3UQOA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA02
3RDZA 4U2WA 2A31A 4WF8A 2PKSC 1JBUH 3SI3H 4ZKSU 1C1VH 2B7DH 3NWUA 1O2JA 2VVVA 2ZIQH 4GAWA 4DG4A 1QL7A 3M61U 3E0NB 4IW4E 4JZEH 1AQ7A 4ABEA 5C1UA 3EA7A 1L2EA 4X0WU 1CA0C 2Z3DA 1OWIA 2ESTE 4MG3A 2ZGBH 1BDAA 1HFDA 1C5ZB 1JWTA 1BTXA 3E0PB 3BG8A 2ZFFH 1ZPCA 2DE8A 1XM1A 4WMDA 4CH2B 3A7YA 1J17T 1P8VC 2BVRH 1GBDA 2O8WA 3GY8A 5JBBS 1D3TB 4CRFA 4CHAB 1GHAG 3F9HA 1GGDB 4X8TH 8GCHG 3SI4H 1F5LA 2GGVB 2HVXA 3LONA 2P59A 1JXPA 1Z8JB 1E37B 3O8BA 4INKA 1UVOA 3TITA 5DO4H 4OS1A 3ZZDA 1DDJA 3GCNA 2QC2A 3U8TH 5EW1H 1C1UH 1GJ9B 1DS2E 2HOBA 1TGSZ 1Y3WA 3PO1B 2FYRA 3E3TA 1P9SA 3HK6B 1DSTA 2W7UA 3GY6A 4ISNA 5GDSH 4NGAH 1GI8B 2P94A 3NXPA 3MH4A 4ISLA 1ZSJA 3O8DA 1SGFG 1DWDH 1WTHD 4NA7A 2UUYA 3BTME 1HAXB 1YPHC 4JYTA 3M7UA 1BJVA 3TGJE 2XBYA 4JZ1A 3LDXH 1AD8H 4WH6A 1ANDA 4NZLA 1O3BA 3LH3A 1AY6H 1TNGA 4DIHH 2ZU5A 1BBRK 1VCWA 4CR5A 4NSYA 1UHBA 1RFNA 3ATKA 2JKHA 3HKJB 1Y59T 2Y7ZA 1PPEE 1CBWC 3MU1A 2ZU2A 1AHTH 2A7HA 2Q6DA 4WMEA 3Q76A 5GIBA 3Q3KA 1MU8B 4NSVA 1EZUC 1MTVA 1ZSLA 2A4QA 3U9AH 2BD2A 1CO7E 3U8RH 1HAVB 1PQAA 2FYQA 1AB9B 1XUHA 2CHAB 1FN6A 1DUAA 3QLPH 3RXTA 1AFEH 3ENSB 1C2JA 3GYMA 4D7GA 1A0HB 1EX3A 1DVAH 1KIGH 3NPSA 1LVMA 1YPJH 3BEIB 4LZ1H 2XNIA 3A83A 3SUEA 3MMGA 3FP7E 3EQ0H 3UNRA 3ATIA 1QB9A 1SSXA 1BRUP 1SI5H 3T27A 2BY6X 5LPFA 1TBRH 2BVXH 1BTYA 1RTKA 2A4OA 2CF9H 4A5TS 1A5GH 1QURH 1P3CA 1QNJA 2PGQB 3MWIU 2F83A 1RTFB 1V2RT 3FVFB 4K3JA 1DANH 2ZNKH 5C5NA 1ZRKA 1O2GH 1P01A 3RC5A 2FS9A 5L6NH 4DURA 4INHA 1KSNA 3VB4A 1Z1JA 2R9PA 2STBE 3LGWA 4BANB 3M37A 1BRAA 3RXCA 1DITH 4X2XA 1QB6A 2H1UA 1O3FA 1G9IE 1FONA 1TMBH 1ZPBA 1RS0A 1UVUH 2ZKSA 3K6YA 5F8XA 2IPHA 3TVJB 2C8WB 1TPSA 1QBVH 1O2HA 1KTSB 3SV7A 1FN8A 1G3CA 1BITA 1C2DA 1A61H 1P10A 5FPYA 1KXAA 5C1YA 5C1XA 4SGBE 1ZR0A 2FZZA 2FMJA 2P8OC 3P8GA 3MO6A 1O2LA 1NPMA 1P2IA 1XMNB 1XUJA 1K21H 6GCHF 1FV9A 4BAHB 2IJOB 1TGNA 3KQEA 3GY5A 2GCHG 2WPHS 2ZPQA 2O9QA 3M3SA 4MNXA 2O8LA 3BIUH 2GCTB 1GI1A 1V2PT 1C5VA 1QTFA 1THPB 3TJNA 3RXHA 2ZPRA 1O3MA 4A1VA 2ZHWH 1GCDA 4K1SA 1ZJDA 2ZDKA 1Y3VA 1GHXH 1MZAA 2VIDA 4NIVA 3H5CB 1G37A 4JMYA 2BD9A 1O2UA 1ZPZA 2GV6A 2K1QA 2VWMA 1SL3A 1O5EH 2R3UA 3FP6E 1NRRH 2F9NA 2Y5GA 2OBQA 4Y79A 2AS9A 2H6MA 1ZGVA 2ANMH 1K1LA 3P92A 1C5OH 1GWAA 3UNQA 3SNAA 1H4WA 1IQEA 4ABFA 2FS8A 1NS3A 1EATA 1GMHG 3LT3A 4I31A 2D1JA 3PMAB 1BOQA 1XVOA 1GDQA 1UHBB 3OY6U 1FUJA 5LGOA 1J14A 1S5SA 2Y6TA 5EXLA 3Q3XA 5JB9S 1XUIA 2TRMA 1QJ7B 3C27B 2OLGA 1UVTH 1ZMLA 3FANA 3QTVH 2FDAA 2FLBH 4E05H 2VJ1A 4H6SB 2FOFA 1CU1A 1XUFA 2LPRA 1WU1A 3S9CA 4X2YA 3PMHB 3MO3A 1V6DA 4BNRA 2OC8A 1V2JT 1H1BA 1Y3XA 2AYWA 4XFQA 1A0LA 7GCHF 3KCGH 3AAUA 3SUDA 3URCA 2F9UA 1HAHH 1V2ST 2BLVA 5K7RA 2PFEA 2PTNA 5A2MH 1LTOA 1T8MA 4ASHA 1C4Y2 2J4IA 2BDBA 1AFQC 2Y5HA 2P16A 4UD9H 3P95A 1HAPH 1P02A 5A8YA 2FM2A 5JYIA 3SOSA 2OC7A 2WPKS 5GXPA 2BYAX 3T5FH 4D7FA 3RMMH 2OXSA 5T3HA 1O3HA 4KTCA 2P3UB 2V3HH 2F9OA 1K1OA 2A1DB 1QBOA 2FTLE 1BBRE 2FESH 1VJAU 4OS4A 2WPJS 4AYVB 2FX4A 3A7VA 2GZ9A 1UTKA 2ZFSA 1GMCF 2SGAA 2R3YA 2Z94A 3A7XA 4Z0KA 1EAIA 2OP9A 1W7GH 4TYDA 2SNVA 5FX6A 1UK3A 1C2LA 2ODPA 4ABAA 1Q3XA 1PFXC 3F9FA 4RN6A 1WCZA 2GT8A 3MH7A 3A85A 2BXUH 3SJ9A 1MKXH 1GI7B 2RCEA 5JBCS 1O3EA 3QN7A 5ABWA 1UVPA 4UFFH 2XXLA 4YOIA 5BPEA 2WYGA 1OYQA 4YOJA 1H8IH 2QXHA 1P9UA 2W3KA 1A3EH 3RU4T 1O3DA 1VITF 5JBTA 1XX9A 4K8YA 1OX1A 9LPRA 2VIQA 3SUFA 1ZTLA 1HDTH 4E06H 1O2MA 1TRNA 5DP7A 2A7CA 5DGJA 2BX3A 2A4GA 1EJMA 3QZQA 1GBJA 2BZAA 3EE0B 1PQ5A 1ZTKA 1C5NH 2G52A 3ZZCA 1L4DA 5L30H 1AE5A 1G3BA 3LU9B 2Z3CA 2FX6A 1T31A 1UTJA 3VGCC 4AZ2B 1RRKA 3LC5A 3A86A 2LNCA 2WUCA 3GY2A 2BDAA 1TOCB 1S6FA 2HPPH 2B0FA 3A87A 2P95A 4FU9A 4D76A 1TYNA 2P3TB 1C1SA 3P6ZB 4CRDA 3UR6A 5E8EH 1AWFH 2ZU1A 1C2FA 1DWBH 3UQVA 2GZ7A 5PTPA 2ZG0H 1Y3UA 2FO9A 4CR9A 3TU7H 1K22H 1RD3B 2AEIH 5EPYA 1ESAA 3EDXB 1ZHMA 3PB1E 1N8OB 4E7RG 3A7ZA 3F68H 3NZIA 1ZYOA 2VGCB 2PW8H 3SUGA 4I8HA 2JH0D 6CHAB 3EAJA 1SR5C 3SNCA 3ZV8A 1ZSKA 1AUJA 3LKWA 1LQDB 3KN2A 4K1TA 1TQ7B 2GZ8A 4X2VA 5A0AE 4ABHA 1TB6H 3NUMA 1TIOA 1NFWA 3I77A 4NFEA 1PQ8A 4OS7A 4TPYA 1MKXK 3SU4A 1GBLA 2FOBA 2ZQ1A 3BTHE 1C5PA 2XC5A 3RXEA 1YLCA 4HZHA 2ZFTA 3ZZ9A 3P70B 4ZMAH 1QR3E 3SHCH 3SNBA 1MTUA 1BA8B 3M7TA 1GBIA 1C1PA 1HAOH 1BTUA 2HGTH 1CT4E 1MAYA 5C3NA 2ZGCA 1EB1H 3BEFB 4RKOB 1E36B 3M5LA 1MD7A 1KXBA 2BLOA 3RXJA 1T7CA 1FY1A 2PR3A 2HNTE 2UUJB 3OU0A 5CMXH 1OOKB 5JBAS 2ZTXA 3A8BA 3W95A 4DIIH 2GTBA 4FUBA 1F0SA 1AMHA 2D26C 4UFGH 1C1WH 1WUNH 1W7XH 1ELTA 2FXRA 1OKXA 3H7OA 2VH0A 1TAWA 3BF6H 3ATWA 5ETXA 2JETB 1NTPA 1HAVA 2Y7XA 3F9GA 1UK4A 1Z8RA 4OS5A 1SOTA 3U98H 2XBWA 1C1NA 1TPOA 1PYTD 4HI3A 1P2JA 1WSSH 4AFUA 4WVPE 4I33A 5GCHF 1N1LA 1GBKA 3CS0A 1ID5H 3LOXA 2OUAA 3ZZ4A 1LHDH 1DSUA 1TRMA 1J16A 4I32A 3SU1A 1T8NA 1G30B 1X7AC 4O3TA 2CF8H 1KTTB 1LHFH 3ZZ5A 4X2WA 1LQEA 1C2IA 1O2KA 3RXAA 2TGPZ 1MKWH 2GMTC 3ZZAA 1SGRE 2ANYA 2BHGA 3UOPA 1EZSC 3D23A 1FMGA 1HXFH 3FZDA 3AVZA 1ZJKA 1JIMA 4ISHH 5EODA 1TONA 1HJAC 1D6WA 1K1JA 3RXDA 4VGCC 4ABJA 1HRTH 4K2YA 4AGKA 2QXJA 1GJ7B 1BQYA 1U6QA 2XW9A 2VWOA 3QZRA 