3RXGA

Crystal structure of trypsin complexed with 4-aminocyclohexanol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxgA02
4X2XA 2Y6TA 2ZF0H 2P3FH 2ZFQH 5DKMA 1A61H 1P2JA 4K8BA 4A7IB 1D3PB 1Z71A 1UCYE 2UUYA 2F9VA 4RKJB 4Z0KA 5JBTA 3RP2A 5GCHF 1ZPBA 1Y59T 2FS9A 1B5GH 1DPOA 3URCA 1N6YA 2F9OA 2IOTA 3QWCH 4AX9H 2TBSA 4D9RA 1ZMLA 2ZU2A 1SGNE 2BLWA 3FAOA 3KCGH 4LXBH 3TITA 4CBNA 3KN2A 4FU7A 1NTPA 2C4FH 3LIWA 1THPB 1W14U 5C3NA 1GVLA 1N6XA 4JZDH 5L30H 5E0JA 3UWJH 5F6MA 5T6DA 4DW2U 3SV9A 1AVGH 2ZHWH 1LHEH 5A8ZA 5FXLA 1TMUH 3ZVEA 3DFLA 5C20A 4FUHA 1C1SA 4LZ1H 3MI4A 1UCYH 4TWWA 1NFYA 2VGCB 3M7UA 1HJ8A 4JCNA 1AFEH 4INLA 4FUCA 5A8XA 1TX8A 6CHAC 3A85A 3SU5A 1O5CB 2CHAB 3D62A 2F9UA 1HJAB 1ZTLA 1HIAA 3S9BA 3B9FH 3SOSA 1F0UA 1NFUA 1GDUA 8GCHG 2QA9E 5FAHA 3GY6A 3TIUA 1G3CA 2BD8A 1ZJDA 4UFDH 2HLCA 1TLDA 2FOMB 2H9HA 4XSKU 4FVBA 2XC5A 9LPRA 1BTHH 3ZZ8A 2FDAA 3TU7H 1D3TB 4XOJA 1EOLA 2FXRA 4ABBA 3K9XB 4BAMB 1EZSC 2OINA 2R0LA 1ACBE 1FJSA 1GG6B 4BTUB 2AFQB 1TOCB 1Q2WA 3VB4A 4GLYA 1W13U 1F0SA 1G2LA 3M5LA 3U98H 4YTAA 1FI8A 1FQ3A 2RG3A 3RXQA 3S9CA 2BY7X 4Y11E 5EODA 2F91A 4WF8A 2ZGJA 1XKBC 3T26A 4B76A 1NT1A 3SJ9A 3TH2H 1OSSA 1FIWA 4ISLA 4GCHF 2FI3E 8KME2 1UTJA 1FN6A 2KAIA 1S85A 5B6OA 3E0NB 5FPTA 1W12U 1LQEA 1Y3UA 4YOJA 4X6MA 3VB5A 1RTKA 2ZFSA 4GCHG 3KGPA 3P92A 1EJMA 1GHVH 1AU8A 1P12E 1THSH 2EEKA 1NPMA 4NA7A 1C9PA 1GI9B 1S81A 1SLXB 4FUJA 1BTUA 1MAXA 1MTNB 1KLJH 3BTGE 1V6DA 1H4WA 3RMMH 1ANBA 2Y5GA 1JOUB 1QA0A 1CVWH 3QGNB 3RXLA 3M61U 4HTCH 2VIQA 2FX4A 2AYWA 3A89A 2EA3A 4DGJA 4ZXXH 5DG6A 1AWFH 3QUMP 1DANH 1JBUH 1VITH 3FP7E 2WPHS 1ZTJA 2H9TH 1X7AC 4X6NA 2F9NA 1O2LA 1DUEA 1TNLA 4JK6A 2XBVA 4K3JA 4FUFA 2OC0A 4OS1A 2GGVB 1ZHMA 2C8XB 1TRYA 3C27B 4ESTE 1MUEB 3P8OA 2YNBA 1DXPA 5JPMH 2RCEA 1QRWA 2PTCE 1GGDB 2BX4A 1YC0A 1YCPK 2XWBI 1SOTA 2FYQA 2WV5A 3TH4H 1SOZA 1XUIA 2NWNA 2VJ1A 1P2OA 1A7SA 3SU2A 3MH5A 4U30A 3F9EA 1OP0A 3JZ2B 3R3GB 1SQOA 1SSXA 4X8VH 2F3CE 4RSPA 1TONA 2P8OC 1HJ9A 3DD2H 1MCTA 3RXGA 2AERH 2FLBH 3JZ1B 4R8TB 4TPIZ 5I25A 1GJ7B 2A2XH 2PSXA 3NPSA 3LDXH 5HXFA 3VFEA 3GOVB 3M5MA 1P02A 1ESAA 2QC2A 3DUXH 4B2BA 1D4PB 3MFJA 3SORA 1HAYB 1INCA 2FWWA 1BJUA 2YOLA 1EOJA 1O31A 1O3GA 2IJOB 2WUCA 1MU8B 4X1SU 2G55A 1WYKA 4FXGH 4O3UA 4WMDA 3OTJE 1SFIA 1RIWC 2C8WB 2WYGA 3A88A 4TPYA 2B5TB 3U69H 5A0CA 2A5KA 2Q1JA 3GYMA 2A7CA 3A7YA 4HI3A 2RDLA 2PFEA 2GZ9A 2WPLS 1AVWA 1GBBA 1TYNA 1A46H 1J8AA 4F49A 1NFXA 3Q3KA 2OQ5A 1WTHD 1ZOMA 2VINA 1GHXH 2FZZA 2TRMA 3F6UH 2R2WU 7GCHG 1TPPA 3SW2B 2G00A 5ESTE 1TGSZ 2SGFE 1QRZA 1GBKA 1GHAF 3FFGA 4IN1A 5A8YA 2ZFTA 2AS9A 4TYDA 4JZFH 2FOEA 2FOHA 2ZKSA 2XRCA 3SQHE 1QGFA 1C4Y2 3NXPA 2HNTC 5FPSA 1TNKA 2H5DA 1UO6A 1CA0B 1SGTA 1YM0A 3LGTA 3LC3A 1XXFA 2J38A 1GI8B 2BDHA 4NSVA 1AIXH 1VJ9U 2VIDA 2ZU3A 2V6NA 1ZPCA 1CBWB 2B9LA 1SGIB 1ELDE 1H8IH 1MTVA 1NC6A 1SGEE 5T6FA 1TMBH 4LZ4B 1DVAH 3ZVDA 1W2KH 1P2MA 4U2WA 3KEEA 1T8OA 4RN6A 1KXAA 1SBWA 3PMAB 1KXCA 1KTSB 3VB3A 1CU1A 1PQ7A 2Z6BD 4CHAB 1MKWH 3SZNA 4UEHH 4XBDA 2PWXA 3RXHA 2GZ7A 1LDTT 1AVXA 1PPFE 1V2NT 2C8ZB 2GCTB 1K22H 2QXGA 4HGCA 1LVMA 2VGCC 2P3UB 4B75A 1F92A 4ZH8A 3UPEA 3FVFB 5EW2H 1ABJH 4O03A 3VEQB 1BB0B 1J15A 1SG8B 5A0AE 3RXCA 1YPHE 3MO6A 2B7DH 1HJAC 4ABFA 4Q7YA 1GMCF 3GICB 1J9CH 2OTVA 2ZHEH 1JIRA 4DY7B 3SNDA 3BSQA 3LGUA 1G37A 1T4UH 3RLYH 2WPKS 2XCFA 1GJ8B 1DY9A 1SGCA 4Y6DA 1EUFA 1MTWA 1L2EA 1GHBG 3TJOA 1AKSB 3TK6A 1C2HA 1D9IA 3GY7A 5I46H 8ESTE 1NRPH 1MTSA 4GSOA 1QR3E 3EA7A 2ZNKH 3UFAA 2BD9A 3ZVCA 3TGIE 2ZC9H 4DURA 5J4QA 1TGBA 2ZDLA 1LVOA 3RXUA 4XBCA 2ZDAH 3EAJA 4GVUA 3C1KA 1AMHA 1UHBB 1BRCE 3KNXA 1C2EA 1DDJA 3TLOA 1FUJA 2BOKA 2CF8H 3BTME 3LH3A 4YESB 3T5FH 1GL1A 2R3UA 2BD2A 2BQ6B 2O8LA 1K1PA 2A7JA 5E0HA 1QA7A 2OP9A 3B23B 3BTTE 1H9HE 1UVUH 1OX1A 1O5BB 1ANEA 1YLCA 1BQYA 2ODQA 1K28D 1QURH 1V2TT 4IS5A 2Z9GA 1PPBH 1MCVA 2QCYA 3RXTA 5E2PA 3AW0A 3SO3A 1MQ5A 2H2ZA 1MTNC 4SGBE 4TY6A 2P3TB 4MG3A 1G3EA 2BY8X 4MTBA 5F8TA 4ABDA 5LPEA 3VB7A 2XCNA 2ZP0H 2LPRA 5JBBS 3FP6E 1P3EA 3LOXA 3BG4B 2BD7A 1KDQA 4JZ1A 1NN6A 2Y7XA 4MPXA 1P9UA 3SJ8A 4YO9A 1E37B 1CT2E 3ZVFA 1BRBE 3M37A 1ELVA 4AYVB 1D6RA 1GMHG 4INKA 3NKKA 1Y3VA 1TBQH 3BTHE 3GISB 4JMYA 1GGDC 1GI7B 3QN7A 4NFFA 5AHGH 3K6ZA 3SV7A 1VR1H 3TH3H 1EJNA 2VIVA 1U6QA 1PJPA 1ZRKA 2BX3A 4ZAEA 1YPLH 2FPZA 4GUXA 3OX7U 5CHAB 1LQDB 1GWAA 1SGYE 4YOGA 1GCTB 2OC8A 5JYIA 4Z6AH 2FYRA 4J1YA 4SGAE 2NU4E 3RXSA 3UNQA 2W5EA 2D1JA 5G4BA 2TPIZ 1O2MA 1BCUH 1TNIA 3A87A 5FX6A 2BY9X 1QQUA 4BAOB 2H9EH 1C1WH 2FO9A 1K2I1 4U32A 4JYVH 1PPEE 4I8KA 1QBVH 3T25A 1O32A 4YT7H 4H4FA 1RRKA 3BTQE 4MNYA 3KL6A 1C2KA 2ZGCA 1PQAA 3V13A 2PGBB 1TMTH 1P2NA 1BIOA 1OYTH 1MZAA 1GBDA 4K2YA 3ZZ5A 1TIOA 2VWNA 1O2NA 3M36A 4WXVA 5J4SA 2HRVA 4Y8ZA 1VCPA 3D65E 2XTTB 2BD5A 5F8XA 5EXMA 1V2LT 1OPHB 2BYAX 1XUFA 3F9HA 4Y10E 1O5EH 1Z1IA 1DLKB 5HM9A 1UK3A 1DS2E 2ZU1A 6LPRA 1WQVH 1FY4A 4B74A 2Z3DA 1O2TA 1UTPA 2ANMH 4INHA 4MPWA 2P59A 2ZQ1A 1YPMH 2ANWA 1IHSH 1A0HB 5A0BA 1Y5AT 3E91A 2Y81A 2G81E 4BOHA 1OWEA 2OLGA 1SFQB 2TGDA 1ID5H 1CA0C 5DP6A 1HPGA 2QXJA 4X1PU 3WY8A 3OSYA 4KELA 3UQOA 1O2IA 1MD7A 1BMLA 