4AFQA

Human chymase - fynomer complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 52
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afqA02
5AFZH 4NA7A 1RFNA 3M5MA 3AW1A 1ZJKA 3JZ2B 1FY5A 4A1XA 2VGCC 5FXLA 1NC6A 3O8CA 3ATLA 1DWEH 3UNSA 1GHBG 1GBHA 4XBDA 3PV4A 1E37B 3SHAH 1ZZZA 3IITA 3BTDE 3VGCB 2VWOA 5JBCS 2P8OB 1C1RA 2ANKH 3MH7A 9LPRA 1EJNA 4GHTA 1HAGE 1CT0E 3SJKA 1CVWH 4Y10E 1KDQB 2A4GA 1THRH 5ESBA 2ZFRH 2WUBA 2EC9H 2R9PA 2BB4A 1IQLA 5ABWA 1GI2A 3A82A 4TWYA 3T25A 1TNKA 1A5GH 3LU9B 1QY6A 1UHBA 2J92A 1MD8A 1NTPA 1O5FH 2CHAC 3TH4H 1AI8H 2ZNKH 2BDAA 1PYTC 1S84A 9ESTA 1N6XA 1O39A 1O3PB 4X2YA 3DT0H 5EXMA 3C27B 1GBEA 1S83A 2GKVE 4I8HA 3RUOA 1MZAA 3LKWA 1BBRK 4Y76A 2FOCA 1V2TT 2VINA 3LH1A 2QXJA 5EODA 4H4FA 4IN1A 4DGJA 2NU1E 2TIOA 3A8CA 1GBJA 4BTIB 2ZHEH 1GMHG 3HK3B 2FYQA 1TBQH 2OBOA 1A3EH 1HNEE 4HI3A 2Z94A 6CHAC 1RJXB 1OWEA 2IN2A 1MU8B 5EQQA 3F1SB 3ZVAA 1EP5A 4WH6A 4Y11E 2EA3A 1OX1A 2G5NA 3GISB 5B6OA 1BUIA 3TJVA 1AD8H 3FP6E 3BV9B 3P8GA 4AN7A 2GCTC 1L2EA 3QWCH 1GJ8B 1Z8GA 2QXIA 1IQFA 1Y3XA 3U8TH 4I8GA 1J16A 1ZHPA 1MTWA 3RC5A 1DUAA 1O30A 5E0GA 3RM2H 1D6RA 2XXLA 1TGSZ 1HCGA 2FTLE 3RXQA 1YBWA 4DJZB 3TK5A 1MBMA 3SNAA 2EI6A 4DVAU 4A5TS 4DG4A 1PQAA 1O3NA 1A7SA 5C2ZA 2W3KA 2PTCE 4PROA 3Q77A 4O3UA 1N1LA 2SGEE 1O2MA 1UTJA 3NK8A 2OCVB 2WUCA 3EA8A 2FPZA 3P70B 1C1UH 1PPZA 1QBNA 1EX3A 4ZROA 2G55A 2GCTB 1FY8E 3TGKE 3SQHE 3MFJA 2GZ9A 1KTTB 1TBRH 3PMBB 5L2ZH 2FODA 3B8JA 2ZEBA 4B2CA 3S69A 2SNVA 3RMMH 4GLYA 2QXGA 2A5IA 5K7RA 1F92A 2XBWA 2RA3A 2R3UA 1O3LA 1FI8A 4CHAC 1O3IA 1WQSA 3KL6A 4YT7H 2BD7A 2ZO3H 1YCPM 5F8ZA 5C1XA 1KXCA 1O5EH 1F0UA 1TNJA 1XMNB 2XYAA 1EJMA 2J94A 1BB0B 3LGUA 3QGJA 1PQ5A 3M7QA 2FZZA 1TX6A 4ZXXH 1BRCE 1LHCH 3A80A 1G3CA 4F49A 3RM0H 1O2YA 5GCHF 2PUQH 1O2VA 4ZAEA 2XWBI 1WU1A 1SOTA 3SV8A 1ZR0A 3D65E 5DO4H 2BHGA 2XRCA 1EJAA 2NWNA 1QL7A 1AQ7A 2WPHS 2XC5A 4NSVA 2Z9IA 4Q7YA 3GY6A 2GGVB 2BDIA 2J34A 2R3YA 3PTBA 3KF2A 1GI5A 1NPMA 3CS0A 5HMAA 4CHAB 2HNTC 1P2NA 3HPTB 3RXSA 4A1VA 1V2QT 1ETTH 1HUTH 2Y5GA 2PW8H 3FAOA 3VXFH 4AYYB 2BOKA 3LGTA 1OWIA 4FU7A 4ZKSU 3M3SA 1TAWA 3ZZCA 3GYLB 4I32A 4MTBA 1K1IA 2C4FH 3QLPH 1MTNC 2ZDNA 2PFEA 5LPRA 1UTMA 1LPGB 1DOJA 1ZMNA 3OX7U 1IAUA 2RCEA 2STAE 4F4OC 2ZKSA 1C5WB 3OTJE 2XWAA 4INHA 5GIBA 1A61H 3SGAE 3PROA 1HAYB 1BTPA 1C1MA 1TLDA 1QB6A 4K2YA 1MCTA 2B0FA 1KIGH 1C2FA 2QN5T 3GY5A 1FQ3A 2VVCA 1QRXA 1CA8B 1EZSC 3Q3XA 2FLBH 4ABAA 1BHXB 2ESTE 4Q7ZA 3C1KA 2ALVA 1ANCA 2BD9A 4X6OA 1GBBA 1GHAG 1P3CA 3R0FA 3RC6A 3A8AA 4OS1A 2P95A 4ZHMU 3SU5A 2ILNA 1DXPA 3RXBA 2R0KA 1P9SA 1HB0B 1T8LA 4IC5A 1AFEH 3BIVH 1OWJA 5EQSA 4BOHA 3FFGA 5EPYA 4WF8A 1XUFA 2Y81A 3LDXH 4BAMB 3BF6H 2BQ6B 1ZSKA 2FXRA 2ZFFH 3SV6A 2XBYA 5FPYA 1GDUA 3RMNH 5BPEA 3RXOA 2ZGCA 3RXIA 4YZUA 2B7DH 3U9AH 1UTQA 1DVAH 2WPMS 2WPKS 1AWHB 5HM2A 1EUFA 2ODQA 3P95A 2AS9A 1O2OA 3TLOA 1EZXC 1WYKA 8GCHG 2RG3A 2VWLA 2CJIA 4Y79A 1GCTC 2Z9GA 1GJDB 1MKXK 3MOCA 4JMYA 1VJ9U 1N6YA 1XVOA 2G81E 1TOCB 3SGQE 3G01A 1QB1A 1BZXE 2A0QB 2H9TH 1C5OH 2W7UA 3LJOA 1V2JT 5DP7A 4CH8B 5GWZA 4ABBA 1WSSH 2P93A 2W26A 3OU0A 1JMOH 4B73A 1B7XB 2TGTA 3MNSA 4AG2A 1E38B 3LONA 5DG6A 5FAHA 4U32A 4X2WA 1ZYOA 4ZMAH 3LGIA 4IMQA 3RMOH 4K3JA 1RTFB 2FLRH 4IS5A 1W0YH 2PWXA 1MTUA 3TJNA 5L6NH 1EKBB 2O8UA 1Y3VA 4YOGA 3HKIB 2CMYA 1NU9A 1BMNH 1N8OB 1S6HA 4UE7H 3A7WA 1C5TA 2ZPQA 3UR9A 1ABIH 1TGCA 4DY7B 1GCTB 2BXTH 1DT2A 5H4IB 1QIXB 1NFWA 3DUXH 4WJG2 5FBIA 3GY7A 4GPGA 4D9QA 1V2VT 2QF3A 3Q76A 5LPFA 1KY9A 1JIMA 1GHVH 1P04A 1SHYA 1V2UT 1C4U2 1XVMA 1YC0A 2GTBA 3T28A 2BTCE 3TPIZ 2Z9JA 1AKSA 2NU4E 1BITA 1F0SA 3ATMA 3ZV9A 3S0NA 1C2KA 3A87A 3FZDA 4E06H 1FY3A 3SUDA 1ZSLA 1SBWA 2XCNA 1QB9A 4B2AA 2PKSB 1TA6A 4UONA 1GPZA 3MO3A 3RMLH 3UUZA 1GMCF 2HNTE 4AFZA 4NIVA 1WV7H 3QZQA 4FUGA 1ZTJA 2PKAA 4ABFA 1O3OA 7KMEH 3Q00A 4I33A 3QX5H 2FP7B 1JRSA 3FZZA 5GDSH 2QA9E 3EE0B 3RXPA 3TNSA 2P3TB 1ZPBA 5HYOA 3M5NA 3PM3A 2R0LA 2VH6A 3VB4A 3SJ8A 4ABHA 3S9BA 2WYGA 2ZTYA 1GMDF 2FWWA 1DUEA 1YPKH 2SNWA 1W11U 1MKWK 2YOLA 3SI3H 1MQ5A 1DX5M 4E05H 1SGRE 2Z9KA 1GBLA 1VJAU 3QO6A 2J95A 3VFEA 5AF9H 1TGNA 2Y6TA 4XDEA 2UUJB 4X6PA 3RXUA 1DSTA 1OS8A 1SLUB 1L1GA 2P59A 1S0RA 1ELFA 2ZU3A 1P2JA 1C2MA 4MPXA 5C3NA 1CA0C 1ZGIA 3GCHC 1EOLA 1UVSH 1W13U 2ZCHP 5G4BA 4NA8A 3SW2B 4B74A 4J2YB 1P0SH 3A86A 3T29A 2G4UA 2O8MA 5CHAC 1G3BA 4K1SA 4MPVA 1O5BB 2BD8A 3GICB 1GJCB 3URDA 1A5HA 3VB6A 3PO1B 4AZ2B 1EAWA 1PPBH 3BSQA 5IYTA 4XBBA 4IW4E 1WAYB 3QGNB 4ABIA 3E91A 1Y5AT 2H2ZA 1GL1A 2GV6A 4D7FA 4KKDA 4MLFB 2AMPA 3VEQB 3MNXA 2G5VA 3LIWA 4KTCA 5CE1A 3RXHA 4CRFA 2A5KA 1O2ZA 1MAXA 2H5CA 3M5OA 3GDUA 4LOYH 3TK9A 3KIDU 3E0PB 4GUXA 4Y8ZA 1SSXA 1RD3B 1UCYK 5DJ7A 1C2LA 1O0DH 1P05A 2PGQB 1XXFA 7GCHG 1EAUA 3SN8A 3K65B 4AB8A 1FDPA 2HOBA 5FPSA 3VB3A 2FS9A 8KME2 1T8MA 1P12E 3MNCA 1CA0B 1BCUH 5JPMH 2C8XB 1FPHH 1RIWB 1AU8A 3GCHB 3LGWA 1O32A 2XBXA 1EB1H 5A8XA 1IHSH 3O8BA 6GCHF 1NFUA 4WWYA 1UVUH 1NU7B 1KXEA 5CHAB 2DE8A 1IQKA 1FZZA 2GCHF 3M37A 3GY2A 1QL9A 1LKBA 1WCZA 1DDJA 4MDSA 5T6GA 1NRPH 3QK1A 2C90B 1C1TA 3SBKA 1GJBB 3L33A 1HAPH 5JB8S 1FNIA 1O2SA 1FMGA 1C2DA 