3UQOA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA02
4JYTA 1RTKA 4AZ2B 1BT7A 4IGDA 1SB1H 3NUMA 1ESBA 5BRRE 1PPEE 1PPZA 3TK6A 1TAWA 1Z7KA 4AFQA 2QY0B 2ZQ2A 4ABAA 3A84A 2A7HA 1LMWB 4KP0A 1BRUP 3F9EA 3ZVFA 1ZZZA 1BTXA 1GI3A 5K0HA 1ZSLA 1P57B 2V0BA 3UQVA 1G2MA 1OP0A 1ZSKA 4Y71A 1MZDA 1C4Y2 4LOYH 1ZJKA 1BMMH 1IHSH 2XYAA 3A7ZA 2C90B 3RXVA 1XX9A 3TGIE 6LPRA 4Y0YE 3VXFH 3SU4A 4FUIA 2PKSC 2NU0E 5FXLA 3SUGA 2DE9A 1NC6A 1TIOA 2VVUA 3PYHA 3A85A 2GGVB 2Y82A 2XBVA 3RU4T 1ZMLA 2ZFSA 1V2QT 4OS7A 3A88A 1H1BA 1W3CA 1QL8A 1EUFA 1SQOA 1DXWA 2GP9B 2GCTB 4ZKSU 3M7UA 4O97A 1GVKB 2G00A 3ZV9A 3GDSA 1J15A 2FXRA 5G4BA 1BITA 2ZZUH 1V2VT 5I25A 5GCHG 1PJPA 1VJ9U 4GLYA 4D7GA 2H6MA 2J2UA 2GTBA 4K1TA 1W0YH 1E35B 8KME2 1NU7B 4YT7H 4AG2A 4CRBA 2TGDA 4ZHLU 2VB0A 1SGIB 3OU0A 4YLUA 4QT8C 4NA8A 1KXCA 3P8NA 5C20A 4I8JA 3BTEE 4DVAU 3S9AA 5HM9A 1LDTT 3M3VA 3GY3A 1GBJA 1D6WA 3L33A 2DE8A 3SJKA 1SGCA 3IWMA 4RN6A 1FY4A 1NRSH 4NGAH 3FAOA 3RXUA 1C2IA 1EZQA 4X2VA 4CR9A 1P2KA 2R3YA 1L1GA 4ZKRU 3EA7A 2ZTXA 3MOCA 1HV7A 1DY8A 1KTTB 2BDGA 3QTOH 2QYIA 2B9LA 3GDUA 4U01A 2FYQA 1TX7A 2XC0A 5C1YA 2GCHF 3BTQE 2ESTE 5E0GA 4WJG2 2SGEE 1FY5A 4ISHH 1O2IA 1C5NH 2ZFTA 4M7GA 1N6YA 2C8YB 2I6SA 4YLQH 1C4U2 1O36A 3RUOA 2ZCKP 3SNAA 4BAHB 1MUEB 3SV6A 4AG1A 1EJNA 2FOHA 2WPJS 2J94A 3SHCH 3P8OA 2VWLA 1JOUB 2Y80A 1AWFH 3AW0A 1OP2A 2A4RA 3A8CA 3PM3A 3UTUH 1IQHA 2ZGBH 2XBWA 1SGQE 1MBQA 1AIXH 2W7UA 3M5OA 4MG3A 1P2IA 5LPEA 2WPKS 1MZAA 5F8ZA 4MTBA 4D9QA 1MU6B 1JMOH 3UREA 1GMHF 1UCYH 3MU4A 4LZ1H 1EOLA 4X8UH 1EKBB 1O3JA 1HJAC 4E06H 4JZEH 2VIWA 4H42U 1L1NA 2ZDMA 1J9CH 2BVXH 2Y6TA 5L2YH 1A1RA 1GWAA 1KDQA 1TGNA 5L2ZH 3AVZA 2Z9JA 3OY6U 2ZPRA 1YGCH 1Z71A 3E3TA 4YM9A 2IJOB 5ESBA 1GBCA 4LXBH 3L6PA 1O2KA 2BMGB 4FXGH 2AERH 1HIAB 1SQAA 3EAJA 5H4IB 3KQCA 4DY7B 4FUFA 2FLBH 2SNWA 4NFEA 1AZZA 1P11E 1XUGA 2Y5HA 3T27A 3SI3H 2Z9KA 1O5EH 1V2ST 2OC1A 1DUAA 3BTFE 1GHYH 4MNVA 1DVAH 1LVYA 3ZVDA 4IN1A 1GGDB 2D1JA 2WPLS 2OC8A 7LPRA 2XBXA 2XTTB 1GI8B 2HNTE 3U1IB 1T4UH 2UWLA 3S0NA 2SFAA 5PTPA 3CENA 4H6SB 1UO6A 2VVVA 4YO9A 1AHTH 5IDKA 3QK1A 1FLEE 1CGIE 1Q3XA 1J14A 4KGAA 5DJ7A 1W11U 2GT7A 1GHXH 1RIWB 2GZ9A 2JETB 2H9HA 2WV4A 4Y10E 3MFJA 5HYOA 3ELAH 3LH1A 3ZZ5A 1C5ZB 3AASA 3QWCH 4K8YA 4B76A 1C1VH 3NZIA 4XSKU 3SUDA 4J2YB 3D62A 3LDXH 7GCHF 1UTNA 1QRXA 2SGQE 2H1UA 1BIOA 1RJXB 4UE7H 3DUXH 1MD7A 3SUFA 1YPMH 1ID5H 2P3UB 2Z94A 3O8BA 1ZHPA 1ORFA 2C8XB 1TMUH 2CHAC 4MPXA 4GCHF 1C5RA 1SLXB 1UTPA 1TX6A 5AF9H 1Q31A 4ZKNU 2ZHEH 1DE7H 3BIUH 3PV4A 3EE0B 1ZTLA 3RXSA 4WY3A 1OSSA 2KAIA 2ZFRH 1A7SA 7KMEH 3DA9B 4BOHA 1GBTA 1MH0A 1LVOA 3SU2A 1NESE 1NRRH 3GYMA 5FAHA 1V2JT 2HPPH 5GPIB 3PLPA 3LGWA 1O3LA 2ZKSA 1W13U 1NRNH 3Q3YA 3M3SA 2QCYA 1A3EH 1VITF 1N6XA 1KXDA 2ZU2A 3IITA 1MTWA 1ZOMA 1ELEE 1VGCB 3A89A 3GCNA 5T3HA 2QN5T 1GBLA 2R2WU 8ESTE 1LHDH 3TGJE 1ZLRA 1ZR0A 1TRMA 1U6QA 2ZGXH 5TCCA 3SI4H 4ESTE 4DIIH 1TALA 3BTWE 1KTSB 1K1OA 3RXOA 2BX4A 1WTGH 2C93B 3UR9A 4BTUB 3TJUA 1ETSH 4KTSA 2BD2A 5F8XA 2GDEH 1B0EA 2Z6BD 1BUIA 2Q6FA 3T62A 2SNVA 5EODA 2O8LA 3BSQA 5A0BA 4U32A 4FUEA 3P95A 3SJ9A 2EA3A 3TH3H 3RC6A 3T28A 4D9RA 3SGBE 1BB0B 6CHAC 1HAOH 2WV5A 3A82A 3GYLB 1OS8A 3VGCB 1BZXE 1QNJA 2UWOA 3ZVBA 1N8OB 3T26A 1A3BH 2HLCA 5GWZA 3QZRA 1UK3A 5ABWA 3U9AH 1QJ1B 1O3IA 5AHGH 3MO6A 1SG8B 3AAUA 4IN2A 2GD4B 3DD2H 1FAKH 1GCTB 1ARBA 3SZNA 1DLEA 5EQRA 5DP9A 1ZSJA 1SGFG 2A4GA 1EJAA 4I33A 2A2QH 1C5QA 1MAXA 1C1TA 3UPEA 2BDYA 1BRBE 3ATMA 2JH0D 4Q80A 1FONA 1Q2WA 2P95A 2EEKA 2PSYA 5EGMA 1AFEH 2D26C 1CE5A 3QDZB 4ISOA 4OS5A 3MI4A 5L6NH 3TNTA 1GMDF 2J4IA 2AMPA 1GBKA 5FBEA 1DT2A 1YPHC 1GHBF 2ZFPH 2CXVA 4NIWA 1HNEE 1C1SA 3EQ0H 1XXFA 1UJ1A 2AIQA 3PTBA 2ZU1A 5TCAA 1ZGIA 1OX1A 3EDXB 2B0FA 5FPTA 4O03A 2A7JA 5A09A 3ZVAA 1H8DH 5E2OA 3QLPH 1GVZA 1QQUA 4X1NU 2BVRH 5EXNA 4DW2U 4NIVA 3SGAE 1K1NA 1QRWA 4Y7AA 2STBE 2JH5D 4KKDA 1P2MA 3Q77A 4NWLA 3QGNB 3KHVA 1HYLA 1QIXB 2VH0A 9LPRA 1FPCH 5A8YA 2FWWA 5DP7A 1HXFH 5FCRA 1MTSA 2SGAA 1F2SE 4XE4A 2GCHG 2BQ7B 3NWUA 1G37A 4AB8A 1B7XB 2BD3A 5ETXA 1BJVA 1VCPA 1V2MT 1D3DB 1YPEH 1AWHB 3RLYH 1PPGE 1NN6A 1L1JA 1V2PT 3RXTA 2R9PA 2THFB 1H9IE 4X1PU 1UVTH 3PLKA 1HAIH 3RXQA 3CS0A 1EPTB 2CN0H 1X7AC 1XVMA 1Y3VA 1NS3A 4H6TA 1NRQH 4PROA 3HK3B 2QC2A 1LHCH 3TPIZ 1WSSH 3PB1E 1E34B 3VFEA 1QJ7B 1HFDA 4FUJA 1QA7A 5EOKA 4CRFA 2PUXB 1OWJA 2W26A 3ODFA 4FUBA 2GT8A 3PMHB 4E7RG 1GMHG 3MNSA 3PROA 4MVNA 1EOJA 1OYTH 4FVDA 3LKWA 4AFZA 3M37A 5LPFA 4CRCA 1DOJA 3RMLH 2BDBA 2BOKA 3BTKE 2B5TB 1HAPH 1O3EA 2ODPA 4A1XA 1ETTH 1P04A 1V2TT 1SGPE 3PO1B 1GJ5H 4HFPB 1UTLM 2HPQH 2ZDKA 3E1XB 1BMNH 2PHBA 2WPHS 2PWXA 1LKBA 2A7CA 1O5GH 2ZPQA 2Y7XA 3VB6A 1V2RT 7ESTE 1Y3YA 1CVWH 4X2YA 1HAVB 3A8AA 1YYY1 2W3KA 1P09A 1P2NA 2P8OC 5EQSA 1O2VA 1AFQB 1O3OA 3TJOA 1RRKA 3ZVEA 2VINA 1P01A 1UK2A 3SNBA 1IQLA 2ZQ1A 2QXGA 3GCTF 9ESTA 3RM2H 4WVPE 3LIWA 3RXEA 1IHTH 1RS0A 1XUIA 3M35A 1FNIA 1TB6H 1CHOF 3KQEA 3OYPA 5HXFA 4VGCC 2HRVA 2O8WA 4X6PA 1C9PA 4IC6A 4B74A 1TPPA 4I8LA 2BLOA 1AD8H 4B71A 2FM2A 1O2MA 2EI7A 1LCYA 1UHBA 1YCPH 4DJZB 1Y8TA 2C8ZB 1PQ5A 3K6YA 4FUGA 1O3MA 2BY7X 