3VB6A

Crystal structure of sars-cov 3c-like protease with c6z
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb6A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb6A02
2JKHA 2XC0A 4NG9H 4NA7A 2OXSA 1AWHB 1S85A 3A7WA 4BXWA 3SO3A 1DE7H 1K1LA 1C5YB 3DT0H 3RXGA 2BD7A 1OKXA 1O33A 1L2EA 1FY3A 2CGAA 1V2JT 4ABFA 2F9PA 3RC6A 1V6DA 6CHAB 2BZAA 4DG4A 1CE5A 3AAUA 1DX5M 2OC7A 3U1IB 1WQVH 1MKXK 4BOHA 4ABEA 1DSTA 4I33A 4D9RA 3P8NA 4OS5A 3I78A 1O2NA 4Y7BA 2XNIA 4GCHF 1QGFA 1MTVA 2OC0A 3M7QA 1FPCH 3MO3A 1ANDA 1C1UH 1TX8A 1GG6C 1N8OB 4FU9A 2ZGCA 5E2PA 5FPSA 3SQEE 1SQAA 3ZZ9A 2SGEE 2BOKA 2NWNA 2GV6A 1ELBA 1AIXH 2Y5GA 1C1TA 3M36A 1O2HA 2G52A 4X1PU 3RXOA 1E38B 1P2KA 3GY6A 2RA0A 1LHGH 1GL1A 1BBRH 3SJKA 5A8ZA 1UTQA 4OS1A 1FY5A 3FP6E 1O32A 3U9AH 5TCAA 1QJ7B 4OS7A 2BD9A 2G00A 4WMDA 1P9UA 3HKIB 1C5PA 3ZZ6A 1MZDA 2QF0A 2YNAA 2BLVA 1K1IA 2P16A 5C5OA 2BVXH 2Z6BD 1GCDA 2AGGX 1LHDH 4JZFH 4Y6DA 4WXVA 1SB1H 3RXQA 5IDKA 1BRAA 1A0JA 2G5VA 3QZRA 2BVSH 2HPQH 2P3UB 4UFGH 3N7OA 3PYHA 1TBZH 1A1RA 3ATLA 1TABE 3RLWH 2GT8A 1KSNA 1HYLA 2Y7XA 5EPYA 1WU1A 1JIRA 1KY9A 1O2JA 1GI6A 2A7JA 2FWWA 2ZHDA 4ZHLU 1SOTA 2ZO3H 1WOFA 3PWBA 3B9FH 5DP6A 2UUJB 1AE8H 1UHBA 2B8OH 1O2UA 3MH4A 3LDXH 3SBKA 4K1SA 2GZ7A 4CREA 1LPKB 2VIWA 3SORA 2AIPA 2ZPSA 2BQ6B 4ZKRU 1LPGB 2BY7X 1T7CA 1LQEA 1AGJA 1O2KA 1RIWB 1TWXB 3SGBE 4D76A 1TBRH 2XYAA 3MNBA 4O97A 1AFEH 2VWMA 1IQNA 3QX5H 2ZF0H 3KHVA 1YPJH 3S9BA 2RG3A 3UIRA 4UONA 1BHXB 2ZI2H 3V0XA 5LPFA 4NFEA 4ZAEA 1O5GH 1MBQA 2ZGXH 1GBBA 4FUJA 4Y11E 4UFDH 2EA3A 2FIRH 2EI7A 1CA8B 1IAUA 3TIUA 5F6MA 3I29A 5GJ4B 2EI8A 4AX9H 1J14A 1K2I1 2IOTA 3U1JB 4X0WU 1VJAU 1IQMA 3ZYEA 1VJ9U 2HNTE 2CJIA 4DT7B 3SOSA 4MPVA 2ZGHA 5DP8A 1C5RA 3RXJA 1UCYK 1HAGE 5FX5A 2ALVA 3SNDA 1PQAA 1EATA 1LKBA 4Q7XA 1NU7B 1W13U 2P8OC 4TWWA 5GXPA 3FANA 4ABDA 4GHQA 1HJAC 4NSVA 1TB6H 3Q3XA 1F0UA 1SFQB 1V2QT 3UWJH 2F3CE 3K9XB 4H6SB 4KTUA 1C1MA 1FY4A 5IYTA 1DFPA 2ZPRA 3NPSA 2VU8E 1ZR0A 2BOHB 3A7YA 3SNCA 3P8FA 2A5IA 2Y5HA 1OWIA 1BRBE 1O3OA 2A7CA 1MKXH 1FAXA 4INHA 4Z0KA 1W7GH 3RM0H 4I8HA 3LGTA 4WH6A 3F1SB 2F9VA 4NGAH 3SV2H 1TNHA 5SGAE 5HMAA 1SQTA 4ISOA 1ZPBA 2HOBA 4LOYH 1LHEH 1ESBA 1LMWB 1F7ZA 1ELGA 1MAYA 1RTFB 1W14U 2A32A 2WPKS 3BTTE 3VB3A 3E3TA 3T25A 3ZVAA 4X6OA 2A5KA 4KTSA 3VGCC 1P10A 1P2IA 3QUMP 2ZU3A 3E6PH 4NZQA 2XBVA 1O2TA 1ZLRA 3U8TH 3K2UA 1O2IA 2IPHA 1C5ZB 1V2VT 1L1NA 1EB1H 1OX1A 2LNCA 1F5RA 1OWKA 3PM3A 3V3MA 1X7AC 1KDQA 5DG6A 1TPSA 2PGBB 3Q77A 3QWCH 6GCHF 2GP9B 4ISHH 3RXLA 1HBTH 2GZ8A 1J17T 4WY3A 1DUEA 5ESTE 3NK8A 2ZTZA 3UOPA 4M7GA 2G51A 1BITA 3ZV8A 2Y82A 4A5TS 1PPEE 2CXVA 2QXIA 1C1QA 5I46H 1JIMA 1ZRKA 3EQ0H 4Y79A 3MU0A 1EKBB 1NRQH 1HAIH 1NRPH 1O3CA 2NU3E 1GBHA 1BTHH 1O2QA 1C2LA 3MO9A 1K1OA 4GLYA 5EPNA 2FX6A 2QXGA 1ZMNA 1P2OA 2ZKSA 3OU0A 2FI4E 5EODA 4R8TB 3VEQB 1V3XA 2G4UA 3IWMA 3ATKA 3MOCA 3M5OA 4Q80A 8ESTE 1GBAA 1XUJA 4JYUH 3KQCA 1IQGA 4X1RU 1D6WA 5EU8A 1SHYA 2B9LA 1QJ6B 1GBFA 2OBOA 1TGCA 5J4QA 4Y8YA 2ZU2A 1UVTH 2BD4A 1MD8A 1O3IA 1P3CA 3SJIA 4DJZB 3BG8A 2FOHA 1UTPA 5FCKA 1PJPA 3GDSA 1B7XB 4O3UA 3TJUA 1JBUH 2TGTA 3U8RH 2WPJS 1WYKA 1YM0A 2ESTE 2BHGA 4CH2B 4FVBA 2O9QA 4MNXA 1GHAG 1O2ZA 2BD3A 4K69A 3D23A 3ODFA 4AB8A 4BAKB 1YGCH 3LOXA 2ZFTA 4JMYA 2F9BH 3EGKH 4KKDA 2ZDAH 2VJ1A 2XRCA 4GPGA 2VVUA 4DIHH 1S5SA 5J4SA 1TLDA 2VINA 2Q6DA 1BUIA 4B74A 2TGPZ 1W7XH 4ABJA 3BTQE 4XBCA 1LCYA 3ZVBA 1GBKA 1UJ1A 1UVUH 1DLKB 1WV7H 1TGSZ 1C2JA 1Y59T 1HB0B 4FUBA 4VGCC 5AF9H 1UCYH 1GHVH 2YOLA 1ARBA 5CHAC 2QGRA 1W0ZU 3BEFB 1BJVA 3A88A 4TPYA 2G8TA 4AB9A 1J16A 1HV7A 3RXBA 4RKOB 4B71A 2ASUB 2FM2A 1THPB 2XWBI 1D6RA 1KXCA 2R0LA 2G55A 1O2XA 5K7RA 4K8YA 1C1PA 5I25A 3R0FA 3ZVEA 1EJMA 3K6ZA 1C1VH 3Q3YA 2GTBA 2WUBA 5L2ZH 1XUHA 2C8ZB 1GBMA 1E36B 2AYWA 1CHOF 2PWXA 3A8DA 3KL6A 1PPFE 1GCTC 3UNRA 1CU1A 2CHAC 2W7UA 4XE4A 2VH0A 1GHXH 1TA2A 2Q6GA 2J95A 1F2SE 2CMYA 2TBSA 3A8CA 3A80A 1FNIA 1D4PB 1NRRH 2Z94A 4MNVA 3PLBA 1AMHA 1XMNB 3E1XB 4DCDA 5EQRA 3TH3H 2HLCA 3OYPA 4ZHAA 1HGTH 3Q00A 1ZYOA 1F5KU 6LPRA 4AG1A 1MCTA 3ZVGA 4BTTB 1ZRBA 1H9IE 3SU4A 3L3TA 1GJDB 3NKKA 4AOQA 5LGOA 2Z9JA 3PB1E 3GY8A 2FS8A 1D3DB 1QFKH 5JYIA 3L33A 4FXGH 1P3EA 1VITF 1AFQC 2A1DB 2GMTC 3RMNH 3C27B 1G32B 3ESTA 3RXHA 2A2QH 1O5DH 1Q31A 2VH6A 4U2WA 1ZSLA 1TIOA 1UTJA 1LTOA 1ZOMA 5FAHA 1AB9C 1J9CH 3EDXB 1SLXB 3VB7A 5PTPA 1TOCB 1ANCA 3MYWA 1C5XB 1ESAA 4WXIA 1G30B 5E0HA 1XUIA 3M3TA 1AHTH 2JH0D 1INCA 1E35B 1C4V2 4UD9H 1NU9A 3RXUA 1P02A 2WPIS 1Z1IA 2QAAA 1CO7E 5HM2A 3NWUA 1O2MA 1OYTH 3K65B 5HYOA 4ZHMU 1G9IE 1CGJE 3LKWA 3KQBA 4KGAA 3SUGA 1MUEB 2Q6FA 1FAKH 2UWPA 5AVDA 2QN5T 2PR3A 1NPMA 2AFQB 2TRMA 4J1YA 2UUYA 3E8LA 3STIA 1OWEA 2A7HA 2FOMB 2HPPH 1QQ4A 1SL3A 3O8DA 4JCNA 2ZCKP 4A92A 2RA3A 3TJNA 2ZP0H 3HPTB 4IC5A 1CSOE 2BDIA 1AUTC 3F68H 4JYVH 5C1UA 1O2OA 2QIQA 3TJOA 1S6HA 1GJ4H 3GYLB 1MU8B 1FQ3A 1IQFA 1P03A 1G2LA 3LONA 3EBNA 3UQVA 2R0KA 1G3EA 3A7TA 3S9CA 4JYTA 3VXFH 3CS7A 1ZZZA 3NZIA 2R3YA 1OYQA 1UO6A 1BHXF 1C9TA 2ZNKH 2PKAB 2V0BA 3M5NA 1SGYE 4X8VH 2FZZA 1Q2WA 1C2FA 2ZCLP 3BIVH 3PTNA 3MH7A 2ZWLH 4KELA 5C1XA 1F5LA 1C1SA 4FUCA 3DA9B 5F8XA 