3UQOA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uqoA02
1P3EA 1UTPA 1V2PT 1EOJA 2TRMA 1DWBH 1HNEE 1RTKA 4XSKU 1W14U 3SU3A 1SGPE 1NT1A 2BLWA 5BRRE 1MAXA 1NRQH 5A8YA 1G9IE 2FTLE 1GPZA 2ZQ2A 2Q1JA 1AN1E 1DXPA 1NPMA 3LPRA 4JYVH 3TNTA 4YLUA 2ZQ1A 3OSYA 5DGJA 1ZMNA 3BTTE 2WV5A 1MKXH 1RIWB 1AQ7A 4Z6AH 2BVSH 1LPKB 1TNHA 3SUFA 3NKKA 4YOGA 2EI7A 2ZU2A 3FZZA 1CBWB 2XC4A 1Z71A 3Q77A 2P93A 2OC7A 1IOEA 1W13U 3P95A 4BAOB 2GZ7A 1C2KA 4TPIZ 1C5UA 1W7XH 3UR9A 4ABBA 2FYQA 1AE5A 4MDSA 3E8LA 1CA8B 2WPHS 5LGOA 2D1JA 1GMDG 4K1TA 2ZF0H 3ZZ3A 2HOBA 1UHBA 1JOUB 2FLBH 2BLOA 4X1PU 2THFB 2P3FH 2HNTF 3VB5A 4ESTE 2RG3A 1SC8U 5DP3A 4YT7H 3BTEE 3SI3H 1O2KA 1ANEA 4O9VA 1ARCA 2HALA 3RXEA 1O38A 3SJKA 1MMJN 3SU6A 3OY6U 1RRKA 2BX4A 1NRRH 4ABHA 4AFUA 1C2DA 3RMOH 1NRNH 3UUZA 5DP4A 9ESTA 2QF0A 3MH7A 3O8CA 2OC0A 3OTJE 1DWEH 2FOHA 1TRMA 3LT3A 2H9EH 3B23B 1TA2A 1O3JA 3Q3YA 1E38B 5C5NA 3B9FH 2TGTA 5EPYA 4WVPE 4DIIH 2I6SA 1GL0E 1O3PB 5F8ZA 3UQOA 3NPSA 4A1XA 6LPRA 2FZZA 1V3XA 1AWHB 4ABFA 3BIUH 2GCTC 4AOQA 3Q3XA 1TALA 2VVCA 2GDEH 2OTVA 2ZPQA 3M3SA 2KAIA 2Y5GA 3ZVFA 6GCHG 3SV8A 1Z8IB 4X6NA 1D4PB 2Z3EA 4X8TH 4D9QA 2ODQA 3GISB 2O8WA 3M5MA 4GHTA 5C1UA 3SNBA 4UONA 1YF4A 1EAWA 4Z0KA 1MCVA 2P16A 5AF9H 1GVKB 1ETSH 1TPAE 4AORA 1QL7A 3S7HB 3HK3B 4D9RA 4RSPA 1GJAB 2GZ8A 3TJNA 4D8NA 2R2WU 4ABJA 1O2GH 1AHTH 3U1JB 4Q7ZA 3M37A 3PLPA 4ABDA 1ZMLA 1L2EA 1J14A 3EQ0H 3A7YA 3SORA 3CS0A 2FEQH 2ZEBA 1O3OA 2TGAA 2A45B 4RKJB 3QWCH 1UVPA 3VGCC 4AYVB 3FAOA 3PTNA 2FWWA 1CT2E 1O3DA 1VITF 2FDAA 1W3CA 1J8AA 1D3PB 1EP5A 3GCOA 1AU8A 2UWLA 3RXCA 3A80A 1HIAA 4MPWA 1LKAA 1H1BA 2ZHFH 3UOUA 5F6MA 1DS2E 2IN2A 2ZGCA 1ABJH 3M5LA 4ABIA 1QRXA 1IQMA 5EQQA 3LGUA 1N6XA 1S85A 2QXJA 1UVSH 4Y7AA 1SGYE 1WQVH 3ZYEA 1L1JA 1ELTA 2Q6FA 1QBNA 1FUJA 2Y5FA 1YC0A 2PSXA 4H4FA 5ESBA 1A5IA 1FI8A 4JZDH 3RXPA 5TCCA 2AMQA 4MPXA 1O3NA 1P9UA 1HBTH 2K1QA 2ZGJA 1EP6A 1KXDA 3ELAH 4Q7XA 5T6GA 5A2MH 1RS0A 5BPEA 1FY3A 2HPPH 2BD4A 1GBMA 3TH4H 2BD3A 1T31A 3O8BA 4E7RG 2BXUH 2BY8X 2A2XH 1SHYA 1UK3A 3BTHE 1P2JA 3ATMA 3M7QA 1F92A 2ZCKP 3DUXH 1FAXA 1GGDC 3MH6A 1HAPH 2AERH 1LPZB 4U30A 2ZDNA 3T25A 2ANKH 3MU1A 2FOCA 3TJOA 4WJG2 2NU2E 4Y7BA 3UWIA 3A7ZA 5EODA 2WV4A 1GHXH 1FIZA 1AB9C 2SGEE 1BQYA 3FP6E 4ZKOU 2EA3A 2VWLA 3VXFH 4IN2A 2QA9E 2ILNA 1TAWA 1O39A 5HMAA 4DIHH 1ZPZA 2ZI2H 4FUJA 1GHWH 3QX5H 1SGFA 3TJUA 5DK1A 2VIQA 3QUMP 3U9AH 1BT7A 1HAIH 2DE8A 2PKSC 1SOZA 1TRYA 3P70B 1JXPA 5E0JA 1C5OH 1SVPA 1YCPM 1FY1A 1SSXA 3D65E 2OQ5A 1GG6C 2BZ6H 4MPUA 4GHQA 1TNJA 1GCDA 1O2VA 2FLRH 1AVGH 3EA9A 3U98H 1OPHB 3N7OA 2HNTC 3EGKH 3ZZ5A 2WPMS 5DKMA 2W26A 3O8RA 4AX9H 1MCTA 1BUIA 1GMCF 1TQ0B 1HPGA 5T6DA 3CP7A 1GHBF 4K2YA 3TLOA 4XOJA 3QK1A 4B2AA 5EGMA 2D2DA 1ARBA 1KDQA 5FBIA 2BZAA 1DOJA 5LPEA 1O5FH 3GCNA 5C1YA 4F49A 3GICB 4X2YA 3RXGA 2C90B 4H42U 1NESE 1VGCB 2GP9B 1ESBA 1FN6A 2UUFB 1AB9B 4FUIA 1TNKA 1GBKA 1UK4A 3LOXA 4IN1A 1IQKA 2ANYA 2EC9H 2Y81A 4NZQA 1CHOG 5GJ4B 1JRSA 3RDZA 2FS8A 1TLDA 1MAYA 4WF8A 4Y0ZE 1GBHA 1ZHMA 1OS8A 1SGDE 1SGIB 3LC5A 3MO3A 2A5IA 1G30B 4SGBE 2H5DA 2BQ6B 5I25A 2PKSB 2UUYA 3EA7A 1SGRE 1V2VT 8LPRA 1K21H 1EUFA 1C2EA 1X7AC 3HGPA 4ZKRU 1GG6B 3A83A 4QT8C 5DG6A 1JMOH 1O2OA 2ZA5A 3BTGE 3BSQA 3SJOA 3NK8A 1H8IH 1O2LA 4NSVA 2ZU5A 4X1RU 1H9HE 1OP0A 1FXYA 4K8YA 1SI5H 1VR1H 2ZFQH 4KTCA 3ZYDA 4JYUH 1GI9B 2JETC 1ZPBA 4CBOA 2WPKS 1LMWB 1C1SA 1AY6H 1C5PA 1FIWA 4DVAU 1DANH 1ZMJA 1Y3WA 2BD7A 2QV1A 3PV4A 4K1EA 2BD9A 5E0HA 3ZVEA 3QN7A 1YPHC 4BNRA 4INKA 4WMEA 2JH5D 1BHXF 2AEIH 1O5BB 1TWXB 3FANA 1C5LH 3QGNB 1UCYH 4HTCH 2VWMA 3UY9A 1O2MA 2SNWA 4H6SB 3KCGH 3PO1B 1KTTB 2STBE 1ZGIA 1BMMH 1Y5AT 3GDVA 2BD2A 2PWXA 5FX6A 1SBWA 1N6YA 4DT7B 1S0QA 1BMAA 1Y3XA 3LGVA 1ELVA 1C1MA 1QB6A 4ABEA 1FY4A 4WMFA 2Z9IA 2HPQH 1YPMH 3A84A 1PQ5A 1UVUH 3M7UA 1GMHG 1JIMA 3RXHA 5GXPA 3TVJB 4E05H 3U8RH 2A7HA 5DP6A 2HVXA 1S83A 1ESTA 2CGAA 5T6FA 3CENA 3MNXA 4B2BA 1AUJA 4B75A 5PTPA 1LVYA 4K69A 4KELA 1VITH 4AB8A 3LIWA 3QGJA 1GI8B 1KXFA 1GVLA 3ITIA 1C2GA 1AFQB 1FLEE 2OLGA 2VGCC 4Y0YE 2FO9A 5G4BA 3U69H 1RGQA 1J15A 4GUXA 3RMNH 3U1IB 1CE5A 2H6MA 4ZUHA 1PPBH 5FBEA 2Y7ZA 1T8OA 2G5VA 5GCHG 1GJ4H 3BTKE 3FFGA 1TBQH 1JIRA 4IC6A 2WPJS 1TBRH 4Y76A 2VIVA 1HGTH 1YM0A 3M35A 1QTFA 3VB6A 1FY5A 4RKOB 5FPYA 5C5OA 3ZV9A 4FUGA 1GBCA 5CHAC 2FI5E 2PUQH 2UWPA 1C1PA 4CRFA 1C5QA 1GJ9B 3F6UH 2QAAA 5C67A 1GJ5H 1V2RT 4I8LA 1O33A 3UQVA 3UFAA 5K7RA 1P2OA 3GCHC 2CMYA 2ZDLA 5F03A 4NIWA 3ZZ9A 1C1NA 1C5ZB 1MTNC 2G5NA 1AZZA 2OC8A 5DP8A 4ZKSU 2F9PA 3RXJA 4GLYA 1C4Y2 5JYIA 1Z6JH 1HXFH 1XUHA 1H9IE 1OP8A 1O2PA 2R2MB 1HYLA 2VJ1A 1LQEA 2FOBA 1XMNB 2J95A 1HXEH 2GV7A 1O37A 1PQ8A 1O2RA 1SQTA 1K1OA 2A4OA 5FHTA 3PMAB 2GKVE 4FUHA 1FDPA 1GBLA 1C1RA 2ZFFH 2VGCB 2A32A 4DG4A 3UWJH 1L0ZA 4ISNA 1LVOA 1T7CA 4X1SU 3EYDA 1T8NA 1EZUC 1Y8TA 4BAQB 3KGPA 3TGIE 2WPIS 1XVOA 5GPIB 1TB6H 2XBYA 2BY9X 3V12A 2QY0B 3GY6A 2TIOA 5C3NA 3E0NB 1VZQH 1C5SA 3VXEH 3SV9A 1ZSLA 1ORFA 4XE4A 3TK6A 1NC6A 1CA0C 4LXBH 1SL3A 1NRSH 2KAIB 3RXKA 2BMGB 3SHCH 2PGQB 3OY5U 1GI7B 1T4VH 3RC5A 5EG4A 5A8ZA 3ESTA 3W94A 2P95A 2QYIA 3PYHA 3ENSB 3RMLH 