3VB6A

Crystal structure of sars-cov 3c-like protease with c6z
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb6A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb6A02
1YPMH 1PPGE 1AVXA 1ORFA 4ISNA 4AG1A 4ZUHA 3ZVCA 3O8CA 1KY9A 1P2OA 4I8GA 2ZHQH 1NO9H 1QBNA 3RMNH 2GZ7A 1F5KU 1XUJA 2VJ1A 3RXAA 4WF8A 3SU0A 3P92A 1JWTA 2QXGA 1SFIA 2JETC 1BMNH 3LONA 5DP6A 3S0NA 1AO5A 3VB5A 1HJAC 4BAQB 1S0RA 1C1PA 4A6LA 2B8OH 2Y5GA 4X2VA 1S81A 1OOKB 2D8WA 4Z6AH 5F6MA 1N6XA 2BMGB 1CQQA 1VITF 2VU8E 3F9GA 1GI3A 1CHOG 1A46H 1QRWA 6ESTA 1PPEE 1FMGA 2WUCA 4I33A 3ODFA 5C1YA 3TGIE 1ANEA 1LHEH 4RKJB 1QRXA 1O2OA 1O5CB 2P59A 1H4WA 3SU6A 3A8DA 1BTUA 1K1LA 3QO6A 3AASA 2AEIH 2UUYA 2W3KA 2Y5FA 1VJAU 1AD8H 1V2NT 1SGYE 2BDCA 4DT7B 1B7XB 1C5RA 1SI5H 3A7VA 1HXFH 1UK4A 1ZHRA 1QTFA 4DIHH 1B5GH 1O2WA 4ZH8A 5L2ZH 1E38B 2OC0A 1GHAG 1XXDA 4BAHB 5DJ7A 4JZDH 1EKBB 1RS0A 3Q3YA 5EQQA 5DK1A 1ABJH 1GCTC 1DICA 3GCTG 1SQAA 4MNXA 4WVPE 4A1VA 4IBLH 2A7JA 4NZLA 1QB6A 3TNTA 2AIQA 3A88A 1D3DB 1YP9A 4ABHA 4A7IB 1RIWC 3OX7U 2FI5E 4Y79A 4ZKNU 1SHHB 2QN5T 4VGCC 1GJ6A 3SNBA 1AE5A 3BEFB 1GBFA 3QGJA 4LK4A 1GBCA 9ESTA 3RXQA 2BY5X 2VIOA 1SSXA 5TJXA 1GHVH 3SNDA 1NPMA 5BRRE 2RCEA 4Q7XA 2Y80A 1ZMJA 4CRDA 1O3PB 3A7WA 2G4TA 3E8LA 4ABBA 1RD3B 3NUMA 1HCGA 1XUKA 2FXRA 1W0YH 3U98H 3LDXH 2ZTXA 3BV9B 1MZAA 4NIYA 1AB9C 3ZVAA 2Z9LA 1UVOA 1FY3A 1C9PA 2WV4A 1P10A 2O8LA 1MKWH 2J2UA 3RXJA 1C2KA 1BRUP 1J15A 2ZEBA 1F7ZA 1J17T 4UONA 5DKMA 4UD9H 5EPYA 1LTOA 5CE1A 3RXTA 1VGCC 3SUEA 3FP8E 1NM6A 4IMZA 5HGGA 3K2UA 2HNTF 1AGJA 1H9LB 1O3IA 2BLOA 3A80A 4FUGA 2R2WU 3HATH 3RXLA 1F92A 2Z9GA 1HAGE 3PMAB 3U9AH 5CMXH 1EPTA 1Z6JH 1OXGA 4OGYA 1F5LA 2B7DH 1MAXA 2ILNA 4K8YA 4TY6A 4Z0KA 1J16A 1MKXK 1NESE 4JCNA 4TWWA 1NFYA 2H5CA 2UUFB 2FESH 1KLTA 3HK6B 1J14A 1Z8RA 2PKSB 4K3JA 1O2UA 3BG4B 3ZV9A 1FY1A 2OC1A 1C2GA 1O2SA 1DWCH 2UWOA 1Y3YA 3ATLA 1W2KH 2GP9B 3ZVBA 1OP8A 1LKBA 2XNIA 4GAWA 3SGQE 3LC5A 2ZDAH 3W94A 1TPAE 4MPVA 4AFQA 4NSYA 2G4UA 2NU4E 4UFFH 3DT0H 1CT0E 4X2XA 1P0SH 2Q6GA 2VVVA 4FUCA 3MU8A 2ULLA 1ACBE 1N1LA 2A7CA 2ZIQH 4ABDA 1ARCA 1T32A 4GCHG 1TQ7B 1TMUH 4VGCB 3F9EA 3SNCA 4I8LA 7LPRA 1B0EA 1WV7H 1UHBA 3BG8A 1O3HA 2TGTA 3SUFA 4HFPB 2CHAC 2VINA 2VIWA 2ZDKA 1KTTB 1HJ8A 1C5TA 2RG3A 1SGIB 3KCGH 2FDAA 1GHWH 3VGCB 1FLEE 1HAHH 1NU9A 1O3GA 3TK6A 2FLRH 4JYTA 4AYYB 3P8NA 3GCOA 1K1IA 1O2XA 3SO3A 4HZHA 3ZYEA 1EASA 3QK1A 1GDUA 1DUAA 1LMWB 4IC5A 3N7OA 1UTMA 1JRSA 4F49A 1YPLH 3CS7A 4MNWA 3ZZ6A 1W13U 3RC5A 4YLUA 2F9NA 1QA7A 1HFDA 4THNH 1MTNB 2J95A 3MNCA 4WJG2 3RC4A 3PYHA 1L1JA 1G2LA 1GMDG 5FX6A 5EXMA 4AFZA 3OTJE 2G55A 3FZDA 1FPHH 3UR9A 5C20A 3GY7A 2H2ZA 1N6YA 3TJVA 1BRAA 3LGTA 2A45B 5I46H 4GCHF 3I29A 1L2EA 4M7GA 3GY5A 4JYUH 1EPTC 3T62A 2AYWA 3U1JB 1ZJDA 4AYVB 2HGTH 1O2MA 1G2MA 1X7AC 2BVXH 2XC0A 1MCTA 1TRNA 1EZXC 5C5NA 2A4RA 1TNGA 2C90B 4LOYH 3M5LA 1YPHE 1AFEH 1CA0C 3U69H 1O3OA 2FOGA 3ZZ4A 2P3TB 3BTHE 1AQ7A 1T8NA 3M36A 1QJ7B 3RU4T 1GHBF 4JZFH 1BHXB 1Z71A 4FUHA 4ABIA 2CHAB 1D4PB 2ZFSA 3W95A 3EA9A 1C5YB 4FUDA 8GCHF 1YPKH 4Q7ZA 3MU4A 2SNWA 1H8IH 5GCHG 3Q3XA 5L6NH 2JKHA 1KXEA 3LGWA 5LPRA 1XMNB 2BLQA 3RXOA 3TNSA 3MO3A 3JZ2B 3BIUH 5C67A 5E2PA 1TBZH 1LPGB 5A8XA 4HI3A 1BIOA 1GVZA 1GMHG 5T6FA 5EXLA 3VXFH 3Q00A 3A8AA 1QA0A 3BIVH 4MNYA 3AW1A 2J92A 2PW8H 1BA8B 1ELCA 2G5NA 1ARBA 1FDPA 3UPEA 3UQOA 4D9RA 4I8KA 3OY6U 1SL3A 4ZXYH 1L4ZA 2TPIZ 2O8TA 1UTPA 3M7QA 1C2MA 1FIWA 1QQUA 1SR5C 2QC2A 4IS5A 2G81E 3BTFE 1XVOA 1S85A 3ZVEA 1DPOA 3KEEA 3M35A 3PB1E 5EPNA 1AIXH 1MD7A 1QBVH 4JMYA 1K22H 1DANH 5LH8A 1WOFA 1UK3A 2F9UA 2VIVA 4BAKB 3SW2B 4U01A 1FJSA 3P6ZB 1C1UH 2BDHA 1Q2WA 1NRPH 4XOJA 3QUMP 2Y5HA 1ZHMA 2OUAA 2Y82A 1K1PA 4Y8XA 1TNIA 1CBWB 4WMDA 1GBDA 2XBVA 4BTTB 4Y76A 2IN2A 2EC9H 1A5IA 4BNRA 1BMMH 3A85A 1Q3XA 2UWLA 1AU8A 1A0HB 3KIDU 5EXNA 3QTVH 3GCHB 2FMJA 2ZFTA 1HYLA 3E16B 1KXAA 3EYDA 1TYNA 2G5VA 3WY8A 1SGQE 1C1SA 1DXWA 4IC6A 3CS0A 2PUXB 1K1MA 3E91A 2ODYB 1SQTA 4TWYA 2R3YA 2F91A 4UEHH 2PSXA 3SGBE 4E7NA 1MCVA 1AFQB 3KQCA 2BY9X 1DUEA 3BEIB 3V0XA 1PPHE 2EI7A 1Z7KA 4K1SA 1O3AA 2YNBA 2G52A 4CH8B 2A4GA 1YLDA 1MUEB 1TWXB 3KQBA 4YESB 2OBOA 3VFEA 2VVUA 4MQAA 4AGKA 1W10U 3GCNA 3P8FA 2AMPA 4JYVH 1Q31A 2HRVA 1MH0A 2ZKSA 5E0JA 1O35A 2D2DA 3BTWE 5AVDA 1HGTH 5FCRA 1P2KA 1P2NA 4OGXA 1FY8E 3TK9A 4O9VA 4OS1A 1TGCA 2BD5A 3RXGA 3RXIA 1H9HE 1DWDH 1C2HA 1EOJA 3M5MA 1V2JT 2HVXA 1FN8A 3PLBA 5GIBA 3BTDE 1YGCH 4ISHH 2QV1A 1V2UT 7GCHF 1LHCH 1CGJE 2P8OB 3RUOA 1A0JA 6CHAB 1P01A 4XE4A 1O2QA 3VB6A 4X8UH 4UFGH 1G32B 2ZCHP 3EA7A 3C27B 3RC6A 2ZGJA 2D26C 3KHVA 1OP0A 1JOUB 3HGNA 1EB2A 1TONA 3MNSA 4E05H 4KP0A 4DGJA 1BCUH 4ZHAA 1TX8A 3PV4A 5E0GA 4B2AA 4WMFA 5IYTA 1QCPA 8KME2 3BG4C 3UNRA 3MU0A 1EJAA 1GWAA 1PQ5A 1G9IE 2FTMA 1ZSJA 3A84A 2O8UA 2ZP0H 1O3CA 2HLCA 1GMHF 1TOMH 4K2YA 2ZWLH 3RXDA 1WTHD 1CVWH 2WYGA 1HAYB 1PQAA 1ELDE 4A5TS 3IG6B 1C2DA 2SGEE 3T28A 2G51A 1YPJH 1YLCA 1PFXC 4ESTE 1LHDH 4BTUB 2Z7FE 1A5HA 2C4FH 1RXPA 3TU7H 1P2QA 1GI8B 1AZZA 4NSVA 3EBNA 2AGGX 4OS4A 2XBWA 2A32A 1UO6A 4Y7AA 2XC4A 3PMJA 1C2JA 1TNLA 2IPHA 1ANDA 1AVWA 5JB8S 3HKIB 2V6NA 1BTWA 1GBTA 