1WU1A 1MKXH 2A2XH 3A7TA 3ZV8A 4MNYA 2FDAA 5EW2H 4DURA 4ISLA 2FTLE 3SNCA 3AAVA 3BN9A 3S69A 3G01A 7GCHG 2ZU3A 3GICB 3RXHA 4UONA 1PYTC 1S5SA 2ZECA 5DO4H 3S9BA 4Y0ZE 1C5MD 1O3KA 2P59A 2VU8E 1O3BA 1HBTH 1RTFB 1YCPM 1YCPK 1GJ9B 3N7OA 3SNDA 4CH2B 1W0ZU 2HNTF 1MKXK 1SGNE 1DSTA 1FIWA 1NPMA 2BD8A 4GCHG 1GBFA 2HWLB 2UUYA 2B8OH 3KL6A 5DP8A 5E0JA 4JCNA 3URCA 5A2MH 3D49H 4CHAB 1XMNB 2P93A 3RXGA 4Z6AH 3BF6H 1GHAF 2FI4E 1G36A 1O33A 2OBQA 3GY8A 1DSUA 2Z3DA 2ZO3H 1GBDA 2VIVA 1GBHA 4AORA 1IQIA 2WPMS 4LZ4B 2GZ7A 3V13A 1RGQA 1PPFE 4JZIA 2STAE 1EZSC 1C1NA 3BG4C 3PLBA 2OINA 2C3SA 5EW1H 3LT3A 1CSOE 1VITG 3GY2A 2BY6X 2FX6A 3LGTA 5DP3A 3Q3KA 5T6DA 3JZ1B 1NROH 1A2CH 3SOSA 3PMBB 3SORA 3S9CA 1V2OT 1YC0A 4NZLA 3BTHE 4ABJA 3M7QA 1P02A 5L30H 2R0LA 1F7ZA 4AGKA 1ABIH 3E90B 4MPUA 1TGBA 1HPGA 1D9IA 1O5CB 3ZZBA 3TH4H 1ZMNA 1KXBA 2F9BH 3LC3A 1OWHA 4JK5A 2ZIQH 2FX4A 1DM4B 2ZGJA 3EA9A 2P3FH 2D8WA 3BTTE 3HKIB 1S84A 1VJAU 2A32A 2BDIA 5FX5A 4I8GA 3U69H 1OKXA 3UWIA 2Y7ZA 1WYKA 3HGPA 2ILNA 1LTOA 4YZUA 1HJ8A 4INHA 1UMAH 3DFJA 3UWJH 2J38A 3VEQB 3P8FA 1P0SH 2AMQA 2W7SA 3NKKA 2ZNKH 4K69A 3RMMH 1O2OA 3SBKA 3GDVA 3VB5A 1N1LA 2BY9X 3LJJA 1C2KA 4NG9H 5TJXA 1JXPA 2VWOA 3A8DA 2WPIS 1D4PB 2BDCA 1AE8H 2PV9B 1CBWB 2AGIX 2G55A 2P3TB 4GAWA 1FY1A 5EPNA 1Y5UT 2G81E 4OGXA 1Z8RA 1P3EA 3ATWA 1G30B 1JWTA 1CHGA 1HAYB 4X6NA 1UTJA 4TWWA 1AUJA 2BYAX 4JZ1A 1Z1IA 1T8LA 1SFQB 1LHGH 1GMDG 3MNXA 3SN8A 2ZEBA 2ZWLH 3FP8E 1FY8E 2VVCA 1GHBG 2GMTB 1HUTH 3RXBA 1XVOA 1GG6B 5EXMA 1HRTH 3A7XA 2G5NA 2JH6D 2P16A 4CRAA 1ZPZA 3KQBA 3Q76A 3ZYDA 1P3CA 2CMYA 2NU2E 4IMZA 4CBNA 2RDLA 1TNHA 1ZJDA 2OQUA 5C3NA 1EP6A 2BOHB 2ZGHA 5C5NA 1ELFA 1EPTA 2ZDNA 1SR5C 3RXLA 4FUCA 1MBMA 3SV9A 1F5KU 1O35A 1O3PB 2ZGCA 5JBCS 3I78A 1AB9B 1BA8B 3PTNA 3RM0H 4NCYA 1C5WB 1VR1H 2PKAB 5I46H 3VB3A 1MAYA 3PWBA 1ZHMA 3U1JB 1AVWA 1O2QA 4AFUA 1WUNH 1GBBA 2SGFE 3SO3A 4MNWA 4BANB 4NZQA 5AVDA 1CA0C 4BAKB 1PQ7A 2BZAA 2Z9GA 4BAMB 4NFFA 1LQDB 1TE0A 4X8VH 3TK5A 1NZQH 1TNKA 1GBAA 3SQHE 1A5HA 2C4FH 1NM6A 1IQKA 1ZRBA 3BTDE 2UUJB 1LO6A 2ZFFH 2AIPA 3EGKH 1A0LA 1O2UA 3LGUA 4Y76A 5CHAB 3RU4E 1G3CA 3RXFA 2ANKH 3F9GA 1FUJA 3BEFB 1C1UH 4A1VA 5C67A 4AX9H 1ELGA 6ESTA 4NSVA 1IQFA 1KYNA 1YPJH 5FPYA 1O5AB 4HTCH 4X8TH 4LK4A 1P2OA 1FI8A 1KXAA 4WMFA 2ZCHP 1MTNC 4ZHMU 3LGIA 3ATIA 4UFGH 2BDAA 3A7VA 2PR3A 3OY5U 5JBTA 4R8TB 1JBUH 1AKSA 1YPKH 3PMJA 1RTLA 1HCGA 2TPIZ 3RP2A 1TYNA 1F0TA 1O2RA 3QZQA 1ETRH 3CP7A 1O3CA 2CV3A 3TLOA 1GBMA 1IQEA 2F9VA 1TMBH 2Z3CA 1XKBC 1FXYA 4UFEH 2A31A 2WUBA 1CT2E 3DFLA 1XXDA 4KTUA 1QCPA 1O2ZA 1UVPA 4K1EA 3A8BA 1P12E 2VIOA 1AVXA 3HKJB 5J4SA 1GJ6A 5DKMA 2VGCC 5B6OA 2IN2A 2UUFB 2G4UA 1TNLA 1TQ7B 1IOEA 5CE1A 2H5DA 2GX4A 1AO5A 1NU9A 3MH6A 2FMJA 3UQOA 3D65E 5E8EH 1O31A 1V2NT 1C5YB 1KY9A 1C2FA 1C2EA 1MCVA 1A4WH 1BBRE 1QBVH 3QGJA 1DS2E 2F9UA 2ANWA 2PUQH 3M3TA 3RXMA 1ANEA 1AZ8A 4JYVH 1WQSA 3GCTG 1ELDE 2IOTA 1S85A 1TQ0B 2F9OA 8GCHF 2PKSB 1K28D 1CHOG 1K2I1 1AUTC 1ZPBA 4Y11E 4RKOB 5SGAE 3SU5A 1SBWA 4Z0KA 1SGYE 1KXEA 2ZG0H 1DANH 3ZZ6A 1TOMH 4AYVB 1HLTH 3KGPA 1NTPA 3KCGH 1P9UA 1QJ6B 3UNSA 4ZAEA 2ZDVH 1O38A 3SV2H 2NU1E 3ZZ9A 5A8ZA 3DHKH 1UTQA 3MU1A 2A5IA 1W8BH 3GCHC 1HB0B 4GHQA 1EAUA 1K1LA 2A1DB 4MQAA 1G3BA 3MO9A 2ANYA 2DUCA 3MTYA 1SGFA 1LPGB 3OX7U 4AB9A 4FVBA 2BQWB 1IQNA 3FZZA 1SLVB 2PTCE 1C1RA 2XCFA 1JIRA 4YOGA 3O8RA 2G5VA 4RSPA 1W7GH 2BLWA 1GJ4H 5FBIA 1TPSA 2D2DA 3MO3A 3VB7A 4OS1A 3NCLA 1O2XA 1E37B 1PQ8A 4ABFA 1WCZA 4AYYB 3UOPA 1DFPA 4INKA 4U2WA 2BD5A 1GHAG 1BDAA 1GDUA 1O37A 2HGTH 4NA7A 3SNEA 2OQ5A 1GHWH 1C5UA 2AGEX 3I29A 4F49A 4TY7A 3TJNA 1J16A 1L4ZA 5FHTA 2FESH 1DICA 1TBQH 5AFYH 2F83A 1TNIA 2V3HH 3LJOA 3ZYEA 2GDDA 3GY7A 3S7KB 2TGAA 3LU9B 3SJ8A 1FQ3A 1A61H 1AN1E 3V3MA 1C9TA 1NO9H 1ELVA 1KIGH 2AEIH 1BMAA 4JMYA 1BTWA 4X2WA 2VJ1A 1C5XB 1C1WH 1W2KH 1RXPA 1O3DA 3RXCA 1BCUH 1QL9A 1SFIA 4Q7XA 1KLJH 2OTVA 1Z6JH 2OXSA 4TY6A 2GCTC 4MLFB 3PMAB 1C5LH 1LKAA 4Y8YA 3MHWU 1GDNA 1P06A 1TBRH 1OYQA 1S81A 1L4DA 2ZC9H 4MPVA 2G51A 1UTKA 4TPIZ 1MMJN 3RC5A 2F9PA 3C27B 1P03A 1DWCH 3LGVA 1FIZA 4FU9A 1CT4E 4Y7BA 4A7IB 1THPB 2VWMA 1YF4A 2FTMA 3U8TH 4IMQA 2O8TA 4NSYA 4B75A 4IW4E 1FAXA 2BLQA 3Q00A 4WWYA 1JRTA 2ZDAH 4XBCA 1PFXC 3TJVA 3QTVH 1HJAB 5C1XA 1PPBH 2VH6A 1MKWK 2K1QA 2HOBA 1NY22 1SGRE 1W10U 3P70B 2OUAA 3GISB 2O9QA 3ZZ7A 3LGYA 1QL7A 3F9HA 4AFSA 4Y8ZA 1C2MA 3E8LA 1SHHB 1A0JA 1ZPCA 1DLKB 4TWYA 1K1PA 4X6OA 1MTVA 4SGBE 1QGFA 2GV7A 4TPYA 4DIHH 4H4FA 2G52A 1VITH 2Z9LA 2ZHQH 2Q6DA 1K22H 4ABHA 5LPRA 1ABJH 1XM1A 1PPCE 3RXAA 2VWNA 4YESB 1G32B 4AGJA 3MNBA 1E36B 1O34A 2WUCA 3D23A 4FU7A 3R0FA 2OLGA 4YT6H 4AN7A 1O3GA 1QHRB 3H7OA 3M7TA 2XRCA 3RLWH 1HIAA 4UFDH 3U8OH 3GY5A 2FS9A 1FY3A 2Y81A 1F5LA 3PWCA 1MQ6A 3SQEE 3SHAH 1O2PA 1YLCA 1KDQB 1UVUH 3BEIB 5JPMH 1O2SA 1ANDA 3RDZA 4O3TA 1GHVH 5FCKA 5BPEA 2AH4X 4DCDA 3V12A 4X8SH 1A5GH 4F4OC 2FODA 1AY6H 1GMCF 4CRDA 3UNRA 1OOKB 1YLDA 1PPHE 3SJOA 2ZTYA 2YNBA 5A8XA 1H4WA 1W7XH 2FEQH 2ALVA 3UR6A 2BY8X 4GHTA 3VPKA 1YBWA 4YOIA 4NWKA 1EB1H 4UDWH 3NK8A 5K7RA 4OS6A 1P2JA 4D76A 4WMEA 1ELBA 2CHAB 2NU4E 1ELCA 1P8VC 1C2LA 