1TPPA 1CT4E 1LTOA 2J2UA 3VEQB 1Y3UA 1Z1JA 1SGCA 3O8DA 5FX5A 1EXFA 3QZQA 1AGJA 1VJAU 1P2MA 5JBTA 1UTNA 2F9BH 2VVVA 2Q6DA 2XNIA 4GPGA 1ABIH 1QBVH 1YGCH 3LH1A 2FESH 5HM9A 1G2MA 3A82A 1MQ6A 3STJA 4XBCA 1EAUA 4OS7A 4CRAA 1GDUA 1O2WA 1UJ1A 3WY8A 1C5VA 4IMQA 1ID5H 5TJXA 3MU5A 4M7GA 4AGKA 4O3UA 2W3KA 3RXAA 2ZU4A 1SPJA 1O3AA 4HI3A 3V0XA 1BMLA 2XRCA 1Z7KA 3RP2A 1MZAA 1SGNE 3UOPA 1GJDB 1DPOA 3M61U 2FS9A 4JCNA 3P6ZB 4X0WU 2BTCE 1HB0B 1MBMA 1H4WA 4DURA 1K1NA 4U32A 2ZGBH 1N8OC 3TJVA 4RN6A 2BXTH 1MKXK 1XX9A 1D6RA 3M5NA 3K9XB 2BDAA 1CVWH 1JRTA 1ESAA 1K1LA 2QCYA 1P10A 1P06A 1HIAB 2O9QA 3I77A 1AD8H 3SNAA 1BTHH 2J94A 2G4UA 1ETRH 1A61H 4I8JA 1DUAA 3PB1E 2A4RA 2Z3CA 5ABWA 1NROH 5A0CA 1C1TA 3FVFB 5J4SA 1LVBA 1OSSA 4Y79A 3AASA 4A92A 1ZRKA 1DWCH 5E8EH 1BBRH 1A2CH 3KNXA 4Y10E 5AHGH 3BEUA 3T28A 1TNGA 2STAE 2YNAA 4I8HA 4NG9H 2SFAA 3DA9B 3ZVAA 2G51A 3RXUA 4X1QU 2VIPA 2ASUB 3PLBA 1TYNA 3A89A 3SU4A 4WXVA 2OC1A 3MFJA 5FPTA 1C1WH 2QGRA 4X6MA 1KYNA 3ZZAA 4X2VA 2GT7A 2G00A 1PFXC 2RDLA 2HLCA 1D9IA 2J92A 1XUGA 3GY3A 1W0YH 1OYTH 2A7JA 1JWTA 1O3FA 1QGFA 1O3HA 5JDUB 1G36A 5EW1H 3A8CA 2XWAA 1BRAA 1F2SE 4GAWA 1K1IA 1GI4A 1EJNA 1HJAC 2F3CE 1N8OB 5FCRA 2ZU3A 2WINI 3TH2H 1QHRB 1BHXB 3BTFE 4O97A 5A0BA 3UNSA 3NXPA 4AYYB 4AFSA 1G3BA 2A1DB 1UVTH 2M5TA 2Z7FE 2VIDA 3AVZA 1TGCA 2Z9GA 2VB0A 1DICA 1NM6A 1ZPCA 1YP9A 1IQJA 3TNSA 2NU1E 3BN9A 2IJOB 3K6ZA 1FY8E 3HGNA 3ZZBA 1O2IA 1GVZA 1ZSKA 1TNIA 4A5TS 1VITG 1UTMA 1TPOA 4FUCA 2PV9B 4NFEA 2F9UA 4ISOA 1HJ8A 4ABAA 3L3TA 1MD8A 2FXRA 4MPVA 1GBJA 1AVXA 2CN0H 4DOQA 1FN8A 1C5MD 1YBWA 2BYAX 1OP2A 2JH0D 4K8BA 3Q3KA 1ZZZA 1G37A 1SLXB 1OKXA 1Z8RA 3PLKA 5LH8A 2GCTB 1O32A 1HAYB 1BITA 2BDIA 2J4IA 1A5GH 4ASHA 4NGAH 2LNCA 1QRZA 1ELCA 1F7ZA 2FI4E 3NZIA 1KDQB 1TGTA 1F5KU 1KSNA 1O3LA 1CT0E 1O3KA 1YPEH 1KXBA 1VCWA 1HJAB 4AGJA 1QB9A 2ZFSA 2W3IA 1O3GA 1L1GA 4D7GA 4O3TA 1AMHA 1P3CA 1NN6A 1GBDA 1IQEA 1PPHE 1SQAA 5FCKA 3L33A 1IHTH 3BTQE 4MQAA 4X1NU 3LJJA 3TK5A 3QTOH 3ZVDA 3BEFB 1TOCB 2QIQA 4Q2KA 4UFGH 7LPRA 2ZHDA 4YT6H 1G2LA 1SR5C 3IWMA 1BRCE 2F9VA 1DT2A 1AUTC 1MTSA 3MU0A 2V3OH 3U8OH 2A5KA 2CHAC 1SFIA 3H7OA 3M5OA 2A4QA 4B73A 2D8WA 1IQNA 1EAIA 3MMGA 1MU6B 1T32A 1W0ZU 3PTBA 4IGDA 1S0RA 2A2QH 4NZLA 1V2ST 3B8JA 3E0PB 3LDXH 1TABE 3M7TA 1E0FD 5C2ZA 2OCVB 3E16B 1K1PA 1UTJA 3P92A 2VIOA 2AIPA 2C93B 1T8MA 4X6OA 3VGCB 1O30A 3RC6A 2BY6X 2OINA 1QA0A 3MH4A 1SLUB 2GMTC 3BV9B 1HDTH 2NU0E 2SGQE 3KQDA 1MKWH 5CMXH 2ANWA 3NCLA 2OP9A 1V2LT 3SW2B 4Q80A 1Z6EA 1MD7A 4ZH8A 4X8VH 4MG3A 4ZAEA 4TPYA 4HFPB 1Y59T 1O2JA 1EZSC 2BQ7B 3RXTA 1PPZA 5IYTA 3ODDA 1CO7E 4DGJA 2DE9A 1PQAA 1OWDA 2CF8H 2UUKB 1PYTC 1GMCG 4FU8A 1QJ6B 1ELBA 1DWDH 3SUEA 1GHBG 2QXIA 1BJVA 1C5XB 1CGIE 3M36A 3HATH 3A86A 1BCUH 4X8UH 2QXHA 1ACBE 1P11E 3RU4T 1OWEA 1L4ZA 4AFZA 5E2OA 4IC5A 1O2UA 3GY5A 4XFQA 4CHAC 3P8FA 4KP0A 2NU3E 4K1SA 4Y6DA 2G81E 2P3UB 3GY8A 3SV7A 3P8NA 2P3TB 3KIDU 7GCHF 3Q00A 1GGDB 1PPGE 1DFPA 2PTNA 5FPSA 1S6FA 1BZXE 2ZDKA 2GMTB 3KN2A 1DSTA 1ELDE 1XUJA 2GGVB 1E37B 3H7TA 1XUIA 3PMBB 2Q6GA 2J34A 3ZV8A 5L2ZH 3V7TA 1DUEA 2AIQA 4D76A 4CRBA 1F0SA 1ZTLA 3RUOA 2GT8A 2OQUA 1OWIA 3TH3H 7KMEH 2VWNA 1T4UH 1XUKA 1KTSB 1GJBB 5ESTE 1HAOH 1M9UA 2D26C 2C8WB 2BDYA 4TWWA 1EZXC 4FU7A 2PUXB 5EXMA 1QA7A 1MUEB 1P0SH 4XBDA 1SLWB 2ZHWH 1V2OT 3MNSA 4BOHA 1YCPH 2A5AA 1DE7H 1N1LA 2ZFPH 3F9EA 1D6WA 1UTKA 5HM2A 1UO6A 2VH0A 5EPNA 1MTWA 4ZHMU 3UPEA 4CHAB 3A88A 2V0BA 2ESTE 1O2XA 1LCYA 5B6OA 1DSUA 1NY22 3LONA 2R3YA 1WSSH 1SGFG 1C1OA 1C1QA 2PSYA 1GJ8B 5AFZH 1O2HA 3SBKA 1SHHB 4R0IA 2I6QA 1LHCH 3BG8A 1PJPA 1WOFA 1E36B 3MTYA 1GI0A 1TNLA 3TGKE 2V3HH 3SOSA 1GL1A 2BDBA 6ESTA 3VB3A 1O5EH 1TX7A 1A1RA 2ZC9H 3MOCA 4KTSA 1W11U 1TE0A 4DW2U 1QY6A 1S82A 1C1UH 1KXAA 2RCEA 3SZNA 1O3BA 3GCTF 2ZHQH 1GHVH 4UFDH 8ESTE 4NFFA 1TA6A 1TX8A 2BY7X 3T2NA 2ODYB 1WV7H 3QDZB 2P59A 1EPTA 1D3DB 1F5LA 2OBQA 1UCYK 2FP7B 1P01A 4ABGA 3P8GA 1QQ4A 2J9NA 3V3MA 3E3TA 4YM9A 3ZVCA 5L30H 4NIXA 8GCHF 1QCPA 2DUCA 4OS5A 5K0HA 4X6PA 4E06H 2FMJA 3C1KA 3QO6A 2G8TA 2ZIQH 3S9AA 3SJ8A 3A8DA 2XWBI 2GCHF 4NA9H 1F0UA 1P12E 2FOAA 1B0EA 1J16A 1YLCA 4JZ1A 2NU4E 1SFQB 1WTGH 1Q3XA 3LGIA 2GTBA 1H9LB 2JETB 1WU1A 4X2XA 4B2CA 1LDTT 1P2KA 2ZFTA 1C5RA 5LPFA 3SNCA 4BAMB 5DJ7A 3SJIA 2BHGA 2ZHEH 3R3GB 2RA0A 2RA3A 3SO3A 4GCHF 1W8BH 3RXMA 1UTLM 4ZHAA 1G3EA 1KXCA 1JBUH 1A3BH 1QB1A 2J38A 3OYPA 1Z8JB 4ISHH 3ZZCA 4UDWH 3ZZDA 2XBXA 3SGQE 4XDEA 2AH4X 3PMHB 3U8TH 1GCTC 5LPRA 2Y82A 1GI6A 2YNBA 3L6PA 4TWYA 1FPHH 3DFJA 4JK5A 3T29A 2BX3A 1HAZB 4AG1A 2HGTH 5DP9A 2SGAA 3SNEA 1K28D 3SV6A 3RC4A 1GBAA 2CF9H 3TIUA 3K6YA 4CBNA 2ZDAH 2SGDE 3SGAE 4D7FA 2QXGA 3SU2A 3M3TA 4SGAE 3BTWE 1V2TT 2AYWA 1BJUA 1ZR0A 1AI8H 2VWOA 2SGFE 3ATLA 8KME2 1ELEE 1WUNH 2F9NA 3KQCA 1O2TA 1GDQA 3BEIB 1ELAA 4Q7YA 4BTUB 2C8YB 2Z94A 3UNRA 3HK6B 3GYMA 1KXEA 1RJXB 1XXDA 4BAKB 1EB2A 2G4TA 4UFEH 9LPRA 1ZSJA 4E7NA 2PGBB 3JZ1B 4MTBA 1AKSA 1FONA 1VCQA 1SLVB 1QFKH 4LZ4B 2XC0A 2O8UA 3QTVH 4ZMAH 1P02A 1YKTA 1YPKH 2AS9A 2XCNA 5CHAB 1KIGH 1DY8A 1WCZA 4H6TA 2VNTA 1C2IA 1O5AB 4IBLH 3SN8A 1K2I1 2ZCHP 3GCHB 1SGQE 1TBZH 