3B23B 2VIPA 2FMJA 2QYIA 4AFSA 4MDSA 4X2VA 3OY6U 3RMOH 2OP9A 1BA8B 3RXAA 3A83A 1VCWA 3URDA 2K1QA 1ZSJA 2ULLA 2XCNA 4KTCA 1Q3XA 3KF2A 1TA6A 4YLQH 1DT2A 7GCHG 3GISB 3BTKE 2ZFSA 4CRBA 1LVMA 4K5ZA 5JB8S 1W12U 5ETXA 3JZ2B 1CGIE 4FU7A 1S0QA 3RLYH 1S84A 2PKAA 2TPIZ 3JZ1B 3SU3A 3D62A 2FOAA 3GCHB 3RMLH 1DWBH 1DANH 1DS2E 3SJ9A 1IQHA 2P93A 4K1TA 2Z9LA 2ZA5A 4HZHA 5ABWA 5DGJA 5E8EH 1V2LT 3FZDA 3UR6A 1WUNH 2W7SA 1V2NT 1LPZB 1V2OT 3HK3B 2WPLS 1PQ8A 1EASA 3F9FA 1AU8A 3A8BA 1O2LA 2BLQA 1MQ5A 2SGDE 4Y71A 1TFXA 5C20A 5DJ7A 4D8NA 4I32A 4TY7A 7ESTE 2F83A 2BX3A 1A0LA 1BMLA 5JDUB 2VVCA 1D3PB 1MD7A 4JZIA 2VGCC 1RXPA 3Q76A 2ZDMA 1O39A 4ABAA 5B6OA 4UFEH 1UTKA 2O8LA 4CR9A 3CENA 5T3HA 2FEQH 3S69A 7LPRA 4FUHA 3FVFB 4LK4A 3ENSB 1OWHA 3LC3A 3RXVA 1DWDH 3GY4A 4CRCA 1YYY1 1C5LH 1QBOA 1A46H 2TGAA 2BD5A 1HAYB 2EI6A 1QA7A 1SFIA 2PV9B 5JBCS 1CHOG 1T4VH 3BG4C 4K2YA 3MU1A 5E0GA 1H4WA 1GL0E 1IQJA 2HNTC 1GMDF 1G2MA 3R3GB 1WBGB 4NSYA 3SNAA 1TPOA 1QB6A 1O2VA 2BX4A 4D7GA 2YNBA 3BF6H 3RXEA 1GHAF 1SGQE 4ABGA 4MTBA 5AFYH 1IQEA 3MHWU 4FUFA 1SGFA 1DVAH 1KXEA 1HJAB 3S7HB 2JETB 2PHBA 1C4Y2 2JH5D 3SHAH 1RFNA 1C1WH 2Y5FA 1DXPA 4AGJA 4BAOB 1GGDB 3PMAB 1SGFG 4X2YA 3OSYA 2H9EH 1O2SA 2XBXA 3SGAE 4AZ2B 4UE7H 3QZQA 3GCOA 2SGPE 1OP8A 3SV8A 1GDQA 1GJ9B 3LC5A 1AE5A 3GDUA 1PQ7A 3SHCH 1FDPA 3IITA 2OINA 4X1NU 4H42U 2PFEA 2SGAA 4BANB 3TH4H 1NFXA 3VXEH 1GHZA 4NA9H 2Y80A 3MFJA 2K7XA 1THRH 2F9UA 2LPRA 1VITG 1K1PA 2HVXA 1TAWA 3GCNA 4AYVB 1P9SA 4YTAA 3UY9A 1GHYH 1CA0C 1BTXA 1CBWB 3SQHE 1XX9A 2Z9GA 1C2IA 2UWOA 4K1EA 1QRXA 5DP5A 3EA7A 1C2EA 1C2KA 4CR5A 3ZVCA 2ZDVH 1XUGA 1GJ8B 4X8UH 3TNSA 2H6MA 1FY8E 1NT1A 2GCHF 2BM2A 3TPIZ 1GBCA 4ESTE 1EP5A 4LZ4B 1QURH 1SI5H 1LHCH 2W3KA 4JZ1A 2ZFRH 4SGAE 1D3QB 4TPIZ 2V35A 4DW2U 2FOEA 1SGRE 1P0SH 3OY5U 2VIDA 2XC4A 1UTLM 1O0DH 4MQAA 1N8OC 3PMBB 2BTCE 5L30H 2KAIB 4O03A 1WCZA 1T31A 2BDAA 3ZZCA 2EEKA 1ANBA 2A45B 1K1MA 1ZJKA 2GV7A 2VWOA 3RXFA 4IS5A 4XFQA 1BOQA 1GVKB 2ZHEH 1PPCE 4JZEH 2JH6D 2NU1E 2BQ7B 3RXIA 1WTHD 5AHGH 2BDHA 5GWZA 3BTFE 4ABHA 5HXFA 3WY8A 3GY7A 3RXTA 1Y5BT 4NIWA 1G3DA 3OTJE 1Y3UA 3A8AA 3DFLA 3BTWE 1SVPA 1O3FA 2BD2A 3MNSA 2B5TB 2BXTH 1ETRH 1PQ5A 3PROA 1G36A 4Q2KA 1FIZA 4ABIA 1BQYA 2W26A 2PGQB 1SC8U 1EQ9A 3P17H 1SGTA 2KAIA 3P6ZB 5F8ZA 4A1VA 1TRMA 1RGQA 3T2NA 4E7NA 4NCYA 4MVNA 2ODPA 1YPGH 2PUXB 4ISLA 4Y0ZE 2AIQA 1QL8A 4YOIA 3RXRA 2P3FH 3SJOA 1L4DA 3TITA 1NY22 5L6NH 1MCVA 5EQSA 2VWNA 4WWYA 4X6PA 4OS4A 5FXLA 1AKSB 1GVZA 3FP8E 1FV9A 1KTTB 2ANMH 4YESB 2I6QA 1KIGH 1GJ6A 3GY2A 2D2DA 3UUZA 2WV4A 1TGBA 4CBNA 2H9HA 4Y10E 2QY0B 4NZLA 2J4IA 2VB0A 1HIAB 1RIWC 1SSXA 2OC8A 1EZUC 3Q3KA 1MQ6A 3RDZA 2PUQH 1TBQH 3URCA 1W0YH 3RP2A 3TLOA 4NIVA 3C1KA 1F92A 1O30A 2SFAA 4NWLA 1K28D 1V2UT 3A85A 2AMDA 1IQIA 1XKBC 1ZMJA 3P95A 1V2MT 2C8XB 4QT8C 1C5SA 3VB6A 1GI8B 4HFPB 6ESTA 1CQQA 1MKWK 1S6FA 1ZTJA 2C90B 1H9LB 2ALPA 1O3BA 1O5FH 2GCTB 4X8TH 1AI8H 5DK1A 1NS3A 3ZZ3A 4ZKNU 3M5MA 1SGEE 1PPZA 5DPAA 4IGDA 3MO6A 2BD8A 4MG3A 4RSPA 1HIAA 8GCHG 1RJXB 3SU6A 1A3EH 1WQSA 1DWEH 3A7ZA 1YLCA 2VWLA 1GJAB 1DPOA 1E37B 1GCTB 3LGYA 2ILNA 1GMHF 1P05A 4WJG2 5E0JA 5AFZH 2UUKB 1HJ9A 4INLA 3LJOA 1FJSA 1GDUA 1GMDG 1IHTH 1XXDA 1SGPE 3ATMA 1A0HB 1C9PA 2FOFA 3RXSA 5H4IB 1GBEA 7GCHF 1NRNH 5A8XA 1ELFA 1S83A 2IN2A 1SG8B 1KLTA 5EXMA 1C1NA 4XSKU 4YOJA 1QCPA 2AERH 1O2WA 4MNWA 1SLVB 2QXHA 1AY6H 2BVRH 3H5CB 1Y3YA 3BTGE 3PO1B 3KNXA 8LPRA 1T8NA 4TYDA 3SUDA 3I77A 1TMUH 2F9OA 1ELAA 4IN2A 4DOQA 1EUFA 4IBLH 1TQ0B 1FPHH 3SNEA 2PTNA 5C1YA 3PLKA 1TRNA 1NN6A 2ZHQH 2F9NA 4B73A 1O3DA 3EA9A 1TX6A 1BDAA 4B75A 1B0FA 3V7TA 1ZHMA 1UTMA 1PPGE 1XUKA 1P12E 1VZQH 1P2JA 4GVUA 2GX4A 1S0RA 4WVPE 4FUIA 1C5TA 1RTLA 1EPTB 5FBEA 1YLDA 1TQ7B 1FMGA 1TNLA 1O2GH 1JRSA 2OC1A 4R0IA 2A0QB 2GCHG 2SGQE 3UR9A 5JB9S 5C5NA 1O3JA 3NUMA 2O8MA 4BTIB 2C93B 1RD3B 3SI3H 1TNIA 2TIOA 2BB4A 3LGIA 1TRYA 3HGNA 1PPBH 1S81A 1ZHRA 5T6DA 2SNWA 1EJAA 2C4FH 2Y6TA 2HALA 2AS9A 2GGVB 2IJOB 3TGJE 1AZ8A 1Y3WA 4CRGA 1ETTH 1O2YA 4BAMB 2WUCA 2BMGB 1VCPA 3PMHB 2C3SA 2Y81A 3ZZ4A 4UFFH 2ANWA 2FODA 2FLBH 1U6QA 1BBRE 4LZ1H 1EPTA 3MTYA 4IMZA 2ZFQH 1ARCA 4MPUA 1ELDE 1TYNA 1O37A 2NU4E 2PW8H 5EXLA 2AGIX 1GI3A 1NO9H 4ZXXH 1MTNC 3BIUH 4K60A 2FI5E 1Z1JA 3P70B 2Z3EA 4AORA 2C8WB 2ZU1A 4YZUA 1DY9A 1O3MA 4BAHB 2AMQA 3BN9A 5CE1A 2BZ6H 3TK6A 2ZGBH 3L6PA 2ZDKA 1CGHA 2GKVE 4THNH 2G5NA 4ISIH 1VGCB 1D3TB 1KLJH 2B7DH 5G4BA 2FTMA 4F4OC 1BMMH 1Z6JH 4CHAB 1KYNA 1SOZA 4MPWA 1MKWH 1E34B 1T32A 1A3BH 1QIXB 2Y7ZA 2WYJA 3MNXA 1DITH 1ACBE 2R3UA 1HCGA 2CN0H 3ZVDA 3P8OA 4WF8A 1Y8TA 2OD3B 1EAUA 4XOJA 2THFB 2A5AA 4IC6A 3V13A 3U69H 1BZXE 2HWLB 4CRFA 3E0PB 2CF9H 3SUEA 2VNTA 1HAZB 1RS0A 2ZHWH 4E7RG 1YPLH 4DVAU 3M35A 2NU0E 4Q7YA 1O36A 1N1LA 1MU6B 5A09A 4K3JA 3HKJB 5FPYA 3PV4A 1HUTH 1GI9B 1TOMH 3T27A 3E16B 1AZZA 2F91A 2FXRA 3LPRA 3QLPH 4Y0YE 1BB0B 1LDTT 1EZXC 2FOGA 2ZU5A 1ZMLA 1XVMA 1GG6B 5JBTA 1O31A 2XW9A 5BRRE 1C1OA 3HATH 1G3BA 1XXFA 1D9IA 1HDTH 1SMFE 5EGMA 1UK4A 4HTCH 3GY3A 3GY5A 1HNEE 1MTSA 3VFEA 1SHHB 3GYMA 2VGCB 4D7FA 5A0AE 2J94A 1LVYA 2AMPA 1QTFA 2V6NA 2ZPQA 3KQEA 3NCLA 5FX6A 5C67A 