3VEQB 5C5OA 1IQHA 1A4WH 1A2CH 1G30B 2ZFQH 2PHBA 2XC5A 4GSOA 1EATA 1GHAF 2VGCB 4JZEH 4CRGA 3QWCH 1Z8IB 3A7YA 2FI3E 1ZMLA 4AFSA 1XUHA 5F8ZA 1YPHC 2ANWA 4R0IA 1Y8TA 4INKA 1NT1A 1ABIH 1C5WB 3LIWA 2AIPA 1MKWK 3SV7A 3QN7A 1NY22 1V2OT 1LVOA 1C5UA 1BTXA 3Q76A 1EJMA 3NPSA 1VCWA 4ZHLU 5TCAA 3LJOA 5E8EH 3ITIA 3ZVDA 4CREA 1GJBB 1QURH 4B73A 1OP2A 1SLXB 2H5DA 4D9QA 5AF9H 3OY5U 1Z8JB 1PPCE 2JH0D 2QXJA 4MLFB 3UNSA 1SB1H 2J38A 1V2ST 3SZNA 2Y81A 1GMCF 4B76A 3PTNA 3MH7A 1C5ZB 1LVMA 5LPEA 3ATMA 1NS3A 1WTGH 1HB0B 5EOKA 3UFAA 3LH1A 1DSTA 4X6MA 1W0ZU 1XUFA 2ZFRH 1C5NH 1LHFH 4NFEA 1RRKA 2C8ZB 2UUJB 3K65B 3EDXB 3ZZBA 3DUXH 2GZ8A 1TPPA 2A1DB 2FLBH 3QGNB 3T27A 1SGDE 2UWPA 1UTJA 3DFLA 4BANB 4U2WA 2F9OA 3KF2A 1BBRK 2Q1JA 2LPRA 1Y3WA 3SU5A 3ATIA 1W3CA 2ZU5A 3E1XB 1A3BH 1WU1A 1TNJA 3T2NA 1QL9A 2FWWA 3A8CA 8GCHG 1GBJA 2H1UA 1C4Y2 3ZZ3A 4NGAH 4ABGA 1T7CA 3SJ8A 2A5KA 2WV5A 5EQSA 4X8TH 1CGIE 2C8YB 4NFFA 4MPUA 1C5OH 1BDAA 1GBKA 4NWLA 5L30H 3F9FA 2ALVA 1ZLRA 1F2SE 1PPBH 2VWLA 2VB0A 2H9EH 2Y7ZA 2RA3A 2HNTE 2GKVE 1YKTA 3E6PH 1YPGH 4FXGH 3LPRA 1IQJA 1TX6A 2ZDVH 5ESTE 1GI9B 1O2TA 3V13A 1GBHA 1SG8B 3NK8A 1G3BA 4FU9A 3B8JA 3F68H 2UUKB 3JZ1B 2Z3DA 1OWJA 1ELEE 4TPYA 5DP8A 5C2ZA 3B9FH 3A89A 1AY6H 2PV9B 4GHQA 1L0ZA 4BAMB 2SGPE 1AUJA 3SBKA 1LDTT 3T25A 3RXRA 2XTTB 1INCA 1EP5A 2BOHB 1TLDA 4E7RG 2NWNA 3STJA 5K7RA 2PKAA 5K0HA 3GCHC 5DG6A 1KIGH 2CGAA 1GPZA 3IWMA 2B5TB 2GMTC 5E0HA 4U30A 2A2XH 2R3UA 4JK6A 1XM1A 5EGMA 4H42U 4AGJA 3BN9A 3IITA 3PWBA 4YO9A 1DE7H 1SGEE 4DVAU 1KDQA 3BTEE 3RXCA 2VIDA 1O2LA 4KTUA 4FUEA 1BQYA 1C5PA 1H8DH 3GY8A 3U8RH 2VH6A 3MFJA 1WQVH 2OC8A 2ZF0H 2BD2A 5HXFA 2H9TH 3GYLB 2WPHS 1WAYB 5TCCA 1SPJA 2Q6DA 7GCHG 2BQ7B 3MYWA 3CP7A 3GY3A 1N8OB 4FVBA 2A4QA 2BDBA 1N8OC 4FUJA 4B1TA 3TJUA 2ZU4A 4BXWA 2LIZA 1ZMNA 1EZSC 3SQHE 4AG2A 3TK5A 4WWYA 1FIZA 4CBOA 1HAOH 3FFGA 1GJDB 1C5XB 1HJAB 1AKSA 1AE8H 5F03A 1O2ZA 4JK5A 1XUIA 2OTVA 1AWHB 1IQMA 3SNEA 1ESTA 1VR1H 1XKAC 4O03A 3TH4H 2HOBA 1AI8H 3LU9B 1O0DH 3D23A 3K6ZA 1FXYA 4DURA 3LGYA 3I78A 2BX3A 1OS8A 3T5FH 1IQLA 1ELVA 1P57B 3LKWA 1P3CA 2GCTB 3ESTA 1KXCA 2TIOA 1CBWC 2W5EA 1DWEH 4GLYA 1QB1A 4NCYA 1DLEA 3GICB 1Y3UA 1TRMA 2G8TA 3OU0A 2GGVB 2OQ5A 4Y6DA 2Q6FA 4WY3A 1GBAA 4AB8A 1V2MT 1A5GH 1O3NA 3SV6A 2ODQA 1FQ3A 2VIPA 4KTCA 1GBLA 3Q77A 1QY6A 4ISOA 5FCKA 1AWFH 1NTPA 2TBSA 2FS8A 1IHSH 1JIRA 1O2YA 2BQWB 2FS9A 1MTUA 4O3UA 1E37B 1SGFA 1G3CA 2A7HA 1EXFA 2VWNA 3KGPA 1GHBG 1KLIH 1OPHB 4D7FA 3ATWA 1V3XA 1ZPZA 1BMLA 2VH0A 2PTCE 2ZQ2A 1S84A 1P05A 2QXHA 1TGSZ 2G00A 1GJ9B 1MZDA 1TA2A 1EAWA 2C8XB 2GCTC 4NG9H 2BVRH 5FBEA 1K1NA 1KLJH 2FYRA 2PLXA 1UCYK 5DPAA 3MU1A 4CRAA 3BTME 3SUGA 1ZRKA 1UVSH 1GBEA 1O5AB 2HWLB 3KQEA 1DWBH 2OINA 1C1MA 2FOMB 1Z8GA 3F9HA 1CA8B 5SGAE 1P9UA 1AMHA 1UMAH 4CRBA 1YCPM 1O3DA 1UCYE 2XRCA 2AGEX 1PYTD 1EP6A 1Z6EA 1QNJA 1SLWB 2BVSH 2D1JA 1V2QT 3V7TA 1DOJA 1C4U2 2FOBA 3SN8A 4DIIH 1Y5BT 1HPGA 2K1QA 2Y7XA 2ZNKH 1O3MA 2GZ9A 1A0LA 3SV9A 3Q3KA 4WH6A 3PTBA 1TGNA 5LGOA 4I31A 2FOAA 2FX6A 2AMDA 1K1OA 1AZ8A 1O2GH 1O31A 2JETB 3MNBA 5EQRA 1ETSH 3M61U 4GVUA 3UREA 1C5SA 7ESTE 2FYQA 1C4V2 3TJNA 1EQ9A 2ZFFH 2ZGXH 4A1XA 2QCYA 1TGBA 3BTTE 3S9CA 3SU3A 1RIWB 2OXSA 2ZZUH 1QQ4A 2GDEH 3M3VA 1NROH 3VB3A 3RLWH 5A8YA 3BTQE 4ZXXH 5EW2H 1OKXA 1ELFA 1GI4A 4ZKRU 1AKSB 1P9SA 3F6UH 1UVTH 1TFXA 2ZDMA 1S6FA 2BY7X 3RXPA 5FPSA 1VCQA 2F83A 4CRCA 3VGCC 1EJNA 4MNVA 3EGKH 1TBQH 1IHTH 1A1RA 4LZ4B 4X8SH 4Y71A 3PLPA 1MD8A 1G36A 1G37A 1MQ5A 2BDIA 2I6QA 2DE9A 3SV2H 1GGDC 3GDVA 1L1NA 1MAYA 1DDJA 3T29A 1T8OA 2AFQB 1ELTA 3L33A 1H1BA 3H7OA 1CHGA 2FIRH 2O8WA 3V3MA 2VIQA 4E06H 1C5LH 1VZQH 1RTLA 1O5FH 4DOQA 5C1XA 2OCVB 1D3QB 1LPKB 1UVPA 3BSQA 1JBUH 2QF0A 1BBRE 1W8BH 2FM2A 2A0QB 3NKKA 1F0RA 1OWKA 4TY7A 1QHRB 1V2RT 2BZ6H 2ZPSA 3AAVA 1PPZA 4X1RU 2SGDE 1SMFE 1GVLA 2CMYA 1S82A 3RLYH 3PLKA 1A7SA 2SGFE 1ZYOA 1UVUH 3GY6A 5ABWA 5H4IB 1C2IA 4CHAC 1GDNA 3NCLA 2QIQA 3QX5H 4FUBA 1SVPA 2A31A 2EEKA 2HPPH 3HK3B 1K1JA 2ANKH 3C1KA 4BTIB 5DP9A 5GXPA 2GT7A 4FU8A 4MVNA 2KAIB 3H5CB 3HPTB 2RDLA 2I6SA 2GX4A 1W14U 2BD9A 3GY2A 1FI8A 3A83A 1QFKH 3STIA 2V3OH 1SBWA 1LCYA 1CE5A 2BOKA 5T6DA 1AN1E 2TGAA 1W11U 2LNCA 5B6OA 2J94A 1M9UA 1HAVB 4Y8YA 1TBRH 1ZPBA 1GCDA 1GHYH 5EW1H 4IN2A 1O2RA 1T8LA 1C1WH 3ZZ9A 2Z6BD 1SQOA 4Y11E 2BY8X 5FAHA 2BD4A 1SGPE 1DLKB 1THRH 5FPTA 2J4IA 2BM2A 1AFQC 1WQSA 4ISIH 4ZHMU 1OX1A 1ZHPA 1ANBA 3PWCA 2ESTE 5GPIB 4K60A 1C1OA 1O3EA 1DX5M 3GDSA 1Z1JA 1UTNA 1U6QA 1DVAH 4F4OC 3PROA 3TJOA 1F0TA 1OYTH 1VGCB 2STBE 4ZROA 5JDUB 2BHGA 2SGAA 1W7XH 4JZ1A 5G4BA 1SGNE 1V2WT 1C9TA 1YC0A 1ELGA 2W3IA 4WXVA 1EX3A 1TAWA 2C3SA 3BF6H 1Y5AT 1ZRBA 3ZZ5A 2WUBA 3SJ9A 2WPKS 4YOIA 4UDWH 2ZU1A 1KXFA 2OD3B 4H4FA 3RMMH 1NRNH 3DD2H 4K1EA 4NIXA 1MQ6A 2AERH 2FOCA 1KDQB 1CU1A 2F9VA 1CO7E 2BD8A 2VGCC 2BD7A 3SOSA 1O37A 1UTOA 1ZJKA 1UHBB 2ZTZA 2GCHF 3SGAE 3PMHB 2PKAB 3AW0A 4B74A 5HM9A 5DO4H 2V35A 3TH2H 1LQEA 4YTAA 3SNAA 1GL0E 2QYIA 4MG3A 4MDSA 1QJ1B 1O5BB 3DFJA 3QLPH 3MH5A 3NWUA 4Q2KA 1GJCB 2TRMA 1RFNA 2ZGBH 1QL8A 3BTGE 3UY9A 5C3NA 3SJOA 1JXPA 2O9QA 1MTWA 2ZHFH 1GVKB 1RJXB 2WPMS 2CXVA 1GHXH 