1FAXA 3OY5U 2ZHQH 4TY6A 5IYTA 1BMNH 1K1NA 6LPRA 5DP8A 5I25A 3A8AA 3AASA 3CS7A 4ISOA 3RXQA 1YCPM 1OWEA 3IITA 1C5QA 4GCHG 1BCUH 1ARCA 1ELBA 5TCCA 1LVOA 2W5EA 1EB2A 1P2QA 2WINI 1O3CA 4X8UH 2ILNA 3HK3B 1GVZA 1FI8A 1W13U 4J2YB 1MQ6A 2Z6BD 1P12E 2IOTA 2V3OH 3SV8A 3GY3A 2H5DA 1AZ8A 1F2SE 1K1IA 1VGCC 2A32A 1S0RA 1O2PA 2P3FH 4GSOA 2H9TH 1MH0A 3BTEE 4DT7B 4FVDA 4UONA 1EUFA 1OWHA 1OPHB 3PTNA 2WPIS 1NU7B 5A8ZA 2BD8A 3GISB 1G2MA 2D2DA 1B0EA 1FPCH 4XE4A 2QA9E 1QQUA 2VB0A 1QJ1B 3V7TA 3RXUA 4FU7A 6GCHG 2Y80A 3MH5A 2M5TA 1AKSA 4X6MA 1O2TA 5LPEA 2Z3EA 5JDUB 2FODA 3V12A 2SGQE 4WWYA 4UE7H 2OCVB 1KXFA 1HAIH 1UCYH 1KLTA 2F91A 4Y6DA 1ZHPA 5TCAA 1OSSA 3URDA 4I8LA 1C2KA 4UDWH 1RTLA 1O35A 4WXIA 2ALPA 1MKWK 1YPLH 3ZVEA 3ZVDA 1GG6B 3RM2H 5A0BA 2ZQ2A 3MNCA 1SOZA 1CE5A 1GBEA 4B75A 3OTJE 4JZFH 4BXSA 1BHXB 4Q7XA 2G8TA 3E1XB 1MZDA 1Q2WA 3B9FH 1HIAB 2V35A 2ANKH 1C5UA 8KME2 2SGPE 3F6UH 2OINA 1ETSH 2Q6FA 2PTCE 2C8XB 1NROH 2SGDE 2ZHEH 1W14U 3RXSA 1C4U2 1S0QA 2TGAA 2CV3A 5T6DA 1ELVA 4K1EA 3IG6B 1HJ8A 4GHQA 2I6QA 1GCTC 2XC0A 3GCOA 4LOYH 4O9VA 2R0KA 5J4SA 5G4BA 3S9AA 2ZTYA 4FUFA 1OXGA 3M5OA 1F0UA 3RC4A 2QXGA 4FUDA 3RUOA 1FAKH 3QGNB 3KHVA 4CRBA 4AORA 3P8OA 1FIWA 2ZGHA 4YO9A 4F4OC 4ZKRU 4H4FA 1O2WA 1D4PB 1K9OE 3DA9B 3SNEA 1O37A 3GYLB 3GDVA 1TABE 3RP2A 1SGYE 1MUEB 1O3AA 4AN7A 3MYWA 1B0FA 2BDYA 1ELEE 1G32B 3MFJA 1YPMH 5DK1A 3GCTF 1V2VT 1LPKB 4U30A 4AFZA 3QUMP 1G2LA 2EC9H 1UCYK 1IQIA 1GL0E 1MTNC 2WUBA 2JH5D 3I78A 4MPUA 4O97A 1UMAH 3ZVGA 4X6PA 4AGJA 2OC0A 1EKBB 4NWLA 4ABGA 1MBMA 3HPTB 1V2TT 2A2XH 2FOHA 1NFYA 1RIWC 4GLYA 4IMZA 2BQWB 1QFKH 4YOGA 4D8NA 3KQDA 2YNAA 3MU5A 2PLXA 1K28D 1WV7H 1YC0A 5F8TA 1A4WH 5HM2A 1FIZA 3E16B 5AHGH 1C5LH 1TQ0B 3KQCA 2ZF0H 4INLA 3ZZ6A 1W11U 3BV9B 1IAUA 1GMCG 1O2XA 1QA0A 1HCGA 4ABIA 1MU6B 4AFQA 1GHVH 4NWKA 1XKBC 2PUQH 3VB5A 4ZKOU 1MBQA 5FBIA 1D3DB 1QJ6B 1B7XB 1WTGH 4X6OA 3GCHC 4IS5A 4OGYA 1Z7KA 1SLXB 2H9EH 2HWLB 2PKSB 1NRSH 4Y11E 5E2OA 4IN1A 2BVSH 1F0TA 1NY22 1C2GA 1QGFA 1UTNA 2ZHFH 1WYKA 1O31A 1AKSB 1QRXA 5EXNA 1FY4A 1GHYH 1FNIA 1Z6JH 3TJOA 4Q7YA 2BD4A 5T6GA 1CA0B 2UUKB 1NN6A 1G36A 1OWJA 2F9VA 3RXIA 3KNXA 1O2IA 1N6YA 1ESTA 2G00A 4ZAEA 1LMWB 4LZ4B 1OWDA 1HB0B 1MTSA 1O3PB 5DP5A 1KXCA 1IQJA 1P03A 4THNH 5DPAA 2W7SA 2BQ7B 3VB6A 4NA8A 1AO5A 3ZV9A 5E0GA 1C5TA 4I8JA 2SGFE 2BB4A 1FXYA 1FLEE 4IGDA 5FX5A 1XUKA 2VWNA 4X1SU 4RKJB 3Q00A 3UWIA 1RJXB 3KQBA 2Z7FE 4XBCA 5JPMH 1G3DA 3QTOH 4QT8C 3RXVA 2Z9KA 1L1JA 2OD3B 1CQQA 2R0LA 3LH1A 1C1OA 4M7GA 1T32A 2OQ5A 3BG4C 4MVNA 2BXTH 2HNTC 2BD3A 1PPZA 4X8VH 4TWYA 1GJCB 4U32A 4ZXYH 2F9BH 3UR9A 4B2BA 1NZQH 4YESB 1F5KU 3EA9A 2BY5X 3PWBA 4CRAA 1ANEA 1C5XB 2XYAA 4XOJA 2ZI2H 5F8ZA 4B1TA 4CRGA 3OSYA 3S7KB 2ZCLP 2J9NA 5F03A 2BDCA 1LHGH 3SU6A 1GJAB 3RU4D 3UREA 1VR1H 1S82A 1P3EA 3MHWU 1OP2A 4O03A 4ZHLU 5A0CA 4Y8XA 1JMOH 1NESE 1YP9A 2BY8X 3BTGE 3UQOA 3M36A 1CBWB 2A4RA 1MTWA 1W12U 1EAUA 1W10U 1XKAC 1HJ9A 2PV9B 2YNBA 4MNYA 3LJOA 4Y7BA 5LH8A 1GI3A 1P2NA 5DP4A 2HLCA 2QV1A 3A82A 5CHAC 4JYUH 1S84A 1GMDG 1BJUA 1FDPA 2BX4A 3ITIA 1YCPH 3TNTA 1LO6A 2VVUA 1ANBA 1GL1A 1GJBB 2VIWA 3EYDA 3GICB 2RG3A 1VITH 1O3NA 2G81E 1SB1H 2QXIA 1YBWA 3QWCH 2A0QB 2R2WU 4KKDA 1A5HA 3KGPA 2XWAA 4D9RA 3M5MA 8LPRA 4Y76A 4H42U 1TNJA 1M9UA 6ESTA 4X1NU 3ESTA 1T8LA 1O38A 4JZIA 1SC8U 2ZGJA 3A88A 3VEQB 4KGAA 3JZ1B 3MTYA 2FWWA 3SGAE 2VIPA 2AGIX 2ZFPH 2B5TB 4HGCA 2A5IA 2VNTA 2W3IA 4DJZB 1S81A 2FI4E 4X1QU 1NRPH 2UWOA 2VIOA 4MPXA 4Y8ZA 3T26A 3TH4H 2FTMA 1P2OA 1PPCE 2H9HA 5JB8S 1EPTC 4FUGA 3R3GB 3UPEA 3WY8A 1QCPA 3BTKE 2GVFA 1NM6A 4ISIH 3A7WA 2R2MB 2GCHF 1Y5BT 1CVWH 5HM9A 1QIXB 1AIXH 1O2VA 1C4V2 4NFFA 1BHXF 1GJDB 3S9BA 4TY7A 1Y8TA 4JZDH 1EZQA 2J38A 1C9TA 1CA8B 2TBSA 3PTBA 1DICA 1SGNE 3M7QA 1CHOG 3K2UA 1QQ4A 1UCYE 5AVDA 5J4QA 3M5NA 5E0JA 4BAQB 4J1YA 3UTUH 4X1RU 2PGBB 3NCLA 2ZDMA 2PHBA 4U01A 2ZP0H 2P8OB 1ORFA 4KTUA 2XRCA 3TH2H 1S6HA 5T6FA 1AZZA 3T29A 1QL8A 1FZZA 2ZA5A 1V2MT 3SJOA 1YPGH 2ZGXH 3KIDU 3MNSA 2J95A 4FUEA 1UTPA 2BQ6B 3MO9A 4CHAC 3VXFH 1GGDC 4GHTA 1GI5A 1C1MA 2HRVA 1AN1E 1INCA 1GMHF 4IC5A 5DP9A 4WMFA 4BTIB 3L33A 2YOLA 3RXRA 1ZHRA 1ELGA 2SGEE 3SGQE 4FU8A 2BDIA 3PV4A 1GBMA 1GBAA 1BTPA 1TPPA 3SZNA 2ZTZA 3PO1C 1HXEH 1SGTA 4AB9A 1TNLA 2I6SA 5F6MA 1V2NT 1XXDA 1O36A 1D6RA 1UK2A 5AFYH 4BXWA 2QGRA 2BY9X 4ZKNU 1A0JA 3SJ8A 1OYTH 1SGQE 1HAZB 3PLPA 3TJVA 3AW1A 2GT7A 4GUXA 1O2QA 1TBZH 8ESTE 1Y5UT 2OBOA 1NFUA 2ZC9H 1CSOE 1P05A 2A5AA 1FPHH 4X8SH 3FFGA 1LHEH 4I7YH 5HXFA 3A84A 3SV2H 3RXPA 2WPMS 1LCYA 3UWJH 3HGPA 2NU0E 1FY8E 3RXMA 2AGGX 1QB1A 4NG9H 1L1NA 3LC3A 4I8KA 2D8WA 3B23B 1C1TA 4R8TB 1CHGA 4XBBA 4IC6A 3DD2H 1SGEE 1SFIA 4ZROA 1C5RA 1DWEH 2FOGA 2ZU3A 4UFEH 4YT6H 7ESTE 2BD7A 3ELAH 5EOKA 1UTLM 1V2OT 1ZRBA 2C93B 3RMLH 1PQ7A 1K1MA 1HIAA 3O8CA 2PSYA 2EI8A 2BLWA 4I8GA 5DJ7A 2BOKA 1AB9C 1WQVH 2CHAC 1NU9A 3VXEH 2Z9LA 3SQEE 7KMEH 5L2YH 2DUCA 1OP0A 1THSH 1V2KT 3UIRA 3L3TA 3KL6A 1O5FH 1FY3A 5EGMA 3SHAH 4MQAA 4AOQA 2FOEA 1THRH 1P04A 1A7SA 4B2CA 4B73A 1BTZA 1EOLA 4FVBA 1AFQB 1ARBA 1W0ZU 3SV6A 1TPAE 2RA0A 2J2UA 1C5YB 3RC6A 1YGCH 1O39A 1E38B 4B74A 