4XE4A 2A4OA 1BA8B 4WVPE 1W11U 4NA9H 1CBWC 1RD3B 4X1NU 1TQ7B 1TGTA 2ZFPH 3QX5H 3VPKA 1HDTH 1Y3WA 4DOQA 3F1SB 4AB8A 1YCPH 1B0EA 5LPRA 1KXFA 1OYQA 1CSOE 1PFXC 3MWIU 3TNTA 2Y5HA 1Z6EA 1O2GH 1SPJA 2ZCHP 2VNTA 2ZFRH 1D3QB 2G8TA 2W7SA 4CHAC 4D9QA 5HMAA 3MH6A 4ZXYH 4AG2A 3ZZ9A 2SGEE 3RXFA 2GX4A 3M5OA 1XM1A 1T8NA 2R9PA 2GCTC 4QT8C 2WPMS 1WSSH 1VGCB 3GCTF 5FCRA 1H9LB 1ZSLA 4O3TA 1PPGE 3TNSA 1MH0A 1QJ7B 2B0FA 1AQ7A 4WWYA 1NU7B 2PKAB 1EATA 1ZTKA 1GMDF 4U01A 5GCHG 3UWIA 1DITH 2XWAA 1ETRH 3RUOA 1WBGB 1YYY1 1TPOA 1ZSJA 2FI5E 3RXJA 1QRXA 2FOGA 1KIGH 3GCNA 2C93B 1S0RA 1GBJA 4ABAA 3EE0B 3U1JB 1XX9A 3PYHA 1SGQE 4PROA 2VH6A 1KLTA 2HGTH 3SV6A 3SQEE 1Z7KA 3SNCA 1XMNB 1YPKH 4X1RU 3GY4A 4DT7B 4KP0A 1EX3A 1N1LA 4Y0ZE 4E7RG 4NFEA 1L0ZA 1ZYOA 4MDSA 2J2UA 3VXEH 4B71A 3PO1B 4DIIH 4H42U 1YF4A 1JXPA 3MU1A 2H6MA 1F5KU 2BVSH 2BLVA 2VVCA 1CO7E 3KQDA 1Y3YA 2V3OH 1CT0E 2ZQ2A 3QDZB 4ABJA 1FMGA 3A8AA 1KDQB 1SB1H 1C1VH 2XW9A 1ETSH 2DUCA 1GBIA 3HK3B 4DIHH 1YPHC 2BDCA 1G36A 7KMEH 1BJVA 1EAWA 1T8MA 2J92A 4Y8YA 4NIXA 3SU3A 1DWCH 3MU0A 5SGAE 2Z9JA 2R0KA 3GCHB 4X8UH 1V2PT 1HFDA 2WYJA 4IBLH 2BHGA 1GI1A 2HOBA 4KTUA 3PB1E 4A92A 1NFWA 1YCPM 6ESTA 1V2VT 2VU8E 1TAWA 2BMGB 2OC7A 1P03A 2SGAA 1T32A 1OOKB 1K9OE 4E7NA 4BAQB 2DE9A 1BTPA 1O3BA 1E38B 1H8DH 1C4V2 2ZG0H 1WQSA 3BG4C 3B8JA 2SGPE 1AKSA 2Y5FA 3MH7A 3UOPA 4BXWA 5C5NA 4UFEH 5HGGA 3MMGA 3PMBB 3RXEA 2ZGXH 2RA3A 2P94A 3MTYA 1O3EA 2D26C 3GDUA 1ZRBA 3OYPA 1AD8H 2OXSA 3D23A 5F8ZA 1F7ZA 3BG8A 1EZUC 3A83A 1E34B 1GDNA 4F4OC 3ATMA 2Z9KA 2ZFFH 3U8OH 2F9BH 3CENA 1LVYA 3F68H 3LGIA 1NRSH 4ZKRU 1UHBA 2TGTA 3SGBE 5BRRE 3M5NA 1O30A 1MTUA 1C4U2 2AMPA 2NU3E 3VGCB 4DVAU 5CHAC 5GWZA 2ODYB 1O2UA 1C5MD 4KTSA 1GCTC 4I8HA 5DJ7A 1QL7A 4ZKOU 3KF2A 3A82A 1ELFA 4FUGA 1SVPA 1ZSKA 2BDYA 3TK9A 1GHWH 4DJZB 2BOHB 1OWDA 1O2JA 3IG6B 4AZ2B 3SJIA 4XFQA 3L6PA 5AVDA 1KSNA 1Z8GA 3M3TA 1JRSA 3ZZDA 1ZPZA 2GTBA 1AB9B 3FANA 1IHTH 3NK8A 3UY9A 2FI4E 1S82A 1YPGH 1QB6A 3BIVH 3QTOH 1O3CA 2BLOA 3NZIA 1ZZZA 2M5TA 1HAIH 2J34A 1C1TA 2BDAA 1EAIA 3IWMA 4O97A 3RMOH 1C2MA 1C1NA 1EXFA 1G9IE 4K8YA 1QHRB 3UR9A 2NU2E 2OBOA 4I8JA 4M7GA 2GP9B 3EA9A 3A8DA 2IPHA 1F5LA 2C90B 3DT0H 4MNXA 2H1UA 4I33A 4BAKB 1LKBA 4JZEH 2G5VA 1TRMA 4A6LA 2PSYA 3A8BA 3STIA 1BOQA 1TBZH 1MBQA 4ABIA 3O8CA 2W3KA 1KXBA 2ZPRA 3A84A 1KLIH 2H5CA 3RU4E 2QY0B 2FOCA 2FOBA 5TCCA 1O2VA 2VWLA 1O35A 1O3OA 5C1UA 5DGJA 1AWHB 2STBE 2V0BA 4XBBA 4VGCB 2HPPH 1L4DA 1HB0B 2PGQB 4HZHA 5GIBA 2ZA5A 3RM2H 2GT8A 2Y80A 2ANYA 1D3DB 1UTNA 4MLFB 1HAHH 4ABHA 3M3SA 1S0QA 1F2SE 1BHXB 1E36B 4OGYA 4OS5A 3T29A 5JBCS 2BVRH 1K1NA 1P2KA 3ITIA 1Q31A 5ETXA 4CRFA 1BZXE 5C2ZA 5GPIB 3MH4A 4OS4A 1C5SA 1Z1JA 4BTIB 1GHAG 3UNSA 2Z9IA 1ZR0A 2G51A 1N8OB 5TJXA 2ZTZA 4Q80A 3RMLH 3M7TA 3HK6B 3S7KB 1LVBA 1VGCC 2P93A 1O5DH 2OQUA 1O2YA 3E8LA 1K1OA 1QJ6B 4ISOA 1G3DA 3T2NA 3P70B 1GVZA 6GCHF 4E05H 1GBCA 5T3HA 2BXTH 4YZUA 4X8TH 5FBIA 2EI6A 2AMQA 3BN9A 1AY6H 1LPGB 1FNIA 1P3CA 2AH4X 2GCHF 1EAXA 1GJBB 2SGDE 2Y82A 2ZTXA 1GCDA 2J4IA 5CE1A 3BTKE 2VIPA 1FY1A 1TNHA 4NIVA 5C67A 2XC4A 3TJNA 1C9TA 2A31A 3SHCH 2GCHG 3LC5A 3MO9A 2I6SA 1PPZA 5K0HA 3P8GA 1A1RA 3L33A 5K7RA 5IDKA 4X6OA 2XC0A 1RJXB 3HGPA 5DK1A 2CHAC 1KXDA 1NRRH 4Q2KA 1V3XA 1ZGVA 3ENSB 1J14A 1ELBA 3UQVA 2OD3B 3TGKE 2ZZUH 1W10U 1YPJH 1CGJE 1C5YB 2HNTF 2CV3A 1TALA 3LU9B 1CGIE 2ZECA 1LHDH 2AGGX 3A8CA 1GMCG 2PR3A 3ZZ7A 3TK5A 3QGJA 2EI8A 1BTZA 1C5UA 3PTNA 1EPTB 4CR5A 3V3MA 1PQ8A 1T31A 1A4WH 1GG6C 3RMNH 1OWJA 1GI2A 1SHYA 3T28A 3TJUA 5EPNA 3BF6H 3D49H 2K1QA 2PKAA 1QJ1B 2R2MB 3PROA 1LHCH 3RXDA 4BNRA 1C2IA 3LGVA 1SGPE 3H5CB 3U1IB 3A7WA 3O8RA 1DLEA 2AGEX 3CS0A 3MU8A 4YLUA 1FY5A 1O2ZA 2BM2A 1DE7H 3ELAH 1QCPA 1GBTA 3A86A 2G5NA 1OKXA 4NA8A 5EXNA 2GVFA 1BRAA 1FY3A 4X2YA 3UUZA 1EB2A 3RXMA 2ALVA 2BLQA 1GBEA 2HPQH 4OGXA 5L6NH 1J17T 3EDXB 3QZRA 1K1IA 1S84A 1WUNH 2P95A 1VZQH 4ZUHA 2I6QA 3V0XA 1C2LA 3SU1A 1UJ1A 4RKOB 1O3LA 1V2OT 3GDSA 1SLWB 3RU4T 3U8TH 2TGAA 4WH6A 3VGCC 2ZPSA 2BB4A 4ISHH 3O8BA 3ATKA 2JETB 2STAE 3MU5A 2UWLA 2PKSB 1O2RA 3LH1A 1A0JA 1O2HA 1TWXB 1SLUB 4KGAA 3U8RH 1ELEE 1ELAA 1O33A 5EQSA 1QY6A 2WV4A 1RFNA 2D2DA 3H7TA 2Z7FE 3E0PB 1OS8A 2Z3CA 2PUXB 1SGFG 1HAVB 2ZU4A 3O8DA 5EXLA 3SGQE 1MQ6A 1IQFA 1H9IE 3SUDA 1AB9C 2CMYA 2A7HA 2RA0A 1V2QT 1HNEE 2IN2A 1DWDH 2ZWLH 2SGQE 4ZHMU 1A5HA 1C1MA 2AEIH 3PWBA 5LH8A 2XYAA 4MPUA 2HALA 1G3BA 1OWHA 1O37A 2A5IA 4UFGH 1XUGA 3Q3YA 3RXKA 3GCOA 2ZHFH 1XKAC 3ESTA 3QLPH 1XXDA 1BDAA 1C5TA 3ZZ6A 1KYNA 1P57B 2PLXA 2BDBA 1DICA 5AFYH 1O3IA 4NGAH 3SBKA 3LJJA 1AN1E 1AO5A 3SN8A 1ETTH 4NCYA 3BTFE 1PYTD 2QYIA 2FTMA 2VVUA 1PYTC 1YBWA 1TE0A 4CH2B 1O2PA 4D7FA 2PTNA 1AZZA 7ESTE 3V12A 1OP8A 4ZHAA 1BBRE 4E06H 1LPKB 2BY6X 2GMTB 1B7XB 3NUMA 3EGKH 2BD4A 5EPYA 3HKJB 1BTXA 1NRQH 2O9QA 5L2YH 4WXIA 3E3TA 1NESE 1O3JA 1L4ZA 2FMJA 4Y76A 1L1NA 1C2FA 1T7CA 2VB0A 2ZO3H 1BRUP 1Z8RA 1O2OA 3RXAA 4JZIA 4LK4A 2ZGBH 2V35A 4AB9A 8LPRA 1GBHA 1VCQA 1TX7A 1GJ5H 1C1QA 1F0TA 2FIRH 3RXIA 3SV8A 4AFQA 3VB6A 1P05A 1LHGH 2O8UA 2TIOA 4CRDA 1H1BA 1GHYH 4ZHLU 3ZVBA 2D8WA 1N8OC 1FPHH 2A4RA 2LNCA 3A7XA 3ZYDA 3FP8E 