1YPJH 2OXSA 3ZZ8A 1MU8B 5DP7A 2CV3A 1DXWA 5A09A 1ZTKA 4OS6A 5HXFA 1S81A 1CQQA 3A8BA 1MTNB 2Y5HA 1K1JA 3TPIZ 1Q31A 3K65B 1QRWA 2AFQB 4YO9A 3SGBE 1O36A 1E35B 5EXNA 4B71A 1Y5BT 2FYRA 4FU9A 1S6HA 3ZVBA 1GHAF 1HAHH 2BLVA 1TMUH 1IQIA 3QLPH 3T26A 4OGXA 4IW4E 3ZZ7A 1P2QA 1C5WB 1TIOA 1MTUA 2BLQA 3E6PH 2VH6A 1A0JA 3SQEE 2OUAA 3ATIA 3URCA 3DT0H 3UIRA 2BOHB 1A46H 1ANDA 1W10U 1B0FA 3ZVGA 1QQUA 4FUEA 2FIRH 2HWLB 2A0QB 1YPLH 4R8TB 1TFXA 1V6DA 4IMZA 1GDNA 5F8TA 4AZ2B 1AFEH 1LPGB 4THNH 4HZHA 2SGPE 3HPTB 4K3JA 2ODPA 1K9OE 2BD5A 3UR6A 5GWZA 1TOMH 3P17H 3DD2H 3MU4A 4I8GA 1GI3A 2TPIZ 4Y8XA 1P8VC 2R0KA 1AIXH 3RU4D 1ZLRA 3MWIU 3Q76A 1CA0B 2A31A 5AFYH 3FP8E 1WBGB 5EQSA 5A8XA 1UTQA 3RXQA 1QL8A 4LZ1H 3W95A 4TYDA 3ODFA 3EA8A 3SJ9A 3F1SB 1YPGH 3VFEA 1YLDA 1HAVA 1Q2WA 4NWKA 2C3SA 3SQHE 1INCA 1O5DH 4A7IB 1GBTA 4LK4A 3SU5A 4UEHH 2PKAB 2F83A 5F8XA 1U6QA 3KL6A 1RFNA 2GV6A 3SI4H 1EJAA 3SUGA 1THRH 4A1TA 2SNVA 1ZJKA 1L4DA 4UE7H 1C5NH 1LHGH 2JH6D 1BA8B 1GMDF 1HJ9A 1OX1A 2R9PA 1TGNA 1BBRK 2A4GA 2UUJB 2CJIA 5SGAE 2B8OH 1O2QA 4OS4A 4AG2A 1C9PA 1PPFE 2ZDVH 1C2MA 4MNVA 3PMJA 2ALVA 2VU8E 4Y8YA 2HNTE 1V2QT 1ELGA 1MZDA 1O5CB 3DFLA 3T62A 4B1TA 4DCDA 2QC2A 2ZO3H 2C8ZB 4WMDA 1GBEA 4TY6A 2F91A 3LGYA 3UTUH 1TMTH 3I29A 1GJ6A 2BDCA 3S7KB 1GBFA 4A1VA 2GDDA 2ZG0H 4JZFH 4JK6A 3G01A 1J17T 1F0TA 1S5SA 4B74A 5E2PA 4IS5A 5AVDA 5CE1A 1O3MA 1V2MT 2B9LA 3AW0A 1TRNA 1QJ1B 1QURH 3LH3A 4ZXXH 5IDKA 1NO9H 3R0FA 1TPSA 4K5ZA 1V2UT 2R0LA 4OS2A 4Y8ZA 4CR5A 1W12U 1ZHPA 5GIBA 3RXSA 6GCHF 2BQWB 1K1MA 2XCFA 1O34A 4MNWA 1QNJA 1K22H 1P05A 4X8SH 2NWNA 1ZOMA 4HGCA 4FUFA 4CH2B 4MLFB 4XBBA 1IQHA 1A7SA 2WYJA 1LHFH 1C4V2 2YOLA 5H4IB 1HAGE 1UCYE 2AGGX 1NZQH 3ZZ4A 1LQDB 1OOKB 2WYGA 2FI3E 4FVDA 1T8LA 4U2WA 2ZNKH 4JZIA 2QF3A 1BTXA 4NCYA 1EX3A 3TU7H 4LOYH 2G55A 1YPHE 3A7XA 3ZZ6A 2OBOA 1ZTJA 3PWCA 3TGJE 4JMYA 3RLYH 3TITA 2IOTA 2PKAA 1H8DH 3V13A 5EOKA 1EPTC 3PROA 1WYKA 3A7VA 5EQRA 1OWKA 5DP5A 3UREA 3AAUA 3NUMA 4U01A 4NIYA 3T5FH 3IG6B 1FAKH 5C1XA 3MYWA 5C20A 3E90B 3VPKA 2FTMA 1GBIA 1IAUA 3RU4E 4NA7A 3SHAH 4Y11E 1XM1A 4BXWA 3RXRA 1GWAA 2P8OC 1GI1A 4BANB 1TQ7B 2XTTB 1KLTA 3GY2A 1PPEE 4F4OC 3EDXB 2ZWLH 1O2SA 1G3DA 1BB0B 1EB1H 3DHKH 2ZPRA 3D49H 3MHWU 1F0RA 1DDJA 1CGJE 2ZECA 3RXOA 4ISIH 1SOTA 3A85A 2XXLA 2Y6TA 2UWOA 4ZROA 4FUDA 3EE0B 4UD9H 3LJOA 4CRDA 2ZCLP 1P2NA 3F9HA 2ULLA 4I7YH 2PR3A 1VGCC 4I8KA 4CREA 2BD8A 5I46H 5EU8A 1MKWK 2ZKSA 1VCPA 4INHA 1SB1H 2ZU1A 2VVUA 4MNXA 4KTUA 3TK9A 1BTZA 3LGTA 7GCHG 2PLXA 2P94A 2PW8H 2Z3DA 3GDUA 1EPTB 2CHAB 1V2WT 2AGEX 2W5EA 4K60A 3MO9A 3SV2H 1NS3A 1WTHD 1BTWA 1XUFA 2V6NA 3UNQA 3RM2H 3F68H 4WXIA 4J1YA 3SU0A 1BTPA 1MBQA 2TBSA 3A7WA 3RXFA 2ZFRH 1LKBA 2V35A 2Z6BD 4JYTA 1THPB 2ZGXH 2IPHA 5DPAA 1NU7B 6CHAC 1C2HA 1QJ7B 4MNYA 3NWUA 2HRVA 1DY9A 2P8OB 2GX4A 3SU1A 4CRCA 3BIVH 1FMGA 1V2NT 4I32A 5FAHA 2EEKA 1AVWA 1TMBH 3S0NA 2H1UA 1ZGVA 1HFDA 4GVUA 1TGBA 2WUBA 2O8LA 1NTPA 1C9TA 5L2YH 4AFQA 1P04A 1LHDH 3S69A 1DLEA 1NFUA 5EW2H 3KQEA 2FODA 4KGAA 3A7TA 1GI5A 5E0GA 1XXFA 3MNBA 1HV7A 1B5GH 1ETTH 5JB9S 3GOVB 3RXIA 4FUBA 1P03A 2Z9KA 1E34B 1O3IA 1DLKB 4YTAA 1J9CH 3RM0H 5ETXA 1EKBB 2WUCA 1C5TA 3D62A 2Z9JA 3M3VA 4ISLA 3BG4C 4INLA 4J2YB 1GJ7B 1FQ3A 1PQ7A 1IQFA 1FJSA 3SUDA 1ELFA 3E91A 3PO1C 2C4FH 1EAXA 3LU9B 1HAXB 1ZYOA 4NA8A 3F9FA 4NWLA 4OGYA 1HCGA 1MH0A 1WAYB 5HYOA 3T27A 5JBBS 3BTME 1FPCH 1KY9A 2B0FA 1C4U2 4YOJA 1SGEE 3IITA 4X2WA 1NFYA 2Y80A 1AZ8A 1RD3B 1S84A 2B5TB 2W7SA 3RLWH 2BY5X 3F9GA 6CHAB 2ZTYA 1C2JA 3PM3A 1SGTA 3BTDE 1A5HA 2GVFA 3GDSA 4ZHLU 2BB4A 2FOMB 1CHOF 4ZXYH 3GCTG 1EASA 3VB4A 5EXLA 1TONA 1SMFE 2BDHA 3MH5A 1O2YA 1LVMA 1MQ5A 1YCPK 1ANCA 1RTLA 2O8MA 1ZHRA 3ATKA 4TY7A 1C2LA 4NIVA 2B7DH 1HUTH 1Z8GA 2BVRH 2EI8A 2C8XB 1ZRBA 1WQSA 4KKDA 1Y3VA 1P57B 1AFQC 1OYQA 2VIWA 1AKSB 3LGWA 2F9OA 1IQLA 4DJZB 8GCHG 1QL9A 3RMMH 4AB9A 1HLTH 1IQGA 3AW1A 1GI2A 3FZDA 1EQ9A 2ZP0H 1NFXA 2GCHG 3RXVA 2FOFA 5TCAA 1MTVA 3QZRA 4B76A 1V2KT 2WPLS 3BG4B 1W7GH 2EI6A 1RXPA 4FVBA 1A3EH 1CHGA 1EJMA 3RXDA 4BTIB 1D3TB 1Y3YA 1XKBC 3FP7E 4NSYA 1BRUP 3AAVA 3EAJA 4CR9A 2LPRA 1C2FA 4WY3A 2FOGA 3STIA 2Y7XA 1O3CA 2GD4B 1SG8B 1TX6A 1O3EA 4GCHG 4YOIA 3GY7A 1BBRE 2BOKA 2ZGHA 3A8AA 4BTTB 2OD3B 2W7UA 3GYLB 1A0HB 4YZUA 1AE8H 1G32B 3PWBA 2ZTXA 1QBOA 3KF2A 1D3QB 2XYAA 2CXVA 4WH8A 3E1XB 1AWFH 3A81A 2FOEA 5JB8S 3I78A 1P09A 3URDA 1SQOA 4CRGA 1ZJDA 3KEEA 1DVAH 2ALPA 2JKHA 2GZ9A 4YESB 4A6LA 1BTYA 5L6NH 2QN5T 1P2IA 1GMHF 1FZZA 4DY7B 1O5GH 1BOQA 2XBWA 1V2JT 2Z9LA 1C5YB 1UTOA 1XVMA 1DM4B 1NRPH 1GHZA 4VGCC 3OU0A 5JBCS 1G3CA 3RXBA 4I33A 1CU1A 2FX6A 2TGPZ 3RXLA 1KLIH 2PHBA 1F5RA 1PYTD 4I31A 2H9HA 4BXSA 1XKAC 1B7XB 3SNDA 4WH6A 2FPZA 1O35A 1Z1IA 2XC5A 3VB7A 4CH8B 1P9SA 3MNCA 5HGGA 1KLJH 4GSOA 4O03A 4Y71A 1C1VH 2PTCE 3MI4A 2O8TA 5A0AE 3MO6A 3LC3A 5GCHF 3S9CA 4WWYA 1HAVB 5DO4H 2H2ZA 3D23A 2FM2A 2ANMH 3ATWA 1Y5UT 3BF6H 5J4QA 1UHBB 4OS1A 1O0DH 2H9TH 1O2ZA 1PPCE 3K2UA 2ZDMA 1YYY1 2BVXH 1LO6A 1EATA 2ZTZA 3CS7A 2A7CA 1GJCB 1L1NA 2R3UA 1BTUA 1QIXB 1HRTH 4PROA 1ANBA 3OX7U 5FXLA 1UK2A 1VJ9U 3LKWA 1UVOA 1BMNH 1NU9A 4FXGH 4JZEH 1A4WH 5T3HA 3MU8A 1RIWC 1GBBA 1GHAG 1THSH 3HKIB 1CSOE 2AMDA 1GCTB 1O2NA 4VGCB 4BAHB 4YLQH 4MVNA 1QR3E 1CBWC 1TGSZ 3KQBA 1BIOA 2ZPSA 1BRBE 3HKJB 1GHYH 7ESTE 1IHSH 2FX4A 1EZQA 1A0LA 1FNIA 1RTFB 1DX5M 3KHVA 2BM2A 3GY4A 4AN7A 1CGHA 2G52A 1OWJA 2XBVA 3S9BA 1AO5A 2AGIX 1O31A 1LHEH 2AMPA 2H5CA 4ZKNU 3C27B 2VINA 4UFFH 2BDGA 1DITH 1NFWA 3P8OA 3H5CB 1OWHA 2TGDA 1EOLA 1FV9A 2XW9A 5GDSH 5JPMH 1OXGA 1UMAH 3JZ2B 1BDAA 3A87A 2PFEA 2ZZUH 5JBAS 1W2KH