5A09A 1YPKH 3ZZ7A 3LGTA 2VH6A 2QCYA 4IMQA 5EQQA 3BSQA 3CENA 3V13A 3MNXA 2EA3A 3O8RA 3U1IB 1S85A 1F5RA 2G4TA 2C90B 1KY9A 2AFQB 3UY9A 1E34B 3PLKA 1KLIH 4OS2A 1UJ1A 2CGAA 3PYHA 2ZO3H 1AVWA 1C5SA 2F9PA 3S69A 1JOUB 3U8OH 1GJ8B 5IDKA 3BTDE 3MU0A 4YT7H 1O3GA 1SLVB 2XC4A 1TNHA 1BTHH 2VIVA 3GDUA 3SNDA 1T4VH 3Q77A 4YZUA 3RXKA 3S0NA 2O8MA 4AYYB 1SMFE 3M3TA 4XDEA 1SGCA 2BDGA 3GY4A 3U69H 2ODYB 3RXGA 3GCTG 2EI6A 3VB7A 4JYVH 1J15A 1ETRH 2OC1A 1BTWA 1GBCA 1Z8IB 3TK5A 2BTCE 2CXVA 1LKAA 3K9XB 1CT2E 4WJG2 2GV7A 3BIVH 1UVSH 1YM0A 3Q3YA 3QK1A 3SGBE 1SGIB 5GJ4B 1P2KA 1BMAA 2GCTC 1GBTA 3ZVCA 1DUEA 3STIA 1GHBF 3VB3A 3DHKH 4IBLH 4FUCA 2UWPA 2W26A 1BMLA 1TA6A 1BT7A 3FP8E 1TRYA 4B71A 1ZTJA 3VGCB 3GOVB 1YLDA 2FI5E 2NU2E 4CREA 1IQNA 1UTMA 3LPRA 1V2UT 1BMMH 1BRCE 4A7IB 3V3MA 1O5CB 1FQ3A 1PPGE 1O3JA 4K69A 2GD4B 1TWXB 3T2NA 1DY8A 2XBXA 2GKVE 1TE0A 1AUTC 2Q1JA 1EJAA 1D3PB 1KXEA 2TIOA 3ZVBA 1L4ZA 5DG6A 1Z6EA 4TPIZ 1SG8B 3E90B 3SW2B 1PPFE 4FUJA 1DWCH 2Z9IA 1EP5A 5C20A 3D65E 1ZLRA 4X6NA 4A6LA 1S83A 2GX4A 1EJNA 1QL9A 4O3UA 1C5WB 3E8LA 1O2YA 4XBDA 3CP7A 1TX7A 2SNWA 3D49H 1ESBA 4UEHH 1ZZZA 3GDSA 2WYJA 3T62A 1O3OA 2BZ6H 4HTCH 1WQSA 3RMOH 4DOQA 4Q2KA 3K6ZA 1SGPE 2DE9A 1L0ZA 3LJJA 3BEUA 1IHSH 3M3VA 4R0IA 1GBFA 1RXPA 2C8YB 4TWWA 2PKAA 1SQTA 1VZQH 2KAIA 4BAOB 4AG1A 1TMUH 2FIRH 5GWZA 2P93A 3R0FA 3TPIZ 3V0XA 1ZGIA 3C1KA 1H8DH 1BRBE 2AGEX 2ZPSA 4AG2A 5L2ZH 1GI9B 1DY9A 4MDSA 1GVLA 2ZU4A 1BZXE 1GI4A 1GVKB 4MPWA 3QDZB 1Z71A 4KP0A 3DFJA 1MCTA 5FXLA 1UTQA 3MU4A 2ZZUH 5I46H 3SN8A 3DUXH 3EA8A 1AVGH 2UWLA 4IN2A 7GCHG 2EEKA 2FEQH 2ZDLA 3LGVA 1C1QA 5GPIB 3AAVA 2AMQA 2AMDA 3HGNA 5BRRE 1E0FD 2TGTA 1DT2A 4LK4A 1O5GH 3ZZ3A 4DVAU 1BB0B 4Y0ZE 4NA9H 2ANWA 3ZYDA 3LGYA 3ZVFA 2BM2A 2CMYA 1W2KH 2Y81A 5FHTA 5HMAA 1LKBA 5EQRA 3BN9A 3PROA 4ZUHA 3RXLA 2IN2A 1TBQH 3SJIA 3GY7A 2O8TA 1PPHE 1A1RA 1CGJE 3UNSA 1MAXA 2GDDA 1F92A 3M35A 5A8XA 4ZHMU 2BMGB 5DP6A 4GCHF 3KF2A 3ZVAA 1AI8H 5FCRA 4JK6A 5FBEA 1IQFA 4WH8A 1LHCH 2GMTB 4DGJA 2V0BA 2Y5FA 1ABIH 4X1PU 3RXBA 4K5ZA 3A8DA 1Y3YA 2ZEBA 2AERH 1HJAB 3ATLA 1YF4A 3A80A 4FUIA 4VGCB 3FAOA 4Y71A 3K65B 2O8UA 2CN0H 1O3IA 4Z6AH 2QIQA 2OTVA 1GHAF 1GI0A 5E2PA 8GCHF 1A5IA 2ULLA 1TGBA 2HNTF 1P11E 1CT0E 1NO9H 1AU8A 3T25A 1W8BH 3ODDA 2JH6D 9ESTA 1DOJA 3SU0A 1VITG 4KELA 1GDNA 2QY0B 3SO3A 1LDTT 5TJXA 1CGHA 5H4IB 3STJA 1O33A 2BDHA 4SGAE 1TNKA 1E35B 3RU4E 2ZDAH 1H9HE 1N6XA 4ZHAA 5C67A 1TOMH 1VGCB 3TIUA 1PYTC 1N8OC 3A8CA 1TGCA 1GHZA 1O3KA 4YTAA 3G01A 1QHRB 2VGCC 1L1GA 1SHHB 1UTOA 6CHAC 3A7TA 1EAWA 2STAE 1O5DH 3PMJA 2NWNA 1ELCA 1PPBH 2J92A 1LVYA 1ETTH 4A92A 1C2EA 1P09A 2SFAA 2VU8E 3A81A 4DW2U 1C5MD 2FI3E 2QF0A 1P06A 2V6NA 3N7OA 2QF3A 3UUZA 1LVBA 1D3QB 4A1TA 2FLRH 2PKAB 2KAIB 1O2NA 4CBNA 4Y10E 1HAGE 3SU5A 1K2I1 2XCNA 2BY7X 3P17H 1ELAA 3BTFE 3LGIA 4NIYA 3ZZ8A 1A3BH 1IQLA 2HALA 5CE1A 3TNSA 5FAHA 1WAYB 3AW0A 3QGJA 1Z1IA 4NCYA 3SBKA 1HNEE 4WXVA 4BAKB 4CRCA 4HFPB 3W94A 1T8OA 1DXWA 1NT1A 1VCQA 1D9IA 1ABJH 1IHTH 5B6OA 1OS8A 5FPTA 1T4UH 1KXDA 2J34A 1O5AB 4AB8A 1ELFA 2NU3E 3DFLA 4CH8B 4A1XA 1HUTH 2FOCA 1P57B 3KEEA 1QY6A 2G55A 1KLJH 1SFQB 1YPEH 1V2LT 3TGKE 2G4UA 4ABBA 3A89A 1MQ5A 1O5BB 4Q7ZA 2C4FH 4K8BA 1YPHE 1ZMJA 3HKIB 3ODFA 5ESBA 1GCTB 5ESTE 1GPZA 2HPQH 2JETC 1NFXA 1JIRA 1QRZA 2FOAA 2RA3A 3F9EA 1DE7H 5K0HA 2TGDA 1KYNA 2VWLA 1EQ9A 3UFAA 1DFPA 1SGFA 2C3SA 1AWHB 3PWCA 1BIOA 4FXGH 4Y8YA 2EI7A 4ZH8A 1QBNA 2OQUA 1LPZB 2XTTB 3SU3A 1TMTH 1XVMA 1IQGA 2PSXA 2WPLS 3BTQE 5LPRA 1SQOA 4FUHA 2XWBI 1SQAA 2NU1E 4KTSA 3ZYEA 1J9CH 2AIPA 3MU8A 2QAAA 4UFDH 2THFB 5FCKA 1OP8A 2GDEH 4MNWA 2A5KA 1GI6A 3RLWH 7LPRA 1HV7A 1TLDA 1O2RA 1MTNB 1DM4B 1FJSA 3BTTE 1GJ5H 3P8NA 2ASUB 1WBGB 3RXFA 1DXPA 2G5VA 5GCHG 1AE8H 2B8OH 2VVCA 4AX9H 1RGQA 3TGIE 1DPOA 3ATMA 1PJPA 1AVXA 1ELDE 1GDUA 3UOUA 3EGKH 2QYIA 1RIWB 2H2ZA 2QN5T 1HLTH 1TA2A 3PLBA 1HPGA 3MOCA 1SVPA 2NU4E 2FOMB 1W0YH 5AFZH 4XSKU 5DKMA 4ESTE 5EG4A 5FPSA 2BD5A 1SHYA 2WV5A 3OX7U 1SBWA 3TJUA 2Z9JA 1KDQA 1SGDE 4K60A 1MMJN 3FZZA 1MCVA 5DP3A 2VINA 3NKKA 4MPVA 1NC6A 1O2ZA 1ZMNA 2A45B 1IQMA 1TNIA 2Q6GA 2G51A 1O30A 4D9QA 1OWKA 1BUIA 1K1PA 1SLWB 2Z9GA 5EU8A 5EXMA 3GCHB 4DY7B 1Z8GA 1EPTA 4RSPA 2ZCHP 4H6TA 3E6PH 1XXFA 2C8ZB 2FP7B 3RXOA 1O2OA 2ZHDA 1TGTA 1YCPK 4JCNA 2H5CA 3SV9A 2AIQA 4Y0YE 3RM0H 2ZWLH 3L6PA 2UUFB 1ANCA 1AGJA 1UO6A 1ACBE 1TALA 2TPIZ 4BTTB 4OGXA 3SJKA 3B8JA 3I29A 1WOFA 2AH4X 1V3XA 1HAYB 4NIWA 3MH6A 1O2SA 2Y82A 5HGGA 4NIXA 2B9LA 1GBBA 1P2MA 1GHBG 1O0DH 1NRNH 1IOEA 4ZXXH 1GG6C 3F1SB 3VPKA 4Y7AA 4B2AA 4DCDA 1Y5AT 3S7HB 1JRSA 2ZDNA 4BTUB 1B5GH 3NK8A 4YLQH 5SGAE 3TK9A 4GVUA 3SQHE 3IWMA 1SLUB 1ZOMA 3TK6A 1F7ZA 1O34A 1MD8A 2WV4A 3HATH 4LXBH 4AFSA 3BG4B 4JK5A 4F49A 1A46H 1C9PA 1GJ6A 3DT0H 5E0HA 3RLYH 1EOJA 2BLQA 1H9LB 1P0SH 1HYLA 1YYY1 2ZDVH 1GI2A 4WY3A 1V2QT 1Q31A 1EZXC 1FY5A 2FPZA 1GMDF 1GJ4H 3QO6A 3TLOA 4E7NA 1GHWH 1LPGB 4YLUA 1C2MA 1TFXA 1SPJA 1DLKB 1XUGA 4Q80A 3QX5H 3LGUA 4ABDA 5EW2H 1TX8A 4BAMB 1A2CH 3H7TA 1DX5M 1HGTH 2CJIA 5EQSA 4NZQA 2PWXA 3T28A 5C2ZA 4GPGA 2AMPA 3PM3A 1C1RA 3RMNH 1EAXA 1O3LA 2G5NA 3LIWA 1HBTH 3SU2A 2PUXB 3BTWE 4YM9A 4CBOA 1GBHA 4MTBA 5C5OA 3PMBB 1QA7A 2ALVA 3ZZBA 1VJ9U 2XBVA 2ODQA 2J94A 3VFEA 1EXFA 2XCFA 2GP9B 5CHAB 3SORA 3D62A 2A7JA 1H9IE 2A2QH 3JZ2B 2BOHB 1IQKA 3MNBA 3E91A 1C2HA 3P8FA 1J8AA 1YKTA 4MLFB 2ZECA 1NRQH 3OYPA 5EPNA 1JRTA 1O32A 3U1JB 5HYOA 1W3CA 1CHOF 2ZFQH 1IQHA 4B76A 2RDLA 1KDQB 4PROA 3TH3H 1DLEA 1G3EA 1VCPA 3MI4A 2F3CE 4OS6A 1CGIE 4MNVA 5AF9H 1V2WT 2ZFRH 1TX6A 2ZCKP 1EP6A 1EASA 1EPTB 1QRWA 1F0RA 4BOHA 1BBRH