1VCPA 1ETTH 3TGJE 3RM0H 4GUXA 1HAZB 3PMBB 1AB9B 2R2MB 1SGCA 1UTLM 1F0SA 1D9IA 3MH6A 1O5DH 1BT7A 1E0FD 1ZTJA 4CHAB 2A5IA 2P3FH 1TRYA 5ESBA 1C1NA 5GDSH 3S9AA 2QXIA 2KAIA 2FODA 1CSOE 3BEUA 1A3EH 2PUQH 2A4OA 2H6MA 1NFXA 1DY9A 3UOUA 2ZC9H 3TH3H 2YOLA 2AS9A 1RTKA 1MTSA 5IDKA 5A0AE 3TPIZ 1EAUA 5PTPA 5E2OA 4B2BA 1ESBA 2BTCE 4YZUA 5DP5A 1OYQA 4ZMAH 1NC6A 2R0KA 3E3TA 2GVFA 1LPZB 3KQDA 4D76A 1C1TA 3M3TA 4IW4E 1DSUA 1O39A 5JYIA 3M3SA 1FNIA 1OWHA 2FP7B 3U8OH 3A7ZA 3UIRA 1NRRH 2TGPZ 2XCNA 3UWIA 4CH2B 2ZHWH 1BTYA 1Y3XA 3KNXA 2ZU2A 2AH4X 4Q80A 5AFYH 2B9LA 1IQNA 4BAOB 2GTBA 4RKOB 2O8MA 1A61H 3SU1A 3KL6A 1XVMA 1D6WA 1S0QA 1IOEA 1QR3E 2JH5D 3KN2A 2K7XA 2PGQB 2ZI2H 1GJ8B 1TB6H 3NZIA 3TLOA 1YPEH 3D65E 2PSYA 4XFQA 1P2MA 1SHYA 2SGQE 4YT6H 1O3KA 3MU5A 2P16A 1BTPA 2BZAA 3RXUA 3RMLH 5JBTA 4SGBE 1KXDA 3FVFB 4B71A 1UTKA 4BXSA 4MPXA 1S5SA 1ZGVA 4X1PU 1GI1A 2QA9E 2XW9A 1K9OE 4X6OA 1HAPH 3ZZAA 1T4UH 1KTSB 2A2QH 1ZSKA 2F9PA 5GCHF 5I25A 1SGFG 2FX4A 4OS2A 3R3GB 3V12A 2PKSC 1GBBA 3UQVA 1O33A 3ZV8A 1XX9A 1MTVA 2ZFPH 3A82A 1FONA 3QTOH 1ELBA 1O2IA 1FY5A 1HLTH 3OYPA 1LO6A 5A09A 2IJOB 1TABE 1D6RA 3OSYA 1PQ7A 4ZKSU 4UE7H 4R8TB 1MBMA 2BXTH 1YCPK 2ALPA 2ANMH 1FV9A 2Y6TA 1HBTH 3SQEE 1SGRE 4IGDA 4PROA 1D3TB 3RXFA 2XBYA 3O8BA 1TALA 4FUIA 4KKDA 1Y5UT 1ANCA 1HJ9A 4QT8C 4YLQH 3GYMA 1C5MD 1C2FA 1D3PB 3SU2A 3ZZCA 5T6GA 4X2WA 2P3UB 1YM0A 2GDDA 4WH8A 3LT3A 1AHTH 2WPIS 1S6HA 2J9NA 4D7GA 4DCDA 1T4VH 1Y59T 4NIVA 1THPB 1XUGA 1C5VA 2QGRA 1BRBE 4A1TA 1ESAA 3P8GA 1TMTH 4AOQA 2ZDNA 5JBBS 2CF8H 3RXBA 5EG4A 2F9BH 2SFAA 1EAXA 3SV8A 1ZTKA 3D62A 1ZR0A 3H7TA 2OBQA 5FXLA 1GDQA 1GI2A 2B0FA 1O5GH 1UJ1A 3GCTF 4WMEA 1F0UA 1CT4E 1FAKH 1O2JA 4MTBA 1AVGH 1VITG 1P12E 2NU1E 2OP9A 4AORA 5HM2A 5EU8A 1ELAA 1FPCH 3MWIU 1P02A 1HIAA 5F8TA 1GBIA 3MOCA 4CBNA 1BJUA 2CF9H 2EI8A 1ZPCA 1YCPH 2VVCA 1K28D 1LVYA 2GCHG 1LQDB 3E0NB 2PTNA 2R0LA 1C1VH 1HAVA 2FPZA 2ZG0H 4I8HA 3SJKA 3K6YA 4X2YA 1QJ6B 4TYDA 3SORA 2BDGA 1TIOA 1RTFB 4X6NA 4O3TA 1TNHA 4DW2U 1OSSA 2V3HH 1K21H 2BYAX 1CT2E 4NA7A 4ZKOU 1TE0A 4YOJA 1O32A 4OS6A 3PO1C 4Y10E 2FOEA 2QY0B 1JIMA 4H6SB 3VXEH 7KMEH 3PO1B 2FOHA 4K5ZA 1UCYH 2P95A 2YNAA 4NA9H 2H9HA 3M7UA 1IQKA 2STAE 4NA8A 1HIAB 2EA3A 5ETXA 5A2MH 3RM2H 3A7TA 1F5RA 1UK2A 1GG6B 1YF4A 2HPQH 2XWBI 4INLA 1BMAA 3M37A 1MBQA 2EI6A 2ZGHA 1RGQA 3RXVA 2AGIX 1HXEH 1KXBA 5J4SA 2BQ6B 3MI4A 4I8JA 5DGJA 1O3FA 3ZZ7A 3A7XA 1UTQA 3MNXA 4SGAE 3RDZA 2WPLS 1O5EH 3S7HB 1DY8A 2FZZA 2WPJS 3FAOA 1OWDA 1O38A 1QBOA 2F3CE 1P09A 1NFUA 3G01A 5JBCS 2NU0E 4AB9A 1GMCG 2GT8A 2OLGA 2BLWA 3RXMA 3TITA 4TPIZ 2ZHDA 3TVJB 1SLVB 3ZVFA 1QL7A 2CV3A 1FY4A 1ZOMA 1O36A 3ENSB 2BLVA 1SGTA 4HTCH 2HALA 2QF3A 3HKJB 3D49H 2BDAA 1IQEA 1O30A 2Z3CA 1AUTC 1S83A 2GV7A 3VPKA 4RN6A 2GV6A 2CJIA 1GI7B 3AAUA 1O2PA 1J8AA 1IAUA 1L4DA 1IQGA 1T31A 3PM3A 5BPEA 1P04A 3SHAH 1W12U 2R9PA 4X1NU 2XBXA 1DXPA 3RXSA 8ESTE 1BTHH 1V2VT 4HGCA 4ABFA 5FX5A 1SOTA 2XCFA 3LOXA 1EZQA 3VB7A 1FAXA 2BXUH 3M5OA 3R0FA 1GG6C 4U32A 1WSSH 2JH6D 5F8XA 1BZXE 1P2JA 2ODPA 1SFQB 3SU4A 1WCZA 3MMGA 1O2HA 3SJIA 4K1TA 2FO9A 4XBBA 2ZGCA 3BTKE 1T8MA 4ABAA 1LVBA 1P06A 2FOFA 1GI6A 2ZCKP 2W26A 1QGFA 1HNEE 1E35B 3QDZB 2ZCLP 5A8ZA 1SOZA 3A87A 4AX9H 1HV7A 4XBCA 1HAIH 1SLUB 2PFEA 1QIXB 3MO6A 3M5NA 3URCA 1ETRH 5A0CA 1ZSLA 3RP2A 1DFPA 1GMDF 2NU3E 1QB9A 1O2VA 2ZHEH 1BBRH 4FU7A 5JB9S 1EB1H 4H6TA 3UTUH 1NFWA 4X1SU 3RMOH 1V2TT 4Y0YE 1NN6A 1FUJA 4KGAA 1BJVA 2GD4B 3B23B 3UOPA 4ZAEA 1O34A 3AVZA 4AN7A 5HYOA 5GWZA 1C5QA 1GCTB 2DUCA 1DS2E 1NZQH 2ZECA 1YYY1 3A86A 4NIWA 1V2KT 1ZTLA 1JMOH 2P94A 5DP4A 2P8OC 6CHAC 2ANYA 3ELAH 1EPTB 3MH4A 2A5AA 2ZO3H 2BY6X 5C1UA 3UWJH 2FEQH 2VWOA 1C1RA 1EAIA 2DE8A 4WXIA 2TGDA 3RU4D 1GJ4H 3NXPA 3P70B 3GY4A 2ZPRA 1TNKA 2FI4E 4ISLA 1DITH 1QRZA 1SC8U 3ATKA 1OWEA 3MO9A 2ZPQA 1PPFE 4OS7A 1MTNC 1Y3VA 4B2CA 1BOQA 1HUTH 4YM9A 3SI3H 3LGIA 4LXBH 6LPRA 2ZTYA 4X0WU 4Q7YA 1G3DA 1J9CH 9LPRA 1E34B 1BTZA 2CN0H 1WYKA 4X6PA 5J4QA 3ZZDA 2W7UA 1TPOA 4XBDA 3T26A 2XWAA 4I32A 1GL1A 1TPSA 1VITH 6GCHF 3P95A 1C1QA 3SHCH 1P2IA 1GBMA 3QZQA 2XXLA 3RXKA 4DJZB 1THSH 1NU7B 4GHTA 5LPFA 4A92A 2Z9JA 4J1YA 1JRTA 1PJPA 4Y8ZA 2SNVA 8LPRA 4AFUA 1CHOF 1L1GA 3EAJA 1V2LT 4JZIA 5GJ4B 4BOHA 1FZZA 3S7KB 3TIUA 4FVDA 1C2EA 3EE0B 3E0PB 3LC3A 4KELA 3LH3A 3S69A 3S9BA 1EUFA 4NWKA 3SI4H 2BD3A 1PYTC 4D8NA 1KSNA 1DM4B 3EA8A 3ZZ8A 3FZZA 1K2I1 3FANA 4X8VH 1P11E 3K9XB 3F1SB 5JPMH 1IQIA 1EOLA 2VNTA 1O2KA 2OC7A 3A81A 3ZYDA 2BX4A 2OQUA 2WYJA 3M7TA 2PGBB 3UUZA 1TOCB 3HGPA 1V6DA 1WBGB 3LGUA 3O8DA 3P17H 1CA0B 1C2LA 3ZVGA 3L3TA 4KTSA 5FBIA 4O97A 3RXEA 3A8BA 1XKBC 5T3HA 3ODDA 1MKXH 1NRSH 3VB4A 1GHZA 3MHWU 3EQ0H 4Y0ZE 3P8OA 1WUNH 5CHAB 4AZ2B 1E36B 1MU6B 1P03A 1BB0B 1HAXB 5DP3A 1ZGIA 3U8TH 2C93B 4RSPA 1CGHA 1XXFA 2Z9KA 1ID5H 3DHKH 4INHA 5AHGH 1EZUC 5A0BA 3LGVA 5DP7A 4I7YH 1NRQH 1GI0A 4XDEA 3GDUA 3DA9B 2P93A 2ZA5A 3RXHA 1LHGH 2VWMA 1HRTH 4ABEA 4CRFA 4YOGA 1KYNA 2BDYA 5JBAS 1MU8B 4IMQA 1TQ0B 1W7GH 4CR9A 4Y7BA 1FN6A 2FTLE 3UR6A 1BHXF 3SUDA 1OWIA 3FP7E 2ASUB 3URDA 2THFB 3RU4E 4MPWA 1GJ5H 4ABJA 3LJJA 4K69A 2NU2E 3FP6E 3U1IB 1P8VC 2ZQ1A 5EODA 2QAAA 4XSKU 4OS5A 1GJAB 2AMQA 1IQFA 4X1QU 2ZU3A 3GISB 1P3EA 2BB4A 2Z9IA 1DT2A 1GGDB 1H9IE 3UNQA 4YT7H 1G3EA 3GOVB 4GPGA 5AFZH 2PR3A 1GI5A 3I77A 1O3LA 3CENA 3E90B 1YBWA 1LKAA 2C8WB 1Z1IA 2HNTC 4NZQA 2IOTA 5CHAC 5L2YH 3O8RA 4FUFA 2M5TA 2WINI 5FPYA 1O2NA 1VJ9U 2J34A 2ZDLA 4UFDH 5FHTA 1O3BA 1TMBH 1B0FA 2PWXA 4B75A 1BUIA 1BITA 1TA6A 2W7SA 1TX7A 4CR5A 4ASHA 1HDTH 4K8BA 4LZ1H 1ZZZA 3MTYA 5HMAA 6GCHG 2RA0A 1O3JA 4DG4A 1V2PT 2Z94A 2XYAA 2V0BA 1PQ8A 3TGKE 3QZRA 2GMTB 3L6PA 1MMJN 1TGTA 4J2YB 1GJ7B 4IN1A 1BRCE 2Z3EA 4UFEH 4DY7B
