2BLWA

Trypsin after a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA02
3T62A 5F8TA 3SI3H 4NWLA 3SUEA 2BDCA 1T8OA 1W7GH 4XE4A 3S69A 4BXSA 2R0LA 1TNJA 2THFB 2ZO3H 1W3CA 5AFZH 4A7IB 1YCPM 1O5FH 3E0NB 2C8WB 1AFQB 4OGXA 2HGTH 3ODFA 2WUBA 1ELGA 3GCNA 3SI4H 5GDSH 5C1UA 5AFYH 2PTNA 4A92A 1TBQH 4DURA 1GJ8B 3A7WA 2BLQA 1CGJE 1A0JA 2ZPRA 2V0BA 3SUFA 1C2IA 3LGIA 2XC4A 1L1NA 3CENA 4H6TA 1RTLA 3M3SA 5I25A 1V2PT 2G5VA 1Z8IB 5PTPA 1TA2A 1YM0A 4CRBA 1EOLA 4X6PA 1V2UT 1AO5A 3EAJA 2A5KA 1K1OA 2GCTC 3PO1B 7LPRA 2OC7A 1BTUA 1O3MA 3PTBA 1F0RA 4GVUA 4AB9A 1MH0A 1EASA 4RKOB 3K2UA 1MD7A 1GL0E 4LXBH 2PW8H 1TYNA 1K2I1 1ID5H 1SGEE 1TA6A 2TGPZ 2FX6A 1Y3YA 3BG4C 3ZV8A 1UHBB 1N1LA 2QF0A 3GY5A 1HCGA 3P6ZB 1LVOA 5DP8A 2XWBI 2NU1E 4GUXA 3RC5A 2V6NA 6LPRA 1G2MA 1EATA 3VB3A 2VU8E 4BAKB 2BDAA 4OS6A 2FYRA 3M3TA 3TNSA 1TNHA 1SGIB 1FY4A 3RXOA 1QTFA 3TK5A 2ZWLH 1TALA 1SQTA 1DOJA 1O38A 1UK3A 3TGKE 2Y81A 4AFQA 2P94A 1LVBA 1QB9A 3TH2H 3PM3A 4IW4E 1O3AA 1SHYA 4FVBA 1UO6A 2H5CA 3P8GA 1VITG 1BA8B 4I8KA 1C2DA 5DG6A 2D2DA 4ZAEA 2BLWA 1K9OE 4X6NA 5C20A 3A7XA 1LVMA 2O8WA 4BOHA 1KLTA 1OWHA 1OS8A 2PUXB 3MMGA 2TIOA 4DOQA 4BTIB 1G2LA 2QGRA 8GCHF 3BTQE 2F9BH 1UTOA 4ZXYH 1G3BA 3DFLA 5JBAS 1ANEA 1EAIA 1TNKA 4X8UH 1AB9B 1EJMA 3VB5A 3DHKH 3ATWA 1MAXA 2Q6DA 1Q3XA 4THNH 3OX7U 3GY7A 1V2RT 1GI6A 1NC6A 3PMJA 1LO6A 1GMDF 4D9QA 1C5RA 2QN5T 2VH0A 2BD3A 1C4V2 2P3TB 1S0RA 1SI5H 2BOKA 5C3NA 2IPHA 4IS5A 2W7UA 1AIXH 1BTPA 5CHAB 1V2ST 2TGTA 2GDEH 3QZQA 2FLRH 3OU0A 5GCHG 1GI8B 1GHAF 1HAVA 2ZTYA 2GKVE 5HMAA 1OWDA 3OSYA 4NSVA 1UVSH 3MO9A 1YKTA 2JETC 1BUIA 2KAIB 3F9HA 1QCPA 2F9OA 1GCTC 5F03A 2QAAA 4KTCA 3PV4A 1JBUH 1FN8A 1AZZA 1K22H 5TCCA 1TNLA 4AGJA 2ZKSA 1C4U2 4TWYA 2SGQE 3ZZ3A 2EI7A 1DWDH 4INHA 2ODYB 2FDAA 5I46H 2QXGA 1S0QA 1J9CH 1C2KA 4AN7A 1BMNH 4ABDA 3RXQA 2VH6A 3QZRA 3TJVA 2ESTE 2OC0A 1FIZA 2ZQ1A 1HJ8A 2Z9GA 3RXCA 1XMNB 1GI0A 1FY3A 1SQOA 5FBIA 2VVCA 1H4WA 3A8BA 1NTPA 1ELBA 1THRH 5FPSA 1TE0A 1YPEH 4ZHAA 1B7XB 1RD3B 2PKAB 3LGYA 5EXMA 3RDZA 1ZSLA 1DWEH 1SLUB 3MTYA 1WTHD 4FU9A 1ZTLA 2WPLS 1DXWA 3VEQB 2SGEE 4ZHLU 3MU1A 4CBOA 1BIOA 1NRNH 4CHAC 4NFEA 3HKJB 1L0ZA 2ZHFH 5AHGH 2A0QB 2VINA 2HWLB 2J94A 4Z0KA 1C5VA 2QIQA 2SNVA 1C5TA 1AVXA 2BY8X 1SHHB 3GY8A 1AMHA 1WAYB 1TLDA 2PLXA 1NROH 2A7CA 4D76A 1HJAC 3SGBE 3S7HB 3URCA 1A7SA 2VWLA 4BAOB 5A0CA 1C5XB 2IOTA 5LGOA 2VIQA 1OP2A 3SO3A 3UQVA 4Y8ZA 1F5RA 4MPWA 1YPLH 2OTVA 2BY7X 2AIPA 3P70B 3KQCA 3LC3A 1BBRK 1MD8A 2YNBA 3KGPA 3S9AA 1TRNA 3H7OA 1HXEH 1O5EH 1RS0A 1K1PA 1V6DA 1XM1A 3D49H 1BZXE 5HYOA 2Q1JA 2W3KA 2ZGBH 1HAGE 1CU1A 1V2QT 4I7YH 5E0GA 2QCYA 1GG6B 1NFWA 1GHBG 4Y0YE 5JB9S 1EQ9A 2BHGA 2HNTC 2Y5HA 4I33A 3T2NA 3P8FA 2H1UA 1C5OH 4K8BA 4X0WU 2FYQA 2H2ZA 1B0FA 5EW2H 4AFZA 4BXWA 2OCVB 3QDZB 4AGKA 2ZU4A 2A2QH 1XUIA 4HI3A 1Z7KA 1OWJA 4CH8B 5A0BA 4H42U 4HZHA 1O3NA 1C1QA 1CE5A 3A7YA 5DP6A 2PHBA 4OS1A 3U8OH 1GVKB 3U9AH 5ABWA 3RMOH 5FPTA 3GCOA 2ZCKP 1A4WH 2FTMA 4YTAA 4JYVH 2J95A 2Z9IA 1WQVH 1SOZA 4JYTA 2HOBA 1GBJA 2AS9A 3Q00A 1CA0B 1QGFA 2JH0D 2WYJA 4MDSA 4UD9H 3SJ9A 1JIRA 4X1QU 1HFDA 6ESTA 3NK8A 2OD3B 3GY6A 3SJ8A 3UIRA 3SNEA 2ODQA 2VNTA 1SFIA 2FOHA 4NZQA 2O8UA 3LH3A 1ELCA 2ZFTA 3P8OA 2BD7A 3TPIZ 2ANYA 3DFJA 1ZSJA 2FZZA 5E2PA 4B71A 4ZXXH 2D26C 3LGVA 4FVDA 4CRAA 2Z3CA 2BOHB 1AVGH 4Y76A 2CHAC 2Z9JA 2GVFA 4Y11E 2FOBA 5GCHF 2QV1A 1MCVA 1MTNB 1LTOA 2B7DH 3E90B 5HM9A 1LDTT 3VB4A 4DIHH 4U32A 2WV5A 1UTQA 3O8CA 3F9EA 1JMOH 1O2IA 3SBKA 4JYUH 3TIUA 1T7CA 4WXVA 1ZPCA 2UUKB 4GAWA 4Y71A 1ELAA 1QBVH 3SGAE 1MAYA 1LQEA 2O8TA 3LONA 1V2KT 5CMXH 2GCHG 3I78A 5K0HA 4ABBA 2DE9A 1EAWA 2ZU2A 2B5TB 1N8OB 1ZGVA 1CA8B 2A5IA 1YPMH 2A31A 1O2SA 1V3XA 2RG3A 3NPSA 4UFGH 4KKDA 1SLWB 3SU1A 1F2SE 1TPSA 3JZ1B 3QGNB 1P2QA 3M61U 1PPGE 1E36B 3NKKA 1HIAA 1Y3UA 3U69H 3SNDA 2FODA 1XXFA 5HXFA 3RXMA 1YC0A 4OS4A 3H5CB 1DE7H 1O34A 1IQHA 3PYHA 1ZJDA 4I31A 2GZ9A 4ZROA 4B1TA 1CHOG 4FUHA 1O5DH 1O0DH 3RXUA 4WVPE 4CBNA 3RM2H 1AHTH 3V3MA 3A7ZA 1UTLM 1XUHA 4NIVA 2R3YA 2QXHA 4X6MA 1QIXB 1P3EA 1TQ7B 1ZRBA 1GMHG 2ZDMA 1O2PA 1ABJH 2SFAA 3KNXA 2GP9B 3TNTA 4ABFA 3ZZ7A 6CHAC 1ZSKA 3GCTG 1C9TA 2TGDA 5IYTA 5EGMA 5FAHA 6GCHF 5EPYA 2Y7ZA 1MKWH 2GT7A 2HNTE 3M5LA 4MG3A 4ZH8A 3MYWA 1S81A 3F6UH 1CT2E 4RN6A 1TMUH 2FOGA 3BSQA 3SOSA 2BD8A 1GGDB 1GJ6A 5TJXA 3P17H 4NWKA 2BQ6B 2H9TH 8ESTE 3SV7A 1BTZA 1QA7A 3RU4T 3TVJB 1HAIH 2PR3A 4MTBA 2GV6A 1N6YA 3HGNA 1P9UA 4NZLA 3QGJA 3ZYDA 5DP5A 1SPJA 1CGIE 2CGAA 1EPTB 1GHBF 1JXPA 4CRDA 1BB0B 2ZDAH 1DWCH 1OYTH 4H4FA 3HPTB 1EZSC 1NPMA 4JZ1A 5IDKA 1ZYOA 5EODA 4B2AA 1DLKB 1GBAA 2VB0A 1SLVB 3ZZ4A 1HJ9A 2PGQB 1YPHE 4ZMAH 1UMAH 4YM9A 1O2VA 1A3BH 1T8LA 4FU8A 2R3UA 1MZAA 3AAUA 2BY6X 3HKIB 3MH6A 3ZVEA 3TK9A 1SGFA 3ATLA 2GMTC 3PMHB 4I8LA 5C1XA 1WUNH 1KDQA 1GI1A 1FPCH 1QBOA 3F9GA 4U2WA 2OBQA 1EB2A 4NIXA 2ANWA 1K1MA 3SHAH 2FS8A 2I6SA 2Y82A 1EZQA 1S84A 3E91A 2DUCA 3RLWH 1YLCA 1ZTJA 3K65B 5JDUB 5FCKA 2ZHDA 4GHTA 5FX5A 3OTJE 2O9QA 4YT6H 2ZCLP 1TAWA 1C2EA 1XUFA 1UTNA 1GBDA 4X8TH 1G3EA 5T6FA 4YESB 3HK6B 4UFDH 3MU8A 2F9VA 4Y10E 1MTUA 4CRGA 2GV7A 4JZIA 3RXBA 1AE8H 4AG2A 