3RXGA

Crystal structure of trypsin complexed with 4-aminocyclohexanol
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxgA02
2ZGJA 5A8YA 2TGDA 4VGCB 2CJIA 3E6PH 3RXEA 5JBBS 3MI4A 2ZI2H 3ESTA 3ODDA 1GHZA 1TALA 1O3HA 3MTYA 3ATKA 3P8FA 2ODPA 1GCDA 1H9HE 4NIWA 1O34A 2FI4E 1P3CA 2GCTB 3TIUA 1VCPA 2ANWA 2PV9B 1TRMA 1Z7KA 1DOJA 3RXFA 8GCHG 2J94A 5GPIB 1NN6A 1DM4B 1H9IE 1EUFA 2A1DB 3GCHC 3KIDU 3VXFH 2F9PA 4I8LA 1K9OE 3BG8A 1SI5H 3MH7A 1S81A 1PFXC 4KTCA 1QGFA 5FCKA 4K1EA 3UNRA 2DE8A 3UUZA 1JIMA 2BHGA 4Y10E 1XUJA 3JZ2B 1FN6A 1QQ4A 3BIVH 1UK4A 1ZJDA 2ZTXA 2A5KA 1JRSA 1P2IA 4MTBA 1BBRK 1MUEB 3UFAA 3GISB 2WV5A 3A8DA 4TPIZ 3GDVA 3HGNA 1H8IH 4HZHA 4D7GA 1Y5UT 5EU8A 3DT0H 4DG4A 4JMYA 4MNYA 2R3YA 1TX7A 1AHTH 2XBWA 4ZHMU 1O3FA 5A8ZA 1KXFA 1ZGIA 4Y7BA 1SGQE 3NKKA 1UTMA 3VGCC 1T8OA 2BMGB 4B74A 2BLWA 3GOVB 1ID5H 3HKJB 1TONA 4JYVH 2Z3EA 1NRRH 1O0DH 1C5WB 1THSH 2FPZA 4JZFH 1O2NA 2A4OA 1CGJE 5JBCS 1BCUH 1EP6A 3LPRA 4RKJB 1GJ7B 1AGJA 2G4UA 3A87A 2O8WA 3SNEA 4Z6AH 3SV8A 4RKOB 3T25A 4AG2A 2BDBA 4MNXA 3Q3XA 1KTSB 4Y8ZA 3T5FH 1A3BH 4NIXA 1SGYE 2Q1JA 2G5VA 3RXAA 3S0NA 3QTOH 3GY8A 1LO6A 7GCHF 3O8DA 1QJ1B 4YLQH 5C20A 3RM0H 5K0HA 2GD4B 2THFB 3F1SB 2ZCLP 1QJ7B 1GDUA 3A81A 3L3TA 2PLXA 2ZU5A 1GHYH 1BOQA 2A5IA 3LGVA 3SNBA 3GYMA 5GIBA 2TBSA 4FU7A 2ZGHA 2G8TA 3FZZA 5AVDA 1T8MA 2Y6TA 1ZZZA 1A1RA 4JYTA 4UD9H 1O2MA 2XYAA 1Y3WA 1XUGA 1IHTH 1XVMA 3MWIU 1ZOMA 2WUBA 2BLQA 1BRAA 3TGJE 4AYYB 3PWCA 3F9FA 3A8BA 2XBVA 1HAYB 1L1GA 4DURA 1SLUB 2GZ8A 5G4BA 5EW1H 2NU0E 4IGDA 3BG4C 1EAUA 1GI9B 1PQAA 2OQ5A 1TGNA 2ZU1A 3AAVA 2Z9JA 1ESBA 2VGCB 4UFGH 1F5RA 1QBVH 2EI6A 3PMHB 4I8HA 5E0GA 3SI3H 2XNIA 4TYDA 3UNQA 3MMGA 1ANDA 4D7FA 3ZYEA 3O8RA 3SV7A 1NFUA 5C1YA 2OC0A 2P59A 1G36A 1ELBA 1NPMA 1SGPE 3BEFB 2ZPSA 4FUCA 2ZGXH 1MKXK 2QF3A 1E37B 2ZDLA 1B5GH 2CMYA 5DPAA 2W7SA 7KMEH 1S82A 1PQ5A 2A2XH 2AERH 2BVSH 3PTNA 1OOKB 2FI3E 1KXBA 1UVPA 3A83A 1KDQB 1GBFA 2VWNA 3SZNA 3OY6U 3Q3KA 4K69A 3JZ1B 1DFPA 2ZHQH 1C5LH 2HALA 2VIOA 3ATMA 3PMJA 1W13U 1W0ZU 4AYVB 3Q76A 4Q2KA 3QGJA 4Y11E 5EXLA 3MOCA 2W7UA 4X0WU 1LDTT 3ZV8A 3RLWH 2B5TB 1ETTH 5DP4A 2GMTB 1DT2A 1TAWA 2AEIH 4GCHF 1K1LA 4BAOB 1OWDA 2G5NA 1UO6A 2WPMS 1DXWA 1O2IA 1EJMA 4Q80A 3SU2A 1JOUB 3SU3A 1O3JA 1CVWH 1HAHH 5AHGH 2BD7A 3QGNB 3RXVA 3A7YA 1N6YA 3BN9A 1GGDB 1H1BA 4BTTB 4IW4E 2G52A 4DJZB 4X6MA 5LPEA 1CE5A 2YOLA 1HJAB 1W0YH 1SVPA 1YCPH 3GICB 1MU8B 3VB3A 1BRUP 1Q3XA 4GUXA 1C1RA 3ZV9A 2ZFSA 1D3QB 1QCPA 1SBWA 5CMXH 3ZZ4A 2BDHA 1EAWA 3CP7A 4B2AA 2VIPA 1QL8A 1TPSA 2W3KA 1F0UA 2OXSA 2QXHA 5TCCA 2H6MA 5FBEA 1L4ZA 3ENSB 3NPSA 1S84A 4HI3A 1KYNA 1XX9A 1WAYB 3A7XA 4JZEH 5F8ZA 2O8UA 4K5ZA 1T4VH 5EG4A 1FJSA 1O5FH 1K22H 3U9AH 4JK6A 1LPZB 4OS5A 1FPHH 1GDNA 1RFNA 4YT6H 2PW8H 2A0QB 5B6OA 1GBCA 4ABDA 2C8XB 2BDIA 4ESTE 1KSNA 4RN6A 1ZHMA 2BXUH 5EXNA 5C1XA 1K1MA 1HB0B 2ZPQA 1E36B 3P17H 3W95A 1N1LA 1Z1JA 4LXBH 4AZ2B 3SOSA 1UVUH 5L6NH 6ESTA 1RGQA 2ZG0H 3M3VA 1J15A 2D2DA 3TK6A 3E3TA 4F49A 2FS9A 2OC1A 4GHQA 2SNWA 1MZDA 3STJA 1NS3A 1BTWA 1OWIA 2ANKH 1AVWA 5EQSA 1GBEA 2A31A 3S9AA 4B76A 1TNIA 2ODYB 1Z8JB 2R2WU 1C1UH 2QAAA 3LOXA 4X2YA 4YM9A 1UK2A 1WUNH 2OBQA 2OUAA 2ZTYA 4FU9A 2G51A 4K2YA 4BAHB 4BANB 1DICA 4NFFA 1DUEA 1S5SA 1XKBC 1GMHG 1V6DA 1B0EA 3KHVA 2ZHFH 1C9PA 3DHKH 3AAUA 1QJ6B 3MU1A 2UWPA 2ILNA 3LH3A 3AASA 1V2WT 3PB1E 1EZSC 2FIRH 1AKSA 1PJPA 2HLCA 3TH2H 4A6LA 4CBOA 1HIAB 4D8NA 1LQEA 1CO7E 3BTDE 1O3EA 1C2FA 3RXTA 1ACBE 5T6GA 2EC9H 1Y3YA 4THNH 1SGFG 4AGKA 3A89A 3LC3A 3UWIA 1YLCA 3TJVA 5L2ZH 1GJ6A 4A7IB 1AO5A 3MH4A 4ZROA 2BM2A 1P9UA 2AMDA 3HK6B 4X6PA 1DY8A 2GCHF 1UMAH 2PFEA 1TNLA 3MU5A 3PV4A 1O31A 5EODA 3MHWU 1CT4E 1HRTH 5CE1A 1BJVA 3BF6H 2F9VA 2AH4X 3M61U 2GTBA 2WPIS 4DW2U 2CHAB 5GCHG 1MKXH 1W14U 5C2ZA 4H6SB 2CGAA 2PKAA 1SGNE 1X7AC 1TFXA 3HKIB 4FU8A 1ARBA 2ZQ1A 1F5LA 2OQUA 1OXGA 1SFIA 1MZAA 3KQBA 1AZZA 1K21H 3QDZB 1PPHE 1D9IA 1V3XA 1P04A 3LGYA 3M5NA 1O3BA 3EE0B 1O3OA 2PKAB 1DSTA 2OLGA 5HM2A 1RD3B 1G30B 1EKBB 2JETC 3NWUA 1UJ1A 3RXBA 6CHAC 3GY7A 4GPGA 1AVGH 1TX6A 4INKA 2GCTC 1KXAA 5FAHA 2FDAA 1IQNA 3KN2A 1SLWB 3HGPA 1FAKH 1LHCH 