chains in the Genus database with same CATH superfamily
1YPMH 1PPGE 1AVXA 1ORFA 2K0QA 4ISNA 4ZUHA 3ZVCA 4AG1A 3O8CA 1KY9A 1P2OA 4I8GA 2ZHQH 1NO9H 3DSPA 1QBNA 3RMNH 2GZ7A 1F5KU 1XUJA 2F4LA 2VJ1A 3RXAA 4WF8A 3SU0A 3P92A 1JWTA 2JETC 1SFIA 2QXGA 1BMNH 3LONA 5DP6A 3S0NA 1AO5A 3VB5A 1HJAC 4BAQB 1S0RA 1C1PA 4A6LA 2B8OH 2Y5GA 2EQNA 4X2VA 1S81A 1OOKB 2D8WA 4Z6AH 5F6MA 1N6XA 2BMGB 1CQQA 1VITF 2VU8E 3F9GA 1GI3A 1CHOG 1A46H 1QRWA 6ESTA 1PPEE 1FMGA 2WUCA 4I33A 3ODFA 5C1YA 3TGIE 1ANEA 1LHEH 4RKJB 1QRXA 1O2OA 1O5CB 2P59A 1H4WA 3SU6A 3A8DA 1BTUA 1K1LA 3QO6A 3AASA 2AEIH 2UUYA 2W3KA 2Y5FA 1VJAU 1AD8H 5C0TA 1V2NT 1SGYE 2BDCA 4DT7B 1B7XB 1C5RA 1SI5H 3A7VA 2WHXA 1HXFH 1UK4A 2EY4C 1ZHRA 1QTFA 4DIHH 1B5GH 1O2WA 4ZH8A 5L2ZH 1E38B 1UW7A 2OC0A 1GHAG 1XXDA 4BAHB 5DJ7A 4JZDH 1EKBB 1RS0A 3Q3YA 5EQQA 5DK1A 1ABJH 1GCTC 1DICA 3GCTG 1SQAA 4MNXA 4WVPE 4A1VA 4IBLH 2A7JA 4NZLA 1QB6A 3TNTA 2AIQA 3A88A 1D3DB 1YP9A 4ABHA 4A7IB 1RIWC 3OX7U 2FI5E 4Y79A 4ZKNU 1SHHB 2QN5T 4VGCC 1GJ6A 3SNBA 1AE5A 2KCAA 3BEFB 1GBFA 3QGJA 4LK4A 1E79D 1GBCA 9ESTA 3RXQA 2BY5X 4ACAA 2VIOA 1SSXA 5TJXA 1GHVH 3SNDA 2F43B 1NPMA 5BRRE 2RCEA 4Q7XA 2Y80A 1ZMJA 4CRDA 1O3PB 3A7WA 2G4TA 3E8LA 4ABBA 1RD3B 3NUMA 1HCGA 1XUKA 2FXRA 1W0YH 3U98H 3LDXH 2ZTXA 3BV9B 1MZAA 4NIYA 1AB9C 3ZVAA 2Z9LA 2YMSB 1UVOA 1FY3A 1C9PA 2WV4A 1P10A 2O8LA 1MKWH 2J2UA 3RXJA 1C2KA 2KX4A 1BRUP 1J15A 2ZEBA 1F7ZA 1J17T 4UONA 5DKMA 4UD9H 5EPYA 1LTOA 5CE1A 3RXTA 1VGCC 3SUEA 3FP8E 1NM6A 4IMZA 5HGGA 3K2UA 2HNTF 1AGJA 1H9LB 1O3IA 2BLOA 3A80A 4FUGA 2R2WU 5HIYA 3HATH 3RXLA 1F92A 2Z9GA 1HAGE 3PMAB 3U9AH 5CMXH 1EPTA 1Z6JH 1OXGA 4OGYA 1F5LA 2B7DH 1MAXA 2ILNA 4K8YA 4TY6A 4Z0KA 1J16A 1MKXK 1NESE 4JCNA 4TWWA 1NFYA 2H5CA 2UUFB 2FESH 1KLTA 3HK6B 1J14A 1Z8RA 2PKSB 4K3JA 1O2UA 3BG4B 3ZV9A 1FY1A 2OC1A 1C2GA 1O2SA 1DWCH 2UWOA 1Y3YA 3ATLA 2J5UA 1W2KH 2GP9B 3ZVBA 1OP8A 1LKBA 2XNIA 4GAWA 3SGQE 3LC5A 2ZDAH 3W94A 1TPAE 4MPVA 4AFQA 4NSYA 2G4UA 2NU4E 4UFFH 3DT0H 1CT0E 3FOAA 4X2XA 1P0SH 2Q6GA 2PP6A 2VVVA 4FUCA 3MU8A 2ULLA 1ACBE 1N1LA 2A7CA 2ZIQH 4ABDA 1ARCA 1T32A 4GCHG 1TQ7B 1TMUH 4VGCB 3F9EA 2JJ1D 3SNCA 4I8LA 7LPRA 1B0EA 1WV7H 1UHBA 3BG8A 1O3HA 2TGTA 3SUFA 4HFPB 2CHAC 2VINA 2VIWA 2ZDKA 1KTTB 1HJ8A 1C5TA 2RG3A 1SGIB 3KCGH 2FDAA 1GHWH 3VGCB 1FLEE 1HAHH 1NU9A 1O3GA 3TK6A 2FLRH 4JYTA 4AYYB 3P8NA 3GCOA 1K1IA 1O2XA 1K0HA 3SO3A 4HZHA 3ZYEA 1EASA 3QK1A 1GDUA 1DUAA 1LMWB 4IC5A 3N7OA 1UTMA 1JRSA 4F49A 1YPLH 3CS7A 4MNWA 3ZZ6A 1W13U 3RC5A 4YLUA 2F9NA 1QA7A 1HFDA 4THNH 1MTNB 2J95A 3MNCA 4WJG2 3RC4A 3PYHA 1L1JA 1G2LA 1GMDG 5FX6A 4Q4LA 5EXMA 4AFZA 3OTJE 2G55A 3FZDA 1FPHH 3UAIC 3UR9A 5C20A 3GY7A 2H2ZA 1N6YA 3TJVA 1BRAA 3LGTA 2A45B 5I46H 4GCHF 3I29A 1L2EA 4M7GA 3GY5A 4JYUH 1EPTC 3T62A 2AYWA 2L6OA 3H09A 3U1JB 1ZJDA 4AYVB 2HGTH 1O2MA 1G2MA 1X7AC 2BVXH 2XC0A 1MCTA 1TRNA 1EZXC 5C5NA 2A4RA 1TNGA 2C90B 4LOYH 3M5LA 3OEHD 1YPHE 1AFEH 1CA0C 3U69H 1O3OA 2FOGA 3ZZ4A 2P3TB 3BTHE 1AQ7A 1T8NA 3M36A 1QJ7B 3RU4T 1GHBF 4JZFH 1BHXB 1Z71A 4FUHA 4ABIA 2CHAB 1D4PB 2ZFSA 3W95A 3EA9A 1C5YB 4FUDA 8GCHF 1YPKH 4Q7ZA 3MU4A 2SNWA 1H8IH 5GCHG 3Q3XA 5L6NH 2JKHA 1KXEA 3KYGA 3LGWA 5LPRA 1XMNB 2BLQA 3RXOA 3TNSA 3MO3A 3JZ2B 3BIUH 5C67A 4M9FA 5E2PA 1TBZH 1LPGB 5A8XA 4HI3A 1BIOA 1GVZA 1GMHG 5T6FA 5EXLA 3VXFH 3Q00A 3A8AA 1QA0A 3BIVH 4MNYA 3AW1A 2J92A 2PW8H 2QE7D 1BA8B 1ELCA 2G5NA 1ARBA 1H8HD 1FDPA 3UPEA 3UQOA 4D9RA 4I8KA 3OY6U 1SL3A 2M2AA 4ZXYH 1L4ZA 2TPIZ 2O8TA 1UTPA 3M7QA 1C2MA 1FIWA 1QQUA 1SR5C 2QC2A 4IS5A 2G81E 3BTFE 1XVOA 1S85A 4XRNA 1DPOA 3ZVEA 3KEEA 3M35A 3PB1E 5EPNA 1EFRD 1NBMD 1AIXH 1MD7A 1QBVH 4JMYA 1YY3A 1K22H 1DANH 5LH8A 1WOFA 1UK3A 2W6JD 2F9UA 2VIVA 4BAKB 3SW2B 4U01A 1FJSA 3P6ZB 1C1UH 2BDHA 1Q2WA 1NRPH 4XOJA 3QUMP 2Y5HA 1ZHMA 2OUAA 2Y82A 1K1PA 4Y8XA 5GNDA 3N99A 1TNIA 1CBWB 4WMDA 1GBDA 2XBVA 4BTTB 4TT3D 4Y76A 2IN2A 2EC9H 1A5IA 4BNRA 1BMMH 3A85A 1Q3XA 2UWLA 1AU8A 1A0HB 3KIDU 5EXNA 3QTVH 3GCHB 2FMJA 2ZFTA 1HYLA 3E16B 1KXAA 2JJ2D 3EYDA 1TYNA 2G5VA 3WY8A 1SGQE 1C1SA 1DXWA 4IC6A 2WSSD 3CS0A 2PUXB 1K1MA 3E91A 2ODYB 1SQTA 4TWYA 2R3YA 2F91A 4UEHH 2PSXA 3SGBE 4E7NA 1MCVA 1AFQB 3KQCA 3EE7A 2BY9X 1DUEA 3BEIB 3V0XA 1PPHE 2EI7A 1Z7KA 2XOKD 4K1SA 1O3AA 2YNBA 2G52A 4CH8B 2A4GA 1YLDA 1MUEB 1TWXB 3KQBA 4YESB 2OBOA 3VFEA 2VVUA 1H8ED 4MQAA 4AGKA 1W10U 3GCNA 3DCLA 3P8FA 3OTPA 2AMPA 4JYVH 1Q31A 2HRVA 1MH0A 2ZKSA 5E0JA 1O35A 2D2DA 3BTWE 5AVDA 1HGTH 5FCRA 1P2KA 1P2NA 4ASUD 4OGXA 1FY8E 3TK9A 4O9VA 4OS1A 1TGCA 2BD5A 3RXGA 3RXIA 1H9HE 1DWDH 1C2HA 1EOJA 3M5MA 1V2JT 