1FMGA

Crystal structure of porcine beta trypsin with 0.04% polydocanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fmgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fmgA02
2TBSA 1VZQH 1O2OA 2AS9A 3O8CA 4B76A 3GYLB 1C5YB 5I25A 5JB8S 1BZXE 3ATMA 4AN7A 1IHTH 2Z94A 4ZH8A 1BMLA 1ELGA 5ETXA 1GDNA 2W26A 4KTUA 1F92A 1ANDA 1C2DA 1QNJA 5FX5A 3PLBA 3RXOA 3S9CA 1C5SA 3HGNA 1GI4A 2VVVA 1Z8GA 4NA8A 1UTNA 4NZLA 1EASA 2G8TA 1B5GH 5HYOA 3LPRA 5IDKA 2ZTYA 1ELDE 2C4FH 3A84A 2C8WB 1H9HE 1MTVA 4Y10E 3E8LA 1YPHC 4TWYA 1WQSA 3V0XA 2J95A 4Y71A 1ZHPA 2H2ZA 2A0QB 1ZPBA 1RTFB 1TGBA 3BG8A 3MNCA 1FY3A 1OWDA 1O3MA 4XE4A 1EPTB 1SQOA 3T5FH 2FI4E 2G55A 4X2YA 1C9TA 1GHXH 1PQ7A 4MQAA 1UCYE 1RIWC 1CGJE 4B75A 2NWNA 5DO4H 1T8LA 2GCHF 3PMHB 1HAYB 1O37A 5BPEA 3C27B 1TFXA 1GI2A 3TIUA 3MTYA 1HJAC 3F6UH 4U2WA 1C5MD 1G3EA 1CGHA 1S81A 4OS6A 4X2XA 1V2KT 1C2MA 2ZIQH 3TNSA 4X1QU 4OS2A 1SLWB 1P57B 3S7HB 1UTMA 2ODYB 1FPHH 4AYYB 1NROH 5L2ZH 1GCTC 1WOFA 2CN0H 1SGCA 2AMPA 3BEUA 2ULLA 1FAXA 2C90B 2O8WA 3KNXA 2FYQA 1GBIA 3PM3A 1KTSB 4IW4E 3BEIB 5CE1A 3BF6H 3VXEH 6ESTA 1THPB 1GHBF 1V6DA 1O2RA 1P8VC 1O3GA 2F83A 1AZ8A 1RFNA 4MPVA 1ACBE 1GI7B 1ZR0A 1K9OE 1ARBA 2BD5A 1A61H 3PMJA 4XBCA 1FY5A 4ZKNU 1PYTC 1J16A 2OXSA 1QR3E 5C1XA 5J4QA 2PSXA 4ZXXH 2V3OH 3Q3YA 2BLOA 1ZYOA 2GDDA 4UE7H 1EOJA 2BDAA 2WINI 2B7DH 4ISOA 6LPRA 2ZHQH 2JH5D 1ZMJA 2PW8H 3FAOA 5C5NA 3DT0H 2JH6D 1FLEE 2F9VA 1YC0A 4FU8A 2DE8A 1TMBH 5GCHG 1ID5H 2STBE 1B7XB 1DXWA 3F1SB 1FUJA 3LIWA 4DVAU 3TGJE 3UNRA 4UFEH 1VR1H 1EAIA 1LO6A 1P2KA 2F9UA 4GHTA 3EAJA 3KCGH 4O3TA 1CT0E 3EYDA 1TGTA 1HNEE 4GHQA 5A09A 1W2KH 3GYMA 5HMAA 2VB0A 3ATLA 2RCEA 1UCYK 5E8EH 4LZ1H 1UHBB 1SI5H 4YTAA 1A7SA 2ZTXA 1AMHA 1FIWA 3BG4B 3M3TA 5EOKA 3P95A 3BTWE 3MU1A 4X6OA 1JOUB 1PQ5A 3RXEA 1PPCE 1GI5A 4K3JA 1O5DH 3SORA 2HLCA 4Y7AA 4Q7YA 3LC3A 2OD3B 2WV4A 1D6RA 2F9BH 3E0NB 1LVMA 5DP9A 2Q6GA 2BDIA 2BQ7B 4OS5A 5FHTA 4MNWA 1W0YH 1EXFA 3Q3KA 4I8LA 3OY6U 2ZU4A 1AWFH 1DITH 3SU0A 1DS2E 4JYUH 1OYQA 4X0WU 2HPQH 3IWMA 2A1DB 5FX6A 4JYTA 1TBRH 1DUEA 1CT4E 2NU3E 2ZA5A 2TGPZ 4NFFA 3RUOA 5BRRE 2A7JA 4GUXA 3RXRA 2ZCHP 1TRNA 1N1LA 4BTUB 1ANEA 4AG2A 3E0PB 3QTOH 3TJNA 1UTQA 2ZI2H 3MHWU 3Q00A 3RDZA 1ORFA 1T4VH 1TONA 3SV8A 1QRWA 4B1TA 4X8UH 1RRKA 2B9LA 5EODA 1L4DA 1C5RA 3KL6A 1QBVH 1YPEH 1WU1A 1AE5A 1RTKA 1W10U 3VB6A 1SOZA 2BHGA 1XKAC 1B0EA 4Y8ZA 1GJ4H 1O3LA 2SNWA 3BTDE 2CHAC 3EA7A 5LPRA 2SGEE 1SG8B 3OTJE 1HAVB 1G3DA 1MH0A 3V13A 6CHAB 4LOYH 3PV4A 3A7YA 1A0HB 5E2OA 4R8TB 1SSXA 2P3UB 1NT1A 3UNQA 3U1JB 2HPPH 1AVWA 1XM1A 6GCHF 1TMTH 1DLKB 1JBUH 2FYRA 1LKAA 2FM2A 3AW0A 3SZNA 1D9IA 2BY6X 4HFPB 3RXPA 3UR6A 1JIMA 1F0RA 1FY1A 2BY8X 4CRAA 2PKSC 4BAHB 2ZECA 3LH1A 4Q2KA 2J9NA 1GJ8B 1O2MA 4VGCB 4B2CA 1O2HA 1CBWC 1BBRE 1OWJA 3D62A 2XW9A 1Y3XA 2ZDAH 1GHWH 1OX1A 4BAMB 3A88A 2FXRA 2QYIA 3MMGA 1ARCA 3LJOA 1MTNB 1WBGB 3F68H 4YZUA 1C2IA 1HB0B 1HGTH 1AHTH 1NRNH 5GXPA 2GV6A 2HWLB 2AYWA 4ISLA 1A5IA 1GJ9B 2A5IA 1SGPE 1C5TA 3WY8A 1C2EA 3STIA 4CH8B 5F6MA 3M5LA 1QY6A 2V0BA 2KAIA 4JMYA 4AORA 4ABHA 3ITIA 2C8ZB 1LPZB 4Q7ZA 1YPKH 3QGJA 2YNBA 3BV9B 3NCLA 1MMJN 5DP5A 3AASA 2XRCA 2OC1A 5C1UA 2AEIH 3ZZAA 4MTBA 1TPOA 1CA0C 2H6MA 4JZFH 3QN7A 1IQNA 4B2AA 1HJAB 3UQOA 4UONA 2Q6DA 2ZEBA 5F03A 1C5XB 2AGEX 2O9QA 4RSPA 1H9IE 6CHAC 4NWLA 3M61U 1O5CB 1O0DH 1P11E 4DY7B 3RXQA 3SU1A 1C2KA 2R0LA 4Y7BA 1DWBH 1LMWB 1ABIH 1C2LA 4KGAA 1K28D 1Z8JB 1W7XH 2PTCE 1MUEB 3ZZ3A 2VU8E 1IQGA 1SGEE 2PWXA 4GCHG 2P8OB 4MNYA 3F9HA 2Y6TA 3ZZDA 1TNIA 1WV7H 1DXPA 5G4BA 1TQ0B 3GY4A 2TRMA 3KN2A 2R0KA 2ZQ2A 4ZMAH 1C5WB 2ZDNA 1V2OT 5PTPA 5FPYA 1O5EH 4HTCH 3LGIA 2FOGA 2WPLS 3U1IB 1IQHA 2Z9IA 2FS9A 3K2UA 4BXSA 2GGVB 1H8DH 4AB8A 2CMYA 4XBBA 2AERH 3STJA 4E7NA 3RC6A 5EW2H 1BRCE 3T28A 2FIRH 2BDHA 1AFEH 1LVOA 1CU1A 1JRTA 3KQBA 3K6ZA 3BSQA 4WMEA 5T6GA 2H5DA 1UVTH 3QLPH 4ESTE 2GZ7A 2OQ5A 2G5VA 1CE5A 3RXSA 2VNTA 1EKBB 1GG6C 1QA7A 2JETB 4DIIH 2Z9GA 1A3EH 1LHCH 3P70B 3MNSA 1SQTA 4U30A 4A1TA 2FI3E 2UUFB 1C1VH 3SJKA 4E05H 4CR9A 1XUGA 1RTLA 4FVDA 3PLPA 4VGCC 3A82A 2QF0A 2P95A 3KGPA 5E0JA 1C5QA 1TWXB 3E90B 3OU0A 1QJ1B 4OGXA 2FZZA 1EAXA 1ZZZA 3Q3XA 3MNBA 1Z8RA 2BY5X 3FZDA 2ZPSA 4GLYA 4I33A 3PYHA 1IQKA 4MPXA 4ABAA 4UEHH 4X1NU 2BOHB 3KQDA 2UWLA 4ZHLU 3LT3A 2SGDE 2BZAA 2KAIB 3MWIU 4Y11E 1H1BA 2ZHWH 1UVOA 2W7SA 1K1OA 5JPMH 1C5NH 3ZYEA 4XSKU 1MBQA 2XC0A 1BBRK 4DGJA 1AB9C 5GJ4B 3A7XA 1L2EA 2BD4A 1Z1IA 1FMGA 3TJOA 2AGGX 1O2WA 1Y59T 1QBOA 1GMHG 2A32A 1N6YA 2OLGA 2ZGJA 4YESB 5JDUB 1TNJA 2R3UA 5EXMA 3D23A 3HGPA 1BDAA 2H9TH 3LOXA 4Y0ZE 1G36A 2P3TB 2VGCC 5A8XA 1GHAG 4NFEA 3F9GA 3P8NA 1ZMLA 1BRBE 2VIVA 2ZPQA 1SFIA 3A7WA 3S9BA 3LGYA 4FUGA 3RLYH 1KYNA 1YPGH 2JH0D 1C1OA 4UFGH 1T8NA 5AFYH 3M5OA 4AX9H 3QUMP 2CHAB 2BY7X 3P92A 1WSSH 3ODDA 2SGAA 1C2FA 1QJ7B 1QBNA 2GD4B 1TOCB 3T62A 3GY3A 1MTSA 1C4V2 3A85A 4K5ZA 2ZNKH 1XUIA 5T6FA 1GBEA 4KELA 1YPJH 1ELCA 1B0FA 3GISB 1VGCB 7GCHG 4U01A 2ZGBH 1C1NA 1JRSA 4ZUHA 4K8YA 1GHZA 1GJAB 3SUFA 1MTWA 4ABJA 1DANH 1NFXA 3FANA 4K1EA 5A0CA 2XBVA 3A89A 3A7TA 4XDEA 1P01A 1O2GH 3SN8A 5JBBS 1AKSB 3SW2B 3UFAA 1GPZA 4U32A 3A7VA 