1TPPA 1ANCA 1O2NA 1MKXK 1KTTB 4F49A 1NZQH 1DANH 1CO7E 1QURH 1P12E 1T32A 4O97A 3RC4A 5DP4A 5DKMA 1GBLA 1P2KA 5EXLA 3QX5H 1LHCH 1WQSA 5FPYA 1ELEE 1EAUA 1NESE 3K6YA 4E7RG 4ZKOU 1W13U 4Z6AH 1SGPE 2G51A 1PJPA 1IQMA 1XUGA 2BY9X 2GCHF 1SG8B 2ZI2H 2XBYA 4ZKNU 3T28A 1PQ5A 3I29A 4MPVA 1DY9A 1NFUA 1V2MT 2FI3E 1P3CA 2A1DB 2GCTB 3GY4A 1RTKA 4NA7A 1CBWC 1S6HA 4YLUA 3H7TA 3DD2H 4LOYH 2FM2A 3V13A 1YCPK 2BLVA 1FN6A 3EQ0H 3SUGA 2PGBB 5FBEA 3GCHC 2ZFFH 4JK5A 3RXJA 1HBTH 1ZLRA 2RA0A 1GJ7B 5FCRA 1SGDE 1MBQA 2F91A 4D7FA 1ANBA 3MO6A 1W7XH 2OC1A 5EPNA 1HAXB 2HPQH 1CHOF 1XX9A 2QC2A 3FP8E 5G4BA 5JB8S 3SHCH 2NU2E 1E34B 3AASA 3TGJE 4JZEH 3ZZ8A 1G32B 4WWYA 4FUBA 1RGQA 5E8EH 4X2XA 3A85A 3FZZA 1GMHF 5BPEA 3ZZ6A 3GOVB 1ZHRA 4DJZB 2Y6TA 2FO9A 1FDPA 3ATIA 5J4SA 2SGFE 4KP0A 1PYTC 3OY5U 1SGQE 4H6SB 4WXIA 1NS3A 2PKSC 2FI4E 3ZVGA 1GMCF 4AFSA 1S82A 1O3CA 1K1IA 1LHEH 5HGGA 5EW1H 1O5CB 3TLOA 2C8YB 3K6ZA 2P3UB 1O37A 1RRKA 5T6GA 3U8RH 2ZGHA 2EC9H 2P59A 4Q7YA 1BOQA 1IHTH 1A1RA 1DLEA 2ALVA 4ZKSU 2PWXA 2AERH 4RKJB 1Y8TA 1QRXA 3KIDU 3BG8A 5A0AE 2SGAA 2ZU3A 1TFXA 1SGFG 5DK1A 2ZTZA 3UR9A 2BDIA 4U01A 3UY9A 1C2HA 3SNCA 4YZUA 5FX6A 1MU8B 2ZFPH 3E0PB 1LHDH 3PLKA 3ZVDA 1O2LA 1A46H 3BV9B 4AB8A 4O03A 3GICB 2J92A 1UTPA 1AUJA 3QWCH 5A8YA 4MVNA 1FY8E 4FUEA 1GBBA 1T8NA 2BZAA 1C1VH 1O30A 7KMEH 4SGBE 1YP9A 3ATKA 1HIAB 2VWMA 1HUTH 1ESTA 4R0IA 4MNYA 1NRQH 1ESBA 1CHGA 1GI9B 2AH4X 4FUCA 5LH8A 1SGNE 5E0HA 5J4QA 3M7UA 4JZDH 2JETB 2BDHA 3SJIA 2H5DA 1QHRB 1GCTB 3A8CA 4YLQH 5T3HA 3ZZ9A 3TK6A 1O2TA 3A84A 4CREA 3UPEA 3A89A 3GDUA 1O35A 4U30A 2FMJA 2XCNA 1K1JA 3BTFE 1B5GH 5DO4H 1FQ3A 1P02A 1ZHPA 1WCZA 2A32A 1TGTA 1RIWC 2BD4A 1C5ZB 2OQ5A 1GBIA 3V0XA 2FIRH 3NUMA 5HM2A 1S85A 3GYMA 1ELVA 2XTTB 3Q3KA 3LC5A 1O3JA 1QQ4A 2YNAA 4AFUA 1T31A 2F9UA 4ISLA 2FOCA 1KSNA 3EYDA 4X8SH 4VGCC 5EQSA 2OXSA 3RXVA 2ZIQH 3RMMH 3RXSA 1L1JA 2Z7FE 1AY6H 3AW0A 1IOEA 1D3QB 2SNWA 2VGCC 2FESH 4NIWA 2BXUH 1AZ8A 1GHXH 1SLXB 2JKHA 3ZZ5A 1EX3A 1AWHB 2BM2A 2ZDKA 4DIIH 4INKA 4CHAB 2VVUA 3T29A 1BT7A 3BIVH 4DGJA 2BYAX 2Y7XA 1GI4A 2FP7B 1TX7A 1TGNA 1KLJH 4KTUA 1FZZA 4K2YA 1GDNA 1PYTD 2BVRH 1GJBB 4X1SU 1LPGB 1BHXB 2BX3A 3FZDA 1HJAB 4AYYB 1CT4E 5AF9H 3MH4A 4A1XA 1O3HA 1KXCA 3A80A 3SJOA 1A3EH 3SUDA 4A5TS 1Y3WA 1VGCC 1D3DB 3LGTA 8LPRA 1W8BH 2WYGA 3BTTE 3STJA 3PLPA 3QK1A 1H9HE 4AYVB 3VXFH 1GCDA 2ZQ2A 1F0TA 2OP9A 2R2WU 3B8JA 2FX4A 1RTFB 1V2NT 3A88A 1HRTH 2PSXA 3ITIA 4K69A 4TY6A 3SORA 1EUFA 3ZVAA 2ZFRH 4FXGH 3A8AA 1KXFA 1O3OA 4X2YA 1FIWA 1EZUC 2BB4A 3JZ2B 4KELA 1UTKA 2F9PA 1W0YH 2QF3A 2XC0A 2OLGA 1O3EA 3B23B 3URDA 3U1IB 1TPOA 1P11E 4X1PU 5C5NA 4AORA 1HYLA 3C27B 4E7NA 4MNXA 2AMPA 2AYWA 4CH2B 4INLA 4Q7XA 4AX9H 1P9SA 1BDAA 3TITA 1BTHH 5LPRA 1J17T 1BHXF 1KTSB 1YGCH 3GISB 4K8YA 4X2VA 1H9LB 1DPOA 1NN6A 2P8OC 4X8VH 1IQKA 2J4IA 4CR5A 3LU9B 3UNQA 1W14U 1C1RA 3SQHE 1ARBA 3A82A 5C5OA 1KXAA 1KXDA 1SC8U 3MWIU 2OBOA 4WH6A 4Y7AA 1Y3XA 1CT0E 1UCYH 2VWOA 1VITF 1C2MA 1G3CA 3SV9A 2A5AA 4WMFA 3UNSA 3S7KB 1MZDA 1LPKB 2ZDLA 4DT7B 4XDEA 3SV2H 2CHAB 4ZHMU 1EJNA 3RC6A 1M9UA 4ZKRU 2Z6BD 1O2ZA 4D7GA 4IC5A 2PSYA 1PPBH 4GHQA 5EQQA 1EXFA 1C9PA 4F4OC 3SU6A 3ZVFA 3VFEA 5L6NH 4BNRA 4E05H 1TB6H 2W5EA 1FJSA 3GDVA 1A2CH 1THPB 1YPHC 1HAPH 1A5GH 1O2QA 1ANDA 1NO9H 2GTBA 1TPAE 2GZ7A 2XRCA 3VPKA 5A2MH 5DP9A 2IJOB 2A4RA 1Y5AT 1EP5A 5C1YA 2AGGX 2VIDA 1HAZB 1Z1JA 4XFQA 3GY3A 1FAKH 1Z6JH 1YLDA 1BJUA 4A6LA 1PPZA 3S0NA 1IQEA 3SU5A 7GCHG 1O2GH 5A8ZA 5ESTE 1D4PB 3MU5A 1TBRH 2PUQH 3EE0B 2B8OH 5L2YH 2XC5A 1UK4A 2CJIA 4B74A 1O32A 1OX1A 3UTUH 4E06H 1HDTH 3TJUA 3K9XB 1OKXA 2BVXH 3RXTA 5E0JA 2ZPQA 3ENSB 2WPMS 4HFPB 2FI5E 2AFQB 1YPKH 2WV4A 4FUFA 1QL9A 1P10A 2H6MA 1S5SA 2UUJB 3NZIA 4UFFH 1C5LH 4YOGA 3L3TA 5EXNA 1ZPZA 2RCEA 3RP2A 2ZU1A 4UDWH 1QL7A 1RXPA 1G36A 2HLCA 1JRSA 1TRYA 4WY3A 1P2OA 1VR1H 6CHAB 1XKBC 1NFXA 1DSUA 1E0FD 1SGTA 2UUYA 1DSTA 4Y79A 1P8VC 1ZJKA 2WPHS 2Z3EA 1BRCE 1KXBA 1PQ8A 2J9NA 4GCHG 3BTDE 1GJ5H 2BXTH 2C8XB 1C2JA 1PPCE 2Y80A 3A81A 1OOKB 4M7GA 1SQAA 1ELFA 4KTSA 3SN8A 1O2YA 4SGAE 1XXDA 2C4FH 2NU0E 3RXEA 4NA8A 1TMTH 1LVYA 4BANB 3PWBA 4JK6A 1BCUH 1SVPA 1ZMJA 1DUEA 1K1NA 2G81E 2Q6FA 2UUFB 1O3BA 4K1SA 4AZ2B 1DITH 3M35A 2NU3E 4NSYA 2ZDVH 3EGKH 3BTME 2IN2A 1O2HA 1J16A 2P16A 3LPRA 3MU0A 1QJ6B 1GBFA 2ZZUH 2WINI 1QJ7B 1W2KH 2BDGA 3T5FH 1GJ9B 2GD4B 2R9PA 3UR6A 1O3KA 1KYNA 2ZU5A 2BTCE 1GWAA 4PROA 1E35B 4FUDA 1P2IA 1V2OT 1IQLA 3SV8A 2FOFA 2BZ6H 2GMTB 3ESTA 1OWKA 1MU6B 1QY6A 1GVZA 2PFEA 2ZGXH 1XVMA 2GT8A 2H9EH 3FP6E 1HAVB 4QT8C 2EI6A 4Y8XA 1ZRKA 1B0EA 1K1LA 2FPZA 1AWFH 2HVXA 1ORFA 1C5WB 1IQNA 2BQ7B 3DT0H 1SL3A 4O3UA 1FV9A 1C5NH 3BTGE 3U8TH 2ZPSA 4I8GA 5TCAA 1ABIH 1UCYE 1MTWA 1EZXC 1G3DA 2UWPA 2B9LA 1IQJA 1TOCB 2Z9LA 3AW1A 3RXIA 2G55A 3SJKA 1QFKH 4I8JA 1BMLA 2OUAA 3ZYEA 5DJ7A 2ZF0H 1J8AA 1MKWK 1C2FA 1LHFH 1A5HA 4ABHA 1W11U 1NT1A 1S6FA 3AVZA 1C4Y2 4DVAU 1UVPA 5LPEA 2BDBA 3UOUA 1GDQA 1DM4B 3PB1E 4FU7A 5E2OA 4IMQA 1DY8A 1YPGH 1GBMA 2R2MB 1GI7B 1O5BB 1O31A 2G52A 4XSKU 3W94A 1FLEE 1GI2A 8GCHG 3A7VA 1GI5A 2NU4E 5AVDA 5FHTA 3D62A 4CR9A 1FXYA 3M37A 4Q80A 3PROA 1J14A 