4J1YA 1A0HB 4I32A 1O5BB 2PW8H 2PTNA 2BVSH 1FPHH 2QV1A 4INLA 1EQ9A 1OWIA 4E7NA 3KIDU 3SW2B 3MWIU 3R3GB 1HDTH 1C1MA 1BTUA 4RKJB 2ZDLA 3SJIA 2PFEA 1WBGB 1A46H 4K1SA 3SGQE 4WH6A 1YP9A 2NWNA 1WTHD 2JKHA 1EASA 1VZQH 5IYTA 1NFYA 1GGDC 3B23B 1GI6A 1MQ5A 2RA3A 2M5TA 1O2LA 1K9OE 2QF3A 2ZCLP 3NXPA 5JDUB 3BIVH 4ZXXH 3ZZCA 2ZTZA 2FLRH 3A86A 3RMNH 3RU4D 1K1MA 1OP8A 2VIQA 1BQYA 1RIWC 2TRMA 2JETC 2Y5GA 3BTGE 1O30A 3QX5H 1ZTKA 4BXSA 6GCHF 4A92A 3W94A 2H9TH 3Q3XA 2FP7B 2Q1JA 1HXEH 1Y3WA 5F03A 4XDEA 1H9HE 5ESTE 2XC5A 2KAIB 3S7HB 1SPJA 1O5FH 1MU8B 1KSNA 1S83A 2XW9A 1OXGA 2QA9E 4X6MA 2A5AA 1T8NA 2TGPZ 6CHAB 5T6GA 5GDSH 3K6ZA 2ZPSA 5GXPA 3MU0A 4NA9H 8GCHG 4I8KA 4Y6DA 1GL1A 1IQJA 1T32A 2ZU5A 1IAUA 1XUJA 2W5EA 1NRPH 3RC4A 1SC8U 2J95A 2QXIA 4A1TA 4Q7ZA 1RFNA 3TH2H 1G9IE 3ATLA 4WMDA 1ACBE 1C5OH 2G8TA 1NFXA 1O2NA 1D6RA 2BB4A 2AYWA 1GI5A 4HZHA 2PSXA 1F92A 3FFGA 3LONA 3E91A 1TABE 3EYDA 1QFKH 3ZZ8A 1C1PA 1FZZA 2GV6A 3SU3A 1Z1JA 1Z8IB 3KN2A 1DXPA 4OS4A 1O2HA 2FO9A 1SOZA 2QAAA 2FPZA 3RXRA 1VGCC 3A7YA 4X2XA 1QBNA 2ZHWH 4ZKOU 2XNIA 1M9UA 4B2AA 1VCQA 4MPWA 4CRGA 1SMFE 3HK6B 2F9NA 3KF2A 2Z7FE 1NFUA 1H8IH 1T7CA 3RXKA 5DP6A 1GI1A 2TGTA 3F6UH 3W95A 1O39A 2WINI 1O2GH 4XFQA 1LVBA 2R0KA 5C1UA 2V35A 4WH8A 4ABGA 1CU1A 3T2NA 4XOJA 4I31A 4MDSA 3EA8A 1GJ8B 1CGJE 3T5FH 1EB2A 1BRCE 1XUKA 3VB4A 2HALA 1EJMA 1O32A 4HI3A 1O3NA 2BD9A 2FIRH 2H5CA 1O2WA 2RCEA 3VGCC 1N8OC 2FOBA 3TK9A 1DWBH 1FN8A 2G4TA 1P05A 3P8GA 3A81A 1LPZB 4OGYA 4TYDA 5GIBA 4SGAE 1ZTJA 4BTIB 1GCTC 4NIXA 4JK6A 3MU8A 1E38B 1TGTA 4ZHAA 3RXPA 1SHYA 1C5PA 1ZMJA 1IQMA 1ZHRA 2BXUH 1S6HA 1SGEE 5JBBS 1XUHA 2TBSA 2ZU4A 2QXJA 4E05H 4B73A 4CH8B 3E16B 2J34A 1CGHA 1T8MA 2SGDE 2A4OA 5AFZH 1C1QA 3B8JA 3HPTB 4O9VA 2AMDA 4Q2KA 5JB9S 3GCOA 3UY9A 4FU8A 2FOAA 1GI7B 1XUFA 1BTPA 1BJUA 1DX5M 1LHEH 3RXIA 4BAQB 1D3PB 3DT0H 2Q6GA 1YM0A 1WOFA 5DP5A 3AW1A 1L0ZA 1WAYB 1TNGA 1H9LB 4ASHA 1OWKA 1EX3A 2V3OH 1GJAB 2XC4A 3BEUA 3OSYA 2A4QA 3QO6A 1TONA 3KNXA 1CQQA 3L3TA 5EPYA 4GVUA 2A5KA 2EI6A 1Y5AT 1GHZA 1B0FA 3STJA 2CF8H 1Z6EA 1BTZA 3P92A 1QA0A 4FUDA 1UVOA 2GVFA 1FJSA 3QN7A 1TPAE 1UTOA 4I7YH 1C5VA 2H2ZA 2P8OB 1UCYK 1O3FA 3SU6A 3A87A 1AQ7A 3FP7E 1ANCA 3VXEH 1ELTA 2BTCE 1J8AA 3SU1A 1SL3A 1EZXC 1SSXA 1P2QA 1T31A 2YNAA 1BBRH 2FS8A 3MH4A 3RXJA 5E2PA 1DWEH 2QIQA 3IG6B 1TNJA 4YOJA 1BMLA 2RA0A 1TBZH 1HAVA 1UVSH 4VGCB 2FI5E 2VIDA 3ODDA 1Y3UA 1EPTC 3UNQA 3MMGA 3RMOH 1QB9A 2AFQB 4BTTB 1SLUB 1UK4A 1UCYE 1QURH 3SU0A 1D3QB 3M5LA 1THRH 1TA6A 1C1OA 1RD3B 1QY6A 4UEHH 2FOMB 1BBRK 3ITIA 3MNCA 1DUEA 1HAGE 3K9XB 1EAWA 1GJCB 3UUZA 1FMGA 1GMCG 2ALPA 2OBOA 5A0AE 2R2MB 1JIMA 2QXHA 2SGPE 4IBLH 1PYTD 1GJDB 1ANBA 1EAXA 1P9SA 4I8HA 2ASUB 1EXFA 4K3JA 4X1RU 2A0QB 3HGNA 1QTFA 4ABBA 4GPGA 4DGJA 4HGCA 1SLWB 1CA8B 3PO1C 1QR3E 4B1TA 2AS9A 1QB1A 1SGTA 3M61U 1W14U 3K2UA 3FZDA 4Y8XA 3LC5A 3ZVGA 4GUXA 4UD9H 1MCTA 4YTAA 2ODYB 5T6FA 3ATKA 4BNRA 3KQDA 1AFQC 1NT1A 1HAXB 5F6MA 5DK1A 2BX3A 1YPHE 1UHBB 3H5CB 2FYRA 4MNXA 1ESAA 4UFFH 4ISNA 3BG4B 3F68H 3H7TA 4GSOA 3LPRA 5C5OA 1LQEA 1F0RA 1T8OA 3O8DA 1TMTH 2ZI2H 1AE5A 1FV9A 4DOQA 2NU3E 2FOCA 1AI8H 2ODQA 2PGQB 5DG6A 1SOTA 3U8RH 2XCNA 1C2GA 2BHGA 2EI8A 3GY4A 3BTME 2IPHA 4IC5A 2A45B 1TLDA 1TX8A 4ABIA 2ZHFH 1INCA 3ZVCA 1P10A 1TPOA 1XKAC 2BLVA 1HGTH 3BV9B 1Z8GA 1CT0E 2BXTH 5C2ZA 6GCHG 1PQAA 5GJ4B 3KEEA 4K5ZA 5GCHF 2Z9IA 1IQGA 2J92A 1DWDH 1J17T 3BG8A 1TGCA 4ZMAH 2HNTC 1C2JA 5F8TA 3V0XA 2GKVE 1V2LT 3O8CA 3TNSA 4O3UA 2F3CE 2VIPA 1NFWA 1DY9A 4JZDH 1Y3XA 2C8WB 3HATH 1MD8A 3TU7H 4CHAC 1HAHH 1LVMA 2PLXA 2J9NA 2TIOA 2ULLA 2Z3EA 1K21H 4CR5A 2FOEA 5DP4A 1TRNA 1O3AA 3I77A 1GI9B 2XBYA 1D3TB 3STIA 1GL0E 1QRZA 3LH3A 1HJ9A 2R3UA 2ZA5A 2O8MA 4AOQA 3M36A 1V2KT 3GY6A 4ZROA 3T29A 5JBAS 1AVGH 1OPHB 1FDPA 3MH5A 4ZUHA 1OWEA 4X0WU 2ZFQH 4K2YA 1O2TA 5J4QA 1VCWA 3V7TA 3ZZAA 1QBOA 3NPSA 4WXIA 1DPOA 2OC0A 2BD4A 2O8UA 1F5RA 2P94A 2XWAA 4U30A 1MKWH 1KLTA 5DGJA 1F0UA 1TFXA 3SV8A 3UFAA 2WYJA 4ABEA 1V6DA 3SV7A 2XXLA 2VNTA 2ZP0H 1BRAA 2FOGA 4R0IA 3OTJE 5EQQA 1O0DH 1S0RA 3ZZ3A 4Y79A 2I6QA 3FANA 4DG4A 2BDHA 1UTMA 3TGKE 1YPGH 1GBIA 2LNCA 3MYWA 1JRSA 3K65B 1K1IA 1DDJA 5HGGA 1KXFA 4CREA 3M5MA 3P17H 1EAIA 4B2CA 3CS7A 1QB6A 1QQ4A 1W12U 1TWXB 4A6LA 1KLIH 5A0CA 1E0FD 2QGRA 2F91A 4D8NA 4WF8A 1GJBB 3TVJB 1Z8JB 3ZZ4A 1O3HA 1FN6A 3FP6E 1B5GH 2BQ6B 4KELA 5DPAA 1GI0A 1A5IA 3MH7A 4ZXYH 1GJ7B 1HAZB 2V6NA 1AMHA 1O5DH 4D7FA 5EXLA 1BHXB 2AGGX 4XBBA 1C2HA 1CA0B 3ENSB 2XWBI 4X1QU 1BHXF 3E6PH 1ESTA 4OS2A 1GBEA 3GOVB 1GDQA 2HVXA 4WXVA 3U98H 2BM2A 1G3DA 2PKAA 1C5TA 1CBWC 1GVLA 2OCVB 1V3XA 3QUMP 2UUKB 1AGJA 1K1JA 3UIRA 2W3IA 2WYGA 2ZF0H 4Q7YA 1YKTA 2CGAA 4B2BA 3A83A 1EP5A 4K8BA 1TGSZ 4A5TS 4ABDA 1DITH 1MTNB 1CO7E 1ZGVA 3JZ2B 1ZRKA 2Y5FA 1T4VH 3F9FA 3URDA 1O2JA 2GMTC 3P6ZB 1EATA 4CBOA 1GG6C 1V2UT 1S82A 5HMAA 3ESTA 2FI3E 4DT7B 1SI5H 1THSH 1BOQA 1ELAA 2FOFA 2FZZA 1Y5BT 5EU8A 1C5SA 3TIUA 2B7DH 3A7WA 5JYIA 2VGCB 1S6FA 2ANMH 1S0QA 4THNH 2H9EH 1WQVH 2CJIA 3TITA 1AB9C 3M5NA 4JYUH 2LPRA 5FX6A 5LH8A 2EC9H 3A80A 4XBDA 1GI4A 1BTHH 4JZFH 1G3EA 1SVPA 3RXDA 2ZHDA 1AU8A 1BTYA 4K60A 5E0HA 1V2WT 1C4V2 1EZUC 1LHFH 3C1KA 1YPLH 4BAOB 1O2YA 5CHAC 2YOLA 1LPKB 2PGBB 4KTCA 1AKSB 1ARCA 1MTUA 1SQTA 2UWPA 3E0PB 3FVFB 3LOXA 2OC7A 1WV7H 1GPZA 3B9FH 2GZ8A 2RG3A 3MU5A 1C2DA 2BY5X 2QF0A 4FUHA 2OP9A 4ISIH 3F1SB 4X1SU 4ZH8A 3ZZDA 1SGDE 8LPRA 4BXWA 5CMXH 1L2EA 3GCHB 3SUEA 3T25A 5FPSA 1OWDA 5EG4A 3E0NB 1GI2A 1ZYOA 3UOUA 1F0SA 1GCDA 1TA2A 4NIYA 1Y59T 1TRYA 4IS5A 3WY8A 2BD7A 5LGOA 2OD3B 1TOCB 5JB8S 2CF9H 5HM2A 2BZ6H 1G2LA