chains in the Genus database with same CATH superfamily
1P3EA 1UTPA 1V2PT 1EOJA 2TRMA 1DWBH 1HNEE 1RTKA 3U28C 3H09A 4XSKU 1W14U 5F53A 3SU3A 1SGPE 1NT1A 2BLWA 3FN8A 5BRRE 1MAXA 1NRQH 5A8YA 1G9IE 2FTLE 1GPZA 2ZQ2A 2Q1JA 1AN1E 1DXPA 1NPMA 3LPRA 4JYVH 3TNTA 4YLUA 2ZQ1A 3OSYA 5DGJA 1ZMNA 3BTTE 2WV5A 1MKXH 1RIWB 1AQ7A 4Z6AH 2BVSH 1LPKB 1TNHA 3SUFA 3NKKA 4YOGA 1NBMD 2EI7A 2ZU2A 3FZZA 1CBWB 2XC4A 1Z71A 3Q77A 2P93A 2CK3D 2WHXA 2OC7A 2J98B 1IOEA 1W13U 3P95A 4BAOB 2GZ7A 1C2KA 4TPIZ 1C5UA 1W7XH 3UR9A 4ABBA 2FYQA 1AE5A 4MDSA 3E8LA 1CA8B 2WPHS 5LGOA 2D1JA 1GMDG 4K1TA 2ZF0H 3ZZ3A 2HOBA 3PV5A 1UHBA 1JOUB 2FLBH 2BLOA 4X1PU 2THFB 2P3FH 2HNTF 3VB5A 4ESTE 2RG3A 1SC8U 5DP3A 4YT7H 3F3BA 3BTEE 3SI3H 3WW7A 5EJZA 1O2KA 1ANEA 4O9VA 1ARCA 2HALA 3RXEA 1O38A 3SJKA 1MMJN 3SU6A 3OY6U 1RRKA 2BX4A 1NRRH 4ABHA 4AFUA 1C2DA 3RMOH 1NRNH 3UUZA 5DP4A 9ESTA 2QF0A 3MH7A 3O8CA 2OC0A 3OTJE 1DWEH 2FOHA 1TRMA 3LT3A 2H9EH 3B23B 1TA2A 1O3JA 3DSOA 3Q3YA 1E38B 5C5NA 3B9FH 2TGTA 1KMHB 5EPYA 3F2GA 4WVPE 4DIIH 2I6SA 3NRLA 1GL0E 1O3PB 5F8ZA 3UQOA 3NPSA 4A1XA 6LPRA 2FZZA 1V3XA 1AWHB 4ABFA 3BIUH 2GCTC 4AOQA 3Q3XA 1TALA 2VVCA 2GDEH 2OTVA 2ZPQA 3KYFA 3M3SA 2KAIA 1E1QD 2Y5GA 3ZVFA 6GCHG 3SV8A 1Z8IB 4X6NA 5DSFA 1D4PB 2Z3EA 4X8TH 5T1VA 4D9QA 2ODQA 3GISB 2O8WA 4TSFD 3M5MA 4GHTA 5C1UA 3SNBA 4UONA 1YF4A 1EAWA 4Z0KA 1MCVA 2P16A 5AF9H 1GVKB 1ETSH 1TPAE 4AORA 1QL7A 3S7HB 3HK3B 4D9RA 4RSPA 1GJAB 2GZ8A 3TJNA 4D8NA 2R2WU 3F0PA 4ABJA 1O2GH 1AHTH 2KM0A 3U1JB 4Q7ZA 3M37A 3PLPA 4ABDA 1ZMLA 1L2EA 1J14A 3EQ0H 3A7YA 3SORA 3CS0A 2FEQH 3FO8D 2OK5A 2ZEBA 1O3OA 2TGAA 2A45B 4RKJB 3QWCH 1UVPA 3VGCC 4AYVB 3FAOA 3PTNA 2FWWA 2KCYA 5EJLA 1CT2E 1O3DA 1VITF 2FDAA 1W3CA 1J8AA 1D3PB 1EP5A 3GCOA 1AU8A 2UWLA 3RXCA 3A80A 1HIAA 4MPWA 1LKAA 1H1BA 2ZHFH 3UOUA 5F6MA 1DS2E 2IN2A 2ZGCA 1ABJH 3M5LA 4ABIA 1QRXA 1IQMA 4P00A 5EQQA 3LGUA 1N6XA 1S85A 2QXJA 1UVSH 4Y7AA 1SGYE 1WQVH 3ZYEA 1L1JA 1ELTA 2Q6FA 3F2HA 1BMFD 1QBNA 1FUJA 2Y5FA 1YC0A 2PSXA 4H4FA 5ESBA 1A5IA 1FI8A 1NBME 4JZDH 3RXPA 5TCCA 2AMQA 4MPXA 1O3NA 1P9UA 1HBTH 2K1QA 2ZGJA 1EP6A 1KXDA 3ELAH 4Q7XA 5T6GA 5A2MH 1RS0A 5BPEA 1FY3A 2HPPH 2BD4A 1GBMA 3TH4H 2BD3A 1T31A 5HIZA 3O8BA 4E7RG 2QE7D 2BXUH 2BY8X 2A2XH 1SHYA 1UK3A 3BTHE 1P2JA 3ATMA 3M7QA 1F92A 2ZCKP 3DUXH 1FAXA 1GGDC 3MH6A 1HAPH 2AERH 1LPZB 4U30A 2ZDNA 3T25A 2ANKH 3MU1A 2FOCA 3TJOA 4WJG2 2NU2E 4Y7BA 3UWIA 3A7ZA 5EODA 2WV4A 1GHXH 1FIZA 1AB9C 2SGEE 1BQYA 3FP6E 4ZKOU 2EA3A 2VWLA 3VXFH 4IN2A 2QA9E 2ILNA 1TAWA 1O39A 5HMAA 4DIHH 2WZQA 1ZPZA 2ZI2H 4FUJA 1GHWH 3QX5H 1SGFA 3TJUA 5DK1A 2VIQA 3QUMP 3U9AH 1BT7A 1HAIH 2DE8A 2PKSC 1SOZA 1TRYA 3P70B 1JXPA 5E0JA 1C5OH 1SVPA 1YCPM 1FY1A 1SSXA 3D65E 2OQ5A 1GG6C 2BZ6H 4MPUA 4GHQA 1TNJA 1GCDA 1O2VA 2FLRH 1AVGH 3EA9A 3U98H 1OPHB 3N7OA 1H8ED 2K8IA 2HNTC 3EGKH 3ZZ5A 2WPMS 5DKMA 2W26A 3O8RA 4AX9H 1MCTA 1BUIA 1GMCF 1TQ0B 1HPGA 5T6DA 3CP7A 1GHBF 4K2YA 3TLOA 4XOJA 3QK1A 4B2AA 5EGMA 2D2DA 1ARBA 1KDQA 5FBIA 2BZAA 1DOJA 5LPEA 1O5FH 3KQ5A 3GCNA 5C1YA 4F49A 3GICB 4X2YA 3RXGA 2C90B 4H42U 1NESE 1VGCB 2GP9B 1ESBA 1FN6A 2UUFB 1AB9B 2RDEA 4FUIA 1TNKA 1GBKA 1UK4A 2QF5A 3LOXA 2IJD1 4IN1A 1IQKA 2ANYA 2EC9H 1W0JD 2Y81A 4NZQA 1CHOG 4B6FA 5GJ4B 1JRSA 3RDZA 2FS8A 1TLDA 1MAYA 4WF8A 4Y0ZE 1GBHA 4AC9A 1ZHMA 4ASUD 1OS8A 1SGDE 1SGIB 3LC5A 3MO3A 2A5IA 1G30B 2KCOA 4SGBE 2H5DA 2BQ6B 5I25A 2PKSB 2UUYA 3EA7A 1SGRE 1V2VT 8LPRA 1K21H 1EUFA 1C2EA 1X7AC 3HGPA 4ZKRU 1GG6B 3A83A 4QT8C 5DG6A 1JMOH 1O2OA 2ZA5A 3BTGE 3BSQA 3SJOA 2W6ID 1H8IH 3NK8A 1O2LA 4NSVA 2ZU5A 4X1RU 1H9HE 1VKYA 1OP0A 1FXYA 4K8YA 1SI5H 1VR1H 2ZFQH 4KTCA 3ZYDA 4JYUH 1GI9B 2JETC 1ZPBA 4CBOA 2WPKS 1LMWB 1C1SA 1AY6H 1C5PA 1FIWA 4DVAU 1DANH 1ZMJA 1Y3WA 2BD7A 2QV1A 3PV4A 4K1EA 2BD9A 5E0HA 3ZVEA 3QN7A 1YPHC 4BNRA 4INKA 4WMEA 2JH5D 1BHXF 3FOAA 2JIZD 2AEIH 1O5BB 1TWXB 3FANA 1C5LH 3QGNB 1UCYH 4HTCH 2VWMA 3UY9A 1O2MA 2SNWA 4H6SB 3KCGH 3PO1B 1KTTB 2STBE 1ZGIA 1BMMH 1Y5AT 3GDVA 2BD2A 2PWXA 5FX6A 1SBWA 1N6YA 4DT7B 1S0QA 1BMAA 2L6OA 1Y3XA 3F0OA 3LGVA 1ELVA 1C1MA 1QB6A 4ABEA 1FY4A 4WMFA 2Z9IA 2HPQH 1E1RD 1YPMH 3A84A 1PQ5A 1UVUH 3M7UA 1GMHG 1JIMA 3RXHA 5GXPA 3TVJB 4E05H 3U8RH 2A7HA 5DP6A 3N99A 1QZ8A 2HVXA 1S83A 1ESTA 5KECA 2CGAA 5T6FA 3CENA 3MNXA 4B2BA 1AUJA 4B75A 5PTPA 1LVYA 4K69A 4KELA 1VITH 3N7DA 4AB8A 3LIWA 3QGJA 1GI8B 1KXFA 1GVLA 3ITIA 1C2GA 1AFQB 2YMSD 1FLEE 2OLGA 2VGCC 4Y0YE 5EJ1A 2FO9A 5G4BA 3U69H 1RGQA 1J15A 4GUXA 3RMNH 3U1IB 1CE5A 2H6MA 4ZUHA 1PPBH 5FBEA 2Y7ZA 1T8OA 2G5VA 5GCHG 1GJ4H 3BTKE 3FFGA 1TBQH 1JIRA 2JDID 4IC6A 2WPJS 1TBRH 4Y76A 2VIVA 1HGTH 1YM0A 3M35A 1QTFA 3VB6A 1FY5A 4RKOB 