2HVXA 1FN8A 3PLBA 5GIBA 3BTDE 1YGCH 4ISHH 2QV1A 1V2UT 7GCHF 1LHCH 1CGJE 2P8OB 3RUOA 1A0JA 6CHAB 1P01A 4XE4A 1O2QA 3VB6A 4X8UH 4UFGH 1G32B 2ZCHP 3EA7A 3C27B 3RC6A 2ZGJA 2JDID 2D26C 3KHVA 1OP0A 1JOUB 3HGNA 1EB2A 1TONA 3FN8A 3MNSA 4E05H 4KP0A 4DGJA 1BCUH 4ZHAA 1TX8A 3PV4A 5E0GA 4B2AA 4WMFA 5IYTA 1QCPA 8KME2 3BG4C 3UNRA 2KZ4A 3SYJA 3MU0A 1EJAA 1GWAA 1PQ5A 3PRDA 1G9IE 2FTMA 1ZSJA 3A84A 2O8UA 2ZP0H 1O3CA 2HLCA 1GMHF 1TOMH 4K2YA 2ZWLH 3RXDA 1WTHD 1CVWH 2WYGA 1HAYB 1PQAA 1ELDE 4A5TS 3IG6B 1C2DA 2SGEE 3T28A 2G51A 1YPJH 1YLCA 1PFXC 4ESTE 1LHDH 4BTUB 2Z7FE 1SKYE 1A5HA 2C4FH 4F55A 1RXPA 3TU7H 1P2QA 1GI8B 1AZZA 4NSVA 3EBNA 2AGGX 4OS4A 2XBWA 2A32A 1UO6A 4Y7AA 2XC4A 3PMJA 1C2JA 1TNLA 2IPHA 1ANDA 1AVWA 5JB8S 3HKIB 2V6NA 1BTWA 1GBTA 1YLNA 3VEQB 5C5OA 1IQHA 1A4WH 1A2CH 1G30B 2ZFQH 2PHBA 2XC5A 4GSOA 1EATA 1GHAF 2VGCB 4JZEH 4CRGA 3QWCH 1Z8IB 3A7YA 2FI3E 2L74A 1ZMLA 4AFSA 1XUHA 5F8ZA 1YPHC 2ANWA 4R0IA 1Y8TA 4INKA 1NT1A 1ABIH 1C5WB 3LIWA 2AIPA 1MKWK 3SV7A 4AC9A 3QN7A 1NY22 1V2OT 1LVOA 1C5UA 1BTXA 3Q76A 1EJMA 3NPSA 4HG6A 1VCWA 4ZHLU 5TCAA 3LJOA 3MQKC 5E8EH 3ITIA 3ZVDA 4CREA 1GJBB 1QURH 4B73A 1OP2A 1SLXB 2H5DA 4D9QA 5AF9H 3OY5U 1Z8JB 1PPCE 2JH0D 2QXJA 4MLFB 4Q63A 3UNSA 1SB1H 2J38A 1V2ST 3SZNA 2Y81A 1GMCF 4B76A 3PTNA 5HIZA 3MH7A 1C5ZB 1LVMA 5LPEA 2VBCA 3ATMA 5DSFA 1NS3A 1WTGH 1HB0B 5EOKA 3UFAA 3LH1A 1DSTA 4X6MA 1W0ZU 1XUFA 3DSOA 2ZFRH 1C5NH 1LHFH 4NFEA 1RRKA 2C8ZB 2UUJB 3K65B 3EDXB 3ZZBA 3DUXH 2GZ8A 1TPPA 2FLBH 2A1DB 3QGNB 3T27A 1SGDE 2UWPA 1UTJA 3DFLA 4BANB 4U2WA 2F9OA 3KF2A 1BBRK 2Q1JA 2LPRA 1Y3WA 3SU5A 3ATIA 1W3CA 2ZU5A 3E1XB 1A3BH 1WU1A 2LP6A 1TNJA 3T2NA 1QL9A 2K8IA 2FWWA 3A8CA 8GCHG 1GBJA 2H1UA 1C4Y2 3ZZ3A 4NGAH 4ABGA 1T7CA 3SJ8A 2A5KA 2WV5A 5EQSA 4X8TH 1CGIE 2C8YB 4NFFA 4MPUA 1C5OH 1BDAA 2GJGA 4ACBA 1GBKA 4NWLA 5L30H 3F9FA 3WWFA 2ALVA 1ZLRA 1F2SE 1PPBH 2VWLA 2VB0A 2H9EH 2Y7ZA 2RA3A 2HNTE 3NRLA 2GKVE 1YKTA 3E6PH 1YPGH 3KQ5A 4FXGH 3LPRA 1IQJA 2V3MA 1TX6A 2ZDVH 5ESTE 1GI9B 4I86A 1O2TA 3V13A 1GBHA 1SG8B 3NK8A 1G3BA 4FU9A 3B8JA 3F68H 2UUKB 3JZ1B 5CDFE 2Z3DA 1OWJA 1ELEE 4TPYA 5DP8A 5C2ZA 4B6FA 3B9FH 3A89A 1AY6H 2PV9B 4GHQA 1L0ZA 4BAMB 2SGPE 1AUJA 3SBKA 1LDTT 3T25A 3RXRA 2XTTB 1INCA 1EP5A 2BOHB 3OE7D 1TLDA 4E7RG 2NWNA 3STJA 5K7RA 2PKAA 5K0HA 3GCHC 5DG6A 1KIGH 2CGAA 1GPZA 3IWMA 2B5TB 2GMTC 5E0HA 4U30A 2A2XH 2R3UA 4JK6A 1XM1A 5EGMA 4H42U 4AGJA 3BN9A 3IITA 3PWBA 4YO9A 1DE7H 1SGEE 2IPQX 5IK2D 4DVAU 1KDQA 3BTEE 3RXCA 2VIDA 1O2LA 3F0PA 4KTUA 4FUEA 1BQYA 1C5PA 1H8DH 3GY8A 3U8RH 2VH6A 3MFJA 1WQVH 2OC8A 2ZF0H 2BD2A 5HXFA 2H9TH 3GYLB 5C0UA 2WPHS 1WAYB 3N7EA 5TCCA 1SPJA 2Q6DA 7GCHG 2BQ7B 3MYWA 3CP7A 3GY3A 1N8OB 4FVBA 2A4QA 2BDBA 1N8OC 4FUJA 4B1TA 3TJUA 2ZU4A 4BXWA 2LIZA 1ZMNA 1EZSC 3SQHE 4AG2A 3TK5A 4WWYA 1FIZA 4CBOA 1HAOH 3FFGA 1GJDB 1C5XB 1HJAB 3F2FA 1AKSA 1AE8H 5F03A 1O2ZA 4JK5A 1XUIA 2OTVA 1AWHB 1IQMA 3SNEA 1ESTA 1VR1H 1XKAC 4O03A 3TH4H 2HOBA 1AI8H 3LU9B 1O0DH 3D23A 3K6ZA 3W1EA 1FXYA 4DURA 3LGYA 3I78A 2BX3A 1VKYA 1OS8A 3T5FH 1IQLA 1ELVA 1P57B 3LKWA 1P3CA 2GCTB 3ESTA 1KXCA 2TIOA 1CBWC 2W5EA 1DWEH 2WZQA 4GLYA 1QB1A 4NCYA 1DLEA 3GICB 1Y3UA 1TRMA 2G8TA 3OU0A 2GGVB 2OQ5A 4Y6DA 2Q6FA 4WY3A 1GBAA 4AB8A 1V2MT 1A5GH 1O3NA 3SV6A 2ODQA 1FQ3A 2VIPA 4KTCA 1GBLA 3Q77A 1QY6A 4ISOA 5FCKA 1AWFH 1NTPA 2TBSA 2FS8A 1IHSH 1JIRA 1O2YA 2BQWB 2FS9A 1MTUA 4O3UA 1E37B 1SGFA 1G3CA 2A7HA 2QF4A 1EXFA 2VWNA 3KGPA 1WDIA 1GHBG 1KLIH 1OPHB 4D7FA 3ATWA 1V3XA 1ZPZA 1BMLA 2VH0A 2PTCE 2ZQ2A 1S84A 1P05A 2QXHA 1TGSZ 2KFWA 2G00A 1GJ9B 1MZDA 1TA2A 1EAWA 2C8XB 2GCTC 4NG9H 2BVRH 5FBEA 1K1NA 1KLJH 2FYRA 2PLXA 1UCYK 5DPAA 3MU1A 4CRAA 3BTME 3SUGA 1ZRKA 1UVSH 1WXRA 2KR7A 1GBEA 1O5AB 2HWLB 1KMHB 3KQEA 1DWBH 2OINA 1C1MA 2FOMB 1Z8GA 3F9HA 1CA8B 5SGAE 1P9UA 1AMHA 1UMAH 4CRBA 1YCPM 1O3DA 1UCYE 1E1QD 2AGEX 2XRCA 1PYTD 1EP6A 1Z6EA 1QNJA 1SLWB 2BVSH 2D1JA 1V2QT 4RT0A 3V7TA 1DOJA 1C4U2 2FOBA 2WV9A 3SN8A 4DIIH 1Y5BT 1HPGA 2K1QA 2Y7XA 2ZNKH 1O3MA 2GZ9A 1A0LA 3SV9A 3Q3KA 4WH6A 3PTBA 1TGNA 5LGOA 4I31A 2FOAA 2FX6A 2AMDA 1K1OA 1AZ8A 1O2GH 1O31A 2JETB 3MNBA 5EQRA 1ETSH 3M61U 4GVUA 3UREA 1C5SA 7ESTE 2FYQA 1C4V2 3TJNA 1EQ9A 2ZFFH 2ZGXH 4A1XA 2QCYA 1TGBA 3BTTE 3S9CA 3SU3A 1RIWB 2OXSA 2ZZUH 1QQ4A 2GDEH 3M3VA 1NROH 3VB3A 3RLWH 5A8YA 3BTQE 4XD7D 4ZXXH 5EW2H 1OKXA 1ELFA 1GI4A 4ZKRU 1AKSB 1P9SA 3F6UH 1UVTH 1TFXA 2ZDMA 1S6FA 2BY7X 3RXPA 5FPSA 1VCQA 2F83A 4CRCA 3VGCC 1EJNA 4MNVA 3EGKH 1TBQH 1IHTH 1A1RA 4LZ4B 4X8SH 4Y71A 3PLPA 1MD8A 1G36A 1G37A 1MQ5A 2BDIA 2I6QA 2DE9A 3SV2H 1GGDC 3GDVA 1L1NA 1MAYA 1DDJA 3T29A 1T8OA 2AFQB 1ELTA 3L33A 1H1BA 3H7OA 1CHGA 2FIRH 2O8WA 3V3MA 2VIQA 4E06H 1C5LH 1VZQH 1RTLA 1O5FH 4DOQA 5C1XA 2OCVB 1D3QB 1LPKB 1UVPA 3PV5A 3BSQA 1JBUH 2QF0A 1BBRE 1W8BH 2FM2A 2A0QB 3NKKA 1F0RA 1OWKA 4TY7A 2AHME 1QHRB 2CK3D 1V2RT 2BZ6H 2ZPSA 3AAVA 1PPZA 4X1RU 2SGDE 1SMFE 1GVLA 2CMYA 1S82A 3RLYH 3PLKA 1A7SA 2SGFE 1ZYOA 1UVUH 3GY6A 5ABWA 5H4IB 2IJD1 1C2IA 4CHAC 1GDNA 3NCLA 2QIQA 3QX5H 4FUBA 1SVPA 2A31A 2EEKA 2HPPH 3HK3B 1K1JA 2ANKH 3C1KA 4BTIB 5DP9A 5GXPA 2GT7A 4FU8A 4MVNA 2KAIB 3H5CB 3HPTB 