chains in the Genus database with same CATH superfamily
3RDZA 4U2WA 2A31A 4WF8A 2PKSC 1JBUH 3SI3H 4ZKSU 1C1VH 2B7DH 3NWUA 1O2JA 1BMFD 2VVVA 2ZIQH 4GAWA 4DG4A 1QL7A 3M61U 3E0NB 4IW4E 4JZEH 1AQ7A 4ABEA 5C1UA 3EA7A 1L2EA 4X0WU 1CA0C 2Z3DA 1OWIA 2ESTE 1COWD 4MG3A 2ZGBH 2KR7A 1BDAA 1HFDA 1C5ZB 1JWTA 1BTXA 2JDID 3E0PB 3BG8A 2ZFFH 4ACBA 1ZPCA 2DE8A 1XM1A 4WMDA 4CH2B 3A7YA 1J17T 1P8VC 2BVRH 1GBDA 2O8WA 3GY8A 5JBBS 1D3TB 4CRFA 4CHAB 1GHAG 2W6ID 1GGDB 3F9HA 4X8TH 3OAAD 8GCHG 3SI4H 1F5LA 2GGVB 2HVXA 3LONA 2P59A 1JXPA 1Z8JB 1E37B 3O8BA 4INKA 1UVOA 3TITA 5DO4H 4OS1A 3ZZDA 1DDJA 3GCNA 2QC2A 3U8TH 5EW1H 1C1UH 1GJ9B 1DS2E 2HOBA 1TGSZ 1Y3WA 3PO1B 1WDIA 2FYRA 3E3TA 1P9SA 3HK6B 1DSTA 2W7UA 3GY6A 3PRDA 4ISNA 5HKKD 5GDSH 4NGAH 1GI8B 2P94A 2EQNA 3NXPA 3MH4A 4ISLA 1ZSJA 2F43B 3O8DA 1SGFG 1DWDH 1WTHD 4NA7A 2UUYA 3BTME 2F4LA 1HAXB 1YPHC 4JYTA 3M7UA 1BJVA 3TGJE 2XBYA 4JZ1A 3LDXH 1AD8H 4WH6A 1ANDA 4NZLA 3N7EA 1O3BA 3LH3A 1AY6H 1TNGA 4DIHH 2ZU5A 3GS9A 1BBRK 1EFRD 1VCWA 4CR5A 4NSYA 1UHBA 1RFNA 3ATKA 2JKHA 3HKJB 1Y59T 2Y7ZA 1PPEE 1CBWC 3MU1A 2ZU2A 2K0QA 1AHTH 2A7HA 2Q6DA 4WMEA 3Q76A 5GIBA 2KFWA 3Q3KA 1MU8B 4I86A 4NSVA 1EZUC 1MTVA 1ZSLA 2A4QA 3U9AH 2BD2A 2YMSB 1CO7E 3U8RH 3OFND 1HAVB 3DSPA 1PQAA 2FYQA 1AB9B 1XUHA 2CHAB 1FN6A 1DUAA 3QLPH 3RXTA 1AFEH 3ENSB 1C2JA 3GYMA 4D7GA 1A0HB 1EX3A 1DVAH 1KIGH 3NPSA 1LVMA 1YPJH 3BEIB 4LZ1H 2XNIA 3A83A 3SUEA 3MMGA 3FP7E 3EQ0H 3UNRA 3AK5A 3ATIA 1QB9A 1SSXA 1BRUP 1SI5H 3T27A 2BY6X 5LPFA 1TBRH 2BVXH 1BTYA 1RTKA 2A4OA 2CF9H 4A5TS 1A5GH 1H8HD 1QURH 1P3CA 1QNJA 2PGQB 3MWIU 2F83A 1RTFB 1V2RT 3FVFB 4K3JA 1DANH 2ZNKH 5C5NA 1ZRKA 1O2GH 1P01A 3RC5A 5CDFE 2FS9A 5L6NH 4DURA 3DCLA 4INHA 1KSNA 3VB4A 1Z1JA 2R9PA 2STBE 3LGWA 4BANB 3M37A 1BRAA 3RXCA 1DITH 4X2XA 1QB6A 2H1UA 1O3FA 1G9IE 1FONA 1TMBH 1ZPBA 1RS0A 1UVUH 2ZKSA 3K6YA 5F8XA 2IPHA 3TVJB 2C8WB 1TPSA 1QBVH 3VG8A 3F2FA 1O2HA 1KTSB 3SV7A 1FN8A 1G3CA 1BITA 1C2DA 1A61H 5C0UA 1P10A 5FPYA 1KXAA 5C1YA 5C1XA 4SGBE 3ZIAD 1ZR0A 2FZZA 2FMJA 4B6FA 2P8OC 3P8GA 3MO6A 1O2LA 1NPMA 1P2IA 1XMNB 1XUJA 1K21H 6GCHF 1FV9A 4BAHB 2IJOB 1TGNA 3UB0A 3KQEA 3GY5A 2GCHG 2WPHS 2ZPQA 2O9QA 3M3SA 4MNXA 3NRLA 2O8LA 3BIUH 2GCTB 1GI1A 1V2PT 1C5VA 1QTFA 1THPB 3TJNA 3RXHA 2ZPRA 1O3MA 4A1VA 2ZHWH 1GCDA 4K1SA 1ZJDA 2ZDKA 1Y3VA 1GHXH 1MZAA 2VIDA 4NIVA 3H5CB 1G37A 4JMYA 4TT3D 3PV2A 2BD9A 1O2UA 1ZPZA 2GV6A 2KM0A 2K1QA 2VWMA 1SL3A 1O5EH 2R3UA 3FP6E 3OEHD 1NRRH 2F9NA 2Y5GA 2OBQA 4Y79A 2AS9A 2H6MA 1ZGVA 2ANMH 1K1LA 3P92A 1C5OH 1GWAA 3UNQA 3SNAA 1H4WA 1IQEA 4ABFA 2FS8A 1VKYA 1NS3A 1EATA 1GMHG 3LT3A 4I31A 2D1JA 3PMAB 2WV9A 1BOQA 1XVOA 1GDQA 1UHBB 3OY6U 1FUJA 5LGOA 1J14A 1S5SA 2Y6TA 5EXLA 3Q3XA 5JB9S 1XUIA 2TRMA 1QJ7B 3C27B 2OLGA 1UVTH 1ZMLA 3FANA 3QTVH 2FDAA 2FLBH 4E05H 2VJ1A 4H6SB 2FOFA 1CU1A 1XUFA 2LPRA 1WU1A 3S9CA 4X2YA 3PMHB 3MO3A 1V6DA 4BNRA 2OC8A 4Q63A 1V2JT 1H1BA 1Y3XA 2AYWA 4XFQA 4ZCNA 1A0LA 7GCHF 3KCGH 3AAUA 3SUDA 4XRNA 3URCA 2F9UA 1HAHH 1V2ST 2BLVA 3DSGA 5K7RA 2PFEA 2PTNA 5A2MH 1LTOA 1T8MA 4ASHA 1C4Y2 4RT0A 2J4IA 2BDBA 1AFQC 2Y5HA 2P16A 4UD9H 3P95A 1HAPH 1P02A 5A8YA 2FM2A 5JYIA 3SOSA 2OC7A 2WPKS 5GXPA 2BYAX 3T5FH 4D7FA 3RMMH 2OXSA 5T3HA 1O3HA 4KTCA 2P3UB 2V3HH 2F9OA 1K1OA 2A1DB 1QBOA 2FTLE 1BBRE 1W0KD 2FESH 1VJAU 4RI0A 4OS4A 2WPJS 3U28C 4AYVB 2FX4A 3A7VA 2GZ9A 1UTKA 2ZFSA 1GMCF 2SGAA 2R3YA 2KCAA 2Z94A 3A7XA 3F2GA 1EAIA 2OP9A 3N99A 4Z0KA 1W7GH 4TYDA 2SNVA 5IK2D 5FX6A 1UK3A 1C2LA 2ODPA 4ABAA 1Q3XA 1S6LA 1PFXC 3F9FA 2K8IA 4RN6A 1WCZA 3W1EA 2GT8A 3MH7A 3A85A 2BXUH 3KYGA 3SJ9A 1MKXH 1GI7B 2RCEA 4Z1MD 1O3EA 3QN7A 5ABWA 1UVPA 5JBCS 4UFFH 2XXLA 4YOIA 5BPEA 2WYGA 1OYQA 4YOJA 1H8IH 2QXHA 1P9UA 2W3KA 1A3EH 3RU4T 1O3DA 1VITF 5JBTA 1XX9A 4K8YA 1OX1A 9LPRA 2LP6A 2VIQA 3SUFA 1ZTLA 1HDTH 4E06H 1O2MA 1TRNA 5DP7A 2A7CA 5DGJA 2BX3A 2A4GA 2KCPA 1EJMA 3QZQA 1GBJA 2BZAA 3EE0B 1PQ5A 1ZTKA 1C5NH 2G52A 3ZZCA 1L4DA 5L30H 1AE5A 1G3BA 3LU9B 2Z3CA 2FX6A 1T31A 1UTJA 3VGCC 4AZ2B 1RRKA 3LC5A 3A86A 2LNCA 2WUCA 2L6OA 2BDAA 3GY2A 1TOCB 1S6FA 2HPPH 2B0FA 3A87A 2P95A 4FU9A 4D76A 1TYNA 2P3TB 1C1SA 3P6ZB 4CRDA 3UR6A 5E8EH 1AWFH 2ZU1A 1C2FA 3F3BA 1DWBH 3UQVA 2GZ7A 5PTPA 2ZG0H 1Y3UA 2FO9A 4CR9A 3TU7H 1K22H 1RD3B 2KX4A 2AEIH 5EPYA 1ESAA 3EDXB 1ZHMA 3PB1E 1N8OB 4E7RG 3A7ZA 3F68H 3NZIA 1ZYOA 2VGCB 2PW8H 3SUGA 4I8HA 2JH0D 6CHAB 3EAJA 1SR5C 3SNCA 3F2HA 3ZV8A 1ZSKA 1AUJA 3LKWA 1LQDB 3KN2A 4K1TA 1TQ7B 2GZ8A 4X2VA 5A0AE 4ABHA 1TB6H 3NUMA 1TIOA 1NFWA 3I77A 4NFEA 1PQ8A 4OS7A 4TPYA 1MKXK 3SU4A 1GBLA 5T1VA 2FOBA 3WWFA 2ZQ1A 3BTHE 1C5PA 2XC5A 3RXEA 3F0OA 1YLCA 4HZHA 2ZFTA 3ZZ9A 3P70B 4ZMAH 