1HJ8A 1HPGA 2PLXA 1O5BB 1KXFA 3RC5A 3UFAA 1QRWA 2R9PA 3O8BA 4CRAA 4CRDA 1GWAA 4MPXA 2LIZA 1ZPCA 1OSSA 4AFUA 1GMHG 2VVVA 1KXBA 3RXPA 2XTTB 3U98H 1OP0A 2BQWB 2PTCE 2ZQ2A 5A8YA 1BTZA 1P11E 2A4QA 2UWLA 4I8LA 5GIBA 4WH8A 2VIQA 3PLPA 2BDCA 3IG6B 4Q7ZA 1EOLA 4AG2A 3RC4A 1Z8JB 1ELVA 3LU9B 2GZ9A 3KIDU 5EG4A 1L4ZA 1A5HA 1O38A 1JMOH 3HGPA 3TK9A 3M3SA 5EW2H 2D26C 3GICB 3ZYDA 2FYQA 1T8OA 1J15A 3F9GA 1SBWA 1T8MA 2ZFFH 3K6YA 3ITIA 1SR5C 2VIOA 1GHWH 1KTSB 2ZHFH 3U8OH 1O3KA 2Z3DA 3RXDA 1C2DA 1ELCA 3UREA 1C5QA 1EJNA 3NXPA 4CH8B 1CA0B 1QJ1B 1L1JA 1CT4E 4NFFA 2GDDA 1UTOA 1JOUB 2XBYA 1JWTA 2OQ5A 4I7YH 1BIOA 1KXDA 2OTVA 3BTME 1Y5AT 5K0HA 4BNRA 4Y76A 1QB9A 1BT7A 8GCHF 1T4UH 2ANYA 3MWIU 4AN7A 2FLRH 4A1TA 5A0CA 1EX3A 1NFYA 4X1SU 4LXBH 1YC0A 1O3PB 3BEUA 2H2ZA 1ELEE 5EQQA 1C4U2 2A2XH 1DDJA 4UDWH 1GBIA 1UMAH 1P01A 3RUOA 5C2ZA 3SU1A 4F49A 3SV6A 3ATIA 1W10U 2PKSC 3SJ8A 1HXEH 2WPHS 3MNCA 1LHFH 1PYTC 5T6FA 1H9HE 2WPMS 1P57B 4NIXA 1AVWA 4H6TA 4YLUA 1YPHE 1UHBB 1O2PA 3SN8A 1DY8A 3RU4E 2P8OB 4XBBA 4YO9A 3AAVA 2QXJA 3S7KB 2FI3E 5F03A 3MU5A 4GUXA 3FP7E 4FUEA 2G81E 4B1TA 2G4TA 5DO4H 3UPEA 3O8RA 2ZZUH 3RM2H 3LGUA 2GVFA 2FPZA 3KQDA 1QBNA 4IMQA 1IQKA 1HAXB 1FZZA 1ZGIA 4IW4E 4INKA 1Z8IB 3M7UA 1BTUA 1AVXA 1W11U 1ZJDA 2ZU4A 4HI3A 1EZSC 5FCRA 4AYYB 1JRTA 1GJBB 1Y3XA 4UEHH 1EP6A 1QL9A 1A4WH 4I8JA 2CF8H 1YCPK 3A82A 1EAIA 3STJA 2P95A 1O2RA 2Z9IA 3M3VA 1T8LA 3A7XA 1GHBF 2ZQ1A 1O35A 4IN1A 3A87A 1EOJA 1MZAA 1AD8H 1K22H 1UK2A 1TE0A 3GCHC 2PSYA 6CHAC 1V2KT 1QB1A 2QF3A 3S9AA 1W8BH 1EZQA 1RTKA 9ESTA 5BPEA 3VGCB 1H8IH 2ZCHP 3DFJA 5GCHF 4OS6A 1M9UA 3UWIA 2FYRA 1DSUA 2FX4A 2WINI 1FN6A 5E2OA 1GBLA 2EC9H 2QV1A 1BRUP 2BYAX 3ZZ7A 1N6YA 1L1GA 1O3HA 2A4GA 4ZMAH 4ZH8A 1QL7A 1UCYE 2RCEA 4DY7B 3BTHE 1V2ST 1FI8A 5FHTA 1UVSH 2I6SA 1MMJN 1NC6A 1YPMH 1K1JA 1TGNA 1TMTH 4I8GA 3M61U 3T26A 3EE0B 1MH0A 1A5GH 1WSSH 2BDGA 1UVOA 1ZTKA 2XBWA 5HGGA 3ZVFA 3ATWA 5L2YH 1NFUA 3SZNA 4FU8A 5EXNA 1A61H 2ZTYA 2A4OA 4YT7H 3RXCA 2J92A 3LGVA 1AO5A 4FUGA 1YPKH 3BV9B 3GOVB 1DWCH 4ABBA 1BJUA 1EAXA 1FIWA 3D65E 2A4RA 5T6GA 1YPEH 1OOKB 1HAVB 2GDEH 4YM9A 2SGFE 1ABIH 4ZROA 2SNVA 3A84A 1YKTA 2ODQA 2XCFA 3QO6A 2JETC 1OPHB 1GPZA 1XUFA 2UUFB 3KEEA 4B76A 4KP0A 1GGDC 2ZIQH 1PPHE 1MTUA 1UTNA 1Z8GA 1GMCF 5EOKA 1FUJA 1P2QA 2ODYB 4AFQA 1BMNH 1ANEA 1CT2E 1EAWA 1ABJH 1O3LA 2ZG0H 1BTPA 1KDQB 3SGQE 5JBAS 7KMEH 4A7IB 1FXYA 1LVOA 3QTVH 3SV7A 1NTPA 4A6LA 3VB4A 1NZQH 2XXLA 2V3HH 3KCGH 1GDNA 1F0SA 1GVLA 1XKAC 3A81A 1K9OE 2FO9A 4H4FA 3TVJB 4J2YB 1CBWC 1O3NA 3MH5A 1AWFH 2M5TA 1QA0A 1TGTA 3RXMA 4B2BA 2O8UA 3ZZBA 1GI0A 1HAHH 2AEIH 1HAVA 4ZUHA 1C5WB 3PMJA 3LH3A 4NWKA 1W2KH 2Z9KA 1NM6A 2ZFPH 2J38A 3EA8A 1LKAA 2D1JA 4FUDA 4VGCB 4B2AA 3PWCA 3BTDE 5C3NA 2ANKH 2OBQA 5CHAB 3SV9A 1AKSA 1GBDA 5A2MH 3G01A 4A1XA 1C5UA 3KGPA 1GI5A 3D49H 1TMBH 3GCTF 4XBDA 3BEIB 1H8DH 3MH6A 3AW0A 1TPAE 3M7TA 1HFDA 1C2MA 3AASA 8KME2 1O3AA 1A2CH 1C5NH 1P8VC 3UTUH 3P8GA 1HXFH 4GCHG 3W95A 1HRTH 3QGJA 1QY6A 2O8WA 1CVWH 3SU2A 3BSQA 1G3CA 1YCPH 4I31A 1B5GH 1V2PT 2Q1JA 5DKMA 5DP9A 2ZTXA 4JK6A 1ESTA 1MAXA 1O3GA 2CHAB 3ZZ8A 3EYDA 5DP7A 1V2WT 2H5CA 1ZHPA 3TNTA 3QTOH 1O34A 1B0EA 3QGNB 5A0BA 2ZDLA 1IHSH 2BY9X 4SGBE 1G37A 3ZZDA 1ZSKA 4JK5A 2TGDA 4X6MA 1P09A 1TX7A 1VCQA 5DP4A 5TJXA 4DGJA 1P04A 1E0FD 3A7VA 4TY6A 4U32A 3E91A 1AVGH 1MTNB 1WAYB 1ELTA 3VPKA 5JPMH 1A5IA 3SI4H 2VIVA 1EXFA 1THSH 3PTBA 3TH2H 2OQUA 1MTWA 2Z3CA 3A89A 3FAOA 1Y3VA 1UK3A 1ZPZA 3QK1A 3B8JA 2BLWA 3ZZAA 3UQOA 3TK5A 3TGKE 1AFQB 4Z6AH 2GMTB 3T29A 2QCYA 2ZGJA 1P2MA 5DP3A 1HLTH 2BY6X 1RRKA 1IQLA 2HNTF 4DURA 3UNQA 1AB9B 2D8WA 1GHBG 1SQOA 2P3TB 3FFGA 3ODDA 3E0NB 1C5VA 3T28A 3BTEE 2B0FA 1BRCE 5LPEA 1Z8RA 4E06H 1YCPM 2J34A 4U30A 3ZV9A 3O8CA 1AUJA 3LGWA 3LH1A 1ZGVA 1PFXC 4O3TA 1GJ7B 5GCHG 2FESH 2W5EA 4TWYA 1JXPA 1Z71A 3KN2A 1LO6A 5FBIA 2RDLA 1GI1A 1V2RT 1AN1E 3GDVA 2GT7A 2BLOA 2A31A 2AH4X 1Z6EA 1EB2A 3AW1A 2V3OH 2ZC9H 2FOBA 3TGIE 1GJCB 1CHGA 5LH8A 2GCTC 1P06A 1IOEA 3MMGA 1DICA 2W3IA 3F9HA 1LVBA 1O5EH 4X8SH 1SGDE 1UVPA 1BTYA 3P92A 2P59A 4B2CA 1DUAA 1TONA 3T62A 4ISNA 5JBBS 1GI4A 2DE9A 2QA9E 1QNJA 5CMXH 1GJ5H 2WV5A 3UNSA 1KXAA 1FONA 1YF4A 4CBOA 3DD2H 4AGKA 1DM4B 1K1NA 1TNJA 4YT6H 4BAQB 3EAJA 1SLUB 3UOUA 1C1RA 2H1UA 4WMEA 5HM9A 1W3CA 2J2UA 3MU4A 2ZECA 4X1QU 2P94A 4K8BA 2H9TH 3W94A 3T5FH 3RU4D 3DUXH 1MBMA 2QC2A 1OWJA 2FTLE 3SU5A 2R2WU 4ASHA 3M37A 1GBTA 4MLFB 1LQDB 3PO1C 1GMCG 1Y5UT 1DOJA 1GBJA 2Z7FE 4GHTA 1BBRK 4ZKSU 2WYGA 5EW1H 1ID5H 1AQ7A 1DLEA 1O3EA 3QDZB 1XM1A 4WMFA 2XC5A 3V12A 4GSOA 4JZDH 5ESBA 2NU2E 3RMMH 3VB5A 3SW2B 2OLGA 4ZKOU 1KLIH 5TCCA 1F0TA 3OX7U 1J8AA 2HRVA 2OUAA 3AVZA 2H5DA 2ZDNA 1O5AB 2BY5X 1SPJA 1EPTC 2STBE 2STAE 2DUCA 1C2HA 2R2MB 3F9EA 1SLWB 1NESE 1QQUA 2BDBA 1SGCA 4GAWA 2CV3A 4Y7AA 4ZXYH 4HGCA 1YBWA 1QRZA 3FZZA 4RN6A 1V2TT 1VITH 4O9VA 3TU7H 1BTWA 1OS8A 1XVOA 3HK6B 1NRSH 3S0NA 1FLEE 2FDAA 2AGEX 2XWAA 1O5CB 3M5LA 2GD4B 2BY8X 1F0RA 3RXKA 1GI7B 4I8KA 1CT0E 4OGYA 5FPTA 3MU8A 4BXSA 4E05H 3QN7A 3LIWA 1C5OH 1NFWA 6GCHG 3SNBA 1BMAA 1ORFA 1QBVH 2FOCA 1SGIB 3GCTG 4YOGA 2C8YB 4BTUB 2ZEBA 1QHRB 1OXGA 1TPPA 1H1BA 2PSXA 1WTGH 1PYTD 2FS9A 4Y8XA 4DIIH 1YP9A 4MNYA 1QR3E 4FVDA 3CS0A 3SUFA 1S82A 1ZTLA 2FP7B 4RKJB 4AFZA 2J9NA 2PKSB 3H7TA 1OP2A 1TNGA 3BG4B 1C5MD 1DXWA 2HGTH 1SGNE 1YPHC 1FN8A 3CP7A 3A86A 3DHKH 2BDYA 1NROH 4X6NA 1TNKA 1L0ZA 2O8TA 4NIYA 9LPRA 3E90B 4NA8A 5GDSH 1BCUH 3ZZ5A 5F8TA 1TALA 1VGCC 1A7SA 1C2GA 2DE8A 4D9QA 1FY1A 3ELAH 3F6UH 1P2NA 4U01A 4CHAC 4Y8ZA 1OWDA 1VR1H 4PROA 1ETSH 4X2WA 4X2XA 5GPIB 3SU0A 1K21H 3LJJA 1Z7KA 3H7OA 4OGXA 3RU4T 3TJVA 5LPRA 1HAPH 2BXUH 4OS2A 4XDEA 3MI4A 1N6XA 2OCVB 1GI2A 1HAOH 3LT3A