2RDLA 2I6SA 2GX4A 1W14U 2BD9A 3GY2A 1FI8A 1BMFD 3A83A 1QFKH 3STIA 2V3OH 1SBWA 1LCYA 1CE5A 2BOKA 5T6DA 1AN1E 2TGAA 1W11U 2LNCA 5B6OA 2J94A 1M9UA 1HAVB 4Y8YA 1TBRH 1ZPBA 1GCDA 1GHYH 5EW1H 4IN2A 1O2RA 1T8LA 1C1WH 3ZZ9A 2Z6BD 1SQOA 4Y11E 2BY8X 5FAHA 2BD4A 1SGPE 1DLKB 1THRH 5FPTA 2J4IA 2BM2A 1AFQC 1WQSA 4ISIH 4ZHMU 1OX1A 1ZHPA 1ANBA 3PWCA 2ESTE 5GPIB 4K60A 1C1OA 1O3EA 1DX5M 3GDSA 1Z1JA 1UTNA 1U6QA 1DVAH 4F4OC 3PROA 3TJOA 1F0TA 1OYTH 1VGCB 1W0KD 2STBE 4ZROA 5JDUB 2BHGA 2SGAA 1W7XH 4JZ1A 5G4BA 1SGNE 1V2WT 1C9TA 1YC0A 1ELGA 2W3IA 4WXVA 1EX3A 1TAWA 2C3SA 3BF6H 1Y5AT 1ZRBA 3ZZ5A 2WUBA 3SJ9A 2WPKS 4YOIA 4UDWH 2ZU1A 1KXFA 2OD3B 4H4FA 3RMMH 1NRNH 3DD2H 4K1EA 4NIXA 1MQ6A 2AERH 2FOCA 1KDQB 1CU1A 2F9VA 1CO7E 2BD8A 2VGCC 2BD7A 3SOSA 1O37A 1UTOA 1ZJKA 1UHBB 2ZTZA 2GCHF 3SGAE 3PMHB 2PKAB 3UB0A 3AW0A 4B74A 5HM9A 5DO4H 2V35A 3TH2H 1LQEA 3OAAD 4YTAA 3SNAA 1GL0E 2QYIA 4MG3A 4MDSA 2XNDD 1QJ1B 1O5BB 3DFJA 3QLPH 3MH5A 3NWUA 4Q2KA 1GJCB 2TRMA 1RFNA 2ZGBH 1QL8A 3BTGE 3UY9A 5C3NA 3SJOA 1JXPA 1COWD 2O9QA 1MTWA 2ZHFH 1GVKB 1RJXB 2WPMS 2CXVA 1GHXH 1VCPA 1ETTH 3TGJE 3RM0H 4GUXA 1HAZB 3PMBB 2YMSD 1AB9B 2R2MB 1SGCA 1UTLM 1F0SA 1D9IA 3MH6A 1O5DH 3CNRA 1E0FD 1BT7A 1ZTJA 4CHAB 2A5IA 2P3FH 4DT4A 1TRYA 5ESBA 1C1NA 5GDSH 3S9AA 2QXIA 2KAIA 2FODA 3ZIAD 1CSOE 3BEUA 1A3EH 2PUQH 2A4OA 2H6MA 1NFXA 1DY9A 3UOUA 2ZC9H 3TH3H 2YOLA 2AS9A 1RTKA 1MTSA 5IDKA 1MABB 5A0AE 2J98B 3TPIZ 1EAUA 5PTPA 5E2OA 3GS9A 1ESBA 2BTCE 4B2BA 4TSFD 4YZUA 5DP5A 1OYQA 4ZMAH 1NC6A 2R0KA 3E3TA 2GVFA 1LPZB 3KQDA 5EIYA 4D76A 1C1TA 3M3TA 4IW4E 1DSUA 1O39A 5JYIA 3M3SA 1FNIA 1OWHA 2FP7B 3U8OH 3A7ZA 3UIRA 1NRRH 2TGPZ 2XCNA 3UWIA 4CH2B 2ZHWH 1BTYA 1Y3XA 3KNXA 2ZU2A 2AH4X 4Q80A 5AFYH 2B9LA 1IQNA 4BAOB 2GTBA 4RKOB 2O8MA 1A61H 3SU1A 3KL6A 1XVMA 1D6WA 1S0QA 3KYFA 1IOEA 1QR3E 2JH5D 3KN2A 2K7XA 2PGQB 2ZI2H 3OFND 1GJ8B 1TB6H 3NZIA 2RDEA 3TLOA 1YPEH 3D65E 2PSYA 4XFQA 1P2MA 1SHYA 2SGQE 4YT6H 1O3KA 3MU5A 5T1VA 2P16A 1BTPA 2BZAA 3RXUA 3RMLH 5JBTA 4SGBE 1KXDA 3FVFB 2KM0A 4B71A 1UTKA 4BXSA 4MPXA 1S5SA 1ZGVA 4X1PU 1GI1A 2QA9E 2XW9A 1K9OE 4X6OA 3SZEA 1HAPH 3ZZAA 1T4UH 1KTSB 2A2QH 1ZSKA 2F9PA 5GCHF 1YWUA 5I25A 1SGFG 2FX4A 4OS2A 3R3GB 3V12A 2PKSC 1GBBA 3UQVA 1O33A 3ZV8A 1XX9A 1MTVA 2ZFPH 3A82A 1FONA 3FKSD 3QTOH 1ELBA 1O2IA 1FY5A 1HLTH 3OYPA 1LO6A 5EJZA 5A09A 2IJOB 1TABE 1D6RA 3OSYA 1PQ7A 4ZKSU 4UE7H 4R8TB 5KECA 1MBMA 2BXTH 1YCPK 1E1RD 2ALPA 2ANMH 1FV9A 2Y6TA 1HBTH 3SQEE 1SGRE 4IGDA 4PROA 4OM9A 1D3TB 3RXFA 2XBYA 3O8BA 1TALA 4FUIA 4KKDA 1Y5UT 1ANCA 1HJ9A 4QT8C 4YLQH 3GYMA 1C5MD 1C2FA 1D3PB 4P02A 3SU2A 3ZZCA 5T6GA 4X2WA 2P3UB 4FOUC 1YM0A 2GDDA 4WH8A 3LT3A 1AHTH 2WPIS 1S6HA 2J9NA 4D7GA 4DCDA 1T4VH 1Y59T 4NIVA 1THPB 1XUGA 1C5VA 2QGRA 1BRBE 4A1TA 5C94A 1ESAA 3P8GA 5CHBA 1TMTH 4AOQA 2ZDNA 5JBBS 2CF8H 3RXBA 5EG4A 2F9BH 2SFAA 1EAXA 2JIZD 3SV8A 1ZTKA 3D62A 1ZR0A 3H7TA 2OBQA 5FXLA 1GDQA 1GI2A 2B0FA 1O5GH 1UJ1A 3GCTF 4WMEA 1F0UA 1CT4E 1FAKH 1O2JA 4MTBA 1AVGH 1VITG 1P12E 2NU1E 2OP9A 4AORA 5HM2A 5EU8A 1ELAA 1FPCH 3MWIU 1P02A 1HIAA 5F8TA 1GBIA 3MOCA 4CBNA 1BJUA 2CF9H 2EI8A 1ZPCA 4RT1A 1YCPH 2VVCA 1K28D 1LVYA 2GCHG 1LQDB 3E0NB 2PTNA 2R0LA 1FX0B 1C1VH 1HAVA 2FPZA 2ZG0H 4I8HA 3SJKA 3K6YA 4X2YA 1QJ6B 1SQRA 4TYDA 3SORA 2BDGA 1TIOA 1RTFB 4X6NA 4O3TA 1TNHA 5FL7D 4DW2U 1OSSA 2V3HH 1K21H 2BYAX 1CT2E 4NA7A 4ZKOU 1TE0A 4YOJA 1O32A 4OS6A 3PO1C 4Y10E 2FOEA 2YMSC 2QY0B 1JIMA 4H6SB 3VXEH 7KMEH 3PO1B 2FOHA 4K5ZA 1NBME 1UCYH 2P95A 2YNAA 4NA9H 2H9HA 3M7UA 1IQKA 2STAE 2WPDD 4NA8A 1HIAB 2EA3A 5ETXA 5A2MH 3RM2H 3A7TA 1F5RA 2QF5A 1UK2A 1GG6B 1YF4A 2HPQH 2XWBI 3F0OA 4INLA 1BMAA 3M37A 4FETA 1MBQA 2EI6A 2ZGHA 1RGQA 3RXVA 2AGIX 1HXEH 1KXBA 5J4SA 2BQ6B 3MI4A 4I8JA 5DGJA 1O3FA 3ZZ7A 3A7XA 1UTQA 3MNXA 4SGAE 3RDZA 2WPLS 1O5EH 3S7HB 1DY8A 2FZZA 2WPJS 3FAOA 1OWDA 1O38A 1QBOA 2F3CE 1P09A 5KEDA 1NFUA 3G01A 5JBCS 2NU0E 4AB9A 1GMCG 2GT8A 2KCOA 2OLGA 2BLWA 3RXMA 3TITA 4TPIZ 2ZHDA 2J97A 3TVJB 1SLVB 3ZVFA 1QL7A 2CV3A 1FY4A 1ZOMA 1O36A 3ENSB 2BLVA 1SGTA 4HTCH 1W0JD 2HALA 2QF3A 3HKJB 3D49H 2BDAA 1IQEA 1O30A 2Z3CA 1AUTC 1S83A 2GV7A 3VPKA 1OHHD 4RN6A 2OK5A 2GV6A 2CJIA 1GI7B 3AAUA 1O2PA 1J8AA 1IAUA 1L4DA 1IQGA 1T31A 3PM3A 5BPEA 1P04A 3SHAH 1W12U 2R9PA 4X1NU 2XBXA 1DXPA 3RXSA 8ESTE 1BTHH 1V2VT 4HGCA 4ABFA 5FX5A 1SOTA 2XCFA 3LOXA 2LELA 1EZQA 3VB7A 1FAXA 2BXUH 3M5OA 3R0FA 1GG6C 3OEED 5EJ1A 2W6ID 1WSSH 4U32A 2JH6D 5F8XA 3VG8A 1BZXE 1P2JA 2ODPA 1SFQB 3SU4A 1WCZA 3MMGA 1O2HA 3SJIA 4K1TA 2FO9A 4XBBA 2ZGCA 3BTKE 1T8MA 4ABAA 1LVBA 1P06A 2FOFA 1GI6A 2ZCKP 2W26A 1QGFA 1HNEE 1E35B 3QDZB 3PRBA 2ZCLP 5A8ZA 1SOZA 3A87A 4AX9H 1HV7A 4XBCA 1HAIH 1SLUB 2RFKC 3F3BA 2PFEA 1S6LA 1QIXB 3MO6A 3M5NA 3URCA 1ETRH 5A0CA 1ZSLA 3RP2A 1DFPA 1GMDF 2NU3E 1QB9A 1O2VA 2ZHEH 1BBRH 4FU7A 5JB9S 1EB1H 4H6TA 3UTUH 1NFWA 4X1SU 3RMOH 1V2TT 4Y0YE 1NN6A 1FUJA 4KGAA 1BJVA 2GD4B 3B23B 3UOPA 4ZAEA 1O34A 3AVZA 4AN7A 5HYOA 5GWZA 1C5QA 1GCTB 2DUCA 1DS2E 1NZQH 2ZECA 1YYY1 3A86A 4NIWA 1V2KT 1ZTLA 1JMOH 2P94A 5DP4A 2P8OC 6CHAC 2ANYA 3ELAH 1EPTB 3MH4A 2A5AA 2ZO3H 2BY6X 5C1UA 3UWJH 2FEQH 2VWOA 