2J4IA 1L1NA 1GI9B 1T8MA 1D3PB 1MKXH 1UTJA 2JETC 3SOSA 1E36B 4I8HA 3ZVAA 4B73A 4D76A 2ZGHA 4MVNA 4TPIZ 3PB1E 3UNSA 1DWCH 4CRGA 1O31A 3N7OA 2J94A 4WH6A 1C4U2 2OBOA 1AGJA 1T32A 2SNVA 4ABEA 1EQ9A 4MPUA 4JK5A 5DKMA 3VXFH 4H42U 1DE7H 4A92A 4A1XA 3NPSA 2H1UA 3FP6E 1KXCA 2Z9JA 1CA0B 2TIOA 1XUHA 1KY9A 2XBXA 2AIPA 5DP4A 2GZ9A 1GI6A 1K1NA 2B8OH 4R0IA 1SL3A 2A4RA 1O2NA 3P17H 5JBTA 1TX7A 1GMDG 3EA9A 1J17T 2CJIA 2RA3A 4X1SU 2ZU1A 3GCNA 1O3JA 1W13U 1A0JA 3TH4H 1GGDC 3M35A 4RN6A 3KF2A 3RXDA 3P8OA 3ZVCA 2Q1JA 1TBQH 3ENSB 2HVXA 2Z3CA 2Y81A 1FY8E 5DK1A 2FP7B 4DIHH 5TJXA 3PTNA 5LH8A 4OS1A 1KTTB 3TJUA 1E0FD 4D7GA 1Q3XA 4BXWA 2FEQH 4K1SA 5B6OA 2UWOA 1O5FH 2P3FH 1ZPZA 3SU5A 1QL9A 1S84A 3TH2H 1K1IA 4DCDA 1ESAA 2NU2E 3M3SA 1DWEH 4D9QA 3SBKA 5JBAS 3ZVGA 4KTCA 1SQAA 3ZVDA 4KKDA 1S82A 2AIQA 3SI3H 3URDA 2WYGA 3V7TA 3GICB 2YNAA 3MO6A 1TRMA 1NRPH 1LKBA 4MG3A 1ZGIA 1AFQB 3SNBA 2WPHS 3A8DA 1THRH 1MAYA 1O3KA 3BIUH 3M36A 1LQEA 3GCOA 3GY7A 4GSOA 1SGTA 1SLUB 4AFZA 1KDQA 1Z6EA 5DP3A 2RG3A 3HKIB 2ZO3H 5FBEA 4INLA 1G2LA 1QQ4A 5EG4A 1SOTA 3UUZA 1FDPA 1HDTH 1KXAA 1V2VT 1S85A 1F5KU 1ELFA 1WTGH 2GX4A 4KTSA 1CHGA 1ZSKA 1FV9A 1QHRB 1XUJA 2VVUA 3F9EA 1A0LA 1M9UA 5E2PA 1C1MA 4YLQH 2THFB 1DOJA 4XBDA 2PHBA 2QN5T 2ASUB 3A7ZA 1O39A 1Y5UT 2VWOA 3FFGA 2FO9A 1UO6A 2R2MB 3B9FH 1P02A 1Y5AT 4DG4A 1SGDE 2AGIX 3E3TA 1HAIH 1BMAA 3EQ0H 1GHVH 3UIRA 1IQLA 1GBTA 2XXLA 3MFJA 4BAQB 1TBZH 1AWHB 1C1SA 2Y5FA 4WVPE 5JYIA 2O8MA 1QIXB 4A6LA 5FCRA 1GBLA 4Y8YA 4RKJB 1V2JT 1C1RA 3TJVA 1BT7A 1OOKB 4X1PU 1KXFA 1SLVB 1GHAF 3DA9B 3QDZB 2DUCA 1C2JA 2BB4A 4THNH 5T3HA 1GI3A 1V2PT 2GMTB 5CHAC 1ANBA 1BTPA 1P2QA 1G3BA 1AUTC 4CBNA 3W94A 1HAVA 2GTBA 3V3MA 4GVUA 4YLUA 1V2QT 2ZCKP 4NA9H 1GBHA 2SGQE 1SBWA 3RC4A 1ZRKA 4ABIA 3HK3B 1GMCF 4WF8A 3ZZBA 1HJ9A 2F91A 3RXJA 2WPJS 4UDWH 5I46H 2EI6A 4LZ4B 1OP2A 1IQMA 2ZHEH 7GCHF 1A46H 1UVSH 4M7GA 3UR9A 3E1XB 1YLCA 3L33A 3RC5A 2C8YB 3RXMA 4BAKB 1ZTLA 4A5TS 1LVYA 1P3EA 3E91A 5JB9S 2GCTB 1KSNA 1PYTD 1TE0A 1YBWA 3SQHE 1C5LH 1GBDA 3UWJH 1HBTH 2FTMA 3NKKA 4ZKSU 3UQVA 3BTGE 3RXTA 1GBCA 1NC6A 1YPHE 2OC8A 3E16B 3LKWA 1O5BB 1PPEE 1U6QA 1GI0A 4D8NA 2TGDA 1GHYH 2IJOB 4BTTB 3ZV8A 1BHXF 1CO7E 4ZROA 1G3CA 1S83A 1V2MT 1BRUP 1G32B 2BMGB 1HAHH 1TNGA 4I31A 1O34A 1XXDA 3W95A 1O5AB 1GJDB 1XMNB 4IN2A 1GMCG 3SV9A 2FOCA 3MU8A 4ASHA 4AB9A 4B2BA 2ZU3A 1OKXA 2UUYA 2GMTC 5CHAB 3O8BA 1QJ6B 1NFUA 1NESE 2XNIA 1E34B 1YKTA 2PKSB 1T31A 1ZLRA 1T4UH 1GBJA 4SGAE 3ZZ5A 4ZAEA 1AVXA 2EEKA 3SGQE 2A31A 2AMDA 2XCFA 1HV7A 2Q6FA 3KQCA 4D7FA 1MCTA 1C2GA 3ZVEA 1P2NA 8ESTE 3V12A 2G52A 4CBOA 3RMMH 3U69H 1DY8A 1O3DA 1O2PA 2GKVE 1V2WT 3GY6A 4DJZB 3ZZCA 1ZTJA 3BTFE 2HRVA 1KXBA 4JZDH 1HYLA 3LONA 2A4QA 4JZ1A 3VEQB 4NCYA 6GCHG 1CHOF 5C1YA 3TK9A 1GBFA 3OSYA 2VJ1A 1KXEA 1TX6A 2PR3A 1V2UT 1L1GA 1MU8B 1FN8A 3BTME 3GCHC 3ZZ6A 1T7CA 2IOTA 1O3EA 4X6PA 2VIPA 3TH3H 1O2KA 1EJAA 2QXGA 4BOHA 3SNEA 1DSTA 3G01A 3AW1A 3FVFB 1ELEE 1JWTA 3SUGA 1W12U 1BQYA 3QGNB 4X2WA 1SVPA 4AFQA 4YT6H 1SGYE 3A87A 3SGAE 1EJNA 3PO1B 3CENA 1O2UA 1Y3UA 3VB3A 1BHXB 2XWAA 1IQEA 2OBQA 1NFYA 1ZSJA 3VPKA 1F7ZA 3UY9A 1EPTC 2OTVA 1TGSZ 2WPIS 2ZFPH 1E35B 1INCA 1BB0B 1RIWB 2ZZUH 1ELBA 2FWWA 2VWMA 3ATWA 1K1JA 2BOKA 3RU4T 2EA3A 1QRZA 3TVJB 1XVOA 2ANKH 3SUDA 1ZJKA 2VIWA 2ZC9H 2J2UA 1F0SA 7ESTE 2ZP0H 1HJ8A 1P2OA 4BTIB 2IPHA 1ABJH 1C1PA 2RDLA 3I78A 3ZZ8A 2STAE 2BXUH 1ETTH 3AVZA 1NPMA 2VINA 4RKOB 1ELVA 2BD3A 1AB9B 1BTYA 4CRFA 4TY6A 2ZF0H 5A0BA 3L6PA 3R3GB 1TNLA 4FUEA 1T8OA 2XBWA 1QTFA 1QQUA 2OINA 5FBIA 1AU8A 1KLIH 2G4TA 1EZXC 3UREA 3PLKA 3JZ1B 2XYAA 1HUTH 3A81A 5GWZA 1O2QA 2Z9KA 5C3NA 2VWLA 4D9RA 1X7AC 1Q2WA 1OSSA 4NA7A 4E7RG 2NU4E 4JZIA 2PTNA 3A8CA 1Z8IB 4NSVA 3HATH 3KIDU 2BDBA 1S6FA 2BQ6B 4MPWA 2GZ8A 2LNCA 4ABFA 3S9AA 3UOUA 4I8KA 2CGAA 3QTVH 3H7OA 4K60A 1MAXA 1VCQA 4X1RU 3ATKA 4MDSA 4IMZA 2ILNA 4AGJA 1W0ZU 1V2TT 3RXHA 1O33A 5GPIB 1CSOE 4YM9A 1FIZA 3QK1A 1BUIA 1PPBH 1FY4A 2GT8A 1BTUA 3SJ8A 5H4IB 1HAXB 3DUXH 1O2JA 1P05A 1S0RA 1Y8TA 1AIXH 5EU8A 3HKJB 4NSYA 1LPGB 3MI4A 4H6TA 2HOBA 4FVBA 1VJ9U 3U8RH 2Y7ZA 4CHAC 3LU9B 1J15A 2GV7A 4X8TH 5DP7A 4CRBA 1P3CA 1Z1JA 3RU4E 1V2ST 4FU9A 1ZPCA 1HXFH 2BD8A 1EOLA 3LGVA 1P06A 1GMHF 2BX4A 3BTEE 4INHA 4XOJA 2XWBI 4OS7A 4ZKRU 1OP8A 2XC5A 3GY5A 1GWAA 2ZDLA 1W7GH 1DPOA 1KIGH 1O2IA 1SLXB 4PROA 2Z3DA 2OC7A 4JK6A 1C9PA 3M5MA 1V3XA 2FOHA 1BIOA 2PKAB 4CREA 2ANWA 1TB6H 1C2HA 2ZGCA 3VB7A 1H8IH 3PMAB 1JXPA 1HAOH 1WYKA 1TOMH 3SJ9A 1NO9H 1F5RA 3MOCA 4GAWA 5ESBA 5GIBA 1G37A 3JZ2B 4IC6A 4X8VH 3MH7A 1AI8H 1MKWH 1SGRE 2D26C 1NS3A 5SGAE 1DX5M 1D3TB 1HLTH 4NG9H 1DFPA 5E0HA 3SU6A 1FPCH 3SQEE 1IHSH 1QCPA 4TPYA 1F0TA 2VWNA 2ZDVH 3ZVFA 2PSYA 3CS7A 3TK6A 2H5CA 2ZU5A 2BZ6H 2A5AA 4Y79A 1C5UA 1LQDB 1ELTA 1EZUC 5J4SA 3BEFB 3A83A 4Y8XA 4Q7XA 3ZZ9A 4CHAB 3MU5A 5EGMA 2QGRA 1ETSH 2AH4X 2IN2A 4K69A 5L6NH 1JIRA 1GJCB 1UCYH 4Q80A 1OWKA 3SV2H 4LK4A 2G81E 3PWCA 1YM0A 4KP0A 4Y76A 4ABDA 3MO3A 5DJ7A 3FP8E 1GJ6A 4TYDA 1ZHRA 1GCDA 2GDEH 5C5OA 4UD9H 2O8TA 2G5NA 1O3AA 4OS4A 5TCCA 1EZSC 1PPGE 8GCHG 2PLXA 1QURH 1EZQA 3CP7A 3SJIA 2ZDMA 1BITA 4AOQA 1NN6A 2JKHA 