chains in the Genus database with same CATH superfamily
4JYTA 1RTKA 4AZ2B 5DN6D 1BT7A 4IGDA 1SB1H 3NUMA 1ESBA 5BRRE 1PPEE 1PPZA 3TK6A 4HG6A 1TAWA 1Z7KA 4AFQA 2QY0B 2ZQ2A 4ABAA 3A84A 2A7HA 1LMWB 4KP0A 1BRUP 3F9EA 3ZVFA 1ZZZA 1BTXA 1GI3A 5K0HA 1ZSLA 4ACAA 1P57B 4XD7D 2V0BA 3UQVA 1G2MA 1OP0A 1ZSKA 4Y71A 1MZDA 1C4Y2 4LOYH 2J97A 1ZJKA 1BMMH 1IHSH 2XYAA 3A7ZA 2C90B 3RXVA 3DCLA 1XX9A 3TGIE 6LPRA 4Y0YE 3VXFH 3SU4A 4FUIA 2PKSC 2NU0E 5FXLA 3SUGA 2DE9A 1NC6A 2LP6A 1TIOA 2VVUA 3PYHA 3A85A 2GGVB 2Y82A 2XBVA 3RU4T 3SYJA 1ZMLA 2ZFSA 1V2QT 4OS7A 3A88A 2F43B 1H1BA 1W3CA 1QL8A 1EUFA 1SQOA 1DXWA 2GP9B 2GCTB 4ZKSU 3M7UA 4O97A 1GVKB 2G00A 3ZV9A 3GDSA 1J15A 2FXRA 5G4BA 1BITA 3N7EA 2ZZUH 1V2VT 5I25A 5GCHG 1PJPA 1VJ9U 4GLYA 4D7GA 3NRLA 2H6MA 2J2UA 2GTBA 4K1TA 1W0YH 1E35B 8KME2 1NU7B 4YT7H 4AG2A 4CRBA 2TGDA 4ZHLU 2VB0A 1SGIB 3OU0A 4YLUA 4QT8C 4NA8A 1KXCA 3P8NA 5C20A 4I8JA 3BTEE 4DVAU 3S9AA 5HM9A 1LDTT 3M3VA 3GY3A 1GBJA 1D6WA 3L33A 2DE8A 3N99A 3SJKA 1SGCA 3IWMA 4RN6A 1FY4A 1NRSH 4NGAH 3FAOA 3RXUA 1C2IA 1EZQA 4X2VA 4CR9A 1P2KA 2R3YA 1L1GA 4ZKRU 3EA7A 2ZTXA 3MOCA 1HV7A 1DY8A 1KTTB 2BDGA 3QTOH 2QYIA 2B9LA 3GDUA 4U01A 2FYQA 1TX7A 2XC0A 5C1YA 2GCHF 3BTQE 2ESTE 5E0GA 4WJG2 2SGEE 1FY5A 4ISHH 1O2IA 1C5NH 2ZFTA 4M7GA 1N6YA 2C8YB 2I6SA 4YLQH 1C4U2 1O36A 3RUOA 2ZCKP 3SNAA 4BAHB 1MUEB 3SV6A 2KFWA 4AG1A 1EJNA 2FOHA 4Z1MD 2WPJS 3SZEA 2WPDD 2J94A 3SHCH 3P8OA 2VWLA 1JOUB 2Y80A 1AWFH 3AW0A 5F53A 1OP2A 2A4RA 3A8CA 3PM3A 3UTUH 1IQHA 2ZGBH 2XBWA 1SGQE 1MBQA 1AIXH 2W7UA 3M5OA 4MG3A 1P2IA 5LPEA 2WPKS 1MZAA 4F48B 5F8ZA 4MTBA 4D9QA 1MU6B 1JMOH 3UREA 1GMHF 1UCYH 3F2FA 3MU4A 4LZ1H 1EOLA 4X8UH 1EKBB 1O3JA 4F55A 1HJAC 4E06H 4JZEH 2VIWA 4H42U 1L1NA 2ZDMA 1J9CH 2BVXH 2Y6TA 5L2YH 1A1RA 1GWAA 1KDQA 1TGNA 5L2ZH 3AVZA 2Z9JA 3OY6U 2ZPRA 1YGCH 1Z71A 3E3TA 4YM9A 1NBMD 2IJOB 5ESBA 5CHBA 1GBCA 4LXBH 3L6PA 1O2KA 2BMGB 4FXGH 2AERH 1HIAB 1SQAA 3EAJA 5H4IB 3KQCA 4DY7B 4FUFA 2FLBH 2SNWA 4NFEA 1AZZA 1P11E 1XUGA 2Y5HA 3T27A 3SI3H 2Z9KA 1O5EH 1V2ST 2OC1A 1DUAA 3BTFE 1GHYH 4MNVA 1DVAH 1LVYA 3ZVDA 4IN1A 1GGDB 2D1JA 2WPLS 2OC8A 7LPRA 2XBXA 2XTTB 1GI8B 2HNTE 5EJZA 3U1IB 1T4UH 2UWLA 3S0NA 2SFAA 5PTPA 3CENA 4H6SB 1UO6A 2VVVA 4YO9A 1AHTH 5IDKA 3QK1A 1FLEE 1CGIE 1Q3XA 1J14A 2KR7A 4KGAA 5DJ7A 1W11U 2GT7A 1GHXH 1RIWB 2EY4C 2GZ9A 2JETB 2H9HA 3F0PA 2WV4A 4Y10E 3MFJA 5HYOA 3ELAH 3LH1A 3ZZ5A 1C5ZB 3AASA 3QWCH 4K8YA 4B76A 1C1VH 3NZIA 4XSKU 3SUDA 4J2YB 3D62A 3PV2A 3LDXH 7GCHF 1UTNA 1QRXA 2SGQE 2H1UA 1BIOA 1RJXB 4P02A 4UE7H 4TT3D 3DUXH 1MD7A 3SUFA 1YPMH 4Q4LA 1ID5H 2P3UB 2Z94A 3O8BA 1ZHPA 1ORFA 2C8XB 1TMUH 2CHAC 4MPXA 4TSFD 4GCHF 1C5RA 1SLXB 1UTPA 1TX6A 5AF9H 1Q31A 4ZKNU 2ZHEH 1DE7H 3BIUH 3PV4A 3EE0B 3F3BA 1ZTLA 3RXSA 4WY3A 1OSSA 2KAIA 2ZFRH 1A7SA 3PV5A 7KMEH 3DA9B 4BOHA 1GBTA 1MH0A 5HKKD 1LVOA 3SU2A 1NESE 1NRRH 3GYMA 5FAHA 1V2JT 2HPPH 5GPIB 4B6EA 3PLPA 3LGWA 1O3LA 2ZKSA 1W13U 1NRNH 3Q3YA 3M3SA 2QCYA 1A3EH 1VITF 1N6XA 1KXDA 2ZU2A 3IITA 1MTWA 1ZOMA 1ELEE 1VGCB 3A89A 3GCNA 5T3HA 2QN5T 1GBLA 2R2WU 8ESTE 1LHDH 3TGJE 1ZLRA 1ZR0A 1TRMA 1U6QA 2ZGXH 5TCCA 3SI4H 4ESTE 4DIIH 1TALA 3BTWE 1KTSB 1K1OA 3RXOA 2BX4A 1WTGH 2C93B 3UR9A 4BTUB 2KCOA 3TJUA 1ETSH 4KTSA 2BD2A 5F8XA 2GDEH 1B0EA 2Z6BD 1BUIA 2Q6FA 3T62A 2SNVA 5EODA 2O8LA 3BSQA 5A0BA 2YMSB 4U32A 2JJ2D 4FUEA 3P95A 3SJ9A 2KCPA 2EA3A 3TH3H 3RC6A 3T28A 4D9RA 3SGBE 1BB0B 5EJLA 6CHAC 1HAOH 2WV5A 3A82A 3GYLB 1OS8A 3VGCB 1BZXE 1QNJA 2UWOA 3ZVBA 1N8OB 3T26A 1A3BH 1K0HA 2HLCA 5GWZA 3QZRA 1UK3A 5ABWA 3U9AH 1QJ1B 1O3IA 5AHGH 3MO6A 1SG8B 3AAUA 4IN2A 1YLNA 2GD4B 3DD2H 1FAKH 1GCTB 4XRNA 1ARBA 3SZNA 1DLEA 5EQRA 5DP9A 1ZSJA 1SGFG 2A4GA 1EJAA 4I33A 2A2QH 1C5QA 1MAXA 1C1TA 2QF5A 3UPEA 2BDYA 1BRBE 3ATMA 2JH0D 5IK2D 4Q80A 1FONA 1Q2WA 2P95A 2EEKA 2PSYA 5EGMA 1AFEH 2D26C 1CE5A 3QDZB 4ISOA 4OS5A 3MI4A 2W6ID 5L6NH 3TNTA 1GMDF 2J4IA 2AMPA 1GBKA 5FBEA 1DT2A 1YPHC 1GHBF 2ZFPH 2CXVA 4NIWA 1HNEE 1C1SA 3EQ0H 1XXFA 1UJ1A 2AIQA 3PTBA 2ZU1A 5TCAA 1ZGIA 1OX1A 3EDXB 2B0FA 5FPTA 4O03A 2A7JA 5A09A 3ZVAA 1H8DH 5E2OA 3QLPH 2V7QD 2KX4A 1GVZA 1QQUA 4X1NU 2HLDD 2BVRH 5EXNA 4DW2U 4NIVA 3SGAE 1K1NA 1QRWA 4Y7AA 2STBE 2JH5D 4KKDA 1P2MA 3Q77A 4NWLA 3QGNB 3KHVA 1HYLA 1QIXB 2VH0A 9LPRA 1FPCH 5A8YA 2FWWA 1COWD 1W0JD 5DP7A 1HXFH 5FCRA 1MTSA 2SGAA 1F2SE 4XE4A 2RDEA 2GCHG 2BQ7B 3NWUA 1G37A 4AB8A 1B7XB 2BD3A 5ETXA 3DSPA 1BJVA 1VCPA 1V2MT 1D3DB 1YPEH 1AWHB 3RLYH 1PPGE 1NN6A 1L1JA 1V2PT 3RXTA 2R9PA 2THFB 1H9IE 4X1PU 1UVTH 3PLKA 1HAIH 3RXQA 3CS0A 1EPTB 2CN0H 1X7AC 1XVMA 1Y3VA 1NS3A 4H6TA 1NRQH 4PROA 3HK3B 2QC2A 1LHCH 3TPIZ 1WSSH 3PB1E 1E34B 3VFEA 