3PLBA 1QTFA 1IQMA 1WV7H 1K1JA 2VH0A 4CRGA 5JDUB 3Q77A 3E6PH 3ODDA 1IQJA 2ZTYA 4FU9A 5DP3A 2GDEH 3PMJA 4AYYB 2NU0E 1C5XB 4GAWA 1HGTH 5IYTA 2P16A 2ZI2H 4Y7AA 1AE8H 3A7VA 3M35A 2UWOA 1AHTH 1W0YH 2AGIX 1SHHB 1WTGH 1QNJA 1JIMA 2QN5T 1TFXA 5FBEA 3T27A 4B2AA 2VIOA 1GI3A 3UREA 4AFZA 1BHXF 5C1YA 1FXYA 1NZQH 1HXFH 1P09A 1UTOA 4MNWA 1SLVB 1S6FA 2ZCLP 3GDVA 4NWKA 1GL0E 3BIUH 1HV7A 3GCTG 1ARCA 1HLTH 2CF9H 1WU1A 1RGQA 1UTKA 3ATWA 1EQ9A 1C5VA 3DFJA 3F9FA 3P8NA 3RDZA 3W94A 5E8EH 4TWYA 2A2QH 3ZZCA 1OWIA 1GMDG 4UONA 5EQQA 1P2QA 2GD4B 1P11E 1ESTA 2A32A 1MU6B 3RLWH 4YM9A 3I29A 1O5AB 3Q00A 5DP8A 4AGJA 2A4QA 3Q3XA 2A1DB 4BANB 1EPTC 1SQAA 3SV2H 2ZDKA 3ZZBA 1MKXK 1SL3A 3SI3H 5DP7A 3SU6A 1LO6A 1W3CA 3N7OA 3UIRA 1BTYA 2J94A 3S7HB 2XNIA 2SNWA 5H4IB 2AIQA 1NS3A 1ZMJA 1O5GH 3ATLA 4IGDA 2QF3A 1SGRE 3RXPA 5AFZH 2BQ7B 1QFKH 1YKTA 5AF9H 2EI7A 3RC6A 1HAOH 1C5LH 5JB9S 4BAHB 1AI8H 3F9GA 5EG4A 3ZVAA 1V2ST 1OWKA 1T4VH 2ZPQA 3ATIA 8GCHF 1W7XH 4GPGA 2CXVA 3SI4H 2BVXH 1F0RA 1MMJN 2XXLA 3BV9B 1CT4E 1CA8B 2JKHA 1C5NH 1P06A 1YLDA 1GBLA 3E90B 4K5ZA 1QBNA 3CP7A 4B73A 1GJ4H 1GJCB 1O2KA 3VXFH 2GV6A 3BTWE 1DXWA 1IQNA 4MPVA 3SU4A 3W95A 3TGJE 2YNAA 5DO4H 4CRAA 2HVXA 4X1QU 1HBTH 3PV4A 2GDDA 3S0NA 3AW1A 3P8FA 4FU8A 1O5FH 1NRNH 5A2MH 2O8TA 1NO9H 3DA9B 5EGMA 1T8LA 3UR6A 4MVNA 4NZLA 1SI5H 4DG4A 4AFSA 2UUKB 4FUDA 2O8MA 3EYDA 1FAXA 1NROH 4H6SB 4UD9H 4YLQH 5GJ4B 1GI0A 3P6ZB 1HAZB 2JETC 4H6TA 1YPEH 3M3VA 2J95A 1EPTA 4IN2A 2Q6GA 2PKSC 1C1RA 2ZDVH 5EQRA 1Q3XA 1O3NA 3PWCA 4ZROA 2FOAA 1KXEA 1SR5C 3KIDU 1QB1A 2Q6FA 2JH6D 1ANCA 1QIXB 4BTTB 5GXPA 4FUEA 1M9UA 1O2QA 5L2ZH 1UVOA 4Y79A 2ZGHA 4ASHA 1K1MA 1L1JA 2PHBA 3LJOA 1GBFA 2Z94A 1UVTH 1Z8JB 3GY5A 4IMZA 2BZ6H 5C5OA 3AAUA 3KQBA 4OS2A 2BY5X 1EP5A 1A2CH 3MHWU 1BBRK 4AORA 5DP4A 1O39A 1WOFA 2AIPA 3KHVA 1RTLA 4D76A 1TNGA 1O2XA 4UDWH 2AMDA 2G4TA 2CGAA 3LT3A 2R3YA 2W26A 3A7ZA 1A0LA 1ABIH 4ISNA 1ARBA 1E35B 2ALPA 1WCZA 1K21H 3RXRA 3HGNA 2F83A 4KKDA 1BT7A 1O3MA 1V2RT 1UK4A 3I77A 3ZYEA 5F03A 1C5PA 2XBWA 1AFQB 5DP5A 4ZKNU 1Y8TA 1B0FA 1O3FA 2GMTC 1THRH 3ZZ4A 5JBAS 1Y5UT 1Z6JH 2B8OH 4WJG2 3TPIZ 1ESBA 3BTEE 1LPZB 2FX6A 1ZHPA 1BUIA 3P17H 1P10A 3GYLB 1AGJA 1G30B 3PMHB 1HAVA 1XVMA 3E16B 4NG9H 2FLRH 1D6WA 1TABE 4OS7A 4A1XA 4DCDA 1DSUA 3URDA 4IC6A 3RXOA 1GVKB 1LCYA 4AGKA 2QXHA 1GJ6A 2A4GA 2ASUB 2CN0H 4CREA 1MD8A 1S83A 1TQ0B 1FN8A 1VCWA 4UE7H 1DY8A 1HCGA 2C8YB 2GKVE 2CJIA 1NU9A 5CMXH 5DPAA 2JH5D 2OC1A 2WPIS 2W3IA 2ZHDA 1XUHA 2WPJS 2VVVA 2BQWB 1JWTA 2VWOA 4K1EA 4I7YH 3HKIB 4A1VA 3ZV8A 1BMNH 1P2IA 4Q7XA 1AE5A 3MNSA 1Z8IB 1UVPA 3SUEA 1V2UT 1O36A 1K1LA 1UCYK 7GCHF 5GDSH 3KQEA 2GT7A 1EZXC 1QQ4A 1XUKA 1EZQA 4CRBA 1FDPA 1F5RA 3I78A 3FZZA 1FLEE 3ODFA 2BXUH 4A1TA 2ZDNA 2ZCKP 1DFPA 1MAYA 4ISIH 1W8BH 1HYLA 1O3KA 3GY3A 4A5TS 1NM6A 1S6HA 1CE5A 2JH0D 3H7OA 1CQQA 2XBXA 1HAPH 3SJKA 1C5WB 1UTLM 4X0WU 2G4UA 3KQCA 1GI4A 2VWMA 1FAKH 1DOJA 4Y71A 2Z9LA 3RM0H 5LPFA 1A5IA 1V2WT 2OUAA 4GHTA 4WMFA 3RC5A 2ILNA 4CRCA 2FM2A 1EB1H 3A7TA 2O8WA 3LPRA 1IQGA 3L3TA 2WINI 2ZIQH 2XBYA 1NY22 5EOKA 2NU1E 5E0GA 1QL9A 6GCHG 1BMAA 3AAVA 3EA8A 1CHGA 1P04A 1P8VC 2ZDMA 3IITA 5HYOA 1WAYB 1EASA 2VIWA 2PUQH 3MNXA 3LKWA 3NCLA 4Y0YE 2QF0A 1TRNA 2THFB 1EJAA 1HIAB 1MBMA 1QBOA 3SGAE 1FY8E 2FESH 1PPCE 1DX5M 2UUJB 3SJOA 5FX5A 3STJA 1UMAH 1ZGIA 3S69A 1AUTC 2F9PA 1BITA 4ZKSU 4WH8A 2GV7A 3PO1C 4I32A 3SNAA 4WMEA 3OU0A 5T6GA 1OP2A 7LPRA 4X6PA 1BMMH 2EC9H 2HWLB 4B1TA 1O38A 3RXBA 1P9SA 2BD3A 3E1XB 4WY3A 4ZMAH 5ABWA 1C2GA 1C1PA 1DM4B 3LGWA 1HUTH 1LMWB 5ESBA 1SMFE 4Y7BA 1GHBF 1L1GA 3K65B 1IQKA 4MNVA 2OBQA 3P95A 4AOQA 1A3BH 2SNVA 4K60A 2KAIB 1ORFA 3SUFA 1TPSA 3GCHC 1KTTB 1P01A 4Y8XA 3V7TA 5TCAA 1QL8A 3HPTB 1CHOF 3BEUA 4HFPB 1TNJA 4MQAA 1YGCH 1AZ8A 1IQIA 1GI6A 1RS0A 1TX6A 4R0IA 1PPHE 1W7GH 3K6YA 3PLPA 1IQHA 1Y3XA 5A09A 1C1OA 2QAAA 6CHAB 1SGDE 3SUGA 3SU0A 1CHOG 1KY9A 1S5SA 3BEIB 1V2JT 4K69A 1TB6H 1GHZA 4OS6A 3PTBA 3ZZ3A 2Y7ZA 1FONA 2A5AA 1C5ZB 2QGRA 3PM3A 2G52A 1PQ5A 3MNBA 4CBOA 3BTDE 3ZVGA 1DWBH 4AFUA 1RXPA 1UVSH 1ELGA 1DT2A 3GY2A 1UTQA 1C5OH 1ZLRA 2FP7B 4O9VA 3TVJB 5EW1H 4GHQA 5DP9A 3K2UA 4FUBA 1DSTA 4Q7ZA 4JYTA 4J2YB 3MYWA 1CGHA 1GPZA 1GDQA 4ABGA 4K1SA 2ODPA 3MO3A 3HATH 2ULLA 1ZHRA 1YP9A 4I8GA 2C3SA 1DUAA 1IQEA 4NSYA 1O3DA 3EQ0H 1MZDA 1JRTA 2ZHQH 3M7QA 1A3EH 1O2SA 4NIYA 1EP6A 4X2VA 4FUIA 1MKXH 1O3PB 2ZEBA 4AN7A 3G01A 4BXSA 1GMHF 2V3HH 4NWLA 1HAXB 4YOIA 1IQLA 2Q6DA 5C1XA 1GJAB 1C1UH 4IC5A 5PTPA 4D7GA 4XDEA 3A81A 3Q76A 1SGFA 1SQTA 1ELCA 1JMOH 2PW8H 1AFQC 2Z3EA 3UTUH 2OCVB 1TA6A 1C5QA 1HXEH 1RTFB 2UWPA 1C2DA 3UNRA 1TPAE 4NIWA 4JK5A 1EKBB 1ZMNA 2ZU5A 5HM2A 2QXIA 1J16A 4IW4E 4NZQA 1G32B 3NWUA 1Y5BT 4UFFH 1IOEA 1V2MT 3MNCA 3AVZA 3LONA 1O0DH 1ZJKA 3QZQA 4B2CA 2W7UA 2FOFA 1OXGA 2BDGA 1W0ZU 3AASA 2ANKH 1P0SH 1FV9A 1XUJA 1VITF 4TY7A 4ABEA 1G2MA 2ESTE 9ESTA 3QTVH 1FIZA 4FVDA 4VGCC 1O34A 5E2OA 3R0FA 4D8NA 3A80A 3MOCA 4LOYH 2BTCE 3OY6U 1HRTH 1VITG 4THNH 3GY8A 1MKWK 3SNBA 1TBRH 1LTOA 1TOMH 1HAGE 1XVOA 2J9NA 1C5RA 2P8OB 3PLKA 2BDIA 1LKAA 1TGNA 3SNEA 1C2JA 5EU8A 1GI5A 2TGPZ 1ANDA 1V2KT 3U9AH 2FTLE 1GBAA 1TA2A 3CS7A 2QV1A 3FZDA 1BBRH 2A45B 3BEFB 5BPEA 2HNTE 3TJVA 2QIQA 3DHKH 3RU4D 4AG1A 5FHTA 2PV9B 2WUBA 4I31A 1LHFH 1RIWB 1VJAU 2FEQH 1GBMA 3QO6A 3RC4A 4CH8B 1SC8U 4IMQA 3MU4A 1FPCH 3OY5U 3ZZAA 3LGYA 1DWEH 4K1TA 1UTMA 2A0QB 3ZV9A 1E0FD 1UK2A 4YT6H 4X2WA 1ELTA 4KTCA 1A5GH 1GJ9B 2BZAA 1IAUA 2SFAA 1TGCA 4JYUH 3QK1A 1AUJA 5FPYA 1O2WA 4CR9A 3T62A 5FCKA 1QB9A 2UUFB 1O3AA 3SHAH 1BTWA 1O3HA 3UOUA 4I8LA 3S9AA 1GJDB 2FODA 2GZ8A 3RXVA 4X8SH 1FZZA 5JB8S 1EAUA 5LGOA 2FS8A 2DE8A