1EXFA 1LCYA 3VB7A 2BY9X 4MQAA 3IG6B 1OWJA 2RCEA 1JIRA 2PUXB 1TQ7B 1O2VA 1GJ8B 1HGTH 2FX6A 1YPHC 2QN5T 4SGBE 1MTWA 3I77A 4DVAU 1O3NA 2QF0A 1UK3A 3ZVEA 1Q31A 1DWCH 3F9GA 1G32B 1Y8TA 3SJOA 3GY5A 1MD7A 1C2LA 1PQ8A 1ANBA 1O2PA 1QRWA 1SGDE 2GV6A 3SUGA 1TQ0B 1O3LA 4B2CA 1ZMLA 2ZCKP 3D23A 5IYTA 1UCYE 6LPRA 1QIXB 4JCNA 1AVXA 1EZXC 1OYTH 2BD3A 2O8TA 1LVBA 1GL1A 3ZVGA 2H9EH 1EPTB 3M37A 1FPCH 1O2LA 1TOCB 1GMDF 1NRQH 5JB9S 1GBDA 2NU4E 3M7QA 1SFQB 4F4OC 5DJ7A 1V2UT 3UTUH 3DFJA 2ZHEH 4WH8A 1HAXB 2P3UB 2FOMB 8KME2 4NG9H 1FV9A 1QURH 2FZZA 4U32A 1ELDE 1EJAA 5HGGA 5TJXA 4E06H 3IWMA 2M5TA 2Y7ZA 2O8MA 1TGTA 2TPIZ 3M3SA 3SU0A 1GBBA 1RRKA 1XUIA 2GKVE 2H5CA 3GY3A 3SU1A 1HBTH 4BXSA 3BTEE 5GWZA 1VITH 1P11E 1Y5AT 7GCHG 1YCPK 4I8JA 1Z6EA 2VGCC 2BD5A 3ZVFA 2CF9H 1GMDG 3RXKA 4A5TS 1WQVH 1JWTA 2F83A 3SUDA 2QYIA 1HFDA 2SGAA 4ASHA 4YESB 1F0RA 2XRCA 1XUKA 5C5NA 1FIZA 4YO9A 3ZZ5A 5JB8S 2R3UA 3LGIA 1C2MA 4MNWA 1S6FA 1UVTH 1ELAA 4WMDA 1DX5M 2CXVA 1Y59T 1HXEH 1PPEE 3NCLA 1O35A 5DGJA 3VB4A 1G2MA 1C5NH 1CHOG 3BTKE 4U01A 6GCHF 2BOKA 1SMFE 2ALVA 3FFGA 5H4IB 4GSOA 3UPEA 2FXRA 4CRDA 1DDJA 2BTCE 2WUCA 1BTZA 2P95A 4MDSA 1QB1A 4JZDH 3KGPA 1LKAA 3RP2A 2G4TA 2AGEX 2XCNA 5E2OA 2A32A 1O33A 4Y0YE 1MQ6A 2Q6DA 1AWHB 1AFQB 4OS1A 1BTUA 1FN8A 1EPTC 4BTUB 1PPGE 2QGRA 1FXYA 4D76A 2TGPZ 3GCHB 2H1UA 1CBWC 3A80A 1SLXB 4FUHA 5E0JA 1SQOA 4FVDA 4AN7A 5JPMH 2P93A 1GBMA 1O30A 1DS2E 3SBKA 1OYQA 3LH1A 1IQEA 3SV9A 2JETB 2O8LA 3D49H 3DA9B 1NESE 2WPKS 2ZHWH 1IAUA 1EASA 2BVRH 2BD4A 1BMMH 1GJBB 1HAOH 3SU5A 2G00A 5EGMA 1KXEA 1YPEH 2D26C 4ISIH 3ITIA 3RU4T 2C93B 2ZDVH 1QB9A 1FLEE 2FLBH 4B73A 1O2JA 1VGCC 4ZH8A 1GHAG 2GDEH 4H6TA 2OP9A 3A82A 1K28D 1SOTA 4YOJA 5HM9A 3A7WA 1MKWH 1GI6A 3O8BA 2ZFPH 1RJXB 1O36A 3TNSA 4X8VH 3BTHE 5AFYH 1BTXA 3MU8A 1PPCE 2ZF0H 1O2ZA 4ABFA 1VZQH 5F03A 3RXHA 1YPKH 1K1IA 4IC6A 2PTNA 2B8OH 1J16A 1LQDB 2GP9B 1BUIA 4Q7XA 4WXIA 1Q2WA 2B0FA 1AN1E 4TY6A 3TK9A 2QIQA 1NRPH 3BTGE 4I7YH 2OC7A 2I6SA 1O3AA 1TNHA 4TWWA 2SNVA 1RS0A 2BVXH 5FCRA 4B1TA 3SGQE 1GI4A 4ZKRU 4HTCH 4DIHH 1AUJA 3T27A 2PGQB 1L4DA 1ZR0A 2J38A 1HDTH 1BA8B 1DWDH 1OPHB 1S83A 1YKTA 4WY3A 3MNXA 4SGAE 3LKWA 1GWAA 5A09A 1P12E 2FOAA 2Z9IA 2Z9GA 2JH0D 1RTFB 4K1SA 3VB6A 2BB4A 4X2VA 2Z3DA 1DWEH 4GLYA 3S9BA 3ZZCA 1DITH 1Y3UA 5EQRA 4BNRA 2A7HA 1NU9A 1XM1A 2FESH 2ZO3H 1JRTA 2FS8A 1VJ9U 1C5VA 4I8GA 5ESBA 1IQHA 2PKSC 4AX9H 2J92A 2Y5HA 3SGBE 4CR5A 1GMCG 2GZ7A 1NTPA 2BD9A 3A7VA 2HNTF 1BJUA 4Q7YA 1GBJA 2OCVB 1W11U 4YZUA 1T7CA 3VFEA 1UCYH 3MYWA 2ESTE 2BDGA 3ATIA 1UTKA 2H9HA 1Z8RA 3SI4H 2UWOA 1NY22 4LZ1H 2ZA5A 1CGIE 5A0CA 1XVOA 3GY6A 1D4PB 2VNTA 3BIUH 1TNGA 5SGAE 3F9HA 1EOJA 1E38B 3E16B 4K8BA 1P09A 3EQ0H 2ZKSA 1V2NT 3V3MA 4ISLA 3VEQB 1SL3A 4K3JA 1O2SA 4CBNA 4A1XA 4WMEA 1ZSJA 3T29A 4MVNA 1QL9A 4J2YB 2ZIQH 3U8RH 2STAE 1UTOA 5EQQA 2J9NA 5GJ4B 1KLTA 1UTLM 4CHAC 1MBQA 1ORFA 2FX4A 1UVSH 1TNKA 4X1NU 1GHWH 5HYOA 1D3TB 3UQOA 2STBE 2WPLS 2ZZUH 1QA0A 2TRMA 2WINI 3LU9B 1E35B 3PLBA 4WWYA 3S7HB 1GVLA 2FOCA 3MNSA 3BV9B 1K1JA 1TMBH 3I78A 4FXGH 5T3HA 1CA0C 2A4GA 4NZQA 1EPTA 3VPKA 3NK8A 4OS6A 3ZZ6A 2FYQA 1WSSH 3BTWE 1HYLA 2ZHDA 2OBOA 2GCHG 2GZ9A 3DFLA 3PLPA 2HGTH 4NFEA 4AB8A 4Z0KA 2FOHA 1YPHE 3AW1A 4ZHLU 2DE9A 2FO9A 1MTNC 3I29A 1N8OC 3S7KB 3F6UH 1B0FA 1BHXB 3Q00A 8ESTE 1IQMA 1O3DA 1C2EA 1ELTA 1LHEH 5LPFA 1SB1H 2GDDA 3K9XB 2AIPA 4MPXA 5DP7A 2A2QH 2B7DH 2BLVA 1OP8A 1S6HA 5DP8A 4CR9A 2YNAA 3TGIE 1F0TA 3G01A 3RXOA 2V0BA 3SNDA 2VINA 1AZ8A 1TB6H 3A7TA 1GI2A 3U8OH 1C1NA 3E0NB 3PROA 2XW9A 1NFXA 2P8OC 1FIWA 7ESTE 1L2EA 1SGEE 2JH5D 3M5LA 1DLEA 4BAMB 1N6XA 3A84A 4KKDA 1ARCA 2ZDAH 3WY8A 2ZDKA 2ZQ2A 4YT7H 1P02A 1GI5A 1P10A 1C4U2 4ZHAA 1YPMH 2VVVA 3HK3B 3SNCA 1L1NA 3TVJB 1YM0A 1GBHA 2V6NA 1D3DB 3MU0A 3B8JA 1TMUH 1UCYK 1EZQA 2DUCA 2VJ1A 1SQAA 1V2RT 2I6QA 1C1QA 3PMAB 4IBLH 1C2DA 4AG1A 2FYRA 1THPB 3E1XB 4KELA 4ISNA 1PPFE 2VWMA 2FTLE 2BQ7B 1HAIH 2ZFRH 1JBUH 1DANH 1HAVB 3QZRA 5J4SA 1ZJKA 1K1NA 2PKSB 3KQDA 1T32A 2F3CE 5EPYA 1QBOA 4Y8XA 2FEQH 2PTCE 2HOBA 1P0SH 4GVUA 1KDQA 5E0HA 4XSKU 3RMOH 4Y79A 5E2PA 1A7SA 1LVOA 4KTUA 2HWLB 1GJ4H 1MKWK 