1C1RA 1EAIA 2DE8A 4WXIA 2TGDA 3RU4D 3AK5A 1GJ4H 3NXPA 3P70B 3GY4A 2ZPRA 1TNKA 2FI4E 4ISLA 1DITH 1QRZA 1SC8U 3ATKA 1OWEA 3MO9A 2ZPQA 1PPFE 4OS7A 1MTNC 1Y3VA 4B2CA 1BOQA 1HUTH 4YM9A 3SI3H 3LGIA 4LXBH 6LPRA 2ZTYA 4X0WU 4Q7YA 1G3DA 1J9CH 9LPRA 1E34B 1BTZA 2CN0H 1WYKA 4X6PA 5J4QA 3ZZDA 2W7UA 3DSGA 1TPOA 4XBDA 3T26A 2XWAA 4I32A 1GL1A 1TPSA 1VITH 6GCHF 3P95A 1C1QA 3SHCH 1P2IA 1GBMA 3QZQA 2XXLA 3RXKA 4DJZB 1THSH 1NU7B 4GHTA 5LPFA 4A92A 2Z9JA 4J1YA 1JRTA 1PJPA 4Y8ZA 2SNVA 8LPRA 4AFUA 1CHOF 1L1GA 3EAJA 1V2LT 4JZIA 5GJ4B 4BOHA 1FZZA 3S7KB 3TIUA 4FVDA 1C2EA 3EE0B 3E0PB 3LC3A 4KELA 3LH3A 3S69A 3S9BA 4YXWD 1EUFA 4NWKA 3SI4H 2BD3A 1PYTC 4D8NA 1KSNA 1DM4B 3EA8A 3ZZ8A 3FZZA 1K2I1 5DN6D 4F48B 3FANA 4X8VH 1P11E 3K9XB 3F1SB 5JPMH 1IQIA 1EOLA 2VNTA 1O2KA 2OC7A 3A81A 3PV2A 3WW7A 3ZYDA 2BX4A 2OQUA 2WYJA 3M7TA 2PGBB 5C17A 2HVYB 3UUZA 1TOCB 3HGPA 1V6DA 1WBGB 3LGUA 3O8DA 3P17H 1CA0B 1C2LA 3ZVGA 3L3TA 4KTSA 3N7DA 2HLDD 4O97A 5FBIA 3A8BA 1XKBC 5T3HA 3RXEA 4B6EA 3ODDA 1MKXH 4P00A 5HKKD 2V7QD 1NRSH 3VB4A 1GHZA 3MHWU 3EQ0H 4Y0ZE 3P8OA 1WUNH 3F2HA 3U28C 3F2GA 5CHAB 4AZ2B 1E36B 1MU6B 1P03A 1BB0B 1HAXB 5DP3A 1ZGIA 3U8TH 2C93B 4RSPA 1CGHA 1XXFA 2Z9KA 1ID5H 3DHKH 4INHA 5AHGH 1EZUC 5A0BA 3LGVA 5DP7A 4I7YH 1NRQH 1GI0A 4XDEA 3GDUA 3DA9B 2P93A 2ZA5A 3RXHA 1LHGH 2KCPA 2VWMA 1HRTH 4ABEA 4CRFA 4YOGA 1KYNA 2BDYA 2J98A 5JBAS 1MU8B 4IMQA 1TQ0B 1W7GH 4CR9A 4Y7BA 1FN6A 2FTLE 3UR6A 1BHXF 5B6LA 3SUDA 1OWIA 3FP7E 2ASUB 3URDA 1QZ8A 2THFB 3RU4E 4MPWA 1GJ5H 4ABJA 5F53A 3LJJA 4K69A 2NU2E 3FP6E 3U1IB 1P8VC 2ZQ1A 5EODA 2QAAA 4XSKU 4OS5A 1GJAB 2AMQA 1IQFA 4X1QU 2ZU3A 3GISB 1P3EA 2BB4A 2Z9IA 1DT2A 1GGDB 1H9IE 3UNQA 4YT7H 1G3EA 3GOVB 4GPGA 5AFZH 2PR3A 1GI5A 3I77A 1O3LA 3CENA 3E90B 1YBWA 1LKAA 2C8WB 5EJLA 1Z1IA 2HNTC 5KGOA 4NZQA 2IOTA 5CHAC 3WWBA 5L2YH 3O8RA 4FUFA 2M5TA 2WINI 5FPYA 1O2NA 1VJ9U 2J34A 2ZDLA 4UFDH 5FHTA 1O3BA 1TMBH 1B0FA 2PWXA 4Z1MD 4B75A 1BUIA 1BITA 1TA6A 2W7SA 1TX7A 4CR5A 4ZCNA 4ASHA 1HDTH 4RI0A 4K8BA 4LZ1H 1ZZZA 3MTYA 5HMAA 6GCHG 2RA0A 1O3JA 4DG4A 1V2PT 2Z94A 2XYAA 2V0BA 1PQ8A 3FO8D 3TGKE 3QZRA 2KCYA 2GMTB 3L6PA 1MMJN 1TGTA 4J2YB 1GJ7B 4IN1A 1BRCE 2Z3EA 4UFEH 4DY7B
chains in the Genus database with same CATH topology
1YPMH 1PPGE 1AVXA 1ORFA 4ISNA 4AG1A 4ZUHA 3ZVCA 3O8CA 1KY9A 1P2OA 4I8GA 2ZHQH 1NO9H 1QBNA 3RMNH 2GZ7A 1F5KU 1XUJA 2VJ1A 3RXAA 4WF8A 3SU0A 3P92A 1JWTA 2QXGA 1SFIA 2JETC 1BMNH 3LONA 5DP6A 3S0NA 1AO5A 3VB5A 1HJAC 4BAQB 1S0RA 1C1PA 4A6LA 2B8OH 2Y5GA 4X2VA 1S81A 1OOKB 2D8WA 4Z6AH 5F6MA 1N6XA 2BMGB 1CQQA 1VITF 2VU8E 3F9GA 1GI3A 1CHOG 1A46H 1QRWA 6ESTA 1PPEE 1FMGA 2WUCA 4I33A 3ODFA 5C1YA 3TGIE 1ANEA 1LHEH 4RKJB 1QRXA 1O2OA 1O5CB 2P59A 1H4WA 3SU6A 3A8DA 1BTUA 1K1LA 3QO6A 3AASA 2AEIH 2UUYA 2W3KA 2Y5FA 1VJAU 1AD8H 1V2NT 1SGYE 2BDCA 4DT7B 1B7XB 1C5RA 1SI5H 3A7VA 1HXFH 1UK4A 1ZHRA 1QTFA 4DIHH 1B5GH 1O2WA 4ZH8A 5L2ZH 1E38B 2OC0A 1GHAG 1XXDA 4BAHB 5DJ7A 4JZDH 1EKBB 1RS0A 3Q3YA 5EQQA 5DK1A 1ABJH 1GCTC 1DICA 3GCTG 1SQAA 4MNXA 4WVPE 4A1VA 4IBLH 2A7JA 4NZLA 1QB6A 3TNTA 2AIQA 3A88A 1D3DB 1YP9A 4ABHA 4A7IB 1RIWC 3OX7U 2FI5E 4Y79A 4ZKNU 1SHHB 2QN5T 4VGCC 1GJ6A 3SNBA 1AE5A 3BEFB 1GBFA 3QGJA 4LK4A 1GBCA 9ESTA 3RXQA 2BY5X 2VIOA 1SSXA 5TJXA 1GHVH 3SNDA 1NPMA 5BRRE 2RCEA 4Q7XA 2Y80A 1ZMJA 4CRDA 1O3PB 3A7WA 2G4TA 3E8LA 4ABBA 1RD3B 3NUMA 1HCGA 1XUKA 2FXRA 1W0YH 3U98H 3LDXH 2ZTXA 3BV9B 1MZAA 4NIYA 1AB9C 3ZVAA 2Z9LA 1UVOA 1FY3A 1C9PA 2WV4A 1P10A 2O8LA 1MKWH 2J2UA 3RXJA 1C2KA 1BRUP 1J15A 2ZEBA 1F7ZA 1J17T 4UONA 5DKMA 4UD9H 5EPYA 1LTOA 5CE1A 3RXTA 1VGCC 3SUEA 3FP8E 1NM6A 4IMZA 5HGGA 3K2UA 2HNTF 1AGJA 1H9LB 1O3IA 2BLOA 3A80A 4FUGA 2R2WU 3HATH 3RXLA 1F92A 2Z9GA 1HAGE 3PMAB 3U9AH 5CMXH 1EPTA 1Z6JH 1OXGA 4OGYA 1F5LA 2B7DH 1MAXA 2ILNA 4K8YA 4TY6A 4Z0KA 1J16A 1MKXK 1NESE 4JCNA 4TWWA 1NFYA 2H5CA 2UUFB 2FESH 1KLTA 3HK6B 1J14A 1Z8RA 2PKSB 4K3JA 1O2UA 3BG4B 3ZV9A 1FY1A 2OC1A 1C2GA 1O2SA 1DWCH 2UWOA 1Y3YA 3ATLA 1W2KH 2GP9B 3ZVBA 1OP8A 1LKBA 2XNIA 4GAWA 3SGQE 3LC5A 2ZDAH 3W94A 1TPAE 4MPVA 4AFQA 4NSYA 2G4UA 2NU4E 4UFFH 3DT0H 1CT0E 4X2XA 1P0SH 2Q6GA 2VVVA 4FUCA 3MU8A 2ULLA 1ACBE 1N1LA 2A7CA 2ZIQH 4ABDA 1ARCA 1T32A 4GCHG 1TQ7B 1TMUH 4VGCB 3F9EA 3SNCA 4I8LA 7LPRA 1B0EA 1WV7H 1UHBA 3BG8A 1O3HA 2TGTA 3SUFA 4HFPB 2CHAC 2VINA 2VIWA 2ZDKA 1KTTB 1HJ8A 1C5TA 2RG3A 1SGIB 3KCGH 2FDAA 1GHWH 3VGCB 1FLEE 1HAHH 1NU9A 1O3GA 3TK6A 2FLRH 4JYTA 4AYYB 3P8NA 3GCOA 1K1IA 1O2XA 3SO3A 4HZHA 3ZYEA 1EASA 3QK1A 1GDUA 1DUAA 1LMWB 4IC5A 3N7OA 1UTMA 1JRSA 4F49A 1YPLH 3CS7A 4MNWA 3ZZ6A 1W13U 3RC5A 4YLUA 2F9NA 1QA7A 1HFDA 4THNH 1MTNB 2J95A 3MNCA 4WJG2 3RC4A 3PYHA 1L1JA 1G2LA 1GMDG 5FX6A 5EXMA 4AFZA 3OTJE 2G55A 3FZDA 1FPHH 3UR9A 5C20A 3GY7A 2H2ZA 1N6YA 3TJVA 1BRAA 3LGTA 2A45B 5I46H 4GCHF 3I29A 1L2EA 4M7GA 3GY5A 4JYUH 1EPTC 3T62A 2AYWA 3U1JB 1ZJDA 4AYVB 2HGTH 1O2MA 1G2MA 1X7AC 2BVXH 2XC0A 1MCTA 1TRNA 1EZXC 5C5NA 2A4RA 1TNGA 2C90B 4LOYH 3M5LA 1YPHE 1AFEH 1CA0C 3U69H 1O3OA 2FOGA 3ZZ4A 2P3TB 3BTHE 1AQ7A 1T8NA 3M36A 1QJ7B 3RU4T 1GHBF 4JZFH 1BHXB 1Z71A 4FUHA 4ABIA 2CHAB 1D4PB 2ZFSA 3W95A 3EA9A 1C5YB 