chains in the Genus database with same CATH superfamily
4X2XA 2Y6TA 2ZF0H 3F3BA 2P3FH 2ZFQH 5DKMA 1A61H 1P2JA 3DCLA 4K8BA 4A7IB 1D3PB 1Z71A 1UCYE 2UUYA 2F9VA 4RKJB 4Z0KA 2YMSD 5JBTA 3RP2A 5GCHF 1ZPBA 1Y59T 2FS9A 1B5GH 1DPOA 3URCA 1N6YA 2F9OA 2IOTA 3QWCH 4AX9H 2TBSA 4D9RA 1ZMLA 2ZU2A 1SGNE 2BLWA 3FAOA 3KCGH 4LXBH 3TITA 4CBNA 3KN2A 4FU7A 1NTPA 2C4FH 3LIWA 1THPB 1W14U 1UW7A 1GVLA 5C3NA 1WDIA 1N6XA 4JZDH 5L30H 5E0JA 3UWJH 5F6MA 5T6DA 4DW2U 3SV9A 1AVGH 2ZHWH 5EJ1A 1LHEH 5A8ZA 5FXLA 1TMUH 3ZVEA 3DFLA 5C20A 4FUHA 1C1SA 4LZ1H 3MI4A 1UCYH 4TWWA 1NFYA 2VGCB 3M7UA 1HJ8A 4JCNA 1AFEH 4INLA 4FUCA 5A8XA 1TX8A 6CHAC 3A85A 3SU5A 1O5CB 2CHAB 3D62A 2F9UA 1HJAB 1ZTLA 1HIAA 3S9BA 3B9FH 3SOSA 1F0UA 1NFUA 1GDUA 8GCHG 2QA9E 5FAHA 3GY6A 3TIUA 1G3CA 2BD8A 1ZJDA 4UFDH 2HLCA 1TLDA 2FOMB 2H9HA 4XSKU 4FVBA 2XC5A 9LPRA 1BTHH 2WHXA 3ZZ8A 2FDAA 3TU7H 1D3TB 4XOJA 1EOLA 2FXRA 2WV9A 4ABBA 3K9XB 4BAMB 1EZSC 2OINA 2R0LA 1ACBE 1FJSA 1GG6B 4BTUB 2AFQB 1TOCB 1Q2WA 3VB4A 4GLYA 1W13U 3W1EA 1F0SA 1G2LA 3M5LA 3U98H 4YTAA 1FI8A 1FQ3A 2RG3A 3RXQA 3S9CA 4ASUD 2BY7X 4Y11E 5EODA 2F91A 4WF8A 2ZGJA 1XKBC 3T26A 4B76A 1NT1A 3SJ9A 3TH2H 1OSSA 1FIWA 4ISLA 4GCHF 2FI3E 8KME2 1UTJA 1FN6A 2KAIA 1S85A 5B6OA 3E0NB 5FPTA 5DN6D 3NRLA 1W12U 1LQEA 1Y3UA 4YOJA 4X6MA 3VB5A 1RTKA 2ZFSA 4GCHG 3KGPA 3P92A 1EJMA 1GHVH 1AU8A 1P12E 1THSH 2EEKA 1NPMA 4NA7A 1C9PA 1GI9B 1S81A 1SLXB 4FUJA 1BTUA 1MAXA 1MTNB 1KLJH 3BTGE 1V6DA 1H4WA 3RMMH 1ANBA 2Y5GA 1JOUB 1QA0A 2J97A 1CVWH 3QGNB 3RXLA 3M61U 4HTCH 2VIQA 5C17A 2FX4A 2AYWA 3A89A 2EA3A 4DGJA 4ZXXH 5DG6A 1AWFH 3QUMP 1DANH 1JBUH 1VITH 3FP7E 2QE7D 2WPHS 1ZTJA 2H9TH 1X7AC 4X6NA 2F9NA 1O2LA 1DUEA 1TNLA 4JK6A 2XBVA 4K3JA 4FUFA 2OC0A 4OS1A 2GGVB 1ZHMA 2C8XB 1TRYA 3C27B 4ESTE 1MUEB 3P8OA 2YNBA 1DXPA 5JPMH 2RCEA 1QRWA 2PTCE 1GGDB 2BX4A 1YC0A 1YCPK 2XWBI 1SOTA 2FYQA 3WWBA 2WV5A 3TH4H 1SOZA 1XUIA 2NWNA 2VJ1A 1P2OA 1A7SA 3SU2A 3MH5A 5HKKD 4U30A 1VKYA 3F9EA 1OP0A 3JZ2B 3R3GB 1SQOA 1SSXA 2WPDD 4X8VH 2F3CE 4RSPA 1TONA 2P8OC 1HJ9A 3DD2H 1MCTA 2GJGA 3RXGA 2AERH 2FLBH 3JZ1B 2M2AA 4R8TB 4TPIZ 5I25A 1GJ7B 2A2XH 2PSXA 3NPSA 3LDXH 5HXFA 3VFEA 3GOVB 3M5MA 1P02A 1ESAA 2QC2A 3DUXH 4B2BA 3F2GA 1D4PB 3MFJA 3SORA 1HAYB 1INCA 2FWWA 1BJUA 2YOLA 1EOJA 1O31A 1O3GA 2IJOB 2WUCA 1MU8B 4X1SU 2G55A 1WYKA 4FXGH 4FETA 4O3UA 4WMDA 3OTJE 1SFIA 1RIWC 2C8WB 2WYGA 3A88A 4TPYA 2B5TB 3U69H 5A0CA 2A5KA 2Q1JA 3GYMA 2A7CA 3A7YA 4HI3A 2RDLA 2PFEA 2GZ9A 2WPLS 3WW7A 1AVWA 1GBBA 1TYNA 1A46H 1J8AA 4F49A 1NFXA 3Q3KA 2OQ5A 1WTHD 1ZOMA 2VINA 1GHXH 2FZZA 2TRMA 3F6UH 2R2WU 7GCHG 1TPPA 3SW2B 2G00A 5ESTE 1TGSZ 2SGFE 1QRZA 1GBKA 1GHAF 3FFGA 4IN1A 5A8YA 2ZFTA 4XRNA 2AS9A 4TYDA 4JZFH 2FOEA 2FOHA 2ZKSA 2XRCA 3SQHE 1QGFA 1C4Y2 3NXPA 2HNTC 2LELA 1TNKA 5FPSA 2H5DA 1UO6A 1CA0B 1SGTA 1YM0A 3LGTA 3LC3A 1XXFA 2J38A 1GI8B 2BDHA 4NSVA 1AIXH 1VJ9U 2VIDA 2ZU3A 2V6NA 1ZPCA 1CBWB 2B9LA 1SGIB 1ELDE 1H8IH 1MTVA 3F2FA 5B6LA 5KGOA 1NC6A 1SGEE 5T6FA 1TMBH 4LZ4B 1DVAH 3ZVDA 1W2KH 1P2MA 4U2WA 3KEEA 1T8OA 4RN6A 1KXAA 1SBWA 3PMAB 1KXCA 1KTSB 3VB3A 1CU1A 1PQ7A 2Z6BD 4CHAB 2XOKD 1MKWH 3SZNA 4UEHH 4XBDA 2PWXA 3RXHA 2GZ7A 1LDTT 5FL7D 1AVXA 1PPFE 1V2NT 2C8ZB 2YMSB 2GCTB 1K22H 2QXGA 4HGCA 1LVMA 2VGCC 2P3UB 5EJLA 4B75A 1F92A 4ZH8A 4DT4A 3UPEA 3FVFB 5EW2H 4M9FA 1ABJH 4O03A 3VEQB 1BB0B 1J15A 1SG8B 5A0AE 3RXCA 1YPHE 3MO6A 2B7DH 1HJAC 4ABFA 4Q7YA 3FOAA 1GMCF 3GICB 1J9CH 2OTVA 2ZHEH 3KQ5A 1JIRA 4DY7B 3SNDA 3BSQA 3LGUA 1G37A 1T4UH 3RLYH 2WPKS 2XCFA 1GJ8B 1DY9A 1SGCA 4Y6DA 1EUFA 1MTWA 1L2EA 3KYFA 1GHBG 3TJOA 1AKSB 3TK6A 1C2HA 1D9IA 3GY7A 5I46H 8ESTE 2KCPA 1K0HA 1NRPH 1MTSA 4GSOA 1QR3E 3EA7A 2ZNKH 3UFAA 2BD9A 3ZVCA 3TGIE 2ZC9H 4DURA 5J4QA 1TGBA 2ZDLA 1LVOA 3RXUA 4XBCA 2ZDAH 4TSFD 3EAJA 4GVUA 3C1KA 1AMHA 1UHBB 1BRCE 3KNXA 1C2EA 1DDJA 3TLOA 1FUJA 2BOKA 2CF8H 3BTME 3LH3A 4YESB 3T5FH 1GL1A 2R3UA 2BD2A 2BQ6B 2O8LA 1K1PA 2A7JA 5E0HA 1QA7A 2OP9A 3B23B 3BTTE 1H9HE 1UVUH 1OX1A 1O5BB 1ANEA 1YLCA 1BQYA 2ODQA 1K28D 1QURH 1V2TT 4IS5A 2Z9GA 3GS9A 1PPBH 1MCVA 2QCYA 4P00A 3RXTA 5E2PA 3AW0A 3SO3A 1MQ5A 2H2ZA 1MTNC 4P02A 4SGBE 4TY6A 2P3TB 4MG3A 1G3EA 2BY8X 4MTBA 5F8TA 4ABDA 5LPEA 3VB7A 2XCNA 2ZP0H 2LPRA 5JBBS 3FP6E 1P3EA 1COWD 3LOXA 3BG4B 2BD7A 1KDQA 4JZ1A 1NN6A 2Y7XA 4MPXA 1P9UA 3SJ8A 4YO9A 1E37B 1CT2E 3ZVFA 1BRBE 3M37A 1ELVA 4AYVB 2J5UA 2L6OA 1D6RA 1GMHG 3WWFA 4INKA 3NKKA 1Y3VA 1TBQH 3BTHE 5HIYA 3GISB 4JMYA 1GGDC 1GI7B 3QN7A 4NFFA 5AHGH 3K6ZA 4AC9A 3SV7A 1VR1H 3TH3H 1EJNA 2VIVA 1U6QA 1PJPA 1ZRKA 2BX3A 4ZAEA 1YPLH 2FPZA 4GUXA 2KR7A 3OX7U 5CHAB 1LQDB 1GWAA 1SGYE 4YOGA 1GCTB 