2OC1A 4AB9A 3ATWA 1M9UA 3BTHE 2W3IA 2PTNA 2Z3CA 4WXIA 3DA9B 2ZCLP 3SU0A 4FUBA 3SOSA 1PJPA 5EGMA 1O3BA 2QC2A 1PPHE 3L3TA 1KLJH 1IQGA 4DOQA 3NCLA 1TFXA 3EDXB 2VNTA 3DHKH 3MI4A 2VIVA 1TPAE 1Q3XA 3LC5A 4Q2KA 2Q1JA 4SGAE 1ELCA 1AE5A 4AFUA 4BAKB 1TGTA 1CHOF 1RTLA 2FOFA 1HAIH 4VGCC 3GDSA 3EYDA 1UTPA 1AZZA 1ELDE 1EAXA 1DANH 3K9XB 1Y3WA 1HXFH 2PSYA 1GVLA 1K21H 2XTTB 1OYTH 1XKAC 3BEIB 1ELEE 1MD7A 4YTAA 4B75A 4O9VA 2AEIH 3VB5A 1FAKH 3MO6A 1A0JA 2J9NA 1ZMJA 1GHXH 1Z8IB 2GMTC 4X2VA 3IG6B 3M3TA 4I8JA 1C5VA 2Q6DA 2VIPA 1O2XA 3RXLA 4YLUA 1UHBB 2UWLA 2ZFQH 1LQDB 3ATIA 4DCDA 3SU6A 1EPTA 2BX4A 1PFXC 2K1QA 3KGPA 2OTVA 3LGYA 1CGHA 1MU6B 1C1PA 3GCNA 3M35A 1TRMA 1DITH 5DP5A 1VR1H 1GG6C 4VGCB 1QRWA 1C1OA 3UREA 1PPGE 3CENA 2PHBA 1K1LA 1P2QA 2ANMH 4NCYA 2VGCB 1C5MD 3Q3YA 3F9GA 4IBLH 3U1JB 2ZDMA 2QF0A 2D1JA 1GI3A 3HK6B 2H5DA 3RC4A 2TRMA 1CHGA 1WTHD 1O36A 2AMDA 4KP0A 1ZGVA 4NIYA 1SPJA 1QHRB 1F7ZA 2QGRA 2A45B 4Q7XA 3BEUA 5EG4A 2DUCA 2GMTB 2EI8A 5A0BA 1OWKA 3UQVA 1HLTH 5A0CA 1TMTH 1O3MA 1G37A 2QAAA 3F6UH 1BMLA 2PGBB 5C1YA 1TB6H 1NFYA 3ZVEA 7ESTE 1XUJA 4UFEH 1W3CA 3SNDA 2BMGB 2OD3B 2CHAB 4TYDA 2CV3A 2VVUA 4X1SU 1QR3E 2BLVA 3U98H 1GG6B 1NESE 1F5RA 3FP7E 1P2OA 1XUKA 5E2PA 3UNRA 1O31A 3SV7A 3ZYDA 1SGNE 3ZVGA 1EQ9A 4Y71A 3RXDA 5DP6A 3MO9A 3GY8A 2ZP0H 4UFGH 1Y59T 3MWIU 1Z1JA 2A4RA 3M36A 4NFEA 1MAYA 3TH3H 1E36B 1C5PA 6CHAB 1LPKB 4MPUA 1DY9A 2OBQA 5FBEA 4TY7A 2OUAA 1OP2A 1G2LA 2F9VA 5JDUB 5DGJA 2ZPSA 4IN2A 2OLGA 1BDAA 1O5CB 1S0QA 2VU8E 4ABEA 4WH8A 1AY6H 1C1WH 1UVTH 1XUGA 3BIUH 1YGCH 1LMWB 3T62A 4CR5A 3LGVA 3SQEE 3O8RA 1S6FA 1GMDG 1QCPA 4JZDH 1K1PA 1DY8A 5AFYH 2AIPA 4M7GA 4WMEA 5C67A 4K1EA 1QGFA 3SNEA 1ETRH 1YKTA 1DWBH 4MNYA 1S82A 2G8TA 3GYMA 1XM1A 5L30H 2J4IA 1AFQC 1HIAA 3UQOA 2OP9A 4BNRA 1ARCA 1RTKA 1OPHB 1P3EA 2VIOA 1HDTH 1KTSB 1T7CA 4WMFA 4U01A 1UO6A 1BA8B 2ZGHA 3TITA 1GBCA 3KHVA 1RGQA 4GVUA 3ZVCA 1ETSH 2ODYB 2V6NA 4ISHH 3V12A 1ZHRA 1GBKA 3KQBA 1TE0A 2BQWB 1O3EA 1UTKA 2J38A 1JBUH 3UOPA 2BM2A 2FESH 3K6YA 1W14U 2HALA 4X1RU 2ZA5A 2ZC9H 1ZRBA 4JYTA 4MPWA 1VITF 5TJXA 1YCPK 2HGTH 1UJ1A 3RXAA 2G52A 2FOEA 4ZHLU 2VIWA 2ZCKP 2FMJA 5EOKA 4ABJA 1LVBA 2ZQ2A 1P01A 1TMUH 5DKMA 2A1DB 1TNLA 4FUDA 1K1NA 1ORFA 1YPMH 3FP8E 4YO9A 3F9FA 2RA0A 4AGJA 4NFFA 8ESTE 1ZTLA 1NRSH 1F0RA 1AB9C 2Y80A 1AVWA 2C3SA 1Z8JB 3BTKE 2NU0E 1ELGA 1C9TA 3MU4A 1GGDC 1O2HA 3F68H 4X1PU 3SUEA 4FUJA 5FHTA 4D76A 5EW1H 4BANB 4BAOB 1C2HA 2BY5X 1IQIA 4JYVH 1SGFA 1SL3A 1SLWB 1THPB 2TGDA 2IOTA 1DWCH 4KTUA 5DP9A 3A7ZA 1JXPA 4YESB 4K8BA 5AHGH 4ZKRU 1SGDE 3LJJA 1ANBA 4FVBA 3V7TA 5F6MA 1F0TA 1D9IA 2JH5D 1PQ8A 1C2EA 3M7TA 1WOFA 4JCNA 3U8OH 4ASHA 1ZPZA 1B0FA 3E0NB 4NZLA 3LH3A 5E0HA 1T8NA 4O97A 1GDQA 1TPOA 4HTCH 3ZZ7A 1FV9A 2HPQH 2WPLS 1GHWH 1C4Y2 2HPPH 2Y82A 4THNH 1AB9B 1BBRE 4OGXA 2ZHWH 4NIWA 1A46H 5JBBS 2WPIS 1MTVA 1GGDB 3F9EA 1SFQB 1MTNB 4DIHH 1TRYA 1DPOA 5E0JA 5DPAA 1E34B 3D49H 4U30A 1EP6A 3RLWH 5A09A 1D3TB 2ZG0H 3ZYEA 1B0EA 3SU2A 1THSH 2KAIA 2THFB 1ZJDA 2F3CE 2AYWA 2BXUH 6LPRA 4YOJA 1XUIA 3D62A 1GHBF 3P8FA 2ODPA 1NM6A 1GJ6A 1LQEA 4BTUB 3RXRA 3ZZDA 1GBDA 4XFQA 3STIA 2W7SA 1G32B 1C2IA 3PWBA 5DP3A 1GBFA 4XBCA 3UFAA 1MQ6A 2O8LA 2UWPA 4CBOA 2VVVA 2GVFA 1GBIA 2TGPZ 5SGAE 1HPGA 2ZHDA 3UWIA 2BLWA 4OS2A 3E3TA 3RXMA 1DS2E 1H4WA 2SGQE 3BN9A 2EEKA 1HAXB 2O9QA 4E7RG 1MMJN 4XE4A 2ASUB 5J4SA 1QJ7B 2HWLB 2AIQA 4YOIA 2BY7X 3H7OA 2AGIX 2A2QH 3PYHA 4FUFA 4WY3A 1PPFE 1UK2A 2C8ZB 1Y5BT 1QJ1B 3A8BA 1FIZA 4DW2U 1V6DA 1TNGA 2SGDE 2FX6A 3T27A 4AX9H 2F9UA 3UNQA 1GJ4H 2GV7A 1SGFG 5ESTE 1GMHF 3PMAB 1DSUA 1X7AC 4KTSA 2QV1A 3B9FH 1ESBA 1T31A 2V0BA 3EGKH 1S85A 3U1IB 2F83A 3W95A 2OC0A 3A85A 2GDDA 1AKSB 5FX5A 3ZZBA 5HGGA 4DURA 1EOJA 2A31A 2BYAX 3GOVB 3KEEA 1HAVA 3SO3A 1V2OT 2ZF0H 2ZGBH 1D6WA 1H8DH 3RXKA 1GI8B 2Y7ZA 4Q80A 4MQAA 4O03A 1KYNA 3KQDA 3MU5A 3RXEA 2PKAB 3RP2A 2ZU1A 4B2BA 6ESTA 2F9OA 2FM2A 4B76A 1O3FA 1P2IA 1L1JA 1SQOA 1O2KA 4X6MA 4U2WA 1SLXB 2B8OH 1DICA 1SGTA 2ULLA 2ZGXH 2ZTXA 1P57B 1NS3A 3K2UA 1LHDH 2BDCA 1LPZB 1G3DA 3A89A 1HJ8A 1ESAA 5J4QA 2FO9A 2BZ6H 1LKAA 4K1TA 1S81A 2R2MB 2ZQ1A 2A7HA 4Y7AA 1DXWA 2P3UB 1RS0A 5EXLA 4UDWH 5T6FA 2BVSH 1MKXH 2ZWLH 5K0HA 3ENSB 1UTOA 2ZIQH 5EQRA 3LPRA 4YT6H 2FTMA 1LO6A 1MCVA 4GCHF 1SMFE 2STBE 1LVYA 4ESTE 1HV7A 3MH6A 2WV4A 1C2GA 5F8XA 3SNBA 2H9HA 4LZ1H 2GD4B 1TABE 1W2KH 4OS7A 2ZDAH 1K28D 1T4UH 2Z9LA 4NA9H 1AE8H 3RU4D 1CT2E 3ZV8A 1EASA 1FAXA 4BAHB 1CGJE 1G9IE 1XX9A 1SQTA 2NU3E 1FY1A 1QQ4A 1SVPA 1V2NT 2V3OH 4D9RA 4A6LA 3QZRA 5GCHG 1GDNA 2SFAA 1ELVA 3RXVA 3ATKA 4UFDH 1C5QA 1MUEB 2ZFSA 4LK4A 1JRTA 2G00A 3H5CB 1UTLM 3BTWE 1XKBC 2PUXB 1GBAA 2BOHB 2NU2E 3RXFA 2IJOB 1YLCA 1MBQA 3GDVA 1A0HB 3TK6A 1QNJA 1V2WT 1O2LA 4TWWA 2BQ7B 4A7IB 1TMBH 1ABJH 1TA2A 5LH8A 1ZPCA 2SGPE 4X1NU 3V3MA 2FI3E 4NIXA 2A32A 1P02A 4NZQA 1Q2WA 1GI9B 3AVZA 4TY6A 3RLYH 3A7YA 4GHQA 1P2MA 3LOXA 2O8WA 1GI1A 1IQMA 1XUHA 3CP7A 1PPCE 4J1YA 3S7HB 3TGJE 3ZZ3A 4H42U 4LZ4B 1AHTH 1AIXH 4I8KA 4GSOA 3AW0A 4AOQA 4K5ZA 5EPNA 3DFJA 1YF4A 3IWMA 2ZDVH 1P10A 3SNCA 3OSYA 1YLDA 3ESTA 2UUFB 4FVDA 3M5LA 1VCQA 1CE5A 3BG8A 2AERH 