4FUDA 8GCHF 1YPKH 4Q7ZA 3MU4A 2SNWA 1H8IH 5GCHG 3Q3XA 5L6NH 2JKHA 1KXEA 3LGWA 5LPRA 1XMNB 2BLQA 3RXOA 3TNSA 3MO3A 3JZ2B 3BIUH 5C67A 5E2PA 1TBZH 1LPGB 5A8XA 4HI3A 1BIOA 1GVZA 1GMHG 5T6FA 5EXLA 3VXFH 3Q00A 3A8AA 1QA0A 3BIVH 4MNYA 3AW1A 2J92A 2PW8H 1BA8B 1ELCA 2G5NA 1ARBA 1FDPA 3UPEA 3UQOA 4D9RA 4I8KA 3OY6U 1SL3A 4ZXYH 1L4ZA 2TPIZ 2O8TA 1UTPA 3M7QA 1C2MA 1FIWA 1QQUA 1SR5C 2QC2A 4IS5A 2G81E 3BTFE 1XVOA 1S85A 3ZVEA 1DPOA 3KEEA 3M35A 3PB1E 5EPNA 1AIXH 1MD7A 1QBVH 4JMYA 1K22H 1DANH 5LH8A 1WOFA 1UK3A 2F9UA 2VIVA 4BAKB 3SW2B 4U01A 1FJSA 3P6ZB 1C1UH 2BDHA 1Q2WA 1NRPH 4XOJA 3QUMP 2Y5HA 1ZHMA 2OUAA 2Y82A 1K1PA 4Y8XA 1TNIA 1CBWB 4WMDA 1GBDA 2XBVA 4BTTB 4Y76A 2IN2A 2EC9H 1A5IA 4BNRA 1BMMH 3A85A 1Q3XA 2UWLA 1AU8A 1A0HB 3KIDU 5EXNA 3QTVH 3GCHB 2FMJA 2ZFTA 1HYLA 3E16B 1KXAA 3EYDA 1TYNA 2G5VA 3WY8A 1SGQE 1C1SA 1DXWA 4IC6A 3CS0A 2PUXB 1K1MA 3E91A 2ODYB 1SQTA 4TWYA 2R3YA 2F91A 4UEHH 2PSXA 3SGBE 4E7NA 1MCVA 1AFQB 3KQCA 2BY9X 1DUEA 3BEIB 3V0XA 1PPHE 2EI7A 1Z7KA 4K1SA 1O3AA 2YNBA 2G52A 4CH8B 2A4GA 1YLDA 1MUEB 1TWXB 3KQBA 4YESB 2OBOA 3VFEA 2VVUA 4MQAA 4AGKA 1W10U 3GCNA 3P8FA 2AMPA 4JYVH 1Q31A 2HRVA 1MH0A 2ZKSA 5E0JA 1O35A 2D2DA 3BTWE 5AVDA 1HGTH 5FCRA 1P2KA 1P2NA 4OGXA 1FY8E 3TK9A 4O9VA 4OS1A 1TGCA 2BD5A 3RXGA 3RXIA 1H9HE 1DWDH 1C2HA 1EOJA 3M5MA 1V2JT 2HVXA 1FN8A 3PLBA 5GIBA 3BTDE 1YGCH 4ISHH 2QV1A 1V2UT 7GCHF 1LHCH 1CGJE 2P8OB 3RUOA 1A0JA 6CHAB 1P01A 4XE4A 1O2QA 3VB6A 4X8UH 4UFGH 1G32B 2ZCHP 3EA7A 3C27B 3RC6A 2ZGJA 2D26C 3KHVA 1OP0A 1JOUB 3HGNA 1EB2A 1TONA 3MNSA 4E05H 4KP0A 4DGJA 1BCUH 4ZHAA 1TX8A 3PV4A 5E0GA 4B2AA 4WMFA 5IYTA 1QCPA 8KME2 3BG4C 3UNRA 3MU0A 1EJAA 1GWAA 1PQ5A 1G9IE 2FTMA 1ZSJA 3A84A 2O8UA 2ZP0H 1O3CA 2HLCA 1GMHF 1TOMH 4K2YA 2ZWLH 3RXDA 1WTHD 1CVWH 2WYGA 1HAYB 1PQAA 1ELDE 4A5TS 3IG6B 1C2DA 2SGEE 3T28A 2G51A 1YPJH 1YLCA 1PFXC 4ESTE 1LHDH 4BTUB 2Z7FE 1A5HA 2C4FH 1RXPA 3TU7H 1P2QA 1GI8B 1AZZA 4NSVA 3EBNA 2AGGX 4OS4A 2XBWA 2A32A 1UO6A 4Y7AA 2XC4A 3PMJA 1C2JA 1TNLA 2IPHA 1ANDA 1AVWA 5JB8S 3HKIB 2V6NA 1BTWA 1GBTA 3VEQB 5C5OA 1IQHA 1A4WH 1A2CH 1G30B 2ZFQH 2PHBA 2XC5A 4GSOA 1EATA 1GHAF 2VGCB 4JZEH 4CRGA 3QWCH 1Z8IB 3A7YA 2FI3E 1ZMLA 4AFSA 1XUHA 5F8ZA 1YPHC 2ANWA 4R0IA 1Y8TA 4INKA 1NT1A 1ABIH 1C5WB 3LIWA 2AIPA 1MKWK 3SV7A 3QN7A 1NY22 1V2OT 1LVOA 1C5UA 1BTXA 3Q76A 1EJMA 3NPSA 1VCWA 4ZHLU 5TCAA 3LJOA 5E8EH 3ITIA 3ZVDA 4CREA 1GJBB 1QURH 4B73A 1OP2A 1SLXB 2H5DA 4D9QA 5AF9H 3OY5U 1Z8JB 1PPCE 2JH0D 2QXJA 4MLFB 3UNSA 1SB1H 2J38A 1V2ST 3SZNA 2Y81A 1GMCF 4B76A 3PTNA 3MH7A 1C5ZB 1LVMA 5LPEA 3ATMA 1NS3A 1WTGH 1HB0B 5EOKA 3UFAA 3LH1A 1DSTA 4X6MA 1W0ZU 1XUFA 2ZFRH 1C5NH 1LHFH 4NFEA 1RRKA 2C8ZB 2UUJB 3K65B 3EDXB 3ZZBA 3DUXH 2GZ8A 1TPPA 2A1DB 2FLBH 3QGNB 3T27A 1SGDE 2UWPA 1UTJA 3DFLA 4BANB 4U2WA 2F9OA 3KF2A 1BBRK 2Q1JA 2LPRA 1Y3WA 3SU5A 3ATIA 1W3CA 2ZU5A 3E1XB 1A3BH 1WU1A 1TNJA 3T2NA 1QL9A 2FWWA 3A8CA 8GCHG 1GBJA 2H1UA 1C4Y2 3ZZ3A 4NGAH 4ABGA 1T7CA 3SJ8A 2A5KA 2WV5A 5EQSA 4X8TH 1CGIE 2C8YB 4NFFA 4MPUA 1C5OH 1BDAA 1GBKA 4NWLA 5L30H 3F9FA 2ALVA 1ZLRA 1F2SE 1PPBH 2VWLA 2VB0A 2H9EH 2Y7ZA 2RA3A 2HNTE 2GKVE 1YKTA 3E6PH 1YPGH 4FXGH 3LPRA 1IQJA 1TX6A 2ZDVH 5ESTE 1GI9B 1O2TA 3V13A 1GBHA 1SG8B 3NK8A 1G3BA 4FU9A 3B8JA 3F68H 2UUKB 3JZ1B 2Z3DA 1OWJA 1ELEE 4TPYA 5DP8A 5C2ZA 3B9FH 3A89A 1AY6H 2PV9B 4GHQA 1L0ZA 4BAMB 2SGPE 1AUJA 3SBKA 1LDTT 3T25A 3RXRA 2XTTB 1INCA 1EP5A 2BOHB 1TLDA 4E7RG 2NWNA 3STJA 5K7RA 2PKAA 5K0HA 3GCHC 5DG6A 1KIGH 2CGAA 1GPZA 3IWMA 2B5TB 2GMTC 5E0HA 4U30A 2A2XH 2R3UA 4JK6A 1XM1A 5EGMA 4H42U 4AGJA 3BN9A 3IITA 3PWBA 4YO9A 1DE7H 1SGEE 4DVAU 1KDQA 3BTEE 3RXCA 2VIDA 1O2LA 4KTUA 4FUEA 1BQYA 1C5PA 1H8DH 3GY8A 3U8RH 2VH6A 3MFJA 1WQVH 2OC8A 2ZF0H 2BD2A 5HXFA 2H9TH 3GYLB 2WPHS 1WAYB 5TCCA 1SPJA 2Q6DA 7GCHG 2BQ7B 3MYWA 3CP7A 3GY3A 1N8OB 4FVBA 2A4QA 2BDBA 1N8OC 4FUJA 4B1TA 3TJUA 2ZU4A 4BXWA 2LIZA 1ZMNA 1EZSC 3SQHE 4AG2A 3TK5A 4WWYA 1FIZA 4CBOA 1HAOH 3FFGA 1GJDB 1C5XB 1HJAB 1AKSA 1AE8H 5F03A 1O2ZA 4JK5A 1XUIA 2OTVA 1AWHB 1IQMA 3SNEA 1ESTA 1VR1H 1XKAC 4O03A 3TH4H 2HOBA 1AI8H 3LU9B 1O0DH 3D23A 3K6ZA 1FXYA 4DURA 3LGYA 3I78A 2BX3A 1OS8A 3T5FH 1IQLA 1ELVA 1P57B 3LKWA 1P3CA 2GCTB 3ESTA 1KXCA 2TIOA 1CBWC 2W5EA 1DWEH 4GLYA 1QB1A 4NCYA 1DLEA 3GICB 1Y3UA 1TRMA 2G8TA 3OU0A 2GGVB 2OQ5A 4Y6DA 2Q6FA 4WY3A 1GBAA 4AB8A 1V2MT 1A5GH 1O3NA 3SV6A 2ODQA 1FQ3A 2VIPA 4KTCA 1GBLA 3Q77A 1QY6A 4ISOA 5FCKA 1AWFH 1NTPA 2TBSA 2FS8A 1IHSH 1JIRA 1O2YA 2BQWB 2FS9A 1MTUA 4O3UA 1E37B 1SGFA 1G3CA 2A7HA 1EXFA 2VWNA 3KGPA 1GHBG 1KLIH 1OPHB 4D7FA 3ATWA 1V3XA 1ZPZA 1BMLA 2VH0A 2PTCE 2ZQ2A 1S84A 1P05A 2QXHA 1TGSZ 2G00A 1GJ9B 1MZDA 1TA2A 1EAWA 2C8XB 2GCTC 4NG9H 2BVRH 5FBEA 1K1NA 1KLJH 2FYRA 2PLXA 1UCYK 5DPAA 3MU1A 4CRAA 3BTME 3SUGA 1ZRKA 1UVSH 1GBEA 1O5AB 2HWLB 3KQEA 1DWBH 2OINA 1C1MA 2FOMB 1Z8GA 3F9HA 1CA8B 5SGAE 1P9UA 1AMHA 1UMAH 4CRBA 1YCPM 1O3DA 1UCYE 2XRCA 2AGEX 1PYTD 1EP6A 1Z6EA 1QNJA 1SLWB 2BVSH 2D1JA 1V2QT 3V7TA 1DOJA 1C4U2 2FOBA 3SN8A 4DIIH 1Y5BT 1HPGA 2K1QA 2Y7XA 2ZNKH 1O3MA 2GZ9A 1A0LA 3SV9A 3Q3KA 4WH6A 3PTBA 1TGNA 5LGOA 4I31A 2FOAA 2FX6A 2AMDA 1K1OA 1AZ8A