5FPYA 5C5OA 3ZV9A 3OFND 4FUGA 1GBCA 5CHAC 2FI5E 2PUQH 2UWPA 1C1PA 4CRFA 1C5QA 1GJ9B 3F6UH 2QAAA 5C67A 1GJ5H 1V2RT 4I8LA 1O33A 3UQVA 3UFAA 5K7RA 1P2OA 3GCHC 2CMYA 2ZDLA 1YY3A 5F03A 4NIWA 3ZZ9A 1C1NA 1C5ZB 1MTNC 2G5NA 1AZZA 2OC8A 5DP8A 4ZKSU 2F9PA 3RXJA 4GLYA 1C4Y2 5JYIA 1Z6JH 3F2FA 1HXFH 1XUHA 1H9IE 1OP8A 1O2PA 2R2MB 1HYLA 2VJ1A 1LQEA 2FOBA 1XMNB 2J95A 1HXEH 2GV7A 1O37A 1PQ8A 1O2RA 1SQTA 1K1OA 2A4OA 5FHTA 3PMAB 4M9FA 2GKVE 4FUHA 1FDPA 1GBLA 2EY4C 1C1RA 2ZFFH 2VGCB 2A32A 4DG4A 3UWJH 1L0ZA 4ISNA 4DT4A 1LVOA 1WDIA 1T7CA 4X1SU 3EYDA 1T8NA 2W6JD 1EZUC 1Y8TA 4BAQB 3KGPA 3TGIE 2WPIS 3N7EA 1XVOA 5GPIB 1TB6H 2XBYA 3W1EA 2BY9X 3V12A 2QY0B 3GY6A 2TIOA 5C3NA 2WPDD 3E0NB 1VZQH 1C5SA 3VXEH 3SV9A 1ZSLA 1ORFA 2M2AA 4XE4A 1NC6A 1CA0C 4LXBH 3TK6A 1SL3A 1NRSH 2KAIB 5C94A 3RXKA 2BMGB 3SHCH 2PGQB 3OY5U 1GI7B 1T4VH 3RC5A 5EG4A 5A8ZA 3ESTA 3W94A 2P95A 2QYIA 3PYHA 3ENSB 2KZ4A 3PRDA 3RMLH 1TPPA 1CT4E 1LTOA 2J2UA 3VEQB 1Y3UA 1Z1JA 1SGCA 3O8DA 5EIYA 5FX5A 1EXFA 3QZQA 1AGJA 1VJAU 1P2MA 5JBTA 1UTNA 2F9BH 2VVVA 2Q6DA 2XNIA 4GPGA 1ABIH 1QBVH 1YGCH 3LH1A 2FESH 5HM9A 1G2MA 3A82A 1MQ6A 3STJA 4XBCA 1EAUA 4OS7A 4CRAA 1GDUA 1O2WA 1OHHD 1UJ1A 3WY8A 1C5VA 4IMQA 1ID5H 5TJXA 3MU5A 4M7GA 2EQNA 4AGKA 4O3UA 2J5UA 4YXWD 2W3KA 3RXAA 2ZU4A 1SPJA 1O3AA 4HI3A 3V0XA 1BMLA 2XRCA 1Z7KA 3RP2A 1MZAA 1SGNE 3UOPA 1GJDB 1DPOA 3M61U 2FS9A 4JCNA 3P6ZB 4X0WU 2BTCE 1HB0B 1MBMA 1H4WA 4DURA 1K1NA 4U32A 2ZGBH 1N8OC 3TJVA 4RN6A 2BXTH 1MKXK 1XX9A 1D6RA 3M5NA 3K9XB 2BDAA 1CVWH 1JRTA 1ESAA 1K1LA 4F48B 2QCYA 1P10A 1P06A 1HIAB 2O9QA 3I77A 1AD8H 3SNAA 1BTHH 2J94A 2G4UA 1ETRH 1A61H 4I8JA 1DUAA 3PB1E 2A4RA 2Z3CA 5ABWA 1NROH 5A0CA 1C1TA 3FVFB 5J4SA 1LVBA 1OSSA 4Y79A 3AASA 4A92A 1ZRKA 1DWCH 3EE7A 5E8EH 1BBRH 1A2CH 3KNXA 4Y10E 5AHGH 3BEUA 3T28A 1TNGA 2STAE 2YNAA 4I8HA 4NG9H 2SFAA 3DA9B 4B6EA 3ZVAA 2G51A 3RXUA 4X1QU 2VIPA 2ASUB 3PLBA 1TYNA 3A89A 3SU4A 4WXVA 2OC1A 3UAIC 3MFJA 5FPTA 1C1WH 2QGRA 4X6MA 1KYNA 3ZZAA 4X2VA 2GT7A 2G00A 1PFXC 2RDLA 2HLCA 1D9IA 2J92A 1XUGA 3GY3A 1W0YH 1OYTH 2A7JA 1JWTA 1O3FA 1QGFA 1O3HA 5JDUB 1G36A 5EW1H 3A8CA 2XWAA 1FX0B 1BRAA 1F2SE 4GAWA 1K1IA 1GI4A 1EJNA 1HJAC 2F3CE 1N8OB 5FCRA 2ZU3A 2WINI 3TH2H 1QHRB 1BHXB 3BTFE 4O97A 5A0BA 3UNSA 3NXPA 4AYYB 4AFSA 1G3BA 2A1DB 1UVTH 2M5TA 2Z7FE 2VIDA 3AVZA 1TGCA 2Z9GA 2VB0A 1WXRA 3AK5A 1DICA 1NM6A 1ZPCA 1YP9A 1IQJA 3TNSA 2NU1E 3BN9A 2IJOB 3K6ZA 1FY8E 3HGNA 3ZZBA 1O2IA 1GVZA 1ZSKA 1TNIA 4A5TS 1VITG 1UTMA 1TPOA 4FUCA 2PV9B 4NFEA 2F9UA 4ISOA 1SKYE 1HJ8A 4ABAA 3L3TA 1MD8A 2FXRA 4MPVA 1GBJA 1AVXA 2CN0H 4DOQA 1FN8A 1C5MD 1YBWA 2BYAX 1OP2A 1E79D 2JH0D 4K8BA 3Q3KA 1ZZZA 1G37A 1SLXB 1OKXA 1Z8RA 2HVYB 3ZIAD 2KFWA 3PLKA 5LH8A 2GCTB 1O32A 3OE7D 1HAYB 1BITA 2BDIA 2J4IA 1A5GH 4ASHA 4NGAH 2LNCA 1QRZA 1ELCA 1F7ZA 2FI4E 3NZIA 1KDQB 1TGTA 1F5KU 1KSNA 5KEDA 1O3LA 1CT0E 1YPEH 1O3KA 1KXBA 1VCWA 1HJAB 4AGJA 1QB9A 4OM9A 2ZFSA 1K0HA 1S6LA 2W3IA 1O3GA 1L1GA 3DSGA 4D7GA 4O3TA 1AMHA 1P3CA 1NN6A 1GBDA 4ACBA 1IQEA 1PPHE 1SQAA 5FCKA 3L33A 1IHTH 3BTQE 4MQAA 4X1NU 3LJJA 3TK5A 3QTOH 3ZVDA 3BEFB 1TOCB 2QIQA 4Q2KA 4UFGH 7LPRA 2ZHDA 4YT6H 1G2LA 1SR5C 3IWMA 1BRCE 2F9VA 1DT2A 1AUTC 1MTSA 3MU0A 2V3OH 3U8OH 2A5KA 2CHAC 1SFIA 3H7OA 3M5OA 5DN6D 2A4QA 4B73A 2D8WA 1IQNA 1EAIA 3MMGA 1MU6B 1T32A 1W0ZU 3PTBA 4IGDA 1S0RA 2A2QH 4NZLA 1V2ST 3B8JA 3E0PB 3LDXH 1TABE 3M7TA 1E0FD 5C2ZA 2OCVB 3E16B 1K1PA 1UTJA 3P92A 2VIOA 2AIPA 2C93B 1T8MA 4X6OA 3VGCB 1O30A 3RC6A 2BY6X 1QA0A 2OINA 3MH4A 1SLUB 2GMTC 3BV9B 1HDTH 2NU0E 2SGQE 3KQDA 1MKWH 5CMXH 2ANWA 3NCLA 2OP9A 1YWUA 1V2LT 3SW2B 4Q80A 1Z6EA 1MD7A 4ZH8A 4X8VH 3OEED 4MG3A 4ZAEA 4TPYA 4HFPB 1Y59T 1O2JA 1EZSC 2BQ7B 3RXTA 1PPZA 5IYTA 5IK2D 3ODDA 1CO7E 4DGJA 2DE9A 1PQAA 1OWDA 2CF8H 2UUKB 1PYTC 1GMCG 4FU8A 1SQRA 1QJ6B 1ELBA 1DWDH 3SUEA 1GHBG 2QXIA 1BJVA 1C5XB 1CGIE 3M36A 3HATH 3A86A 5HIYA 1BCUH 4X8UH 2QXHA 1ACBE 1P11E 3RU4T 1OWEA 1L4ZA 4AFZA 5E2OA 4IC5A 1O2UA 3GY5A 4XFQA 4CHAC 3P8FA 4KP0A 2NU3E 4K1SA 4Y6DA 2G81E 2KCPA 2P3UB 3GY8A 3UB0A 3SV7A 3P8NA 2P3TB 3KIDU 7GCHF 3Q00A 1GGDB 1PPGE 1DFPA 2PTNA 5FPSA 1S6FA 1BZXE 5C17A 2ZDKA 2GMTB 3KN2A 1DSTA 1ELDE 1XUJA 2GGVB 1E37B 3H7TA 1XUIA 3PMBB 2Q6GA 2J34A 3ZV8A 5L2ZH 3V7TA 1DUEA 2AIQA 4D76A 4ACAA 4CRBA 1F0SA 1ZTLA 3RUOA 2GT8A 2OQUA 3KYGA 1OWIA 3TH3H 7KMEH 2VWNA 1T4UH 1XUKA 1KTSB 1GJBB 5ESTE 1HAOH 1M9UA 2D26C 2C8WB 2BDYA 4TWWA 3SYJA 1EZXC 4FU7A 2PUXB 5EXMA 1QA7A 1MUEB 1P0SH 4XBDA 1SLWB 2ZHWH 1V2OT 3MNSA 4BOHA 1YCPH 2A5AA 1DE7H 1N1LA 2ZFPH 3F9EA 1D6WA 1UTKA 2V3MA 2PP6A 5HM2A 1UO6A 2VH0A 5EPNA 1MTWA 4ZHMU 3UPEA 4CHAB 3A88A 2V0BA 2ESTE 1O2XA 1LCYA 5B6OA 1DSUA 1NY22 3LONA 2R3YA 1WSSH 1SGFG 1C1OA 1C1QA 2PSYA 1GJ8B 5AFZH 1O2HA 3SBKA 1SHHB 4R0IA 2I6QA 1LHCH 3BG8A 1PJPA 1WOFA 1E36B 3MTYA 1GI0A 1TNLA 3TGKE 2V3HH 3SOSA 1GL1A 2BDBA 6ESTA 1EFRD 3VB3A 1O5EH 1TX7A 4F55A 1A1RA 2ZC9H 3MOCA 4KTSA 1W11U 1TE0A 4DW2U 1QY6A 1S82A 1C1UH 1KXAA 2RCEA 3SZNA 1O3BA 3GCTF 2ZHQH 1GHVH 1COWD 4UFDH 8ESTE 4NFFA 1TA6A 1TX8A 5CHBA 2BY7X 3T2NA 2ODYB 1WV7H 3QDZB 2P59A 1EPTA 1D3DB 1F5LA 2OBQA 1UCYK 2FP7B 