1QJ7B 1HFDA 4FUJA 1QA7A 5EOKA 4CRFA 2PUXB 1OWJA 2W26A 3ODFA 4FUBA 2GT8A 3PMHB 4E7RG 1GMHG 3MNSA 3PROA 4MVNA 1EOJA 1OYTH 4FVDA 3LKWA 4AFZA 3M37A 5LPFA 4CRCA 1DOJA 3RMLH 2BDBA 2BOKA 3BTKE 2B5TB 1HAPH 1O3EA 2ODPA 4A1XA 1ETTH 1P04A 1V2TT 4FETA 1SGPE 2K8IA 2LELA 3PO1B 1GJ5H 4HFPB 2VBCA 1UTLM 3OAAD 2HPQH 2ZDKA 3E1XB 1BMNH 2PHBA 2WPHS 2PWXA 1LKBA 2A7CA 1O5GH 2ZPQA 2Y7XA 3VB6A 1V2RT 7ESTE 1Y3YA 1CVWH 1H8HD 4X2YA 1HAVB 3A8AA 1YYY1 3AK5A 2W3KA 1P09A 1P2NA 2P8OC 5EQSA 1O2VA 1AFQB 1O3OA 3TJOA 1RRKA 3ZVEA 2VINA 5KECA 1P01A 1UK2A 2XNDD 3SNBA 1IQLA 2ZQ1A 2RFKC 2QXGA 3GCTF 9ESTA 3RM2H 4WVPE 3LIWA 3RXEA 1IHTH 1RS0A 1XUIA 3M35A 1FNIA 1TB6H 1CHOF 3KQEA 3OYPA 5DSFA 5HXFA 4ZCNA 4VGCC 2HRVA 2O8WA 4X6PA 1C9PA 4IC6A 4B74A 1TPPA 4I8LA 2BLOA 1AD8H 4B71A 2FM2A 1O2MA 2EI7A 1LCYA 1UHBA 1YCPH 4DJZB 1Y8TA 2C8ZB 1PQ5A 3K6YA 4FUGA 1O3MA 2BY7X 1WU1A 1MKXH 2A2XH 3A7TA 3ZV8A 4MNYA 2FDAA 5EW2H 4DURA 4ISLA 2FTLE 3SNCA 3AAVA 3BN9A 3S69A 3G01A 7GCHG 5C94A 5KEDA 2ZU3A 3GICB 3RXHA 4UONA 4RI0A 2J98B 1PYTC 1S5SA 2ZECA 5DO4H 3S9BA 4Y0ZE 1C5MD 1O3KA 2P59A 2VU8E 1O3BA 1HBTH 1RTFB 1YCPM 1YCPK 1GJ9B 2AHME 3N7OA 3SNDA 4CH2B 1W0ZU 1SKYE 2HNTF 1MKXK 1SGNE 1DSTA 1FIWA 1NPMA 2BD8A 4GCHG 1GBFA 2HWLB 2UUYA 2B8OH 3KL6A 5DP8A 5E0JA 4JCNA 3URCA 5A2MH 3D49H 4CHAB 4FOUC 3F0OA 1XMNB 2P93A 3RXGA 4Z6AH 3BF6H 1GHAF 2FI4E 1G36A 1O33A 2OBQA 3GY8A 1DSUA 2Z3DA 2ZO3H 1GBDA 2VIVA 1GBHA 4AORA 1IQIA 2WPMS 4LZ4B 2GZ7A 3V13A 1RGQA 1PPFE 4JZIA 2STAE 1EZSC 1C1NA 3BG4C 3PLBA 2OINA 2C3SA 5EW1H 3LT3A 1CSOE 1VITG 3GY2A 2BY6X 2FX6A 3LGTA 5DP3A 4YXWD 3Q3KA 5T6DA 3JZ1B 1NROH 1A2CH 3SOSA 2HVYB 3PMBB 3SORA 3S9CA 1V2OT 1YC0A 4NZLA 3BTHE 4ABJA 3M7QA 1P02A 5L30H 2R0LA 1F7ZA 4AGKA 1ABIH 3E90B 4MPUA 1TGBA 1HPGA 3MQKC 1D9IA 1O5CB 3ZZBA 3TH4H 1ZMNA 1KXBA 2F9BH 3LC3A 1OWHA 4JK5A 2ZIQH 2FX4A 1DM4B 2ZGJA 3EA9A 2P3FH 2D8WA 3BTTE 3HKIB 1S84A 1VJAU 2A32A 2BDIA 5FX5A 4I8GA 3U69H 1OKXA 3UWIA 2Y7ZA 1WYKA 3HGPA 2ILNA 1LTOA 2J5UA 4YZUA 1HJ8A 4INHA 1UMAH 3DFJA 3UWJH 2J38A 3VEQB 3P8FA 1P0SH 2AMQA 3CNRA 2W7SA 3NKKA 2ZNKH 4K69A 3RMMH 1O2OA 3SBKA 3GDVA 3VB5A 1N1LA 2BY9X 3LJJA 1C2KA 4NG9H 5TJXA 1JXPA 2VWOA 3A8DA 2WPIS 1D4PB 2BDCA 1AE8H 2PV9B 1CBWB 2AGIX 2G55A 2P3TB 4GAWA 1FY1A 5EPNA 1Y5UT 2G81E 4OGXA 1Z8RA 1P3EA 2KM0A 3ATWA 1G30B 1JWTA 1CHGA 1HAYB 4X6NA 1UTJA 4TWWA 1AUJA 2BYAX 4JZ1A 1Z1IA 1T8LA 1SFQB 1LHGH 1GMDG 3MNXA 3SN8A 2ZEBA 2ZWLH 3FP8E 1FY8E 2VVCA 1GHBG 2GMTB 3H09A 1HUTH 3RXBA 1XVOA 1GG6B 4AC9A 5EXMA 1HRTH 3A7XA 2G5NA 2JH6D 2P16A 4CRAA 1ZPZA 3KQBA 3Q76A 3ZYDA 1P3CA 2CMYA 2NU2E 4IMZA 4CBNA 2RDLA 1TNHA 1ZJDA 2OQUA 5C3NA 4B6FA 1EP6A 2BOHB 2ZGHA 5C5NA 1ELFA 1EPTA 2ZDNA 1SR5C 3RXLA 4FUCA 1MBMA 3SV9A 1F5KU 1O35A 1O3PB 2ZGCA 5JBCS 3UAIC 3I78A 1AB9B 1BA8B 3PTNA 3RM0H 3KQ5A 4NCYA 1C5WB 1VR1H 2PKAB 5I46H 3VB3A 1MAYA 3PWBA 1ZHMA 3U1JB 1AVWA 1O2QA 4AFUA 1WUNH 1GBBA 2SGFE 3SO3A 4MNWA 4BANB 4NZQA 5AVDA 1CA0C 4BAKB 1PQ7A 2BZAA 2Z9GA 4BAMB 4NFFA 1LQDB 1TE0A 4X8VH 3TK5A 1NZQH 1TNKA 1GBAA 3FN8A 3SQHE 1A5HA 2C4FH 1NM6A 1IQKA 1WXRA 1ZRBA 3BTDE 2UUJB 1LO6A 2ZFFH 2AIPA 3EGKH 1A0LA 1O2UA 3LGUA 4Y76A 5CHAB 3RU4E 1G3CA 3RXFA 2ANKH 3F9GA 1FUJA 3BEFB 1C1UH 4A1VA 5C67A 4AX9H 1ELGA 6ESTA 4NSVA 3PRBA 1IQFA 1KYNA 1YPJH 5FPYA 1O5AB 4HTCH 4X8TH 4LK4A 1P2OA 1FI8A 1KXAA 4WMFA 1YY3A 5C0TA 2ZCHP 1MTNC 4ZHMU 3LGIA 1YWUA 3ATIA 4UFGH 2BDAA 3A7VA 2PR3A 3OY5U 5JBTA 4R8TB 1JBUH 1AKSA 5EJ1A 1YPKH 3PMJA 1RTLA 1HCGA 2TPIZ 3RP2A 1TYNA 1F0TA 1O2RA 3QZQA 1ETRH 3CP7A 1O3CA 2CV3A 3TLOA 1GBMA 1IQEA 2F9VA 1TMBH 2Z3CA 1XKBC 1FXYA 4UFEH 2A31A 2WUBA 1CT2E 3DFLA 1XXDA 4KTUA 1QCPA 1O2ZA 1UVPA 4K1EA 3A8BA 1P12E 2VIOA 1AVXA 3HKJB 5J4SA 1GJ6A 5DKMA 2VGCC 5B6OA 2IN2A 3F2HA 2UUFB 2G4UA 2OK5A 1TNLA 1TQ7B 1IOEA 5CE1A 2H5DA 2GX4A 1AO5A 1NU9A 3MH6A 2FMJA 3UQOA 3D65E 5E8EH 1O31A 1V2NT 1C5YB 1KY9A 1C2FA 1C2EA 1MCVA 1A4WH 1BBRE 1QBVH 3QGJA 1DS2E 2F9UA 2ANWA 2PUQH 3M3TA 3RXMA 1ANEA 2GJGA 1AZ8A 4JYVH 1WQSA 3GCTG 1ELDE 2IOTA 1S85A 1TQ0B 2F9OA 8GCHF 2PKSB 1K28D 4P00A 1CHOG 1K2I1 1AUTC 1ZPBA 4Y11E 4RKOB 5SGAE 3SU5A 1SBWA 4Z0KA 1SGYE 1KXEA 3OFND 2ZG0H 1DANH 3ZZ6A 1TOMH 5HIZA 4AYVB 4ACBA 1HLTH 3KGPA 1NTPA 1KMHB 3KCGH 1P9UA 1QJ6B 3UNSA 4ZAEA 2ZDVH 1O38A 3SV2H 2NU1E 3ZZ9A 5A8ZA 3DHKH 1UTQA 3MU1A 2A5IA 1W8BH 3GCHC 1HB0B 4GHQA 1EAUA 1K1LA 2A1DB 4MQAA 1G3BA 3MO9A 2ANYA 2DUCA 3MTYA 1SGFA 1LPGB 3OX7U 4AB9A 4FVBA 2BQWB 1IQNA 3FZZA 1SLVB 2PTCE 1C1RA 3KYFA 2XCFA 1JIRA 4YOGA 3O8RA 2G5VA 4RSPA 1W7GH 2BLWA 1GJ4H 5FBIA 1TPSA 2D2DA 3MO3A 2YMSD 3VB7A 4OS1A 3NCLA 1O2XA 1E37B 1PQ8A 4ABFA 1WCZA 5GNDA 3UOPA 1DFPA 4AYYB 4INKA 4U2WA 2BD5A 1E1QD 1GHAG 1BDAA 1GDUA 1O37A 2HGTH 4NA7A 3SNEA 2OQ5A 1GHWH 1C5UA 3FKSD 2AGEX 3I29A 4F49A 4TY7A 3TJNA 1J16A 1L4ZA 4OM9A 5FHTA 2FESH 1DICA 1TBQH 5AFYH 2F83A 1TNIA 2V3HH 3LJOA 3ZYEA 1UW7A 2GDDA 3GY7A 3S7KB 2TGAA 3LU9B 5FL7D 3SJ8A 1FQ3A 1A61H 1AN1E 3WWBA 3V3MA 1C9TA 1NO9H 1ELVA 1KIGH 2AEIH 1BMAA 4JMYA 1BTWA 4X2WA 2VJ1A 3ZIAD 1C5XB 1C1WH 1W2KH 1RXPA 1O3DA 3RXCA 1BCUH 1QL9A 1SFIA 4Q7XA 1KLJH 2OTVA 1Z6JH 2OXSA 4TY6A 2GCTC 4MLFB 3PMAB 1C5LH 1LKAA 