chains in the Genus database with same CATH superfamily
2JKHA 2XC0A 4NG9H 4NA7A 2OXSA 1AWHB 1S85A 3A7WA 4BXWA 3SO3A 1DE7H 1K1LA 1C5YB 3DT0H 3RXGA 2BD7A 1OKXA 1O33A 1L2EA 1FY3A 2CGAA 1V2JT 4ABFA 2F9PA 3RC6A 1V6DA 6CHAB 2BZAA 4DG4A 1CE5A 3AAUA 1DX5M 2OC7A 3U1IB 1WQVH 2KCAA 1MKXK 4BOHA 4ABEA 1DSTA 4I33A 4D9RA 3P8NA 4OS5A 3I78A 1O2NA 4Y7BA 2XNIA 4GCHF 1QGFA 1MTVA 2OC0A 3M7QA 1FPCH 3MO3A 1ANDA 1C1UH 1TX8A 1GG6C 1N8OB 4FU9A 2ZGCA 5E2PA 5FPSA 3SQEE 1SQAA 3ZZ9A 2QE7D 5EJ1A 2SGEE 2LELA 2BOKA 2NWNA 2GV6A 1ELBA 1AIXH 2Y5GA 1C1TA 3M36A 1O2HA 2G52A 4X1PU 3RXOA 1E38B 1P2KA 3GY6A 2RA0A 1LHGH 1GL1A 1BBRH 3SJKA 4OM9A 5A8ZA 1UTQA 4OS1A 1FY5A 5CHBA 3FP6E 1O32A 1SKYE 3U9AH 5HIYA 5TCAA 1QJ7B 4OS7A 2BD9A 2G00A 4WMDA 1P9UA 3HKIB 1C5PA 3ZZ6A 1MZDA 2QF0A 2YNAA 5KEDA 2BLVA 1K1IA 2P16A 5C5OA 2BVXH 2Z6BD 1GCDA 2AGGX 1LHDH 4JZFH 4Y6DA 4WXVA 1FX0B 1SB1H 3RXQA 5IDKA 1BRAA 1A0JA 2G5VA 3QZRA 2BVSH 2HPQH 2KCOA 2P3UB 4UFGH 3N7OA 3PYHA 1TBZH 1A1RA 3ATLA 1TABE 3RLWH 2GT8A 5B6LA 1KSNA 1HYLA 2Y7XA 5EPYA 1WU1A 1JIRA 1KY9A 1O2JA 1GI6A 2A7JA 2FWWA 2ZHDA 4ZHLU 1SOTA 2ZO3H 1WOFA 3PWBA 3B9FH 5DP6A 4ASUD 2UUJB 1AE8H 1UHBA 2YMSC 2B8OH 1O2UA 3MH4A 3LDXH 3SBKA 4K1SA 2GZ7A 4CREA 1LPKB 2VIWA 3SORA 2AIPA 2ZPSA 2WHXA 2BQ6B 4ZKRU 1LPGB 2BY7X 4P00A 1T7CA 1LQEA 1AGJA 1O2KA 1RIWB 1TWXB 3SGBE 4D76A 1TBRH 2XYAA 3MNBA 4O97A 1AFEH 2KCPA 2VWMA 1IQNA 3QX5H 2ZF0H 3KHVA 1YPJH 3S9BA 2RG3A 3UIRA 4UONA 1BHXB 2ZI2H 3V0XA 5LPFA 4NFEA 4ZAEA 1O5GH 1MBQA 2ZGXH 1GBBA 4FUJA 4Y11E 5HIZA 4UFDH 2EA3A 2FIRH 2EI7A 1CA8B 1IAUA 3TIUA 5F6MA 3I29A 5GJ4B 2EI8A 4AX9H 5F53A 1J14A 1K2I1 2IOTA 3U1JB 4X0WU 1VJAU 1IQMA 3ZYEA 1VJ9U 2HNTE 2CJIA 4DT7B 3SOSA 4MPVA 2ZGHA 5DP8A 1C5RA 3RXJA 1E79D 1UCYK 1HAGE 5FX5A 2ALVA 3SNDA 1PQAA 1EATA 2KZ4A 1LKBA 4Q7XA 1NU7B 1W13U 2P8OC 1NBMD 4TWWA 5GXPA 3FANA 4ABDA 4GHQA 1HJAC 4NSVA 1TB6H 3Q3XA 1F0UA 1SFQB 1V2QT 3UWJH 2F3CE 3K9XB 4H6SB 4KTUA 1C1MA 1FY4A 5IYTA 1DFPA 2ZPRA 3NPSA 2VU8E 4F55A 1ZR0A 2BOHB 3A7YA 3SNCA 3P8FA 2A5IA 2Y5HA 1OWIA 1BRBE 1O3OA 2A7CA 1MKXH 1FAXA 4INHA 4Z0KA 1W7GH 3RM0H 4I8HA 3LGTA 4WH6A 3F1SB 2F9VA 2AHME 4NGAH 3SV2H 1TNHA 5SGAE 5HMAA 1SQTA 3OEED 4ISOA 1ZPBA 2HOBA 4LOYH 1LHEH 1ESBA 1LMWB 4Q63A 1F7ZA 1ELGA 1MAYA 1RTFB 1W14U 2A32A 2WPKS 3BTTE 3VB3A 3E3TA 3F2HA 3T25A 3ZVAA 4X6OA 2A5KA 4KTSA 3VGCC 1P10A 1P2IA 3QUMP 2ZU3A 3E6PH 4NZQA 2XBVA 1O2TA 1ZLRA 3U8TH 3K2UA 1O2IA 2IPHA 1WXRA 1KMHB 1C5ZB 1V2VT 1L1NA 1EB1H 1OX1A 2LNCA 1F5RA 1OWKA 2GJGA 3PM3A 3V3MA 1X7AC 1KDQA 5DG6A 1TPSA 2PGBB 3Q77A 3QWCH 6GCHF 2GP9B 4ISHH 3RXLA 1HBTH 2GZ8A 1J17T 4WY3A 1DUEA 5ESTE 3NK8A 2ZTZA 2F43B 4M7GA 3UOPA 2G51A 1BITA 3ZV8A 2Y82A 4A5TS 5KECA 1PPEE 2CXVA 2QXIA 5EJZA 1C1QA 5I46H 1JIMA 1ZRKA 3EQ0H 4Y79A 3MU0A 1EKBB 1NRQH 1HAIH 1NRPH 1O3CA 2NU3E 1GBHA 1BTHH 1O2QA 1C2LA 3MO9A 1K1OA 4GLYA 5EPNA 2FX6A 2QXGA 1ZMNA 1P2OA 2ZKSA 3OU0A 1COWD 2FI4E 5EODA 4R8TB 3VEQB 1V3XA 2G4UA 3IWMA 3ATKA 3MOCA 3M5OA 4Q80A 8ESTE 1GBAA 1XUJA 4JYUH 3KQCA 1IQGA 4X1RU 1D6WA 5EU8A 1SHYA 2B9LA 1QJ6B 1GBFA 2OBOA 1TGCA 5J4QA 4Y8YA 2ZU2A 1UVTH 2BD4A 1MD8A 1O3IA 1P3CA 3SJIA 4DJZB 3BG8A 2FOHA 1UTPA 5FCKA 1PJPA 3GDSA 1B7XB 4O3UA 3TJUA 1JBUH 2TGTA 3U8RH 2WPJS 1WYKA 1YM0A 2ESTE 2BHGA 4CH2B 4FVBA 2O9QA 4MNXA 1GHAG 1O2ZA 2BD3A 4K69A 3D23A 3ODFA 4AB8A 4BAKB 1YGCH 3LOXA 2ZFTA 4JMYA 2F9BH 3EGKH 4KKDA 2ZDAH 2VJ1A 2XRCA 4TSFD 4GPGA 2VVUA 4DIHH 1S5SA 5J4SA 1TLDA 2VINA 2Q6DA 1BUIA 4B74A 2TGPZ 1W7XH 4ABJA 3BTQE 2V7QD 4XBCA 1UW7A 1LCYA 3ZVBA 1GBKA 1UJ1A 1UVUH 1DLKB 1WV7H 1TGSZ 1C2JA 1Y59T 1HB0B 2KCYA 4FUBA 4VGCC 5AF9H 1UCYH 1GHVH 2YOLA 1ARBA 5CHAC 2QGRA 1W0ZU 3GS9A 3BEFB 5FL7D 1BJVA 3A88A 4TPYA 2G8TA 4AB9A 1J16A 5GNDA 1HV7A 3RXBA 4RKOB 4B71A 2ASUB 2FM2A 1THPB 2XWBI 1D6RA 1KXCA 2R0LA 2G55A 1O2XA 5K7RA 4K8YA 1C1PA 5I25A 3R0FA 3ZVEA 1EJMA 3K6ZA 1C1VH 3Q3YA 2GTBA 2WUBA 5L2ZH 1XUHA 2C8ZB 1GBMA 1E36B 2AYWA 1CHOF 2PWXA 3A8DA 3KL6A 1PPFE 1GCTC 4XRNA 3UNRA 1CU1A 2CHAC 2W7UA 4XE4A 2VH0A 1GHXH 1TA2A 2Q6GA 2J95A 1F2SE 2CMYA 2TBSA 3A8CA 3A80A 1FNIA 1D4PB 1NRRH 2Z94A 4MNVA 3PLBA 1AMHA 1XMNB 3E1XB 4DCDA 5EQRA 4B6EA 3WW7A 3TH3H 2HLCA 3OYPA 4ZHAA 1HGTH 3Q00A 1ZYOA 1F5KU 6LPRA 4AG1A 1MCTA 3ZVGA 4BTTB 1ZRBA 1H9IE 3SU4A 3L3TA 1GJDB 3NKKA 4Q4LA 4AOQA 2Z9JA 5LGOA 3PB1E 3GY8A 2FS8A 1D3DB 1QFKH 5JYIA 3L33A 4FXGH 1P3EA 1VITF 1AFQC 2A1DB 2GMTC 3RMNH 3C27B 1G32B 3ESTA 3RXHA 2A2QH 1O5DH 1Q31A 2VH6A 4U2WA 1ZSLA 1TIOA 1UTJA 1LTOA 1ZOMA 5FAHA 1AB9C 1J9CH 3EDXB 1SLXB 3VB7A 5PTPA 1TOCB 1ANCA 3MYWA 1C5XB 1ESAA 4WXIA 1G30B 