4XSKU 3S7KB 1RXPA 2VH0A 1C1NA 1PYTD 4R0IA 1EPTC 3NXPA 1MKWH 2BZAA 1VGCC 1HJ9A 1H9IE 4RN6A 4XOJA 4Y8YA 4FU9A 1W10U 2XBVA 1TWXB 3AAUA 3DFLA 3UY9A 1BRUP 1SC8U 1BMMH 1OP8A 1PQ7A 2AH4X 1C9PA 1C5RA 3F9HA 1KLIH 1O2NA 1Z1IA 2IPHA 2JH6D 1HJAC 4NSYA 4NWKA 1WTGH 1H9HE 1NFXA 5JBTA 1ZMLA 3ODFA 1AMHA 1ELBA 3E1XB 1LHFH 2VJ1A 2FYRA 2BY6X 3PWCA 3A7TA 2TGAA 3NKKA 4UD9H 1YYY1 2TPIZ 5GPIB 4YLQH 3OYPA 5TCCA 3SU4A 3BTTE 2D2DA 4CREA 2VB0A 1TQ7B 1GJ9B 3SGBE 3ODDA 4CRAA 1SGYE 3QDZB 4BXSA 1EPTB 2PV9B 1P09A 1BOQA 2H9EH 2GZ7A 1VGCB 2BLQA 2ZGJA 1DLEA 3UWJH 5EXNA 1UCYH 1BTXA 1TALA 4I31A 4JZFH 3BTME 1P11E 5CMXH 1WBGB 2ZHFH 1DLKB 2Q6GA 1W0ZU 3M61U 1O3HA 2A7CA 1BIOA 1C1SA 2LNCA 3FVFB 8GCHF 1KDQA 1O3GA 1HJAB 1FJSA 1AO5A 1IQEA 1MTSA 3PLBA 1TOMH 1EXFA 4WXVA 1YPGH 5I46H 1LHEH 1Z71A 4LXBH 1GJ5H 1T4VH 1JOUB 5DK1A 2ALPA 3GCOA 1NT1A 1A0LA 4E7NA 1TQ0B 1ZSJA 1F2SE 2HRVA 3P92A 5T6DA 2C8WB 4IGDA 3E6PH 2WINI 5E2OA 2OC8A 1A2CH 1O3AA 2ZZUH 1VCPA 5GJ4B 5EU8A 1H1BA 2I6SA 3KQCA 1O2JA 1BTZA 1LVOA 1OSSA 1TX7A 1FIWA 1O2PA 4MG3A 3EAJA 4DT7B 3SJOA 1FPCH 4JZEH 4OS6A 2WV5A 1AZ8A 2PSXA 1HRTH 1G36A 1C5XB 3NZIA 2F9NA 4FUCA 2Z3DA 1P2KA 3SORA 5FCKA 3T5FH 5L2YH 1C5UA 1HFDA 4CR9A 1HAHH 1YPHC 2UUKB 1OWDA 1ZHMA 2GT8A 5T3HA 1OOKB 4D7GA 1J8AA 1IHTH 3O8DA 4BXWA 1NY22 1UTNA 5A8ZA 1VZQH 1TYNA 2OQUA 1GCDA 1S5SA 4WMDA 4K8YA 1RRKA 1FXYA 1GI6A 1L4DA 2UUYA 1NRQH 2G51A 4B71A 2O8TA 3HGPA 2FOGA 2R2WU 2ZPRA 3TIUA 4RSPA 1SB1H 4FU8A 4R8TB 1C5NH 1GMCG 3P8OA 1GVZA 2BD4A 1V3XA 1LCYA 1SR5C 1WQVH 5C1UA 1BRAA 2HNTF 3S9CA 2CF9H 1K9OE 2OC7A 5EW2H 1P06A 3SJ9A 2BDYA 1LDTT 1BHXF 3WY8A 4MNVA 1ANDA 4X2XA 1GWAA 4IC6A 1GI0A 1T32A 1O37A 3HKJB 1UCYE 1GJ7B 2YNBA 3EQ0H 3MH4A 1C5ZB 1QRZA 1KXBA 2A5AA 4CRDA 3Q3KA 3R3GB 5C5NA 1BJUA 2FOBA 1DM4B 3NPSA 3TU7H 3V0XA 3V13A 3UIRA 4Y8XA 3ZVDA 3K6ZA 1SFIA 2ANYA 1GI4A 4KGAA 1H9LB 3T2NA 3LT3A 4ISIH 1YP9A 4I8LA 3W94A 1VCWA 3PMJA 1QL8A 5BRRE 5LPEA 1HIAB 1U6QA 2TBSA 4GCHG 1HXEH 3RU4E 3QN7A 1BBRH 1P03A 1D3QB 1F5LA 2XC0A 1CT4E 3TNTA 1TONA 4JZ1A 4HZHA 2GP9B 3UPEA 1QJ6B 3S9AA 2VWNA 4TPIZ 4ISOA 4INKA 1CSOE 4A1TA 1AN1E 1SGCA 1CU1A 3SV9A 1O3JA 2WPJS 7LPRA 1FUJA 1GI7B 1XXDA 2FDAA 3SZNA 2H6MA 4Y7BA 1K2I1 4K60A 4JK6A 2Z7FE 2B5TB 2BD5A 3RU4T 4CRGA 1ZLRA 4AYVB 3ITIA 3E16B 2QXHA 5E8EH 4ZKOU 3SI4H 1YM0A 1Z8RA 2PLXA 1K1JA 5GXPA 2Y5HA 5A2MH 3PMHB 5FX6A 1DFPA 3P17H 1OXGA 3P8NA 4TPYA 1AFQB 3OY6U 5A0AE 3GCTF 4YM9A 3MYWA 1J17T 2QCYA 3N7OA 2F9BH 7GCHF 2FS8A 3ZVFA 6GCHG 1TPSA 1QBVH 2C8YB 1W12U 2VIDA 1AGJA 1TPPA 2GCHG 1SLVB 1JWTA 3D23A 1KLTA 3UOUA 2Z3EA 2BDHA 1MZDA 1JIRA 1EATA 1ZRKA 3E8LA 2ZHQH 1CQQA 3MTYA 4Z6AH 1V2RT 3BTEE 5I25A 1J14A 3STJA 5TCAA 3A81A 4BTTB 3U69H 2OQ5A 2F91A 2FEQH 1O34A 2YNAA 1BMAA 3PLKA 1O33A 1QQUA 3MU0A 1G3EA 5JB9S 4AG1A 3EA9A 3SHCH 4NWLA 3RXGA 1J15A 1Y3UA 2V35A 1SGEE 1LHGH 3MU1A 3MMGA 2FOAA 3MU8A 2XC4A 2CGAA 3SJIA 3A88A 1BRBE 4HFPB 1ELTA 2ZDLA 5AVDA 1CHOG 2ANWA 3AAVA 3E90B 1NZQH 3MH5A 4X8VH 2W5EA 2LPRA 3SU3A 1YPHE 4MVNA 1D3DB 4AGKA 2VWMA 3RXJA 1ANEA 2AGGX 1OYQA 3TH2H 4RKOB 2PR3A 1ESTA 1QURH 2D8WA 1FONA 2BY9X 1K1OA 1NO9H 1BTWA 2KAIB 1W8BH 2DE9A 4AFQA 4UEHH 4JK5A 2JH0D 1O2RA 4ZHAA 2AFQB 1MH0A 3ELAH 2AMQA 1C1QA 3QTVH 5JBAS 2P3FH 3GY4A 2Y7XA 4ZXYH 2A2XH 1C5SA 4IMZA 3KCGH 2OXSA 1SI5H 1YCPH 1C5LH 1F5KU 1LVMA 2CXVA 2A7JA 1GBMA 4Z0KA 1L4ZA 1CBWC 2OINA 3VB7A 4ZUHA 2Q6FA 1N8OC 2BVXH 3NWUA 3ZZ5A 1UK4A 3PB1E 4OGYA 2ZFTA 1HYLA 5DP8A 1QBOA 5FPTA 1PPEE 4NGAH 5FCRA 3M7UA 5C20A 3ZZ4A 3M3VA 4H6SB 3TJOA 4AFSA 1O5GH 4ISNA 1SHHB 1K22H 2G4TA 4CRCA 1EB2A 1YPLH 1UVOA 3U8RH 1ACBE 3BTGE 3RXTA 3A83A 2BDGA 1CGIE 3GY3A 1O2GH 2WYJA 3UR6A 4BAQB 4X8SH 2SGAA 4I7YH 2PKSC 1G30B 3BG4C 1GBTA 3A7VA 1E0FD 2ZU4A 1O38A 3QTOH 4ISLA 3JZ1B 1HBTH 3B23B 2GX4A 1CBWB 3OY5U 4INLA 2C93B 4UFFH 4JYUH 1O2UA 2F9PA 2I6QA 1VITH 1HAVB 4CH2B 1TX8A 4SGBE 3ZZAA 1IQJA 1BT7A 5F8TA 1TRNA 2HLCA 5HXFA 1HGTH 1Y3YA 1A4WH 2CF8H 5C5OA 4D8NA 2ZDKA 3HATH 3FANA 1L0ZA 1C4V2 2Y5FA 3BTFE 1V2LT 2BLOA 1A5IA 2JETC 2FI5E 5A8YA 2J2UA 3ZZ9A 1QTFA 3T26A 4KELA 2GDEH 1IQHA 1OP0A 3HGNA 1K1MA 1BJVA 1ZOMA 4GAWA 1BTYA 2FIRH 1UVPA 3A7XA 3BG4B 1LTOA 5HM9A 4ZKNU 4DIIH 4CRBA 1IQNA 3I78A 1GHZA 1KXFA 3PO1C 1AVGH 1O3CA 1GJAB 2FX4A 4MNXA 2ZTZA 3P6ZB 2A4QA 1EAIA 5DP4A 2XW9A 2QYIA 4X8UH 3TVJB 2BD3A 1OKXA 2QY0B 3EA7A 5F03A 1G2MA 1WUNH 4O3TA 3ZZ8A 3KN2A 1BTHH 2H1UA 1FLEE 4AORA 4Y0ZE 2GZ8A 1CO7E 1ID5H 1IOEA 5JYIA 2V3HH 4HGCA 4NG9H 1J9CH 1ELAA 2JETB 1KSNA 1T8OA 1Y8TA 1QA0A 2FI4E 1SGIB 3QUMP 1KXDA 4X6NA 1SGPE 1P8VC 1TNHA 3KQEA 3VPKA 1HAZB 3SUGA 1SQAA 2P16A 4OS5A 1RIWC 2GT7A 4FXGH 1Z6JH 1NRRH 1GVKB 3RDZA 1FN8A 4JZIA 1KXAA 1YPEH 3TJUA 1SGQE 3TGIE 2XNIA 5ETXA 2FOHA 1GHYH 1W7GH 4FUHA 2VIQA 1VITG 1AUJA 1W7XH 4B1TA 1NRNH 3SV2H 2ZI2H 3H7TA 1BQYA 1V2KT 4OS4A 1EZUC 1AVXA 1Y5UT 1Q31A 2B9LA 2BDBA 2UWOA 2RDLA 1O2TA 2ZECA 3I29A 1QFKH 3URCA 4CBNA 1BTUA 1AWFH 2SGFE 3PTNA 1O3DA 1Z7KA 5LGOA 3GCTG 1O3KA 2M5TA 2XCFA 2BVRH 4FUIA 1TGBA 2EI7A 3BTQE 3SU1A 3L6PA 3AASA 3NUMA 1SG8B 1TNIA 1P9UA 3MHWU 2FOMB 1ARBA 1YPJH 1B5GH 4ABDA 1H8IH 3KNXA 1NROH 2A4OA 3A8DA 1SOZA 4X8TH 4FUEA 1L1NA 1DWDH 1GL0E 2HVXA 1V2ST 2BY8X 3ZZ6A 1NN6A 1V2PT 3PLPA 1INCA 1UK3A 2ZFPH 1QA7A 1ZTKA 4H6TA 2QIQA 1O2IA 1HAOH 1E35B 4X1QU 3LC3A 1A1RA 5PTPA 1C2JA 1TBZH 2BX3A 3A84A 1TIOA 1FN6A 1O2QA 4RKJB 2Z6BD 1O5DH 4Y0YE 1OWHA 3MNBA 2P94A 5IDKA 2ZU2A 1UMAH 2D26C 3VGCC 3VXEH 2P8OC 2BD2A 1D4PB 3SUFA 4K69A 4ABGA 1C1VH 4ZH8A 4A92A 1Z6EA 3RXCA 1D3PB 8LPRA 3CS7A 1O5AB 2ZU5A 1EZQA 4MNWA 1A3BH 1O35A 4WVPE 1C5YB 1AUTC 2JKHA 1DE7H 3DD2H 2CN0H 1O2WA 1FY4A 4QT8C 3BEFB 4Y6DA 3UTUH 1V2MT 2AGEX 3I77A 4X0WU 3ZVBA 1GHAF