2OC8A 5JYIA 4Z6AH 2FYRA 4J1YA 4SGAE 5C94A 2NU4E 3RXSA 3UNQA 2W5EA 2D1JA 5G4BA 2TPIZ 1O2MA 1BCUH 1TNIA 3A87A 5FX6A 2BY9X 1QQUA 4BAOB 2H9EH 1C1WH 2FO9A 1K2I1 4U32A 4JYVH 1PPEE 2RFKC 3OEED 4I8KA 1QBVH 3T25A 1O32A 4YT7H 4H4FA 1RRKA 3BTQE 4MNYA 3KL6A 1C2KA 2ZGCA 1PQAA 3V13A 2PGBB 1TMTH 1P2NA 1BIOA 1OYTH 1MZAA 1GBDA 2WZQA 4K2YA 3ZZ5A 1TIOA 2VWNA 1O2NA 3M36A 3VG8A 4WXVA 5J4SA 4ACAA 2HRVA 4Y8ZA 1VCPA 3D65E 2XTTB 2BD5A 5F8XA 5EXMA 1V2LT 1OPHB 2BYAX 1XUFA 5C0UA 3F9HA 4Y10E 1O5EH 3ZIAD 1Z1IA 1DLKB 5HM9A 2OK5A 1UK3A 1DS2E 2ZU1A 6LPRA 1WQVH 1FY4A 4B74A 2Z3DA 1O2TA 1UTPA 2ANMH 4INHA 4MPWA 2P59A 2ZQ1A 1YPMH 2ANWA 1IHSH 1A0HB 5A0BA 1Y5AT 3E91A 2Y81A 2G81E 4BOHA 1OWEA 2OLGA 1SFQB 2TGDA 4RT0A 1ID5H 1CA0C 5DP6A 1HPGA 2QXJA 4X1PU 3WY8A 3OSYA 4KELA 3UQOA 1O2IA 1MD7A 1BMLA 4XE4A 2A4OA 1BA8B 4WVPE 1W11U 4NA9H 1CBWC 1RD3B 4X1NU 1TQ7B 1TGTA 2ZFPH 3QX5H 3VPKA 1HDTH 1Y3WA 4DOQA 3F1SB 4AB8A 1YCPH 1B0EA 5LPRA 1KXFA 1OYQA 2CK3D 1CSOE 1PFXC 3MWIU 3TNTA 2Y5HA 1Z6EA 1O2GH 1SPJA 2ZCHP 2VNTA 2ZFRH 1D3QB 2G8TA 2W7SA 4CHAC 4D9QA 5HMAA 2KCOA 3MH6A 4ZXYH 4AG2A 3ZZ9A 2SGEE 1OHHD 3KYGA 3RXFA 2GX4A 3M5OA 1XM1A 1T8NA 2YMSC 2R9PA 2GCTC 4QT8C 2WPMS 1WSSH 1VGCB 2W6JD 3GCTF 5FCRA 1H9LB 1ZSLA 3N7DA 4O3TA 1PPGE 3TNSA 1MH0A 1QJ7B 2B0FA 1AQ7A 4WWYA 1NU7B 2PKAB 1EATA 1ZTKA 1GMDF 4U01A 5GCHG 3UWIA 1DITH 2XWAA 1ETRH 3RUOA 1WBGB 1YYY1 4ACBA 1TPOA 1ZSJA 2FI5E 3RXJA 1QRXA 2FOGA 1KIGH 3GCNA 2C93B 1S0RA 1GBJA 4ABAA 3EE0B 3U1JB 1XX9A 3PYHA 1SGQE 4PROA 2VH6A 3UB0A 1KLTA 2HGTH 3SV6A 3SQEE 1Z7KA 3SNCA 1XMNB 1YPKH 4X1RU 3GY4A 4DT7B 4KP0A 1EX3A 3FO8D 1N1LA 4Y0ZE 4E7RG 4NFEA 1L0ZA 1ZYOA 4MDSA 2J2UA 3VXEH 4B71A 3PO1B 4DIIH 4H42U 1YF4A 1JXPA 3MU1A 2H6MA 1F5KU 2BVSH 2BLVA 3PV2A 2VVCA 1CO7E 3KQDA 1Y3YA 2JDID 2V3OH 2HLDD 1CT0E 2ZQ2A 3QDZB 4ABJA 1FMGA 3A8AA 1KDQB 1SB1H 1C1VH 2XW9A 1ETSH 2DUCA 1GBIA 3HK3B 4DIHH 1YPHC 2BDCA 1G36A 7KMEH 1BJVA 1EAWA 1T8MA 2J92A 4Y8YA 4NIXA 3SU3A 1DWCH 3MU0A 5SGAE 2Z9JA 2R0KA 3GCHB 3SZEA 4X8UH 1V2PT 1HFDA 2WYJA 4IBLH 2BHGA 1GI1A 2HOBA 4KTUA 3PB1E 4A92A 1NFWA 1YCPM 6ESTA 1V2VT 2VU8E 1TAWA 2BMGB 2OC7A 1P03A 2SGAA 1T32A 1OOKB 1K9OE 4E7NA 4BAQB 2DE9A 1BTPA 1O3BA 1E38B 1H8DH 1C4V2 2ZG0H 3FN8A 1WQSA 3OFND 3BG4C 2V7QD 3B8JA 2SGPE 1AKSA 2Y5FA 3MH7A 3UOPA 4BXWA 5C5NA 4UFEH 5HGGA 3MMGA 3PMBB 3RXEA 2ZGXH 2RA3A 2P94A 3MTYA 1O3EA 2D26C 2RDEA 3GDUA 1ZRBA 3OYPA 1AD8H 2OXSA 3D23A 5F8ZA 1F7ZA 3BG8A 1EZUC 3A83A 1E34B 1GDNA 4F4OC 3ATMA 2Z9KA 2ZFFH 3U8OH 2F9BH 3CENA 1LVYA 3F68H 3LGIA 1NRSH 4ZKRU 1H8ED 1UHBA 2TGTA 3SGBE 5BRRE 3M5NA 1O30A 3OEHD 1MTUA 1C4U2 2AMPA 2NU3E 3VGCB 4DVAU 5CHAC 5GWZA 2ODYB 1O2UA 1C5MD 4KTSA 1GCTC 4I8HA 5DJ7A 1QL7A 4ZKOU 3KF2A 3A82A 1ELFA 4FUGA 3MQKC 1SVPA 1ZSKA 2BDYA 3TK9A 1GHWH 4DJZB 2BOHB 1OWDA 1O2JA 3IG6B 4AZ2B 3SJIA 4XFQA 3L6PA 5AVDA 1KSNA 1Z8GA 3M3TA 1JRSA 2K0QA 3ZZDA 1ZPZA 2GTBA 1AB9B 3FANA 5DSFA 1IHTH 3NK8A 3UY9A 2FI4E 1S82A 1YPGH 1QB6A 3BIVH 3QTOH 1O3CA 2BLOA 3NZIA 1ZZZA 2M5TA 1HAIH 2J34A 1C1TA 2BDAA 1EAIA 3IWMA 4O97A 3RMOH 1C2MA 1C1NA 5F53A 1EXFA 1G9IE 4K8YA 1QHRB 3UR9A 2NU2E 2OBOA 4I8JA 4M7GA 5KEDA 2GP9B 3EA9A 3A8DA 2IPHA 1F5LA 2C90B 3DT0H 4MNXA 2H1UA 4I33A 4BAKB 1LKBA 2PP6A 4JZEH 2G5VA 1TRMA 3PRBA 1NBME 4A6LA 2PSYA 3A8BA 3STIA 2IPQX 1BOQA 1TBZH 1MBQA 4ABIA 3O8CA 2W3KA 1KXBA 2ZPRA 5EJZA 3A84A 1KLIH 2H5CA 3RU4E 2QY0B 2FOCA 2FOBA 5TCCA 1O2VA 2VWLA 1O35A 1O3OA 5C1UA 5DGJA 1AWHB 2STBE 2V0BA 4XBBA 4VGCB 2HPPH 4B6EA 1L4DA 1HB0B 2PGQB 4HZHA 5GIBA 2ZA5A 3RM2H 2GT8A 2Y80A 2ANYA 1D3DB 1UTNA 4MLFB 1HAHH 4ABHA 3M3SA 1S0QA 1F2SE 2EY4C 1BHXB 3OTPA 1E36B 2F4LA 4OGYA 4OS5A 3T29A 5JBCS 2BVRH 2EQNA 1K1NA 1P2KA 3ITIA 1Q31A 5ETXA 4CRFA 1BZXE 5C2ZA 5GPIB 3MH4A 4OS4A 1C5SA 1Z1JA 4BTIB 1GHAG 3UNSA 2Z9IA 1ZR0A 2G51A 1N8OB 5TJXA 2ZTZA 1WXRA 4Q80A 3RMLH 3M7TA 4ZCNA 3HK6B 3S7KB 1LVBA 1VGCC 2P93A 1O5DH 2OQUA 1O2YA 3E8LA 5KECA 1K1OA 1QJ6B 4ISOA 1G3DA 3T2NA 3P70B 1GVZA 6GCHF 4E05H 1GBCA 5T3HA 2BXTH 4YZUA 4X8TH 5FBIA 2EI6A 2AMQA 4Z1MD 3BN9A 1AY6H 1LPGB 1FNIA 1P3CA 2AH4X 2KFWA 2QF4A 2GCHF 1EAXA 1GJBB 2SGDE 2Y82A 2ZTXA 1E1RD 1GCDA 2J4IA 5CE1A 3BTKE 2VIPA 1FY1A 1TNHA 4NIVA 5C67A 2XC4A 3TJNA 1C9TA 2A31A 3SHCH 2GCHG 3LC5A 3MO9A 2I6SA 1PPZA 5K0HA 3P8GA 1A1RA 3L33A 5K7RA 5IDKA 4X6OA 2XC0A 1RJXB 3HGPA 5DK1A 2CHAC 1KXDA 1NRRH 4Q2KA 1V3XA 1ZGVA 3ENSB 1J14A 1ELBA 3UQVA 2OD3B 3TGKE 3OAAD 2ZZUH 1W10U 1YPJH 3DSGA 1CGJE 1C5YB 2HNTF 2CV3A 1TALA 3LU9B 1CGIE 2ZECA 1LHDH 2AGGX 3A8CA 1GMCG 2PR3A 3ZZ7A 3TK5A 3QGJA 2EI8A 1BTZA 1C5UA 3PTNA 1EPTB 4CR5A 3V3MA 1PQ8A 1T31A 1H8HD 1A4WH 1GG6C 3RMNH 1OWJA 1GI2A 1SHYA 3T28A 3TJUA 5EPNA 3BF6H 3D49H 2K1QA 2PKAA 1QJ1B 2R2MB 3PROA 1LHCH 3RXDA 4BNRA 1C2IA 3LGVA 1SGPE 3H5CB 3U1IB 2JIZD 3A7WA 1SKYE 3O8RA 1DLEA 2AGEX 3CS0A 3MU8A 4YLUA 1FY5A 1O2ZA 2BM2A 1DE7H 3ELAH 1QCPA 1GBTA 3A86A 2G5NA 1OKXA 4NA8A 3F0PA 3PV5A 5EXNA 2GVFA 1BRAA 1FY3A 4X2YA 3UUZA 1EB2A 3RXMA 2ALVA 2BLQA 2J98B 1GBEA 2HPQH 4OGXA 5L6NH 5C0TA 1J17T 3EDXB 2KZ4A 3QZRA 1K1IA 1S84A 1WUNH 2P95A 1VZQH 4ZUHA 2I6QA 3V0XA 1C2LA 3SU1A 1UJ1A 4RKOB 1YLNA 1O3LA 2V3MA 2F43B 1V2OT 