1P01A 4ABGA 3P8GA 1QQ4A 2J9NA 3V3MA 3E3TA 4YM9A 4XD7D 3ZVCA 5L30H 4NIXA 8GCHF 1QCPA 2DUCA 4OS5A 5K0HA 4X6PA 2IPQX 2FMJA 4E06H 3C1KA 3QO6A 2G8TA 2ZIQH 3S9AA 3SJ8A 3A8DA 2XWBI 2GCHF 4NA9H 1F0UA 1P12E 2FOAA 1B0EA 1J16A 1YLCA 4JZ1A 2NU4E 1SFQB 1WTGH 1Q3XA 3LGIA 2GTBA 1H9LB 2JETB 1WU1A 5C0TA 4X2XA 4B2CA 1LDTT 1P2KA 2ZFTA 1C5RA 5LPFA 3SNCA 4BAMB 5DJ7A 3SJIA 2BHGA 2ZHEH 3R3GB 2RA0A 2RA3A 3SO3A 4GCHF 1W8BH 3RXMA 1UTLM 4ZHAA 1G3EA 1KXCA 1JBUH 1A3BH 1QB1A 2J38A 3OYPA 1Z8JB 4ISHH 3ZZCA 4UDWH 3ZZDA 2XBXA 3SGQE 4XDEA 2AH4X 3PMHB 3U8TH 1GCTC 5LPRA 2Y82A 1GI6A 2YNBA 3L6PA 4TWYA 1FPHH 3DFJA 4JK5A 3T29A 2BX3A 1HAZB 4AG1A 2HGTH 5DP9A 2SGAA 3SNEA 1K28D 3SV6A 3RC4A 1GBAA 5HKKD 2CF9H 3TIUA 3K6YA 4CBNA 2ZDAH 2SGDE 3SGAE 4D7FA 2QXGA 3SU2A 3M3TA 4SGAE 3BTWE 1V2TT 2AYWA 1BJUA 1ZR0A 1AI8H 2VWOA 2SGFE 3ATLA 8KME2 1ELEE 1WUNH 2F9NA 3KQCA 1O2TA 1GDQA 3BEIB 1ELAA 4Q7YA 4BTUB 2C8YB 2Z94A 3UNRA 3HK6B 3GYMA 1KXEA 1RJXB 1XXDA 4BAKB 1EB2A 2G4TA 4UFEH 9LPRA 1ZSJA 4E7NA 2PGBB 3JZ1B 4MTBA 1AKSA 1FONA 1VCQA 1SLVB 1QFKH 4LZ4B 2XC0A 2O8UA 3QTVH 4ZMAH 1P02A 1YKTA 1YPKH 2AS9A 2XCNA 5CHAB 1KIGH 1DY8A 1WCZA 4H6TA 2VNTA 1C2IA 1O5AB 4IBLH 3SN8A 3VG8A 1K2I1 2ZCHP 3GCHB 2JJ1D 1SGQE 1TBZH 1YPJH 5GNDA 2OXSA 3ZZ8A 1MU8B 5DP7A 2CV3A 1DXWA 5A09A 1ZTKA 4OS6A 5HXFA 1S81A 1CQQA 3A8BA 3OTPA 1MTNB 2Y5HA 4Q63A 1K1JA 3TPIZ 1Q31A 3K65B 1QRWA 2AFQB 4YO9A 3SGBE 1O36A 1E35B 5EXNA 4B71A 1Y5BT 2FYRA 4FU9A 1S6HA 3ZVBA 1GHAF 1HAHH 2BLVA 1TMUH 1IQIA 3QLPH 3T26A 4OGXA 4IW4E 3ZZ7A 1P2QA 1C5WB 1TIOA 1MTUA 2BLQA 3E6PH 2VH6A 1A0JA 3SQEE 2OUAA 3ATIA 3URCA 3DT0H 3UIRA 2BOHB 1A46H 1ANDA 1W10U 1B0FA 3ZVGA 1QQUA 4FUEA 2FIRH 2HWLB 2A0QB 1YPLH 4R8TB 1TFXA 1V6DA 4IMZA 1GDNA 5F8TA 4AZ2B 1UW7A 1AFEH 1LPGB 4FOUC 4THNH 4HZHA 2SGPE 3HPTB 4K3JA 2ODPA 1K9OE 2BD5A 3UR6A 5GWZA 1TOMH 3P17H 3DD2H 2K0QA 3MU4A 4I8GA 1GI3A 2TPIZ 4Y8XA 1P8VC 2R0KA 1AIXH 3RU4D 1ZLRA 3MWIU 3Q76A 1CA0B 2A31A 5AFYH 3FP8E 1WBGB 5EQSA 5A8XA 1UTQA 3RXQA 1QL8A 4LZ1H 3W95A 4TYDA 3ODFA 3EA8A 3SJ9A 3F1SB 1YPGH 3VFEA 1YLDA 1HAVA 1Q2WA 1W0KD 2WSSD 4NWKA 5B6LA 2XOKD 5CDFE 2C3SA 3SQHE 1INCA 1O5DH 4A7IB 1GBTA 4LK4A 3SU5A 4UEHH 5KGOA 2PKAB 2F83A 5F8XA 1U6QA 3KL6A 3SZEA 1RFNA 2GV6A 3SI4H 1EJAA 3SUGA 1THRH 4A1TA 2SNVA 1ZJKA 1L4DA 4UE7H 1C5NH 1LHGH 2JH6D 1BA8B 1GMDF 1HJ9A 1OX1A 2R9PA 1TGNA 1BBRK 2A4GA 2UUJB 2CJIA 1YLNA 2B8OH 1O2QA 5SGAE 4OS4A 4AG2A 1C9PA 1PPFE 2ZDVH 1C2MA 4MNVA 3PMJA 2ALVA 2VU8E 4Y8YA 2HNTE 3OEHD 1V2QT 1ELGA 1MZDA 1O5CB 3DFLA 3T62A 4B1TA 4DCDA 2L74A 2QC2A 2ZO3H 2C8ZB 4WMDA 1GBEA 4HG6A 4TY6A 2F91A 3LGYA 3UTUH 1TMTH 3I29A 1GJ6A 4RT1A 2BDCA 3S7KB 3MQKC 1GBFA 4A1VA 2GDDA 2ZG0H 4JZFH 4JK6A 3G01A 1J17T 1F0TA 1S5SA 4B74A 5E2PA 4IS5A 5AVDA 5CE1A 1O3MA 1V2MT 2QF4A 2B9LA 3AW0A 1TRNA 1QJ1B 1QURH 3LH3A 4ZXXH 5IDKA 1NO9H 3WWBA 3R0FA 1TPSA 4K5ZA 1V2UT 2R0LA 4OS2A 4Y8ZA 4CR5A 1W12U 1ZHPA 5GIBA 3RXSA 6GCHF 2BQWB 1K1MA 2XCFA 1O34A 4MNWA 1QNJA 1K22H 1P05A 4X8SH 2NWNA 1ZOMA 4HGCA 4P02A 4FUFA 4CH2B 4MLFB 4XBBA 1IQHA 1A7SA 2WYJA 1LHFH 1C4V2 2YOLA 5H4IB 1HAGE 1UCYE 2AGGX 2J98A 1NZQH 3ZZ4A 1LQDB 1OOKB 2WYGA 2FI3E 3PRBA 4FVDA 1T8LA 4U2WA 2ZNKH 4JZIA 2QF3A 1BTXA 4NCYA 1EX3A 3TU7H 2J97A 2KX4A 2G55A 2AHME 4LOYH 1YPHE 3A7XA 3ZZ6A 2OBOA 1ZTJA 3PWCA 3TGJE 4JMYA 3RLYH 3TITA 2IOTA 2PKAA 1H8DH 3V13A 5EOKA 1EPTC 3PROA 1WYKA 3A7VA 5EQRA 1OWKA 5DP5A 3UREA 3AAUA 3NUMA 4U01A 4NIYA 3T5FH 3IG6B 1FAKH 5C1XA 3MYWA 5C20A 2F43B 3E90B 3VPKA 2FTMA 1GBIA 1IAUA 3RU4E 4NA7A 3SHAH 4Y11E 1XM1A 4BXWA 3RXRA 1GWAA 2P8OC 1GI1A 4BANB 1TQ7B 2KR7A 2XTTB 1KLTA 5FL7D 3GY2A 1PPEE 4F4OC 3EDXB 2ZWLH 1O2SA 1G3DA 2XNDD 1BB0B 1EB1H 3DHKH 2ZPRA 3D49H 3MHWU 1F0RA 1DDJA 1CGJE 2ZECA 3RXOA 2YMSC 4ISIH 1SOTA 3A85A 2XXLA 2Y6TA 2UWOA 4ZROA 4FUDA 3EE0B 4UD9H 3LJOA 4CRDA 2ZCLP 1P2NA 3F9HA 2ULLA 4I7YH 2PR3A 1VGCC 4I8KA 4CREA 2BD8A 2GJGA 5I46H 5EU8A 1MKWK 2ZKSA 1VCPA 4INHA 1SB1H 2ZU1A 2VVUA 4MNXA 4KTUA 3TK9A 2VBCA 1BTZA 3LGTA 7GCHG 2PLXA 2P94A 2PW8H 2RFKC 2Z3DA 3GDUA 1EPTB 2CHAB 1V2WT 4RT0A 2AGEX 2W5EA 4K60A 3MO9A 3SV2H 1NS3A 1WTHD 1BTWA 1XUFA 2V6NA 3UNQA 3RM2H 3F68H 4WXIA 4J1YA 3SU0A 1BTPA 1MBQA 2TBSA 3A7WA 3RXFA 2ZFRH 1LKBA 2V35A 2Z6BD 4JYTA 1THPB 2ZGXH 2IPHA 4RI0A 5DPAA 1NU7B 6CHAC 1C2HA 1QJ7B 4MNYA 3NWUA 2HRVA 1DY9A 2P8OB 2GX4A 3SU1A 4CRCA 3BIVH 1FMGA 1V2NT 4I32A 5FAHA 2EEKA 1AVWA 1TMBH 3S0NA 2H1UA 1ZGVA 1HFDA 4GVUA 1TGBA 2WUBA 2O8LA 1NTPA 1C9TA 5L2YH 4AFQA 1P04A 1LHDH 3S69A 1DLEA 1NFUA 1H8HD 3KQEA 5EW2H 3DCLA 2FODA 4KGAA 3DSPA 3A7TA 1GI5A 2YMSB 5E0GA 4Z1MD 1XXFA 3MNBA 1HV7A 1B5GH 1ETTH 5JB9S 3GOVB 3RXIA 4FUBA 1P03A 2Z9KA 3PV2A 1E34B 1O3IA 1DLKB 4YTAA 1J9CH 3RM0H 5ETXA 1EKBB 2WUCA 1C5TA 3D62A 2Z9JA 3M3VA 4ISLA 3BG4C 4INLA 4J2YB 1GJ7B 1FQ3A 1PQ7A 1IQFA 1FJSA 3SUDA 1ELFA 3E91A 3PO1C 4XRNA 2C4FH 1EAXA 3LU9B 1HAXB 5C0UA 1ZYOA 4NA8A 3F9FA 4NWLA 4OGYA 1HCGA 1MH0A 1WAYB 5HYOA 3T27A 5JBBS 3BTME 1FPCH 1KY9A 2B0FA 1C4U2 4YOJA 1SGEE 3IITA 4X2WA 1NFYA 2Y80A 1AZ8A 1RD3B 1S84A 2B5TB 2W7SA 3RLWH 2BY5X 3F9GA 6CHAB 2ZTYA 1C2JA 3PM3A 1SGTA 3BTDE 1A5HA 2GVFA 3GDSA 4ZHLU 2BB4A 