4Y8YA 3MHWU 1GDNA 1P06A 1TBRH 1OYQA 1S81A 1L4DA 2ZC9H 4MPVA 2G51A 1UTKA 4TPIZ 1MMJN 3RC5A 2F9PA 3C27B 1P03A 1DWCH 3LGVA 1FIZA 4FU9A 1CT4E 4Y7BA 4A7IB 1THPB 2VWMA 1YF4A 2FTMA 3U8TH 4IMQA 2O8TA 3OE7D 4NSYA 4IW4E 4B75A 1FAXA 2BLQA 3Q00A 4WWYA 1E79D 1JRTA 2ZDAH 4XBCA 1PFXC 3TJVA 3QTVH 1HJAB 5C1XA 3U28C 1PPBH 2VH6A 1MKWK 2K1QA 2HOBA 1NY22 1SGRE 1W10U 3P70B 2KCYA 2OUAA 3GISB 2O9QA 3ZZ7A 2QE7D 2JDID 2KCAA 3LGYA 1QL7A 3F9HA 4AFSA 4Y8ZA 1C2MA 3E8LA 5HIYA 1SHHB 1A0JA 1ZPCA 1DLKB 4TWYA 1K1PA 4X6OA 1MTVA 4SGBE 1QGFA 2GV7A 4TPYA 4DIHH 4H4FA 2G52A 1VITH 2Z9LA 2ZHQH 2Q6DA 1K22H 4ABHA 5LPRA 1ABJH 1XM1A 1PPCE 3RXAA 2VWNA 2XOKD 4YESB 1G32B 4AGJA 3MNBA 1E36B 1O34A 2WUCA 3D23A 4FU7A 2JIZD 3R0FA 2OLGA 4YT6H 4AN7A 1O3GA 1QHRB 3H7OA 3M7TA 2XRCA 3RLWH 1HIAA 4UFDH 3U8OH 3GY5A 2FS9A 1FY3A 2Y81A 1F5LA 3PWCA 1MQ6A 3SQEE 3SHAH 1O2PA 1YLCA 1KDQB 1UVUH 3BEIB 5JPMH 1O2SA 1ANDA 3RDZA 4O3TA 1GHVH 5FCKA 5BPEA 2AH4X 4DCDA 3V12A 4X8SH 1A5GH 4F4OC 2FODA 1AY6H 1GMCF 3OEED 4CRDA 3UNRA 1OOKB 1YLDA 1PPHE 3SJOA 2ZTYA 2YNBA 5A8XA 1H4WA 1W7XH 2FEQH 2ALVA 3UR6A 2BY8X 2QF4A 4GHTA 3VPKA 1YBWA 4YOIA 4NWKA 1EB1H 4UDWH 3NK8A 5K7RA 4OS6A 1P2JA 4D76A 4WMEA 1ELBA 2CHAB 2NU4E 1ELCA 1P8VC 1C2LA 4J1YA 1A0HB 4I32A 1O5BB 2PW8H 2PTNA 2BVSH 1FPHH 2QV1A 4INLA 1EQ9A 1OWIA 4E7NA 3KIDU 3SW2B 3MWIU 3R3GB 1HDTH 1C1MA 1BTUA 4RKJB 2ZDLA 3SJIA 2PFEA 1WBGB 1A46H 4K1SA 3SGQE 5EIYA 4WH6A 1YP9A 2NWNA 1WTHD 2JKHA 1EASA 1VZQH 5IYTA 1NFYA 1GGDC 3B23B 1GI6A 1MQ5A 2RA3A 2M5TA 5T1VA 1O2LA 1K9OE 2QF3A 2ZCLP 2CK3D 3NXPA 5JDUB 3BIVH 1VKYA 4ZXXH 1QZ8A 3DSOA 3ZZCA 2ZTZA 2FLRH 3A86A 3RMNH 3RU4D 1K1MA 1OP8A 2VIQA 1BQYA 1RIWC 2TRMA 2JETC 2Y5GA 3BTGE 1O30A 3OEHD 3QX5H 1ZTKA 4BXSA 6GCHF 4A92A 3W94A 3EE7A 2H9TH 3Q3XA 2FP7B 2Q1JA 1HXEH 1Y3WA 2W6JD 5F03A 4XDEA 1H9HE 5ESTE 2XC5A 2KAIB 3S7HB 1SPJA 1O5FH 1MU8B 4RT0A 1KSNA 1S83A 2XW9A 1OXGA 2QA9E 4X6MA 2A5AA 1T8NA 2TGPZ 6CHAB 5T6GA 5GDSH 3K6ZA 2ZPSA 5GXPA 3MU0A 4NA9H 8GCHG 4I8KA 4Y6DA 1GL1A 1IQJA 1T32A 2ZU5A 1IAUA 1XUJA 2W5EA 1NRPH 3RC4A 1SC8U 2J95A 2QXIA 4A1TA 4Q7ZA 1RFNA 3TH2H 1G9IE 3ATLA 4WMDA 1ACBE 1C5OH 2G8TA 1NFXA 1O2NA 1D6RA 2BB4A 2AYWA 1GI5A 4HZHA 2PSXA 1F92A 3FFGA 3LONA 3E91A 1TABE 3EYDA 1QFKH 3ZZ8A 1C1PA 1FZZA 2GV6A 3SU3A 1Z1JA 1Z8IB 3KN2A 1DXPA 3UB0A 4OS4A 1O2HA 2FO9A 5CDFE 1SOZA 2QAAA 2FPZA 3RXRA 1VGCC 3A7YA 4M9FA 4X2XA 1QBNA 2ZHWH 4ZKOU 2XNIA 4DT4A 1M9UA 3FO8D 4B2AA 1VCQA 4MPWA 4CRGA 1SMFE 3HK6B 2F9NA 3KF2A 2Z7FE 1NFUA 1H8IH 1T7CA 3RXKA 2M2AA 5DP6A 1GI1A 2TGTA 3F6UH 3W95A 1O39A 2WINI 1O2GH 4XFQA 2EQNA 1LVBA 2R0KA 5C1UA 2V35A 4WH8A 3DSGA 4ABGA 1CU1A 2YMSC 3T2NA 4XOJA 2IJD1 4I31A 4MDSA 3EA8A 1GJ8B 1CGJE 3T5FH 1EB2A 1BRCE 1XUKA 3VB4A 2HALA 1EJMA 1O32A 4HI3A 1O3NA 2BD9A 2FIRH 2H5CA 1O2WA 2RCEA 3VGCC 1N8OC 2FOBA 3TK9A 1DWBH 1FN8A 2G4TA 1P05A 3P8GA 3A81A 1LPZB 4OGYA 4TYDA 5GIBA 4SGAE 1ZTJA 4BTIB 1GCTC 2WZQA 4JK6A 4NIXA 3MU8A 1E38B 1TGTA 4ZHAA 3RXPA 1SHYA 1C5PA 1ZMJA 1IQMA 1ZHRA 2BXUH 1S6HA 1SGEE 5JBBS 1XUHA 2TBSA 2ZU4A 2QXJA 4E05H 4B73A 4CH8B 3E16B 2J34A 1CGHA 1T8MA 2SGDE 2A4OA 5AFZH 1C1QA 3B8JA 3HPTB 4O9VA 2IPQX 2AMDA 3KYGA 4Q2KA 5JB9S 3GCOA 3UY9A 4FU8A 2FOAA 1GI7B 1XUFA 1BTPA 1BJUA 1DX5M 1LHEH 3RXIA 4BAQB 1D3PB 3DT0H 2Q6GA 1YM0A 1WOFA 5DP5A 3AW1A 1L0ZA 1WAYB 1TNGA 1H9LB 4ASHA 1OWKA 1EX3A 2V3OH 1GJAB 2XC4A 3BEUA 3N7DA 3OSYA 2A4QA 1W0KD 3QO6A 1TONA 3KNXA 1CQQA 3L3TA 5EPYA 4GVUA 2A5KA 2EI6A 1Y5AT 1GHZA 1B0FA 3STJA 2CF8H 1Z6EA 2F4LA 1BTZA 3P92A 1QA0A 4FUDA 1UVOA 2GVFA 1FJSA 3QN7A 1TPAE 1UTOA 4I7YH 1C5VA 2H2ZA 2P8OB 1UCYK 1O3FA 3SU6A 3A87A 1AQ7A 3FP7E 1ANCA 3VXEH 1ELTA 2BTCE 1J8AA 3SU1A 1SL3A 1EZXC 1SSXA 1P2QA 1T31A 4Q63A 3F2GA 2YNAA 1BBRH 2FS8A 3MH4A 3RXJA 5E2PA 1DWEH 2QIQA 3IG6B 1TNJA 4YOJA 1BMLA 2RA0A 1TBZH 1HAVA 1UVSH 4VGCB 2FI5E 2VIDA 3ODDA 1Y3UA 1EPTC 3UNQA 3MMGA 3RMOH 1QB9A 2AFQB 4BTTB 1SLUB 1UK4A 1UCYE 1QURH 3SU0A 1D3QB 3M5LA 1THRH 1TA6A 1C1OA 1RD3B 1QY6A 4UEHH 2FOMB 1BBRK 3ITIA 3MNCA 1DUEA 1HAGE 3K9XB 1EAWA 1GJCB 3UUZA 1FMGA 1GMCG 2ALPA 2OBOA 5A0AE 2R2MB 1JIMA 2QXHA 2SGPE 4IBLH 1PYTD 1GJDB 1ANBA 2KZ4A 1EAXA 1OHHD 2WHXA 1P9SA 4I8HA 2ASUB 1EXFA 4K3JA 4X1RU 2A0QB 3HGNA 1QTFA 4ABBA 4GPGA 4DGJA 4HGCA 1SLWB 1CA8B 3PO1C 1QR3E 4B1TA 2AS9A 3WWFA 1QB1A 1SGTA 2J98A 3M61U 1W14U 5C0UA 3K2UA 3FZDA 4Y8XA 3LC5A 3ZVGA 4GUXA 4UD9H 1MCTA 4YTAA 2ODYB 5T6FA 3ATKA 4BNRA 3KQDA 1AFQC 1NT1A 1HAXB 5F6MA 5DK1A 2BX3A 1YPHE 1UHBB 3H5CB 4ASUD 2FYRA 4MNXA 1ESAA 4UFFH 4ISNA 3BG4B 4RT1A 3F68H 3H7TA 4GSOA 3LPRA 5C5OA 5KGOA 1LQEA 1F0RA 1T8OA 3O8DA 1TMTH 2ZI2H 1AE5A 1FV9A 4DOQA 2NU3E 2FOCA 1AI8H 2ODQA 2PGQB 5DG6A 1SOTA 3U8RH 2XCNA 1C2GA 2BHGA 2EI8A 3GY4A 3BTME 2IPHA 4IC5A 2A45B 1TLDA 1E1RD 1TX8A 1FX0B 4ABIA 2ZHFH 1INCA 3ZVCA 1P10A 1TPOA 1XKAC 2BLVA 1HGTH 3BV9B 1Z8GA 1CT0E 2BXTH 5C2ZA 6GCHG 1PQAA 5GJ4B 3KEEA 4K5ZA 5GCHF 2Z9IA 1IQGA 2J92A 1DWDH 1J17T 3BG8A 1TGCA 4ZMAH 2HNTC 3OTPA 1C2JA 5F8TA 3V0XA 2GKVE 1V2LT 3O8CA 3TNSA 4O3UA 2F3CE 2VIPA 1NFWA 1DY9A 4JZDH 1Y3XA 1S6LA 2C8WB 3HATH 1MD8A 3TU7H 4CHAC 1HAHH 1LVMA 1MABB 2J9NA 2PLXA 2TIOA 2ULLA 2Z3EA 