1GVLA 3SU4A 3E1XB 1IAUA 1WU1A 1CBWB 1ZTKA 3M3VA 7ESTE 1OXGA 4X1RU 1YCPH 2AIQA 5CE1A 3DUXH 1DT2A 5L2ZH 2WPIS 1SGRE 3GCHB 1QRZA 1XUKA 4B75A 2AEIH 2GZ8A 2QYIA 2J38A 1C1UH 1ELTA 3G01A 4UE7H 2Y5FA 1ZR0A 1GHAG 4YT7H 2FOAA 1SSXA 4OS5A 3RUOA 1W10U 1HAOH 1NRPH 2F83A 3FP7E 2BMGB 5B6OA 3KF2A 3UWIA 1GHVH 3LIWA 1N6XA 2W26A 4JMYA 8KME2 4LK4A 5DP7A 4UFEH 4R8TB 3HGPA 3NXPA 1IQFA 4I32A 2PKSB 2XW9A 3RU4D 1MUEB 1DX5M 1V2WT 1VJ9U 3SNBA 4GCHF 1P2JA 2A45B 1D6WA 4K60A 2G00A 3RU4E 2A4OA 3SU0A 3BG4B 1Z8GA 4WMDA 5C2ZA 1BTYA 3HATH 2LPRA 1NU9A 1UJ1A 3A7TA 2TGAA 1O2XA 3CS7A 3P8NA 3SU3A 3F9FA 3E16B 4DW2U 1C5QA 3SW2B 3ZZCA 1RJXB 2V3OH 2ZECA 4FUGA 4NA9H 2VJ1A 2FOEA 1K21H 3GCTF 1O33A 1TWXB 1WBGB 1FONA 3TJOA 4X2WA 5FXLA 3VGCC 3QTOH 4XBDA 1MQ5A 2QA9E 1P0SH 3A83A 1W0ZU 1C5SA 2UWLA 4J2YB 3MO3A 1WYKA 1GJDB 4DG4A 1ETTH 1ACBE 1NU7B 1ETSH 1THSH 4IN1A 1CGHA 3BF6H 1OP8A 2RA3A 2A4GA 2STBE 3WY8A 1AFQC 3SU2A 4D9RA 3SZNA 1DWBH 2BLOA 1GPZA 4TPYA 1GBHA 3MOCA 4ESTE 2A7HA 1GHZA 4BAHB 2A2XH 1Z8JB 4B2CA 1GL1A 3KCGH 4GLYA 1QBNA 2ZFQH 3KHVA 3L6PA 1VZQH 9LPRA 2FEQH 1BRBE 3ZZBA 3EA9A 3QN7A 4ISOA 1FPHH 1XVOA 4IGDA 2TRMA 2F9NA 4TPIZ 1BJVA 3MNCA 3TH4H 5GXPA 2ANKH 4MQAA 4ISNA 5DGJA 3PO1C 2K1QA 1RIWB 4WMEA 3VB7A 1INCA 4MPUA 1OSSA 3GYLB 4ISHH 4BAMB 5GWZA 3FANA 3GY2A 1NFYA 1ZHMA 3SV6A 1E37B 2GDDA 2ZG0H 3KQEA 4JCNA 4O9VA 1V2TT 1QB1A 1TIOA 3STIA 4ABAA 1GBCA 4VGCB 3M5NA 3IG6B 1O3LA 4XBBA 1G37A 1JIMA 2VGCB 1TGCA 3T26A 2SGDE 3N7OA 4WH8A 3MFJA 1H8IH 4XBCA 1TQ0B 1E38B 1V2LT 1L4ZA 2FOMB 2ZEBA 1ARCA 2AMDA 1C1NA 3Q3YA 4IMZA 1CQQA 3LJOA 1V2VT 1O5GH 2ZTXA 5K7RA 1SFQB 1FMGA 3BIUH 1OP0A 1O2KA 3TU7H 2LNCA 3W95A 2ZHWH 1SB1H 1MQ6A 2ALPA 4KGAA 5BRRE 9ESTA 1O3FA 4B76A 1CVWH 1GHWH 2QY0B 3C1KA 1VGCB 1LMWB 2TPIZ 5T6DA 1TGBA 2D8WA 2DE8A 3O8DA 1QL8A 1X7AC 4FUJA 3V7TA 1O3GA 2ZCHP 2JH5D 1TABE 5F6MA 2ODPA 1VJAU 3RXHA 2B0FA 1Y3VA 1DICA 3BTKE 1EPTA 3R3GB 1GHYH 1YPJH 1DFPA 1AB9C 3D65E 2FTLE 2W7SA 1O36A 1GBTA 1O3IA 5ESBA 5JBBS 5ETXA 1YYY1 2VVVA 3UFAA 1AKSA 1YBWA 4MNWA 3KN2A 4DCDA 1TBZH 1Q2WA 2FS9A 3V12A 4YOIA 2CXVA 3MNBA 1PFXC 3P92A 1ELDE 4Y6DA 4CRCA 1GDUA 1HNEE 2YOLA 5F8XA 5CHAC 1KDQB 1UK2A 1Y5BT 4I8HA 1O2JA 1A5IA 1BBRH 3HK3B 2OC8A 1H8DH 1BMAA 2HRVA 3A87A 3NCLA 3PMBB 4UEHH 4ZUHA 2OINA 2P8OB 2ZDNA 2P3FH 4ISIH 1T4UH 3RM0H 2WPJS 2ZGCA 4YO9A 2C93B 4HTCH 2O8LA 1K28D 1S83A 1Z6EA 3MHWU 2BX4A 1UVOA 3PTNA 1MTSA 1SOTA 1ZMNA 1P04A 2BD5A 3TJNA 2G4TA 5JYIA 1P09A 2Y5GA 1KLIH 1UVTH 1NRSH 3M7QA 3MI4A 5H4IB 2Z9KA 2WPKS 1PPEE 3GDSA 3U98H 3BEFB 3UREA 3QLPH 1BMMH 1TNIA 1P05A 1VITH 3FVFB 1VCWA 1AN1E 1EAXA 1GJCB 1D3PB 6GCHG 2VIWA 1TGSZ 3BTWE 1C5UA 1D6RA 2VWNA 3CS0A 1ETRH 1FI8A 4YOJA 1TX8A 3KEEA 1SR5C 3KL6A 4BTUB 5JPMH 1F0SA 1TONA 3MH5A 3QTVH 3S9BA 1RFNA 3RXKA 1AVWA 3L33A 1DVAH 1QA0A 2TBSA 2AGIX 3RXFA 2RDLA 1J15A 1DS2E 3FAOA 1F5KU 3LKWA 2CF8H 2XYAA 2EEKA 1OYQA 4GSOA 4Y0ZE 3O8RA 3M5OA 1EP6A 3MNXA 2H9HA 5JBTA 3S9CA 1G30B 3SNAA 3IITA 1XUJA 3EA7A 4TWWA 3ZVBA 1MTVA 4XOJA 4B2BA 4LZ4B 1GI3A 3RXDA 3TH3H 3DA9B 2HNTF 1Y5UT 4A1TA 1QNJA 3F68H 4Y7BA 4AOQA 4MPXA 3LT3A 3BEIB 1TX6A 2XNIA 2G5NA 1O2UA 1C1TA 4K5ZA 2G8TA 3RLYH 1C1WH 3EA8A 5F8ZA 1P06A 2HALA 3MU4A 2R0KA 2XXLA 2Z3DA 3BTEE 1AE5A 1AU8A 1C5PA 1P01A 3LJJA 2EI8A 1PQ7A 4UONA 1AUTC 1KIGH 1LQDB 3RXAA 2C8ZB 4D8NA 1MBMA 2BY5X 3T25A 2ZFSA 1GG6C 5A09A 1WOFA 2A7JA 5EQRA 1C1SA 1A0LA 1AD8H 1O3PB 2J34A 1ZZZA 3UUZA 3RXLA 1ZPBA 3AAVA 4WF8A 1C1PA 2BQWB 2ULLA 2W3IA 1QB6A 1H9IE 1C1OA 1SBWA 4Q7ZA 1BITA 4J1YA 4BTTB 1U6QA 1UCYK 1L1GA 2V3HH 3TGIE 3MNSA 1T8MA 3BTHE 2QXIA 3OY6U 2GGVB 5C67A 2VIOA 4MNVA 2FWWA 1AGJA 4BAQB 1UHBA 1BRUP 1LKAA 1AQ7A 3IWMA 1BTWA 1EKBB 1Z71A 1O2RA 5DP3A 1P03A 3RXPA 1FUJA 2BVSH 4NGAH 2ASUB 1CA0C 1PPFE 2Q6GA 1P2NA 1NY22 2C90B 2ZHEH 3F1SB 4Y8YA 3RXRA 3ODDA 5EOKA 2AGEX 2SGPE 1F0UA 3QO6A 3ZV9A 2JH6D 1AFEH 1OWIA 4IC6A 2ZP0H 1C5MD 4NCYA 1EB1H 4WJG2 2EA3A 1P57B 3OYPA 1SGYE 1H1BA 1L2EA 1ZMLA 3FFGA 1PQAA 3R0FA 3M5MA 3LGWA 1BBRE 1WTGH 4AG1A 1A61H 3BEUA 4JZFH 3CP7A 2ILNA 1MMJN 2BD9A 5GIBA 3ZZDA 1MTNC 2ANMH 3LH1A 4IBLH 3O8BA 1HAHH 3ATMA 1TNGA 2ZA5A 1CSOE 1JRTA 1Z1IA 3VB6A 5LPFA 3SQEE 3SGQE 5EG4A 1GJ4H 1HPGA 1HV7A 5GPIB 3KQBA 2C3SA 1D9IA 3UQOA 1TMBH 1N8OC 1GBKA 2F3CE 2UWOA 1LHGH 2FLBH 5EU8A 3E6PH 3VXEH 1FY1A 1KXEA 1TOMH 4ABGA 3PWCA 4Q2KA 1QR3E 1FNIA 1EOJA 1F92A 1O39A 4MLFB 1C2LA 1QQUA 2CN0H 3E8LA 2J2UA 3KQDA 1HGTH 4K1TA 3UNRA 1Y59T 1T4VH 4NIYA 2CF9H 1GMCG 2CMYA 1TRMA 2QXJA 4K3JA 1G9IE 1UTJA 4B73A 2KAIA 1Q31A 3A86A 5A8XA 1JWTA 3MH7A 1BQYA 1C5YB 2PTCE 3LDXH 4DY7B 1W12U 4RSPA 1F5LA 1C1MA 2D1JA 1QJ1B 1SMFE 2O8MA 3Q3XA 4GPGA 2FXRA 2XCFA 4OGYA 1WV7H 2HPPH 1QRWA 1IQGA 2VIPA 4OS2A 4ABIA 1OWEA 1P2MA 1Z8RA 1JOUB 2XBXA 4IN2A 1LKBA 3M36A 2XBWA 1O2MA 1L4DA 2AMQA 3RMNH 4ABJA 1BRAA 1VCQA 3B9FH 2NWNA 4LZ1H 1MKXH 1V2JT 3UOPA 1AKSB 2V35A 4ABEA 1IHSH 2XWAA 3A8DA 1WSSH 1GGDC 1O3DA 1NM6A 1FAXA 2PKAA 3RXGA 2PV9B 4HGCA 5L30H 1MCTA 2A4QA 3Q76A 1FY5A 3LGUA 2CV3A 1F7ZA 2ZC9H 1IQIA 2P93A 1OPHB 2ZHQH 5JBCS 3QUMP 1DUAA 4X6OA 3D23A 1DXPA 2WUCA 3Q77A 1EPTC 4TY7A 4X1NU 3RMLH 1PPHE 3E3TA 4TYDA 4FUIA 7GCHF 1BTXA 2OQUA 1UVUH 1VCPA 3ELAH 4ASHA 3EDXB 2M5TA 1HAYB 3T27A 2VIVA 3ZVCA 1KY9A 1NRRH 2Z94A 4O3TA 1D3TB 2XBVA 3NWUA 1SGCA 2ZGJA 4K1EA 1GMDG 2BDYA 3BN9A 3PLBA 1LPZB 1ZOMA 5GJ4B 2P95A 3LOXA 1XKAC 1AI8H 5DPAA 3ZZAA 1EJAA 1O2WA 1O5AB 3PMAB 1HLTH 4NFFA 3UWJH 1GJAB 2G4UA 5SGAE 1HB0B 1ZGIA 1GBEA 2ZNKH 1A0HB 3U1JB 1DDJA 1ESAA 3I77A 1UTMA 4NG9H 2STAE 4OS7A 1O2OA 3M7TA 1YF4A 1C2GA 3P95A 4A1VA 4CRFA 2BD2A 2I6QA 3VGCB 2GX4A 1HXFH 1LCYA