5E0HA 1XUIA 3M3TA 1AHTH 2JH0D 1INCA 1E35B 1C4V2 4UD9H 1E1QD 5KGOA 1NU9A 3RXUA 1P02A 2WPIS 1Z1IA 2QAAA 1CO7E 5HM2A 1SQRA 3UAIC 3NWUA 1O2MA 3W1EA 1OYTH 3K65B 5HYOA 4ZHMU 1G9IE 1CGJE 3LKWA 3KQBA 4KGAA 3SUGA 1MUEB 2Q6FA 1FAKH 2UWPA 5AVDA 2QN5T 2PR3A 1NPMA 2AFQB 2TRMA 4J1YA 2UUYA 3E8LA 3STIA 1OWEA 2A7HA 2FOMB 2HPPH 1QQ4A 1SL3A 3O8DA 4JCNA 2ZCKP 4A92A 2RA3A 3TJNA 2ZP0H 3HPTB 4IC5A 1CSOE 2BDIA 1AUTC 3F68H 4JYVH 5C1UA 1O2OA 2QIQA 3TJOA 1S6HA 4RI0A 1GJ4H 3GYLB 1MU8B 1FQ3A 3F2FA 1IQFA 1P03A 1G2LA 3LONA 3OAAD 5T1VA 3EBNA 3UQVA 2R0KA 1G3EA 3A7TA 3S9CA 4JYTA 3VXFH 3CS7A 1ZZZA 3NZIA 2R3YA 1OYQA 1UO6A 1BHXF 1C9TA 2ZNKH 2PKAB 2V0BA 3M5NA 1SGYE 4X8VH 2FZZA 1Q2WA 1C2FA 2ZCLP 3BIVH 3PTNA 3MH7A 2ZWLH 4KELA 5C1XA 1F5LA 1C1SA 4FUCA 3DA9B 5F8XA 3B23B 3KQ5A 2VIPA 2FMJA 2QYIA 4AFSA 4MDSA 4X2VA 5DN6D 3OTPA 3OY6U 3RMOH 2OP9A 1BA8B 3RXAA 2VBCA 3A83A 1VCWA 3F0PA 3URDA 2K1QA 1ZSJA 2ULLA 2XCNA 4KTCA 1Q3XA 3KF2A 1TA6A 2YMSD 4YLQH 1DT2A 7GCHG 3GISB 3BTKE 2ZFSA 3FN8A 4CRBA 1LVMA 4K5ZA 5JB8S 1W12U 5ETXA 2RFKC 3JZ2B 1CGIE 4FU7A 1S0QA 1W0KD 3RLYH 1S84A 2PKAA 2TPIZ 3JZ1B 3SU3A 3D62A 2FOAA 3GCHB 3RMLH 1DWBH 1DANH 1DS2E 3SJ9A 1IQHA 2P93A 3ZIAD 4K1TA 2Z9LA 2ZA5A 4HZHA 5ABWA 5DGJA 5E8EH 1V2LT 3FZDA 3UR6A 1WUNH 2W7SA 1V2NT 1LPZB 1V2OT 3HK3B 2WPLS 1PQ8A 1EASA 3F9FA 1AU8A 3A8BA 1O2LA 2BLQA 1MQ5A 2SGDE 4Y71A 1TFXA 5C20A 5DJ7A 4D8NA 4I32A 4TY7A 7ESTE 2F83A 2HLDD 2BX3A 1YLNA 1A0LA 1BMLA 5C17A 5JDUB 2VVCA 1D3PB 1MD7A 4JZIA 4DT4A 2VGCC 1RXPA 3Q76A 2ZDMA 1O39A 4ABAA 5B6OA 4UFEH 1UTKA 2O8LA 4CR9A 3CENA 5T3HA 2FEQH 3S69A 7LPRA 2EY4C 4FUHA 3FVFB 4LK4A 3ENSB 1OWHA 3LC3A 3FO8D 3RXVA 1DWDH 3GY4A 4CRCA 1YYY1 1C5LH 1QBOA 1A46H 2TGAA 2BD5A 1HAYB 2EI6A 1QA7A 1SFIA 2PV9B 5JBCS 1CHOG 1T4VH 3BG4C 4K2YA 3MU1A 5E0GA 1H4WA 1GL0E 1IQJA 2HNTC 1GMDF 1G2MA 3R3GB 1WBGB 4NSYA 3SNAA 5C94A 1TPOA 1QB6A 1O2VA 2BX4A 4D7GA 2YNBA 3BF6H 3F3BA 3RXEA 1GHAF 1SGQE 4ABGA 4MTBA 4F48B 5AFYH 1IQEA 3MHWU 4FUFA 1SGFA 1DVAH 1KXEA 1HJAB 3S7HB 2JETB 2PHBA 1C4Y2 2JH5D 3SHAH 1RFNA 1C1WH 2Y5FA 1DXPA 4AGJA 4BAOB 1GGDB 3PMAB 1SGFG 4X2YA 3OSYA 2H9EH 1O2SA 2XBXA 3SGAE 4AZ2B 4UE7H 3QZQA 3GCOA 2SGPE 1OP8A 3SV8A 1GDQA 1GJ9B 3LC5A 1AE5A 3GDUA 2RDEA 1PQ7A 3SHCH 1FDPA 3OE7D 3IITA 2OINA 2PP6A 4X1NU 4H42U 2PFEA 2SGAA 4BANB 3TH4H 1NFXA 3DSGA 3VXEH 1GHZA 4NA9H 2Y80A 3MFJA 2K7XA 1THRH 2F9UA 2LPRA 1VITG 1K1PA 2HVXA 1TAWA 3GCNA 4AYVB 1P9SA 4YTAA 3UY9A 1GHYH 1CA0C 1BTXA 1CBWB 3SQHE 1XX9A 2Z9GA 1C2IA 2UWOA 4K1EA 3VG8A 1QRXA 5DP5A 3EA7A 1C2EA 1C2KA 4CR5A 3ZVCA 2ZDVH 1XUGA 1GJ8B 4X8UH 4ZCNA 3TNSA 1FY8E 1NT1A 2BM2A 2GCHF 2H6MA 3TPIZ 1GBCA 4ESTE 1EP5A 4LZ4B 2M2AA 1QURH 1SI5H 1LHCH 1VKYA 2W3KA 4JZ1A 2ZFRH 4SGAE 1D3QB 4TPIZ 2V35A 4DW2U 2FOEA 1SGRE 1P0SH 3OY5U 2VIDA 2XC4A 1UTLM 1O0DH 4MQAA 1N8OC 3PMBB 2BTCE 5L30H 2KAIB 3MQKC 4O03A 1WCZA 1T31A 2BDAA 3ZZCA 2EEKA 1ANBA 2A45B 1K1MA 1ZJKA 2GV7A 2VWOA 3RXFA 4IS5A 4XFQA 1BOQA 1GVKB 2ZHEH 1PPCE 4JZEH 2QF5A 2JH6D 2NU1E 2BQ7B 3RXIA 1WTHD 5AHGH 2BDHA 1BMFD 5GWZA 3BTFE 4ABHA 5HXFA 3WY8A 3GY7A 3RXTA 1Y5BT 4NIWA 2LP6A 1G3DA 5C0TA 3OTJE 1Y3UA 3A8AA 3DFLA 2V3MA 3BTWE 1SVPA 1O3FA 4ACBA 2BD2A 3MNSA 2B5TB 2BXTH 1ETRH 1PQ5A 3PROA 1G36A 4Q2KA 1FIZA 4ABIA 1BQYA 2W26A 2PGQB 1SC8U 4FOUC 1EQ9A 3P17H 1SGTA 2KAIA 3P6ZB 3EE7A 5F8ZA 1TRMA 4A1VA 1RGQA 3T2NA 4E7NA 4NCYA 4MVNA 2ODPA 1YPGH 2PUXB 4ISLA 4Y0ZE 2AIQA 1QL8A 4YOIA 3RXRA 2P3FH 3SJOA 1L4DA 3TITA 5EIYA 1NY22 5L6NH 1MCVA 5EQSA 2VWNA 4RT0A 4WWYA 4X6PA 4OS4A 5FXLA 1AKSB 1GVZA 3FP8E 1FV9A 1KTTB 2ANMH 4YESB 2I6QA 1KIGH 1GJ6A 3GY2A 2D2DA 4RT1A 3UUZA 2WV4A 1TGBA 4CBNA 2H9HA 4Y10E 2QY0B 4NZLA 2J4IA 2VB0A 1HIAB 1RIWC 1SSXA 2OC8A 1EZUC 3Q3KA 1MQ6A 3RDZA 2PUQH 1TBQH 3URCA 1W0YH 3RP2A 3TLOA 4NIVA 3C1KA 1F92A 1O30A 2SFAA 4NWLA 1K28D 1V2UT 3A85A 1H8ED 2AMDA 1IQIA 1XKBC 1ZMJA 3P95A 1V2MT 2C8XB 4QT8C 1C5SA 2IPQX 3VB6A 1GI8B 4HFPB 6ESTA 1CQQA 1MKWK 1S6FA 1WDIA 1ZTJA 2C90B 1H9LB 2ALPA 1O3BA 1O5FH 2GCTB 4X8TH 1AI8H 5DK1A 1NS3A 3ZZ3A 4ZKNU 3M5MA 1SGEE 1PPZA 5DPAA 4IGDA 3MO6A 2BD8A 4MG3A 3WWBA 4RSPA 1HIAA 8GCHG 1RJXB 3SU6A 2K0QA 1A3EH 1WQSA 1DWEH 3A7ZA 1YLCA 2VWLA 1GJAB 1DPOA 1E37B 1GCTB 3LGYA 2ILNA 1GMHF 1P05A 4WJG2 5E0JA 5AFZH 2UUKB 1HJ9A 4INLA 3LJOA 1FJSA 1GDUA 1GMDG 1IHTH 1XXDA 1SGPE 3ATMA 1A0HB 1C9PA 2FOFA 3RXSA 5H4IB 1GBEA 7GCHF 1NRNH 5A8XA 1ELFA 1S83A 2IN2A 1SG8B 1KLTA 5EXMA 1C1NA 4XSKU 4YOJA 1QCPA 2AERH 1O2WA 4MNWA 1SLVB 2QXHA 1AY6H 2BVRH 3H5CB 1Y3YA 3BTGE 3NRLA 3PO1B 3KNXA 8LPRA 1T8NA 4TYDA 3SUDA 3I77A 1TMUH 2F9OA 1ELAA 4IN2A 4DOQA 1EUFA 4IBLH 1TQ0B 1FPHH 3SNEA 2PTNA 5C1YA 3PLKA 1TRNA 1NN6A 2ZHQH 2F9NA 4B73A 1O3DA 3EA9A 1TX6A 1BDAA 2WZQA 1B0FA 4B75A 3V7TA 1ZHMA 1UTMA 1PPGE 1XUKA 1P12E 1VZQH 1P2JA 4TT3D 4GVUA 2GX4A 1S0RA 4WVPE 4FUIA 1C5TA 1RTLA 1EPTB 5FBEA 1YLDA 1TQ7B 1FMGA 1TNLA 3DSOA 1O2GH 1JRSA 2OC1A 4R0IA 3OEHD 5DSFA 2A0QB 2GCHG 2SGQE 3UR9A 5JB9S 5C5NA 1O3JA 3NUMA 2O8MA 4BTIB 2C93B 1RD3B 3SI3H 1TNIA 2TIOA 2BB4A 3LGIA 1TRYA 3HGNA 1PPBH 1S81A 1ZHRA 5T6DA 2SNWA 1EJAA 2C4FH 2Y6TA 2HALA 2J98B 2AS9A 2GGVB 2IJOB 3TGJE 1AZ8A 1Y3WA 4CRGA 1ETTH 1O2YA 