3C1KA 2G55A 5LGOA 2WPHS 3ATWA 1QB6A 1O3GA 1GCTC 1HNEE 4IN1A 1LTOA 1G3EA 2JKHA 1P03A 4UFFH 5C67A 4CH8B 1WBGB 1WTHD 2CN0H 3RXQA 3P8NA 5JYIA 4OS2A 1SGFA 3T62A 2Z3CA 3EA9A 1AI8H 1QFKH 1ZHPA 4UE7H 2CHAC 4IC5A 3RXLA 5BPEA 2HNTC 1O2KA 1QTFA 3F9EA 2Z6BD 4YOGA 1GI1A 1YP9A 1FQ3A 3SO3A 4Y8YA 1OP2A 1DWBH 2J95A 2BD8A 2FOGA 3L33A 5DKMA 4ZXYH 1ETSH 3U8TH 1BMNH 1ETRH 5T6FA 5FX6A 1BT7A 3TJNA 4BTIB 4Y6DA 3RXRA 3BTQE 2WV4A 1C2KA 3OTJE 1MBMA 3M3TA 1C1SA 1LHFH 1GG6B 4LOYH 3LONA 2IJOB 3TH4H 4A1VA 1BQYA 3ZZAA 1FI8A 1ELGA 4ZMAH 4KTSA 3FZDA 1GMCF 1IQIA 1WU1A 4DT7B 1O3IA 3EYDA 1C5SA 1P2MA 2FMJA 1HAPH 3H5CB 3SJIA 1ANEA 1NFWA 1A3EH 1ZYOA 3U69H 4R0IA 4BXWA 1SQTA 1A5GH 1YPJH 2FWWA 4K60A 2V3HH 2Z94A 3RXSA 2J34A 1W7XH 5EW2H 5FX5A 4NWLA 4AFSA 1P2KA 1GI0A 1SGIB 1P57B 4FUGA 3MNBA 2ZU3A 4M7GA 3SUFA 1HUTH 3SHCH 4ABBA 1VR1H 2TGAA 2BZAA 4DY7B 2QXGA 2A7CA 1LVYA 2A7JA 1J17T 3RC4A 5DK1A 1NZQH 1HLTH 2VIVA 4DOQA 1CT0E 4Y76A 1ZPBA 1TRNA 3BEUA 2IPHA 1MAXA 4AB9A 1O5GH 1ZTJA 1BZXE 4ABIA 1O38A 3FP8E 1T8NA 1VCWA 2ZC9H 1S0RA 2BQ6B 3RC6A 1MTNB 1ZSLA 3HPTB 2UUKB 1MH0A 1O2OA 1A61H 1GJ9B 2K1QA 1S85A 3RMLH 2VU8E 3T2NA 1MTVA 1D3PB 1GI3A 1BTHH 1IQFA 1SC8U 2C90B 4D9RA 3A85A 2Z9KA 3UR9A 1YC0A 4D9QA 3KL6A 1C2GA 4XBCA 1AMHA 1TNJA 1FAXA 4AFUA 3QLPH 1FNIA 4X2WA 3RLYH 1H4WA 4NIVA 2ZECA 3AW0A 1TLDA 3RUOA 1P9SA 1ZMNA 4K1TA 3RMNH 1SHYA 3MU4A 5GXPA 1KLIH 5A8XA 5E8EH 2IOTA 1GI7B 1DSUA 2BZ6H 2R0LA 1FDPA 1WOFA 1Y5BT 1C1WH 4AFZA 4UFDH 4U30A 5A0BA 1N8OB 3RU4D 4DCDA 3CENA 4GCHG 3ZYDA 3E90B 1YLDA 4FUFA 3E0PB 1F92A 1QR3E 4JZ1A 3TH3H 3QN7A 1JXPA 2Y82A 1C5TA 3ZZDA 1O3CA 3UOPA 1GGDC 4ZKOU 3UQVA 1ZLRA 1IQJA 2QA9E 2R0KA 1CA0B 2XBYA 4DGJA 3DUXH 2OD3B 3BTTE 5TCAA 1YCPM 3SORA 1NO9H 3HATH 1BBRE 3KEEA 1NFYA 4IMQA 4BAQB 2IN2A 1O39A 3P92A 5JDUB 3FVFB 1O2GH 3TPIZ 3R3GB 4CHAB 1TGBA 1P2QA 5FPTA 3R0FA 2Y81A 3TITA 4LZ4B 2ULLA 3CS7A 2ZTZA 3P8OA 4NZLA 4X1PU 1GVKB 1AB9B 1O3MA 4NA9H 1K2I1 4NSVA 1IQGA 2P8OB 1TOMH 2GV7A 3SU4A 1O2RA 3SHAH 1QNJA 3ZVCA 3LIWA 2BDYA 3LGTA 5FPSA 1L0ZA 3OY5U 1WTGH 4O03A 3LJOA 4WXVA 1RTLA 1VITF 1O5CB 1F2SE 4X6NA 2Y7XA 2GT8A 1OWKA 3PLKA 2C4FH 4CRFA 5LPRA 2PHBA 2LNCA 1ELVA 1Z71A 5L2YH 1INCA 1CA8B 2GMTC 1DY9A 2BY8X 3ZVDA 3M35A 2A5AA 1ABIH 2UWLA 2OC8A 1A46H 2P3FH 4MLFB 3RMMH 2ZPRA 4IS5A 5C5OA 4YOIA 3URDA 2WYGA 1BMLA 4JK5A 4PROA 3QWCH 3GY2A 3M5MA 4UEHH 5FPYA 2BYAX 1V2ST 4FVBA 1HIAA 3EGKH 2FM2A 1AKSB 1YF4A 5K7RA 5DP3A 1AU8A 4H4FA 2Y80A 4HGCA 2VH6A 1MD8A 3GCOA 2PSYA 2D8WA 1OSSA 3A86A 1WCZA 4CRGA 1BRCE 3EAJA 4H42U 1A0HB 1XMNB 1G3DA 4MG3A 2ZFFH 2SGPE 3SJ8A 1P06A 3FP7E 3ZZBA 2XC5A 2VH0A 4IN2A 1ZRBA 1P2OA 3TU7H 3ATLA 5DP6A 1QBNA 1TBQH 1ZRKA 3RXUA 2B9LA 1HV7A 2ZFQH 2ZNKH 1XUFA 3MNCA 1UTQA 1RTKA 1G3CA 5ABWA 3NUMA 1AIXH 2ZCHP 3OU0A 3GY4A 1V2TT 5J4QA 4UDWH 1NRNH 1BDAA 1KLJH 5FHTA 1E34B 4B2BA 1O2HA 1T4UH 1FY4A 3TK5A 3RXMA 4B75A 2HVXA 1P8VC 1QHRB 2SGFE 1ZMJA 4X1QU 2A45B 2V35A 2ZDMA 1O5AB 1O2UA 4NGAH 1L1JA 3BSQA 1W2KH 1EB2A 1TA2A 2KAIA 4OS7A 1O5DH 1SG8B 4UONA 2Y5FA 1MU6B 1HJAC 1AFQC 2QXJA 3A8AA 3ZZ9A 1AUTC 1EB1H 1LMWB 4RSPA 2ZU4A 3P95A 3U1IB 4B71A 1E0FD 4X8TH 2W26A 1K1PA 8GCHF 1HPGA 1UHBB 1MTSA 3ZZ7A 1CHGA 4A92A 2AS9A 5DP9A 3SJ9A 1NU7B 3RM2H 2VVUA 4FUIA 3RC5A 3RXGA 2NU1E 3TLOA 5F8XA 4X8UH 3TJUA 1FMGA 3F68H 1ELCA 4X2XA 4CREA 1NROH 4MPVA 1BHXF 1HJ8A 5AF9H 1P3EA 1AY6H 4FUDA 4YLUA 1CGHA 1GBLA 1W8BH 2TIOA 3RXCA 3LGWA 4E7NA 1DUAA 2Q6GA 2C8ZB 1G37A 2J2UA 3TJOA 6GCHG 5JBTA 3GCNA 1B7XB 1YPLH 1FY5A 1EOLA 1TX8A 1V2VT 1Z8GA 2Z7FE 2BDCA 2SGDE 1H8DH 3VXEH 1ELFA 3UOUA 1GVZA 1JMOH 8LPRA 2ZEBA 1P2JA 1O5EH 4GAWA 1KIGH 1MCTA 1GDQA 4BOHA 1RIWB 2QY0B 2HNTE 1LHGH 3PWBA 1F7ZA 3TNTA 4NSYA 1V2QT 1KXDA 2UUJB 4I33A 1HAVA 4ABJA 4OGXA 3VB5A 1IQLA 1GHBF 1C4Y2 2ALPA 1MAYA 1F0SA 1FY1A 1GHXH 1D6WA 4FUBA 1OKXA 1W7GH 2ANYA 1UHBA 3SV2H 1FONA 1WYKA 3SQHE 1MQ5A 3EDXB 3K6YA 3TGKE 1GG6C 4ABAA 3V12A 5FBIA 1DVAH 1TPPA 2WYJA 2TGTA 1DPOA 3K6ZA 1UTPA 2P16A 3KQCA 2SGQE 1XXDA 4XE4A 1SGRE 3FANA 3CS0A 5AFZH 1Y3XA 5DP5A 2GT7A 1M9UA 1ANCA 2FLRH 3GCTF 2QC2A 1C1PA 1J14A 1TIOA 2HPPH 2UUYA 2AYWA 2XTTB 1OP0A 1Z1IA 2PSXA 3RXPA 