chains in the Genus database with same CATH superfamily
3T62A 5F8TA 3SI3H 4NWLA 3SUEA 2BDCA 1T8OA 1W7GH 4ACAA 4XE4A 3S69A 4BXSA 2R0LA 1TNJA 2THFB 2ZO3H 1W3CA 5AFZH 4A7IB 1YCPM 1O5FH 3E0NB 2C8WB 1AFQB 4OGXA 2HGTH 3ODFA 2WUBA 1ELGA 3GCNA 3SI4H 5GDSH 5C1UA 5AFYH 2PTNA 4A92A 1TBQH 4DURA 1GJ8B 3A7WA 2BLQA 1CGJE 1A0JA 2ZPRA 2V0BA 3SUFA 1C2IA 3LGIA 2XC4A 1L1NA 3CENA 4H6TA 1RTLA 3M3SA 5I25A 1V2PT 2G5VA 1Z8IB 5PTPA 1TA2A 1YM0A 4CRBA 1EOLA 4X6PA 1V2UT 1AO5A 5EJZA 3EAJA 2A5KA 1K1OA 2GCTC 3PO1B 7LPRA 2OC7A 1BTUA 5KEDA 1O3MA 3PTBA 1F0RA 4GVUA 4AB9A 1MH0A 1EASA 4RKOB 3K2UA 1MD7A 1GL0E 4LXBH 3VG8A 2PW8H 1TYNA 1K2I1 1ID5H 1SGEE 1TA6A 2TGPZ 2FX6A 1Y3YA 3BG4C 3ZV8A 1UHBB 1N1LA 2QF0A 3GY5A 1HCGA 3P6ZB 1LVOA 5DP8A 2XWBI 2NU1E 4GUXA 3RC5A 2V6NA 4DT4A 6LPRA 2W6ID 1G2MA 1EATA 3VB3A 2VU8E 4BAKB 2BDAA 4OS6A 2FYRA 3M3TA 3TNSA 1TNHA 1SGIB 1FY4A 3RXOA 1QTFA 3TK5A 2ZWLH 1TALA 1SQTA 1DOJA 1O38A 1UK3A 3TGKE 2Y81A 4AFQA 2P94A 1LVBA 2JDID 1QB9A 3TH2H 3PM3A 4IW4E 1O3AA 1SHYA 4FVBA 1UO6A 2H5CA 3P8GA 1VITG 4YXWD 5DSFA 1BA8B 4I8KA 1C2DA 5DG6A 2D2DA 4ZAEA 2BLWA 1K9OE 4X6NA 5C20A 3A7XA 1LVMA 2O8WA 4BOHA 1KLTA 1OWHA 1OS8A 2PUXB 3MMGA 3U28C 2TIOA 4DOQA 4BTIB 1G2LA 2QGRA 8GCHF 3BTQE 2F9BH 1UTOA 4ZXYH 1G3BA 3DFLA 5JBAS 1ANEA 1EAIA 1TNKA 1UW7A 3KYFA 4X8UH 1AB9B 1EJMA 3VB5A 3DHKH 2IJD1 3ATWA 1MAXA 2Q6DA 1YY3A 1Q3XA 4THNH 3OX7U 3GY7A 1V2RT 1GI6A 1NC6A 3PMJA 1LO6A 1GMDF 4D9QA 1C5RA 2QN5T 2VH0A 2BD3A 1C4V2 2P3TB 1S0RA 1SI5H 2BOKA 5C3NA 2IPHA 4IS5A 2W7UA 1AIXH 1BTPA 5CHAB 1V2ST 2TGTA 2GDEH 3QZQA 2FLRH 3OU0A 5GCHG 1GI8B 1GHAF 1HAVA 2ZTYA 2GKVE 5HMAA 1OWDA 3OSYA 3SYJA 4NSVA 1UVSH 3MO9A 1YKTA 2JETC 1BUIA 2KAIB 2M2AA 3F9HA 1QCPA 2F9OA 1GCTC 5F03A 2QE7D 2QAAA 4KTCA 3PV4A 1JBUH 1FN8A 1AZZA 1K22H 5TCCA 1TNLA 4AGJA 2ZKSA 1C4U2 4TWYA 2QF4A 2SGQE 3ZZ3A 2EI7A 1DWDH 4INHA 2ODYB 2FDAA 5I46H 2QXGA 1S0QA 1J9CH 1C2KA 4AN7A 1BMNH 4ABDA 3RXQA 2VH6A 3QZRA 3TJVA 2ESTE 2OC0A 1FIZA 2ZQ1A 1HJ8A 2Z9GA 3RXCA 1XMNB 1GI0A 1FY3A 1SQOA 5FBIA 2VVCA 1H4WA 3A8BA 1NTPA 1ELBA 2HLDD 1THRH 5FPSA 1TE0A 1YPEH 4ZHAA 1B7XB 1RD3B 2PKAB 3LGYA 5EXMA 3RDZA 1ZSLA 1DWEH 1SLUB 3MTYA 1WTHD 4FU9A 1ZTLA 2WPLS 1DXWA 3VEQB 2SGEE 4ZHLU 3MU1A 4CBOA 1BIOA 1NRNH 4CHAC 4NFEA 3HKJB 1L0ZA 3OTPA 3FOAA 2ZHFH 5AHGH 2A0QB 2VINA 2HWLB 2J94A 4Z0KA 1C5VA 2QIQA 2SNVA 1C5TA 1AVXA 2BY8X 1SHHB 3GY8A 3NRLA 1AMHA 1EFRD 1WAYB 1TLDA 2PLXA 1NROH 2A7CA 4D76A 1HJAC 3SGBE 3S7HB 3URCA 1A7SA 2VWLA 4BAOB 5A0CA 1C5XB 2IOTA 5LGOA 2VIQA 1OP2A 3SO3A 2KZ4A 3UQVA 4Y8ZA 1F5RA 4MPWA 1YPLH 2OTVA 2BY7X 2AIPA 3P70B 3KQCA 3LC3A 1BBRK 1MD8A 2YNBA 3KGPA 3S9AA 1TRNA 3H7OA 1HXEH 1O5EH 1RS0A 1K1PA 1V6DA 1XM1A 3D49H 1BZXE 5HYOA 2Q1JA 2W3KA 2WSSD 2ZGBH 1HAGE 1CU1A 1V2QT 4I7YH 2WHXA 5E0GA 2QCYA 1GG6B 1NFWA 2WV9A 1GHBG 4Y0YE 5JB9S 1EQ9A 2BHGA 2HNTC 2Y5HA 4I33A 3T2NA 3P8FA 2H1UA 1C5OH 4K8BA 4X0WU 2FYQA 2H2ZA 1B0FA 5EW2H 4AFZA 4BXWA 2OCVB 3QDZB 4AGKA 2ZU4A 2A2QH 1XUIA 4HI3A 1Z7KA 1OWJA 4CH8B 5A0BA 4H42U 4HZHA 1O3NA 1C1QA 1CE5A 3A7YA 5DP6A 2PHBA 4OS1A 3U8OH 1GVKB 3U9AH 5ABWA 3RMOH 5FPTA 3GCOA 2ZCKP 1A4WH 2FTMA 4YTAA 4JYVH 2J95A 2Z9IA 1WQVH 1SOZA 4JYTA 2HOBA 1GBJA 2AS9A 2IPQX 3UB0A 3Q00A 1CA0B 1QGFA 2JH0D 2WYJA 4MDSA 4UD9H 3SJ9A 1JIRA 4X1QU 1HFDA 6ESTA 3NK8A 2OD3B 3GY6A 3SJ8A 3UIRA 3SNEA 2ODQA 2VNTA 1SFIA 2FOHA 4NZQA 2O8UA 3LH3A 1ELCA 2ZFTA 3P8OA 2BD7A 3TPIZ 2ANYA 3DFJA 1ZSJA 2FZZA 5E2PA 4B71A 4ZXXH 3SZEA 2D26C 3LGVA 4FVDA 4CRAA 2Z3CA 2BOHB 1AVGH 4Y76A 2CHAC 2Z9JA 2GVFA 4Y11E 3KYGA 2FOBA 5GCHF 2QV1A 1MCVA 1MTNB 1LTOA 2B7DH 3E90B 5HM9A 1LDTT 3VB4A 4DIHH 4U32A 2WV5A 1UTQA 3O8CA 3F9EA 1JMOH 1O2IA 3SBKA 4JYUH 3TIUA 1T7CA 2KCOA 4WXVA 5C0TA 1ZPCA 2UUKB 4GAWA 4Y71A 4RT0A 1ELAA 1QBVH 3SGAE 1MAYA 1LQEA 2O8TA 3LONA 1E79D 1V2KT 5CMXH 2GCHG 3I78A 5K0HA 4ABBA 2DE9A 5CHBA 1EAWA 2ZU2A 2B5TB 1N8OB 1ZGVA 1CA8B 2A5IA 1YPMH 2A31A 1O2SA 1V3XA 2RG3A 3NPSA 4UFGH 4F48B 3KQ5A 4KKDA 1SLWB 3SU1A 1F2SE 1TPSA 3JZ1B 3QGNB 1P2QA 3M61U 1PPGE 1E36B 3NKKA 1HIAA 1Y3UA 3U69H 5KECA 3SNDA 2FODA 1XXFA 5HXFA 3RXMA 1YC0A 4OS4A 3H5CB 1DE7H 1O34A 1IQHA 3PYHA 1ZJDA 4I31A 3WWBA 2GZ9A 4ZROA 4B1TA 1CHOG 4FUHA 1O5DH 1O0DH 3RXUA 4WVPE 4CBNA 2V7QD 3RM2H 1AHTH 3V3MA 3A7ZA 1UTLM 1XUHA 4NIVA 2R3YA 2QXHA 4X6MA 1QIXB 1P3EA 1TQ7B 1ZRBA 1GMHG 2ZDMA 4I86A 1O2PA 1ABJH 2SFAA 3KNXA 2GP9B 3TNTA 4ABFA 3ZZ7A 6CHAC 1ZSKA 3GCTG 1C9TA 2TGDA 5IYTA 5EGMA 5FAHA 6GCHF 5EPYA 2Y7ZA 1MKWH 2GT7A 2HNTE 3M5LA 1YLNA 2L74A 4MG3A 4ZH8A 3MYWA 1S81A 3F6UH 1CT2E 4RN6A 1TMUH 2FOGA 3BSQA 3SOSA 2BD8A 1GGDB 1GJ6A 5TJXA 3P17H 4NWKA 2BQ6B 2H9TH 8ESTE 3SV7A 1BTZA 1QA7A 3RU4T 3TVJB 1HAIH 