chains in the Genus database with same CATH superfamily
5AFZH 4NA7A 1RFNA 3M5MA 3AW1A 1ZJKA 3JZ2B 1FY5A 3SYJA 4A1XA 2VGCC 5FXLA 1NC6A 3DSOA 3ATLA 3O8CA 2WHXA 1DWEH 3UNSA 1GHBG 1GBHA 4XBDA 3PV4A 1E37B 3SHAH 1ZZZA 3IITA 3BTDE 3VGCB 2VWOA 5JBCS 2P8OB 1C1RA 2ANKH 3NRLA 3MH7A 9LPRA 1EJNA 4GHTA 1HAGE 1CT0E 3SJKA 1CVWH 4Y10E 1KDQB 2A4GA 1THRH 5ESBA 2ZFRH 2WUBA 2EC9H 2R9PA 2BB4A 1IQLA 5ABWA 1GI2A 3A82A 4TWYA 3T25A 1TNKA 1A5GH 3LU9B 1QY6A 1UHBA 2QE7D 2J92A 1MD8A 1NTPA 1O5FH 2CHAC 3KYGA 1AI8H 3TH4H 2ZNKH 2BDAA 1PYTC 1S84A 9ESTA 1N6XA 1O39A 1O3PB 4X2YA 2JDID 3F0PA 3DT0H 5EXMA 3C27B 1GBEA 1S83A 4ZCNA 2GKVE 4I8HA 3RUOA 1MZAA 3LKWA 1BBRK 4Y76A 2FOCA 1V2TT 2VINA 3LH1A 2QXJA 5KGOA 1FX0B 5EODA 1WDIA 4H4FA 4IN1A 4DGJA 2NU1E 2TIOA 3A8CA 1GBJA 4BTIB 2ZHEH 1GMHG 3HK3B 2FYQA 1TBQH 2OBOA 1A3EH 1HNEE 4HI3A 2Z94A 5KEDA 6CHAC 1RJXB 2AHME 1OWEA 2IN2A 1MU8B 5EQQA 3F1SB 3ZVAA 1EP5A 4WH6A 4Y11E 2EA3A 1OX1A 2G5NA 3GISB 5B6OA 1BUIA 3TJVA 1AD8H 3FP6E 3BV9B 3P8GA 4AN7A 2GCTC 1L2EA 3QWCH 1GJ8B 1Z8GA 3U28C 2QXIA 1IQFA 1Y3XA 3U8TH 4I8GA 1J16A 1ZHPA 1MTWA 3RC5A 1DUAA 1O30A 5E0GA 3RM2H 1D6RA 2XXLA 1TGSZ 1HCGA 2FTLE 3RXQA 1YBWA 1QZ8A 4DJZB 3TK5A 1MBMA 3SNAA 2EI6A 4DVAU 4A5TS 4DG4A 1PQAA 1O3NA 1A7SA 5C2ZA 2W3KA 2PTCE 4PROA 1KMHB 3Q77A 4O3UA 1N1LA 2SGEE 1O2MA 1UTJA 3NK8A 2OCVB 2WUCA 3EA8A 2FPZA 3P70B 1C1UH 1PPZA 1QBNA 1EX3A 4ZROA 2G55A 1BMFD 2GCTB 4F55A 1FY8E 3MQKC 3TGKE 3SQHE 3MFJA 2GZ9A 1KTTB 1TBRH 3PMBB 5L2ZH 2FODA 3B8JA 2ZEBA 4B2CA 3S69A 2SNVA 3RMMH 4GLYA 2QXGA 2A5IA 5K7RA 1F92A 2XBWA 2RA3A 2R3UA 1O3LA 1FI8A 4CHAC 1O3IA 1WQSA 3KL6A 4YT7H 2BD7A 2ZO3H 1YCPM 5F8ZA 5C1XA 1KXCA 1O5EH 1F0UA 1TNJA 1XMNB 2XYAA 1EJMA 2J94A 1BB0B 3LGUA 3QGJA 1PQ5A 3M7QA 2FZZA 1TX6A 4ZXXH 1BRCE 1LHCH 3A80A 1G3CA 4XRNA 4F49A 3RM0H 2WV9A 1O2YA 5GCHF 2PUQH 1O2VA 4ZAEA 2XWBI 1WU1A 1SOTA 3SV8A 5CHBA 1ZR0A 3D65E 5DO4H 2BHGA 2XRCA 1EJAA 2NWNA 1QL7A 1AQ7A 2WPHS 2XC5A 4NSVA 2Z9IA 4Q7YA 3GY6A 2GGVB 2BDIA 2J34A 2R3YA 3PTBA 3KF2A 5C0TA 1GI5A 1NPMA 3CS0A 5HMAA 4CHAB 2HNTC 1P2NA 3HPTB 3RXSA 4A1VA 1V2QT 1ETTH 1HUTH 2Y5GA 2PW8H 3FAOA 3VXFH 4AYYB 2BOKA 3LGTA 1OWIA 4FU7A 4ZKSU 3M3SA 1TAWA 3ZZCA 3GYLB 4I32A 4MTBA 1K1IA 2C4FH 3QLPH 1MTNC 2ZDNA 2PFEA 5LPRA 1UTMA 1LPGB 1DOJA 1ZMNA 3OX7U 1IAUA 2RCEA 2STAE 4F4OC 2ZKSA 3F2FA 1C5WB 3OTJE 2XWAA 4INHA 5GIBA 1A61H 3SGAE 3PROA 1HAYB 1BTPA 1C1MA 1TLDA 1QB6A 4K2YA 1MCTA 2KCOA 2B0FA 1KIGH 1C2FA 2QN5T 3GY5A 1FQ3A 2VVCA 1QRXA 1CA8B 2LP6A 1EZSC 3Q3XA 2FLBH 4ABAA 1BHXB 2ESTE 4Q7ZA 3C1KA 4TT3D 2ALVA 1ANCA 2BD9A 3DCLA 1W0JD 4X6OA 1GBBA 1GHAG 1P3CA 3R0FA 3RC6A 3A8AA 4OS1A 2P95A 4ZHMU 3SU5A 2ILNA 1DXPA 3RXBA 2R0KA 1P9SA 1HB0B 1T8LA 4IC5A 1AFEH 3BIVH 1OWJA 5EQSA 4BOHA 4RT0A 2XNDD 3FFGA 5EPYA 4WF8A 1XUFA 2Y81A 3LDXH 4BAMB 3BF6H 1NBMD 2BQ6B 1ZSKA 2FXRA 2ZFFH 3SV6A 2XBYA 2QF4A 5FPYA 1GDUA 3RMNH 5BPEA 3RXOA 2ZGCA 3RXIA 4YZUA 2B7DH 3U9AH 1UTQA 1DVAH 2WPMS 2WPKS 1AWHB 5HM2A 1EUFA 2ODQA 3P95A 3F2HA 2AS9A 1O2OA 3TLOA 1EZXC 1WYKA 8GCHG 2RG3A 2VWLA 2CJIA 4Y79A 1GCTC 2Z9GA 1GJDB 1MKXK 3MOCA 4JMYA 1VJ9U 1N6YA 1XVOA 2G81E 4P00A 1TOCB 3SGQE 3G01A 1QB1A 1BZXE 2A0QB 2H9TH 1C5OH 2W7UA 3LJOA 1V2JT 2JJ2D 5DP7A 4CH8B 5GWZA 4ABBA 1WSSH 2P93A 2W26A 3OU0A 1JMOH 4B73A 1B7XB 2TGTA 3MNSA 4AG2A 1E38B 2GJGA 5B6LA 3LONA 5DG6A 2WPDD 5FAHA 4U32A 4X2WA 1ZYOA 4ZMAH 3LGIA 4IMQA 3RMOH 4K3JA 1RTFB 2FLRH 4IS5A 1W0YH 2PWXA 1MTUA 3TJNA 5L6NH 1EKBB 2O8UA 1Y3VA 4YOGA 3HKIB 2CMYA 1NU9A 1BMNH 1N8OB 1S6HA 4UE7H 3A7WA 1C5TA 2ZPQA 3UR9A 1ABIH 1TGCA 4DY7B 1GCTB 2BXTH 1DT2A 5H4IB 1QIXB 2QF5A 1NFWA 3DUXH 4WJG2 5FBIA 3GY7A 4GPGA 4D9QA 1V2VT 4ACBA 2QF3A 3Q76A 5LPFA 1KY9A 1JIMA 1GHVH 1P04A 1SHYA 1V2UT 1C4U2 1XVMA 1YC0A 2GTBA 3T28A 2BTCE 3TPIZ 2Z9JA 1AKSA 2NU4E 1BITA 1F0SA 3ATMA 3ZV9A 3S0NA 1C2KA 3A87A 3FZDA 4E06H 1FY3A 3SUDA 1ZSLA 3N7EA 1SBWA 2XCNA 1QB9A 4B2AA 2PKSB 1TA6A 4UONA 4P02A 1GPZA 3MO3A 3RMLH 3UUZA 1GMCF 2HNTE 2LELA 4AFZA 4NIVA 1WV7H 3QZQA 4FUGA 1ZTJA 2PKAA 4ABFA 1O3OA 7KMEH 3Q00A 4I33A 3QX5H 2FP7B 1JRSA 3FZZA 5GDSH 2QA9E 3EE0B 1VKYA 3RXPA 3TNSA 2P3TB 1ZPBA 5HYOA 3M5NA 3PM3A 2R0LA 2VH6A 3VB4A 3SJ8A 4ABHA 3S9BA 2WYGA 2ZTYA 1GMDF 2FWWA 1DUEA 1YPKH 2SNWA 1W11U 1MKWK 2YOLA 3SI3H 1MQ5A 1DX5M 3FKSD 1SGRE 2Z9KA 4E05H 1GBLA 1VJAU 3QO6A 2J95A 3VFEA 5AF9H 1TGNA 2Y6TA 4XDEA 3OTPA 2UUJB 4X6PA 3RXUA 1DSTA 1OS8A 1SLUB 1L1GA 2HVYB 2P59A 1S0RA 1ELFA 2ZU3A 1P2JA 1C2MA 4MPXA 5C3NA 5F53A 1CA0C 1ZGIA 3CNRA 3GCHC 1EOLA 1UVSH 1W13U 2ZCHP 5G4BA 4NA8A 3SW2B 4B74A 4J2YB 1P0SH 3A86A 3T29A 2G4UA 2O8MA 5CHAC 1G3BA 4K1SA 