3GDSA 1SLWB 3RU4T 3U8TH 2TGAA 4WH6A 3VGCC 2ZPSA 2BB4A 4ISHH 3O8BA 3ATKA 2JETB 2STAE 3MU5A 2JJ2D 2UWLA 2PKSB 1O2RA 3LH1A 1A0JA 1O2HA 1TWXB 1SLUB 4KGAA 3U8RH 1ELEE 1ELAA 1O33A 5EQSA 1QY6A 2WV4A 1RFNA 2D2DA 3H7TA 2VBCA 2Z7FE 3E0PB 1OS8A 2Z3CA 2PUXB 1SGFG 1HAVB 2ZU4A 3O8DA 5EXLA 3SGQE 1MQ6A 1IQFA 1H9IE 3SUDA 1AB9C 2CMYA 2A7HA 2RA0A 1V2QT 3SYJA 1HNEE 2IN2A 1DWDH 2IJD1 2ZWLH 2SGQE 4ZHMU 1A5HA 1C1MA 2AEIH 3PWBA 5LH8A 2XYAA 4MPUA 2HALA 1G3BA 1OWHA 1O37A 2A5IA 4UFGH 1XUGA 3Q3YA 3RXKA 5GNDA 3GCOA 1E1QD 2ZHFH 1XKAC 1YWUA 3ESTA 3QLPH 1XXDA 1BDAA 1C5TA 3ZZ6A 1KYNA 1P57B 1W0KD 2BDBA 2PLXA 1DICA 5AFYH 1O3IA 4NGAH 3SBKA 3LJJA 1AN1E 1AO5A 3SN8A 1ETTH 4RI0A 4NCYA 3BTFE 1PYTD 2QYIA 2FTMA 2VVUA 1PYTC 1YBWA 1TE0A 4CH2B 1O2PA 4D7FA 2PTNA 1AZZA 7ESTE 3V12A 1OP8A 4ZHAA 1BBRE 2KCYA 4E06H 1LPKB 2BY6X 2GMTB 1B7XB 3NUMA 3EGKH 2BD4A 5EPYA 3HKJB 1BTXA 1NRQH 2O9QA 5L2YH 4WXIA 3E3TA 1NESE 1O3JA 1L4ZA 2FMJA 4Y76A 1L1NA 1C2FA 1T7CA 2VB0A 2ZO3H 1BRUP 1Z8RA 1O2OA 3RXAA 4JZIA 4LK4A 2ZGBH 2V35A 4AB9A 8LPRA 1GBHA 1VCQA 1TX7A 1GJ5H 1C1QA 1F0TA 2FIRH 3RXIA 3SV8A 4AFQA 3VB6A 1P05A 1LHGH 2O8UA 2TIOA 4CRDA 1H1BA 1GHYH 4ZHLU 3ZVBA 2D8WA 1N8OC 1FPHH 2A4RA 2LNCA 3A7XA 3ZYDA 3FP8E 3PLBA 1QTFA 1IQMA 1WV7H 2K8IA 1K1JA 2VH0A 4CRGA 5JDUB 3Q77A 3FKSD 3E6PH 1E79D 3ODDA 1IQJA 2ZTYA 4FU9A 5DP3A 2GDEH 3PMJA 4AYYB 2NU0E 1C5XB 4GAWA 1HGTH 5IYTA 2P16A 2ZI2H 4Y7AA 1AE8H 3A7VA 3M35A 2UWOA 1AHTH 1W0YH 2AGIX 1SHHB 1WTGH 1QNJA 1JIMA 2QN5T 1TFXA 5FBEA 3T27A 4B2AA 2VIOA 1GI3A 3UREA 4AFZA 1BHXF 5C1YA 1FXYA 1NZQH 1HXFH 1P09A 1UTOA 4MNWA 1SLVB 1S6FA 2ZCLP 3GDVA 4NWKA 1GL0E 3BIUH 1HV7A 3GCTG 1ARCA 1HLTH 2CF9H 1WU1A 1RGQA 1UTKA 3ATWA 1EQ9A 1C5VA 3DFJA 3F9FA 3P8NA 3RDZA 3W94A 5E8EH 4TWYA 2A2QH 3ZZCA 1OWIA 1GMDG 1EFRD 4UONA 5EQQA 1P2QA 2GD4B 1P11E 1ESTA 2A32A 1MU6B 3RLWH 4YM9A 3I29A 1O5AB 3Q00A 5DP8A 4AGJA 2A4QA 3Q3XA 2A1DB 4BANB 1EPTC 1SQAA 3SV2H 2ZDKA 3ZZBA 1MKXK 1SL3A 1S6LA 5DP7A 3SI3H 1LO6A 3SU6A 2KM0A 1W3CA 5IK2D 3N7OA 3UIRA 1BTYA 2J94A 3S7HB 2XNIA 2SNWA 5H4IB 2AIQA 1NS3A 1ZMJA 1O5GH 5EIYA 3ATLA 4IGDA 2QF3A 1SGRE 3RXPA 5AFZH 2KCAA 2BQ7B 1QFKH 1YKTA 5AF9H 2EI7A 3RC6A 3U28C 1HAOH 1C5LH 5JB9S 4BAHB 1AI8H 3F9GA 5CDFE 5EG4A 3ZVAA 1V2ST 1OWKA 1T4VH 2QF5A 2ZPQA 3ATIA 8GCHF 1W7XH 4GPGA 2CXVA 3SI4H 2BVXH 1F0RA 1MMJN 2XXLA 3BV9B 1CT4E 1CA8B 2JKHA 1C5NH 1P06A 1YLDA 5T1VA 1GBLA 3E90B 4K5ZA 1QBNA 3CP7A 4B73A 1GJ4H 1GJCB 1O2KA 3VXFH 2GV6A 3BTWE 1DXWA 1IQNA 4MPVA 3SU4A 3W95A 3TGJE 2YNAA 5DO4H 4CRAA 2HVXA 4X1QU 1HBTH 3PV4A 2GDDA 3S0NA 3AW1A 3P8FA 4FU8A 1O5FH 1NRNH 5A2MH 2O8TA 1NO9H 3DA9B 5EGMA 1T8LA 3UR6A 4MVNA 4NZLA 1SI5H 4DG4A 4AFSA 2UUKB 4FUDA 2O8MA 1QZ8A 3EYDA 1FAXA 1NROH 4H6SB 4UD9H 4YLQH 5GJ4B 1GI0A 3P6ZB 1HAZB 2JETC 4H6TA 1YPEH 3M3VA 2J95A 3PRDA 1EPTA 4IN2A 2Q6GA 2PKSC 1C1RA 2ZDVH 4RT1A 5EQRA 1Q3XA 1O3NA 3PWCA 4ZROA 2FOAA 1KXEA 1SR5C 3KIDU 1QB1A 2Q6FA 2JH6D 1ANCA 1QIXB 4BTTB 5GXPA 4FUEA 1M9UA 1O2QA 5L2ZH 1UVOA 4Y79A 2ZGHA 4ASHA 1K1MA 1L1JA 2PHBA 3LJOA 1GBFA 2Z94A 1UVTH 1Z8JB 3GY5A 4IMZA 2BZ6H 5C5OA 3AAUA 3KQBA 4OS2A 2BY5X 1EP5A 1A2CH 3MHWU 1BBRK 4AORA 5DP4A 1O39A 1WOFA 2AIPA 2W6ID 3KHVA 1RTLA 4D76A 1TNGA 1O2XA 4UDWH 2AMDA 2G4TA 2CGAA 3LT3A 2R3YA 2J98A 2W26A 3A7ZA 1A0LA 1ABIH 4Q4LA 4ISNA 1ARBA 1E35B 2ALPA 1WCZA 1K21H 3RXRA 3HGNA 2F83A 4KKDA 1BT7A 1O3MA 1V2RT 1UK4A 3F0OA 3I77A 3ZYEA 5F03A 1C5PA 2XBWA 1SQRA 1AFQB 5DP5A 4ZKNU 1Y8TA 1B0FA 1O3FA 2GMTC 1THRH 3ZZ4A 5JBAS 1Y5UT 1Z6JH 2B8OH 4WJG2 3TPIZ 1ESBA 3BTEE 1LPZB 2FX6A 1ZHPA 1BUIA 1MABB 3P17H 1P10A 3GYLB 1AGJA 1G30B 3PMHB 1HAVA 1XVMA 3E16B 4NG9H 2FLRH 1D6WA 1TABE 3AK5A 4OS7A 4A1XA 4DCDA 1DSUA 3URDA 1BMFD 4IC6A 3RXOA 1GVKB 1LCYA 2JJ1D 4AGKA 2QXHA 1GJ6A 2A4GA 2ASUB 2CN0H 4CREA 1MD8A 1S83A 1TQ0B 1FN8A 1VCWA 4UE7H 2LP6A 1DY8A 1HCGA 2C8YB 2GKVE 2CJIA 1NU9A 5CMXH 5DPAA 2JH5D 2OC1A 2WPIS 2W3IA 2ZHDA 1XUHA 2WPJS 2VVVA 2BQWB 1JWTA 2VWOA 4K1EA 4I7YH 3HKIB 4A1VA 3ZV8A 1BMNH 1P2IA 4Q7XA 1AE5A 3MNSA 1Z8IB 1UVPA 3SUEA 1V2UT 1O36A 1K1LA 1UCYK 7GCHF 5GDSH 3KQEA 2GT7A 1EZXC 1QQ4A 1XUKA 1EZQA 4CRBA 1FDPA 1F5RA 4XD7D 3I78A 3FZZA 1FLEE 3ODFA 2BXUH 4A1TA 2ZDNA 2ZCKP 1DFPA 1MAYA 4ISIH 1W8BH 1HYLA 1O3KA 3GY3A 4A5TS 1NM6A 1S6HA 1CE5A 2JH0D 3H7OA 1CQQA 2XBXA 1HAPH 3DSOA 3SJKA 1C5WB 1UTLM 4X0WU 2G4UA 3KQCA 1GI4A 2VWMA 1FAKH 1DOJA 4Y71A 2Z9LA 3RM0H 5LPFA 1A5IA 1V2WT 2OUAA 4GHTA 4WMFA 3RC5A 4HG6A 2ILNA 4CRCA 2FM2A 1EB1H 3A7TA 2O8WA 3LPRA 1IQGA 3L3TA 2WINI 2ZIQH 2XBYA 1NY22 4FOUC 5EOKA 2NU1E 5E0GA 2WSSD 1QL9A 6GCHG 1BMAA 3AAVA 3EA8A 1CHGA 1P04A 1P8VC 2ZDMA 3IITA 5HYOA 1WAYB 1EASA 2VIWA 2PUQH 3MNXA 3LKWA 3NCLA 4Y0YE 2QF0A 1TRNA 2THFB 1EJAA 1HIAB 1MBMA 1QBOA 3SGAE 1FY8E 2FESH 1PPCE 1DX5M 2UUJB 3CNRA 3SJOA 3N7EA 5FX5A 3STJA 1UMAH 1ZGIA 3S69A 1AUTC 2F9PA 3DSPA 3UAIC 1BITA 4ZKSU 4WH8A 2GV7A 3PO1C 4I32A 3SNAA 4WMEA 1YY3A 3OU0A 5CHBA 5T6GA 1OP2A 7LPRA 4X6PA 1BMMH 1W0JD 2EC9H 2HWLB 4B1TA 1O38A 3RXBA 1P9SA 2BD3A 3E1XB 4WY3A 4ZMAH 5ABWA 1C2GA 1C1PA 4B6FA 1DM4B 3LGWA 1HUTH 4I86A 1LMWB 5ESBA 1SMFE 4Y7BA 1GHBF 1L1GA 3K65B 1IQKA 4MNVA 2OBQA 3P95A 4AOQA 1A3BH 