4CRBA 3E8LA 3SU6A 1CU1A 4K8YA 4AGJA 2BY5X 3Q3YA 1SLVB 2ZDNA 1V2JT 1C5PA 4O9VA 1OX1A 3PMBB 2ZFTA 2XCFA 5HXFA 3LJJA 5BRRE 1UTJA 4AORA 3B23B 5A2MH 1T8LA 2KAIB 1NM6A 4FUJA 3U1JB 1C1MA 3LC5A 1A0JA 2VIQA 4OGYA 5GDSH 4VGCC 1PYTC 6CHAB 1MMJN 1A2CH 1GL0E 4ZKSU 4WJG2 2EEKA 2OTVA 3P8GA 3A7ZA 1TPOA 2R9PA 1KTTB 1RXPA 1C5YB 1ZGVA 4ABGA 1O5BB 2AGGX 2GX4A 1IHSH 1ZPZA 1CSOE 3M5OA 4WH6A 9LPRA 1U6QA 2V3OH 4Y71A 1FY8E 4QT8C 5EOKA 1GBKA 3AVZA 1V2OT 1ZHRA 2FI5E 1W10U 1DE7H 3B9FH 1YBWA 1YGCH 2H9TH 2Y5GA 3ZVBA 1FUJA 4NA8A 1KY9A 2EI8A 5JBAS 1GJAB 2NWNA 1IQKA 2OINA 2QXIA 4NA7A 3OSYA 1CHOF 3M36A 1HJ9A 2C3SA 4O3UA 3SGAE 1C5RA 5EPNA 1V2LT 3FP6E 4MNVA 1ZTKA 2W3IA 1QQUA 1SGCA 4X1SU 1EAXA 2EI7A 3FAOA 3UNSA 2NU3E 2AGIX 5C3NA 1EATA 2XC0A 1SR5C 3PTBA 1WV7H 3UR6A 4R8TB 4ISOA 5IDKA 2ASUB 1F5KU 4XBBA 3H7TA 3SV6A 1BITA 3RXIA 3A88A 2FOFA 1CQQA 2AIQA 1RIWC 3LDXH 3SW2B 1GPZA 2PR3A 1ESTA 1C5QA 4I8KA 4XFQA 2C8WB 3GYLB 2BY6X 3LGUA 4CH2B 4KP0A 3ZZ3A 2GVFA 2XWAA 1VJAU 1C1TA 3PYHA 1SPJA 1AQ7A 2P3TB 1C2IA 1EX3A 3PO1C 4NWKA 4GHTA 2ANMH 1C1VH 4AFQA 2BLOA 4MPUA 3URCA 3BTFE 1OWHA 1C5OH 1V2PT 1TBZH 2RA0A 3GDUA 5ETXA 2RA3A 1LVMA 3T26A 4ZKNU 5EXMA 1C5MD 2ZGBH 4Y0ZE 1D6RA 1TBRH 1EQ9A 1H9LB 1TWXB 1FZZA 3P6ZB 2UUFB 3P70B 1GJ5H 1EZUC 2BXTH 4ZXXH 1OS8A 1P01A 3KQEA 5F8TA 2QCYA 3KF2A 1IOEA 1GMHF 1C2HA 2SFAA 2BX3A 2R2MB 3EA7A 1A5HA 3IITA 3MO6A 1BTYA 1V2KT 4AOQA 1QRZA 1LPGB 2EA3A 1EJNA 4INHA 4LK4A 1Z6JH 3LT3A 4TY7A 1OWEA 1O37A 3QK1A 2AMQA 1C5UA 1XXFA 1HAZB 1BB0B 1HXFH 2A4QA 2RDLA 4E7RG 1P2NA 5DO4H 2C8YB 1V2MT 3M7UA 1W3CA 1SHHB 1TGSZ 3V0XA 3ZVAA 3UREA 4INLA 3DD2H 1FY3A 2XWBI 4J1YA 1A5IA 3QX5H 1MTUA 1G2LA 1HCGA 5C1UA 1GBIA 1PYTD 3T28A 3U98H 2D1JA 2VWOA 1CBWB 2ZU2A 3RXDA 1C5XB 2VIDA 1O2XA 4ZAEA 1AD8H 1LHDH 5DG6A 1UTNA 2VVCA 2XC4A 5PTPA 1BRBE 1GI8B 1C5ZB 1TMTH 5F6MA 4OS4A 1NC6A 1THRH 1XUHA 2W5EA 3S69A 1AE8H 1QL7A 1ZSKA 1TYNA 1LPKB 3E91A 1YPGH 2HPQH 4UFEH 1G9IE 1EP5A 2QV1A 4MPWA 2FP7B 4NCYA 2BQWB 4CRCA 2CF8H 1O2YA 5CHAB 5A0AE 4Y7AA 2SGEE 3H7OA 5FXLA 4E05H 1O2WA 1TGCA 3NXPA 3SNAA 1S0QA 4JYUH 2RG3A 1GHBG 1GHAF 3GCTG 4O3TA 3SUEA 2H5DA 2ZWLH 4NIYA 2HRVA 3QTVH 2ZGCA 2VWLA 5L30H 2BD2A 4YTAA 3W94A 1QRXA 3A8CA 1NRSH 1QA7A 1AB9C 5I46H 3ZZ8A 2VB0A 2BX4A 3QZQA 1VCQA 5I25A 1GBAA 4I31A 1GCTB 3MFJA 4I32A 3V13A 1GJDB 2P94A 2G81E 1J8AA 1PPBH 4FUEA 3NZIA 4CRAA 4XDEA 2LPRA 1P05A 1W12U 1QY6A 3SQEE 1CT2E 2CV3A 1TPAE 4IMZA 2FOEA 3N7OA 1Z8IB 1TE0A 1PQ7A 2XXLA 3SN8A 1C9TA 1TABE 3L6PA 2XBXA 9ESTA 1O2QA 1DLKB 3OYPA 1SSXA 1ABJH 2F9NA 3STIA 4XBDA 3BEIB 2J4IA 4ABHA 1J9CH 2F9UA 1ZTLA 3OX7U 4U2WA 4X1RU 4KGAA 1SGTA 3PO1B 4XOJA 2AFQB 1LKBA 2PUQH 2AMPA 1K1OA 3D65E 3ELAH 4X6OA 1O3KA 1T31A 3MH5A 1Y3VA 2JH6D 1BBRH 2ODQA 2BOHB 2BDAA 4BAKB 2Q6FA 5HMAA 3MH6A 4HFPB 1BTPA 3BTME 2YNBA 4WVPE 1BMAA 1WQSA 2PWXA 1A0LA 1AFEH 4O97A 3SJKA 1KXCA 3K65B 2F9OA 1O3PB 3QO6A 3PM3A 3S9CA 1UVOA 2ZP0H 1A4WH 1AWFH 1XKAC 3UWJH 1C4V2 1G3BA 1SOZA 1GBTA 1C1OA 2WPJS 5GCHF 1DXPA 2NU2E 1ESAA 1ELEE 3MO9A 1PPZA 3QUMP 1GHVH 3MO3A 4A1TA 5T6DA 3Q77A 1YYY1 2F91A 3EA8A 1BIOA 3RU4E 3UIRA 3RXJA 3V7TA 2PGBB 3ODFA 2VIWA 1AE5A 3K2UA 5CHAC 1GJCB 2A4RA 4WF8A 1MCVA 3RDZA 7LPRA 2FOBA 4Q7ZA 5ESTE 1O32A 4X8SH 3KCGH 4DIIH 2F9BH 1TRYA 1HAGE 4TWYA 4ZUHA 3KNXA 5LH8A 1ZPCA 1O2TA 3BG4B 3C27B 2GGVB 4JZIA 1NT1A 2FTMA 4WMFA 4ABEA 3D62A 3UY9A 2Z9LA 2H2ZA 2O9QA 1TA6A 4ISHH 2BY7X 3O8CA 4TPYA 1VGCB 3VGCB 3GDSA 1C2JA 2FODA 1VITG 1EAIA 3M7TA
chains in the Genus database with same CATH superfamily