1QR3E 2QF5A 3SHCH 3SNBA 1MTUA 1BA8B 3M7TA 1GBIA 1C1PA 1HAOH 1BTUA 2HGTH 1CT4E 1MAYA 3PV5A 5C3NA 2ZGCA 1EB1H 3BEFB 4RKOB 1E36B 3M5LA 1MD7A 1KXBA 2BLOA 3RXJA 1T7CA 1FY1A 2PR3A 2HNTE 2UUJB 3OU0A 5CMXH 3FKSD 2LELA 1OOKB 5JBAS 2ZTXA 3A8BA 3W95A 4DIIH 2GTBA 4FUBA 1F0SA 1AMHA 2D26C 4UFGH 1C1WH 1WUNH 3SZEA 1W7XH 1ELTA 2FXRA 1OKXA 3H7OA 2VH0A 1TAWA 3BF6H 3ATWA 5ETXA 2JETB 1NTPA 1HAVA 2Y7XA 3F9GA 1UK4A 1Z8RA 4OS5A 1SOTA 3U98H 2XBWA 1C1NA 1TPOA 1PYTD 4HI3A 1P2JA 1WSSH 4AFUA 4WVPE 4I33A 5GCHF 1N1LA 1GBKA 3CS0A 1ID5H 3LOXA 2OUAA 3ZZ4A 1LHDH 1DSUA 1TRMA 2M2AA 1J16A 4I32A 3SU1A 1T8NA 1G30B 1X7AC 4O3TA 2CF8H 1KTTB 1LHFH 3ZZ5A 4X2WA 1LQEA 1C2IA 1O2KA 2WZQA 3RXAA 2TGPZ 3EE7A 1MKWH 2GMTC 3ZZAA 1SGRE 2ANYA 2BHGA 3UOPA 1EZSC 3D23A 1FMGA 4B6EA 2W6JD 1HXFH 3FZDA 3AVZA 1ZJKA 1JIMA 4ISHH 5EODA 1TONA 1HJAC 1D6WA 1K1JA 3RXDA 4VGCC 4ABJA 1HRTH 4K2YA 4AGKA 2QXJA 1GJ7B 1BQYA 1U6QA 2XW9A 2VWOA 3QZRA 1FAXA 3OY5U 2ZHQH 4TY6A 5IYTA 1BMNH 1K1NA 6LPRA 5DP8A 5I25A 3A8AA 3AASA 3CS7A 4ISOA 3RXQA 1YCPM 1OWEA 3IITA 1C5QA 4GCHG 1BCUH 1ARCA 1ELBA 5TCCA 1LVOA 2W5EA 1EB2A 1P2QA 2WINI 1O3CA 4X8UH 2ILNA 3HK3B 1GVZA 1FI8A 1W13U 4J2YB 1MQ6A 2J97A 1P12E 2IOTA 2Z6BD 2V3OH 3SV8A 3GY3A 2H5DA 1AZ8A 1F2SE 1K1IA 1VGCC 2A32A 1S0RA 1O2PA 2P3FH 4GSOA 2H9TH 1MH0A 3BTEE 4DT7B 4FVDA 4DT4A 4UONA 1EUFA 1OWHA 1OPHB 3PTNA 2WPIS 1NU7B 5A8ZA 2BD8A 3GISB 1G2MA 2D2DA 1B0EA 1FPCH 4XE4A 2QA9E 1QQUA 2VB0A 1QJ1B 3V7TA 3RXUA 4FU7A 6GCHG 2Y80A 3MH5A 2M5TA 1AKSA 1YWUA 4X6MA 1O2TA 5LPEA 2Z3EA 5JDUB 2FODA 3V12A 2SGQE 4WWYA 4UE7H 2OCVB 1KXFA 1HAIH 1UCYH 1KLTA 2F91A 4Y6DA 1ZHPA 5TCAA 1OSSA 3URDA 4I8LA 1C2KA 4UDWH 1RTLA 1O35A 3MQKC 4WXIA 2ALPA 1MKWK 1YPLH 3ZVEA 3ZVDA 1GG6B 3RM2H 5A0BA 2ZQ2A 3MNCA 1SOZA 1CE5A 1GBEA 4B75A 3OTJE 4JZFH 4BXSA 1K0HA 1BHXB 4Q7XA 2G8TA 3E1XB 1MZDA 1Q2WA 3B9FH 1HIAB 2V35A 2ANKH 1C5UA 8KME2 2SGPE 3F6UH 2OINA 1ETSH 2Q6FA 2PTCE 2C8XB 1NROH 2SGDE 2ZHEH 1W14U 3RXSA 1C4U2 1S0QA 2TGAA 2CV3A 2VBCA 5T6DA 1ELVA 4K1EA 3IG6B 1HJ8A 4GHQA 2I6QA 1GCTC 2XC0A 3GCOA 4LOYH 4O9VA 2R0KA 5J4SA 5G4BA 3S9AA 2ZTYA 4FUFA 1OXGA 3M5OA 1F0UA 3RC4A 2QXGA 4FUDA 3RUOA 1FAKH 1E1RD 3QGNB 3KHVA 4CRBA 4AORA 3P8OA 1FIWA 2ZGHA 4YO9A 4F4OC 4ZKRU 3SYJA 4H4FA 1KMHB 1O2WA 1D4PB 1K9OE 3DA9B 3SNEA 1O37A 3GYLB 3GDVA 1TABE 3RP2A 1SGYE 1MUEB 1O3AA 4AN7A 3MYWA 1B0FA 2BDYA 1ELEE 1G32B 3MFJA 1YPMH 5DK1A 3GCTF 1V2VT 1LPKB 4U30A 4AFZA 3QUMP 1G2LA 2EC9H 1UCYK 1IQIA 1GL0E 1MTNC 2WUBA 2JH5D 3I78A 4MPUA 4O97A 1UMAH 3ZVGA 4X6PA 4AGJA 2OC0A 1EKBB 4NWLA 2OK5A 4ABGA 1MBMA 3HPTB 1V2TT 2A2XH 2FOHA 1NFYA 1RIWC 4GLYA 4IMZA 2BQWB 1QFKH 4YOGA 4D8NA 3KQDA 2YNAA 3MU5A 2PLXA 1K28D 1WV7H 1YC0A 5F8TA 1A4WH 5HM2A 1FIZA 3E16B 5AHGH 1C5LH 1TQ0B 3PRBA 3KQCA 2ZF0H 4INLA 3ZZ6A 1W11U 3BV9B 1IAUA 1GMCG 1O2XA 1QA0A 1HCGA 4ABIA 1MU6B 4AFQA 1GHVH 4NWKA 1XKBC 2PUQH 3VB5A 4ZKOU 2YMSD 2QE7D 1MBQA 5FBIA 1D3DB 1QJ6B 1B7XB 1WTGH 4X6OA 3GCHC 4IS5A 4OGYA 2JJ2D 1Z7KA 1SLXB 2H9EH 2HWLB 2PKSB 1NRSH 3FO8D 4Y11E 5E2OA 5EJZA 4IN1A 2BVSH 1F0TA 1NY22 1C2GA 3N7DA 1QGFA 4RT1A 1UTNA 2ZHFH 1WYKA 1O31A 1AKSB 1QRXA 5EXNA 1FY4A 1GHYH 1FNIA 1Z6JH 3TJOA 4Q7YA 2BD4A 5T6GA 1CA0B 3KYFA 2UUKB 1NN6A 1G36A 1OWJA 2F9VA 3RXIA 3KNXA 1O2IA 1N6YA 1ESTA 2G00A 4ZAEA 1LMWB 4LZ4B 1OWDA 1HB0B 1MTSA 1O3PB 5DP5A 1KXCA 1IQJA 1P03A 4THNH 5DPAA 2W7SA 2BQ7B 2EY4C 3VB6A 4NA8A 2IPQX 1AO5A 3ZV9A 5E0GA 1C5TA 4I8JA 2SGFE 2BB4A 1FXYA 1FLEE 4IGDA 5FX5A 1XUKA 2VWNA 5KGOA 4X1SU 4RKJB 3Q00A 3UWIA 1RJXB 3KQBA 2Z7FE 4XBCA 5JPMH 1G3DA 3QTOH 4QT8C 3RXVA 3OEED 2Z9KA 1L1JA 2OD3B 1CQQA 2R0LA 3LH1A 1C1OA 2JIZD 4M7GA 1T32A 2OQ5A 3BG4C 4MVNA 2BXTH 2HNTC 2BD3A 1PPZA 4X8VH 4TWYA 1GJCB 4U32A 4ZXYH 2F9BH 3UR9A 4B2BA 2HLDD 1NZQH 4YESB 1F5KU 3EA9A 2BY5X 3PWBA 4CRAA 1ANEA 1C5XB 2XYAA 4XOJA 2ZI2H 5F8ZA 4B1TA 4CRGA 3OSYA 3S7KB 2ZCLP 2J9NA 5F03A 2BDCA 1LHGH 3SU6A 1GJAB 3RU4D 3UREA 1VR1H 1S82A 1P3EA 3MHWU 1OP2A 4O03A 4ZHLU 5A0CA 4Y8XA 1JMOH 1NESE 1YP9A 2BY8X 3BTGE 3UQOA 3M36A 1CBWB 2A4RA 1MTWA 1W12U 1EAUA 3OE7D 1W10U 1XKAC 1HJ9A 2PV9B 2YNBA 4MNYA 3LJOA 4Y7BA 5LH8A 1GI3A 1P2NA 5DP4A 2HLCA 2QV1A 3A82A 5CHAC 4JYUH 1S84A 1GMDG 1BJUA 1FDPA 2BX4A 3ITIA 1YCPH 3TNTA 1LO6A 2VVUA 1ANBA 1GL1A 1GJBB 2VIWA 3EYDA 3GICB 2RG3A 1VITH 1O3NA 2G81E 1SB1H 2QXIA 4Q4LA 1YBWA 3QWCH 2A0QB 2R2WU 4KKDA 1A5HA 5DSFA 3KGPA 2XWAA 4D9RA 3M5MA 8LPRA 4Y76A 4H42U 1TNJA 1M9UA 6ESTA 4X1NU 3ESTA 1T8LA 1O38A 4JZIA 1SC8U 2ZGJA 3A88A 3VEQB 4KGAA 5F53A 3JZ1B 3MTYA 2FWWA 3SGAE 2VIPA 2AGIX 2ZFPH 2B5TB 1NBME 4HGCA 2A5IA 2VNTA 2W3IA 4DJZB 1S81A 2FI4E 4X1QU 1NRPH 2UWOA 2VIOA 4MPXA 4Y8ZA 3T26A 3TH4H 2FTMA 1P2OA 1PPCE 2H9HA 5JB8S 1EPTC 4FUGA 3R3GB 3UPEA 3WY8A 1QCPA 3BTKE 2GVFA 1NM6A 4ISIH 3A7WA 2R2MB 2GCHF 1Y5BT 1CVWH 5HM9A 1QIXB 1AIXH 1O2VA 1C4V2 4NFFA 1BHXF 1GJDB 3S9BA 4TY7A 1Y8TA 4JZDH 1EZQA 2J38A 1C9TA 1CA8B 2TBSA 3PTBA 1DICA 1SGNE 3M7QA 1CHOG 3K2UA 5CHBA 1QQ4A 1UCYE 5AVDA 5J4QA 3M5NA 5E0JA 5KEDA 4BAQB 4J1YA 3UTUH 4X1RU 2PGBB 3NCLA 2ZDMA 2PHBA 4U01A 2ZP0H 2P8OB 1ORFA 4KTUA 2XRCA 4P00A 3TH2H 1S6HA 5T6FA 1AZZA 3T29A 1QL8A 1FZZA 2ZA5A 