4BAMB 2WUCA 2BMGB 1VCPA 3PMHB 2C3SA 5CDFE 2Y81A 3ZZ4A 2KX4A 4UFFH 2ANWA 2F4LA 2FODA 2FLBH 1U6QA 1BBRE 4LZ1H 1EPTA 2XNDD 3MTYA 4IMZA 2ZFQH 1ARCA 4MPUA 1ELDE 1TYNA 1O37A 2NU4E 2PW8H 5EXLA 2AGIX 1GI3A 1NO9H 4ZXXH 1MTNC 3BIUH 4K60A 2FI5E 2KR7A 1Z1JA 3P70B 2Z3EA 4AORA 2C8WB 2ZU1A 4YZUA 1DY9A 1O3MA 4BAHB 2AMQA 3BN9A 5CE1A 2BZ6H 3TK6A 2ZGBH 3L6PA 2ZDKA 1CGHA 2GKVE 4THNH 4AC9A 2J98A 2G5NA 4ISIH 3N99A 1VGCB 1D3TB 1KLJH 3PRDA 2B7DH 5G4BA 2FTMA 4F4OC 1BMMH 1Z6JH 4CHAB 1KYNA 1SOZA 4MPWA 1MKWH 1E34B 1T32A 1A3BH 1QIXB 2Y7ZA 2WYJA 3MNXA 1DITH 1ACBE 2R3UA 1HCGA 3SYJA 2CN0H 3ZVDA 3N7EA 3P8OA 4WF8A 1Y8TA 2OD3B 1EAUA 4XOJA 2THFB 2OK5A 2A5AA 4IC6A 3V13A 3U69H 1BZXE 2HWLB 4CRFA 3E0PB 2CF9H 3SUEA 2HVYB 2VNTA 1HAZB 1RS0A 2ZHWH 4E7RG 1YPLH 4DVAU 3M35A 2NU0E 4Q7YA 1O36A 1N1LA 1MU6B 5A09A 4K3JA 3HKJB 5FPYA 3PV4A 1HUTH 1GI9B 1TOMH 3T27A 3E16B 1AZZA 2F91A 2FXRA 3LPRA 3QLPH 4Y0YE 1BB0B 1LDTT 1EZXC 2FOGA 2ZU5A 1ZMLA 1XVMA 1GG6B 5JBTA 1O31A 2XW9A 5BRRE 1C1OA 3SZEA 3HATH 1S6LA 1G3BA 1XXFA 1D9IA 1HDTH 1SMFE 5EGMA 1UK4A 4HTCH 3GY3A 3GY5A 1HNEE 1MTSA 3VFEA 1SHHB 3GYMA 2VGCB 4D7FA 5A0AE 2J94A 1LVYA 2AMPA 1QTFA 2V6NA 2ZPQA 3KQEA 3NCLA 5FX6A 5C67A 1YWUA 1HJ8A 1HPGA 2PLXA 1O5BB 1KXFA 3RC5A 3UFAA 1QRWA 2R9PA 1EFRD 3O8BA 4CRAA 4CRDA 1GWAA 4MPXA 2LIZA 3AK5A 1ZPCA 1OSSA 4AFUA 1GMHG 2VVVA 1KXBA 3RXPA 2XTTB 3U98H 1OP0A 2BQWB 2PTCE 2ZQ2A 5A8YA 2W6JD 1BTZA 1P11E 2A4QA 2UWLA 4I8LA 5GIBA 4WH8A 2VIQA 3PLPA 2BDCA 3IG6B 4Q7ZA 1EOLA 4AG2A 3RC4A 1Z8JB 1ELVA 3LU9B 2GZ9A 3KIDU 5EG4A 1L4ZA 1A5HA 1O38A 1JMOH 3HGPA 3TK9A 3M3SA 5EW2H 2D26C 2YMSB 3GICB 3ZYDA 2JDID 2FYQA 1T8OA 1J15A 3F9GA 1SBWA 1T8MA 2ZFFH 3K6YA 3ITIA 1SR5C 2VIOA 1GHWH 1KTSB 2ZHFH 3U8OH 1O3KA 2Z3DA 3RXDA 1C2DA 1ELCA 3UREA 1C5QA 1EJNA 4I86A 2JJ1D 3PV5A 3NXPA 4CH8B 1CA0B 1QJ1B 1L1JA 1CT4E 4NFFA 1UTOA 2GDDA 1JOUB 2XBYA 1JWTA 2OQ5A 4I7YH 1BIOA 1KXDA 2OTVA 3BTME 1Y5AT 5K0HA 4BNRA 4Y76A 1QB9A 1BT7A 8GCHF 1T4UH 2ANYA 3MWIU 4AN7A 2FLRH 4A1TA 2KFWA 5A0CA 1EX3A 1NFYA 4X1SU 4LXBH 1YC0A 1O3PB 3BEUA 2H2ZA 1ELEE 5EQQA 1C4U2 2A2XH 1DDJA 4UDWH 1GBIA 1QZ8A 1UMAH 1P01A 3RUOA 5C2ZA 3SU1A 4F49A 3SV6A 3ATIA 1W10U 2PKSC 3SJ8A 1HXEH 2W6ID 2WPHS 3MNCA 1LHFH 1PYTC 2CK3D 1H9HE 2WPMS 1P57B 1YY3A 4NIXA 1AVWA 5T6FA 2J5UA 4H6TA 4YLUA 1YPHE 1UHBB 1O2PA 3SN8A 1DY8A 3RU4E 2P8OB 4XBBA 4YO9A 3AAVA 2QXJA 3KYGA 2FI3E 5F03A 3S7KB 4B6FA 3MU5A 4GUXA 3FP7E 4FUEA 2G81E 4B1TA 2G4TA 5DO4H 3UPEA 3O8RA 2ZZUH 3RM2H 3LGUA 2GVFA 2FPZA 3KQDA 1QBNA 4IMQA 1IQKA 1HAXB 1FZZA 1ZGIA 4IW4E 4INKA 1Z8IB 3M7UA 1BTUA 1AVXA 1W11U 1ZJDA 2ZU4A 4HI3A 1EZSC 5FCRA 4AYYB 1JRTA 1GJBB 1Y3XA 4UEHH 1EP6A 1QL9A 1A4WH 4I8JA 2CF8H 1YCPK 3A82A 5C0UA 1EAIA 3STJA 2P95A 1O2RA 2Z9IA 3M3VA 1T8LA 3A7XA 1GHBF 2ZQ1A 1O35A 4IN1A 3A87A 1EOJA 1MZAA 1AD8H 1K22H 1UK2A 1TE0A 3GCHC 2PSYA 6CHAC 1V2KT 1QB1A 2QF3A 3S9AA 1W8BH 1EZQA 1RTKA 9ESTA 5BPEA 3VGCB 1H8IH 2ZCHP 3DFJA 5GCHF 4OS6A 1M9UA 3UWIA 2FYRA 1DSUA 2FX4A 2WINI 1FN6A 3U28C 5E2OA 1GBLA 2EC9H 2QV1A 1BRUP 2BYAX 3ZZ7A 1N6YA 1L1GA 1O3HA 2A4GA 4ZMAH 4ZH8A 1QL7A 1UCYE 2RCEA 4DY7B 3BTHE 1V2ST 1FI8A 5FHTA 1UVSH 2I6SA 1MMJN 1NC6A 1YPMH 1K1JA 1TGNA 1TMTH 4I8GA 3M61U 5HKKD 3T26A 3EE0B 1MH0A 2L6OA 1A5GH 1WSSH 2BDGA 1UVOA 1ZTKA 2XBWA 5HGGA 3ZVFA 3ATWA 5L2YH 1NFUA 3SZNA 4FU8A 5EXNA 1A61H 2ZTYA 4ACAA 2A4OA 2KM0A 4YT7H 3RXCA 2J92A 3LGVA 1AO5A 4FUGA 1YPKH 3BV9B 3GOVB 5EJLA 1DWCH 4ABBA 1BJUA 1EAXA 1FIWA 3D65E 2A4RA 5T6GA 1YPEH 2L74A 1OOKB 1HAVB 2GDEH 4YM9A 2SGFE 1ABIH 4ZROA 2SNVA 3A84A 1YKTA 2ODQA 2XCFA 3QO6A 2JETC 1OPHB 1GPZA 1XUFA 2UUFB 3KEEA 4B76A 4KP0A 1GGDC 2ZIQH 1PPHE 1MTUA 1UTNA 1Z8GA 1GMCF 5EOKA 1FUJA 1P2QA 2ODYB 4AFQA 1BMNH 1ANEA 1CT2E 1EAWA 1ABJH 1O3LA 2ZG0H 1BTPA 1KDQB 3SGQE 5JBAS 7KMEH 3OFND 4A7IB 3F2GA 1FXYA 1LVOA 3FKSD 3QTVH 3SV7A 1NTPA 4A6LA 3VB4A 1NZQH 2XXLA 2V3HH 3KCGH 1GDNA 1F0SA 1GVLA 1XKAC 3A81A 1K9OE 2FO9A 4H4FA 3TVJB 4J2YB 1CBWC 1O3NA 3MH5A 1AWFH 2M5TA 1QA0A 1TGTA 3F0OA 3RXMA 4B2BA 2O8UA 3ZZBA 1GI0A 1HAHH 2AEIH 1HAVA 4ZUHA 1C5WB 2EQNA 3KYFA 3PMJA 3LH3A 4NWKA 1W2KH 3PV2A 2Z9KA 1NM6A 2ZFPH 2J38A 3EA8A 1LKAA 2D1JA 4FUDA 4VGCB 4B2AA 3PWCA 3BTDE 5C3NA 2ANKH 2OBQA 5CHAB 3SV9A 1AKSA 1GBDA 5A2MH 4HG6A 3G01A 4A1XA 1C5UA 3KGPA 1GI5A 3D49H 1TMBH 3GCTF 4XBDA 3BEIB 1H8DH 3MH6A 3AW0A 1TPAE 3M7TA 1HFDA 1C2MA 3AASA 8KME2 1O3AA 1A2CH 1C5NH 1P8VC 3UTUH 3P8GA 4Z1MD 1HXFH 4GCHG 3W95A 1HRTH 3QGJA 1QY6A 2O8WA 4YXWD 1CVWH 3SU2A 3BSQA 1G3CA 1YCPH 4I31A 1B5GH 1V2PT 2Q1JA 5DKMA 1K0HA 5DP9A 2ZTXA 4JK6A 1ESTA 1MAXA 1O3GA 2CHAB 3ZZ8A 3EYDA 5DP7A 1V2WT 2H5CA 1ZHPA 3TNTA 3QTOH 4XD7D 1O34A 1B0EA 3QGNB 3DCLA 2ZDLA 5A0BA 1IHSH 2BY9X 4SGBE 1G37A 3ZZDA 1ZSKA 4JK5A 2TGDA 4X6MA 1P09A 1TX7A 1VCQA 5DP4A 5TJXA 4DGJA 1P04A 1E0FD 3A7VA 4TY6A 4U32A 3E91A 1AVGH 1MTNB 1WAYB 1ELTA 3VPKA 5JPMH 1A5IA 3SI4H 2VIVA 1EXFA 1THSH 3PTBA 3TH2H 2OQUA 1MTWA 2Z3CA 3A89A 2XOKD 3FAOA 1Y3VA 1UK3A 1ZPZA 3QK1A 3B8JA 2BLWA 3ZZAA 3UQOA 3TK5A 3TGKE 1W0JD 1AFQB 4Z6AH 2GMTB 3T29A 2QCYA 2ZGJA 1P2MA 5DP3A 2QF4A 2WSSD 1HLTH 2BY6X 1RRKA 3N7DA 1IQLA 2HNTF 4DURA 3UNQA 1AB9B 2D8WA 