2SGPE 3P8GA 2O8UA 2Y7XA 2BDYA 3VGCB 4Y0YE 3RMOH 4GPGA 3DHKH 2VH6A 2ESTE 1EX3A 2QXIA 1GHBG 1O2LA 1UTPA 2AFQB 2RA0A 4WJG2 4X6MA 3A8BA 4HI3A 3S0NA 2FOFA 1P03A 5ESTE 2PUXB 2YOLA 5GCHF 2VVCA 2A2QH 1OYTH 1A4WH 3B8JA 1YF4A 1DY9A 3TU7H 3PWBA 1EAWA 4BAOB 1BTHH 3UWIA 1P10A 1BTWA 1XVMA 2VH0A 3ZZ7A 1VITH 3FZZA 1FNIA 1WAYB 1LVBA 5C20A 1BBRH 3MYWA 1Y5BT 3RXAA 1TIOA 2EC9H 1IQIA 3ZV9A 4CRDA 4WXIA 3LJJA 3O8RA 2A7HA 3LH3A 4YOIA 2UWPA 3U9AH 3RXUA 1ANCA 2A45B 2ALVA 2CF8H 1L4ZA 4FUCA 3NUMA 2F9OA 1AFQC 5HM2A 1TYNA 5DPAA 3DD2H 4FUJA 2GP9B 4A7IB 2ZFRH 3ATIA 5K7RA 2QC2A 1QRXA 3TITA 3UTUH 2ODPA 1VCWA 2PGQB 1D3QB 1E38B 4NWKA 1WTHD 3GY2A 1K1PA 1TQ7B 1GJ7B 3BTHE 3KHVA 1L1JA 3TNTA 8KME2 4AYVB 1NRSH 1SC8U 1PPZA 1HIAA 3KEEA 1GG6B 1BJUA 1P9UA 3U8TH 3QO6A 1UTKA 1MD8A 2V3HH 2VIDA 3VB4A 2BXTH 3RXKA 1P09A 2F3CE 1TRYA 1C5OH 1OWIA 4ISHH 3D65E 3I77A 1O32A 1TNKA 1GBAA 1P9SA 2C93B 5C67A 2FS8A 3GCTF 4K1TA 3DFJA 1C5ZB 1A5HA 3Q77A 1J14A 1RS0A 1DVAH 4ISIH 2BQWB 5AHGH 1NM6A 3TPIZ 2QCYA 1MQ6A 1EJMA 2B5TB 5CMXH 4Z0KA 1H4WA 2A4OA 2BTCE 3OX7U 1ZOMA 1WQVH 3H7TA 1PJPA 2A7CA 5LPEA 2I6SA 2VIQA 1QA0A 3GDVA 2BDGA 2UUKB 2WPKS 1GBBA 5DP6A 3RM2H 5IYTA 1WCZA 3T2NA 1BOQA 1VITG 1OP0A 1TPSA 3QZQA 2ZDKA 1G9IE 5TCAA 3VFEA 1ZSLA 2R2WU 3SNAA 1UHBA 4WMFA 1XX9A 1YYY1 4ZXYH 1MZAA 3SU3A 3D49H 4F4OC 4E06H 3RXVA 1ZGVA 5EXNA 2F9NA 1NU7B 1SMFE 1TALA 1A1RA 3RMNH 3RXBA 2P8OC 1NTPA 1GCTB 5DP8A 2O8LA 1NY22 1OS8A 2P93A 3LGWA 2R3YA 4FUBA 1DDJA 1CT2E 1AD8H 1SGNE 3T29A 3SO3A 5AFZH 1W8BH 3MH6A 2BVRH 1SR5C 2K1QA 4I32A 1VCPA 2OCVB 1HXEH 1GJ5H 2ZGXH 3OYPA 1BMMH 3K6YA 3SJOA 2TGAA 4JYVH 4NIVA 3TGKE 5LGOA 2GCTC 3M7QA 8LPRA 4H4FA 1TAWA 3SNDA 3TK5A 4DT7B 5FCKA 3GY8A 1TABE 1FONA 1MZDA 1ZRBA 1N8OC 1PQAA 4YOGA 1NFWA 1XUFA 2BLQA 2ZTZA 1EB1H 1SHYA 1GI1A 2M5TA 1TGCA 3GOVB 3IG6B 2BD9A 1TA6A 1MKXK 1P04A 3RXFA 1O2VA 4JCNA 1SFQB 1OWEA 1PQ8A 5EQSA 1P2JA 2NU1E 3NZIA 4H6SB 4IN1A 2W7UA 1AUJA 1AQ7A 1YP9A 3GCHB 2B0FA 1Z6JH 1P2IA 3L3TA 4GCHF 2Y80A 2FDAA 1O2XA 1TGNA 2FOEA 3DFLA 4O97A 2VGCB 3E6PH 2BD2A 1C1WH 2OUAA 3O8DA 5AVDA 1EPTA 1K22H 3RXIA 1DUAA 1ESTA 1CGIE 4Z6AH 4ABGA 2VIOA 1HFDA 5F8XA 5C2ZA 1LHEH 4CRCA 2C8XB 2EI8A 2Y5HA 2PKAA 1GBKA 4YOJA 4AZ2B 1PPFE 2NU0E 1PPHE 3M5NA 3BG4C 2QF3A 4FUDA 2FOAA 1MBMA 1LHGH 1W11U 1Y3YA 4X6NA 1TPPA 2TPIZ 3SU4A 1BMNH 3LGUA 1UK2A 9LPRA 2QAAA 1G2MA 1PFXC 1AVGH 2FESH 3MH4A 1AN1E 2AMQA 1UTOA 3PO1C 5EQQA 3QZRA 1THSH 4IGDA 1JMOH 3LGTA 1QL8A 4DURA 1O36A 1MCVA 1V2RT 2PUQH 2QV1A 1P2MA 3C1KA 4FU7A 4K8BA 1N8OB 2HALA 2OQUA 1O3PB 1MD7A 1RJXB 1YCPK 3P8FA 5L2YH 2QXJA 5DG6A 1OWHA 4I8JA 2GCHG 5T6DA 1ETRH 1A5GH 2ANYA 3MH5A 1XXFA 1FZZA 2ZPRA 3M37A 2I6QA 3VB5A 2ZFSA 4XFQA 3BTTE 1SGIB 1LDTT 1UTLM 2ZU2A 2FX6A 2TGTA 1SB1H 2SGFE 2FMJA 2A5KA 4MNXA 4CH2B 4NZQA 4OGYA 1ZHMA 1GL1A 1UK4A 2BLWA 1ZMNA 3SUEA 1IAUA 1QB1A 2FLBH 3SHAH 4J1YA 2J34A 7LPRA 1BRAA 1HPGA 1ESBA 1VITF 1MU6B 2BY9X 2J92A 2SFAA 3U8OH 1HAPH 4YT7H 2BVSH 3URCA 4O03A 4TY7A 3T25A 2Z7FE 1C4Y2 3AAVA 4CR5A 4WMDA 4YO9A 1P12E 3I29A 1QB9A 1GVZA 3U98H 1E37B 1GDQA 2QXHA 1DM4B 5EW1H 1C1UH 4FUIA 1CQQA 3QWCH 4IC5A 2Y82A 1MTUA 5GDSH 1XKBC 1C1QA 3FP7E 4NIWA 4AFUA 1LCYA 1LHFH 1IQJA 3M3VA 1AE8H 1ZTKA 4NIYA 7KMEH 1NU9A 4NIXA 1TMUH 1IOEA 2OC0A 1C5VA 2HNTF 1O5GH 1W3CA 1EP6A 3F9FA 4FUHA 4SGBE 5F8TA 3BIVH 2FOBA 3A8AA 4B71A 4ZHAA 1GGDB 2ZHFH 3A86A 4IMQA 2J38A 2W5EA 4ABBA 2DE9A 3ZYDA 1DT2A 1NZQH 2LPRA 1CBWB 2ALPA 2BM2A 3BN9A 3K65B 3ESTA 4NGAH 1YCPM 1S6HA 5A2MH 2FOMB 4JZEH 1SGFG 1EUFA 2XTTB 3MU4A 2W3IA 2A4GA 2A2XH 2Z6BD 2ZHDA 1DICA 5EXLA 2CV3A 5LPFA 1O3OA 3UPEA 1MQ5A 1YLDA 3S7KB 2FPZA 4K2YA 1UVUH 1EB2A 2ZCLP 2P16A 2D8WA 3PROA 1HIAB 1RD3B 2WUCA 3IITA 4FUFA 1FI8A 2Y5GA 2ZFTA 3BTQE 4Y6DA 1J9CH 3TLOA 4BNRA 1TLDA 4DOQA 1YGCH 1EATA 1P0SH 3GDSA 2WUBA 1RXPA 1QGFA 1D4PB 1TNHA 2ZWLH 2BVXH 5DGJA 8GCHF 1DLEA 2BX3A 2HGTH 1DWDH 1EAUA 3MO9A 1LHDH 2G00A 1FAKH 4ZKOU 1S0QA 3RM0H 1O38A 1H9LB 5A8ZA 3SI4H 3K9XB 1AO5A 5F8ZA 4AG1A 2F9PA 3PMBB 3OY5U 5HXFA 3T27A 2G4UA 1MTNC 2V6NA 2QA9E 3BTKE 3GDUA 4I7YH 1F5LA 1CHOG 1F0UA 1Q31A 1K21H 1O3FA 1TX8A 1XUKA 5FPSA 3LC5A 1LPKB 2BDCA 1O3CA 4X8SH 1RGQA 3NK8A 1GL0E 3LDXH 2BD7A 1BTZA 1O3HA 1HAGE 1ZJDA 4LXBH 4O3UA 4WY3A 1DSUA 5A0AE 3ELAH 2GT7A 2ODQA 3Q76A 2QY0B 2CF9H 1GBMA 4O9VA 1O3BA 3M7UA 3NWUA 1QL7A 2V35A 3QX5H 1AY6H 3RXCA 1AZZA 1UJ1A 3VGCC 1YCPH 2H9HA 5FPTA 1Z7KA 2WV5A 1SGFA 1SGQE 2PGBB 1QB6A 2QIQA 4WWYA 5FAHA 4B74A 1VJAU 1EP5A 1O2SA 1J8AA 1W14U 2FTLE 2EI7A 1KXDA 4WH8A 3SNCA 3ODFA 2Z3EA 4UFFH 3EDXB 5K0HA 4HZHA 2PV9B 3EE0B 4HGCA 2ZQ1A 1FXYA 3MU0A 3A80A 4ZHMU 1LTOA 3RLWH 4F49A 5FXLA 1HAZB 3HK6B 1UK3A 1UVPA 4AFSA 3AAUA 1V2NT 1MKWK 1GMDF 2WPMS 2ZFFH 5AF9H 1AKSA 2GVFA 1HRTH 1GI8B 2BLVA 1GDUA 1HCGA 1K1LA 1K2I1 1KDQB 1QFKH 1Y3VA 2FI5E 2ZG0H 1V2LT 1C1TA 1FJSA 1SPJA 3RU4D 9ESTA 5HM9A 1BJVA 1BA8B 5E0GA 1O3NA 2XCNA 2C3SA 2P59A 3P6ZB 2H9EH 3ZVBA 1TPAE 4X2VA 2R9PA 1TA2A 2G51A 1A3BH 1ELAA 3RXGA 1CVWH 1K1MA 3UOPA 5A8YA 4ISNA 2P94A 4UFDH 2FLRH 2W3KA 2WYJA 2ZFQH 2PFEA 1Y3WA 2D2DA 3RP2A 1G30B 1KLJH 3SV6A 1BTXA 1SHHB 5EQRA 3MNXA 3NXPA 5EPYA 3TGIE 3EA8A 4I8GA 1GJBB 1O35A 2Z9LA 1UMAH 2ANMH 2FODA 3CS0A 1L0ZA 1NRRH 1O2YA 2CXVA 1WUNH 5JBCS 2UUJB 1D6WA 2OP9A 4FXGH 3SGBE 2HNTC 3T26A 2XBYA 1Z71A 1GVKB 3PTBA 4J2YB 2FX4A 3RXLA 2BYAX 3RMLH 2XC4A 3HPTB 1S5SA 2HNTE 1O2ZA 4MNVA 1FQ3A 3B23B 4INKA 1KLTA 3KQEA 3R0FA 3SU2A 1YPLH 1C5PA 1O30A 1OPHB 5ABWA 4MLFB 2D1JA 1D3DB 3SV7A 2ZKSA 1BCUH 1YPMH 4IBLH 1VGCC 1A2CH 3S69A 4IS5A 1CA8B 4A1VA 1GVLA 1IQFA 1OXGA 4QT8C 5HGGA 1O2TA 1NRQH 4AGKA 1F2SE 4BANB 1FN6A 3GCTG 1O3IA 1N6XA 4WXVA 4TWWA 5EPNA 3M7TA 3ZZ4A 5L30H 3EGKH 4DW2U 3SHCH 3H5CB