2FOMB 1CHOF 4ZXYH 3GCTG 1EASA 3VB4A 5EXLA 1TONA 1SMFE 2BDHA 3MH5A 1O2YA 1LVMA 1MQ5A 1YCPK 1ANCA 1RTLA 2O8MA 1ZHRA 3ATKA 4TY7A 1C2LA 4NIVA 2B7DH 1HUTH 1Z8GA 2BVRH 2EI8A 2C8XB 1ZRBA 1WQSA 4KKDA 1Y3VA 1P57B 1AFQC 1OYQA 2VIWA 1AKSB 3LGWA 2F9OA 1IQLA 4DJZB 8GCHG 1QL9A 3RMMH 4AB9A 1HLTH 1IQGA 3AW1A 1GI2A 3FZDA 1EQ9A 2ZP0H 4I86A 1NFXA 2GCHG 3RXVA 2FOFA 5TCAA 1MTVA 3QZRA 4B76A 1V2KT 2WPLS 3BG4B 1W7GH 2EI6A 1RXPA 4FVBA 1A3EH 1CHGA 1EJMA 3RXDA 4BTIB 1D3TB 1Y3YA 1XKBC 3FP7E 4NSYA 1BRUP 3AAVA 3EAJA 4CR9A 2LPRA 1C2FA 4WY3A 2FOGA 3STIA 2Y7XA 1O3CA 2GD4B 1SG8B 1TX6A 1O3EA 4GCHG 4YOIA 3GY7A 1BBRE 2BOKA 2ZGHA 3A8AA 4BTTB 2OD3B 2W7UA 3GYLB 1A0HB 4YZUA 1AE8H 1G32B 3PWBA 2JJ2D 2ZTXA 1QBOA 3KF2A 1D3QB 2XYAA 2CXVA 4WH8A 3E1XB 1AWFH 3A81A 2WV9A 2FOEA 5JB8S 3I78A 1P09A 4FETA 3URDA 1SQOA 4CRGA 1ZJDA 3KEEA 1DVAH 2ALPA 2JKHA 2GZ9A 2KCAA 4YESB 4A6LA 1BTYA 5L6NH 2QN5T 1P2IA 1GMHF 3FKSD 1FZZA 4DY7B 1O5GH 1BOQA 2XBWA 1V2JT 2Z9LA 1C5YB 1UTOA 1XVMA 1DM4B 1NRPH 1GHZA 4VGCC 3OU0A 5JBCS 1G3CA 3RXBA 4I33A 3WWFA 1CU1A 2FX6A 2TGPZ 3RXLA 1MABB 1KLIH 2PHBA 1F5RA 3CNRA 1PYTD 4I31A 2H9HA 4BXSA 1XKAC 1B7XB 3SNDA 4WH6A 2FPZA 1O35A 1Z1IA 2XC5A 3VB7A 4TT3D 1P9SA 3MNCA 4CH8B 5HGGA 1KLJH 4GSOA 4O03A 4Y71A 1C1VH 2PTCE 3MI4A 2O8TA 5A0AE 3MO6A 3LC3A 5GCHF 3S9CA 3GS9A 4WWYA 1HAVB 5DO4H 2H2ZA 3D23A 2FM2A 2ANMH 3ATWA 1Y5UT 3BF6H 5J4QA 1UHBB 4OS1A 1O0DH 2H9TH 1O2ZA 1PPCE 3K2UA 2ZDMA 2HLDD 1YYY1 2BVXH 1LO6A 1EATA 2ZTZA 3CS7A 2A7CA 1GJCB 1L1NA 2R3UA 1BTUA 1QIXB 4ZCNA 1HRTH 4PROA 1ANBA 3OX7U 5FXLA 1UK2A 1VJ9U 3LKWA 1UVOA 1BMNH 1NU9A 2LP6A 4FXGH 4JZEH 1A4WH 5T3HA 3MU8A 1RIWC 4Q4LA 1GBBA 1GHAG 1THSH 2F4LA 1CSOE 2AMDA 3HKIB 1GCTB 1O2NA 4VGCB 4BAHB 4YLQH 4MVNA 1QR3E 1CBWC 1TGSZ 3KQBA 1BIOA 2ZPSA 1BRBE 3HKJB 1GHYH 7ESTE 1IHSH 2FX4A 2V7QD 1EZQA 1A0LA 1FNIA 1RTFB 1DX5M 3KHVA 2BM2A 3GY4A 4AN7A 1CGHA 2G52A 1OWJA 2XBVA 3S9BA 1AO5A 2AGIX 1O31A 1LHEH 2AMPA 2H5CA 4ZKNU 3C27B 2VINA 4UFFH 2BDGA 1DITH 1NFWA 3P8OA 3H5CB 1OWHA 2TGDA 1EOLA 1FV9A 3OAAD 2XW9A 5GDSH 5JPMH 1OXGA 1UMAH 2LELA 3JZ2B 1BDAA 3A87A 2PFEA 2ZZUH 5JBAS 1W2KH
chains in the Genus database with same CATH topology
1P3EA 1UTPA 1V2PT 1EOJA 2TRMA 1DWBH 1HNEE 1RTKA 4XSKU 1W14U 3SU3A 1SGPE 1NT1A 2BLWA 5BRRE 1MAXA 1NRQH 5A8YA 1G9IE 2FTLE 1GPZA 2ZQ2A 2Q1JA 1AN1E 1DXPA 1NPMA 3LPRA 4JYVH 3TNTA 4YLUA 2ZQ1A 3OSYA 5DGJA 1ZMNA 3BTTE 2WV5A 1MKXH 1RIWB 1AQ7A 4Z6AH 2BVSH 1LPKB 1TNHA 3SUFA 3NKKA 4YOGA 2EI7A 2ZU2A 3FZZA 1CBWB 2XC4A 1Z71A 3Q77A 2P93A 2OC7A 1IOEA 1W13U 3P95A 4BAOB 2GZ7A 1C2KA 4TPIZ 1C5UA 1W7XH 3UR9A 4ABBA 2FYQA 1AE5A 4MDSA 3E8LA 1CA8B 2WPHS 5LGOA 2D1JA 1GMDG 4K1TA 2ZF0H 3ZZ3A 2HOBA 1UHBA 1JOUB 2FLBH 2BLOA 4X1PU 2THFB 2P3FH 2HNTF 3VB5A 4ESTE 2RG3A 1SC8U 5DP3A 4YT7H 3BTEE 3SI3H 1O2KA 1ANEA 4O9VA 1ARCA 2HALA 3RXEA 1O38A 3SJKA 1MMJN 3SU6A 3OY6U 1RRKA 2BX4A 1NRRH 4ABHA 4AFUA 1C2DA 3RMOH 1NRNH 3UUZA 5DP4A 9ESTA 2QF0A 3MH7A 3O8CA 2OC0A 3OTJE 1DWEH 2FOHA 1TRMA 3LT3A 2H9EH 3B23B 1TA2A 1O3JA 3Q3YA 1E38B 5C5NA 3B9FH 2TGTA 5EPYA 4WVPE 4DIIH 2I6SA 1GL0E 1O3PB 5F8ZA 3UQOA 3NPSA 4A1XA 6LPRA 2FZZA 1V3XA 1AWHB 4ABFA 3BIUH 2GCTC 4AOQA 3Q3XA 1TALA 2VVCA 2GDEH 2OTVA 2ZPQA 3M3SA 2KAIA 2Y5GA 3ZVFA 6GCHG 3SV8A 1Z8IB 4X6NA 1D4PB 2Z3EA 4X8TH 4D9QA 2ODQA 3GISB 2O8WA 3M5MA 4GHTA 5C1UA 3SNBA 4UONA 1YF4A 1EAWA 4Z0KA 1MCVA 2P16A 5AF9H 1GVKB 1ETSH 1TPAE 4AORA 1QL7A 3S7HB 3HK3B 4D9RA 4RSPA 1GJAB 2GZ8A 3TJNA 4D8NA 2R2WU 4ABJA 1O2GH 1AHTH 3U1JB 4Q7ZA 3M37A 3PLPA 4ABDA 1ZMLA 1L2EA 1J14A 3EQ0H 3A7YA 3SORA 3CS0A 2FEQH 2ZEBA 1O3OA 2TGAA 2A45B 4RKJB 3QWCH 1UVPA 3VGCC 4AYVB 3FAOA 3PTNA 2FWWA 1CT2E 1O3DA 1VITF 2FDAA 1W3CA 1J8AA 1D3PB 1EP5A 3GCOA 1AU8A 2UWLA 3RXCA 3A80A 1HIAA 4MPWA 1LKAA 1H1BA 2ZHFH 3UOUA 5F6MA 1DS2E 2IN2A 2ZGCA 1ABJH 3M5LA 4ABIA 1QRXA 1IQMA 5EQQA 3LGUA 1N6XA 1S85A 2QXJA 1UVSH 4Y7AA 1SGYE 1WQVH 3ZYEA 1L1JA 1ELTA 2Q6FA 1QBNA 1FUJA 2Y5FA 1YC0A 2PSXA 4H4FA 5ESBA 1A5IA 1FI8A 4JZDH 3RXPA 5TCCA 2AMQA 4MPXA 1O3NA 1P9UA 1HBTH 2K1QA 2ZGJA 1EP6A 1KXDA 3ELAH 4Q7XA 5T6GA 5A2MH 1RS0A 5BPEA 1FY3A 2HPPH 2BD4A 1GBMA 3TH4H 2BD3A 1T31A 3O8BA 4E7RG 2BXUH 2BY8X 2A2XH 1SHYA 1UK3A 3BTHE 1P2JA 3ATMA 3M7QA 1F92A 2ZCKP 3DUXH 1FAXA 1GGDC 3MH6A 1HAPH 2AERH 1LPZB 4U30A 2ZDNA 3T25A 2ANKH 3MU1A 2FOCA 3TJOA 4WJG2 2NU2E 4Y7BA 3UWIA 3A7ZA 5EODA 2WV4A 1GHXH 1FIZA 1AB9C 2SGEE 1BQYA 3FP6E 4ZKOU 2EA3A 2VWLA 3VXFH 4IN2A 2QA9E 2ILNA 1TAWA 1O39A 5HMAA 4DIHH 1ZPZA 2ZI2H 4FUJA 1GHWH 3QX5H 1SGFA 3TJUA 5DK1A 2VIQA 3QUMP 3U9AH 1BT7A 1HAIH 2DE8A 2PKSC 1SOZA 1TRYA 3P70B 1JXPA 5E0JA 1C5OH 1SVPA 1YCPM 1FY1A 1SSXA 3D65E 2OQ5A 1GG6C 2BZ6H 4MPUA 4GHQA 1TNJA 1GCDA 1O2VA 2FLRH 1AVGH 3EA9A 3U98H 1OPHB 3N7OA 2HNTC 3EGKH 3ZZ5A 2WPMS 5DKMA 2W26A 3O8RA 4AX9H 1MCTA 1BUIA 1GMCF 1TQ0B 1HPGA 5T6DA 3CP7A 1GHBF 4K2YA 3TLOA 4XOJA 3QK1A 4B2AA 5EGMA 2D2DA 1ARBA 1KDQA 5FBIA 2BZAA 1DOJA 5LPEA 1O5FH 3GCNA 5C1YA 4F49A 3GICB 4X2YA 3RXGA 2C90B 4H42U 1NESE 1VGCB 2GP9B 1ESBA 1FN6A 2UUFB 1AB9B 4FUIA 1TNKA 1GBKA 1UK4A 3LOXA 4IN1A 1IQKA 2ANYA 2EC9H 2Y81A 4NZQA 1CHOG 5GJ4B 1JRSA 3RDZA 2FS8A 