2PR3A 4MTBA 2GV6A 1N6YA 3HGNA 1P9UA 2KR7A 4NZLA 3QGJA 3ZYDA 5DP5A 1SPJA 1CGIE 2CGAA 1EPTB 1GHBF 1JXPA 4CRDA 1BB0B 2ZDAH 1DWCH 1OYTH 4H4FA 3HPTB 1EZSC 1NPMA 4JZ1A 5IDKA 1ZYOA 5EODA 4B2AA 1DLKB 1GBAA 2VB0A 1SLVB 3ZZ4A 1HJ9A 2WPDD 2PGQB 1YPHE 4ZMAH 1UMAH 4YM9A 1O2VA 1A3BH 1T8LA 4FU8A 2R3UA 1MZAA 3AAUA 2BY6X 3HKIB 3MH6A 3ZVEA 3TK9A 1SGFA 3ATLA 2GMTC 3PMHB 4I8LA 5C1XA 1WUNH 1KDQA 1GI1A 1FPCH 1QBOA 3F9GA 4U2WA 2OBQA 1EB2A 4NIXA 2ANWA 1K1MA 3SHAH 2FS8A 2I6SA 2Y82A 1E1QD 1EZQA 1S84A 3E91A 2DUCA 3RLWH 1YLCA 1ZTJA 3K65B 5JDUB 5FCKA 5EJ1A 2ZHDA 4GHTA 5FX5A 3OTJE 2O9QA 4YT6H 2ZCLP 1TAWA 1C2EA 1XUFA 1UTNA 1GBDA 4X8TH 1G3EA 4OM9A 1MABB 2J98A 5T6FA 4YESB 3HK6B 4UFDH 2LP6A 3MU8A 2F9VA 4Y10E 1MTUA 4CRGA 2GV7A 4JZIA 3RXBA 1AE8H 4AG2A 1TPPA 1ANCA 1O2NA 1MKXK 1KTTB 4F49A 1NZQH 1DANH 1CO7E 1QURH 1P12E 1T32A 4O97A 3RC4A 5DP4A 5DKMA 1GBLA 1P2KA 5EXLA 3W1EA 3QX5H 1LHCH 1WQSA 5FPYA 1ELEE 1EAUA 1NESE 3K6YA 4E7RG 4ZKOU 1W13U 4Z6AH 1SGPE 2G51A 1PJPA 1IQMA 1XUGA 2BY9X 2GCHF 1SG8B 2ZI2H 2XBYA 4ZKNU 3T28A 1PQ5A 3I29A 4MPVA 1DY9A 1NFUA 1V2MT 2YMSD 2FI3E 1P3CA 2A1DB 2GCTB 3GY4A 1RTKA 4NA7A 5B6LA 1CBWC 1S6HA 4YLUA 3H7TA 3DD2H 4LOYH 2FM2A 3V13A 1YCPK 2BLVA 1FN6A 3EQ0H 3SUGA 2PGBB 5FBEA 3GCHC 2ZFFH 4JK5A 3RXJA 1HBTH 1ZLRA 2RA0A 1GJ7B 5FCRA 1SGDE 1MBQA 2F91A 4D7FA 1ANBA 3MO6A 1W7XH 2OC1A 5EPNA 1HAXB 2HPQH 1CHOF 1XX9A 2QC2A 3FP8E 5G4BA 5JB8S 3SHCH 2NU2E 1E34B 3AASA 3TGJE 4JZEH 3ZZ8A 1G32B 3UAIC 4WWYA 4FUBA 1RGQA 5E8EH 4X2XA 3A85A 4P02A 3FZZA 2KM0A 1GMHF 5BPEA 3ZZ6A 3GOVB 1ZHRA 4DJZB 2Y6TA 2FO9A 1FDPA 3ATIA 5J4SA 2SGFE 2J5UA 4KP0A 1PYTC 3OY5U 1SGQE 4H6SB 4WXIA 1NS3A 2PKSC 1NBMD 2FI4E 3ZVGA 1GMCF 4AFSA 1S82A 1O3CA 1K1IA 1LHEH 5HGGA 5EW1H 1O5CB 1NBME 3TLOA 2C8YB 3K6ZA 2P3UB 1O37A 1RRKA 5T6GA 3U8RH 2ZGHA 2EC9H 2P59A 4Q7YA 1BOQA 1IHTH 1WXRA 1A1RA 1DLEA 2ALVA 4ZKSU 2PWXA 2AERH 4RKJB 1Y8TA 1QRXA 3KIDU 3BG8A 3OAAD 5A0AE 2SGAA 2W6JD 2ZU3A 1TFXA 1SGFG 5DK1A 2ZTZA 3UR9A 2BDIA 4U01A 3UY9A 1C2HA 3SNCA 4YZUA 5FX6A 1MU8B 2ZFPH 3E0PB 1LHDH 3PLKA 3ZVDA 4FETA 1O2LA 1A46H 3BV9B 4AB8A 4O03A 3MQKC 3GICB 2J92A 1UTPA 1AUJA 3QWCH 2PP6A 5A8YA 4MVNA 1FY8E 4FUEA 1GBBA 1T8NA 2BZAA 1C1VH 1O30A 7KMEH 4SGBE 3F3BA 1YP9A 3ATKA 1HIAB 2VWMA 1HUTH 2JIZD 1ESTA 4R0IA 4MNYA 1NRQH 1ESBA 1CHGA 1GI9B 2KFWA 2AH4X 4FUCA 5LH8A 1SGNE 5E0HA 5J4QA 3M7UA 4JZDH 2JETB 2BDHA 3SJIA 2H5DA 1QHRB 1GCTB 3A8CA 4YLQH 5T3HA 3ZZ9A 3TK6A 1O2TA 3A84A 2XOKD 4CREA 3UPEA 2K8IA 1SQRA 3A89A 3GDUA 1O35A 4U30A 2FMJA 2XCNA 1K1JA 3BTFE 4ZCNA 1B5GH 5DO4H 1FQ3A 3F2HA 1P02A 1ZHPA 1WCZA 2A32A 1TGTA 1RIWC 2BD4A 1C5ZB 2OQ5A 1GBIA 3V0XA 2FIRH 3NUMA 5HM2A 1S85A 3GYMA 1ELVA 2XTTB 3Q3KA 3LC5A 1O3JA 1QQ4A 2YNAA 4AFUA 1T31A 5F53A 2F9UA 4ISLA 2FOCA 1KSNA 3EYDA 4X8SH 4VGCC 5EQSA 2OXSA 3RXVA 2ZIQH 3RMMH 3RXSA 1L1JA 2Z7FE 1AY6H 3AW0A 1IOEA 5CDFE 1D3QB 2SNWA 2VGCC 2FESH 4NIWA 2BXUH 1AZ8A 1GHXH 1SLXB 1H8ED 2JKHA 3ZZ5A 1EX3A 1AWHB 2BM2A 2ZDKA 4DIIH 4INKA 4CHAB 2HVYB 2VVUA 3T29A 1BT7A 3BIVH 4DGJA 2BYAX 2Y7XA 1GI4A 2FP7B 1TX7A 1TGNA 1KLJH 4KTUA 1FZZA 4K2YA 1GDNA 1PYTD 2BVRH 1GJBB 4X1SU 3EE7A 1LPGB 1BHXB 2BX3A 4XRNA 3FZDA 5C94A 1HJAB 4AYYB 1CT4E 5AF9H 3MH4A 4A1XA 1O3HA 1KXCA 3A80A 3SJOA 1A3EH 3SUDA 4A5TS 1Y3WA 1VGCC 1D3DB 3LGTA 8LPRA 1W8BH 2WYGA 3BTTE 3STJA 3PLPA 3QK1A 1H9HE 4AYVB 3VXFH 1GCDA 2ZQ2A 1F0TA 2OP9A 2R2WU 3B8JA 2FX4A 1RTFB 1V2NT 3A88A 1HRTH 2PSXA 3ITIA 4K69A 4TY6A 3SORA 1EUFA 3ZVAA 2ZFRH 4FXGH 3A8AA 1KXFA 4P00A 1O3OA 4X2YA 1FIWA 1EZUC 2BB4A 2F43B 3JZ2B 5C0UA 4KELA 3DSPA 1UTKA 2F9PA 1W0YH 2QF3A 3F2FA 2XC0A 2QF5A 2OLGA 1O3EA 3B23B 2J98B 3URDA 3U1IB 1TPOA 1P11E 4X1PU 5C5NA 4AORA 1HYLA 2LELA 3C27B 4MNXA 4E7NA 2AMPA 2AYWA 4CH2B 4INLA 4Q7XA 4AX9H 1P9SA 1BDAA 3TITA 1BTHH 2V3MA 5LPRA 1J17T 1BHXF 1KTSB 1YGCH 3GISB 4K8YA 4X2VA 1H9LB 1DPOA 1NN6A 2P8OC 4X8VH 1OHHD 2JJ1D 1IQKA 2J4IA 4CR5A 3LU9B 3UNQA 1W14U 2WZQA 1C1RA 3SQHE 1ARBA 3A82A 5C5OA 1KXAA 1KXDA 1SC8U 3MWIU 2OBOA 4WH6A 4Y7AA 1Y3XA 1CT0E 1UCYH 2VWOA 1VITF 1FX0B 1C2MA 1G3CA 3SV9A 2A5AA 4WMFA 3UNSA 3S7KB 1MZDA 1LPKB 2ZDLA 4DT7B 4XDEA 3SV2H 1W0JD 2CHAB 4ZHMU 1EJNA 3RC6A 1M9UA 5EIYA 4ZKRU 2Z6BD 1O2ZA 4D7GA 4IC5A 2PSYA 1PPBH 4GHQA 5EQQA 2KCPA 1EXFA 1C9PA 2VBCA 4F4OC 3SU6A 3ZVFA 3VFEA 5L6NH 4BNRA 4E05H 1TB6H 2W5EA 1FJSA 3GDVA 1A2CH 1THPB 1YPHC 1HAPH 1A5GH 1O2QA 1ANDA 1NO9H 2GTBA 1TPAE 2GZ7A 2XRCA 3VPKA 5A2MH 5DP9A 2IJOB 2A4RA 1Y5AT 4Q63A 1EP5A 5C1YA 2AGGX 2VIDA 1HAZB 1Z1JA 4XFQA 3GY3A 4Z1MD 1FAKH 1Z6JH 1YLDA 1BJUA 4A6LA 1PPZA 3S0NA 1IQEA 3SU5A 7GCHG 1O2GH 5A8ZA 5ESTE 1D4PB 3MU5A 1TBRH 2GJGA 2PUQH 3EE0B 3OFND 2B8OH 5L2YH 2XC5A 1UK4A 2CJIA 4B74A 1O32A 1OX1A 3UTUH 4E06H 1HDTH 3TJUA 3K9XB 1OKXA 2BVXH 3RXTA 5E0JA 2ZPQA 3ENSB 2WPMS 4HFPB 2FI5E 3F0PA 2AFQB 1YPKH 2WV4A 4FUFA 1QL9A 1P10A 2H6MA 1S5SA 2UUJB 3NZIA 4UFFH 1C5LH 4YOGA 3L3TA 5EXNA 1ZPZA 2RCEA 3GS9A 3RP2A 2ZU1A 4UDWH 1QL7A 1RXPA 1G36A 5EJLA 2HLCA 1JRSA 1TRYA 4AC9A 4WY3A 1P2OA 1VR1H 6CHAB 1XKBC 1NFXA 1DSUA 1E0FD 1SGTA 2UUYA 1DSTA 4Y79A 1P8VC 1ZJKA 5HIYA 2WPHS 2Z3EA 1BRCE 2KCAA 1KXBA 1PQ8A 2J9NA 4GCHG 3BTDE 