chains in the Genus database with same CATH superfamily
2TBSA 1VZQH 1O2OA 2AS9A 3O8CA 4B76A 3GYLB 1C5YB 5I25A 5JB8S 1BZXE 3ATMA 4AN7A 1IHTH 2Z94A 4ZH8A 1BMLA 1ELGA 2JDID 5ETXA 1GDNA 2W26A 4KTUA 1F92A 1ANDA 1C2DA 1QNJA 5FX5A 3PLBA 3RXOA 3S9CA 1C5SA 3HGNA 1GI4A 2VVVA 1Z8GA 4NA8A 1UTNA 4NZLA 1EASA 3F3BA 2G8TA 1B5GH 5HYOA 3LPRA 5IDKA 2ZTYA 1ELDE 2C4FH 3A84A 2C8WB 1H9HE 1MTVA 4Y10E 3E8LA 1YPHC 4TWYA 1WQSA 3V0XA 2J95A 4Y71A 1ZHPA 2H2ZA 2A0QB 1ZPBA 1RTFB 1TGBA 3BG8A 3MNCA 1FY3A 1OWDA 1O3MA 4XE4A 1EPTB 1SQOA 3T5FH 2FI4E 2G55A 4X2YA 1C9TA 1GHXH 1PQ7A 4MQAA 1UCYE 1RIWC 1CGJE 4B75A 2NWNA 5DO4H 1T8LA 2GCHF 3PMHB 1HAYB 1O37A 5BPEA 3C27B 1E1RD 1TFXA 1GI2A 3TIUA 3PRDA 3MTYA 1HJAC 3F6UH 4U2WA 1C5MD 1G3EA 1CGHA 1S81A 4OS6A 4X2XA 1V2KT 1C2MA 2ZIQH 3TNSA 4X1QU 4OS2A 1SLWB 1P57B 3N7EA 3S7HB 1UTMA 2ODYB 1FPHH 4AYYB 1NROH 5L2ZH 1GCTC 1WOFA 2CN0H 1SGCA 2AMPA 3BEUA 2ULLA 1FAXA 2WZQA 2C90B 2O8WA 3KNXA 2FYQA 1GBIA 3PM3A 1KTSB 4IW4E 3BEIB 5CE1A 4RT1A 3BF6H 3VXEH 6ESTA 1THPB 1GHBF 1V6DA 1O2RA 1P8VC 1O3GA 2F83A 1AZ8A 1RFNA 3OAAD 4MPVA 1ACBE 1GI7B 1ZR0A 1K9OE 1ARBA 2BD5A 1A61H 3PMJA 4XBCA 1FY5A 4ZKNU 1PYTC 1J16A 2OXSA 1QR3E 5C1XA 5J4QA 2PSXA 4ZXXH 2V3OH 3Q3YA 2BLOA 1ZYOA 2GDDA 4UE7H 1EOJA 2BDAA 2WINI 2B7DH 4ISOA 6LPRA 2ZHQH 2JH5D 2YMSD 1ZMJA 2PW8H 3FAOA 5C5NA 3DT0H 2JH6D 1FLEE 2F9VA 1YC0A 4FU8A 2DE8A 1TMBH 5HIYA 5GCHG 1ID5H 2STBE 1B7XB 1DXWA 3F1SB 1FUJA 2IPQX 3LIWA 4DVAU 3TGJE 3UNRA 4UFEH 1VR1H 1EAIA 1LO6A 1P2KA 2F9UA 4GHTA 3EAJA 3KCGH 4O3TA 1CT0E 3EYDA 1TGTA 1HNEE 4GHQA 5A09A 1W2KH 3GYMA 5HMAA 2VB0A 3ATLA 2RCEA 1UCYK 5E8EH 4LZ1H 1UHBB 1SI5H 4YTAA 2JIZD 1A7SA 2ZTXA 1AMHA 1FIWA 3BG4B 3M3TA 3F2HA 5EOKA 3P95A 3BTWE 3MU1A 4X6OA 1JOUB 1PQ5A 3RXEA 1PPCE 1GI5A 4K3JA 1O5DH 3SORA 2HLCA 4Y7AA 4Q7YA 3LC3A 2OD3B 2WV4A 1D6RA 2F9BH 3E0NB 1LVMA 5DP9A 2Q6GA 2BDIA 2BQ7B 4OS5A 5FHTA 4MNWA 1W0YH 1EXFA 3Q3KA 4I8LA 3OY6U 2ZU4A 1AWFH 1DITH 3SU0A 1DS2E 4JYUH 1OYQA 4X0WU 2HPQH 3IWMA 2A1DB 5FX6A 1SQRA 4JYTA 1TBRH 1DUEA 1CT4E 2NU3E 2ZA5A 2TGPZ 4NFFA 3RUOA 5BRRE 2A7JA 4GUXA 3RXRA 2ZCHP 1TRNA 1N1LA 4BTUB 1ANEA 4AG2A 3E0PB 3QTOH 3TJNA 2V3MA 1UTQA 2ZI2H 3MHWU 3Q00A 3RDZA 1ORFA 1T4VH 1TONA 5CHBA 3SV8A 1QRWA 2VBCA 4B1TA 4X8UH 1RRKA 2B9LA 5EODA 1L4DA 1C5RA 3KL6A 1QBVH 1YPEH 1WU1A 1AE5A 1RTKA 1W10U 3VB6A 1SOZA 2BHGA 1XKAC 1B0EA 4Y8ZA 1GJ4H 1O3LA 2SNWA 2RDEA 3BTDE 2CHAC 3EA7A 5LPRA 2SGEE 1SG8B 3OTJE 1HAVB 1G3DA 1MH0A 3V13A 6CHAB 4LOYH 3PV4A 3A7YA 2QF4A 1A0HB 5E2OA 4R8TB 1SSXA 2P3UB 1NT1A 3UNQA 3U1JB 2HPPH 1AVWA 1XM1A 5C0TA 6GCHF 1TMTH 1DLKB 1JBUH 2FYRA 1LKAA 2FM2A 3AW0A 3SZNA 1D9IA 2BY6X 4HFPB 3RXPA 3UR6A 1JIMA 1F0RA 1FY1A 2BY8X 4CRAA 2PKSC 4BAHB 2ZECA 3LH1A 4Q2KA 5KECA 2J9NA 5C17A 1GJ8B 1O2MA 4VGCB 4B2CA 1O2HA 1CBWC 1BBRE 1OWJA 4F48B 3D62A 2XW9A 1Y3XA 2ZDAH 1GHWH 1OX1A 4BAMB 3A88A 2FXRA 5C94A 2QYIA 3MMGA 1ARCA 3LJOA 1MTNB 1WBGB 3F68H 4YZUA 1C2IA 1HB0B 1HGTH 1AHTH 1NRNH 5GXPA 2GV6A 2HWLB 2AYWA 4ISLA 1A5IA 1GJ9B 5EJLA 2A5IA 1SGPE 1C5TA 3WY8A 1C2EA 2KCOA 3STIA 4CH8B 5F6MA 3M5LA 1QY6A 2V0BA 2KAIA 4JMYA 4AORA 4ABHA 3ITIA 2C8ZB 1LPZB 4Q7ZA 1YPKH 3QGJA 2YNBA 3BV9B 3NCLA 1MMJN 5DP5A 3AASA 2XRCA 2OC1A 5C1UA 2AEIH 3ZZAA 4MTBA 1TPOA 1CA0C 2H6MA 4JZFH 3QN7A 1IQNA 4B2AA 1HJAB 3UQOA 4UONA 2Q6DA 2ZEBA 3KYFA 5F03A 3MQKC 1C5XB 2EY4C 2AGEX 2O9QA 4RSPA 1H9IE 6CHAC 4NWLA 3M61U 1O5CB 1O0DH 1P11E 4DY7B 3RXQA 3SU1A 1C2KA 2R0LA 4Y7BA 1DWBH 1LMWB 1ABIH 1C2LA 3F0OA 4KGAA 1K28D 1Z8JB 1W7XH 2PTCE 1MUEB 3ZZ3A 2VU8E 2PWXA 1IQGA 1SGEE 4GCHG 2P8OB 4MNYA 3F9HA 2Y6TA 3ZZDA 1TNIA 1WV7H 1DXPA 5G4BA 1TQ0B 3GY4A 2TRMA 3KN2A 2R0KA 2ZQ2A 4ZMAH 1C5WB 2ZDNA 1V2OT 5PTPA 5FPYA 1O5EH 1WDIA 4HTCH 3LGIA 2FOGA 2WPLS 3U1IB 5IK2D 1IQHA 2Z9IA 3N99A 2FS9A 3K2UA 4BXSA 2GGVB 1H8DH 4AB8A 2CMYA 3DSPA 4XBBA 2AERH 3STJA 2OK5A 4E7NA 3RC6A 2HLDD 5EW2H 1BRCE 3T28A 2FIRH 2BDHA 1AFEH 1LVOA 2EQNA 1CU1A 1JRTA 3KQBA 3K6ZA 3BSQA 4WMEA 5T6GA 2H5DA 1UVTH 5CDFE 3QLPH 4ESTE 2GZ7A 2OQ5A 2G5VA 1CE5A 3RXSA 2VNTA 1EKBB 1GG6C 1QA7A 2JETB 4DIIH 2Z9GA 1A3EH 1LHCH 3P70B 3MNSA 1SQTA 4U30A 4A1TA 2FI3E 2UUFB 1C1VH 3SJKA 4Q4LA 4E05H 4CR9A 5C0UA 2CK3D 1XUGA 1RTLA 4FVDA 3PLPA 4VGCC 3F2GA 3A82A 2QF0A 4F55A 2P95A 1YLNA 2J5UA 3KGPA 5E0JA 1C5QA 1TWXB 3E90B 3OU0A 1QJ1B 4OGXA 2FZZA 1EAXA 1ZZZA 3Q3XA 3MNBA 1Z8RA 2BY5X 3FZDA 2ZPSA 4GLYA 4I33A 3PYHA 1IQKA 4MPXA 4ABAA 4UEHH 4X1NU 2BOHB 3KQDA 2UWLA 4ZHLU 2QF5A 3LT3A 2SGDE 2BZAA 2KAIB 3MWIU 4Y11E 1H1BA 2HVYB 2ZHWH 1UVOA 2W7SA 1K1OA 5JPMH 1C5NH 4OM9A 3ZYEA 4XSKU 1MBQA 2XC0A 1BBRK 2LP6A 4DGJA 1AB9C 5GJ4B 