3PV2A 2ZGJA 5A8YA 2TGDA 4VGCB 2CJIA 3E6PH 3RXEA 5JBBS 3MI4A 2ZI2H 3ESTA 3ODDA 1GHZA 1TALA 1O3HA 3MTYA 3ATKA 3P8FA 2ODPA 1GCDA 1H9HE 4NIWA 4RT0A 1O34A 2FI4E 1P3CA 2GCTB 3N7EA 3TIUA 1VCPA 2ANWA 2PV9B 1TRMA 1Z7KA 1DOJA 3RXFA 8GCHG 2J94A 5GPIB 1NN6A 1DM4B 1H9IE 1EUFA 2A1DB 3GCHC 3KIDU 3VXFH 2F9PA 4I8LA 1K9OE 3BG8A 1SI5H 3MH7A 1S81A 1PFXC 4KTCA 1QGFA 5FCKA 4K1EA 3UNRA 2DE8A 3UUZA 1JIMA 2BHGA 4Y10E 1XUJA 3JZ2B 1FN6A 1QQ4A 3BIVH 1UK4A 1ZJDA 2ZTXA 2A5KA 1JRSA 1P2IA 4MTBA 1BBRK 1MUEB 3UFAA 3GISB 2WV5A 3A8DA 5C17A 4TPIZ 3GDVA 3HGNA 1H8IH 5C0TA 4HZHA 4D7GA 1Y5UT 5EU8A 3DT0H 4DG4A 4JMYA 4MNYA 2R3YA 1TX7A 1AHTH 2XBWA 4ZHMU 1O3FA 5A8ZA 1FX0B 1KXFA 1E1QD 1ZGIA 4Y7BA 1SGQE 3NKKA 1UTMA 3VGCC 3WW7A 1T8OA 2BMGB 4B74A 2BLWA 3GOVB 1ID5H 2J98A 3HKJB 1TONA 4JYVH 1NBMD 2Z3EA 3WWBA 1NRRH 1O0DH 1C5WB 1THSH 2FPZA 4JZFH 1O2NA 2A4OA 1CGJE 5JBCS 1BCUH 1EP6A 3LPRA 4RKJB 1GJ7B 1AGJA 2G4UA 3A87A 2O8WA 3SNEA 4Z6AH 3SV8A 4RKOB 5GNDA 3T25A 4AG2A 2BDBA 4MNXA 4FETA 3Q3XA 1KTSB 4Y8ZA 2KCPA 2L6OA 3T5FH 1A3BH 4NIXA 1SGYE 2Q1JA 2RFKC 2G5VA 3RXAA 3S0NA 3QTOH 3GY8A 1LO6A 7GCHF 3O8DA 1QJ1B 4YLQH 5C20A 3RM0H 5K0HA 2GD4B 2THFB 3F1SB 2ZCLP 1QJ7B 1GDUA 3A81A 3L3TA 2PLXA 2ZU5A 1GHYH 1BOQA 2A5IA 3LGVA 3SNBA 3GYMA 5GIBA 2TBSA 4FU7A 2ZGHA 2G8TA 3FZZA 4OM9A 5AVDA 1T8MA 1EFRD 2Y6TA 1ZZZA 1A1RA 4JYTA 1E79D 4UD9H 1O2MA 2XYAA 1Y3WA 1XUGA 1IHTH 1XVMA 3MWIU 1ZOMA 2WUBA 2BLQA 1BRAA 3TGJE 4TT3D 4AYYB 3PWCA 3F9FA 3A8BA 2XBVA 1HAYB 1L1GA 4DURA 1SLUB 2GZ8A 5G4BA 5EW1H 2NU0E 4IGDA 3BG4C 1EAUA 1GI9B 1PQAA 2OQ5A 1TGNA 2ZU1A 3AAVA 2Z9JA 1ESBA 2VGCB 4UFGH 1F5RA 1QBVH 1W0KD 2EI6A 3PMHB 4I8HA 5E0GA 3SI3H 2XNIA 4TYDA 3UNQA 3MMGA 1ANDA 4D7FA 3ZYEA 3O8RA 3SV7A 1NFUA 5C1YA 2OC0A 2P59A 1G36A 1ELBA 1NPMA 1SGPE 3BEFB 2ZPSA 4FUCA 2ZGXH 1MKXK 2YMSC 2QF3A 1E37B 2ZDLA 1B5GH 2CMYA 5DPAA 2W7SA 7KMEH 1S82A 1PQ5A 2A2XH 2AERH 2BVSH 3PTNA 1OOKB 2FI3E 1KXBA 1UVPA 3A83A 1KDQB 1GBFA 2VWNA 3SZNA 2XNDD 3OY6U 3Q3KA 4K69A 3JZ1B 1DFPA 2ZHQH 1C5LH 2HALA 2VIOA 3ATMA 3PMJA 1W13U 1W0ZU 3KQ5A 4AYVB 3Q76A 4Q2KA 3QGJA 4Y11E 2V3MA 4B6EA 5EXLA 2LELA 2W7UA 3MOCA 4X0WU 1LDTT 3ZV8A 3RLWH 2B5TB 2RDEA 1ETTH 5DP4A 2GMTB 1DT2A 1TAWA 2AEIH 4GCHF 1K1LA 4BAOB 1OWDA 2G5NA 1UO6A 2WPMS 1DXWA 1O2IA 1EJMA 4Q80A 3SU2A 1JOUB 3SU3A 1O3JA 1CVWH 1HAHH 5AHGH 2BD7A 3QGNB 3RXVA 3A7YA 1N6YA 3BN9A 1GGDB 1H1BA 4BTTB 4IW4E 2G52A 4DJZB 4X6MA 5LPEA 1CE5A 2YOLA 1HJAB 1W0YH 1SVPA 1YCPH 3GICB 1MU8B 3VB3A 1BRUP 1Q3XA 4GUXA 1C1RA 3ZV9A 2ZFSA 1D3QB 1QCPA 1SBWA 5CMXH 3ZZ4A 2BDHA 1EAWA 3CP7A 4B2AA 2VIPA 1QL8A 1TPSA 2W3KA 1F0UA 2QXHA 2OXSA 5TCCA 2H6MA 5FBEA 1L4ZA 3ENSB 3NPSA 4F48B 1S84A 4HI3A 1KYNA 1XX9A 1WAYB 3A7XA 4JZEH 5F8ZA 3UAIC 2O8UA 4K5ZA 1T4VH 5EG4A 1FJSA 1O5FH 1K22H 3U9AH 4JK6A 1LPZB 4OS5A 2QE7D 2EQNA 1FPHH 1GDNA 1RFNA 4YT6H 2PW8H 2A0QB 5B6OA 1GBCA 4ABDA 2C8XB 2BDIA 4ESTE 1KSNA 3N99A 4RN6A 1ZHMA 2BXUH 5EXNA 5C1XA 2QF4A 1K1MA 1HB0B 2ZPQA 1E36B 3P17H 3W95A 1N1LA 1Z1JA 4LXBH 4AZ2B 3SOSA 1UVUH 5L6NH 6ESTA 1RGQA 2ZG0H 3M3VA 1J15A 2D2DA 5EJZA 3E3TA 3TK6A 4F49A 2FS9A 2OC1A 4GHQA 2SNWA 1MZDA 3STJA 1NS3A 1BTWA 1OWIA 2ANKH 1AVWA 5EQSA 1GBEA 2A31A 3S9AA 4B76A 1TNIA 2ODYB 1Z8JB 2R2WU 1C1UH 2QAAA 3LOXA 4X2YA 4YM9A 1UK2A 1WUNH 2OBQA 2OUAA 2ZTYA 4FU9A 2G51A 4K2YA 4BAHB 4BANB 1DICA 4NFFA 1DUEA 1S5SA 1XKBC 1GMHG 1V6DA 1B0EA 3KHVA 2ZHFH 1C9PA 3DHKH 3AAUA 2J98B 1QJ6B 3MU1A 2UWPA 2ILNA 3LH3A 3AASA 1V2WT 3PB1E 1EZSC 2FIRH 1AKSA 1PJPA 2HLCA 3TH2H 4A6LA 4CBOA 1HIAB 4D8NA 1LQEA 1CO7E 3BTDE 1O3EA 1C2FA 3RXTA 1ACBE 5T6GA 2EC9H 1Y3YA 4THNH 1SGFG 4AGKA 3A89A 3LC3A 4HG6A 3UWIA 1YLCA 3TJVA 5L2ZH 1GJ6A 4A7IB 1AO5A 3MH4A 1VITG 4ZROA 2BM2A 1P9UA 2AMDA 5FL7D 3HK6B 4X6PA 1DY8A 2GCHF 1UMAH 2PFEA 1TNLA 3MU5A 3PV4A 1O31A 5EODA 3MHWU 1CT4E 1HRTH 5CE1A 1BJVA 3BF6H 2F9VA 2AH4X 3M61U 2GTBA 2WPIS 4DW2U 2CHAB 5GCHG 1MKXH 1W14U 5C2ZA 4H6SB 2CGAA 2PKAA 1SGNE 1X7AC 1TFXA 3HKIB 4FU8A 1ARBA 2ZQ1A 1F5LA 2OQUA 1OXGA 1SFIA 1MZAA 3KQBA 1AZZA 1K21H 3QDZB 1PPHE 1D9IA 1V3XA 1P04A 3LGYA 3M5NA 1O3BA 3EE0B 1O3OA 2PKAB 1E1RD 1DSTA 2OLGA 5HM2A 1RD3B 1G30B 1EKBB 2JETC 3NWUA 1UJ1A 3RXBA 6CHAC 3GY7A 2KCAA 4GPGA 1AVGH 1TX6A 4INKA 2GCTC 1KXAA 5FAHA 2FDAA 1IQNA 3KN2A 1SLWB 3HGPA 1FAKH 1LHCH 1EXFA 1LCYA 3VB7A 2BY9X 4MQAA 3IG6B 1OWJA 2RCEA 1JIRA 2PUXB 1TQ7B 1O2VA 1GJ8B 3F0OA 1HGTH 2FX6A 1YPHC 2QN5T 4SGBE 1MTWA 3I77A 5C94A 4DVAU 1O3NA 2QF0A 1UK3A 3ZVEA 1Q31A 1DWCH 3F9GA 1G32B 1Y8TA 3SJOA 3GY5A 1MD7A 1C2LA 1PQ8A 1ANBA 1O2PA 1QRWA 1SGDE 2GV6A 3SUGA 1TQ0B 1O3LA 4B2CA 1ZMLA 2ZCKP 3D23A 5IYTA 1UCYE 6LPRA 1QIXB 3OFND 4JCNA 1AVXA 1EZXC 4P00A 1OYTH 2BD3A 2O8TA 1LVBA 1GL1A 3ZVGA 2H9EH 1EPTB 3M37A 1FPCH 1O2LA 1TOCB 1GMDF 1NRQH 5JB9S 1GBDA 2NU4E 