4FOUC 1GJ5H 2BXTH 2C8XB 3DCLA 1C2JA 1PPCE 2Y80A 3A81A 1OOKB 4M7GA 1SQAA 1ELFA 4KTSA 3SN8A 1O2YA 4SGAE 1XXDA 2C4FH 2NU0E 3RXEA 4NA8A 1TMTH 5GNDA 1LVYA 4BANB 3PWBA 4JK6A 1BCUH 1SVPA 1ZMJA 1DUEA 1K1NA 2G81E 2Q6FA 2UUFB 1O3BA 4K1SA 4AZ2B 1DITH 3M35A 2NU3E 4NSYA 2YMSC 2ZDVH 3EGKH 3BTME 2IN2A 1O2HA 1J16A 2P16A 3LPRA 3MU0A 1QJ6B 1GBFA 2ZZUH 2WINI 1QJ7B 1W2KH 2BDGA 3T5FH 1GJ9B 2GD4B 2R9PA 3AK5A 3UR6A 1O3KA 1KYNA 2ZU5A 2BTCE 1GWAA 4PROA 1E35B 3N7DA 4FUDA 1P2IA 1V2OT 1IQLA 3SV8A 2FOFA 2BZ6H 2GMTB 3ESTA 1OWKA 1MU6B 1QY6A 1GVZA 2PFEA 2ZGXH 4XD7D 1XVMA 2GT8A 2H9EH 3FP6E 1HAVB 4QT8C 2EI6A 4Y8XA 1ZRKA 1B0EA 1K1LA 2FPZA 1AWFH 2HVXA 1ORFA 1E1RD 1C5WB 1IQNA 2BQ7B 3DT0H 1SL3A 4O3UA 1FV9A 4TSFD 1C5NH 3BTGE 3ZIAD 3U8TH 2ZPSA 4I8GA 5TCAA 1ABIH 1UCYE 1MTWA 1EZXC 1G3DA 2UWPA 1VKYA 2B9LA 1IQJA 1TOCB 2Z9LA 3AW1A 4M9FA 3RXIA 2G55A 3SJKA 1QFKH 4I8JA 1BMLA 2OUAA 3ZYEA 5DJ7A 2ZF0H 1J8AA 1MKWK 1C2FA 1LHFH 1A5HA 4ABHA 1W11U 4B6EA 1NT1A 1S6FA 3AVZA 1C4Y2 4DVAU 1UVPA 5LPEA 2BDBA 2L6OA 3UOUA 1GDQA 1DM4B 3PB1E 4FU7A 5E2OA 4IMQA 3OE7D 1DY8A 1YPGH 1GBMA 2R2MB 1GI7B 1O5BB 1O31A 2G52A 4XSKU 3W94A 1FLEE 1GI2A 5C17A 8GCHG 3A7VA 1GI5A 2NU4E 5AVDA 5FHTA 3D62A 4CR9A 1FXYA 3M37A 4Q80A 3PROA 1J14A 1GVLA 3SU4A 3E1XB 1IAUA 1WU1A 1CBWB 1ZTKA 3M3VA 7ESTE 1OXGA 4X1RU 1YCPH 2AIQA 5CE1A 3DUXH 1DT2A 5L2ZH 2WPIS 1SGRE 3GCHB 1QRZA 1XUKA 4B75A 2AEIH 2GZ8A 2QYIA 2J38A 1C1UH 1ELTA 3G01A 4UE7H 2Y5FA 1ZR0A 5HIZA 1GHAG 4YT7H 2FOAA 1SSXA 4OS5A 3RUOA 1W10U 1HAOH 1NRPH 2F83A 3FP7E 2BMGB 5B6OA 3KF2A 3N7EA 5DN6D 3UWIA 1GHVH 3LIWA 1N6XA 2AHME 2W26A 4JMYA 8KME2 4LK4A 5DP7A 4UFEH 4R8TB 3HGPA 3NXPA 1IQFA 4I32A 2PKSB 2XW9A 3RU4D 1MUEB 1DX5M 1V2WT 1VJ9U 3PRBA 3SNBA 4GCHF 1P2JA 2A45B 1D6WA 4K60A 2G00A 3RU4E 2A4OA 3SU0A 3BG4B 1Z8GA 4WMDA 5C2ZA 1BTYA 3HATH 2LPRA 1NU9A 1UJ1A 3A7TA 2TGAA 1O2XA 3CS7A 3P8NA 3SU3A 3F9FA 3E16B 4DW2U 1C5QA 3SW2B 3ZZCA 4F55A 1RJXB 2OK5A 2V3OH 2ZECA 4FUGA 4NA9H 2VJ1A 2FOEA 1K21H 3GCTF 1O33A 1TWXB 1WBGB 2RFKC 1FONA 3TJOA 4X2WA 5FXLA 3VGCC 3QTOH 4XBDA 1MQ5A 2QA9E 1P0SH 3A83A 1W0ZU 1C5SA 2UWLA 4J2YB 3MO3A 1WYKA 5FL7D 1GJDB 4DG4A 1ETTH 1ACBE 1NU7B 1ETSH 1THSH 4IN1A 3WWFA 1CGHA 3BF6H 1OP8A 2RA3A 2A4GA 2STBE 3WY8A 1AFQC 3SU2A 4D9RA 3SZNA 1DWBH 2BLOA 1GPZA 4TPYA 1GBHA 3MOCA 4ESTE 2A7HA 1GHZA 4BAHB 2A2XH 1Z8JB 4B2CA 1GL1A 3KCGH 4GLYA 1QBNA 2ZFQH 3KHVA 3L6PA 1VZQH 9LPRA 2FEQH 1BRBE 3ZZBA 3EA9A 3QN7A 4ISOA 1FPHH 1XVOA 3FO8D 4IGDA 2TRMA 2F9NA 4TPIZ 1BJVA 3MNCA 3TH4H 5GXPA 2ANKH 4MQAA 4ISNA 5DGJA 3PO1C 2K1QA 3PRDA 4ACBA 1RIWB 4B6FA 4WMEA 3VB7A 1INCA 4MPUA 1OSSA 3GYLB 4ISHH 4BAMB 5GWZA 3FANA 3GY2A 3N99A 1NFYA 1ZHMA 3SV6A 1E37B 2GDDA 2ZG0H 3KQEA 4JCNA 4O9VA 1V2TT 1QB1A 1TIOA 3STIA 4ABAA 1GBCA 4VGCB 1YWUA 3M5NA 3IG6B 1O3LA 4XBBA 1G37A 1JIMA 2VGCB 1TGCA 3T26A 2SGDE 5KGOA 3N7OA 4WH8A 3MFJA 1H8IH 4XBCA 1TQ0B 1E38B 2KX4A 1V2LT 1L4ZA 2FOMB 2ZEBA 1ARCA 2AMDA 1C1NA 3Q3YA 4IMZA 1CQQA 3LJOA 1V2VT 1O5GH 2ZTXA 5K7RA 1SFQB 2J97A 1FMGA 3BIUH 1OP0A 1O2KA 3TU7H 2LNCA 3W95A 2ZHWH 1SB1H 1MQ6A 2ALPA 4KGAA 5BRRE 9ESTA 1O3FA 4B76A 1CVWH 1GHWH 2QY0B 3C1KA 1VGCB 1LMWB 2TPIZ 5T6DA 1TGBA 2D8WA 1QZ8A 2DE8A 3O8DA 1QL8A 1X7AC 4FUJA 3V7TA 3OEHD 1O3GA 2ZCHP 2JH5D 1TABE 3FN8A 5F6MA 2ODPA 1VJAU 3RXHA 2B0FA 1Y3VA 1DICA 3BTKE 3PV2A 1EPTA 3R3GB 1GHYH 1YPJH 1DFPA 1AB9C 3D65E 2FTLE 2W7SA 1O36A 1GBTA 1O3IA 5ESBA 5JBBS 5ETXA 1YYY1 2VVVA 3UFAA 1AKSA 5IK2D 1YBWA 4MNWA 3KN2A 4DCDA 1TBZH 1Q2WA 2FS9A 3V12A 4YOIA 2CXVA 3MNBA 1PFXC 3P92A 1ELDE 4Y6DA 4CRCA 1GDUA 1HNEE 2YOLA 5F8XA 5CHAC 1KDQB 1UK2A 1Y5BT 4I8HA 1O2JA 1A5IA 1BBRH 3HK3B 2OC8A 1H8DH 1BMAA 2HRVA 3A87A 3NCLA 3PMBB 4UEHH 4ZUHA 2OINA 2P8OB 1H8HD 2ZDNA 2P3FH 4ISIH 1T4UH 3RM0H 2WPJS 2ZGCA 4YO9A 2C93B 3OEED 4HTCH 2O8LA 1K28D 1S83A 1Z6EA 3MHWU 2BX4A 1UVOA 3PTNA 1MTSA 1SOTA 1ZMNA 1P04A 2BD5A 3TJNA 3DSOA 2G4TA 5JYIA 1P09A 2Y5GA 1KLIH 1UVTH 1NRSH 3M7QA 3MI4A 5H4IB 2Z9KA 2WPKS 1PPEE 3GDSA 3U98H 3BEFB 4TT3D 3UREA 3QLPH 1BMMH 1TNIA 1P05A 1VITH 3FVFB 1VCWA 1AN1E 1EAXA 1GJCB 1D3PB 6GCHG 2VIWA 1TGSZ 3BTWE 1C5UA 1D6RA 2VWNA 3CS0A 1ETRH 1FI8A 3DSGA 4YOJA 1TX8A 3KEEA 1SR5C 3KL6A 4BTUB 5JPMH 1F0SA 1TONA 1SKYE 3MH5A 3QTVH 3S9BA 1RFNA 3RXKA 1AVWA 3L33A 1DVAH 1QA0A 2TBSA 3F0OA 2AGIX 3RXFA 2RDLA 1J15A 1DS2E 2K0QA 3FAOA 1F5KU 3LKWA 2CF8H 2XYAA 2EEKA 1OYQA 4GSOA 4Y0ZE 3O8RA 3M5OA 1EP6A 3MNXA 3H09A 2H9HA 5JBTA 3S9CA 1G30B 3SNAA 1K0HA 3IITA 1XUJA 3EA7A 4Q4LA 4TWWA 1MTVA 3ZVBA 4XOJA 4B2BA 4LZ4B 1GI3A 3RXDA 3TH3H 3DA9B 2HNTF 1Y5UT 4A1TA 1QNJA 3F68H 4Y7BA 4AOQA 4MPXA 3LT3A 3BEIB 1TX6A 2XNIA 2G5NA 1O2UA 1C1TA 2EQNA 4K5ZA 2G8TA 3RLYH 1C1WH 3EA8A 5F8ZA 1P06A 2HALA 3MU4A 2R0KA 2XXLA 2Z3DA 3BTEE 5HKKD 1AE5A 1AU8A 1C5PA 1P01A 3LJJA 2EI8A 1PQ7A 4UONA 1AUTC 1KIGH 1LQDB 3RXAA 2C8ZB 4D8NA 1MBMA 2BY5X 3T25A 2ZFSA 1GG6C 5A09A 1WOFA 2A7JA 5EQRA 1C1SA 1A0LA 1AD8H 1O3PB 2J34A 1ZZZA 3UUZA 3RXLA 1ZPBA 3AAVA 4WF8A 1W0KD 1C1PA 2BQWB 2ULLA 2W3IA 1QB6A 1H9IE 1C1OA 1SBWA 4Q7ZA 1BITA 4J1YA 4BTTB 1U6QA 1UCYK 1L1GA 2V3HH 3TGIE 3MNSA 1T8MA 2RDEA 1WDIA 3BTHE 2QXIA 3OY6U 2GGVB 5C67A 2VIOA 