3A7XA 1L2EA 2BD4A 1Z1IA 1FMGA 2J97A 3TJOA 1YWUA 2AGGX 1O2WA 1Y59T 1QBOA 1GMHG 2A32A 1N6YA 2OLGA 2ZGJA 4YESB 5JDUB 1TNJA 2R3UA 5EXMA 3D23A 3HGPA 1BDAA 2H9TH 3LOXA 4Y0ZE 1G36A 2P3TB 2VGCC 5A8XA 1GHAG 4NFEA 3F9GA 3P8NA 1ZMLA 1BRBE 2VIVA 2ZPQA 1SFIA 3A7WA 3S9BA 3LGYA 4FUGA 3RLYH 1KYNA 1YPGH 2JH0D 1C1OA 4UFGH 1T8NA 5AFYH 3M5OA 4AX9H 3QUMP 2CHAB 2BY7X 3P92A 1WSSH 3ODDA 2SGAA 1C2FA 1QJ7B 1QBNA 2GD4B 1TOCB 3T62A 3GY3A 1MTSA 1C4V2 3A85A 4K5ZA 2ZNKH 1XUIA 5T6FA 1GBEA 4KELA 1YPJH 1ELCA 1B0FA 3GISB 1VGCB 7GCHG 4U01A 2ZGBH 1C1NA 1JRSA 4ZUHA 4K8YA 1GHZA 1GJAB 3SUFA 1MTWA 4ABJA 1DANH 1NFXA 3FANA 4K1EA 5A0CA 2XBVA 3A89A 3A7TA 4XDEA 4DT4A 1P01A 1O2GH 4I86A 3SN8A 5JBBS 1AKSB 3SW2B 3UFAA 1GPZA 4U32A 3A7VA 2J4IA 1L1NA 1GI9B 1T8MA 1D3PB 1MKXH 1UTJA 2JETC 3SOSA 1E36B 4I8HA 3ZVAA 4B73A 4D76A 2ZGHA 4MVNA 4TPIZ 3PB1E 3UNSA 1DWCH 4CRGA 1O31A 3N7OA 2J94A 4WH6A 1C4U2 2OBOA 1AGJA 2WPDD 1T32A 2SNVA 4ABEA 1EQ9A 4MPUA 4JK5A 5DKMA 3VXFH 4H42U 1DE7H 4A92A 4A1XA 3NPSA 2KCAA 2H1UA 3FP6E 1KXCA 2Z9JA 1CA0B 2TIOA 1XUHA 1KY9A 3KYGA 2LELA 2XBXA 4ACBA 2AIPA 1H8ED 5DP4A 2GZ9A 1GI6A 1K1NA 2B8OH 4R0IA 1SL3A 2A4RA 1O2NA 3P17H 5JBTA 1TX7A 1GMDG 3EA9A 1J17T 2CJIA 2RA3A 1S6LA 4X1SU 2ZU1A 3GCNA 1O3JA 1W13U 1A0JA 3TH4H 1GGDC 3M35A 4RN6A 3KF2A 3RXDA 3P8OA 3ZVCA 2Q1JA 1TBQH 3ENSB 2HVXA 2Z3CA 2Y81A 1FY8E 5DK1A 2FP7B 4DIHH 5TJXA 3PTNA 3GS9A 5LH8A 4OS1A 1KTTB 3TJUA 1E0FD 4D7GA 1Q3XA 4BXWA 2FEQH 4K1SA 5B6OA 2UWOA 1O5FH 2P3FH 1ZPZA 3SU5A 1QL9A 1S84A 3TH2H 1K1IA 4DCDA 1ESAA 2NU2E 3M3SA 1DWEH 4D9QA 3SBKA 5JBAS 3ZVGA 4KTCA 1SQAA 3ZVDA 4KKDA 1S82A 2AIQA 3SI3H 3URDA 2WYGA 3V7TA 3GICB 2YNAA 3MO6A 1TRMA 1NRPH 1K0HA 1LKBA 4MG3A 3WWFA 1ZGIA 1AFQB 3SNBA 2WPHS 3A8DA 1THRH 1MAYA 1O3KA 3BIUH 3M36A 1EFRD 1LQEA 3GCOA 3GY7A 1QZ8A 1SGTA 4GSOA 1SLUB 4AFZA 1KDQA 1BMFD 5DSFA 1Z6EA 5DP3A 2RG3A 3HKIB 2ZO3H 5FBEA 1W0KD 4INLA 1G2LA 1QQ4A 5EG4A 1SOTA 3UUZA 1FDPA 1HDTH 1KXAA 1V2VT 1OHHD 1S85A 1F5KU 1ELFA 1WTGH 2GX4A 4KTSA 1CHGA 1ZSKA 1FV9A 1QHRB 3N7DA 1XUJA 4M9FA 2VVUA 3F9EA 1A0LA 1M9UA 5E2PA 1C1MA 4YLQH 2THFB 1DOJA 4XBDA 2PHBA 2QN5T 2ASUB 3A7ZA 1O39A 2V7QD 1Y5UT 2VWOA 3FFGA 2FO9A 1UO6A 2R2MB 3B9FH 1P02A 1Y5AT 4DG4A 1SGDE 2AGIX 3E3TA 1HAIH 1BMAA 3EQ0H 1GHVH 3UIRA 1IQLA 1GBTA 2XXLA 3MFJA 4BAQB 1TBZH 1AWHB 1C1SA 2Y5FA 2KR7A 4WVPE 5JYIA 2KM0A 2O8MA 1QIXB 4A6LA 5FCRA 1GBLA 4Y8YA 4RKJB 1V2JT 1C1RA 3TJVA 1BT7A 1OOKB 3FOAA 3UAIC 1NBMD 4X1PU 1KXFA 1SLVB 1GHAF 3DA9B 3QDZB 2DUCA 1C2JA 2BB4A 4THNH 5T3HA 1GI3A 1V2PT 2GMTB 5CHAC 1ANBA 1BTPA 2XOKD 1P2QA 1G3BA 1AUTC 4CBNA 3W94A 1HAVA 2GTBA 3V3MA 4GVUA 4YLUA 1V2QT 2ZCKP 4NA9H 1GBHA 3DSOA 2SGQE 1SBWA 3RC4A 1ZRKA 4ABIA 3HK3B 1GMCF 4WF8A 3ZZBA 1HJ9A 2F91A 3RXJA 2WPJS 4UDWH 5I46H 2EI6A 4LZ4B 1OP2A 1IQMA 2ZHEH 7GCHF 1A46H 1UVSH 4M7GA 3UR9A 3E1XB 1YLCA 3L33A 3RC5A 2C8YB 3RXMA 4BAKB 1ZTLA 4A5TS 1LVYA 1P3EA 3E91A 5B6LA 5JB9S 2GCTB 1KSNA 1PYTD 1TE0A 1YBWA 3SQHE 1C5LH 1GBDA 3UWJH 1HBTH 2FTMA 3NKKA 4ZKSU 3UQVA 3AK5A 3BTGE 3RXTA 1GBCA 1NC6A 1YPHE 2OC8A 3E16B 1COWD 3LKWA 1O5BB 1PPEE 1U6QA 1GI0A 4D8NA 2TGDA 1GHYH 2IJOB 4BTTB 3ZV8A 1BHXF 1CO7E 4ZROA 1G3CA 1S83A 1V2MT 1BRUP 1G32B 2BMGB 1HAHH 1TNGA 4I31A 1O34A 1XXDA 3W95A 4B6FA 1O5AB 1GJDB 1XMNB 4IN2A 1GMCG 3SV9A 2WSSD 2FOCA 3MU8A 4ASHA 4AB9A 4B2BA 2ZU3A 1OKXA 2UUYA 2GMTC 5CHAB 3O8BA 1QJ6B 1KMHB 1NFUA 1NESE 2XNIA 1E34B 1YKTA 2PKSB 1T31A 1ZLRA 1T4UH 1GBJA 4SGAE 3ZZ5A 4ZAEA 1AVXA 2EEKA 3SGQE 2A31A 2AMDA 2XCFA 1HV7A 2Q6FA 3KQCA 4D7FA 1MCTA 1C2GA 5T1VA 3ZVEA 1P2NA 8ESTE 3V12A 2G52A 4CBOA 3RMMH 3U69H 1DY8A 1O3DA 1O2PA 2GKVE 1V2WT 3GY6A 4DJZB 3ZZCA 1ZTJA 2L74A 3BTFE 2HRVA 1KXBA 4JZDH 1HYLA 3LONA 2A4QA 4JZ1A 3VEQB 4NCYA 6GCHG 1CHOF 5C1YA 3TK9A 1GBFA 3OSYA 2VJ1A 1KXEA 1TX6A 2PR3A 1V2UT 1L1GA 1MU8B 1FN8A 3BTME 3GCHC 3ZZ6A 1T7CA 2IOTA 1O3EA 4X6PA 2VIPA 3TH3H 1O2KA 1EJAA 2QXGA 4BOHA 4Z1MD 4XD7D 2IJD1 3SNEA 1DSTA 3G01A 3AW1A 2YMSB 3FVFB 1ELEE 1JWTA 3SUGA 1W12U 1BQYA 3QGNB 4X2WA 1SVPA 4AFQA 4YT6H 1SGYE 3A87A 3SGAE 1WXRA 1EJNA 3PO1B 1H8HD 3CENA 1O2UA 1Y3UA 3VB3A 1BHXB 2XWAA 1IQEA 2OBQA 1NFYA 3WW7A 1ZSJA 3NRLA 3VPKA 1F7ZA 3UY9A 1EPTC 2OTVA 1TGSZ 5KEDA 4RT0A 2WPIS 2ZFPH 1E35B 1INCA 1BB0B 1RIWB 2ZZUH 1ELBA 2FWWA 2VWMA 3ATWA 1K1JA 2F43B 2M2AA 2BOKA 3RU4T 2EA3A 1QRZA 3TVJB 1XVOA 2ANKH 3SUDA 1ZJKA 2VIWA 2ZC9H 2J2UA 1F0SA 7ESTE 4P02A 2ZP0H 1HJ8A 1P2OA 4BTIB 2IPHA 1ABJH 1C1PA 2RDLA 3I78A 3ZZ8A 2STAE 2BXUH 1ETTH 3AVZA 1NPMA 2VINA 4RKOB 1ELVA 2BD3A 1AB9B 1BTYA 4CRFA 4TY6A 2ZF0H 5A0BA 3L6PA 3R3GB 1TNLA 4FUEA 1T8OA 2XBWA 1QTFA 1QQUA 2OINA 5FBIA 1AU8A 1KLIH 2G4TA 1EZXC 3UREA 3PLKA 3JZ1B 2XYAA 1HUTH 3A81A 5GWZA 1O2QA 2Z9KA 5C3NA 2VWLA 4D9RA 1X7AC 1Q2WA 1OSSA 4NA7A 4E7RG 2NU4E 4JZIA 2PTNA 3A8CA 1Z8IB 4NSVA 3HATH 3KIDU 2BDBA 1S6FA 2BQ6B 4MPWA 2GZ8A 2LNCA 4ABFA 3S9AA 3UOUA 4I8KA 2CGAA 3QTVH 3H7OA 5HKKD 4K60A 1MAXA 1VCQA 4X1RU 3ATKA 4MDSA 4IMZA 2ILNA 3WWBA 4AGJA 1W0ZU 1V2TT 3RXHA 1O33A 5GPIB 1CSOE 4YM9A 1FIZA 3QK1A 1BUIA 1PPBH 1FY4A 2GT8A 1BTUA 3SJ8A 3OFND 5H4IB 1HAXB 3DUXH 1O2JA 1UW7A 1P05A 1S0RA 1Y8TA 1AIXH 5EU8A 3HKJB 4NSYA 1LPGB 