4MPVA 1O5BB 2BD8A 3GICB 1GJCB 1UW7A 5FL7D 1A5HA 3URDA 3PO1B 3VB6A 4AZ2B 1EAWA 1PPBH 3BSQA 5IYTA 4XBBA 4IW4E 1WAYB 3QGNB 4ABIA 3E91A 1Y5AT 2H2ZA 1GL1A 2GV6A 4D7FA 4KKDA 4MLFB 2AMPA 3VEQB 3MNXA 2G5VA 3LIWA 4KTCA 5CE1A 3RXHA 4CRFA 2A5KA 1O2ZA 1MAXA 2H5CA 3M5OA 3GDUA 4LOYH 3TK9A 3KIDU 3E0PB 4GUXA 4Y8ZA 1SSXA 1RD3B 1UCYK 5DJ7A 1C2LA 1O0DH 1P05A 2PGQB 1XXFA 7GCHG 3FN8A 1EAUA 3SN8A 3K65B 4AB8A 1FDPA 2HOBA 2JIZD 5FPSA 3VB3A 2FS9A 1E1RD 8KME2 1T8MA 1P12E 3MNCA 2K0QA 1CA0B 1BCUH 5JPMH 2C8XB 1FPHH 1RIWB 1AU8A 3GCHB 3LGWA 1O32A 2XBXA 1EB1H 5A8XA 1IHSH 3O8BA 6GCHF 1NFUA 2PP6A 4WWYA 1UVUH 1NU7B 1KXEA 5CHAB 2DE8A 1IQKA 1FZZA 2GCHF 3M37A 3GY2A 1QL9A 1LKBA 1WCZA 1DDJA 4MDSA 5T6GA 1NRPH 3QK1A 2C90B 1C1TA 3SBKA 1GJBB 3L33A 1HAPH 5JB8S 1FNIA 1O2SA 1FMGA 1C2DA 2OC1A 2V3MA 4AB9A 3ATWA 1M9UA 3BTHE 2W3IA 2PTNA 2Z3CA 4WXIA 3DA9B 2ZCLP 3SU0A 4FUBA 3SOSA 1PJPA 5EGMA 1O3BA 2QC2A 1PPHE 3L3TA 1KLJH 1IQGA 4DOQA 3NCLA 1TFXA 3EDXB 2VNTA 3DHKH 3MI4A 2VIVA 1TPAE 1Q3XA 3LC5A 4Q2KA 2Q1JA 4SGAE 1ELCA 1AE5A 4AFUA 4BAKB 1TGTA 1CHOF 1RTLA 2FOFA 1HAIH 4VGCC 3GDSA 3EYDA 1UTPA 1AZZA 1ELDE 1EAXA 1DANH 3K9XB 1Y3WA 1HXFH 2PSYA 1GVLA 1K21H 2XTTB 1OYTH 1XKAC 3BEIB 1ELEE 1MD7A 1NBME 2WSSD 4YTAA 4B75A 4O9VA 2AEIH 3VB5A 1FAKH 3MO6A 1A0JA 2J9NA 1ZMJA 1GHXH 1Z8IB 2GMTC 4FOUC 4X2VA 3IG6B 3M3TA 4I8JA 1C5VA 1H8ED 2Q6DA 2VIPA 1O2XA 3RXLA 4YLUA 1UHBB 2UWLA 2ZFQH 1LQDB 3ATIA 4DCDA 3SU6A 1EPTA 2BX4A 1PFXC 2K1QA 3KGPA 2OTVA 3LGYA 1CGHA 1MU6B 1C1PA 3GCNA 3M35A 1TRMA 1DITH 5DP5A 2KCYA 1VR1H 1GG6C 2K8IA 4VGCB 1QRWA 1C1OA 3UREA 1PPGE 3CENA 2PHBA 1K1LA 1P2QA 2ANMH 3ZIAD 4NCYA 2VGCB 1C5MD 3Q3YA 3F9GA 4IBLH 3U1JB 2J98A 2ZDMA 2QF0A 2D1JA 1GI3A 3HK6B 2H5DA 3RC4A 2TRMA 1CHGA 1WTHD 1O36A 2AMDA 4KP0A 1ZGVA 4NIYA 1SPJA 3UB0A 1QHRB 1F7ZA 2QGRA 2A45B 4Q7XA 3BEUA 5EG4A 2YMSD 2DUCA 2GMTB 2EI8A 5A0BA 1OWKA 3UQVA 3WWBA 1HLTH 5A0CA 1TMTH 1O3MA 1G37A 1YY3A 2QAAA 3F6UH 1BMLA 2PGBB 5C1YA 1TB6H 1NFYA 3ZVEA 7ESTE 1XUJA 4UFEH 1W3CA 3SNDA 2BMGB 2OD3B 2CHAB 4TYDA 2CV3A 2VVUA 4X1SU 1QR3E 2BLVA 3U98H 1GG6B 1NESE 1F5RA 3FP7E 1P2OA 1XUKA 5E2PA 3UNRA 1O31A 3SV7A 3ZYDA 1SGNE 3ZVGA 1EQ9A 2KM0A 4Y71A 3RXDA 5DP6A 3MO9A 3GY8A 2ZP0H 4UFGH 2CK3D 1Y59T 3MWIU 1Z1JA 2A4RA 3M36A 4NFEA 1MAYA 3TH3H 1E36B 1C5PA 6CHAB 1LPKB 4MPUA 1DY9A 2OBQA 5FBEA 4TY7A 2OUAA 1OP2A 1G2LA 2F9VA 5JDUB 5DGJA 2ZPSA 4IN2A 2OLGA 1BDAA 1O5CB 1S0QA 2VU8E 4ABEA 4WH8A 1AY6H 1C1WH 1UVTH 1XUGA 3PV2A 3BIUH 1YGCH 1LMWB 3T62A 4ASUD 4CR5A 3LGVA 3SQEE 3O8RA 1S6FA 1GMDG 1QCPA 4JZDH 1K1PA 1DY8A 5AFYH 2AIPA 4M7GA 4WMEA 5C67A 4K1EA 1QGFA 3SNEA 1ETRH 1YKTA 1DWBH 4MNYA 3DSGA 1S82A 2G8TA 3GYMA 1XM1A 2F4LA 5L30H 2J4IA 1AFQC 1SKYE 4Z1MD 1HIAA 3UQOA 2OP9A 4BNRA 1ARCA 1H8HD 1RTKA 1OPHB 1P3EA 2IJD1 2VIOA 1HDTH 1KTSB 1T7CA 1EFRD 4WMFA 4U01A 1UO6A 1BA8B 2ZGHA 3TITA 1GBCA 3KHVA 1RGQA 4GVUA 3ZVCA 1ETSH 2ODYB 2V6NA 4ISHH 3V12A 1ZHRA 1S6LA 2RFKC 1GBKA 3KQBA 1TE0A 2BQWB 1O3EA 1UTKA 2J38A 1JBUH 3UOPA 2BM2A 2FESH 3K6YA 1W14U 2HALA 4X1RU 2ZA5A 2ZC9H 1ZRBA 4JYTA 4MPWA 1VITF 1K0HA 5TJXA 1YCPK 2HGTH 1UJ1A 3RXAA 2G52A 2FOEA 3VG8A 4ZHLU 2VIWA 2ZCKP 2FMJA 5EOKA 4ABJA 1LVBA 2ZQ2A 1P01A 2KCPA 1TMUH 5DKMA 2A1DB 1TNLA 4FUDA 1K1NA 1ORFA 1YPMH 3FP8E 4YO9A 3F9FA 2RA0A 4AGJA 4NFFA 8ESTE 1ZTLA 1NRSH 1F0RA 1AB9C 2Y80A 1AVWA 2C3SA 1Z8JB 3BTKE 2NU0E 1ELGA 1C9TA 3MU4A 1GGDC 1O2HA 3F68H 4X1PU 3SUEA 4FUJA 5FHTA 4D76A 5EW1H 4BANB 4BAOB 2XOKD 1C2HA 2BY5X 1IQIA 4JYVH 1SGFA 1SL3A 1SLWB 2L74A 1THPB 4B6EA 2TGDA 2IOTA 1DWCH 4KTUA 5DP9A 3A7ZA 1JXPA 4YESB 4K8BA 5AHGH 4ZKRU 1SGDE 3LJJA 1ANBA 4FVBA 3V7TA 5F6MA 1F0TA 1D9IA 2JH5D 3KQ5A 1PQ8A 1C2EA 3M7TA 1WOFA 4JCNA 3U8OH 4ASHA 1ZPZA 1B0FA 3E0NB 4NZLA 3LH3A 5E0HA 1T8NA 4O97A 5DSFA 1GDQA 1TPOA 4HTCH 3ZZ7A 5EIYA 1FV9A 2HPQH 2WPLS 1GHWH 1C4Y2 2HPPH 2Y82A 4THNH 1AB9B 1BBRE 4OGXA 2ZHWH 4NIWA 1A46H 5JBBS 2WPIS 1MTVA 1GGDB 3F9EA 1SFQB 1MTNB 4DIHH 1TRYA 1DPOA 5E0JA 5DPAA 1E34B 3D49H 4U30A 1EP6A 3RLWH 5A09A 1D3TB 2ZG0H 3ZYEA 1B0EA 3SU2A 1THSH 2KAIA 2THFB 2WZQA 1ZJDA 2F3CE 2AYWA 2BXUH 3WWFA 6LPRA 4YOJA 1XUIA 3D62A 1GHBF 3P8FA 2ODPA 1NM6A 1GJ6A 1LQEA 4BTUB 3RXRA 3ZZDA 1GBDA 4XFQA 3STIA 2W7SA 1G32B 1C2IA 3PWBA 5DP3A 1GBFA 4XBCA 3UFAA 1MQ6A 2O8LA 2UWPA 4CBOA 2VVVA 2GVFA 1GBIA 2TGPZ 5SGAE 1HPGA 2ZHDA 3UWIA 2BLWA 4OM9A 4OS2A 3E3TA 3RXMA 1DS2E 1H4WA 2SGQE 3BN9A 2EEKA 1HAXB 3PRDA 2O9QA 4E7RG 1MMJN 4XE4A 2ASUB 5J4SA 1QJ7B 2HWLB 5EJLA 2AIQA 4YOIA 2BY7X 3H7OA 2AGIX 2A2QH 3PYHA 4FUFA 4WY3A 1PPFE 1UK2A 2C8ZB 1Y5BT 1QJ1B 3A8BA 1FIZA 4DW2U 1V6DA 1TNGA 2SGDE 2FX6A 3T27A 4AX9H 2F9UA 3UNQA 1GJ4H 2GV7A 1SGFG 2KR7A 5ESTE 1GMHF 2KFWA 3PMAB 1DSUA 1X7AC 4KTSA 2QV1A 3B9FH 1ESBA 2F43B 1T31A 2V0BA 3EGKH 1S85A 3U1IB 2F83A 3W95A 4YXWD 2OC0A 3A85A 2GDDA 1AKSB 5FX5A 3ZZBA 5HGGA 4DURA 1EOJA 2A31A 2BYAX 3GOVB 3KEEA 1HAVA 3SO3A 1V2OT 2ZF0H 2ZGBH 1D6WA 4I86A 1H8DH 3RXKA 1GI8B 2Y7ZA 4Q80A 4MQAA 4O03A 1KYNA 3KQDA 3MU5A 3RXEA 2PKAB 3RP2A 2ZU1A 4B2BA 6ESTA 2F9OA 2FM2A 4B76A 5EJZA 3FOAA 1O3FA 1P2IA 1L1JA 1SQOA 1O2KA 4X6MA 5KECA 4U2WA 1SLXB 2B8OH 1DICA 1SGTA 2ULLA 2ZGXH 2ZTXA 