4MNVA 2FWWA 1AGJA 4BAQB 1UHBA 1BRUP 1LKAA 3CNRA 1AQ7A 3IWMA 1BTWA 1EKBB 1Z71A 1O2RA 5DP3A 1P03A 3RXPA 1FUJA 2BVSH 4NGAH 2ASUB 1CA0C 1PPFE 2Q6GA 1P2NA 3WW7A 2YMSB 1NY22 2C90B 2ZHEH 3F1SB 4Y8YA 3RXRA 3ODDA 5EOKA 2AGEX 1BMFD 2SGPE 1F0UA 3QO6A 3ZV9A 2JH6D 4HG6A 1AFEH 1OWIA 4IC6A 2ZP0H 1C5MD 4NCYA 1EB1H 4WJG2 2EA3A 1P57B 3OYPA 1SGYE 1H1BA 1L2EA 1ZMLA 3FFGA 1PQAA 3R0FA 3M5MA 3LGWA 1BBRE 1WTGH 4AG1A 1A61H 3BEUA 4JZFH 3CP7A 2ILNA 1MMJN 2BD9A 5GIBA 3ZZDA 1MTNC 2ANMH 3LH1A 4IBLH 3O8BA 1HAHH 3ATMA 1TNGA 2ZA5A 1CSOE 1JRTA 1Z1IA 3VB6A 5LPFA 3SQEE 3SGQE 5EG4A 1GJ4H 1HPGA 1HV7A 5GPIB 3KQBA 2C3SA 1D9IA 3UQOA 1TMBH 1N8OC 1GBKA 2F3CE 2UWOA 1LHGH 2FLBH 5EU8A 3E6PH 3VXEH 1FY1A 1KXEA 1TOMH 4ABGA 3PWCA 4Q2KA 1QR3E 1FNIA 1EOJA 1F92A 1O39A 4MLFB 1C2LA 1QQUA 2CN0H 3E8LA 2J2UA 3KQDA 1HGTH 4K1TA 3UNRA 1Y59T 4RT1A 4ASUD 1T4VH 4NIYA 2CF9H 1GMCG 2CMYA 1TRMA 2QXJA 4K3JA 1G9IE 1UTJA 2EY4C 2KAIA 4B73A 2F4LA 1Q31A 3A86A 5A8XA 1JWTA 3MH7A 1BQYA 1C5YB 2PTCE 3LDXH 4DY7B 1COWD 1W12U 4RSPA 1F5LA 1C1MA 2D1JA 1QJ1B 1SMFE 2O8MA 3Q3XA 4GPGA 2FXRA 2XCFA 4OGYA 1WV7H 2HPPH 1QRWA 1IQGA 2VIPA 4OS2A 4ABIA 1OWEA 1P2MA 2CK3D 1Z8RA 1JOUB 2XBXA 4IN2A 1LKBA 3M36A 2XBWA 1O2MA 1L4DA 2AMQA 3RMNH 4ABJA 1BRAA 1VCQA 3B9FH 2NWNA 4LZ1H 1MKXH 1V2JT 3UOPA 1AKSB 2V35A 4ABEA 1IHSH 2XWAA 3A8DA 1WSSH 1GGDC 1O3DA 1NM6A 1FAXA 2PKAA 3RXGA 2PV9B 4HGCA 5L30H 1MCTA 2A4QA 3Q76A 1FY5A 3LGUA 2CV3A 2JJ2D 1F7ZA 2ZC9H 3PV5A 1IQIA 2P93A 3F2GA 1OPHB 2ZHQH 5JBCS 3QUMP 1DUAA 4X6OA 3D23A 1DXPA 2WUCA 3Q77A 3FKSD 1EPTC 2XNDD 4TY7A 4X1NU 3RMLH 1PPHE 3E3TA 4TYDA 4FUIA 7GCHF 1BTXA 2OQUA 1UVUH 1VCPA 3ELAH 4ASHA 3EDXB 2M5TA 1HAYB 3T27A 2VIVA 3ZVCA 1KY9A 1NRRH 2Z94A 4O3TA 1D3TB 2XBVA 3NWUA 1SGCA 2ZGJA 4K1EA 1GMDG 2BDYA 3BN9A 3PLBA 1LPZB 1ZOMA 5GJ4B 2P95A 3LOXA 4RI0A 1XKAC 1AI8H 5DPAA 3ZZAA 1EJAA 1O2WA 5T1VA 1O5AB 3PMAB 1KMHB 1HLTH 4NFFA 3UWJH 1GJAB 2G4UA 5SGAE 1HB0B 1ZGIA 1GBEA 2KCYA 2ZNKH 1A0HB 3U1JB 1DDJA 1ESAA 3I77A 1UTMA 4NG9H 2STAE 4OS7A 1O2OA 3M7TA 1YF4A 1C2GA 3P95A 4A1VA 4CRFA 2BD2A 2I6QA 3VGCB 2GX4A 1HXFH 1S6LA 1LCYA
chains in the Genus database with same CATH topology
3T62A 5F8TA 3SI3H 4NWLA 3SUEA 2BDCA 1T8OA 1W7GH 4XE4A 3S69A 4BXSA 2R0LA 1TNJA 2THFB 2ZO3H 1W3CA 5AFZH 4A7IB 1YCPM 1O5FH 3E0NB 2C8WB 1AFQB 4OGXA 2HGTH 3ODFA 2WUBA 1ELGA 3GCNA 3SI4H 5GDSH 5C1UA 5AFYH 2PTNA 4A92A 1TBQH 4DURA 1GJ8B 3A7WA 2BLQA 1CGJE 1A0JA 2ZPRA 2V0BA 3SUFA 1C2IA 3LGIA 2XC4A 1L1NA 3CENA 4H6TA 1RTLA 3M3SA 5I25A 1V2PT 2G5VA 1Z8IB 5PTPA 1TA2A 1YM0A 4CRBA 1EOLA 4X6PA 1V2UT 1AO5A 3EAJA 2A5KA 1K1OA 2GCTC 3PO1B 7LPRA 2OC7A 1BTUA 1O3MA 3PTBA 1F0RA 4GVUA 4AB9A 1MH0A 1EASA 4RKOB 3K2UA 1MD7A 1GL0E 4LXBH 2PW8H 1TYNA 1K2I1 1ID5H 1SGEE 1TA6A 2TGPZ 2FX6A 1Y3YA 3BG4C 3ZV8A 1UHBB 1N1LA 2QF0A 3GY5A 1HCGA 3P6ZB 1LVOA 5DP8A 2XWBI 2NU1E 4GUXA 3RC5A 2V6NA 6LPRA 1G2MA 1EATA 3VB3A 2VU8E 4BAKB 2BDAA 4OS6A 2FYRA 3M3TA 3TNSA 1TNHA 1SGIB 1FY4A 3RXOA 1QTFA 3TK5A 2ZWLH 1TALA 1SQTA 1DOJA 1O38A 1UK3A 3TGKE 2Y81A 4AFQA 2P94A 1LVBA 1QB9A 3TH2H 3PM3A 4IW4E 1O3AA 1SHYA 4FVBA 1UO6A 2H5CA 3P8GA 1VITG 1BA8B 4I8KA 1C2DA 5DG6A 2D2DA 4ZAEA 2BLWA 1K9OE 4X6NA 5C20A 3A7XA 1LVMA 2O8WA 4BOHA 1KLTA 1OWHA 1OS8A 2PUXB 3MMGA 2TIOA 4DOQA 4BTIB 1G2LA 2QGRA 8GCHF 3BTQE 2F9BH 1UTOA 4ZXYH 1G3BA 3DFLA 5JBAS 1ANEA 1EAIA 1TNKA 4X8UH 1AB9B 1EJMA 3VB5A 3DHKH 3ATWA 1MAXA 2Q6DA 1Q3XA 4THNH 3OX7U 3GY7A 1V2RT 1GI6A 1NC6A 3PMJA 1LO6A 1GMDF 4D9QA 1C5RA 2QN5T 2VH0A 2BD3A 1C4V2 2P3TB 1S0RA 1SI5H 2BOKA 5C3NA 2IPHA 4IS5A 2W7UA 1AIXH 1BTPA 5CHAB 1V2ST 2TGTA 2GDEH 3QZQA 2FLRH 3OU0A 5GCHG 1GI8B 1GHAF 1HAVA 2ZTYA 2GKVE 5HMAA 1OWDA 3OSYA 4NSVA 1UVSH 3MO9A 1YKTA 2JETC 1BUIA 2KAIB 3F9HA 1QCPA 2F9OA 1GCTC 5F03A 2QAAA 4KTCA 3PV4A 1JBUH 1FN8A 1AZZA 1K22H 5TCCA 1TNLA 4AGJA 2ZKSA 1C4U2 4TWYA 2SGQE 3ZZ3A 2EI7A 1DWDH 4INHA 2ODYB 2FDAA 5I46H 2QXGA 1S0QA 1J9CH 1C2KA 4AN7A 1BMNH 4ABDA 3RXQA 2VH6A 3QZRA 3TJVA 2ESTE 2OC0A 1FIZA 2ZQ1A 1HJ8A 2Z9GA 3RXCA 1XMNB 1GI0A 1FY3A 1SQOA 5FBIA 2VVCA 1H4WA 3A8BA 1NTPA 1ELBA 1THRH 5FPSA 1TE0A 1YPEH 4ZHAA 1B7XB 1RD3B 2PKAB 3LGYA 5EXMA 3RDZA 1ZSLA 1DWEH 1SLUB 3MTYA 1WTHD 4FU9A 1ZTLA 2WPLS 1DXWA 3VEQB 2SGEE 4ZHLU 3MU1A 4CBOA 1BIOA 1NRNH 4CHAC 4NFEA 3HKJB 1L0ZA 2ZHFH 5AHGH 2A0QB 2VINA 2HWLB 2J94A 4Z0KA 1C5VA 2QIQA 2SNVA 1C5TA 1AVXA 2BY8X 1SHHB 3GY8A 1AMHA 1WAYB 1TLDA 2PLXA 1NROH 2A7CA 4D76A 1HJAC 3SGBE 3S7HB 3URCA 1A7SA 2VWLA 4BAOB 5A0CA 1C5XB 2IOTA 5LGOA 2VIQA 1OP2A 3SO3A 3UQVA 4Y8ZA 1F5RA 4MPWA 1YPLH 2OTVA 2BY7X 2AIPA 3P70B 3KQCA 3LC3A 1BBRK 1MD8A 2YNBA 3KGPA 3S9AA 1TRNA 3H7OA 1HXEH 1O5EH 1RS0A 1K1PA 1V6DA 1XM1A 3D49H 1BZXE 5HYOA 2Q1JA 2W3KA 2ZGBH 1HAGE 1CU1A 1V2QT 4I7YH 5E0GA 2QCYA 1GG6B 1NFWA 1GHBG 4Y0YE 5JB9S 1EQ9A 2BHGA 2HNTC 2Y5HA 4I33A 3T2NA 3P8FA 2H1UA 1C5OH 4K8BA 4X0WU 2FYQA 2H2ZA 1B0FA 5EW2H 4AFZA 4BXWA 2OCVB 3QDZB 4AGKA 2ZU4A 2A2QH 1XUIA 4HI3A 1Z7KA 1OWJA 4CH8B 5A0BA 4H42U 4HZHA 1O3NA 1C1QA 1CE5A 3A7YA 5DP6A 2PHBA 4OS1A 3U8OH 1GVKB 3U9AH 5ABWA 3RMOH 5FPTA 3GCOA 2ZCKP 1A4WH 2FTMA 4YTAA 4JYVH 2J95A 2Z9IA 1WQVH 1SOZA 4JYTA 2HOBA 