3MI4A 4H6TA 2HOBA 4FVBA 1VJ9U 3U8RH 2Y7ZA 4CHAC 2KZ4A 3LU9B 1J15A 2GV7A 4X8TH 5DP7A 4CRBA 1P3CA 1Z1JA 3RU4E 3OEED 1V2ST 4FU9A 1ZPCA 1HXFH 2BD8A 1EOLA 3LGVA 1P06A 5DN6D 1GMHF 2BX4A 3BTEE 4INHA 4XOJA 2XWBI 2YMSC 4OS7A 4ZKRU 1OP8A 2XC5A 3GY5A 1GWAA 2ZDLA 1W7GH 1DPOA 1KIGH 1O2IA 1E1QD 1SLXB 4PROA 2Z3DA 2OC7A 2PP6A 1C9PA 2WV9A 3M5MA 4JK6A 5KGOA 1V3XA 2FOHA 1BIOA 2PKAB 4CREA 2ANWA 1TB6H 1C2HA 2ZGCA 3VB7A 1H8IH 3PMAB 1JXPA 1HAOH 1WYKA 1TOMH 3F2FA 3SJ9A 1NO9H 1F5RA 3MOCA 4GAWA 5ESBA 5GIBA 1G37A 3JZ2B 4IC6A 4X8VH 3MH7A 1AI8H 1MKWH 1SGRE 2D26C 1NS3A 5SGAE 1DX5M 1D3TB 1HLTH 4NG9H 1DFPA 5E0HA 3SU6A 1FPCH 3SQEE 1IHSH 1QCPA 1NBME 4TPYA 1F0TA 2VWNA 2ZDVH 3ZVFA 2PSYA 3CS7A 3TK6A 2H5CA 2ZU5A 2BZ6H 2A5AA 4Y79A 1C5UA 1LQDB 1ELTA 1EZUC 5J4SA 1FX0B 3BEFB 3A83A 4Y8XA 4Q7XA 3ZZ9A 4CHAB 3MU5A 5EGMA 2QGRA 1ETSH 2AH4X 2IN2A 4K69A 5L6NH 1JIRA 1GJCB 2KX4A 1UCYH 4Q80A 1OWKA 3SV2H 4LK4A 2G81E 3PWCA 1YM0A 4KP0A 4Y76A 4ABDA 3MO3A 5DJ7A 2WHXA 3FP8E 1GJ6A 4TYDA 1ZHRA 1GCDA 2GDEH 5C5OA 4UD9H 2O8TA 2G5NA 1O3AA 4OS4A 5TCCA 1EZSC 1PPGE 8GCHG 2PLXA 1QURH 1EZQA 3CP7A 3SJIA 2ZDMA 1BITA 4AOQA 1NN6A 2JKHA 2SGPE 3P8GA 2O8UA 2Y7XA 2BDYA 3VGCB 4Y0YE 3RMOH 4GPGA 3DHKH 2VH6A 2ESTE 1EX3A 2QXIA 1GHBG 1O2LA 1UTPA 1YY3A 2AFQB 2RA0A 4WJG2 3FN8A 4TT3D 4X6MA 3A8BA 4HI3A 3S0NA 2FOFA 1P03A 5ESTE 2PUXB 2YOLA 5GCHF 2A2QH 2VVCA 1OYTH 1A4WH 3B8JA 1YF4A 1DY9A 3TU7H 2QE7D 3PWBA 1EAWA 4BAOB 1BTHH 3UWIA 1P10A 1BTWA 1XVMA 2VH0A 3ZZ7A 1VITH 3FZZA 1FNIA 1WAYB 1LVBA 5GNDA 5C20A 2AHME 1BBRH 3MYWA 1Y5BT 3RXAA 2RFKC 1TIOA 2EC9H 1IQIA 3ZV9A 4CRDA 4WXIA 3LJJA 3O8RA 2A7HA 2KCYA 2J98B 3LH3A 4YOIA 2UWPA 3U9AH 3RXUA 1ANCA 2A45B 2ALVA 2KCPA 2CF8H 1L4ZA 4FUCA 3NUMA 2F9OA 1AFQC 5HM2A 1TYNA 3DSGA 5DPAA 3DD2H 4FUJA 2GP9B 4A7IB 2ZFRH 3ATIA 5K7RA 2QC2A 1QRXA 3TITA 3UTUH 2ODPA 1VCWA 2PGQB 1D3QB 1E38B 4NWKA 1WTHD 3GY2A 1K1PA 1TQ7B 1GJ7B 3BTHE 3KHVA 1L1JA 3TNTA 8KME2 4AYVB 1NRSH 1SC8U 1PPZA 1HIAA 3KEEA 1GG6B 1BJUA 1P9UA 3U8TH 3QO6A 1UTKA 1MD8A 2V3HH 2VIDA 3VB4A 2BXTH 3RXKA 1P09A 2F3CE 1TRYA 1C5OH 1OWIA 4ISHH 3D65E 3I77A 1O32A 1TNKA 1GBAA 1P9SA 2C93B 5C67A 2FS8A 3GCTF 4K1TA 3DFJA 1C5ZB 1A5HA 3Q77A 1J14A 1RS0A 1DVAH 4ISIH 2BQWB 5AHGH 1NM6A 4FOUC 3TPIZ 4ZCNA 2QCYA 1MQ6A 1EJMA 2B5TB 3SZEA 5CMXH 4Z0KA 1H4WA 2A4OA 2BTCE 3OX7U 1ZOMA 1WQVH 3H7TA 1PJPA 2A7CA 5LPEA 2I6SA 2VIQA 1QA0A 3GDVA 2BDGA 2UUKB 2WPKS 1GBBA 5DP6A 3RM2H 5IYTA 1WCZA 3T2NA 1BOQA 1VITG 1OP0A 1TPSA 3QZQA 2ZDKA 1G9IE 5TCAA 3VFEA 1ZSLA 2R2WU 3SNAA 1UHBA 4WMFA 1XX9A 1YYY1 4ZXYH 1MZAA 2KFWA 3SU3A 3D49H 3SYJA 4F4OC 4E06H 3RXVA 1ZGVA 5EXNA 2F9NA 1NU7B 1SMFE 1TALA 1A1RA 3RMNH 3RXBA 2P8OC 1NTPA 1GCTB 5DP8A 2O8LA 1NY22 1OS8A 2P93A 3LGWA 2R3YA 4FUBA 1DDJA 1CT2E 1AD8H 1SGNE 3T29A 3SO3A 5AFZH 1W8BH 3MH6A 2BVRH 2XNDD 1SR5C 2K1QA 4I32A 1VCPA 2OCVB 1HXEH 1GJ5H 2ZGXH 3OYPA 1BMMH 3K6YA 3SJOA 2TGAA 4JYVH 4NIVA 3TGKE 5FL7D 5LGOA 3PV5A 2GCTC 3M7QA 8LPRA 4H4FA 1TAWA 3SNDA 3TK5A 4DT7B 5FCKA 5EJZA 3GY8A 1TABE 1FONA 1MZDA 1ZRBA 1N8OC 1PQAA 4YOGA 1NFWA 1XUFA 2BLQA 2ZTZA 1EB1H 1SHYA 1GI1A 2M5TA 1TGCA 3GOVB 1VKYA 2BD9A 1TA6A 1MKXK 1P04A 3IG6B 3RXFA 1O2VA 4B6EA 4JCNA 1SFQB 1OWEA 1PQ8A 5EQSA 1P2JA 2NU1E 3NZIA 4H6SB 4IN1A 2W7UA 1AUJA 1AQ7A 1YP9A 3GCHB 5HIZA 2B0FA 1Z6JH 3UB0A 1P2IA 3L3TA 4GCHF 2Y80A 2FDAA 4Q63A 1O2XA 1TGNA 2FOEA 3DFLA 4O97A 2VGCB 3E6PH 2BD2A 1C1WH 2OUAA 3O8DA 5AVDA 1EPTA 1K22H 3RXIA 1DUAA 1ESTA 1CGIE 4Z6AH 4ABGA 2VIOA 1HFDA 5F8XA 5C2ZA 1LHEH 4CRCA 2C8XB 2EI8A 4XRNA 2Y5HA 1W0JD 2PKAA 1GBKA 4YOJA 4AZ2B 4HG6A 1PPFE 2NU0E 1PPHE 3M5NA 3BG4C 2QF3A 4FUDA 2FOAA 1MBMA 1LHGH 1W11U 1Y3YA 4X6NA 1TPPA 2TPIZ 3SU4A 1BMNH 3LGUA 1UK2A 9LPRA 2QAAA 1G2MA 1PFXC 1AVGH 2FESH 3MH4A 1AN1E 2AMQA 1UTOA 3PO1C 5EQQA 3QZRA 1THSH 4IGDA 4P00A 1JMOH 3LGTA 1QL8A 4DURA 1O36A 1MCVA 1V2RT 2PUQH 2QV1A 1P2MA 3C1KA 4FU7A 4K8BA 1N8OB 2HALA 2OQUA 1O3PB 1MD7A 1RJXB 1YCPK 3P8FA 5L2YH 2QXJA 5DG6A 1OWHA 4I8JA 2GCHG 5T6DA 1ETRH 1A5GH 2ANYA 3MH5A 1XXFA 1FZZA 2ZPRA 3M37A 2I6QA 3VB5A 2ZFSA 4XFQA 3BTTE 1SGIB 1LDTT 1UTLM 2ZU2A 2FX6A 2TGTA 1SB1H 2SGFE 2FMJA 2A5KA 4MNXA 4CH2B 4NZQA 4OGYA 1ZHMA 1GL1A 1UK4A 4YXWD 2BLWA 1ZMNA 3SUEA 1IAUA 1QB1A 2FLBH 3SHAH 4J1YA 2J34A 7LPRA 1BRAA 1HPGA 1ESBA 1VITF 1MU6B 2BY9X 2J92A 2SFAA 3U8OH 1HAPH 4YT7H 2BVSH 3URCA 4O03A 4TY7A 3T25A 2Z7FE 1C4Y2 3AAVA 4CR5A 3PRBA 4WMDA 4YO9A 1P12E 3I29A 1QB9A 1GVZA 2W6ID 3U98H 1E37B 1GDQA 2QXHA 1DM4B 5EW1H 1C1UH 4FUIA 1CQQA 3QWCH 4IC5A 2Y82A 1MTUA 5GDSH 1XKBC 1C1QA 3FP7E 4NIWA 4AFUA 1LCYA 1LHFH 1IQJA 3M3VA 1AE8H 1ZTKA 4NIYA 7KMEH 1NU9A 4NIXA 1TMUH 5EJ1A 1IOEA 2OC0A 1C5VA 2HNTF 1O5GH 1W3CA 1EP6A 3F9FA 4FUHA 4SGBE 5F8TA 3BIVH 2FOBA 3A8AA 4B71A 2JJ2D 4ACAA 3PV2A 4ZHAA 1GGDB 2ZHFH 3A86A 3FKSD 4IMQA 2J38A 2W5EA 4ABBA 2DE9A 3ZYDA 1DT2A 1NZQH 2LPRA 1CBWB 2ALPA 2BM2A 3BN9A 3DCLA 3K65B 4ASUD 3ESTA 4NGAH 1YCPM 1S6HA 5A2MH 2FOMB 4JZEH 1SGFG 1EUFA 2XTTB 3MU4A 2W3IA 2A4GA 2A2XH 2Z6BD 2ZHDA 1DICA 5EXLA 1SKYE 2CV3A 5LPFA 1O3OA 3UPEA 1MQ5A 1YLDA 3S7KB 2FPZA 4K2YA 1UVUH 1EB2A 2ZCLP 2P16A 2JJ1D 2D8WA 3PROA 1HIAB 1RD3B 2WUCA 3IITA 4FUFA 1FI8A 