3M7QA 1SFQB 4F4OC 5DJ7A 1V2UT 3UTUH 3DFJA 2ZHEH 4WH8A 1HAXB 2P3UB 2FOMB 5HIYA 8KME2 4NG9H 1FV9A 1QURH 2FZZA 4U32A 1ELDE 1EJAA 5HGGA 5TJXA 4E06H 3IWMA 2M5TA 2Y7ZA 2O8MA 1TGTA 2TPIZ 3M3SA 3SU0A 1GBBA 1RRKA 1XUIA 2GKVE 2H5CA 3GY3A 3SU1A 1SKYE 1HBTH 4BXSA 3BTEE 3SZEA 5GWZA 1VITH 1P11E 1Y5AT 7GCHG 1YCPK 4I8JA 1Z6EA 2VGCC 2BD5A 3ZVFA 2CF9H 1GMDG 3RXKA 4A5TS 1WQVH 1JWTA 2F83A 3SUDA 2QYIA 1HFDA 2SGAA 4P02A 4ASHA 4YESB 1F0RA 2XRCA 1XUKA 3KYGA 5C5NA 1FIZA 4YO9A 3ZZ5A 5JB8S 2R3UA 3LGIA 1C2MA 2J97A 4MNWA 1S6FA 1UVTH 1ELAA 4WMDA 1DX5M 3WWFA 2CXVA 1Y59T 1HXEH 1PPEE 3NCLA 1O35A 5DGJA 3VB4A 1G2MA 1C5NH 1CHOG 3BTKE 4U01A 6GCHF 2BOKA 1SMFE 2ALVA 3FFGA 3OEHD 5F53A 5H4IB 4GSOA 3UPEA 2FXRA 4CRDA 1DDJA 2BTCE 2WUCA 1BTZA 2P95A 4MDSA 5EJLA 1QB1A 4JZDH 5DN6D 3KGPA 1LKAA 3RP2A 2G4TA 2AGEX 2XCNA 5E2OA 4TSFD 2A32A 1O33A 4Y0YE 1MQ6A 2Q6DA 1AWHB 1AFQB 4OS1A 1BTUA 1FN8A 1EPTC 4BTUB 1PPGE 2QGRA 1FXYA 4D76A 2TGPZ 3GCHB 2H1UA 1CBWC 3A80A 1SLXB 4FUHA 5E0JA 4ACAA 1SQOA 4FVDA 4AN7A 5JPMH 2P93A 1GBMA 1O30A 1DS2E 3SBKA 4RI0A 1OYQA 3LH1A 1IQEA 3SV9A 2JETB 2O8LA 3D49H 3DA9B 1NESE 2WPKS 2ZHWH 1IAUA 3GS9A 1EASA 2BVRH 2BD4A 1BMMH 1GJBB 1HAOH 3SU5A 2G00A 5EGMA 5HKKD 1KXEA 1YPEH 2D26C 4ISIH 2GJGA 3ITIA 3RU4T 2C93B 2ZDVH 2WHXA 1QB9A 1FLEE 2FLBH 4B73A 1O2JA 1VGCC 4ZH8A 1GHAG 2GDEH 4H6TA 2OP9A 3A82A 1K28D 1SOTA 4YOJA 5HM9A 3A7WA 1MKWH 1GI6A 3O8BA 2ZFPH 1RJXB 1O36A 3TNSA 4X8VH 3BTHE 5AFYH 1BTXA 3MU8A 1PPCE 2ZF0H 1O2ZA 4ABFA 1VZQH 1WDIA 5F03A 3RXHA 1YPKH 1K1IA 4IC6A 2PTNA 2B8OH 1J16A 1LQDB 3DSOA 2HVYB 2KM0A 2GP9B 1BUIA 4Q7XA 4WXIA 1Q2WA 2B0FA 1AN1E 4TY6A 3TK9A 2QIQA 1NRPH 3BTGE 4I7YH 2OC7A 2I6SA 1O3AA 1TNHA 4TWWA 2SNVA 1RS0A 2BVXH 5FCRA 4B1TA 3SGQE 1GI4A 4ZKRU 4HTCH 4DIHH 1AUJA 3T27A 2PGQB 1L4DA 1ZR0A 2LP6A 2J38A 1HDTH 1COWD 4XRNA 1BA8B 1DWDH 1OPHB 1S83A 1YKTA 4WY3A 3MNXA 4SGAE 3LKWA 1GWAA 5A09A 1P12E 2FOAA 2Z9IA 2Z9GA 2JH0D 3NRLA 1RTFB 4K1SA 3VB6A 2BB4A 4X2VA 2Z3DA 3CNRA 1DWEH 4GLYA 3F0PA 4M9FA 1DITH 1Y3UA 5EQRA 3ZZCA 5CDFE 3S9BA 4RT1A 4BNRA 3FOAA 2A7HA 1NU9A 1XM1A 2FESH 2ZO3H 1JRTA 2FS8A 4ACBA 1VJ9U 1C5VA 4I8GA 5ESBA 1IQHA 2PKSC 4AX9H 2J92A 2Y5HA 3SGBE 4CR5A 1GMCG 2GZ7A 1NTPA 2BD9A 3A7VA 2HNTF 1BJUA 4Q7YA 1GBJA 2OCVB 1W11U 4YZUA 1T7CA 2J5UA 3VFEA 1UCYH 3MYWA 2ESTE 2BDGA 3ATIA 1UTKA 2H9HA 2F43B 1Z8RA 3SI4H 2UWOA 1NY22 4LZ1H 2ZA5A 1CGIE 5A0CA 1XVOA 3GY6A 1D4PB 2VNTA 3BIUH 1TNGA 5SGAE 3F9HA 1EOJA 1E38B 3E16B 4K8BA 1P09A 3EQ0H 2ZKSA 1V2NT 3V3MA 4ISLA 3VEQB 1SL3A 4K3JA 1O2SA 4CBNA 4A1XA 4WMEA 1ZSJA 3T29A 4MVNA 1QL9A 4J2YB 2ZIQH 3U8RH 2STAE 1UTOA 5EQQA 2J9NA 5GJ4B 1KLTA 1UTLM 4CHAC 1MBQA 1ORFA 2FX4A 1UVSH 1TNKA 4X1NU 1GHWH 5HYOA 1D3TB 3UQOA 2STBE 2WPLS 2ZZUH 1QA0A 2TRMA 2WINI 3LU9B 1E35B 3PLBA 4WWYA 3S7HB 1GVLA 2FOCA 3MNSA 3BV9B 1YY3A 1K1JA 1TMBH 3I78A 4FXGH 5T3HA 1CA0C 2A4GA 4NZQA 1EPTA 3VPKA 3OAAD 3NK8A 4OS6A 3ZZ6A 2FYQA 1WSSH 3BTWE 1HYLA 2ZHDA 2OBOA 2GCHG 2GZ9A 3DFLA 3PLPA 2HGTH 4NFEA 4AB8A 4Z0KA 2FOHA 1YPHE 3AW1A 4ZHLU 2DE9A 2FO9A 1MTNC 3I29A 1N8OC 3S7KB 3F6UH 1B0FA 1BHXB 3Q00A 8ESTE 1IQMA 1O3DA 1C2EA 3ZIAD 1ELTA 1LHEH 5LPFA 1SB1H 2GDDA 3K9XB 2AIPA 4MPXA 5DP7A 2A2QH 2B7DH 2BLVA 1OP8A 1S6HA 5DP8A 4CR9A 2YNAA 3TGIE 1F0TA 3G01A 3RXOA 2V0BA 3SNDA 2VINA 1AZ8A 1TB6H 3A7TA 1GI2A 3U8OH 1C1NA 3E0NB 3PROA 2XW9A 1NFXA 2P8OC 1FIWA 7ESTE 1L2EA 1SGEE 2JH5D 3M5LA 1DLEA 4BAMB 1N6XA 3A84A 4KKDA 1ARCA 2ZDAH 3WY8A 2ZDKA 2ZQ2A 4YT7H 1P02A 1GI5A 1P10A 1C4U2 4ZHAA 1YPMH 2VVVA 3HK3B 3SNCA 1L1NA 3TVJB 1YM0A 1GBHA 2V6NA 1D3DB 3MU0A 3B8JA 1TMUH 1UCYK 1EZQA 2DUCA 1SQAA 1V2RT 2I6QA 2VJ1A 1C1QA 3PMAB 4IBLH 1C2DA 4AG1A 2FYRA 1THPB 3E1XB 4KELA 4ISNA 1PPFE 2VWMA 2FTLE 2BQ7B 1HAIH 2WSSD 2ZFRH 5HIZA 1JBUH 1DANH 1HAVB 3QZRA 5J4SA 1ZJKA 1K1NA 2PKSB 3KQDA 1T32A 2F3CE 5EPYA 1QBOA 4Y8XA 2FEQH 2PTCE 2HOBA 1P0SH 4GVUA 1KDQA 5E0HA 4XSKU 3RMOH 4Y79A 5E2PA 1A7SA 1LVOA 4KTUA 2HWLB 1GJ4H 1MKWK 3C1KA 2G55A 5LGOA 2WPHS 3ATWA 1QB6A 1O3GA 4YXWD 1GCTC 1HNEE 4IN1A 3OEED 1LTOA 1G3EA 2JKHA 1P03A 4UFFH 5C67A 4CH8B 1WBGB 1WTHD 2CN0H 3RXQA 3P8NA 5JYIA 4OS2A 1SGFA 3T62A 2Z3CA 3EA9A 1AI8H 