1V2MT 3SJOA 1YPGH 2ZGXH 3KIDU 3MNSA 2J95A 4FUEA 1UTPA 2BQ6B 3MO9A 4CHAC 3VXFH 1GGDC 4GHTA 1GI5A 1C1MA 2HRVA 1AN1E 1INCA 1GMHF 4IC5A 5DP9A 4WMFA 4BTIB 3L33A 2YOLA 3RXRA 1ZHRA 1ELGA 2SGEE 3SGQE 4FU8A 2BDIA 3PV4A 1GBMA 1GBAA 1BTPA 1TPPA 3SZNA 2ZTZA 3PO1C 1HXEH 1SGTA 4AB9A 1TNLA 2I6SA 5F6MA 1V2NT 1XXDA 2IJD1 1O36A 1D6RA 1UK2A 5AFYH 4BXWA 2QGRA 2BY9X 4ZKNU 1A0JA 3SJ8A 1OYTH 1SGQE 1HAZB 3PLPA 3TJVA 5C94A 3AW1A 4FETA 2GT7A 4GUXA 1O2QA 1TBZH 8ESTE 1Y5UT 2OBOA 1NFUA 2ZC9H 1CSOE 1P05A 2A5AA 1FPHH 4X8SH 3FFGA 1LHEH 4I7YH 2KCYA 3A84A 5HXFA 3SV2H 3RXPA 2WPMS 1LCYA 3UWJH 3HGPA 2NU0E 1FY8E 2RDEA 2AGGX 3RXMA 1QB1A 4NG9H 1L1NA 3LC3A 4I8KA 2D8WA 3B23B 1C1TA 4R8TB 1CHGA 4XBBA 4IC6A 3DD2H 1SGEE 4ASUD 1SFIA 4ZROA 1C5RA 1DWEH 2FOGA 2ZU3A 4UFEH 4YT6H 3WWBA 7ESTE 2BD7A 3ELAH 5EOKA 1UTLM 1V2OT 1ZRBA 2C93B 3RMLH 1OHHD 1PQ7A 2YMSC 1K1MA 1HIAA 3O8CA 2PSYA 2EI8A 2BLWA 4I8GA 5DJ7A 2BOKA 1AB9C 1WQVH 2CHAC 1NU9A 3VXEH 2Z9LA 3SQEE 7KMEH 5L2YH 2DUCA 1OP0A 1THSH 1V2KT 3UIRA 3L3TA 3KL6A 1O5FH 1FY3A 5EGMA 3SHAH 4MQAA 4AOQA 2FOEA 1THRH 1P04A 1SKYE 1A7SA 4B2CA 4B73A 1BTZA 1EOLA 4FVBA 1AFQB 1ARBA 1W0ZU 3SV6A 1TPAE 2RA0A 2J2UA 1C5YB 3RC6A 1YGCH 1O39A 1E38B 4B74A 3KQ5A 5A09A 1YPKH 3ZZ7A 3LGTA 2VH6A 2QCYA 4IMQA 5EQQA 3BSQA 3CENA 3V13A 3MNXA 2EA3A 4F55A 3O8RA 3U1IB 2J5UA 1S85A 1F5RA 2G4TA 2C90B 1KY9A 2AFQB 3UY9A 1E34B 3PLKA 1KLIH 4OS2A 1UJ1A 2CGAA 3PYHA 2ZO3H 1AVWA 1C5SA 2F9PA 3S69A 1JOUB 3U8OH 1GJ8B 5IDKA 3BTDE 3MU0A 4YT7H 1O3GA 1SLVB 2XC4A 2J98A 1TNHA 1BTHH 2VIVA 3GDUA 3SNDA 2AHME 1T4VH 1FX0B 3Q77A 4YZUA 3RXKA 3S0NA 2O8MA 4AYYB 1SMFE 3M3TA 4XDEA 1SGCA 1UW7A 2BDGA 3GY4A 3U69H 2ODYB 3RXGA 3GCTG 2EI6A 3VB7A 4JYVH 1J15A 1ETRH 2OC1A 1BTWA 1GBCA 1Z8IB 3TK5A 2BTCE 2CXVA 1YY3A 1LKAA 3K9XB 1CT2E 4WJG2 2GV7A 3BIVH 1UVSH 1YM0A 3Q3YA 3QK1A 3SGBE 1SGIB 5GJ4B 1P2KA 1BMAA 2GCTC 1GBTA 3ZVCA 1DUEA 3STIA 1GHBF 3VB3A 3DHKH 4IBLH 4FUCA 2UWPA 2W26A 1BMLA 1TA6A 1BT7A 3FP8E 1TRYA 4B71A 1ZTJA 3VGCB 3GOVB 1YLDA 2FI5E 2NU2E 4CREA 1IQNA 1UTMA 3LPRA 1V2UT 1BMMH 1BRCE 4A7IB 3FN8A 3V3MA 1O5CB 5B6LA 1FQ3A 1E1QD 1PPGE 1O3JA 4K69A 2GD4B 1TWXB 4M9FA 3T2NA 1DY8A 2XBXA 2GKVE 1TE0A 2JJ1D 1AUTC 4HG6A 2Q1JA 1EJAA 1D3PB 1KXEA 2TIOA 3ZVBA 1E79D 1L4ZA 4TSFD 5DG6A 1Z6EA 4TPIZ 1SG8B 3E90B 3SW2B 1PPFE 4FUJA 1DWCH 2Z9IA 1EP5A 5C20A 3D65E 1ZLRA 4X6NA 4A6LA 1S83A 2GX4A 1EJNA 1QL9A 4O3UA 1C5WB 3E8LA 1O2YA 4XBDA 3CP7A 1TX7A 2SNWA 3D49H 1ESBA 5EJLA 4UEHH 1ZZZA 3GDSA 2WYJA 3T62A 1O3OA 2BZ6H 4HTCH 1WQSA 1YLNA 3RMOH 4DOQA 4Q2KA 3K6ZA 1SGPE 2DE9A 1L0ZA 3LJJA 3BEUA 1IHSH 3M3VA 4R0IA 1GBFA 1RXPA 2C8YB 4TWWA 2PKAA 1SQTA 1VZQH 2KAIA 4BAOB 4AG1A 1TMUH 2FIRH 5GWZA 2P93A 3R0FA 3TPIZ 3V0XA 1ZGIA 3C1KA 1H8DH 3WW7A 1BRBE 2RFKC 2KZ4A 2AGEX 2ZPSA 4AG2A 5L2ZH 1GI9B 1DY9A 1QZ8A 1MABB 4MDSA 1GVLA 2ZU4A 1BZXE 1GI4A 1GVKB 4MPWA 3QDZB 1Z71A 4KP0A 4OM9A 3DFJA 1MCTA 5FXLA 1UTQA 3MU4A 2WHXA 2ZZUH 5I46H 3SN8A 3DUXH 3EA8A 1AVGH 2UWLA 2HVYB 4IN2A 7GCHG 2EEKA 2FEQH 2ZDLA 3LGVA 1C1QA 5GPIB 3AAVA 2AMQA 2AMDA 3HGNA 5BRRE 1E0FD 2TGTA 1DT2A 4LK4A 1O5GH 3ZZ3A 2J98B 4DVAU 1BB0B 4Y0ZE 4NA9H 2ANWA 3ZYDA 3LGYA 3ZVFA 2BM2A 2CMYA 1W2KH 2Y81A 5FHTA 5HMAA 1LKBA 5EQRA 3BN9A 3PROA 4ZUHA 1WXRA 3RXLA 2IN2A 1TBQH 3SJIA 3GY7A 2O8TA 1PPHE 1A1RA 1CGJE 3UNSA 1MAXA 2GDDA 4YXWD 1F92A 3M35A 5A8XA 4ZHMU 2BMGB 5DP6A 4GCHF 3KF2A 3ZVAA 1AI8H 5FCRA 4JK6A 5FBEA 1IQFA 4WH8A 1LHCH 2GMTB 4DGJA 2V0BA 2Y5FA 5KECA 1ABIH 4X1PU 3RXBA 4K5ZA 3A8DA 1Y3YA 2ZEBA 2AERH 4P02A 1HJAB 3ATLA 1YF4A 3A80A 4FUIA 4VGCB 3FAOA 4Y71A 3K65B 2O8UA 2CN0H 1O3IA 4Z6AH 2QIQA 2OTVA 1GHAF 1GI0A 5E2PA 8GCHF 1A5IA 2ULLA 1TGBA 2HNTF 1P11E 1CT0E 1NO9H 1AU8A 3T25A 1W8BH 3ODDA 2JH6D 9ESTA 1DOJA 3SU0A 1VITG 4KELA 1GDNA 2QY0B 3SO3A 1LDTT 5TJXA 1CGHA 5H4IB 3STJA 5C17A 1O33A 2BDHA 4SGAE 1TNKA 1E35B 2GJGA 3RU4E 2ZDAH 1H9HE 1N6XA 4ZHAA 5C67A 1TOMH 1H8ED 2PP6A 1VGCB 3TIUA 1PYTC 1N8OC 3A8CA 1TGCA 1GHZA 1O3KA 4YTAA 3G01A 1QHRB 2VGCC 1L1GA 1SHHB 1UTOA 6CHAC 3A7TA 1EAWA 5C0TA 2STAE 1O5DH 3PMJA 2NWNA 1ELCA 1PPBH 5FL7D 2J92A 1LVYA 1ETTH 4A92A 1C2EA 1P09A 2SFAA 2VU8E 3A81A 4DW2U 1C5MD 2FI3E 5EIYA 2QF0A 1P06A 2V6NA 3N7OA 2QF3A 3UUZA 1LVBA 1D3QB 4A1TA 2FLRH 2PKAB 2KAIB 1O2NA 4CBNA 4Y10E 1HAGE 3SU5A 1K2I1 2XCNA 2BY7X 3P17H 1ELAA 3BTFE 3LGIA 4NIYA 3ZZ8A 1A3BH 1IQLA 2HALA 5CE1A 3TNSA 5FAHA 1WAYB 3AW0A 3QGJA 1Z1IA 4NCYA 5HIYA 3SBKA 1HNEE 4WXVA 4BAKB 4CRCA 4HFPB 3W94A 1T8OA 1DXWA 1NT1A 1VCQA 1D9IA 1ABJH 1IHTH 5B6OA 1OS8A 5FPTA 1W0JD 1T4UH 1KXDA 2J34A 1O5AB 4AB8A 2L74A 1ELFA 2NU3E 3DFLA 4CH8B 4A1XA 1HUTH 2FOCA 1P57B 3KEEA 1QY6A 2G55A 1KLJH 1SFQB 1YPEH 1V2LT 3TGKE 3H09A 2G4UA 4ABBA 3A89A 1MQ5A 3FOAA 1O5BB 4Q7ZA 4XD7D 2C4FH 4K8BA 1YPHE 1ZMJA 3HKIB 3ODFA 5ESBA 1GCTB 5ESTE 1GPZA 2HPQH 2JETC 1NFXA 1JIRA 1QRZA 3CNRA 2FOAA 2RA3A 3F9EA 1DE7H 5K0HA 2TGDA 1KYNA 2VWLA 1EQ9A 3UFAA 1DFPA 1SGFA 2C3SA 1AWHB 2QF4A 3F0PA 3PWCA 1BIOA 4FXGH 4Y8YA 2EI7A 4ZH8A 1QBNA 2OQUA 1LPZB 2XTTB 3SU3A 1TMTH 1XVMA 1IQGA 2PSXA 2WPLS 3BTQE 5LPRA 1SQOA 4FUHA 5DN6D 2XWBI 1SQAA 2NU1E 2XOKD 4KTSA 3ZYEA 1J9CH 2AIPA 3MU8A 2QAAA 