1GHBG 1SQOA 2P3TB 3FFGA 3ODDA 3E0NB 1C5VA 3T28A 3BTEE 2B0FA 1BRCE 5LPEA 1Z8RA 4E06H 1YCPM 2J34A 4U30A 3ZV9A 3O8CA 1AUJA 3LGWA 3LH1A 1ZGVA 2JIZD 1PFXC 4O3TA 1GJ7B 5GCHG 2FESH 2W5EA 4TWYA 1JXPA 1Z71A 3KN2A 3WWFA 1LO6A 2WPDD 5FBIA 2RDLA 1GI1A 1V2RT 1AN1E 3GDVA 2GT7A 2BLOA 3FOAA 2A31A 2AH4X 1Z6EA 1EB2A 3AW1A 2V3OH 2ZC9H 2FOBA 3TGIE 1GJCB 1CHGA 5LH8A 2GCTC 1P06A 1IOEA 3MMGA 1DICA 2W3IA 3F9HA 1LVBA 1O5EH 4X8SH 1SGDE 1UVPA 3H09A 1BTYA 3P92A 2P59A 4B2CA 1DUAA 1TONA 3T62A 4ISNA 3PRBA 1NBME 5JBBS 5IK2D 1GI4A 1MABB 2DE9A 2QA9E 1QNJA 5CMXH 1GJ5H 2WV5A 3UNSA 1OHHD 1KXAA 1FONA 1YF4A 2K8IA 4CBOA 3DD2H 4AGKA 1DM4B 1K1NA 1TNJA 4YT6H 4BAQB 4FETA 3EAJA 1H8HD 1SLUB 3UOUA 1C1RA 2H1UA 4WMEA 5HM9A 2WV9A 1W3CA 2J2UA 4M9FA 3MU4A 2ZECA 4X1QU 2P94A 4K8BA 2H9TH 3W94A 3T5FH 3RU4D 3DUXH 1MBMA 2QC2A 1OWJA 2FTLE 3SU5A 2R2WU 4ASHA 3M37A 1GBTA 4MLFB 1LQDB 3PO1C 1GMCG 1Y5UT 2JJ2D 1DOJA 1GBJA 2Z7FE 4GHTA 1BBRK 4ZKSU 3DSPA 2WYGA 5EW1H 1ID5H 1AQ7A 1DLEA 1O3EA 3QDZB 1XM1A 4WMFA 2XC5A 3V12A 4GSOA 4JZDH 5ESBA 2NU2E 3RMMH 3VB5A 3SW2B 2OLGA 4ZKOU 1KLIH 5TCCA 1F0TA 3OX7U 1J8AA 2HRVA 2OUAA 3AVZA 2H5DA 2ZDNA 1O5AB 2BY5X 1SPJA 1EPTC 2STBE 2STAE 2DUCA 1C2HA 2R2MB 3F9EA 1SLWB 1NESE 1QQUA 2BDBA 1SGCA 4GAWA 2CV3A 4Y7AA 4ZXYH 4HGCA 1YBWA 1QRZA 3FZZA 4RN6A 1V2TT 1VITH 3CNRA 4O9VA 3TU7H 1BTWA 1OS8A 1XVOA 3HK6B 1NRSH 3S0NA 1FLEE 2FDAA 2AGEX 2XWAA 1O5CB 3M5LA 2GD4B 2BY8X 1F0RA 3RXKA 1GI7B 4I8KA 2J97A 1CT0E 4OGYA 5FPTA 3MU8A 4BXSA 4E05H 3QN7A 3LIWA 1C5OH 1NFWA 6GCHG 3SNBA 1BMAA 1ORFA 1QBVH 2FOCA 1SGIB 3GCTG 4YOGA 2C8YB 4BTUB 2ZEBA 1QHRB 1OXGA 1TPPA 1H1BA 2PSXA 1WTGH 1PYTD 2IJD1 2FS9A 4Y8XA 4DIIH 1YP9A 4MNYA 1QR3E 4FVDA 3CS0A 3SUFA 1S82A 1ZTLA 2FP7B 4RKJB 4AFZA 2J9NA 2PKSB 3H7TA 1E1RD 1OP2A 1TNGA 3BG4B 1C5MD 1DXWA 2HGTH 1SGNE 1YPHC 1FN8A 3CP7A 3A86A 3DHKH 2BDYA 1NROH 4X6NA 1TNKA 1L0ZA 2O8TA 4NIYA 9LPRA 3E90B 4NA8A 5GDSH 4P02A 1BCUH 3ZZ5A 5F8TA 1TALA 1VGCC 1A7SA 1C2GA 2DE8A 4D9QA 1FY1A 3ELAH 3F6UH 1P2NA 4U01A 4CHAC 4Y8ZA 1OWDA 1VR1H 4PROA 1ETSH 4X2WA 4X2XA 5GPIB 3SU0A 1K21H 3LJJA 1Z7KA 3H7OA 4OGXA 3RU4T 3TJVA 5LPRA 1HAPH 2BXUH 4OS2A 4XDEA 3MI4A 3UB0A 1N6XA 2OCVB 1GI2A 1HAOH 3LT3A
chains in the Genus database with same CATH topology
2JKHA 2XC0A 4NG9H 4NA7A 2OXSA 1AWHB 1S85A 3A7WA 4BXWA 3SO3A 1DE7H 1K1LA 1C5YB 3DT0H 3RXGA 2BD7A 1OKXA 1O33A 1L2EA 1FY3A 2CGAA 1V2JT 4ABFA 2F9PA 3RC6A 1V6DA 6CHAB 2BZAA 4DG4A 1CE5A 3AAUA 1DX5M 2OC7A 3U1IB 1WQVH 1MKXK 4BOHA 4ABEA 1DSTA 4I33A 4D9RA 3P8NA 4OS5A 3I78A 1O2NA 4Y7BA 2XNIA 4GCHF 1QGFA 1MTVA 2OC0A 3M7QA 1FPCH 3MO3A 1ANDA 1C1UH 1TX8A 1GG6C 1N8OB 4FU9A 2ZGCA 5E2PA 5FPSA 3SQEE 1SQAA 3ZZ9A 2SGEE 2BOKA 2NWNA 2GV6A 1ELBA 1AIXH 2Y5GA 1C1TA 3M36A 1O2HA 2G52A 4X1PU 3RXOA 1E38B 1P2KA 3GY6A 2RA0A 1LHGH 1GL1A 1BBRH 3SJKA 5A8ZA 1UTQA 4OS1A 1FY5A 3FP6E 1O32A 3U9AH 5TCAA 1QJ7B 4OS7A 2BD9A 2G00A 4WMDA 1P9UA 3HKIB 1C5PA 3ZZ6A 1MZDA 2QF0A 2YNAA 2BLVA 1K1IA 2P16A 5C5OA 2BVXH 2Z6BD 1GCDA 2AGGX 1LHDH 4JZFH 4Y6DA 4WXVA 1SB1H 3RXQA 5IDKA 1BRAA 1A0JA 2G5VA 3QZRA 2BVSH 2HPQH 2P3UB 4UFGH 3N7OA 3PYHA 1TBZH 1A1RA 3ATLA 1TABE 3RLWH 2GT8A 1KSNA 1HYLA 2Y7XA 5EPYA 1WU1A 1JIRA 1KY9A 1O2JA 1GI6A 2A7JA 2FWWA 2ZHDA 4ZHLU 1SOTA 2ZO3H 1WOFA 3PWBA 3B9FH 5DP6A 2UUJB 1AE8H 1UHBA 2B8OH 1O2UA 3MH4A 3LDXH 3SBKA 4K1SA 2GZ7A 4CREA 1LPKB 2VIWA 3SORA 2AIPA 2ZPSA 2BQ6B 4ZKRU 1LPGB 2BY7X 1T7CA 1LQEA 1AGJA 1O2KA 1RIWB 1TWXB 3SGBE 4D76A 1TBRH 2XYAA 3MNBA 4O97A 1AFEH 2VWMA 1IQNA 3QX5H 2ZF0H 3KHVA 1YPJH 3S9BA 2RG3A 3UIRA 4UONA 1BHXB 2ZI2H 3V0XA 5LPFA 4NFEA 4ZAEA 1O5GH 1MBQA 2ZGXH 1GBBA 4FUJA 4Y11E 4UFDH 2EA3A 2FIRH 2EI7A 1CA8B 1IAUA 3TIUA 5F6MA 3I29A 5GJ4B 2EI8A 4AX9H 1J14A 1K2I1 2IOTA 3U1JB 4X0WU 1VJAU 1IQMA 3ZYEA 1VJ9U 2HNTE 2CJIA 4DT7B 3SOSA 4MPVA 2ZGHA 5DP8A 1C5RA 3RXJA 1UCYK 1HAGE 5FX5A 2ALVA 3SNDA 1PQAA 1EATA 1LKBA 4Q7XA 1NU7B 1W13U 2P8OC 4TWWA 5GXPA 3FANA 4ABDA 4GHQA 1HJAC 4NSVA 1TB6H 3Q3XA 1F0UA 1SFQB 1V2QT 3UWJH 2F3CE 3K9XB 4H6SB 4KTUA 1C1MA 1FY4A 5IYTA 1DFPA 2ZPRA 3NPSA 2VU8E 1ZR0A 2BOHB 3A7YA 3SNCA 3P8FA 2A5IA 2Y5HA 1OWIA 1BRBE 1O3OA 2A7CA 1MKXH 1FAXA 4INHA 4Z0KA 1W7GH 3RM0H 4I8HA 3LGTA 4WH6A 3F1SB 2F9VA 4NGAH 3SV2H 1TNHA 5SGAE 5HMAA 1SQTA 4ISOA 1ZPBA 2HOBA 4LOYH 1LHEH 1ESBA 1LMWB 1F7ZA 1ELGA 1MAYA 1RTFB 1W14U 2A32A 2WPKS 3BTTE 3VB3A 3E3TA 3T25A 3ZVAA 4X6OA 2A5KA 4KTSA 3VGCC 1P10A 1P2IA 3QUMP 2ZU3A 3E6PH 4NZQA 2XBVA 1O2TA 1ZLRA 3U8TH 3K2UA 1O2IA 2IPHA 1C5ZB 1V2VT 1L1NA 1EB1H 1OX1A 2LNCA 1F5RA 1OWKA 3PM3A 3V3MA 1X7AC 1KDQA 5DG6A 1TPSA 2PGBB 3Q77A 3QWCH 6GCHF 2GP9B 4ISHH 3RXLA 1HBTH 2GZ8A 1J17T 4WY3A 1DUEA 5ESTE 3NK8A 2ZTZA 3UOPA 4M7GA 2G51A 1BITA 3ZV8A 2Y82A 4A5TS 1PPEE 2CXVA 2QXIA 1C1QA 5I46H 1JIMA 1ZRKA 3EQ0H 4Y79A 3MU0A 1EKBB 1NRQH 1HAIH 1NRPH 1O3CA 2NU3E 1GBHA 1BTHH 1O2QA 1C2LA 3MO9A 1K1OA 4GLYA 5EPNA 2FX6A 2QXGA 1ZMNA 1P2OA 2ZKSA 3OU0A 2FI4E 5EODA 4R8TB 3VEQB 1V3XA 2G4UA 3IWMA 3ATKA 3MOCA 3M5OA 4Q80A 8ESTE 1GBAA 1XUJA 4JYUH 3KQCA 1IQGA 4X1RU 1D6WA 5EU8A 1SHYA 2B9LA 1QJ6B 1GBFA 2OBOA 1TGCA 5J4QA 4Y8YA 2ZU2A 1UVTH 2BD4A 1MD8A 1O3IA 1P3CA 3SJIA 4DJZB 