1P57B 1NS3A 3K2UA 1LHDH 2BDCA 1LPZB 1G3DA 3A89A 1HJ8A 1ESAA 5J4QA 2FO9A 2BZ6H 1LKAA 4K1TA 1S81A 2R2MB 2ZQ1A 2A7HA 4Y7AA 1DXWA 2P3UB 1RS0A 5EXLA 4UDWH 5T6FA 2BVSH 1MKXH 2ZWLH 5K0HA 3ENSB 1UTOA 5C17A 2ZIQH 5EQRA 3LPRA 3OAAD 4YT6H 2FTMA 1LO6A 1MCVA 4GCHF 1SMFE 2STBE 3DSPA 1LVYA 4ESTE 1HV7A 3MH6A 2WV4A 1C2GA 5F8XA 3SNBA 2H9HA 4LZ1H 2GD4B 1TABE 1W2KH 4OS7A 2ZDAH 1K28D 1T4UH 2Z9LA 4NA9H 1AE8H 3RU4D 1CT2E 2L6OA 1EASA 5GNDA 1FAXA 3ZV8A 4BAHB 1CGJE 1G9IE 1XX9A 1SQTA 2NU3E 1FY1A 2HLDD 1QQ4A 1SVPA 1V2NT 2V3OH 4D9RA 3OEED 4A6LA 3QZRA 5GCHG 1GDNA 2SFAA 1ELVA 3RXVA 3ATKA 4UFDH 1C5QA 1MUEB 2ZFSA 4LK4A 1JRTA 2G00A 3H5CB 1UTLM 3BTWE 1XKBC 2PUXB 1GBAA 2BOHB 2NU2E 3RXFA 2IJOB 1YLCA 1MBQA 3GDVA 1A0HB 3TK6A 1QNJA 1V2WT 1O2LA 4TWWA 2BQ7B 4A7IB 1TMBH 1ABJH 1TA2A 3OEHD 5LH8A 1ZPCA 2SGPE 4X1NU 3V3MA 2FI3E 4NIXA 2JJ1D 2A32A 1P02A 4NZQA 1Q2WA 1GI9B 3AVZA 4TY6A 3RLYH 3A7YA 2EY4C 4GHQA 1P2MA 3LOXA 2O8WA 1GI1A 1IQMA 1XUHA 3CP7A 1PPCE 4DT4A 4J1YA 3S7HB 3TGJE 3ZZ3A 4H42U 4LZ4B 1AHTH 1AIXH 4I8KA 3GS9A 3FO8D 4GSOA 4M9FA 3AW0A 4AOQA 4K5ZA 1COWD 5EPNA 2EQNA 3DFJA 1YF4A 3IWMA 2ZDVH 1P10A 3SNCA 3OSYA 1YLDA 3ESTA 2UUFB 4FVDA 3M5LA 1VCQA 1CE5A 3BG8A 2AERH 3KYFA 4XSKU 3S7KB 1RXPA 2VH0A 1C1NA 1PYTD 4R0IA 1EPTC 3NXPA 1MKWH 2BZAA 1VGCC 1HJ9A 1H9IE 4RN6A 4XOJA 4Y8YA 4FU9A 1W10U 2XBVA 1TWXB 3AAUA 3DFLA 3UY9A 1BRUP 1SC8U 3SZEA 1BMMH 1OP8A 1PQ7A 2AH4X 1C9PA 1C5RA 3F9HA 1KLIH 1O2NA 1Z1IA 2IPHA 2JH6D 1HJAC 4NSYA 3H09A 4NWKA 1WTGH 1H9HE 1NFXA 5JBTA 1ZMLA 3ODFA 1AMHA 1ELBA 3E1XB 1LHFH 2VJ1A 2FYRA 2BY6X 3PWCA 3A7TA 2TGAA 3NKKA 4UD9H 1YYY1 2TPIZ 5GPIB 4YLQH 3OYPA 5TCCA 3SU4A 3BTTE 2D2DA 4CREA 2VB0A 1TQ7B 1GJ9B 3SGBE 3ODDA 4CRAA 5EJ1A 1SGYE 3QDZB 4BXSA 1EPTB 2PV9B 1P09A 1BOQA 2H9EH 5T1VA 2GZ7A 1VGCB 2BLQA 2ZGJA 1DLEA 3UWJH 5EXNA 1UCYH 1BTXA 1TALA 4I31A 4JZFH 4F48B 3BTME 1P11E 5CMXH 1WBGB 2ZHFH 1DLKB 2Q6GA 1W0ZU 3M61U 1YLNA 1O3HA 2A7CA 1BIOA 1C1SA 2LNCA 3FVFB 5HIZA 1KDQA 8GCHF 1O3GA 1HJAB 1FJSA 1AO5A 1IQEA 1MTSA 2J98B 3PLBA 1TOMH 4B6FA 1EXFA 4WXVA 1YPGH 5I46H 1LHEH 1Z71A 4LXBH 1GJ5H 1T4VH 3F0OA 1JOUB 5DK1A 2ALPA 3GCOA 1NT1A 1A0LA 4E7NA 1TQ0B 1ZSJA 1F2SE 2HRVA 3P92A 5T6DA 3OFND 2C8WB 4IGDA 3E6PH 2WINI 5E2OA 2OC8A 1A2CH 1O3AA 2ZZUH 1VCPA 5GJ4B 5EU8A 1H1BA 2I6SA 3KQCA 1O2JA 1BTZA 1LVOA 1OSSA 1TX7A 1FIWA 1O2PA 4MG3A 4XD7D 3EAJA 4DT7B 3SJOA 1FPCH 4JZEH 4OS6A 2WV5A 1AZ8A 2PSXA 1HRTH 1G36A 1C5XB 3NZIA 2F9NA 4FUCA 2Z3DA 1P2KA 3SORA 5FCKA 3T5FH 5L2YH 1C5UA 1HFDA 4CR9A 1HAHH 1YPHC 2UUKB 1OWDA 1ZHMA 2GT8A 4RI0A 5T3HA 1OOKB 4D7GA 1J8AA 1IHTH 3O8DA 4BXWA 1NY22 1UTNA 5A8ZA 1VZQH 1TYNA 2OQUA 1GCDA 1S5SA 4WMDA 4K8YA 1RRKA 1FXYA 1GI6A 1L4DA 2UUYA 1NRQH 2G51A 4B71A 2O8TA 5IK2D 3HGPA 2FOGA 2R2WU 2ZPRA 3TIUA 4RSPA 1E1QD 1SB1H 4FU8A 4R8TB 1C5NH 1GMCG 3P8OA 1GVZA 1MABB 2BD4A 1V3XA 1LCYA 1SR5C 1WQVH 5C1UA 1BRAA 2HNTF 2KZ4A 3S9CA 2CF9H 1K9OE 2OC7A 5EW2H 1P06A 3SJ9A 2BDYA 1LDTT 1BHXF 3WY8A 4MNVA 1ANDA 4X2XA 1GWAA 4IC6A 1GI0A 1T32A 1O37A 3HKJB 1UCYE 1GJ7B 2YNBA 3EQ0H 3MH4A 1C5ZB 1QRZA 1KXBA 2A5AA 4CRDA 3Q3KA 3R3GB 5C5NA 1BJUA 2FOBA 1DM4B 3NPSA 3TU7H 3V0XA 3V13A 3UIRA 4Y8XA 3ZVDA 3K6ZA 1SFIA 2ANYA 1GI4A 4KGAA 1H9LB 1W0KD 2YMSC 3T2NA 3LT3A 4ISIH 1YP9A 4I8LA 3W94A 1VCWA 3PMJA 1QL8A 5BRRE 5LPEA 1HIAB 1U6QA 2TBSA 4GCHG 1HXEH 3RU4E 3QN7A 1BBRH 1P03A 1D3QB 1F5LA 2XC0A 1CT4E 2RDEA 3TNTA 1TONA 4JZ1A 4HZHA 2GP9B 3UPEA 1QJ6B 3S9AA 2VWNA 4TPIZ 4ISOA 4INKA 1CSOE 4A1TA 1AN1E 1SGCA 1CU1A 3WW7A 3SV9A 1O3JA 2WPJS 7LPRA 1FUJA 1GI7B 1XXDA 2FDAA 3SZNA 2H6MA 4Y7BA 1K2I1 4K60A 3N99A 4JK6A 2Z7FE 2B5TB 2BD5A 3RU4T 4CRGA 1ZLRA 4AYVB 3ITIA 3E16B 2QXHA 5E8EH 4ZKOU 3SI4H 2YMSB 1WXRA 1YM0A 1Z8RA 2PLXA 1K1JA 5GXPA 2Y5HA 5A2MH 3PMHB 5FX6A 1DFPA 3P17H 1OXGA 3P8NA 4TPYA 1AFQB 1SQRA 3OY6U 3GCTF 4YM9A 3MYWA 5A0AE 1J17T 2QCYA 3N7OA 2F9BH 7GCHF 2FS8A 3ZVFA 3W1EA 2IPQX 6GCHG 2V7QD 1TPSA 1QBVH 2C8YB 5C0UA 1W12U 2VIDA 1AGJA 1TPPA 2GCHG 1SLVB 1JWTA 3D23A 1KLTA 3UOUA 2Z3EA 2BDHA 1MZDA 1JIRA 1EATA 1ZRKA 3E8LA 2ZHQH 1CQQA 3F2GA 3MTYA 1V2RT 3BTEE 4Z6AH 5I25A 1J14A 3STJA 5TCAA 3A81A 4BTTB 3U69H 2OQ5A 2F91A 2FEQH 1O34A 2YNAA 1BMAA 3PLKA 1O33A 1QQUA 3MU0A 1G3EA 5JB9S 4AG1A 3EA9A 3SHCH 4NWLA 3RXGA 1J15A 1Y3UA 2V35A 1SGEE 1LHGH 3MU1A 3MMGA 2FOAA 3MU8A 2XC4A 2CGAA 3SJIA 2J5UA 3A88A 3EE7A 1BRBE 4HFPB 1ELTA 2ZDLA 5AVDA 1CHOG 2ANWA 3AAVA 3E90B 1NZQH 3MH5A 4X8VH 2W5EA 2LPRA 3SU3A 5CDFE 1YPHE 4MVNA 1D3DB 4AGKA 2VWMA 3RXJA 1ANEA 2AGGX 1OYQA 3TH2H 4TSFD 4RKOB 2PR3A 1ESTA 1QURH 3N7DA 2D8WA 1FONA 2BY9X 1K1OA 1NO9H 1BTWA 2KAIB 1W8BH 2DE9A 4AFQA 4UEHH 4JK5A 1E79D 2JH0D 1O2RA 4ZHAA 2AFQB 1MH0A 3ELAH 2AMQA 1C1QA 3QTVH 5JBAS 2P3FH 3GY4A 2Y7XA 4ZXYH 2A2XH 1C5SA 4IMZA 3KCGH 2OXSA 1SI5H 1YCPH 1C5LH 1F5KU 1LVMA 2CXVA 2KCAA 2A7JA 1GBMA 4Z0KA 1L4ZA 1CBWC 2OINA 3VB7A 4ZUHA 2Q6FA 1N8OC 2BVXH 3NWUA 3ZZ5A 1UK4A 3PB1E 4HG6A 4OGYA 2J97A 2ZFTA 1HYLA 3F3BA 1QBOA 5DP8A 5FPTA 1PPEE 4NGAH 5FCRA 5HKKD 3M7UA 5C20A 2VBCA 3ZZ4A 3M3VA 4H6SB 3TJOA 4AFSA 1O5GH 4ISNA 1SHHB 2OK5A 1K22H 2G4TA 4CRCA 1EB2A 1YPLH 1UVOA 3U8RH 4Q63A 1ACBE 2M2AA 3BTGE 3RXTA 