1QFKH 1ZHPA 4UE7H 2CHAC 4IC5A 3RXLA 5BPEA 2HNTC 1O2KA 1QTFA 3F9EA 2Z6BD 4YOGA 1GI1A 1YP9A 1FQ3A 3SO3A 4Y8YA 1OP2A 1DWBH 2WZQA 2J95A 2BD8A 2FOGA 3L33A 5DKMA 4ZXYH 1ETSH 3U8TH 1BMNH 2QF5A 1ETRH 5T6FA 5FX6A 1BT7A 3TJNA 4BTIB 4Y6DA 3RXRA 3BTQE 2WV4A 1C2KA 3OTJE 1MBMA 3M3TA 1C1SA 1LHFH 2KZ4A 1GG6B 4LOYH 3LONA 2IJOB 3TH4H 4A1VA 1BQYA 3ZZAA 1FI8A 1ELGA 4ZMAH 4KTSA 3FZDA 5C0UA 1GMCF 1IQIA 1WU1A 4DT7B 1O3IA 3EYDA 1C5SA 1P2MA 2FMJA 1HAPH 3H5CB 3SJIA 1ANEA 1NFWA 1A3EH 1ZYOA 3U69H 4R0IA 4BXWA 1SQTA 1A5GH 2KX4A 1YPJH 2FWWA 4K60A 2V3HH 2Z94A 3RXSA 2J34A 1W7XH 5EW2H 5FX5A 4NWLA 4AFSA 1P2KA 1GI0A 1SGIB 1P57B 4FUGA 3MNBA 2ZU3A 4M7GA 3SUFA 2IPQX 1HUTH 3SHCH 4ABBA 1VR1H 2TGAA 2BZAA 4DY7B 2QXGA 2A7CA 1LVYA 2A7JA 1J17T 3RC4A 5DK1A 1NZQH 1HLTH 2VIVA 4DOQA 1CT0E 4Y76A 2EY4C 1ZPBA 1TRNA 3BEUA 2IPHA 1MAXA 4AB9A 1O5GH 1ZTJA 1BZXE 4ABIA 1O38A 3FP8E 1T8NA 1VCWA 2ZC9H 1S0RA 2BQ6B 3RC6A 1MTNB 1ZSLA 3HPTB 2UUKB 1MH0A 2KR7A 1O2OA 1A61H 1GJ9B 2K1QA 1S85A 5KGOA 2VU8E 3RMLH 1QZ8A 3T2NA 1MTVA 1D3PB 1GI3A 1BTHH 1IQFA 1SC8U 2C90B 4D9RA 4ZCNA 3A85A 2Z9KA 3UR9A 1YC0A 4D9QA 3KL6A 1C2GA 4XBCA 1AMHA 1TNJA 1FAXA 4AFUA 3QLPH 1FNIA 4X2WA 3RLYH 1H4WA 4NIVA 2ZECA 3AW0A 1TLDA 3RUOA 1P9SA 1ZMNA 4K1TA 3RMNH 1SHYA 3MU4A 5GXPA 1KLIH 5A8XA 5E8EH 2IOTA 1GI7B 1DSUA 2BZ6H 2R0LA 1FDPA 1WOFA 1Y5BT 1C1WH 3KYFA 4AFZA 4UFDH 4U30A 5A0BA 1N8OB 3RU4D 3AK5A 4DCDA 3VG8A 3CENA 4GCHG 3ZYDA 3E90B 1YLDA 4FUFA 3E0PB 1F92A 1QR3E 4JZ1A 3TH3H 3QN7A 1JXPA 2Y82A 1C5TA 3ZZDA 1O3CA 3UOPA 3F2FA 1GGDC 4ZKOU 3UQVA 1ZLRA 1IQJA 2QA9E 2R0KA 1CA0B 2XBYA 4DGJA 3DUXH 2OD3B 3BTTE 5TCAA 1YCPM 3SORA 1NO9H 3HATH 1BBRE 3KEEA 1NFYA 4IMQA 4BAQB 3F2HA 2K0QA 2IN2A 1O39A 3P92A 5JDUB 3FVFB 2OK5A 1O2GH 3TPIZ 3R3GB 4CHAB 1TGBA 1P2QA 5FPTA 3R0FA 2Y81A 3TITA 4LZ4B 2ULLA 3CS7A 2ZTZA 3P8OA 4NZLA 4X1PU 1GVKB 1AB9B 1O3MA 4NA9H 1K2I1 4NSVA 1IQGA 2P8OB 1TOMH 2GV7A 3SU4A 1O2RA 3SHAH 1QNJA 3ZVCA 3LIWA 2BDYA 3LGTA 5FPSA 3MQKC 1L0ZA 3OY5U 1WTGH 4O03A 3LJOA 4WXVA 1RTLA 1VITF 1O5CB 2JDID 1F2SE 4X6NA 2Y7XA 2GT8A 1OWKA 3PLKA 2C4FH 4CRFA 5LPRA 2PHBA 2LNCA 1ELVA 1Z71A 3SYJA 5L2YH 1INCA 1CA8B 2GMTC 4XD7D 1DY9A 2BY8X 3ZVDA 3M35A 2A5AA 1ABIH 2UWLA 2OC8A 1A46H 2P3FH 1MABB 4MLFB 3DCLA 3RMMH 2ZPRA 4IS5A 5C5OA 4YOIA 4B6FA 3URDA 2WYGA 1BMLA 4JK5A 2W6ID 4PROA 3QWCH 3GY2A 3M5MA 4UEHH 5FPYA 2BYAX 1V2ST 4FVBA 1HIAA 3EGKH 2FM2A 1AKSB 1YF4A 3DSGA 5K7RA 5DP3A 1AU8A 4H4FA 2Y80A 4HGCA 2VH6A 1MD8A 3GCOA 2PSYA 2D8WA 3DSPA 1YLNA 1OSSA 3A86A 1WCZA 4CRGA 1BRCE 3EAJA 4H42U 1A0HB 1XMNB 1G3DA 4MG3A 2ZFFH 2SGPE 3SJ8A 3FN8A 1P06A 3FP7E 3ZZBA 2XC5A 2VH0A 4IN2A 1ZRBA 1P2OA 3TU7H 3ATLA 5DP6A 1QBNA 1TBQH 1ZRKA 3RXUA 4DT4A 2B9LA 1HV7A 2ZFQH 2ZNKH 1XUFA 3MNCA 1UTQA 1RTKA 1G3CA 5ABWA 3NUMA 1AIXH 2ZCHP 3OU0A 3GY4A 1V2TT 5J4QA 4UDWH 1NRNH 1BDAA 1KLJH 3FKSD 5FHTA 1E34B 2PP6A 4B2BA 1O2HA 1T4UH 1FY4A 3TK5A 3RXMA 4B75A 2HVXA 1P8VC 1QHRB 2SGFE 2KCOA 1ZMJA 4X1QU 2A45B 2V35A 2ZDMA 1O5AB 1O2UA 4NGAH 1L1JA 3BSQA 1W2KH 1EB2A 1TA2A 2KAIA 4OS7A 1O5DH 1SG8B 4UONA 2Y5FA 1MU6B 1HJAC 1AFQC 2QXJA 3A8AA 3ZZ9A 1AUTC 1EB1H 1LMWB 2V7QD 4RSPA 2ZU4A 3P95A 3U1IB 3PRBA 4B71A 1E0FD 4X8TH 3EE7A 2W26A 1K1PA 8GCHF 1HPGA 1UHBB 1MTSA 3ZZ7A 1CHGA 4A92A 2AS9A 5DP9A 3SJ9A 1NU7B 3RM2H 2IJD1 2VVUA 4FUIA 3RC5A 3RXGA 2CK3D 2NU1E 3TLOA 5F8XA 4I86A 4X8UH 3TJUA 1FMGA 3F68H 1ELCA 4X2XA 4CREA 1NROH 4MPVA 1BHXF 1HJ8A 5AF9H 1P3EA 1AY6H 3OTPA 4FUDA 4YLUA 1CGHA 1GBLA 1W8BH 2TIOA 3RXCA 3LGWA 4E7NA 1DUAA 2Q6GA 2C8ZB 1G37A 2J2UA 3TJOA 6GCHG 5JBTA 3GCNA 1B7XB 1YPLH 1FY5A 1EOLA 5EIYA 1TX8A 1V2VT 1Z8GA 2Z7FE 1BMFD 2BDCA 2SGDE 1H8DH 3VXEH 1ELFA 3UOUA 1GVZA 1JMOH 8LPRA 2ZEBA 5EJ1A 1P2JA 1O5EH 4GAWA 1KIGH 1MCTA 1GDQA 4BOHA 1RIWB 2QY0B 2HNTE 1LHGH 3PWBA 1F7ZA 3TNTA 4NSYA 1V2QT 1KXDA 2UUJB 4I33A 1HAVA 4ABJA 4OGXA 3VB5A 1IQLA 1GHBF 1C4Y2 2ALPA 1MAYA 5KECA 1F0SA 1FY1A 1GHXH 1D6WA 4FUBA 1OKXA 1W7GH 2ANYA 1SQRA 1UHBA 3SV2H 1FONA 1WYKA 3SQHE 1MQ5A 4Q4LA 3EDXB 3K6YA 3TGKE 1GG6C 4ABAA 3V12A 5FBIA 1DVAH 1TPPA 2WYJA 2TGTA 1DPOA 5T1VA 3K6ZA 1UTPA 2P16A 3KQCA 2SGQE 1XXDA 4XE4A 1SGRE 3FANA 3CS0A 5AFZH 