2SNVA 4K60A 2KAIB 1ORFA 3SUFA 1TPSA 3GCHC 1KTTB 1P01A 4Y8XA 3V7TA 5TCAA 1QL8A 3HPTB 1CHOF 3BEUA 4HFPB 1TNJA 4MQAA 1YGCH 1AZ8A 1IQIA 1GI6A 1RS0A 1TX6A 2L74A 4R0IA 1PPHE 1W7GH 3K6YA 3PLPA 1IQHA 2HVYB 1Y3XA 5A09A 1C1OA 2QAAA 6CHAB 1SGDE 3SUGA 3SU0A 1CHOG 1KY9A 1S5SA 3BEIB 1V2JT 4K69A 1TB6H 4YXWD 1GHZA 4OS6A 3PTBA 3ZZ3A 2Y7ZA 1FONA 2A5AA 1C5ZB 2QGRA 3PM3A 2G52A 1PQ5A 3MNBA 4CBOA 3BTDE 3ZVGA 1DWBH 4AFUA 1RXPA 1UVSH 1ELGA 1DT2A 3GY2A 1UTQA 1C5OH 1ZLRA 2FP7B 4O9VA 3TVJB 5EW1H 4GHQA 5DP9A 3K2UA 4FUBA 1DSTA 4Q7ZA 4JYTA 3H09A 4J2YB 3MYWA 1CGHA 1GPZA 1GDQA 4ABGA 4K1SA 2ODPA 3MO3A 3HATH 2ULLA 1ZHRA 1YP9A 4I8GA 2C3SA 1DUAA 1IQEA 4NSYA 1O3DA 3EQ0H 1MZDA 1JRTA 2ZHQH 3M7QA 1A3EH 1O2SA 4NIYA 1EP6A 4X2VA 4FUIA 1MKXH 1O3PB 2ZEBA 4AN7A 3G01A 4BXSA 1GMHF 2V3HH 4NWLA 1HAXB 4YOIA 1IQLA 2Q6DA 5C1XA 1GJAB 1C1UH 4IC5A 5PTPA 4D7GA 4XDEA 3A81A 3Q76A 1SGFA 1SQTA 1ELCA 1JMOH 2PW8H 1AFQC 2Z3EA 3UTUH 2OCVB 1TA6A 1C5QA 1HXEH 1RTFB 2UWPA 1C2DA 3UNRA 3N99A 1TPAE 4NIWA 4JK5A 1EKBB 1ZMNA 2ZU5A 5HM2A 2QXIA 1J16A 4IW4E 4NZQA 1G32B 3NWUA 1Y5BT 4UFFH 1IOEA 1V2MT 3MNCA 3AVZA 3LONA 1O0DH 1ZJKA 3QZQA 4B2CA 2W7UA 2FOFA 1OXGA 4TT3D 2BDGA 1W0ZU 2KX4A 2ANKH 3AASA 1P0SH 1FV9A 1XUJA 1VITF 4TY7A 4ABEA 1G2MA 2ESTE 9ESTA 3OE7D 1FIZA 3QTVH 4FVDA 4VGCC 1O34A 5E2OA 3R0FA 4D8NA 3A80A 3MOCA 4LOYH 2BTCE 5HIZA 3OY6U 1HRTH 1VITG 4THNH 3GY8A 1FX0B 1MKWK 3SNBA 1TBRH 1LTOA 1TOMH 1HAGE 4F55A 1XVOA 2J9NA 1C5RA 2P8OB 3PLKA 2BDIA 1LKAA 1TGNA 3SNEA 4Q63A 1C2JA 5EU8A 1GI5A 2AHME 2TGPZ 1ANDA 1V2KT 3U9AH 1NBMD 2FTLE 1GBAA 1TA2A 3CS7A 2QV1A 4OM9A 2XNDD 3FZDA 3F2HA 1BBRH 1KMHB 2A45B 3BEFB 5BPEA 2HNTE 3TJVA 2QIQA 3DHKH 3RU4D 4AG1A 5FHTA 2PV9B 2WUBA 4I31A 1LHFH 1RIWB 1VJAU 2FEQH 1GBMA 3QO6A 3RC4A 4CH8B 1SC8U 4IMQA 3MU4A 1FPCH 3OY5U 3ZZAA 3LGYA 1DWEH 4K1TA 1UTMA 2A0QB 3ZV9A 1E0FD 1UK2A 4YT6H 4X2WA 1ELTA 4KTCA 1A5GH 1GJ9B 2BZAA 1IAUA 2SFAA 1TGCA 4JYUH 3QK1A 1AUJA 5FPYA 1O2WA 4CR9A 3T62A 5FCKA 4F48B 1QB9A 2UUFB 1O3AA 3SHAH 1BTWA 1O3HA 3UOUA 4I8LA 3S9AA 1GJDB 2FODA 2GZ8A 3RXVA 4X8SH 1FZZA 5JB8S 3EE7A 1EAUA 5LGOA 2FS8A 2DE8A
chains in the Genus database with same CATH topology
4X2XA 2Y6TA 2ZF0H 2P3FH 2ZFQH 5DKMA 1A61H 1P2JA 4K8BA 4A7IB 1D3PB 1Z71A 1UCYE 2UUYA 2F9VA 4RKJB 4Z0KA 5JBTA 3RP2A 5GCHF 1ZPBA 1Y59T 2FS9A 1B5GH 1DPOA 3URCA 1N6YA 2F9OA 2IOTA 3QWCH 4AX9H 2TBSA 4D9RA 1ZMLA 2ZU2A 1SGNE 2BLWA 3FAOA 3KCGH 4LXBH 3TITA 4CBNA 3KN2A 4FU7A 1NTPA 2C4FH 3LIWA 1THPB 1W14U 5C3NA 1GVLA 1N6XA 4JZDH 5L30H 5E0JA 3UWJH 5F6MA 5T6DA 4DW2U 3SV9A 1AVGH 2ZHWH 1LHEH 5A8ZA 5FXLA 1TMUH 3ZVEA 3DFLA 5C20A 4FUHA 1C1SA 4LZ1H 3MI4A 1UCYH 4TWWA 1NFYA 2VGCB 3M7UA 1HJ8A 4JCNA 1AFEH 4INLA 4FUCA 5A8XA 1TX8A 6CHAC 3A85A 3SU5A 1O5CB 2CHAB 3D62A 2F9UA 1HJAB 1ZTLA 1HIAA 3S9BA 3B9FH 3SOSA 1F0UA 1NFUA 1GDUA 8GCHG 2QA9E 5FAHA 3GY6A 3TIUA 1G3CA 2BD8A 1ZJDA 4UFDH 2HLCA 1TLDA 2FOMB 2H9HA 4XSKU 4FVBA 2XC5A 9LPRA 1BTHH 3ZZ8A 2FDAA 3TU7H 1D3TB 4XOJA 1EOLA 2FXRA 4ABBA 3K9XB 4BAMB 1EZSC 2OINA 2R0LA 1ACBE 1FJSA 1GG6B 4BTUB 2AFQB 1TOCB 1Q2WA 3VB4A 4GLYA 1W13U 1F0SA 1G2LA 3M5LA 3U98H 4YTAA 1FI8A 1FQ3A 2RG3A 3RXQA 3S9CA 2BY7X 4Y11E 5EODA 2F91A 4WF8A 2ZGJA 1XKBC 3T26A 4B76A 1NT1A 3SJ9A 3TH2H 1OSSA 1FIWA 4ISLA 4GCHF 2FI3E 8KME2 1UTJA 1FN6A 2KAIA 1S85A 5B6OA 3E0NB 5FPTA 1W12U 1LQEA 1Y3UA 4YOJA 4X6MA 3VB5A 1RTKA 2ZFSA 4GCHG 3KGPA 3P92A 1EJMA 1GHVH 1AU8A 1P12E 1THSH 2EEKA 1NPMA 4NA7A 1C9PA 1GI9B 1S81A 1SLXB 4FUJA 1BTUA 1MAXA 1MTNB 1KLJH 3BTGE 1V6DA 1H4WA 3RMMH 1ANBA 2Y5GA 1JOUB 1QA0A 1CVWH 3QGNB 3RXLA 3M61U 4HTCH 2VIQA 2FX4A 2AYWA 3A89A 2EA3A 4DGJA 4ZXXH 5DG6A 1AWFH 3QUMP 1DANH 1JBUH 1VITH 3FP7E 2WPHS 1ZTJA 2H9TH 1X7AC 4X6NA 2F9NA 1O2LA 1DUEA 1TNLA 4JK6A 2XBVA 4K3JA 4FUFA 2OC0A 4OS1A 2GGVB 1ZHMA 2C8XB 1TRYA 3C27B 4ESTE 1MUEB 3P8OA 2YNBA 1DXPA 5JPMH 2RCEA 1QRWA 2PTCE 1GGDB 2BX4A 1YC0A 1YCPK 2XWBI 1SOTA 2FYQA 2WV5A 3TH4H 1SOZA 1XUIA 2NWNA 2VJ1A 1P2OA 1A7SA 3SU2A 3MH5A 4U30A 3F9EA 1OP0A 3JZ2B 3R3GB 1SQOA 1SSXA 4X8VH 2F3CE 4RSPA 1TONA 2P8OC 1HJ9A 3DD2H 1MCTA 3RXGA 2AERH 2FLBH 3JZ1B 4R8TB 4TPIZ 5I25A 1GJ7B 2A2XH 2PSXA 3NPSA 3LDXH 5HXFA 3VFEA 3GOVB 3M5MA 1P02A 1ESAA 2QC2A 3DUXH 4B2BA 1D4PB 3MFJA 3SORA 1HAYB 1INCA 2FWWA 1BJUA 2YOLA 1EOJA 1O31A 1O3GA 2IJOB 2WUCA 1MU8B 4X1SU 2G55A 1WYKA 4FXGH 4O3UA 4WMDA 3OTJE 1SFIA 1RIWC 2C8WB 2WYGA 3A88A 4TPYA 2B5TB 3U69H 5A0CA 2A5KA 2Q1JA 3GYMA 2A7CA 3A7YA 4HI3A 2RDLA 2PFEA 2GZ9A 2WPLS 1AVWA 1GBBA 1TYNA 1A46H 1J8AA 4F49A 1NFXA 3Q3KA 2OQ5A 1WTHD 1ZOMA 2VINA 1GHXH 2FZZA 2TRMA 3F6UH 2R2WU 7GCHG 1TPPA 3SW2B 2G00A 5ESTE 1TGSZ 2SGFE 1QRZA 1GBKA 1GHAF 3FFGA 4IN1A 5A8YA 2ZFTA 2AS9A 4TYDA 4JZFH 2FOEA 2FOHA 2ZKSA 2XRCA 3SQHE 1QGFA 1C4Y2 3NXPA 2HNTC 5FPSA 1TNKA 2H5DA 1UO6A 1CA0B 1SGTA 1YM0A 3LGTA 3LC3A 1XXFA 2J38A 1GI8B 2BDHA 4NSVA 1AIXH 1VJ9U 2VIDA 2ZU3A 2V6NA 1ZPCA 1CBWB 2B9LA 1SGIB 1ELDE 1H8IH 1MTVA 1NC6A 1SGEE 5T6FA 1TMBH 4LZ4B 1DVAH 3ZVDA 1W2KH 1P2MA 4U2WA 3KEEA 1T8OA 4RN6A 1KXAA 1SBWA 3PMAB 1KXCA 1KTSB 3VB3A 1CU1A 1PQ7A 2Z6BD 4CHAB 1MKWH 3SZNA 4UEHH 4XBDA 2PWXA 3RXHA 2GZ7A 1LDTT 1AVXA 1PPFE 