3A83A 2BDGA 1CGIE 3GY3A 1O2GH 2WYJA 3UR6A 4BAQB 4X8SH 2SGAA 4I7YH 2PKSC 1G30B 3BG4C 1GBTA 3A7VA 1E0FD 2ZU4A 1O38A 3QTOH 4ISLA 3JZ1B 1HBTH 3B23B 2GX4A 1CBWB 3OY5U 4INLA 2C93B 4UFFH 4JYUH 1O2UA 2F9PA 2I6QA 1VITH 3PV5A 1HAVB 4CH2B 1TX8A 4SGBE 3ZZAA 3UAIC 1IQJA 1BT7A 5F8TA 1TRNA 2HLCA 5HXFA 1HGTH 1Y3YA 4RT1A 5C94A 1A4WH 2CF8H 5C5OA 4D8NA 2ZDKA 5HIYA 3HATH 3FANA 1L0ZA 1C4V2 2Y5FA 2KX4A 3BTFE 1V2LT 2BLOA 1A5IA 2JETC 2FI5E 5A8YA 2J2UA 3ZZ9A 1QTFA 3T26A 4KELA 2GDEH 1IQHA 1OP0A 3HGNA 1K1MA 1BJVA 1ZOMA 3PRBA 1BTYA 4GAWA 2FIRH 1UVPA 3A7XA 3BG4B 1LTOA 5HM9A 4ZKNU 4DIIH 4CRBA 1IQNA 3I78A 1GHZA 5DN6D 1KXFA 3PO1C 1AVGH 1O3CA 1GJAB 2FX4A 4MNXA 2ZTZA 3P6ZB 4Q4LA 2A4QA 1EAIA 5DP4A 2XW9A 2QYIA 4X8UH 3TVJB 2BD3A 1YWUA 1OKXA 2QY0B 3EA7A 5F03A 2W6ID 1G2MA 1WUNH 4O3TA 3ZZ8A 3KN2A 4AC9A 1BTHH 2H1UA 1FLEE 4AORA 4Y0ZE 2GZ8A 1CO7E 1ID5H 1IOEA 5JYIA 2V3HH 4HGCA 4NG9H 1J9CH 1ELAA 2JETB 1KSNA 1T8OA 2W6JD 1Y8TA 1QA0A 2FI4E 1SGIB 3QUMP 1KXDA 4X6NA 1SGPE 1P8VC 1TNHA 3KQEA 3VPKA 1HAZB 3SUGA 1SQAA 2P16A 4OS5A 1RIWC 2GT7A 4FXGH 1Z6JH 1NRRH 1GVKB 3RDZA 1FN8A 4JZIA 1KXAA 1YPEH 3TJUA 1SGQE 3TGIE 2XNIA 3AK5A 5ETXA 2FOHA 1GHYH 1W7GH 4FUHA 2VIQA 1VITG 1AUJA 1W7XH 4B1TA 1NRNH 3SV2H 2ZI2H 3H7TA 1BQYA 1V2KT 4OS4A 1EZUC 1AVXA 1Y5UT 4ACAA 1Q31A 2B9LA 2BDBA 2UWOA 1OHHD 2RDLA 1O2TA 2ZECA 3I29A 1QFKH 3URCA 4CBNA 1BTUA 1AWFH 2SGFE 3PTNA 1O3DA 1Z7KA 5LGOA 3GCTG 4FETA 1O3KA 2M5TA 2XCFA 2BVRH 4FUIA 1TGBA 2EI7A 3BTQE 3SU1A 3L6PA 3AASA 3NUMA 1SG8B 1TNIA 1P9UA 3MHWU 2FOMB 1ARBA 1YPJH 1B5GH 4ABDA 1H8IH 3KNXA 1NROH 2A4OA 3A8DA 1SOZA 4X8TH 4FUEA 1L1NA 1DWDH 1GL0E 2HVXA 1V2ST 2BY8X 3ZZ6A 1NN6A 1V2PT 3PLPA 1INCA 1UK3A 2ZFPH 1QA7A 1ZTKA 4H6TA 2QIQA 1O2IA 1HAOH 1E35B 3OE7D 4X1QU 3LC3A 1A1RA 5PTPA 1C2JA 1TBZH 2BX3A 3A84A 1TIOA 1FN6A 1O2QA 4RKJB 2Z6BD 1O5DH 4Y0YE 1OWHA 3MNBA 2P94A 5IDKA 2ZU2A 1UMAH 2D26C 3VGCC 3VXEH 2P8OC 2BD2A 1D4PB 3SUFA 4K69A 4ABGA 1C1VH 4ZH8A 4A92A 1Z6EA 3RXCA 1D3PB 8LPRA 3CS7A 1O5AB 2ZU5A 1EZQA 4MNWA 1A3BH 1O35A 4WVPE 1C5YB 1AUTC 2JKHA 1DE7H 3DD2H 2CN0H 1O2WA 1FY4A 4QT8C 3BEFB 4Y6DA 3UTUH 1V2MT 2AGEX 3I77A 4X0WU 3ZVBA 1GHAF
chains in the Genus database with same CATH topology
5AFZH 4NA7A 1RFNA 3M5MA 3AW1A 1ZJKA 3JZ2B 1FY5A 4A1XA 2VGCC 5FXLA 1NC6A 3O8CA 3ATLA 1DWEH 3UNSA 1GHBG 1GBHA 4XBDA 3PV4A 1E37B 3SHAH 1ZZZA 3IITA 3BTDE 3VGCB 2VWOA 5JBCS 2P8OB 1C1RA 2ANKH 3MH7A 9LPRA 1EJNA 4GHTA 1HAGE 1CT0E 3SJKA 1CVWH 4Y10E 1KDQB 2A4GA 1THRH 5ESBA 2ZFRH 2WUBA 2EC9H 2R9PA 2BB4A 1IQLA 5ABWA 1GI2A 3A82A 4TWYA 3T25A 1TNKA 1A5GH 3LU9B 1QY6A 1UHBA 2J92A 1MD8A 1NTPA 1O5FH 2CHAC 3TH4H 1AI8H 2ZNKH 2BDAA 1PYTC 1S84A 9ESTA 1N6XA 1O39A 1O3PB 4X2YA 3DT0H 5EXMA 3C27B 1GBEA 1S83A 2GKVE 4I8HA 3RUOA 1MZAA 3LKWA 1BBRK 4Y76A 2FOCA 1V2TT 2VINA 3LH1A 2QXJA 5EODA 4H4FA 4IN1A 4DGJA 2NU1E 2TIOA 3A8CA 1GBJA 4BTIB 2ZHEH 1GMHG 3HK3B 2FYQA 1TBQH 2OBOA 1A3EH 1HNEE 4HI3A 2Z94A 6CHAC 1RJXB 1OWEA 2IN2A 1MU8B 5EQQA 3F1SB 3ZVAA 1EP5A 4WH6A 4Y11E 2EA3A 1OX1A 2G5NA 3GISB 5B6OA 1BUIA 3TJVA 1AD8H 3FP6E 3BV9B 3P8GA 4AN7A 2GCTC 1L2EA 3QWCH 1GJ8B 1Z8GA 2QXIA 1IQFA 1Y3XA 3U8TH 4I8GA 1J16A 1ZHPA 1MTWA 3RC5A 1DUAA 1O30A 5E0GA 3RM2H 1D6RA 2XXLA 1TGSZ 1HCGA 2FTLE 3RXQA 1YBWA 4DJZB 3TK5A 1MBMA 3SNAA 2EI6A 4DVAU 4A5TS 4DG4A 1PQAA 1O3NA 1A7SA 5C2ZA 2W3KA 2PTCE 4PROA 3Q77A 4O3UA 1N1LA 2SGEE 1O2MA 1UTJA 3NK8A 2OCVB 2WUCA 3EA8A 2FPZA 3P70B 1C1UH 1PPZA 1QBNA 1EX3A 4ZROA 2G55A 2GCTB 1FY8E 3TGKE 3SQHE 3MFJA 2GZ9A 1KTTB 1TBRH 3PMBB 5L2ZH 2FODA 3B8JA 2ZEBA 4B2CA 3S69A 2SNVA 3RMMH 4GLYA 2QXGA 2A5IA 5K7RA 1F92A 2XBWA 2RA3A 2R3UA 1O3LA 1FI8A 4CHAC 1O3IA 1WQSA 3KL6A 4YT7H 2BD7A 2ZO3H 1YCPM 5F8ZA 5C1XA 1KXCA 1O5EH 1F0UA 1TNJA 1XMNB 2XYAA 1EJMA 2J94A 1BB0B 3LGUA 3QGJA 1PQ5A 3M7QA 2FZZA 1TX6A 4ZXXH 1BRCE 1LHCH 3A80A 1G3CA 4F49A 3RM0H 1O2YA 5GCHF 2PUQH 1O2VA 4ZAEA 2XWBI 1WU1A 1SOTA 3SV8A 1ZR0A 3D65E 5DO4H 2BHGA 2XRCA 1EJAA 2NWNA 1QL7A 1AQ7A 2WPHS 2XC5A 4NSVA 2Z9IA 4Q7YA 3GY6A 2GGVB 2BDIA 2J34A 2R3YA 3PTBA 3KF2A 1GI5A 1NPMA 3CS0A 5HMAA 4CHAB 2HNTC 1P2NA 3HPTB 3RXSA 4A1VA 1V2QT 1ETTH 1HUTH 2Y5GA 2PW8H 3FAOA 3VXFH 4AYYB 2BOKA 3LGTA 1OWIA 4FU7A 4ZKSU 3M3SA 1TAWA 3ZZCA 3GYLB 4I32A 4MTBA 1K1IA 2C4FH 3QLPH 1MTNC 2ZDNA 2PFEA 5LPRA 1UTMA 1LPGB 1DOJA 1ZMNA 3OX7U 1IAUA 2RCEA 2STAE 4F4OC 2ZKSA 1C5WB 3OTJE 2XWAA 4INHA 5GIBA 1A61H 3SGAE 3PROA 1HAYB 1BTPA 1C1MA 1TLDA 1QB6A 4K2YA 1MCTA 2B0FA 1KIGH 1C2FA 2QN5T 3GY5A 1FQ3A 2VVCA 1QRXA 1CA8B 1EZSC 3Q3XA 2FLBH 4ABAA 1BHXB 2ESTE 4Q7ZA 3C1KA 2ALVA 1ANCA 2BD9A 4X6OA 1GBBA 1GHAG 1P3CA 3R0FA 3RC6A 3A8AA 4OS1A 2P95A 4ZHMU 3SU5A 2ILNA 1DXPA 3RXBA 2R0KA 1P9SA 1HB0B 1T8LA 4IC5A 1AFEH 3BIVH 1OWJA 5EQSA 4BOHA 3FFGA 5EPYA 4WF8A 1XUFA 2Y81A 3LDXH 4BAMB 3BF6H 2BQ6B 1ZSKA 2FXRA 2ZFFH 3SV6A 2XBYA 5FPYA 1GDUA 3RMNH 5BPEA 3RXOA 2ZGCA 3RXIA 4YZUA 2B7DH 3U9AH 1UTQA 1DVAH 2WPMS 2WPKS 1AWHB 5HM2A 1EUFA 2ODQA 3P95A 2AS9A 1O2OA 3TLOA 1EZXC 1WYKA 8GCHG 2RG3A 2VWLA 2CJIA 4Y79A 1GCTC 2Z9GA 1GJDB 1MKXK 3MOCA 4JMYA 1VJ9U 1N6YA 1XVOA 2G81E 1TOCB 3SGQE 3G01A 1QB1A 1BZXE 2A0QB 2H9TH 1C5OH 2W7UA 3LJOA 1V2JT 