4UFDH 2THFB 5FCKA 1OP8A 2GDEH 4MNWA 2A5KA 1GI6A 3RLWH 7LPRA 1HV7A 1TLDA 1O2RA 1MTNB 1DM4B 1FJSA 3BTTE 1GJ5H 3P8NA 2ASUB 1WBGB 3RXFA 1DXPA 2CK3D 2G5VA 5GCHG 1AE8H 2B8OH 2VVCA 4AX9H 1RGQA 3TGIE 1DPOA 3ATMA 2V7QD 1PJPA 1AVXA 1ELDE 1GDUA 3UOUA 3EGKH 2WSSD 2QYIA 1RIWB 2H2ZA 2QN5T 1HLTH 1TA2A 3PLBA 1HPGA 3MOCA 1SVPA 2NU4E 2FOMB 1W0YH 5AFZH 4ACAA 4XSKU 5DKMA 4ESTE 5EG4A 5FPSA 2BD5A 1SHYA 2WV5A 3OX7U 1SBWA 3TJUA 2Z9JA 1KDQA 1SGDE 4K60A 1MMJN 3FZZA 1MCVA 5DP3A 2VINA 3NKKA 2WPDD 4MPVA 1NC6A 1O2ZA 1ZMNA 2A45B 1IQMA 1TNIA 2Q6GA 2G51A 1O30A 4D9QA 1OWKA 1BUIA 1K1PA 1SLWB 2Z9GA 5EU8A 5EXMA 3GCHB 4DY7B 1Z8GA 1EPTA 4RSPA 2V3MA 2ZCHP 4H6TA 3E6PH 1XXFA 2C8ZB 2FP7B 3RXOA 1O2OA 2ZHDA 1TGTA 1YCPK 4JCNA 2H5CA 3SV9A 2AIQA 4Y0YE 3RM0H 2ZWLH 3L6PA 2UUFB 1ANCA 1AGJA 1UO6A 4AC9A 1ACBE 1TALA 2TPIZ 4BTTB 4OGXA 3SJKA 3B8JA 3I29A 1WOFA 2AH4X 1NBMD 1V3XA 1HAYB 4NIWA 3MH6A 1O2SA 2Y82A 5HGGA 4NIXA 2B9LA 1GBBA 1P2MA 1GHBG 1O0DH 1NRNH 1IOEA 4ZXXH 1GG6C 3F1SB 3VPKA 4Y7AA 4B2AA 4DCDA 1Y5AT 3S7HB 1JRSA 2ZDNA 4BTUB 1B5GH 3NK8A 4YLQH 5SGAE 3TK9A 4GVUA 3SQHE 3IWMA 1SLUB 1ZOMA 3TK6A 1F7ZA 1O34A 1MD8A 2WV4A 3HATH 4LXBH 4AFSA 3BG4B 4F48B 4JK5A 4F49A 1A46H 1C9PA 1GJ6A 3DT0H 5E0HA 3RLYH 3OTPA 1EOJA 2BLQA 1H9LB 1P0SH 1HYLA 1YYY1 2ZDVH 1GI2A 4WY3A 1V2QT 4FOUC 1Q31A 1EZXC 1FY5A 2FPZA 1GMDF 1GJ4H 3QO6A 3TLOA 4E7NA 1GHWH 1LPGB 4YLUA 1C2MA 1TFXA 1SPJA 1DLKB 1XUGA 4Q80A 3QX5H 3LGUA 4ABDA 5EW2H 1TX8A 4BAMB 1A2CH 3H7TA 1DX5M 1HGTH 2CJIA 5EQSA 4NZQA 2PWXA 3T28A 3DSOA 5C2ZA 5EJ1A 2KCOA 4GPGA 5GNDA 2AMPA 3PM3A 1C1RA 3RMNH 1SQRA 1EAXA 1O3LA 2G5NA 3LIWA 1HBTH 2XNDD 2PUXB 3BTWE 3SU2A 4YM9A 4CBOA 1GBHA 4MTBA 5C5OA 3PMBB 1QA7A 2ALVA 3ZZBA 1VJ9U 2XBVA 2ODQA 2J94A 3VFEA 1EXFA 2XCFA 2GP9B 5CHAB 3SORA 3D62A 2A7JA 1H9IE 2A2QH 3JZ2B 2BOHB 3UAIC 1IQKA 3MNBA 5HIZA 3E91A 1C2HA 3P8FA 1J8AA 1YKTA 4MLFB 2ZECA 1NRQH 3OYPA 5EPNA 1JRTA 1O32A 3U1JB 5HYOA 1W3CA 1CHOF 2ZFQH 1IQHA 4B76A 2RDLA 1KDQB 4PROA 3TH3H 1DLEA 1G3EA 1VCPA 3MI4A 2F3CE 4OS6A 1CGIE 4MNVA 5AF9H 1V2WT 2ZFRH 1TX6A 2ZCKP 1EP6A 1EASA 1EPTB 1QRWA 1F0RA 4BOHA 1BBRH
chains in the Genus database with same CATH topology
3RDZA 4U2WA 2A31A 4WF8A 2PKSC 1JBUH 3SI3H 4ZKSU 1C1VH 2B7DH 3NWUA 1O2JA 2VVVA 2ZIQH 4GAWA 4DG4A 1QL7A 3M61U 3E0NB 4IW4E 4JZEH 1AQ7A 4ABEA 5C1UA 3EA7A 1L2EA 4X0WU 1CA0C 2Z3DA 1OWIA 2ESTE 4MG3A 2ZGBH 1BDAA 1HFDA 1C5ZB 1JWTA 1BTXA 3E0PB 3BG8A 2ZFFH 1ZPCA 2DE8A 1XM1A 4WMDA 4CH2B 3A7YA 1J17T 1P8VC 2BVRH 1GBDA 2O8WA 3GY8A 5JBBS 1D3TB 4CRFA 4CHAB 1GHAG 3F9HA 1GGDB 4X8TH 8GCHG 3SI4H 1F5LA 2GGVB 2HVXA 3LONA 2P59A 1JXPA 1Z8JB 1E37B 3O8BA 4INKA 1UVOA 3TITA 5DO4H 4OS1A 3ZZDA 1DDJA 3GCNA 2QC2A 3U8TH 5EW1H 1C1UH 1GJ9B 1DS2E 2HOBA 1TGSZ 1Y3WA 3PO1B 2FYRA 3E3TA 1P9SA 3HK6B 1DSTA 2W7UA 3GY6A 4ISNA 5GDSH 4NGAH 1GI8B 2P94A 3NXPA 3MH4A 4ISLA 1ZSJA 3O8DA 1SGFG 1DWDH 1WTHD 4NA7A 2UUYA 3BTME 1HAXB 1YPHC 4JYTA 3M7UA 1BJVA 3TGJE 2XBYA 4JZ1A 3LDXH 1AD8H 4WH6A 1ANDA 4NZLA 1O3BA 3LH3A 1AY6H 1TNGA 4DIHH 2ZU5A 1BBRK 1VCWA 4CR5A 4NSYA 1UHBA 1RFNA 3ATKA 2JKHA 3HKJB 1Y59T 2Y7ZA 1PPEE 1CBWC 3MU1A 2ZU2A 1AHTH 2A7HA 2Q6DA 4WMEA 3Q76A 5GIBA 3Q3KA 1MU8B 4NSVA 1EZUC 1MTVA 1ZSLA 2A4QA 3U9AH 2BD2A 1CO7E 3U8RH 1HAVB 1PQAA 2FYQA 1AB9B 1XUHA 2CHAB 1FN6A 1DUAA 3QLPH 3RXTA 1AFEH 3ENSB 1C2JA 3GYMA 4D7GA 1A0HB 1EX3A 1DVAH 1KIGH 3NPSA 1LVMA 1YPJH 3BEIB 4LZ1H 2XNIA 3A83A 3SUEA 3MMGA 3FP7E 3EQ0H 3UNRA 3ATIA 1QB9A 1SSXA 1BRUP 1SI5H 3T27A 2BY6X 5LPFA 1TBRH 2BVXH 1BTYA 1RTKA 2A4OA 2CF9H 4A5TS 1A5GH 1QURH 1P3CA 1QNJA 2PGQB 3MWIU 2F83A 1RTFB 1V2RT 3FVFB 4K3JA 1DANH 2ZNKH 5C5NA 1ZRKA 1O2GH 1P01A 3RC5A 2FS9A 5L6NH 4DURA 4INHA 1KSNA 3VB4A 1Z1JA 2R9PA 2STBE 3LGWA 4BANB 3M37A 1BRAA 3RXCA 1DITH 4X2XA 1QB6A 2H1UA 1O3FA 1G9IE 1FONA 1TMBH 1ZPBA 1RS0A 1UVUH 2ZKSA 3K6YA 5F8XA 2IPHA 3TVJB 2C8WB 1TPSA 1QBVH 1O2HA 1KTSB 3SV7A 1FN8A 1G3CA 1BITA 1C2DA 1A61H 1P10A 5FPYA 1KXAA 5C1YA 5C1XA 4SGBE 1ZR0A 2FZZA 2FMJA 2P8OC 3P8GA 3MO6A 1O2LA 1NPMA 1P2IA 1XMNB 1XUJA 1K21H 6GCHF 1FV9A 4BAHB 2IJOB 1TGNA 3KQEA 3GY5A 2GCHG 2WPHS 2ZPQA 2O9QA 3M3SA 4MNXA 2O8LA 3BIUH 2GCTB 1GI1A 1V2PT 1C5VA 1QTFA 1THPB 3TJNA 3RXHA 2ZPRA 1O3MA 4A1VA 2ZHWH 1GCDA 4K1SA 1ZJDA 2ZDKA 1Y3VA 1GHXH 1MZAA 2VIDA 4NIVA 3H5CB 1G37A 4JMYA 2BD9A 1O2UA 1ZPZA 2GV6A 2K1QA 2VWMA 1SL3A 1O5EH 2R3UA 3FP6E 1NRRH 2F9NA 2Y5GA 2OBQA 4Y79A 2AS9A 2H6MA 1ZGVA 2ANMH 1K1LA 3P92A 1C5OH 1GWAA 3UNQA 3SNAA 1H4WA 1IQEA 4ABFA 2FS8A 1NS3A 1EATA 1GMHG 3LT3A 4I31A 2D1JA 3PMAB 1BOQA 1XVOA 1GDQA 1UHBB 3OY6U 1FUJA 5LGOA 1J14A 1S5SA 2Y6TA 5EXLA 3Q3XA 5JB9S 1XUIA 2TRMA 1QJ7B 3C27B 2OLGA 1UVTH 1ZMLA 3FANA 3QTVH 2FDAA 2FLBH 4E05H 2VJ1A 4H6SB 2FOFA 1CU1A 1XUFA 2LPRA 1WU1A 3S9CA 4X2YA 3PMHB 3MO3A 1V6DA 4BNRA 2OC8A 1V2JT 1H1BA 1Y3XA 2AYWA 4XFQA 1A0LA 7GCHF 3KCGH 3AAUA 3SUDA 3URCA 2F9UA 1HAHH 1V2ST 2BLVA 5K7RA 2PFEA 2PTNA 5A2MH 1LTOA 1T8MA 4ASHA 1C4Y2 2J4IA 2BDBA 1AFQC 2Y5HA 2P16A 4UD9H 3P95A 1HAPH 1P02A 5A8YA 2FM2A 5JYIA 3SOSA 2OC7A 2WPKS 5GXPA 2BYAX 3T5FH 4D7FA 3RMMH 2OXSA 5T3HA 1O3HA 4KTCA 2P3UB 2V3HH 2F9OA 1K1OA 2A1DB 1QBOA 