3A 4INKA 3SU2A 3UTUH 1TGNA 3ZZ9A 3QGNB 1AI8H 2WYJA 3QX5H 1ZGVA 2AMPA 1AN1E 5HGGA 3ATKA 5JBTA 4FXGH 1C2KA 4KKDA 1NT1A 1O2YA 1SOTA 1J17T 3RXJA 4SGBE 1W10U 4XE4A 1RTLA 2ZDNA 4BAOB 1M9UA 1EAWA 2F9BH 4CBOA 3RP2A 3RC5A 3RMMH 5E0GA 2VWOA 2A45B 1BTUA 4RKOB 4CR9A 1HXFH 2A4OA 1GBKA 2FX4A 1YP9A 3EQ0H 3BTKE 3PMHB 5DP9A 1SQOA 3D23A 3S7KB 1MTWA 1ELVA 1S0RA 2OP9A 1PPHE 2BDIA 3F1SB 1W8BH 1QCPA 1GI4A 3LGYA 3MOCA 5IDKA 1P06A 8GCHG 5ESBA 3RXUA 2V35A 2VU8E 3S9AA 3RXRA 1NFUA 2TGPZ 2G5NA 4A1XA 4JYVH 1EASA 1O2LA 1ELFA 1QB9A 3RXMA 4D9RA 1G3EA 1C1PA 1P03A 1V2TT 1O33A 2BY9X 3UY9A 1G3CA 4A7IB 1BMNH 4MPWA 5FX5A 1O37A 2QXHA 1ABIH 2R0LA 4NG9H 2D1JA 4BTUB 2YOLA 1O5BB 5A8ZA 1TGSZ 4AFSA 3T27A 2EI6A 1O3CA 1UK2A 1MKXK 1D9IA 1HLTH 2OTVA 4MQAA 1S82A 3K9XB 4YM9A 2HVXA 2CMYA 4RN6A 4ABHA 5PTPA 2A7JA 1O2TA 3A8DA 2XBVA 1GMHF 1GHBF 2FYQA 1ZMJA 2XBWA 4THNH 1QJ1B 1XVOA 4E05H 2BB4A 1ZHMA 2BX4A 1O34A 1O38A 2XWBI 1BRUP 1AO5A 1V2KT 1A4WH 1W0YH 2I6QA 2GDEH 2VJ1A 4ABIA 2F3CE 3Q76A 4BTTB 2D8WA 3LU9B 3M5LA 2A0QB 1MQ5A 3H7OA 1P04A 3SU5A 4AOQA 2FOFA 1EJNA 1W7GH 2C4FH 1ELCA 4MPUA 1BQYA 2BYAX 3QZRA 1QBVH 1O3JA 1FAXA 1HJ8A 3TLOA 3PO1C 3MU1A 1C4V2 3TH4H 3RM0H 1ETTH 1C5VA 1GGDC 4ABGA 3GISB 4HZHA 2G5VA 5AFYH 1UVPA 4MDSA 2G4TA 2BD7A 4Y8ZA 1D3TB 1Z8JB 1DSTA 1YPHC 4HTCH 2FP7B 1C5YB 3M61U