5DP7A 4CH8B 5GWZA 4ABBA 1WSSH 2P93A 2W26A 3OU0A 1JMOH 4B73A 1B7XB 2TGTA 3MNSA 4AG2A 1E38B 3LONA 5DG6A 5FAHA 4U32A 4X2WA 1ZYOA 4ZMAH 3LGIA 4IMQA 3RMOH 4K3JA 1RTFB 2FLRH 4IS5A 1W0YH 2PWXA 1MTUA 3TJNA 5L6NH 1EKBB 2O8UA 1Y3VA 4YOGA 3HKIB 2CMYA 1NU9A 1BMNH 1N8OB 1S6HA 4UE7H 3A7WA 1C5TA 2ZPQA 3UR9A 1ABIH 1TGCA 4DY7B 1GCTB 2BXTH 1DT2A 5H4IB 1QIXB 1NFWA 3DUXH 4WJG2 5FBIA 3GY7A 4GPGA 4D9QA 1V2VT 2QF3A 3Q76A 5LPFA 1KY9A 1JIMA 1GHVH 1P04A 1SHYA 1V2UT 1C4U2 1XVMA 1YC0A 2GTBA 3T28A 2BTCE 3TPIZ 2Z9JA 1AKSA 2NU4E 1BITA 1F0SA 3ATMA 3ZV9A 3S0NA 1C2KA 3A87A 3FZDA 4E06H 1FY3A 3SUDA 1ZSLA 1SBWA 2XCNA 1QB9A 4B2AA 2PKSB 1TA6A 4UONA 1GPZA 3MO3A 3RMLH 3UUZA 1GMCF 2HNTE 4AFZA 4NIVA 1WV7H 3QZQA 4FUGA 1ZTJA 2PKAA 4ABFA 1O3OA 7KMEH 3Q00A 4I33A 3QX5H 2FP7B 1JRSA 3FZZA 5GDSH 2QA9E 3EE0B 3RXPA 3TNSA 2P3TB 1ZPBA 5HYOA 3M5NA 3PM3A 2R0LA 2VH6A 3VB4A 3SJ8A 4ABHA 3S9BA 2WYGA 2ZTYA 1GMDF 2FWWA 1DUEA 1YPKH 2SNWA 1W11U 1MKWK 2YOLA 3SI3H 1MQ5A 1DX5M 4E05H 1SGRE 2Z9KA 1GBLA 1VJAU 3QO6A 2J95A 3VFEA 5AF9H 1TGNA 2Y6TA 4XDEA 2UUJB 4X6PA 3RXUA 1DSTA 1OS8A 1SLUB 1L1GA 2P59A 1S0RA 1ELFA 2ZU3A 1P2JA 1C2MA 4MPXA 5C3NA 1CA0C 1ZGIA 3GCHC 1EOLA 1UVSH 1W13U 2ZCHP 5G4BA 4NA8A 3SW2B 4B74A 4J2YB 1P0SH 3A86A 3T29A 2G4UA 2O8MA 5CHAC 1G3BA 4K1SA 4MPVA 1O5BB 2BD8A 3GICB 1GJCB 3URDA 1A5HA 3VB6A 3PO1B 4AZ2B 1EAWA 1PPBH 3BSQA 5IYTA 4XBBA 4IW4E 1WAYB 3QGNB 4ABIA 3E91A 1Y5AT 2H2ZA 1GL1A 2GV6A 4D7FA 4KKDA 4MLFB 2AMPA 3VEQB 3MNXA 2G5VA 3LIWA 4KTCA 5CE1A 3RXHA 4CRFA 2A5KA 1O2ZA 1MAXA 2H5CA 3M5OA 3GDUA 4LOYH 3TK9A 3KIDU 3E0PB 4GUXA 4Y8ZA 1SSXA 1RD3B 1UCYK 5DJ7A 1C2LA 1O0DH 1P05A 2PGQB 1XXFA 7GCHG 1EAUA 3SN8A 3K65B 4AB8A 1FDPA 2HOBA 5FPSA 3VB3A 2FS9A 8KME2 1T8MA 1P12E 3MNCA 1CA0B 1BCUH 5JPMH 2C8XB 1FPHH 1RIWB 1AU8A 3GCHB 3LGWA 1O32A 2XBXA 1EB1H 5A8XA 1IHSH 3O8BA 6GCHF 1NFUA 4WWYA 1UVUH 1NU7B 1KXEA 5CHAB 2DE8A 1IQKA 1FZZA 2GCHF 3M37A 3GY2A 1QL9A 1LKBA 1WCZA 1DDJA 4MDSA 5T6GA 1NRPH 3QK1A 2C90B 1C1TA 3SBKA 1GJBB 3L33A 1HAPH 5JB8S 1FNIA 1O2SA 1FMGA 1C2DA 2OC1A 4AB9A 3ATWA 1M9UA 3BTHE 2W3IA 2PTNA 2Z3CA 4WXIA 3DA9B 2ZCLP 3SU0A 4FUBA 3SOSA 1PJPA 5EGMA 1O3BA 2QC2A 1PPHE 3L3TA 1KLJH 1IQGA 4DOQA 3NCLA 1TFXA 3EDXB 2VNTA 3DHKH 3MI4A 2VIVA 1TPAE 1Q3XA 3LC5A 4Q2KA 2Q1JA 4SGAE 1ELCA 1AE5A 4AFUA 4BAKB 1TGTA 1CHOF 1RTLA 2FOFA 1HAIH 4VGCC 3GDSA 3EYDA 1UTPA 1AZZA 1ELDE 1EAXA 1DANH 3K9XB 1Y3WA 1HXFH 2PSYA 1GVLA 1K21H 2XTTB 1OYTH 1XKAC 3BEIB 1ELEE 1MD7A 4YTAA 4B75A 4O9VA 2AEIH 3VB5A 1FAKH 3MO6A 1A0JA 2J9NA 1ZMJA 1GHXH 1Z8IB 2GMTC 4X2VA 3IG6B 3M3TA 4I8JA 1C5VA 2Q6DA 2VIPA 1O2XA 3RXLA 4YLUA 1UHBB 2UWLA 2ZFQH 1LQDB 3ATIA 4DCDA 3SU6A 1EPTA 2BX4A 1PFXC 2K1QA 3KGPA 2OTVA 3LGYA 1CGHA 1MU6B 1C1PA 3GCNA 3M35A 1TRMA 1DITH 5DP5A 1VR1H 1GG6C 4VGCB 1QRWA 1C1OA 3UREA 1PPGE 3CENA 2PHBA 1K1LA 1P2QA 2ANMH 4NCYA 2VGCB 1C5MD 3Q3YA 3F9GA 4IBLH 3U1JB 2ZDMA 2QF0A 2D1JA 1GI3A 3HK6B 2H5DA 3RC4A 2TRMA 1CHGA 1WTHD 1O36A 2AMDA 4KP0A 1ZGVA 4NIYA 1SPJA 1QHRB 1F7ZA 2QGRA 2A45B 4Q7XA 3BEUA 5EG4A 2DUCA 2GMTB 2EI8A 5A0BA 1OWKA 3UQVA 1HLTH 5A0CA 1TMTH 1O3MA 1G37A 2QAAA 3F6UH 1BMLA 2PGBB 5C1YA 1TB6H 1NFYA 3ZVEA 7ESTE 1XUJA 4UFEH 1W3CA 3SNDA 2BMGB 2OD3B 2CHAB 4TYDA 2CV3A 2VVUA 4X1SU 1QR3E 2BLVA 3U98H 1GG6B 1NESE 1F5RA 3FP7E 1P2OA 1XUKA 5E2PA 3UNRA 1O31A 3SV7A 3ZYDA 1SGNE 3ZVGA 1EQ9A 4Y71A 3RXDA 5DP6A 3MO9A 3GY8A 2ZP0H 4UFGH 1Y59T 3MWIU 1Z1JA 2A4RA 3M36A 4NFEA 1MAYA 3TH3H 1E36B 1C5PA 6CHAB 1LPKB 4MPUA 1DY9A 2OBQA 5FBEA 4TY7A 2OUAA 1OP2A 1G2LA 2F9VA 5JDUB 5DGJA 2ZPSA 4IN2A 2OLGA 1BDAA 1O5CB 1S0QA 2VU8E 4ABEA 4WH8A 1AY6H 1C1WH 1UVTH 1XUGA 3BIUH 1YGCH 1LMWB 3T62A 4CR5A 3LGVA 3SQEE 3O8RA 1S6FA 1GMDG 1QCPA 4JZDH 1K1PA 1DY8A 5AFYH 2AIPA 4M7GA 4WMEA 5C67A 4K1EA 1QGFA 3SNEA 1ETRH 1YKTA 1DWBH 4MNYA 1S82A 2G8TA 3GYMA 1XM1A 5L30H 2J4IA 1AFQC 1HIAA 3UQOA 2OP9A 4BNRA 1ARCA 1RTKA 1OPHB 1P3EA 2VIOA 1HDTH 1KTSB 1T7CA 4WMFA 4U01A 1UO6A 1BA8B 2ZGHA 3TITA 1GBCA 3KHVA 1RGQA 4GVUA 3ZVCA 1ETSH 2ODYB 2V6NA 4ISHH 3V12A 1ZHRA 1GBKA 3KQBA 1TE0A 2BQWB 1O3EA 1UTKA 2J38A 1JBUH 3UOPA 2BM2A 2FESH 3K6YA 1W14U 2HALA 4X1RU 2ZA5A 2ZC9H 1ZRBA 4JYTA 4MPWA 1VITF 5TJXA 1YCPK 2HGTH 1UJ1A 3RXAA 2G52A 2FOEA 4ZHLU 2VIWA 2ZCKP 2FMJA 5EOKA 4ABJA 1LVBA 2ZQ2A 1P01A 1TMUH 5DKMA 2A1DB 1TNLA 4FUDA 1K1NA 1ORFA 1YPMH 3FP8E 4YO9A 3F9FA 2RA0A 4AGJA 4NFFA 8ESTE 1ZTLA 1NRSH 1F0RA 1AB9C 2Y80A 1AVWA 2C3SA 1Z8JB 3BTKE 2NU0E 1ELGA 1C9TA 3MU4A 1GGDC 1O2HA 3F68H 4X1PU 3SUEA 4FUJA 5FHTA 4D76A 5EW1H 4BANB 4BAOB 1C2HA 2BY5X 1IQIA 4JYVH 1SGFA 1SL3A 1SLWB 1THPB 2TGDA 2IOTA 1DWCH 4KTUA 5DP9A 3A7ZA 1JXPA 4YESB 4K8BA 5AHGH 4ZKRU 1SGDE 3LJJA 1ANBA 4FVBA 3V7TA 5F6MA 1F0TA 1D9IA 2JH5D 1PQ8A 1C2EA 3M7TA 1WOFA 4JCNA 3U8OH 4ASHA 1ZPZA 1B0FA 3E0NB 4NZLA 3LH3A 5E0HA 1T8NA 4O97A 1GDQA 1TPOA 4HTCH 3ZZ7A 1FV9A 2HPQH 2WPLS 1GHWH 1C4Y2 2HPPH 2Y82A 4THNH 1AB9B 1BBRE 4OGXA 2ZHWH 4NIWA 1A46H 5JBBS 2WPIS 1MTVA 1GGDB 3F9EA 1SFQB 1MTNB 4DIHH 1TRYA 1DPOA 5E0JA 5DPAA 1E34B 3D49H 4U30A 1EP6A 3RLWH 5A09A 1D3TB 2ZG0H 3ZYEA 1B0EA 3SU2A 1THSH 2KAIA 2THFB 1ZJDA 2F3CE 2AYWA 2BXUH 6LPRA 4YOJA 1XUIA 3D62A