3BG8A 2FOHA 1UTPA 5FCKA 1PJPA 3GDSA 1B7XB 4O3UA 3TJUA 1JBUH 2TGTA 3U8RH 2WPJS 1WYKA 1YM0A 2ESTE 2BHGA 4CH2B 4FVBA 2O9QA 4MNXA 1GHAG 1O2ZA 2BD3A 4K69A 3D23A 3ODFA 4AB8A 4BAKB 1YGCH 3LOXA 2ZFTA 4JMYA 2F9BH 3EGKH 4KKDA 2ZDAH 2VJ1A 2XRCA 4GPGA 2VVUA 4DIHH 1S5SA 5J4SA 1TLDA 2VINA 2Q6DA 1BUIA 4B74A 2TGPZ 1W7XH 4ABJA 3BTQE 4XBCA 1LCYA 3ZVBA 1GBKA 1UJ1A 1UVUH 1DLKB 1WV7H 1TGSZ 1C2JA 1Y59T 1HB0B 4FUBA 4VGCC 5AF9H 1UCYH 1GHVH 2YOLA 1ARBA 5CHAC 2QGRA 1W0ZU 3BEFB 1BJVA 3A88A 4TPYA 2G8TA 4AB9A 1J16A 1HV7A 3RXBA 4RKOB 4B71A 2ASUB 2FM2A 1THPB 2XWBI 1D6RA 1KXCA 2R0LA 2G55A 1O2XA 5K7RA 4K8YA 1C1PA 5I25A 3R0FA 3ZVEA 1EJMA 3K6ZA 1C1VH 3Q3YA 2GTBA 2WUBA 5L2ZH 1XUHA 2C8ZB 1GBMA 1E36B 2AYWA 1CHOF 2PWXA 3A8DA 3KL6A 1PPFE 1GCTC 3UNRA 1CU1A 2CHAC 2W7UA 4XE4A 2VH0A 1GHXH 1TA2A 2Q6GA 2J95A 1F2SE 2CMYA 2TBSA 3A8CA 3A80A 1FNIA 1D4PB 1NRRH 2Z94A 4MNVA 3PLBA 1AMHA 1XMNB 3E1XB 4DCDA 5EQRA 3TH3H 2HLCA 3OYPA 4ZHAA 1HGTH 3Q00A 1ZYOA 1F5KU 6LPRA 4AG1A 1MCTA 3ZVGA 4BTTB 1ZRBA 1H9IE 3SU4A 3L3TA 1GJDB 3NKKA 4AOQA 5LGOA 2Z9JA 3PB1E 3GY8A 2FS8A 1D3DB 1QFKH 5JYIA 3L33A 4FXGH 1P3EA 1VITF 1AFQC 2A1DB 2GMTC 3RMNH 3C27B 1G32B 3ESTA 3RXHA 2A2QH 1O5DH 1Q31A 2VH6A 4U2WA 1ZSLA 1TIOA 1UTJA 1LTOA 1ZOMA 5FAHA 1AB9C 1J9CH 3EDXB 1SLXB 3VB7A 5PTPA 1TOCB 1ANCA 3MYWA 1C5XB 1ESAA 4WXIA 1G30B 5E0HA 1XUIA 3M3TA 1AHTH 2JH0D 1INCA 1E35B 1C4V2 4UD9H 1NU9A 3RXUA 1P02A 2WPIS 1Z1IA 2QAAA 1CO7E 5HM2A 3NWUA 1O2MA 1OYTH 3K65B 5HYOA 4ZHMU 1G9IE 1CGJE 3LKWA 3KQBA 4KGAA 3SUGA 1MUEB 2Q6FA 1FAKH 2UWPA 5AVDA 2QN5T 2PR3A 1NPMA 2AFQB 2TRMA 4J1YA 2UUYA 3E8LA 3STIA 1OWEA 2A7HA 2FOMB 2HPPH 1QQ4A 1SL3A 3O8DA 4JCNA 2ZCKP 4A92A 2RA3A 3TJNA 2ZP0H 3HPTB 4IC5A 1CSOE 2BDIA 1AUTC 3F68H 4JYVH 5C1UA 1O2OA 2QIQA 3TJOA 1S6HA 1GJ4H 3GYLB 1MU8B 1FQ3A 1IQFA 1P03A 1G2LA 3LONA 3EBNA 3UQVA 2R0KA 1G3EA 3A7TA 3S9CA 4JYTA 3VXFH 3CS7A 1ZZZA 3NZIA 2R3YA 1OYQA 1UO6A 1BHXF 1C9TA 2ZNKH 2PKAB 2V0BA 3M5NA 1SGYE 4X8VH 2FZZA 1Q2WA 1C2FA 2ZCLP 3BIVH 3PTNA 3MH7A 2ZWLH 4KELA 5C1XA 1F5LA 1C1SA 4FUCA 3DA9B 5F8XA 3B23B 2VIPA 2FMJA 2QYIA 4AFSA 4MDSA 4X2VA 3OY6U 3RMOH 2OP9A 1BA8B 3RXAA 3A83A 1VCWA 3URDA 2K1QA 1ZSJA 2ULLA 2XCNA 4KTCA 1Q3XA 3KF2A 1TA6A 4YLQH 1DT2A 7GCHG 3GISB 3BTKE 2ZFSA 4CRBA 1LVMA 4K5ZA 5JB8S 1W12U 5ETXA 3JZ2B 1CGIE 4FU7A 1S0QA 3RLYH 1S84A 2PKAA 2TPIZ 3JZ1B 3SU3A 3D62A 2FOAA 3GCHB 3RMLH 1DWBH 1DANH 1DS2E 3SJ9A 1IQHA 2P93A 4K1TA 2Z9LA 2ZA5A 4HZHA 5ABWA 5DGJA 5E8EH 1V2LT 3FZDA 3UR6A 1WUNH 2W7SA 1V2NT 1LPZB 1V2OT 3HK3B 2WPLS 1PQ8A 1EASA 3F9FA 1AU8A 3A8BA 1O2LA 2BLQA 1MQ5A 2SGDE 4Y71A 1TFXA 5C20A 5DJ7A 4D8NA 4I32A 4TY7A 7ESTE 2F83A 2BX3A 1A0LA 1BMLA 5JDUB 2VVCA 1D3PB 1MD7A 4JZIA 2VGCC 1RXPA 3Q76A 2ZDMA 1O39A 4ABAA 5B6OA 4UFEH 1UTKA 2O8LA 4CR9A 3CENA 5T3HA 2FEQH 3S69A 7LPRA 4FUHA 3FVFB 4LK4A 3ENSB 1OWHA 3LC3A 3RXVA 1DWDH 3GY4A 4CRCA 1YYY1 1C5LH 1QBOA 1A46H 2TGAA 2BD5A 1HAYB 2EI6A 1QA7A 1SFIA 2PV9B 5JBCS 1CHOG 1T4VH 3BG4C 4K2YA 3MU1A 5E0GA 1H4WA 1GL0E 1IQJA 2HNTC 1GMDF 1G2MA 3R3GB 1WBGB 4NSYA 3SNAA 1TPOA 1QB6A 1O2VA 2BX4A 4D7GA 2YNBA 3BF6H 3RXEA 1GHAF 1SGQE 4ABGA 4MTBA 5AFYH 1IQEA 3MHWU 4FUFA 1SGFA 1DVAH 1KXEA 1HJAB 3S7HB 2JETB 2PHBA 1C4Y2 2JH5D 3SHAH 1RFNA 1C1WH 2Y5FA 1DXPA 4AGJA 4BAOB 1GGDB 3PMAB 1SGFG 4X2YA 3OSYA 2H9EH 1O2SA 2XBXA 3SGAE 4AZ2B 4UE7H 3QZQA 3GCOA 2SGPE 1OP8A 3SV8A 1GDQA 1GJ9B 3LC5A 1AE5A 3GDUA 1PQ7A 3SHCH 1FDPA 3IITA 2OINA 4X1NU 4H42U 2PFEA 2SGAA 4BANB 3TH4H 1NFXA 3VXEH 1GHZA 4NA9H 2Y80A 3MFJA 2K7XA 1THRH 2F9UA 2LPRA 1VITG 1K1PA 2HVXA 1TAWA 3GCNA 4AYVB 1P9SA 4YTAA 3UY9A 1GHYH 1CA0C 1BTXA 1CBWB 3SQHE 1XX9A 2Z9GA 1C2IA 2UWOA 4K1EA 1QRXA 5DP5A 3EA7A 1C2EA 1C2KA 4CR5A 3ZVCA 2ZDVH 1XUGA 1GJ8B 4X8UH 3TNSA 2H6MA 1FY8E 1NT1A 2GCHF 2BM2A 3TPIZ 1GBCA 4ESTE 1EP5A 4LZ4B 1QURH 1SI5H 1LHCH 2W3KA 4JZ1A 2ZFRH 4SGAE 1D3QB 4TPIZ 2V35A 4DW2U 2FOEA 1SGRE 1P0SH 3OY5U 2VIDA 2XC4A 1UTLM 1O0DH 4MQAA 1N8OC 3PMBB 2BTCE 5L30H 2KAIB 4O03A 1WCZA 1T31A 2BDAA 3ZZCA 2EEKA 1ANBA 2A45B 1K1MA 1ZJKA 2GV7A 2VWOA 3RXFA 4IS5A 4XFQA 1BOQA 1GVKB 2ZHEH 1PPCE 4JZEH 2JH6D 2NU1E 2BQ7B 3RXIA 1WTHD 5AHGH 2BDHA 5GWZA 3BTFE 4ABHA 5HXFA 3WY8A 3GY7A 3RXTA 1Y5BT 4NIWA 1G3DA 3OTJE 1Y3UA 3A8AA 3DFLA 3BTWE 1SVPA 1O3FA 2BD2A 3MNSA 2B5TB 2BXTH 1ETRH 1PQ5A 3PROA 1G36A 4Q2KA 1FIZA 4ABIA 1BQYA 2W26A 2PGQB 1SC8U 1EQ9A 3P17H 1SGTA 2KAIA 3P6ZB 5F8ZA 4A1VA 1TRMA 1RGQA 3T2NA 4E7NA 4NCYA 4MVNA 2ODPA 1YPGH 2PUXB 4ISLA 4Y0ZE 2AIQA 1QL8A 4YOIA 3RXRA 2P3FH 3SJOA 1L4DA 3TITA 1NY22 5L6NH 1MCVA 5EQSA 2VWNA 4WWYA 4X6PA 4OS4A 5FXLA 1AKSB 1GVZA 3FP8E 1FV9A 1KTTB 2ANMH 4YESB 2I6QA 1KIGH 1GJ6A 3GY2A 2D2DA 3UUZA 2WV4A 1TGBA 4CBNA 2H9HA 4Y10E 2QY0B 4NZLA 2J4IA 2VB0A 1HIAB 1RIWC 1SSXA 2OC8A 1EZUC 3Q3KA 1MQ6A 3RDZA 2PUQH 1TBQH 3URCA 1W0YH 3RP2A 3TLOA 4NIVA 3C1KA 1F92A 1O30A 2SFAA 4NWLA 1K28D 1V2UT 3A85A 2AMDA 1IQIA 1XKBC 1ZMJA 3P95A 1V2MT 2C8XB 4QT8C 1C5SA 3VB6A 1GI8B 4HFPB 6ESTA 1CQQA 1MKWK 1S6FA 1ZTJA 2C90B 1H9LB 2ALPA 1O3BA 1O5FH 2GCTB 4X8TH 1AI8H 5DK1A 1NS3A 3ZZ3A 4ZKNU 3M5MA 1SGEE 1PPZA 5DPAA 4IGDA 3MO6A 2BD8A 4MG3A 4RSPA 1HIAA 8GCHG 1RJXB 3SU6A 1A3EH