1V2NT 2C8ZB 2GCTB 1K22H 2QXGA 4HGCA 1LVMA 2VGCC 2P3UB 4B75A 1F92A 4ZH8A 3UPEA 3FVFB 5EW2H 1ABJH 4O03A 3VEQB 1BB0B 1J15A 1SG8B 5A0AE 3RXCA 1YPHE 3MO6A 2B7DH 1HJAC 4ABFA 4Q7YA 1GMCF 3GICB 1J9CH 2OTVA 2ZHEH 1JIRA 4DY7B 3SNDA 3BSQA 3LGUA 1G37A 1T4UH 3RLYH 2WPKS 2XCFA 1GJ8B 1DY9A 1SGCA 4Y6DA 1EUFA 1MTWA 1L2EA 1GHBG 3TJOA 1AKSB 3TK6A 1C2HA 1D9IA 3GY7A 5I46H 8ESTE 1NRPH 1MTSA 4GSOA 1QR3E 3EA7A 2ZNKH 3UFAA 2BD9A 3ZVCA 3TGIE 2ZC9H 4DURA 5J4QA 1TGBA 2ZDLA 1LVOA 3RXUA 4XBCA 2ZDAH 3EAJA 4GVUA 3C1KA 1AMHA 1UHBB 1BRCE 3KNXA 1C2EA 1DDJA 3TLOA 1FUJA 2BOKA 2CF8H 3BTME 3LH3A 4YESB 3T5FH 1GL1A 2R3UA 2BD2A 2BQ6B 2O8LA 1K1PA 2A7JA 5E0HA 1QA7A 2OP9A 3B23B 3BTTE 1H9HE 1UVUH 1OX1A 1O5BB 1ANEA 1YLCA 1BQYA 2ODQA 1K28D 1QURH 1V2TT 4IS5A 2Z9GA 1PPBH 1MCVA 2QCYA 3RXTA 5E2PA 3AW0A 3SO3A 1MQ5A 2H2ZA 1MTNC 4SGBE 4TY6A 2P3TB 4MG3A 1G3EA 2BY8X 4MTBA 5F8TA 4ABDA 5LPEA 3VB7A 2XCNA 2ZP0H 2LPRA 5JBBS 3FP6E 1P3EA 3LOXA 3BG4B 2BD7A 1KDQA 4JZ1A 1NN6A 2Y7XA 4MPXA 1P9UA 3SJ8A 4YO9A 1E37B 1CT2E 3ZVFA 1BRBE 3M37A 1ELVA 4AYVB 1D6RA 1GMHG 4INKA 3NKKA 1Y3VA 1TBQH 3BTHE 3GISB 4JMYA 1GGDC 1GI7B 3QN7A 4NFFA 5AHGH 3K6ZA 3SV7A 1VR1H 3TH3H 1EJNA 2VIVA 1U6QA 1PJPA 1ZRKA 2BX3A 4ZAEA 1YPLH 2FPZA 4GUXA 3OX7U 5CHAB 1LQDB 1GWAA 1SGYE 4YOGA 1GCTB 2OC8A 5JYIA 4Z6AH 2FYRA 4J1YA 4SGAE 2NU4E 3RXSA 3UNQA 2W5EA 2D1JA 5G4BA 2TPIZ 1O2MA 1BCUH 1TNIA 3A87A 5FX6A 2BY9X 1QQUA 4BAOB 2H9EH 1C1WH 2FO9A 1K2I1 4U32A 4JYVH 1PPEE 4I8KA 1QBVH 3T25A 1O32A 4YT7H 4H4FA 1RRKA 3BTQE 4MNYA 3KL6A 1C2KA 2ZGCA 1PQAA 3V13A 2PGBB 1TMTH 1P2NA 1BIOA 1OYTH 1MZAA 1GBDA 4K2YA 3ZZ5A 1TIOA 2VWNA 1O2NA 3M36A 4WXVA 5J4SA 2HRVA 4Y8ZA 1VCPA 3D65E 2XTTB 2BD5A 5F8XA 5EXMA 1V2LT 1OPHB 2BYAX 1XUFA 3F9HA 4Y10E 1O5EH 1Z1IA 1DLKB 5HM9A 1UK3A 1DS2E 2ZU1A 6LPRA 1WQVH 1FY4A 4B74A 2Z3DA 1O2TA 1UTPA 2ANMH 4INHA 4MPWA 2P59A 2ZQ1A 1YPMH 2ANWA 1IHSH 1A0HB 5A0BA 1Y5AT 3E91A 2Y81A 2G81E 4BOHA 1OWEA 2OLGA 1SFQB 2TGDA 1ID5H 1CA0C 5DP6A 1HPGA 2QXJA 4X1PU 3WY8A 3OSYA 4KELA 3UQOA 1O2IA 1MD7A 1BMLA 4XE4A 2A4OA 1BA8B 4WVPE 1W11U 4NA9H 1CBWC 1RD3B 4X1NU 1TQ7B 1TGTA 2ZFPH 3QX5H 3VPKA 1HDTH 1Y3WA 4DOQA 3F1SB 4AB8A 1YCPH 1B0EA 5LPRA 1KXFA 1OYQA 1CSOE 1PFXC 3MWIU 3TNTA 2Y5HA 1Z6EA 1O2GH 1SPJA 2ZCHP 2VNTA 2ZFRH 1D3QB 2G8TA 2W7SA 4CHAC 4D9QA 5HMAA 3MH6A 4ZXYH 4AG2A 3ZZ9A 2SGEE 3RXFA 2GX4A 3M5OA 1XM1A 1T8NA 2R9PA 2GCTC 4QT8C 2WPMS 1WSSH 1VGCB 3GCTF 5FCRA 1H9LB 1ZSLA 4O3TA 1PPGE 3TNSA 1MH0A 1QJ7B 2B0FA 1AQ7A 4WWYA 1NU7B 2PKAB 1EATA 1ZTKA 1GMDF 4U01A 5GCHG 3UWIA 1DITH 2XWAA 1ETRH 3RUOA 1WBGB 1YYY1 1TPOA 1ZSJA 2FI5E 3RXJA 1QRXA 2FOGA 1KIGH 3GCNA 2C93B 1S0RA 1GBJA 4ABAA 3EE0B 3U1JB 1XX9A 3PYHA 1SGQE 4PROA 2VH6A 1KLTA 2HGTH 3SV6A 3SQEE 1Z7KA 3SNCA 1XMNB 1YPKH 4X1RU 3GY4A 4DT7B 4KP0A 1EX3A 1N1LA 4Y0ZE 4E7RG 4NFEA 1L0ZA 1ZYOA 4MDSA 2J2UA 3VXEH 4B71A 3PO1B 4DIIH 4H42U 1YF4A 1JXPA 3MU1A 2H6MA 1F5KU 2BVSH 2BLVA 2VVCA 1CO7E 3KQDA 1Y3YA 2V3OH 1CT0E 2ZQ2A 3QDZB 4ABJA 1FMGA 3A8AA 1KDQB 1SB1H 1C1VH 2XW9A 1ETSH 2DUCA 1GBIA 3HK3B 4DIHH 1YPHC 2BDCA 1G36A 7KMEH 1BJVA 1EAWA 1T8MA 2J92A 4Y8YA 4NIXA 3SU3A 1DWCH 3MU0A 5SGAE 2Z9JA 2R0KA 3GCHB 4X8UH 1V2PT 1HFDA 2WYJA 4IBLH 2BHGA 1GI1A 2HOBA 4KTUA 3PB1E 4A92A 1NFWA 1YCPM 6ESTA 1V2VT 2VU8E 1TAWA 2BMGB 2OC7A 1P03A 2SGAA 1T32A 1OOKB 1K9OE 4E7NA 4BAQB 2DE9A 1BTPA 1O3BA 1E38B 1H8DH 1C4V2 2ZG0H 1WQSA 3BG4C 3B8JA 2SGPE 1AKSA 2Y5FA 3MH7A 3UOPA 4BXWA 5C5NA 4UFEH 5HGGA 3MMGA 3PMBB 3RXEA 2ZGXH 2RA3A 2P94A 3MTYA 1O3EA 2D26C 3GDUA 1ZRBA 3OYPA 1AD8H 2OXSA 3D23A 5F8ZA 1F7ZA 3BG8A 1EZUC 3A83A 1E34B 1GDNA 4F4OC 3ATMA 2Z9KA 2ZFFH 3U8OH 2F9BH 3CENA 1LVYA 3F68H 3LGIA 1NRSH 4ZKRU 1UHBA 2TGTA 3SGBE 5BRRE 3M5NA 1O30A 1MTUA 1C4U2 2AMPA 2NU3E 3VGCB 4DVAU 5CHAC 5GWZA 2ODYB 1O2UA 1C5MD 4KTSA 1GCTC 4I8HA 5DJ7A 1QL7A 4ZKOU 3KF2A 3A82A 1ELFA 4FUGA 1SVPA 1ZSKA 2BDYA 3TK9A 1GHWH 4DJZB 2BOHB 1OWDA 1O2JA 3IG6B 4AZ2B 3SJIA 4XFQA 3L6PA 5AVDA 1KSNA 1Z8GA 3M3TA 1JRSA 3ZZDA 1ZPZA 2GTBA 1AB9B 3FANA 1IHTH 3NK8A 3UY9A 2FI4E 1S82A 1YPGH 1QB6A 3BIVH 3QTOH 1O3CA 2BLOA 3NZIA 1ZZZA 2M5TA 1HAIH 2J34A 1C1TA 2BDAA 1EAIA 3IWMA 4O97A 3RMOH 1C2MA 1C1NA 1EXFA 1G9IE 4K8YA 1QHRB 3UR9A 2NU2E 2OBOA 4I8JA 4M7GA 2GP9B 3EA9A 3A8DA 2IPHA 1F5LA 2C90B 3DT0H 4MNXA 2H1UA 4I33A 4BAKB 1LKBA 4JZEH 2G5VA 1TRMA 4A6LA 2PSYA 3A8BA 3STIA 1BOQA 1TBZH 1MBQA 4ABIA 3O8CA 2W3KA 1KXBA 2ZPRA 3A84A 1KLIH 2H5CA 3RU4E 2QY0B 2FOCA 2FOBA 5TCCA 1O2VA 2VWLA 1O35A 1O3OA 5C1UA 5DGJA 1AWHB 2STBE 2V0BA 4XBBA 4VGCB 2HPPH 1L4DA 1HB0B 2PGQB 4HZHA 5GIBA 2ZA5A 3RM2H 2GT8A 2Y80A 2ANYA 1D3DB 1UTNA 4MLFB 1HAHH 4ABHA 3M3SA 1S0QA 1F2SE 1BHXB 1E36B 4OGYA 4OS5A 3T29A 5JBCS 2BVRH 1K1NA 1P2KA 3ITIA 1Q31A 5ETXA 4CRFA 1BZXE 5C2ZA 5GPIB 3MH4A 4OS4A 1C5SA 1Z1JA 4BTIB 1GHAG 3UNSA 2Z9IA 1ZR0A 2G51A 1N8OB 5TJXA 2ZTZA 4Q80A 3RMLH 3M7TA 3HK6B 3S7KB 1LVBA 1VGCC 2P93A 1O5DH 2OQUA 1O2YA 3E8LA 1K1OA 1QJ6B 4ISOA 1G3DA 3T2NA 3P70B 1GVZA 6GCHF 4E05H 1GBCA 5T3HA 2BXTH 4YZUA 4X8TH 5FBIA 2EI6A 2AMQA 3BN9A 1AY6H 1LPGB 1FNIA 1P3CA 2AH4X 2GCHF 1EAXA 1GJBB 2SGDE 2Y82A 2ZTXA 1GCDA 2J4IA 5CE1A 3BTKE 2VIPA 1FY1A 1TNHA 4NIVA