2Y5GA 2ZFTA 3BTQE 4Y6DA 1J9CH 3TLOA 4BNRA 1TLDA 4DOQA 1YGCH 2J98A 1EATA 1P0SH 4RI0A 3GDSA 3OEHD 2K0QA 2WUBA 1RXPA 1QGFA 1D4PB 1TNHA 2ZWLH 2BVXH 5DGJA 8GCHF 1DLEA 2BX3A 3EE7A 2HGTH 1DWDH 1EAUA 3MO9A 1LHDH 2G00A 1FAKH 4ZKOU 1S0QA 3RM0H 1O38A 1H9LB 5A8ZA 3SI4H 3K9XB 1AO5A 5F8ZA 4AG1A 2F9PA 1MABB 3PMBB 3H09A 3OY5U 5HXFA 3T27A 2G4UA 1MTNC 2V6NA 2QA9E 2GJGA 3BTKE 3GDUA 4I7YH 1F5LA 1CHOG 1F0UA 1Q31A 1K21H 1O3FA 1TX8A 1XUKA 5FPSA 3LC5A 1LPKB 2BDCA 3W1EA 1O3CA 4X8SH 1RGQA 3NK8A 1GL0E 3LDXH 2BD7A 1BTZA 1O3HA 1HAGE 1ZJDA 4LXBH 4O3UA 4WY3A 1DSUA 5A0AE 3ELAH 2GT7A 2ODQA 3Q76A 2QY0B 2CF9H 1GBMA 4O9VA 3ZIAD 1O3BA 3OTPA 3M7UA 3NWUA 1QL7A 2V35A 3QX5H 1AY6H 3RXCA 1AZZA 1UJ1A 3VGCC 3CNRA 1YCPH 2H9HA 5FPTA 1Z7KA 2WV5A 3OE7D 1SGFA 1SGQE 2PGBB 1QB6A 2QIQA 4WWYA 5FAHA 4B74A 1VJAU 1EP5A 1O2SA 1J8AA 1W14U 2FTLE 2EI7A 1KXDA 4WH8A 3SNCA 3ODFA 2Z3EA 4UFFH 3EDXB 5K0HA 4HZHA 2PV9B 3EE0B 4HGCA 2ZQ1A 1FXYA 2L6OA 3MU0A 3A80A 4ZHMU 1LTOA 3RLWH 4F49A 5FXLA 1HAZB 3HK6B 1UK3A 1UVPA 4AFSA 3AAUA 1V2NT 1MKWK 1GMDF 2WPMS 2ZFFH 5AF9H 4TSFD 1AKSA 2GVFA 1HRTH 1GI8B 2BLVA 1GDUA 1HCGA 1K1LA 1K2I1 1KDQB 1QFKH 1E79D 1Y3VA 2FI5E 5F53A 2ZG0H 1V2LT 1C1TA 1FJSA 1SPJA 3FO8D 3RU4D 9ESTA 5HM9A 1BJVA 1BA8B 5E0GA 1O3NA 2XCNA 2C3SA 2P59A 3P6ZB 2H9EH 3ZVBA 1TPAE 4X2VA 2R9PA 1TA2A 2G51A 1A3BH 1ELAA 3RXGA 1CVWH 1K1MA 3UOPA 5A8YA 4ISNA 2P94A 4UFDH 2FLRH 2W3KA 2WYJA 2ZFQH 2PFEA 1Y3WA 2D2DA 3RP2A 1G30B 1KLJH 3SV6A 1BTXA 2K8IA 1SHHB 5EQRA 3MNXA 2F4LA 3NXPA 5EPYA 3TGIE 3EA8A 4I8GA 1GJBB 1O35A 2Z9LA 1UMAH 3KQ5A 2ANMH 2FODA 3CS0A 1L0ZA 1NRRH 1O2YA 2CXVA 1WUNH 5EIYA 2UUJB 1D6WA 2OP9A 4FXGH 3SGBE 2HNTC 5JBCS 3T26A 2XBYA 1Z71A 1GVKB 3PTBA 4J2YB 2FX4A 3RXLA 2BYAX 3RMLH 2XC4A 3HPTB 1S5SA 2HNTE 1O2ZA 4MNVA 1FQ3A 3B23B 4INKA 1KLTA 3KQEA 3R0FA 3SU2A 1YPLH 1C5PA 1O30A 1OPHB 2W6JD 5ABWA 4MLFB 2D1JA 1D3DB 3SV7A 2ZKSA 1BCUH 1YPMH 4IBLH 1VGCC 4AC9A 1A2CH 3S69A 4IS5A 1CA8B 4A1VA 3F0PA 1GVLA 3VG8A 1IQFA 1OXGA 3U28C 4QT8C 5HGGA 1O2TA 1NRQH 4AGKA 1F2SE 4BANB 1FN6A 3GCTG 1O3IA 1N6XA 4WXVA 4TWWA 5EPNA 3M7TA 3ZZ4A 5L30H 3EGKH 4DW2U 3SHCH 4FETA 3H5CB
chains in the Genus database with same CATH topology
2TBSA 1VZQH 1O2OA 2AS9A 3O8CA 4B76A 3GYLB 1C5YB 5I25A 5JB8S 1BZXE 3ATMA 4AN7A 1IHTH 2Z94A 4ZH8A 1BMLA 1ELGA 5ETXA 1GDNA 2W26A 4KTUA 1F92A 1ANDA 1C2DA 1QNJA 5FX5A 3PLBA 3RXOA 3S9CA 1C5SA 3HGNA 1GI4A 2VVVA 1Z8GA 4NA8A 1UTNA 4NZLA 1EASA 2G8TA 1B5GH 5HYOA 3LPRA 5IDKA 2ZTYA 1ELDE 2C4FH 3A84A 2C8WB 1H9HE 1MTVA 4Y10E 3E8LA 1YPHC 4TWYA 1WQSA 3V0XA 2J95A 4Y71A 1ZHPA 2H2ZA 2A0QB 1ZPBA 1RTFB 1TGBA 3BG8A 3MNCA 1FY3A 1OWDA 1O3MA 4XE4A 1EPTB 1SQOA 3T5FH 2FI4E 2G55A 4X2YA 1C9TA 1GHXH 1PQ7A 4MQAA 1UCYE 1RIWC 1CGJE 4B75A 2NWNA 5DO4H 1T8LA 2GCHF 3PMHB 1HAYB 1O37A 5BPEA 3C27B 1TFXA 1GI2A 3TIUA 3MTYA 1HJAC 3F6UH 4U2WA 1C5MD 1G3EA 1CGHA 1S81A 4OS6A 4X2XA 1V2KT 1C2MA 2ZIQH 3TNSA 4X1QU 4OS2A 1SLWB 1P57B 3S7HB 1UTMA 2ODYB 1FPHH 4AYYB 1NROH 5L2ZH 1GCTC 1WOFA 2CN0H 1SGCA 2AMPA 3BEUA 2ULLA 1FAXA 2C90B 2O8WA 3KNXA 2FYQA 1GBIA 3PM3A 1KTSB 4IW4E 3BEIB 5CE1A 3BF6H 3VXEH 6ESTA 1THPB 1GHBF 1V6DA 1O2RA 1P8VC 1O3GA 2F83A 1AZ8A 1RFNA 4MPVA 1ACBE 1GI7B 1ZR0A 1K9OE 1ARBA 2BD5A 1A61H 3PMJA 4XBCA 1FY5A 4ZKNU 1PYTC 1J16A 2OXSA 1QR3E 5C1XA 5J4QA 2PSXA 4ZXXH 2V3OH 3Q3YA 2BLOA 1ZYOA 2GDDA 4UE7H 1EOJA 2BDAA 2WINI 2B7DH 4ISOA 6LPRA 2ZHQH 2JH5D 1ZMJA 2PW8H 3FAOA 5C5NA 3DT0H 2JH6D 1FLEE 2F9VA 1YC0A 4FU8A 2DE8A 1TMBH 5GCHG 1ID5H 2STBE 1B7XB 1DXWA 3F1SB 1FUJA 3LIWA 4DVAU 3TGJE 3UNRA 4UFEH 1VR1H 1EAIA 1LO6A 1P2KA 2F9UA 4GHTA 3EAJA 3KCGH 4O3TA 1CT0E 3EYDA 1TGTA 1HNEE 4GHQA 5A09A 1W2KH 3GYMA 5HMAA 2VB0A 3ATLA 2RCEA 1UCYK 5E8EH 4LZ1H 1UHBB 1SI5H 4YTAA 1A7SA 2ZTXA 1AMHA 1FIWA 3BG4B 3M3TA 5EOKA 3P95A 3BTWE 3MU1A 4X6OA 1JOUB 1PQ5A 3RXEA 1PPCE 1GI5A 4K3JA 1O5DH 3SORA 2HLCA 4Y7AA 4Q7YA 3LC3A 2OD3B 2WV4A 1D6RA 2F9BH 3E0NB 1LVMA 5DP9A 2Q6GA 2BDIA 2BQ7B 4OS5A 5FHTA 4MNWA 1W0YH 1EXFA 3Q3KA 4I8LA 3OY6U 2ZU4A 1AWFH 1DITH 3SU0A 1DS2E 4JYUH 1OYQA 4X0WU 2HPQH 3IWMA 2A1DB 5FX6A 4JYTA 1TBRH 1DUEA 1CT4E 2NU3E 2ZA5A 2TGPZ 4NFFA 3RUOA 5BRRE 2A7JA 4GUXA 3RXRA 2ZCHP 1TRNA 1N1LA 4BTUB 1ANEA 4AG2A 3E0PB 3QTOH 3TJNA 1UTQA 2ZI2H 3MHWU 3Q00A 3RDZA 1ORFA 1T4VH 1TONA 3SV8A 1QRWA 4B1TA 4X8UH 1RRKA 2B9LA 5EODA 1L4DA 1C5RA 3KL6A 1QBVH 1YPEH 1WU1A 1AE5A 1RTKA 1W10U 3VB6A 1SOZA 2BHGA 1XKAC 1B0EA 4Y8ZA 1GJ4H 1O3LA 2SNWA 3BTDE 2CHAC 3EA7A 5LPRA 2SGEE 1SG8B 3OTJE 1HAVB 1G3DA 1MH0A 3V13A 6CHAB 4LOYH 3PV4A 3A7YA 1A0HB 5E2OA 4R8TB 1SSXA 2P3UB 1NT1A 3UNQA 3U1JB 2HPPH 1AVWA 1XM1A 6GCHF 1TMTH 1DLKB 1JBUH 2FYRA 1LKAA 2FM2A 3AW0A 3SZNA 1D9IA 2BY6X 4HFPB 3RXPA 3UR6A 1JIMA 1F0RA 1FY1A 2BY8X 4CRAA 2PKSC 4BAHB 2ZECA 3LH1A 4Q2KA 2J9NA 1GJ8B 1O2MA 4VGCB 4B2CA 1O2HA 1CBWC 1BBRE 1OWJA 3D62A 2XW9A 1Y3XA 2ZDAH 1GHWH 1OX1A 4BAMB 3A88A 2FXRA 2QYIA 3MMGA 1ARCA 3LJOA 1MTNB 1WBGB 3F68H 4YZUA 1C2IA 1HB0B 1HGTH 1AHTH 1NRNH 5GXPA 2GV6A 2HWLB 2AYWA 4ISLA 1A5IA 1GJ9B 2A5IA 1SGPE 1C5TA 3WY8A 1C2EA 3STIA 4CH8B 5F6MA 3M5LA 1QY6A 2V0BA 2KAIA 4JMYA 4AORA 4ABHA 3ITIA 2C8ZB 1LPZB 4Q7ZA 1YPKH 3QGJA 