2FTLE 1BBRE 2FESH 1VJAU 4OS4A 2WPJS 4AYVB 2FX4A 3A7VA 2GZ9A 1UTKA 2ZFSA 1GMCF 2SGAA 2R3YA 2Z94A 3A7XA 4Z0KA 1EAIA 2OP9A 1W7GH 4TYDA 2SNVA 5FX6A 1UK3A 1C2LA 2ODPA 4ABAA 1Q3XA 1PFXC 3F9FA 4RN6A 1WCZA 2GT8A 3MH7A 3A85A 2BXUH 3SJ9A 1MKXH 1GI7B 2RCEA 5JBCS 1O3EA 3QN7A 5ABWA 1UVPA 4UFFH 2XXLA 4YOIA 5BPEA 2WYGA 1OYQA 4YOJA 1H8IH 2QXHA 1P9UA 2W3KA 1A3EH 3RU4T 1O3DA 1VITF 5JBTA 1XX9A 4K8YA 1OX1A 9LPRA 2VIQA 3SUFA 1ZTLA 1HDTH 4E06H 1O2MA 1TRNA 5DP7A 2A7CA 5DGJA 2BX3A 2A4GA 1EJMA 3QZQA 1GBJA 2BZAA 3EE0B 1PQ5A 1ZTKA 1C5NH 2G52A 3ZZCA 1L4DA 5L30H 1AE5A 1G3BA 3LU9B 2Z3CA 2FX6A 1T31A 1UTJA 3VGCC 4AZ2B 1RRKA 3LC5A 3A86A 2LNCA 2WUCA 3GY2A 2BDAA 1TOCB 1S6FA 2HPPH 2B0FA 3A87A 2P95A 4FU9A 4D76A 1TYNA 2P3TB 1C1SA 3P6ZB 4CRDA 3UR6A 5E8EH 1AWFH 2ZU1A 1C2FA 1DWBH 3UQVA 2GZ7A 5PTPA 2ZG0H 1Y3UA 2FO9A 4CR9A 3TU7H 1K22H 1RD3B 2AEIH 5EPYA 1ESAA 3EDXB 1ZHMA 3PB1E 1N8OB 4E7RG 3A7ZA 3F68H 3NZIA 1ZYOA 2VGCB 2PW8H 3SUGA 4I8HA 2JH0D 6CHAB 3EAJA 1SR5C 3SNCA 3ZV8A 1ZSKA 1AUJA 3LKWA 1LQDB 3KN2A 4K1TA 1TQ7B 2GZ8A 4X2VA 5A0AE 4ABHA 1TB6H 3NUMA 1TIOA 1NFWA 3I77A 4NFEA 1PQ8A 4OS7A 4TPYA 1MKXK 3SU4A 1GBLA 2FOBA 2ZQ1A 3BTHE 1C5PA 2XC5A 3RXEA 1YLCA 4HZHA 2ZFTA 3ZZ9A 3P70B 4ZMAH 1QR3E 3SHCH 3SNBA 1MTUA 1BA8B 3M7TA 1GBIA 1C1PA 1HAOH 1BTUA 2HGTH 1CT4E 1MAYA 5C3NA 2ZGCA 1EB1H 3BEFB 4RKOB 1E36B 3M5LA 1MD7A 1KXBA 2BLOA 3RXJA 1T7CA 1FY1A 2PR3A 2HNTE 2UUJB 3OU0A 5CMXH 1OOKB 5JBAS 2ZTXA 3A8BA 3W95A 4DIIH 2GTBA 4FUBA 1F0SA 1AMHA 2D26C 4UFGH 1C1WH 1WUNH 1W7XH 1ELTA 2FXRA 1OKXA 3H7OA 2VH0A 1TAWA 3BF6H 3ATWA 5ETXA 2JETB 1NTPA 1HAVA 2Y7XA 3F9GA 1UK4A 1Z8RA 4OS5A 1SOTA 3U98H 2XBWA 1C1NA 1TPOA 1PYTD 4HI3A 1P2JA 1WSSH 4AFUA 4WVPE 4I33A 5GCHF 1N1LA 1GBKA 3CS0A 1ID5H 3LOXA 2OUAA 3ZZ4A 1LHDH 1DSUA 1TRMA 1J16A 4I32A 3SU1A 1T8NA 1G30B 1X7AC 4O3TA 2CF8H 1KTTB 1LHFH 3ZZ5A 4X2WA 1LQEA 1C2IA 1O2KA 3RXAA 2TGPZ 1MKWH 2GMTC 3ZZAA 1SGRE 2ANYA 2BHGA 3UOPA 1EZSC 3D23A 1FMGA 1HXFH 3FZDA 3AVZA 1ZJKA 1JIMA 4ISHH 5EODA 1TONA 1HJAC 1D6WA 1K1JA 3RXDA 4VGCC 4ABJA 1HRTH 4K2YA 4AGKA 2QXJA 1GJ7B 1BQYA 1U6QA 2XW9A 2VWOA 3QZRA 1FAXA 3OY5U 2ZHQH 4TY6A 5IYTA 1BMNH 1K1NA 6LPRA 5DP8A 5I25A 3A8AA 3AASA 3CS7A 4ISOA 3RXQA 1YCPM 1OWEA 3IITA 1C5QA 4GCHG 1BCUH 1ARCA 1ELBA 5TCCA 1LVOA 2W5EA 1EB2A 1P2QA 2WINI 1O3CA 4X8UH 2ILNA 3HK3B 1GVZA 1FI8A 1W13U 4J2YB 1MQ6A 2Z6BD 1P12E 2IOTA 2V3OH 3SV8A 3GY3A 2H5DA 1AZ8A 1F2SE 1K1IA 1VGCC 2A32A 1S0RA 1O2PA 2P3FH 4GSOA 2H9TH 1MH0A 3BTEE 4DT7B 4FVDA 4UONA 1EUFA 1OWHA 1OPHB 3PTNA 2WPIS 1NU7B 5A8ZA 2BD8A 3GISB 1G2MA 2D2DA 1B0EA 1FPCH 4XE4A 2QA9E 1QQUA 2VB0A 1QJ1B 3V7TA 3RXUA 4FU7A 6GCHG 2Y80A 3MH5A 2M5TA 1AKSA 4X6MA 1O2TA 5LPEA 2Z3EA 5JDUB 2FODA 3V12A 2SGQE 4WWYA 4UE7H 2OCVB 1KXFA 1HAIH 1UCYH 1KLTA 2F91A 4Y6DA 1ZHPA 5TCAA 1OSSA 3URDA 4I8LA 1C2KA 4UDWH 1RTLA 1O35A 4WXIA 2ALPA 1MKWK 1YPLH 3ZVEA 3ZVDA 1GG6B 3RM2H 5A0BA 2ZQ2A 3MNCA 1SOZA 1CE5A 1GBEA 4B75A 3OTJE 4JZFH 4BXSA 1BHXB 4Q7XA 2G8TA 3E1XB 1MZDA 1Q2WA 3B9FH 1HIAB 2V35A 2ANKH 1C5UA 8KME2 2SGPE 3F6UH 2OINA 1ETSH 2Q6FA 2PTCE 2C8XB 1NROH 2SGDE 2ZHEH 1W14U 3RXSA 1C4U2 1S0QA 2TGAA 2CV3A 5T6DA 1ELVA 4K1EA 3IG6B 1HJ8A 4GHQA 2I6QA 1GCTC 2XC0A 3GCOA 4LOYH 4O9VA 2R0KA 5J4SA 5G4BA 3S9AA 2ZTYA 4FUFA 1OXGA 3M5OA 1F0UA 3RC4A 2QXGA 4FUDA 3RUOA 1FAKH 3QGNB 3KHVA 4CRBA 4AORA 3P8OA 1FIWA 2ZGHA 4YO9A 4F4OC 4ZKRU 4H4FA 1O2WA 1D4PB 1K9OE 3DA9B 3SNEA 1O37A 3GYLB 3GDVA 1TABE 3RP2A 1SGYE 1MUEB 1O3AA 4AN7A 3MYWA 1B0FA 2BDYA 1ELEE 1G32B 3MFJA 1YPMH 5DK1A 3GCTF 1V2VT 1LPKB 4U30A 4AFZA 3QUMP 1G2LA 2EC9H 1UCYK 1IQIA 1GL0E 1MTNC 2WUBA 2JH5D 3I78A 4MPUA 4O97A 1UMAH 3ZVGA 4X6PA 4AGJA 2OC0A 1EKBB 4NWLA 4ABGA 1MBMA 3HPTB 1V2TT 2A2XH 2FOHA 1NFYA 1RIWC 4GLYA 4IMZA 2BQWB 1QFKH 4YOGA 4D8NA 3KQDA 2YNAA 3MU5A 2PLXA 1K28D 1WV7H 1YC0A 5F8TA 1A4WH 5HM2A 1FIZA 3E16B 5AHGH 1C5LH 1TQ0B 3KQCA 2ZF0H 4INLA 3ZZ6A 1W11U 3BV9B 1IAUA 1GMCG 1O2XA 1QA0A 1HCGA 4ABIA 1MU6B 4AFQA 1GHVH 4NWKA 1XKBC 2PUQH 3VB5A 4ZKOU 1MBQA 5FBIA 1D3DB 1QJ6B 1B7XB 1WTGH 4X6OA 3GCHC 4IS5A 4OGYA 1Z7KA 1SLXB 2H9EH 2HWLB 2PKSB 1NRSH 4Y11E 5E2OA 4IN1A 2BVSH 1F0TA 1NY22 1C2GA 1QGFA 1UTNA 2ZHFH 1WYKA 1O31A 1AKSB 1QRXA 5EXNA 1FY4A 1GHYH 1FNIA 1Z6JH 3TJOA 4Q7YA 2BD4A 5T6GA 1CA0B 2UUKB 1NN6A 1G36A 1OWJA 2F9VA 3RXIA 3KNXA 1O2IA 1N6YA 1ESTA 2G00A 4ZAEA 1LMWB 4LZ4B 1OWDA 1HB0B 1MTSA 1O3PB 5DP5A 1KXCA 1IQJA 1P03A 4THNH 5DPAA 2W7SA 2BQ7B 3VB6A 4NA8A 1AO5A 3ZV9A 5E0GA 1C5TA 4I8JA 2SGFE 2BB4A 1FXYA 1FLEE 4IGDA 5FX5A 1XUKA 2VWNA 4X1SU 4RKJB 3Q00A 3UWIA 1RJXB 3KQBA 2Z7FE 4XBCA 5JPMH 1G3DA 3QTOH 4QT8C 3RXVA 2Z9KA 1L1JA 2OD3B 1CQQA 2R0LA 3LH1A 1C1OA 4M7GA 1T32A 2OQ5A 3BG4C 4MVNA 2BXTH 2HNTC 2BD3A 1PPZA 4X8VH 4TWYA 1GJCB 4U32A 4ZXYH 2F9BH 3UR9A 4B2BA 1NZQH 4YESB 1F5KU 3EA9A 2BY5X 3PWBA 4CRAA 1ANEA 1C5XB 2XYAA 4XOJA 2ZI2H 5F8ZA 4B1TA 4CRGA 3OSYA 3S7KB 2ZCLP 2J9NA 5F03A 2BDCA 1LHGH 3SU6A 1GJAB 3RU4D 3UREA 1VR1H 1S82A 1P3EA 3MHWU 1OP2A 4O03A 4ZHLU 5A0CA 4Y8XA 1JMOH 1NESE 1YP9A 2BY8X 3BTGE 3UQOA 3M36A 1CBWB 2A4RA 1MTWA 1W12U 1EAUA 1W10U 1XKAC 1HJ9A 2PV9B 2YNBA 4MNYA 3LJOA 4Y7BA 5LH8A 1GI3A