1K21H 4CR5A 2FOEA 5DP4A 1TRNA 1O3AA 3I77A 1GI9B 2XBYA 3WW7A 1D3TB 3STIA 1GL0E 1QRZA 3LH3A 1HJ9A 2R3UA 2ZA5A 2O8MA 4AOQA 3M36A 1V2KT 3GY6A 4ZROA 3T29A 5JBAS 1AVGH 1OPHB 1FDPA 3MH5A 4ZUHA 1OWEA 4X0WU 2ZFQH 4K2YA 1O2TA 5J4QA 1VCWA 3V7TA 3ZZAA 1QBOA 3NPSA 4WXIA 1DPOA 2OC0A 2BD4A 2O8UA 1F5RA 2P94A 2XWAA 4U30A 1MKWH 1KLTA 5DGJA 1F0UA 1TFXA 3SV8A 3UFAA 2WYJA 1BMFD 4ABEA 1V6DA 3SV7A 3GS9A 2XXLA 2VNTA 2ZP0H 1BRAA 2FOGA 4R0IA 3OTJE 5EQQA 1O0DH 1S0RA 3ZZ3A 4Y79A 2I6QA 3FANA 4DG4A 2BDHA 1UTMA 1EFRD 2L74A 3TGKE 1YPGH 1GBIA 1NBME 2LNCA 3MYWA 1JRSA 3K65B 1K1IA 1DDJA 5HGGA 1KXFA 4CREA 3M5MA 3P17H 1EAIA 4B2CA 3CS7A 1QB6A 1QQ4A 1W12U 1TWXB 4A6LA 1KLIH 5A0CA 1E0FD 2QGRA 2F91A 4D8NA 4WF8A 1GJBB 3TVJB 1Z8JB 3ZZ4A 1O3HA 1FN6A 3FP6E 1B5GH 2BQ6B 1H8ED 4KELA 5DPAA 1GI0A 1A5IA 3MH7A 4ZXYH 1GJ7B 1HAZB 2V6NA 1AMHA 1O5DH 4D7FA 5EXLA 1BHXB 2AGGX 4XBBA 1C2HA 1CA0B 3ENSB 2XWBI 4X1QU 2L6OA 1BHXF 3E6PH 1ESTA 4OS2A 1GBEA 2JJ1D 3GOVB 1GDQA 2HVXA 3PRDA 1WDIA 4WXVA 3U98H 2BM2A 1G3DA 2PKAA 1C5TA 1CBWC 2K0QA 1GVLA 2OCVB 4I86A 1V3XA 3QUMP 2UUKB 1AGJA 1K1JA 3UIRA 2W3IA 2WYGA 2ZF0H 4Q7YA 1YKTA 2CGAA 4B2BA 3A83A 1EP5A 4K8BA 1TGSZ 4A5TS 4ABDA 1DITH 1MTNB 1CO7E 5B6LA 1ZGVA 3JZ2B 1ZRKA 2Y5FA 1T4VH 3F9FA 3URDA 1O2JA 2GMTC 3P6ZB 1EATA 4CBOA 1GG6C 1V2UT 1S82A 5HMAA 3ESTA 2FI3E 4DT7B 1SI5H 1THSH 1BOQA 1ELAA 2FOFA 2FZZA 1Y5BT 5EU8A 1C5SA 3TIUA 2B7DH 3A7WA 5JYIA 2VGCB 1S6FA 2ANMH 1S0QA 4THNH 2H9EH 1WQVH 2CJIA 3TITA 1AB9C 3M5NA 4JYUH 2LPRA 5FX6A 5LH8A 2EC9H 3A80A 4XBDA 1GI4A 1BTHH 4JZFH 1G3EA 1SVPA 3RXDA 2ZHDA 1AU8A 1BTYA 1SQRA 4K60A 5E0HA 1V2WT 1C4V2 2WV9A 1EZUC 1LHFH 3C1KA 1YPLH 4BAOB 1O2YA 5CHAC 3W1EA 2YOLA 1LPKB 2PGBB 4KTCA 1AKSB 1ARCA 1MTUA 1SQTA 2UWPA 3E0PB 3FVFB 3LOXA 3VG8A 2OC7A 1WV7H 1GPZA 3B9FH 2GZ8A 2RG3A 3MU5A 1C2DA 2BY5X 2QF0A 4FUHA 2OP9A 3FOAA 4ISIH 3F1SB 4X1SU 4ZH8A 3ZZDA 1SGDE 5C17A 8LPRA 4BXWA 5CMXH 1L2EA 3GCHB 3SUEA 3T25A 5FPSA 2PP6A 1OWDA 5EG4A 2V3MA 3E0NB 1GI2A 1ZYOA 3UOUA 1F0SA 1GCDA 1TA2A 4NIYA 1Y59T 1TRYA 4IS5A 3WY8A 2BD7A 5LGOA 2OD3B 1TOCB 5JB8S 2CF9H 2WSSD 5HM2A 2BZ6H 1G2LA
chains in the Genus database with same CATH topology
4JYTA 1RTKA 4AZ2B 1BT7A 4IGDA 1SB1H 3NUMA 1ESBA 5BRRE 1PPEE 1PPZA 3TK6A 1TAWA 1Z7KA 4AFQA 2QY0B 2ZQ2A 4ABAA 3A84A 2A7HA 1LMWB 4KP0A 1BRUP 3F9EA 3ZVFA 1ZZZA 1BTXA 1GI3A 5K0HA 1ZSLA 1P57B 2V0BA 3UQVA 1G2MA 1OP0A 1ZSKA 4Y71A 1MZDA 1C4Y2 4LOYH 1ZJKA 1BMMH 1IHSH 2XYAA 3A7ZA 2C90B 3RXVA 1XX9A 3TGIE 6LPRA 4Y0YE 3VXFH 3SU4A 4FUIA 2PKSC 2NU0E 5FXLA 3SUGA 2DE9A 1NC6A 1TIOA 2VVUA 3PYHA 3A85A 2GGVB 2Y82A 2XBVA 3RU4T 1ZMLA 2ZFSA 1V2QT 4OS7A 3A88A 1H1BA 1W3CA 1QL8A 1EUFA 1SQOA 1DXWA 2GP9B 2GCTB 4ZKSU 3M7UA 4O97A 1GVKB 2G00A 3ZV9A 3GDSA 1J15A 2FXRA 5G4BA 1BITA 2ZZUH 1V2VT 5I25A 5GCHG 1PJPA 1VJ9U 4GLYA 4D7GA 2H6MA 2J2UA 2GTBA 4K1TA 1W0YH 1E35B 8KME2 1NU7B 4YT7H 4AG2A 4CRBA 2TGDA 4ZHLU 2VB0A 1SGIB 3OU0A 4YLUA 4QT8C 4NA8A 1KXCA 3P8NA 5C20A 4I8JA 3BTEE 4DVAU 3S9AA 5HM9A 1LDTT 3M3VA 3GY3A 1GBJA 1D6WA 3L33A 2DE8A 3SJKA 1SGCA 3IWMA 4RN6A 1FY4A 1NRSH 4NGAH 3FAOA 3RXUA 1C2IA 1EZQA 4X2VA 4CR9A 1P2KA 2R3YA 1L1GA 4ZKRU 3EA7A 2ZTXA 3MOCA 1HV7A 1DY8A 1KTTB 2BDGA 3QTOH 2QYIA 2B9LA 3GDUA 4U01A 2FYQA 1TX7A 2XC0A 5C1YA 2GCHF 3BTQE 2ESTE 5E0GA 4WJG2 2SGEE 1FY5A 4ISHH 1O2IA 1C5NH 2ZFTA 4M7GA 1N6YA 2C8YB 2I6SA 4YLQH 1C4U2 1O36A 3RUOA 2ZCKP 3SNAA 4BAHB 1MUEB 3SV6A 4AG1A 1EJNA 2FOHA 2WPJS 2J94A 3SHCH 3P8OA 2VWLA 1JOUB 2Y80A 1AWFH 3AW0A 1OP2A 2A4RA 3A8CA 3PM3A 3UTUH 1IQHA 2ZGBH 2XBWA 1SGQE 1MBQA 1AIXH 2W7UA 3M5OA 4MG3A 1P2IA 5LPEA 2WPKS 1MZAA 5F8ZA 4MTBA 4D9QA 1MU6B 1JMOH 3UREA 1GMHF 1UCYH 3MU4A 4LZ1H 1EOLA 4X8UH 1EKBB 1O3JA 1HJAC 4E06H 4JZEH 2VIWA 4H42U 1L1NA 2ZDMA 1J9CH 2BVXH 2Y6TA 5L2YH 1A1RA 1GWAA 1KDQA 1TGNA 5L2ZH 3AVZA 2Z9JA 3OY6U 2ZPRA 1YGCH 1Z71A 3E3TA 4YM9A 2IJOB 5ESBA 1GBCA 4LXBH 3L6PA 1O2KA 2BMGB 4FXGH 2AERH 1HIAB 1SQAA 3EAJA 5H4IB 3KQCA 4DY7B 4FUFA 2FLBH 2SNWA 4NFEA 1AZZA 1P11E 1XUGA 2Y5HA 3T27A 3SI3H 2Z9KA 1O5EH 1V2ST 2OC1A 1DUAA 3BTFE 1GHYH 4MNVA 1DVAH 1LVYA 3ZVDA 4IN1A 1GGDB 2D1JA 2WPLS 2OC8A 7LPRA 2XBXA 2XTTB 1GI8B 2HNTE 3U1IB 1T4UH 2UWLA 3S0NA 2SFAA 5PTPA 3CENA 4H6SB 1UO6A 2VVVA 4YO9A 1AHTH 5IDKA 3QK1A 1FLEE 1CGIE 1Q3XA 1J14A 4KGAA 5DJ7A 1W11U 2GT7A 1GHXH 1RIWB 2GZ9A 2JETB 2H9HA 2WV4A 4Y10E 3MFJA 5HYOA 3ELAH 3LH1A 3ZZ5A 1C5ZB 3AASA 3QWCH 4K8YA 4B76A 1C1VH 3NZIA 4XSKU 3SUDA 4J2YB 3D62A 3LDXH 7GCHF 1UTNA 1QRXA 2SGQE 2H1UA 1BIOA 1RJXB 4UE7H 3DUXH 1MD7A 3SUFA 1YPMH 1ID5H 2P3UB 2Z94A 3O8BA 1ZHPA 1ORFA 2C8XB 1TMUH 2CHAC 4MPXA 4GCHF 1C5RA 1SLXB 1UTPA 1TX6A 5AF9H 1Q31A 4ZKNU 2ZHEH 1DE7H 3BIUH 3PV4A 3EE0B 1ZTLA 3RXSA 4WY3A 1OSSA 2KAIA 2ZFRH 1A7SA 7KMEH 3DA9B 4BOHA 1GBTA 1MH0A 1LVOA 3SU2A 1NESE 1NRRH 3GYMA 5FAHA 1V2JT 2HPPH 5GPIB 3PLPA 3LGWA 1O3LA 2ZKSA 1W13U 1NRNH 3Q3YA 3M3SA 2QCYA 1A3EH 1VITF 1N6XA 1KXDA 2ZU2A 3IITA 1MTWA 1ZOMA 1ELEE 1VGCB 3A89A 3GCNA 5T3HA 2QN5T 1GBLA 2R2WU 8ESTE 1LHDH 3TGJE 1ZLRA 1ZR0A 1TRMA 1U6QA 2ZGXH 5TCCA 3SI4H 4ESTE 4DIIH 1TALA 3BTWE 1KTSB 1K1OA 3RXOA 2BX4A 1WTGH 2C93B 3UR9A 4BTUB 