2YNBA 3BV9B 3NCLA 1MMJN 5DP5A 3AASA 2XRCA 2OC1A 5C1UA 2AEIH 3ZZAA 4MTBA 1TPOA 1CA0C 2H6MA 4JZFH 3QN7A 1IQNA 4B2AA 1HJAB 3UQOA 4UONA 2Q6DA 2ZEBA 5F03A 1C5XB 2AGEX 2O9QA 4RSPA 1H9IE 6CHAC 4NWLA 3M61U 1O5CB 1O0DH 1P11E 4DY7B 3RXQA 3SU1A 1C2KA 2R0LA 4Y7BA 1DWBH 1LMWB 1ABIH 1C2LA 4KGAA 1K28D 1Z8JB 1W7XH 2PTCE 1MUEB 3ZZ3A 2VU8E 1IQGA 1SGEE 2PWXA 4GCHG 2P8OB 4MNYA 3F9HA 2Y6TA 3ZZDA 1TNIA 1WV7H 1DXPA 5G4BA 1TQ0B 3GY4A 2TRMA 3KN2A 2R0KA 2ZQ2A 4ZMAH 1C5WB 2ZDNA 1V2OT 5PTPA 5FPYA 1O5EH 4HTCH 3LGIA 2FOGA 2WPLS 3U1IB 1IQHA 2Z9IA 2FS9A 3K2UA 4BXSA 2GGVB 1H8DH 4AB8A 2CMYA 4XBBA 2AERH 3STJA 4E7NA 3RC6A 5EW2H 1BRCE 3T28A 2FIRH 2BDHA 1AFEH 1LVOA 1CU1A 1JRTA 3KQBA 3K6ZA 3BSQA 4WMEA 5T6GA 2H5DA 1UVTH 3QLPH 4ESTE 2GZ7A 2OQ5A 2G5VA 1CE5A 3RXSA 2VNTA 1EKBB 1GG6C 1QA7A 2JETB 4DIIH 2Z9GA 1A3EH 1LHCH 3P70B 3MNSA 1SQTA 4U30A 4A1TA 2FI3E 2UUFB 1C1VH 3SJKA 4E05H 4CR9A 1XUGA 1RTLA 4FVDA 3PLPA 4VGCC 3A82A 2QF0A 2P95A 3KGPA 5E0JA 1C5QA 1TWXB 3E90B 3OU0A 1QJ1B 4OGXA 2FZZA 1EAXA 1ZZZA 3Q3XA 3MNBA 1Z8RA 2BY5X 3FZDA 2ZPSA 4GLYA 4I33A 3PYHA 1IQKA 4MPXA 4ABAA 4UEHH 4X1NU 2BOHB 3KQDA 2UWLA 4ZHLU 3LT3A 2SGDE 2BZAA 2KAIB 3MWIU 4Y11E 1H1BA 2ZHWH 1UVOA 2W7SA 1K1OA 5JPMH 1C5NH 3ZYEA 4XSKU 1MBQA 2XC0A 1BBRK 4DGJA 1AB9C 5GJ4B 3A7XA 1L2EA 2BD4A 1Z1IA 1FMGA 3TJOA 2AGGX 1O2WA 1Y59T 1QBOA 1GMHG 2A32A 1N6YA 2OLGA 2ZGJA 4YESB 5JDUB 1TNJA 2R3UA 5EXMA 3D23A 3HGPA 1BDAA 2H9TH 3LOXA 4Y0ZE 1G36A 2P3TB 2VGCC 5A8XA 1GHAG 4NFEA 3F9GA 3P8NA 1ZMLA 1BRBE 2VIVA 2ZPQA 1SFIA 3A7WA 3S9BA 3LGYA 4FUGA 3RLYH 1KYNA 1YPGH 2JH0D 1C1OA 4UFGH 1T8NA 5AFYH 3M5OA 4AX9H 3QUMP 2CHAB 2BY7X 3P92A 1WSSH 3ODDA 2SGAA 1C2FA 1QJ7B 1QBNA 2GD4B 1TOCB 3T62A 3GY3A 1MTSA 1C4V2 3A85A 4K5ZA 2ZNKH 1XUIA 5T6FA 1GBEA 4KELA 1YPJH 1ELCA 1B0FA 3GISB 1VGCB 7GCHG 4U01A 2ZGBH 1C1NA 1JRSA 4ZUHA 4K8YA 1GHZA 1GJAB 3SUFA 1MTWA 4ABJA 1DANH 1NFXA 3FANA 4K1EA 5A0CA 2XBVA 3A89A 3A7TA 4XDEA 1P01A 1O2GH 3SN8A 5JBBS 1AKSB 3SW2B 3UFAA 1GPZA 4U32A 3A7VA 2J4IA 1L1NA 1GI9B 1T8MA 1D3PB 1MKXH 1UTJA 2JETC 3SOSA 1E36B 4I8HA 3ZVAA 4B73A 4D76A 2ZGHA 4MVNA 4TPIZ 3PB1E 3UNSA 1DWCH 4CRGA 1O31A 3N7OA 2J94A 4WH6A 1C4U2 2OBOA 1AGJA 1T32A 2SNVA 4ABEA 1EQ9A 4MPUA 4JK5A 5DKMA 3VXFH 4H42U 1DE7H 4A92A 4A1XA 3NPSA 2H1UA 3FP6E 1KXCA 2Z9JA 1CA0B 2TIOA 1XUHA 1KY9A 2XBXA 2AIPA 5DP4A 2GZ9A 1GI6A 1K1NA 2B8OH 4R0IA 1SL3A 2A4RA 1O2NA 3P17H 5JBTA 1TX7A 1GMDG 3EA9A 1J17T 2CJIA 2RA3A 4X1SU 2ZU1A 3GCNA 1O3JA 1W13U 1A0JA 3TH4H 1GGDC 3M35A 4RN6A 3KF2A 3RXDA 3P8OA 3ZVCA 2Q1JA 1TBQH 3ENSB 2HVXA 2Z3CA 2Y81A 1FY8E 5DK1A 2FP7B 4DIHH 5TJXA 3PTNA 5LH8A 4OS1A 1KTTB 3TJUA 1E0FD 4D7GA 1Q3XA 4BXWA 2FEQH 4K1SA 5B6OA 2UWOA 1O5FH 2P3FH 1ZPZA 3SU5A 1QL9A 1S84A 3TH2H 1K1IA 4DCDA 1ESAA 2NU2E 3M3SA 1DWEH 4D9QA 3SBKA 5JBAS 3ZVGA 4KTCA 1SQAA 3ZVDA 4KKDA 1S82A 2AIQA 3SI3H 3URDA 2WYGA 3V7TA 3GICB 2YNAA 3MO6A 1TRMA 1NRPH 1LKBA 4MG3A 1ZGIA 1AFQB 3SNBA 2WPHS 3A8DA 1THRH 1MAYA 1O3KA 3BIUH 3M36A 1LQEA 3GCOA 3GY7A 4GSOA 1SGTA 1SLUB 4AFZA 1KDQA 1Z6EA 5DP3A 2RG3A 3HKIB 2ZO3H 5FBEA 4INLA 1G2LA 1QQ4A 5EG4A 1SOTA 3UUZA 1FDPA 1HDTH 1KXAA 1V2VT 1S85A 1F5KU 1ELFA 1WTGH 2GX4A 4KTSA 1CHGA 1ZSKA 1FV9A 1QHRB 1XUJA 2VVUA 3F9EA 1A0LA 1M9UA 5E2PA 1C1MA 4YLQH 2THFB 1DOJA 4XBDA 2PHBA 2QN5T 2ASUB 3A7ZA 1O39A 1Y5UT 2VWOA 3FFGA 2FO9A 1UO6A 2R2MB 3B9FH 1P02A 1Y5AT 4DG4A 1SGDE 2AGIX 3E3TA 1HAIH 1BMAA 3EQ0H 1GHVH 3UIRA 1IQLA 1GBTA 2XXLA 3MFJA 4BAQB 1TBZH 1AWHB 1C1SA 2Y5FA 4WVPE 5JYIA 2O8MA 1QIXB 4A6LA 5FCRA 1GBLA 4Y8YA 4RKJB 1V2JT 1C1RA 3TJVA 1BT7A 1OOKB 4X1PU 1KXFA 1SLVB 1GHAF 3DA9B 3QDZB 2DUCA 1C2JA 2BB4A 4THNH 5T3HA 1GI3A 1V2PT 2GMTB 5CHAC 1ANBA 1BTPA 1P2QA 1G3BA 1AUTC 4CBNA 3W94A 1HAVA 2GTBA 3V3MA 4GVUA 4YLUA 1V2QT 2ZCKP 4NA9H 1GBHA 2SGQE 1SBWA 3RC4A 1ZRKA 4ABIA 3HK3B 1GMCF 4WF8A 3ZZBA 1HJ9A 2F91A 3RXJA 2WPJS 4UDWH 5I46H 2EI6A 4LZ4B 1OP2A 1IQMA 2ZHEH 7GCHF 1A46H 1UVSH 4M7GA 3UR9A 3E1XB 1YLCA 3L33A 3RC5A 2C8YB 3RXMA 4BAKB 1ZTLA 4A5TS 1LVYA 1P3EA 3E91A 5JB9S 2GCTB 1KSNA 1PYTD 1TE0A 1YBWA 3SQHE 1C5LH 1GBDA 3UWJH 1HBTH 2FTMA 3NKKA 4ZKSU 3UQVA 3BTGE 3RXTA 1GBCA 1NC6A 1YPHE 2OC8A 3E16B 3LKWA 1O5BB 1PPEE 1U6QA 1GI0A 4D8NA 2TGDA 1GHYH 2IJOB 4BTTB 3ZV8A 1BHXF 1CO7E 4ZROA 1G3CA 1S83A 1V2MT 1BRUP 1G32B 2BMGB 1HAHH 1TNGA 4I31A 1O34A 1XXDA 3W95A 1O5AB 1GJDB 1XMNB 4IN2A 1GMCG 3SV9A 2FOCA 3MU8A 4ASHA 4AB9A 4B2BA 2ZU3A 1OKXA 2UUYA 2GMTC 5CHAB 3O8BA 1QJ6B 1NFUA 1NESE 2XNIA 1E34B 1YKTA 2PKSB 1T31A 1ZLRA 1T4UH 1GBJA 4SGAE 3ZZ5A 4ZAEA 1AVXA 2EEKA 3SGQE 2A31A 2AMDA 2XCFA 1HV7A 2Q6FA 3KQCA 4D7FA 1MCTA 1C2GA 3ZVEA 1P2NA 8ESTE 3V12A 2G52A 4CBOA 3RMMH 3U69H 1DY8A 1O3DA 1O2PA 2GKVE 1V2WT 3GY6A 4DJZB 3ZZCA 1ZTJA 3BTFE 2HRVA 1KXBA 4JZDH 1HYLA 3LONA 2A4QA 4JZ1A 3VEQB 4NCYA 6GCHG 1CHOF 5C1YA 3TK9A 1GBFA 3OSYA 2VJ1A 1KXEA 1TX6A 2PR3A 1V2UT 1L1GA 1MU8B 1FN8A 3BTME 3GCHC 3ZZ6A 1T7CA 2IOTA 1O3EA 4X6PA 2VIPA 3TH3H 1O2KA 1EJAA 2QXGA 4BOHA 3SNEA 1DSTA 3G01A 3AW1A 3FVFB 1ELEE 1JWTA 3SUGA 1W12U 1BQYA 3QGNB 4X2WA 1SVPA 4AFQA 4YT6H 1SGYE 3A87A 3SGAE 1EJNA 3PO1B 3CENA 1O2UA 1Y3UA 3VB3A 1BHXB 2XWAA 1IQEA 2OBQA 1NFYA 1ZSJA 3VPKA