1GBJA 2AS9A 3Q00A 1CA0B 1QGFA 2JH0D 2WYJA 4MDSA 4UD9H 3SJ9A 1JIRA 4X1QU 1HFDA 6ESTA 3NK8A 2OD3B 3GY6A 3SJ8A 3UIRA 3SNEA 2ODQA 2VNTA 1SFIA 2FOHA 4NZQA 2O8UA 3LH3A 1ELCA 2ZFTA 3P8OA 2BD7A 3TPIZ 2ANYA 3DFJA 1ZSJA 2FZZA 5E2PA 4B71A 4ZXXH 2D26C 3LGVA 4FVDA 4CRAA 2Z3CA 2BOHB 1AVGH 4Y76A 2CHAC 2Z9JA 2GVFA 4Y11E 2FOBA 5GCHF 2QV1A 1MCVA 1MTNB 1LTOA 2B7DH 3E90B 5HM9A 1LDTT 3VB4A 4DIHH 4U32A 2WV5A 1UTQA 3O8CA 3F9EA 1JMOH 1O2IA 3SBKA 4JYUH 3TIUA 1T7CA 4WXVA 1ZPCA 2UUKB 4GAWA 4Y71A 1ELAA 1QBVH 3SGAE 1MAYA 1LQEA 2O8TA 3LONA 1V2KT 5CMXH 2GCHG 3I78A 5K0HA 4ABBA 2DE9A 1EAWA 2ZU2A 2B5TB 1N8OB 1ZGVA 1CA8B 2A5IA 1YPMH 2A31A 1O2SA 1V3XA 2RG3A 3NPSA 4UFGH 4KKDA 1SLWB 3SU1A 1F2SE 1TPSA 3JZ1B 3QGNB 1P2QA 3M61U 1PPGE 1E36B 3NKKA 1HIAA 1Y3UA 3U69H 3SNDA 2FODA 1XXFA 5HXFA 3RXMA 1YC0A 4OS4A 3H5CB 1DE7H 1O34A 1IQHA 3PYHA 1ZJDA 4I31A 2GZ9A 4ZROA 4B1TA 1CHOG 4FUHA 1O5DH 1O0DH 3RXUA 4WVPE 4CBNA 3RM2H 1AHTH 3V3MA 3A7ZA 1UTLM 1XUHA 4NIVA 2R3YA 2QXHA 4X6MA 1QIXB 1P3EA 1TQ7B 1ZRBA 1GMHG 2ZDMA 1O2PA 1ABJH 2SFAA 3KNXA 2GP9B 3TNTA 4ABFA 3ZZ7A 6CHAC 1ZSKA 3GCTG 1C9TA 2TGDA 5IYTA 5EGMA 5FAHA 6GCHF 5EPYA 2Y7ZA 1MKWH 2GT7A 2HNTE 3M5LA 4MG3A 4ZH8A 3MYWA 1S81A 3F6UH 1CT2E 4RN6A 1TMUH 2FOGA 3BSQA 3SOSA 2BD8A 1GGDB 1GJ6A 5TJXA 3P17H 4NWKA 2BQ6B 2H9TH 8ESTE 3SV7A 1BTZA 1QA7A 3RU4T 3TVJB 1HAIH 2PR3A 4MTBA 2GV6A 1N6YA 3HGNA 1P9UA 4NZLA 3QGJA 3ZYDA 5DP5A 1SPJA 1CGIE 2CGAA 1EPTB 1GHBF 1JXPA 4CRDA 1BB0B 2ZDAH 1DWCH 1OYTH 4H4FA 3HPTB 1EZSC 1NPMA 4JZ1A 5IDKA 1ZYOA 5EODA 4B2AA 1DLKB 1GBAA 2VB0A 1SLVB 3ZZ4A 1HJ9A 2PGQB 1YPHE 4ZMAH 1UMAH 4YM9A 1O2VA 1A3BH 1T8LA 4FU8A 2R3UA 1MZAA 3AAUA 2BY6X 3HKIB 3MH6A 3ZVEA 3TK9A 1SGFA 3ATLA 2GMTC 3PMHB 4I8LA 5C1XA 1WUNH 1KDQA 1GI1A 1FPCH 1QBOA 3F9GA 4U2WA 2OBQA 1EB2A 4NIXA 2ANWA 1K1MA 3SHAH 2FS8A 2I6SA 2Y82A 1EZQA 1S84A 3E91A 2DUCA 3RLWH 1YLCA 1ZTJA 3K65B 5JDUB 5FCKA 2ZHDA 4GHTA 5FX5A 3OTJE 2O9QA 4YT6H 2ZCLP 1TAWA 1C2EA 1XUFA 1UTNA 1GBDA 4X8TH 1G3EA 5T6FA 4YESB 3HK6B 4UFDH 3MU8A 2F9VA 4Y10E 1MTUA 4CRGA 2GV7A 4JZIA 3RXBA 1AE8H 4AG2A 1TPPA 1ANCA 1O2NA 1MKXK 1KTTB 4F49A 1NZQH 1DANH 1CO7E 1QURH 1P12E 1T32A 4O97A 3RC4A 5DP4A 5DKMA 1GBLA 1P2KA 5EXLA 3QX5H 1LHCH 1WQSA 5FPYA 1ELEE 1EAUA 1NESE 3K6YA 4E7RG 4ZKOU 1W13U 4Z6AH 1SGPE 2G51A 1PJPA 1IQMA 1XUGA 2BY9X 2GCHF 1SG8B 2ZI2H 2XBYA 4ZKNU 3T28A 1PQ5A 3I29A 4MPVA 1DY9A 1NFUA 1V2MT 2FI3E 1P3CA 2A1DB 2GCTB 3GY4A 1RTKA 4NA7A 1CBWC 1S6HA 4YLUA 3H7TA 3DD2H 4LOYH 2FM2A 3V13A 1YCPK 2BLVA 1FN6A 3EQ0H 3SUGA 2PGBB 5FBEA 3GCHC 2ZFFH 4JK5A 3RXJA 1HBTH 1ZLRA 2RA0A 1GJ7B 5FCRA 1SGDE 1MBQA 2F91A 4D7FA 1ANBA 3MO6A 1W7XH 2OC1A 5EPNA 1HAXB 2HPQH 1CHOF 1XX9A 2QC2A 3FP8E 5G4BA 5JB8S 3SHCH 2NU2E 1E34B 3AASA 3TGJE 4JZEH 3ZZ8A 1G32B 4WWYA 4FUBA 1RGQA 5E8EH 4X2XA 3A85A 3FZZA 1GMHF 5BPEA 3ZZ6A 3GOVB 1ZHRA 4DJZB 2Y6TA 2FO9A 1FDPA 3ATIA 5J4SA 2SGFE 4KP0A 1PYTC 3OY5U 1SGQE 4H6SB 4WXIA 1NS3A 2PKSC 2FI4E 3ZVGA 1GMCF 4AFSA 1S82A 1O3CA 1K1IA 1LHEH 5HGGA 5EW1H 1O5CB 3TLOA 2C8YB 3K6ZA 2P3UB 1O37A 1RRKA 5T6GA 3U8RH 2ZGHA 2EC9H 2P59A 4Q7YA 1BOQA 1IHTH 1A1RA 1DLEA 2ALVA 4ZKSU 2PWXA 2AERH 4RKJB 1Y8TA 1QRXA 3KIDU 3BG8A 5A0AE 2SGAA 2ZU3A 1TFXA 1SGFG 5DK1A 2ZTZA 3UR9A 2BDIA 4U01A 3UY9A 1C2HA 3SNCA 4YZUA 5FX6A 1MU8B 2ZFPH 3E0PB 1LHDH 3PLKA 3ZVDA 1O2LA 1A46H 3BV9B 4AB8A 4O03A 3GICB 2J92A 1UTPA 1AUJA 3QWCH 5A8YA 4MVNA 1FY8E 4FUEA 1GBBA 1T8NA 2BZAA 1C1VH 1O30A 7KMEH 4SGBE 1YP9A 3ATKA 1HIAB 2VWMA 1HUTH 1ESTA 4R0IA 4MNYA 1NRQH 1ESBA 1CHGA 1GI9B 2AH4X 4FUCA 5LH8A 1SGNE 5E0HA 5J4QA 3M7UA 4JZDH 2JETB 2BDHA 3SJIA 2H5DA 1QHRB 1GCTB 3A8CA 4YLQH 5T3HA 3ZZ9A 3TK6A 1O2TA 3A84A 4CREA 3UPEA 3A89A 3GDUA 1O35A 4U30A 2FMJA 2XCNA 1K1JA 3BTFE 1B5GH 5DO4H 1FQ3A 1P02A 1ZHPA 1WCZA 2A32A 1TGTA 1RIWC 2BD4A 1C5ZB 2OQ5A 1GBIA 3V0XA 2FIRH 3NUMA 5HM2A 1S85A 3GYMA 1ELVA 2XTTB 3Q3KA 3LC5A 1O3JA 1QQ4A 2YNAA 4AFUA 1T31A 2F9UA 4ISLA 2FOCA 1KSNA 3EYDA 4X8SH 4VGCC 5EQSA 2OXSA 3RXVA 2ZIQH 3RMMH 3RXSA 1L1JA 2Z7FE 1AY6H 3AW0A 1IOEA 1D3QB 2SNWA 2VGCC 2FESH 4NIWA 2BXUH 1AZ8A 1GHXH 1SLXB 2JKHA 3ZZ5A 1EX3A 1AWHB 2BM2A 2ZDKA 4DIIH 4INKA 4CHAB 2VVUA 3T29A 1BT7A 3BIVH 4DGJA 2BYAX 2Y7XA 1GI4A 2FP7B 1TX7A 1TGNA 1KLJH 4KTUA 1FZZA 4K2YA 1GDNA 1PYTD 2BVRH 1GJBB 4X1SU 1LPGB 1BHXB 2BX3A 3FZDA 1HJAB 4AYYB 1CT4E 5AF9H 3MH4A 4A1XA 1O3HA 1KXCA 3A80A 3SJOA 1A3EH 3SUDA 4A5TS 1Y3WA 1VGCC 1D3DB 3LGTA 8LPRA 1W8BH 2WYGA 3BTTE 3STJA 3PLPA 3QK1A 1H9HE 4AYVB 3VXFH 1GCDA 2ZQ2A 1F0TA 2OP9A 2R2WU 3B8JA 2FX4A 1RTFB 1V2NT 3A88A 1HRTH 2PSXA 3ITIA 4K69A 4TY6A 3SORA 1EUFA 3ZVAA 2ZFRH 4FXGH 3A8AA 1KXFA 1O3OA 4X2YA 1FIWA 1EZUC 2BB4A 3JZ2B 4KELA 1UTKA 2F9PA 1W0YH 2QF3A 2XC0A 2OLGA 1O3EA 3B23B 3URDA 3U1IB 1TPOA 1P11E 4X1PU 5C5NA 4AORA 1HYLA 3C27B 4E7NA 4MNXA 2AMPA 2AYWA 4CH2B 4INLA 4Q7XA 4AX9H 1P9SA 1BDAA 3TITA 1BTHH 5LPRA 1J17T 1BHXF 1KTSB 1YGCH 3GISB 4K8YA 4X2VA 1H9LB 1DPOA 1NN6A 2P8OC 4X8VH 1IQKA 2J4IA 4CR5A 3LU9B 3UNQA 1W14U 1C1RA 3SQHE 1ARBA 3A82A 5C5OA 1KXAA 1KXDA 1SC8U 3MWIU 2OBOA 4WH6A 4Y7AA 1Y3XA 1CT0E 1UCYH 2VWOA 1VITF 1C2MA 1G3CA 3SV9A 2A5AA 4WMFA 3UNSA 3S7KB 1MZDA 1LPK