3TJUA 1ETSH 4KTSA 2BD2A 5F8XA 2GDEH 1B0EA 2Z6BD 1BUIA 2Q6FA 3T62A 2SNVA 5EODA 2O8LA 3BSQA 5A0BA 4U32A 4FUEA 3P95A 3SJ9A 2EA3A 3TH3H 3RC6A 3T28A 4D9RA 3SGBE 1BB0B 6CHAC 1HAOH 2WV5A 3A82A 3GYLB 1OS8A 3VGCB 1BZXE 1QNJA 2UWOA 3ZVBA 1N8OB 3T26A 1A3BH 2HLCA 5GWZA 3QZRA 1UK3A 5ABWA 3U9AH 1QJ1B 1O3IA 5AHGH 3MO6A 1SG8B 3AAUA 4IN2A 2GD4B 3DD2H 1FAKH 1GCTB 1ARBA 3SZNA 1DLEA 5EQRA 5DP9A 1ZSJA 1SGFG 2A4GA 1EJAA 4I33A 2A2QH 1C5QA 1MAXA 1C1TA 3UPEA 2BDYA 1BRBE 3ATMA 2JH0D 4Q80A 1FONA 1Q2WA 2P95A 2EEKA 2PSYA 5EGMA 1AFEH 2D26C 1CE5A 3QDZB 4ISOA 4OS5A 3MI4A 5L6NH 3TNTA 1GMDF 2J4IA 2AMPA 1GBKA 5FBEA 1DT2A 1YPHC 1GHBF 2ZFPH 2CXVA 4NIWA 1HNEE 1C1SA 3EQ0H 1XXFA 1UJ1A 2AIQA 3PTBA 2ZU1A 5TCAA 1ZGIA 1OX1A 3EDXB 2B0FA 5FPTA 4O03A 2A7JA 5A09A 3ZVAA 1H8DH 5E2OA 3QLPH 1GVZA 1QQUA 4X1NU 2BVRH 5EXNA 4DW2U 4NIVA 3SGAE 1K1NA 1QRWA 4Y7AA 2STBE 2JH5D 4KKDA 1P2MA 3Q77A 4NWLA 3QGNB 3KHVA 1HYLA 1QIXB 2VH0A 9LPRA 1FPCH 5A8YA 2FWWA 5DP7A 1HXFH 5FCRA 1MTSA 2SGAA 1F2SE 4XE4A 2GCHG 2BQ7B 3NWUA 1G37A 4AB8A 1B7XB 2BD3A 5ETXA 1BJVA 1VCPA 1V2MT 1D3DB 1YPEH 1AWHB 3RLYH 1PPGE 1NN6A 1L1JA 1V2PT 3RXTA 2R9PA 2THFB 1H9IE 4X1PU 1UVTH 3PLKA 1HAIH 3RXQA 3CS0A 1EPTB 2CN0H 1X7AC 1XVMA 1Y3VA 1NS3A 4H6TA 1NRQH 4PROA 3HK3B 2QC2A 1LHCH 3TPIZ 1WSSH 3PB1E 1E34B 3VFEA 1QJ7B 1HFDA 4FUJA 1QA7A 5EOKA 4CRFA 2PUXB 1OWJA 2W26A 3ODFA 4FUBA 2GT8A 3PMHB 4E7RG 1GMHG 3MNSA 3PROA 4MVNA 1EOJA 1OYTH 4FVDA 3LKWA 4AFZA 3M37A 5LPFA 4CRCA 1DOJA 3RMLH 2BDBA 2BOKA 3BTKE 2B5TB 1HAPH 1O3EA 2ODPA 4A1XA 1ETTH 1P04A 1V2TT 1SGPE 3PO1B 1GJ5H 4HFPB 1UTLM 2HPQH 2ZDKA 3E1XB 1BMNH 2PHBA 2WPHS 2PWXA 1LKBA 2A7CA 1O5GH 2ZPQA 2Y7XA 3VB6A 1V2RT 7ESTE 1Y3YA 1CVWH 4X2YA 1HAVB 3A8AA 1YYY1 2W3KA 1P09A 1P2NA 2P8OC 5EQSA 1O2VA 1AFQB 1O3OA 3TJOA 1RRKA 3ZVEA 2VINA 1P01A 1UK2A 3SNBA 1IQLA 2ZQ1A 2QXGA 3GCTF 9ESTA 3RM2H 4WVPE 3LIWA 3RXEA 1IHTH 1RS0A 1XUIA 3M35A 1FNIA 1TB6H 1CHOF 3KQEA 3OYPA 5HXFA 4VGCC 2HRVA 2O8WA 4X6PA 1C9PA 4IC6A 4B74A 1TPPA 4I8LA 2BLOA 1AD8H 4B71A 2FM2A 1O2MA 2EI7A 1LCYA 1UHBA 1YCPH 4DJZB 1Y8TA 2C8ZB 1PQ5A 3K6YA 4FUGA 1O3MA 2BY7X 1WU1A 1MKXH 2A2XH 3A7TA 3ZV8A 4MNYA 2FDAA 5EW2H 4DURA 4ISLA 2FTLE 3SNCA 3AAVA 3BN9A 3S69A 3G01A 7GCHG 2ZU3A 3GICB 3RXHA 4UONA 1PYTC 1S5SA 2ZECA 5DO4H 3S9BA 4Y0ZE 1C5MD 1O3KA 2P59A 2VU8E 1O3BA 1HBTH 1RTFB 1YCPM 1YCPK 1GJ9B 3N7OA 3SNDA 4CH2B 1W0ZU 2HNTF 1MKXK 1SGNE 1DSTA 1FIWA 1NPMA 2BD8A 4GCHG 1GBFA 2HWLB 2UUYA 2B8OH 3KL6A 5DP8A 5E0JA 4JCNA 3URCA 5A2MH 3D49H 4CHAB 1XMNB 2P93A 3RXGA 4Z6AH 3BF6H 1GHAF 2FI4E 1G36A 1O33A 2OBQA 3GY8A 1DSUA 2Z3DA 2ZO3H 1GBDA 2VIVA 1GBHA 4AORA 1IQIA 2WPMS 4LZ4B 2GZ7A 3V13A 1RGQA 1PPFE 4JZIA 2STAE 1EZSC 1C1NA 3BG4C 3PLBA 2OINA 2C3SA 5EW1H 3LT3A 1CSOE 1VITG 3GY2A 2BY6X 2FX6A 3LGTA 5DP3A 3Q3KA 5T6DA 3JZ1B 1NROH 1A2CH 3SOSA 3PMBB 3SORA 3S9CA 1V2OT 1YC0A 4NZLA 3BTHE 4ABJA 3M7QA 1P02A 5L30H 2R0LA 1F7ZA 4AGKA 1ABIH 3E90B 4MPUA 1TGBA 1HPGA 1D9IA 1O5CB 3ZZBA 3TH4H 1ZMNA 1KXBA 2F9BH 3LC3A 1OWHA 4JK5A 2ZIQH 2FX4A 1DM4B 2ZGJA 3EA9A 2P3FH 2D8WA 3BTTE 3HKIB 1S84A 1VJAU 2A32A 2BDIA 5FX5A 4I8GA 3U69H 1OKXA 3UWIA 2Y7ZA 1WYKA 3HGPA 2ILNA 1LTOA 4YZUA 1HJ8A 4INHA 1UMAH 3DFJA 3UWJH 2J38A 3VEQB 3P8FA 1P0SH 2AMQA 2W7SA 3NKKA 2ZNKH 4K69A 3RMMH 1O2OA 3SBKA 3GDVA 3VB5A 1N1LA 2BY9X 3LJJA 1C2KA 4NG9H 5TJXA 1JXPA 2VWOA 3A8DA 2WPIS 1D4PB 2BDCA 1AE8H 2PV9B 1CBWB 2AGIX 2G55A 2P3TB 4GAWA 1FY1A 5EPNA 1Y5UT 2G81E 4OGXA 1Z8RA 1P3EA 3ATWA 1G30B 1JWTA 1CHGA 1HAYB 4X6NA 1UTJA 4TWWA 1AUJA 2BYAX 4JZ1A 1Z1IA 1T8LA 1SFQB 1LHGH 1GMDG 3MNXA 3SN8A 2ZEBA 2ZWLH 3FP8E 1FY8E 2VVCA 1GHBG 2GMTB 1HUTH 3RXBA 1XVOA 1GG6B 5EXMA 1HRTH 3A7XA 2G5NA 2JH6D 2P16A 4CRAA 1ZPZA 3KQBA 3Q76A 3ZYDA 1P3CA 2CMYA 2NU2E 4IMZA 4CBNA 2RDLA 1TNHA 1ZJDA 2OQUA 5C3NA 1EP6A 2BOHB 2ZGHA 5C5NA 1ELFA 1EPTA 2ZDNA 1SR5C 3RXLA 4FUCA 1MBMA 3SV9A 1F5KU 1O35A 1O3PB 2ZGCA 5JBCS 3I78A 1AB9B 1BA8B 3PTNA 3RM0H 4NCYA 1C5WB 1VR1H 2PKAB 5I46H 3VB3A 1MAYA 3PWBA 1ZHMA 3U1JB 1AVWA 1O2QA 4AFUA 1WUNH 1GBBA 2SGFE 3SO3A 4MNWA 4BANB 4NZQA 5AVDA 1CA0C 4BAKB 1PQ7A 2BZAA 2Z9GA 4BAMB 4NFFA 1LQDB 1TE0A 4X8VH 3TK5A 1NZQH 1TNKA 1GBAA 3SQHE 1A5HA 2C4FH 1NM6A 1IQKA 1ZRBA 3BTDE 2UUJB 1LO6A 2ZFFH 2AIPA 3EGKH 1A0LA 1O2UA 3LGUA 4Y76A 5CHAB 3RU4E 1G3CA 3RXFA 2ANKH 3F9GA 1FUJA 3BEFB 1C1UH 4A1VA 5C67A 4AX9H 1ELGA 6ESTA 4NSVA 1IQFA 1KYNA 1YPJH 5FPYA 1O5AB 4HTCH 4X8TH 4LK4A 1P2OA 1FI8A 1KXAA 4WMFA 2ZCHP 1MTNC 4ZHMU 3LGIA 3ATIA 4UFGH 2BDAA 3A7VA 2PR3A 3OY5U 5JBTA 4R8TB 1JBUH 1AKSA 1YPKH 3PMJA 1RTLA 1HCGA 2TPIZ 3RP2A 1TYNA 1F0TA 1O2RA 3QZQA 1ETRH 3CP7A 1O3CA 2CV3A 3TLOA 1GBMA 1IQEA 2F9VA 1TMBH 2Z3CA 1XKBC 1FXYA 4UFEH 2A31A 2WUBA 1CT2E 3DFLA 1XXDA 4KTUA 1QCPA 1O2ZA 1UVPA 4K1EA 3A8BA 1P12E 2VIOA 1AVXA 3HKJB 5J4SA 1GJ6A 5DKMA 2VGCC 5B6OA 2IN2A 2UUFB 2G4UA 1TNLA 1TQ7B 1IOEA 5CE1A 2H5DA 2GX4A 1AO5A 1NU9A 3MH6A 2FMJA 3UQOA 3D65E 5E8EH 1O31A 1V2NT 1C5YB 1KY9A 1C2FA 1C2EA 1MCVA 1A4WH 1BBRE 1QBVH 3QGJA 1DS2E 2F9UA 2ANWA 2PUQH 3M3TA 3RXMA 1ANEA 1AZ8A 4JYVH 1WQSA 3GCTG 1ELDE 2IOTA 1S85A 1TQ0B 2F9OA 8GCHF 2PKSB 1K28D 1CHOG 1K2I1 1AUTC 1ZPBA 4Y11E