1TLDA 1MAYA 4WF8A 4Y0ZE 1GBHA 1ZHMA 1OS8A 1SGDE 1SGIB 3LC5A 3MO3A 2A5IA 1G30B 4SGBE 2H5DA 2BQ6B 5I25A 2PKSB 2UUYA 3EA7A 1SGRE 1V2VT 8LPRA 1K21H 1EUFA 1C2EA 1X7AC 3HGPA 4ZKRU 1GG6B 3A83A 4QT8C 5DG6A 1JMOH 1O2OA 2ZA5A 3BTGE 3BSQA 3SJOA 3NK8A 1H8IH 1O2LA 4NSVA 2ZU5A 4X1RU 1H9HE 1OP0A 1FXYA 4K8YA 1SI5H 1VR1H 2ZFQH 4KTCA 3ZYDA 4JYUH 1GI9B 2JETC 1ZPBA 4CBOA 2WPKS 1LMWB 1C1SA 1AY6H 1C5PA 1FIWA 4DVAU 1DANH 1ZMJA 1Y3WA 2BD7A 2QV1A 3PV4A 4K1EA 2BD9A 5E0HA 3ZVEA 3QN7A 1YPHC 4BNRA 4INKA 4WMEA 2JH5D 1BHXF 2AEIH 1O5BB 1TWXB 3FANA 1C5LH 3QGNB 1UCYH 4HTCH 2VWMA 3UY9A 1O2MA 2SNWA 4H6SB 3KCGH 3PO1B 1KTTB 2STBE 1ZGIA 1BMMH 1Y5AT 3GDVA 2BD2A 2PWXA 5FX6A 1SBWA 1N6YA 4DT7B 1S0QA 1BMAA 1Y3XA 3LGVA 1ELVA 1C1MA 1QB6A 4ABEA 1FY4A 4WMFA 2Z9IA 2HPQH 1YPMH 3A84A 1PQ5A 1UVUH 3M7UA 1GMHG 1JIMA 3RXHA 5GXPA 3TVJB 4E05H 3U8RH 2A7HA 5DP6A 2HVXA 1S83A 1ESTA 2CGAA 5T6FA 3CENA 3MNXA 4B2BA 1AUJA 4B75A 5PTPA 1LVYA 4K69A 4KELA 1VITH 4AB8A 3LIWA 3QGJA 1GI8B 1KXFA 1GVLA 3ITIA 1C2GA 1AFQB 1FLEE 2OLGA 2VGCC 4Y0YE 2FO9A 5G4BA 3U69H 1RGQA 1J15A 4GUXA 3RMNH 3U1IB 1CE5A 2H6MA 4ZUHA 1PPBH 5FBEA 2Y7ZA 1T8OA 2G5VA 5GCHG 1GJ4H 3BTKE 3FFGA 1TBQH 1JIRA 4IC6A 2WPJS 1TBRH 4Y76A 2VIVA 1HGTH 1YM0A 3M35A 1QTFA 3VB6A 1FY5A 4RKOB 5FPYA 5C5OA 3ZV9A 4FUGA 1GBCA 5CHAC 2FI5E 2PUQH 2UWPA 1C1PA 4CRFA 1C5QA 1GJ9B 3F6UH 2QAAA 5C67A 1GJ5H 1V2RT 4I8LA 1O33A 3UQVA 3UFAA 5K7RA 1P2OA 3GCHC 2CMYA 2ZDLA 5F03A 4NIWA 3ZZ9A 1C1NA 1C5ZB 1MTNC 2G5NA 1AZZA 2OC8A 5DP8A 4ZKSU 2F9PA 3RXJA 4GLYA 1C4Y2 5JYIA 1Z6JH 1HXFH 1XUHA 1H9IE 1OP8A 1O2PA 2R2MB 1HYLA 2VJ1A 1LQEA 2FOBA 1XMNB 2J95A 1HXEH 2GV7A 1O37A 1PQ8A 1O2RA 1SQTA 1K1OA 2A4OA 5FHTA 3PMAB 2GKVE 4FUHA 1FDPA 1GBLA 1C1RA 2ZFFH 2VGCB 2A32A 4DG4A 3UWJH 1L0ZA 4ISNA 1LVOA 1T7CA 4X1SU 3EYDA 1T8NA 1EZUC 1Y8TA 4BAQB 3KGPA 3TGIE 2WPIS 1XVOA 5GPIB 1TB6H 2XBYA 2BY9X 3V12A 2QY0B 3GY6A 2TIOA 5C3NA 3E0NB 1VZQH 1C5SA 3VXEH 3SV9A 1ZSLA 1ORFA 4XE4A 3TK6A 1NC6A 1CA0C 4LXBH 1SL3A 1NRSH 2KAIB 3RXKA 2BMGB 3SHCH 2PGQB 3OY5U 1GI7B 1T4VH 3RC5A 5EG4A 5A8ZA 3ESTA 3W94A 2P95A 2QYIA 3PYHA 3ENSB 3RMLH 1TPPA 1CT4E 1LTOA 2J2UA 3VEQB 1Y3UA 1Z1JA 1SGCA 3O8DA 5FX5A 1EXFA 3QZQA 1AGJA 1VJAU 1P2MA 5JBTA 1UTNA 2F9BH 2VVVA 2Q6DA 2XNIA 4GPGA 1ABIH 1QBVH 1YGCH 3LH1A 2FESH 5HM9A 1G2MA 3A82A 1MQ6A 3STJA 4XBCA 1EAUA 4OS7A 4CRAA 1GDUA 1O2WA 1UJ1A 3WY8A 1C5VA 4IMQA 1ID5H 5TJXA 3MU5A 4M7GA 4AGKA 4O3UA 2W3KA 3RXAA 2ZU4A 1SPJA 1O3AA 4HI3A 3V0XA 1BMLA 2XRCA 1Z7KA 3RP2A 1MZAA 1SGNE 3UOPA 1GJDB 1DPOA 3M61U 2FS9A 4JCNA 3P6ZB 4X0WU 2BTCE 1HB0B 1MBMA 1H4WA 4DURA 1K1NA 4U32A 2ZGBH 1N8OC 3TJVA 4RN6A 2BXTH 1MKXK 1XX9A 1D6RA 3M5NA 3K9XB 2BDAA 1CVWH 1JRTA 1ESAA 1K1LA 2QCYA 1P10A 1P06A 1HIAB 2O9QA 3I77A 1AD8H 3SNAA 1BTHH 2J94A 2G4UA 1ETRH 1A61H 4I8JA 1DUAA 3PB1E 2A4RA 2Z3CA 5ABWA 1NROH 5A0CA 1C1TA 3FVFB 5J4SA 1LVBA 1OSSA 4Y79A 3AASA 4A92A 1ZRKA 1DWCH 5E8EH 1BBRH 1A2CH 3KNXA 4Y10E 5AHGH 3BEUA 3T28A 1TNGA 2STAE 2YNAA 4I8HA 4NG9H 2SFAA 3DA9B 3ZVAA 2G51A 3RXUA 4X1QU 2VIPA 2ASUB 3PLBA 1TYNA 3A89A 3SU4A 4WXVA 2OC1A 3MFJA 5FPTA 1C1WH 2QGRA 4X6MA 1KYNA 3ZZAA 4X2VA 2GT7A 2G00A 1PFXC 2RDLA 2HLCA 1D9IA 2J92A 1XUGA 3GY3A 1W0YH 1OYTH 2A7JA 1JWTA 1O3FA 1QGFA 1O3HA 5JDUB 1G36A 5EW1H 3A8CA 2XWAA 1BRAA 1F2SE 4GAWA 1K1IA 1GI4A 1EJNA 1HJAC 2F3CE 1N8OB 5FCRA 2ZU3A 2WINI 3TH2H 1QHRB 1BHXB 3BTFE 4O97A 5A0BA 3UNSA 3NXPA 4AYYB 4AFSA 1G3BA 2A1DB 1UVTH 2M5TA 2Z7FE 2VIDA 3AVZA 1TGCA 2Z9GA 2VB0A 1DICA 1NM6A 1ZPCA 1YP9A 1IQJA 3TNSA 2NU1E 3BN9A 2IJOB 3K6ZA 1FY8E 3HGNA 3ZZBA 1O2IA 1GVZA 1ZSKA 1TNIA 4A5TS 1VITG 1UTMA 1TPOA 4FUCA 2PV9B 4NFEA 2F9UA 4ISOA 1HJ8A 4ABAA 3L3TA 1MD8A 2FXRA 4MPVA 1GBJA 1AVXA 2CN0H 4DOQA 1FN8A 1C5MD 1YBWA 2BYAX 1OP2A 2JH0D 4K8BA 3Q3KA 1ZZZA 1G37A 1SLXB 1OKXA 1Z8RA 3PLKA 5LH8A 2GCTB 1O32A 1HAYB 1BITA 2BDIA 2J4IA 1A5GH 4ASHA 4NGAH 2LNCA 1QRZA 1ELCA 1F7ZA 2FI4E 3NZIA 1KDQB 1TGTA 1F5KU 1KSNA 1O3LA 1CT0E 1O3KA 1YPEH 1KXBA 1VCWA 1HJAB 4AGJA 1QB9A 2ZFSA 2W3IA 1O3GA 1L1GA 4D7GA 4O3TA 1AMHA 1P3CA 1NN6A 1GBDA 1IQEA 1PPHE 1SQAA 5FCKA 3L33A 1IHTH 3BTQE 4MQAA 4X1NU 3LJJA 3TK5A 3QTOH 3ZVDA 3BEFB 1TOCB 2QIQA 4Q2KA 4UFGH 7LPRA 2ZHDA 4YT6H 1G2LA 1SR5C 3IWMA 1BRCE 2F9VA 1DT2A 1AUTC 1MTSA 3MU0A 2V3OH 3U8OH 2A5KA 2CHAC 1SFIA 3H7OA 3M5OA 2A4QA 4B73A 2D8WA 1IQNA 1EAIA 3MMGA 1MU6B 1T32A 1W0ZU 3PTBA 4IGDA 1S0RA 2A2QH 4NZLA 1V2ST 3B8JA 3E0PB 3LDXH 1TABE 3M7TA 1E0FD 5C2ZA 2OCVB 3E16B 1K1PA 1UTJA 3P92A 2VIOA 2AIPA 2C93B 1T8MA 4X6OA 3VGCB 1O30A 3RC6A 2BY6X 2OINA 1QA0A 3MH4A 1SLUB 2GMTC 3BV9B 1HDTH 2NU0E 2SGQE 3KQDA 1MKWH 5CMXH 2ANWA 3NCLA 2OP9A 1V2LT 3SW2B 4Q80A 1Z6EA 1MD7A 4ZH8A 4X8VH 4MG3A 4ZAEA 4TPYA 4HFPB 1Y59T 1O2JA 1EZSC 2BQ7B 3RXTA 1PPZA 5IYTA 3ODDA 1CO7E 4DGJA 2DE9A 1PQAA 1OWDA 2CF8H 2UUKB 1PYTC 1GMCG 4FU8A 1QJ6B 1ELBA 1DWDH 3SUEA 1GHBG 2QXIA 1BJVA 1C5XB 1CGIE 3M36A 3HATH 3A86A 1BCUH 4X8UH 2QXHA 1ACBE 1P11E 3RU4T 1OWEA 1L4ZA 4AFZA 5E2OA 4IC5A 1O2UA 3GY5A 4XFQA 4CHAC 3P8FA 4KP0A 2NU3E 4K1SA 4Y6DA 2G81E 2P3UB 3GY8A 3SV7A 3P8NA 2P3TB 3KIDU 7GCHF 3Q00A 1GGDB 1PPGE 1DFPA 2PTNA 5FPSA 1S6FA 1BZXE 2ZDKA