1Y3XA 5DP5A 1H8ED 2GT7A 1M9UA 1ANCA 2FLRH 3GCTF 2QC2A 1C1PA 1J14A 1TIOA 2HPPH 2UUYA 2AYWA 2XTTB 1OP0A 1Z1IA 2PSXA 3RXPA 4CRBA 3E8LA 3SU6A 3W1EA 1CU1A 4K8YA 4AGJA 2BY5X 3Q3YA 1SLVB 2ZDNA 1V2JT 1C5PA 4O9VA 1OX1A 3PMBB 2ZFTA 2XCFA 5HXFA 3LJJA 5BRRE 1UTJA 4AORA 3B23B 5A2MH 1T8LA 2KAIB 1NM6A 4FUJA 3U1JB 1C1MA 3LC5A 1A0JA 2VIQA 4OGYA 5GDSH 1KMHB 4VGCC 1PYTC 2F4LA 6CHAB 1MMJN 1A2CH 1GL0E 4ZKSU 4WJG2 2EEKA 2OTVA 3P8GA 3A7ZA 1TPOA 2R9PA 1KTTB 1RXPA 1C5YB 3N7DA 1ZGVA 4F55A 4ABGA 1O5BB 2AGGX 2GX4A 1IHSH 1ZPZA 1CSOE 3M5OA 4WH6A 9LPRA 4ASUD 1U6QA 2V3OH 4Y71A 1FY8E 4QT8C 5EOKA 1GBKA 3AVZA 1V2OT 1ZHRA 2FI5E 1W10U 1DE7H 3B9FH 1YBWA 1YGCH 2H9TH 2Y5GA 3ZVBA 1FUJA 4NA8A 1KY9A 2EI8A 2VBCA 5JBAS 1GJAB 2NWNA 1IQKA 2OINA 2QXIA 4NA7A 3UB0A 3OSYA 1CHOF 3M36A 1HJ9A 2C3SA 4O3UA 3SGAE 1C5RA 5EPNA 1V2LT 3FP6E 4MNVA 1ZTKA 2W3IA 1QQUA 1SGCA 4X1SU 1EAXA 2EI7A 3FAOA 3UNSA 2NU3E 2AGIX 5C3NA 1EATA 2XC0A 1SR5C 3PTBA 1WV7H 3UR6A 4R8TB 4ISOA 5IDKA 2ASUB 2YMSB 1F5KU 4XBBA 3H7TA 3SV6A 1BITA 3RXIA 3A88A 2FOFA 1CQQA 2AIQA 1RIWC 3LDXH 3SW2B 1GPZA 2PR3A 1ESTA 1VKYA 1C5QA 4I8KA 4XFQA 2C8WB 4Q63A 3GYLB 2BY6X 3LGUA 4CH2B 4KP0A 3ZZ3A 2WPDD 2M2AA 2GVFA 2XWAA 1VJAU 1C1TA 3PYHA 1SPJA 1AQ7A 2P3TB 2AHME 1C2IA 1EX3A 3PO1C 4NWKA 4GHTA 2ANMH 1C1VH 4AFQA 2BLOA 4MPUA 3URCA 3BTFE 1OWHA 1S6LA 1C5OH 1H8HD 1TBZH 1V2PT 2RA0A 3GDUA 5ETXA 2RA3A 1LVMA 3T26A 4ZKNU 5EXMA 2JJ1D 1C5MD 2ZGBH 4Y0ZE 1D6RA 1TBRH 1EQ9A 1H9LB 2W6JD 1TWXB 1FZZA 3P6ZB 2UUFB 3P70B 1GJ5H 1EZUC 2BXTH 4ZXXH 1OS8A 1P01A 3KQEA 5F8TA 2QCYA 3FO8D 3KF2A 1IOEA 1GMHF 1C2HA 2SFAA 2BX3A 2KCYA 2R2MB 1A5HA 3EA7A 3IITA 3MO6A 1BTYA 1V2KT 4AOQA 1QRZA 1LPGB 2EA3A 3F2GA 1EJNA 4INHA 4LK4A 1Z6JH 2YMSD 3LT3A 4TY7A 1OWEA 1O37A 3QK1A 2AMQA 1C5UA 1XXFA 1HAZB 1BB0B 1HXFH 2A4QA 2RDLA 4E7RG 1P2NA 3U28C 5DO4H 2C8YB 1V2MT 3M7UA 1W3CA 1SHHB 1TGSZ 1UW7A 3V0XA 3ZVAA 3UREA 4INLA 3DD2H 1FY3A 2XWBI 4J1YA 1A5IA 3QX5H 1MTUA 1G2LA 1HCGA 5C1UA 2WV9A 1GBIA 1PYTD 3T28A 3U98H 2D1JA 2VWOA 1CBWB 2ZU2A 3RXDA 1C5XB 2VIDA 1O2XA 4ZAEA 1AD8H 5IK2D 1LHDH 5DG6A 1UTNA 2VVCA 2JJ2D 5DSFA 2XC4A 5PTPA 1BRBE 1GI8B 1C5ZB 1TMTH 5F6MA 4OS4A 1NC6A 1THRH 1XUHA 2W5EA 3S69A 1AE8H 1QL7A 1ZSKA 1TYNA 1LPKB 3E91A 1YPGH 2HPQH 4UFEH 1G9IE 1EP5A 2QV1A 3F3BA 4MPWA 2FP7B 4NCYA 2BQWB 4CRCA 2CF8H 1O2YA 5B6LA 5CHAB 5A0AE 4Y7AA 2SGEE 3H7OA 5FXLA 4E05H 1O2WA 1TGCA 3NXPA 3SNAA 1S0QA 4JYUH 1YWUA 2RG3A 1GHBG 1GHAF 3GCTG 4Z1MD 4O3TA 3SUEA 2H5DA 2ZWLH 4NIYA 2HRVA 3QTVH 2ZGCA 2VWLA 5L30H 2BD2A 5CHBA 4YTAA 3W94A 1QRXA 3A8CA 1NRSH 1QA7A 1AB9C 5I46H 3ZZ8A 2VB0A 2BX4A 3QZQA 1VCQA 2XOKD 2K8IA 5I25A 3OE7D 1GBAA 4I31A 1GCTB 3MFJA 4I32A 1WXRA 3V13A 1K0HA 1GJDB 2P94A 2G81E 3PRDA 1J8AA 1PPBH 4FUEA 3NZIA 4CRAA 4XDEA 2LPRA 1P05A 5KEDA 1W12U 1QY6A 3SQEE 1CT2E 2CV3A 1OHHD 1TPAE 4IMZA 2FOEA 3N7OA 1Z8IB 1TE0A 1PQ7A 2XXLA 3SN8A 1C9TA 1TABE 3L6PA 2XBXA 9ESTA 1O2QA 2KFWA 1DLKB 3OYPA 1SSXA 1ABJH 2F9NA 3STIA 4FOUC 4XBDA 3BEIB 2J4IA 4ABHA 1J9CH 2F9UA 1ZTLA 3OX7U 4U2WA 4X1RU 4KGAA 1SGTA 3PO1B 4XOJA 2AFQB 1LKBA 2HLDD 2PUQH 2AMPA 1K1OA 3D65E 3ELAH 4X6OA 1O3KA 1T31A 3MH5A 1Y3VA 2JH6D 1BBRH 2ODQA 2BOHB 2BDAA 4BAKB 2Q6FA 5HMAA 3MH6A 4HFPB 1BTPA 3BTME 2YNBA 4WVPE 1NBME 1BMAA 1WQSA 2PWXA 1A0LA 1AFEH 4O97A 3SJKA 1KXCA 3K65B 2F9OA 1O3PB 3QO6A 3PM3A 3S9CA 1UVOA 2ZP0H 1A4WH 1AWFH 1XKAC 3UWJH 1C4V2 3H09A 1G3BA 1SOZA 1GBTA 1C1OA 2WPJS 5GCHF 1DXPA 2NU2E 1ESAA 1ELEE 3MO9A 1PPZA 3QUMP 1GHVH 3MO3A 4A1TA 5T6DA 3Q77A 1YYY1 2F91A 3EA8A 1BIOA 3RU4E 3UIRA 3RXJA 3V7TA 2PGBB 3ODFA 2VIWA 1AE5A 3K2UA 5CHAC 2JIZD 1GJCB 2A4RA 4WF8A 1MCVA 3RDZA 7LPRA 2FOBA 4Q7ZA 5ESTE 1O32A 4X8SH 3KCGH 4DIIH 1W0JD 2F9BH 1TRYA 1HAGE 4TWYA 4ZUHA 3KNXA 5LH8A 1ZPCA 1O2TA 3BG4B 3C27B 3PV5A 2GGVB 4JZIA 1NT1A 2FTMA 4WMFA 4ABEA 3D62A 3UY9A 2Z9LA 2H2ZA 2O9QA 1TA6A 4ISHH 2BY7X 3O8CA 4TPYA 1VGCB 3VGCB 3GDSA 1C2JA 4AC9A 2FODA 2L74A 1EAIA 3M7TA
chains in the Genus database with same CATH topology
2ZGJA 5A8YA 2TGDA 4VGCB 2CJIA 3E6PH 3RXEA 5JBBS 3MI4A 2ZI2H 3ESTA 3ODDA 1GHZA 1TALA 1O3HA 3MTYA 3ATKA 3P8FA 2ODPA 1GCDA 1H9HE 4NIWA 1O34A 2FI4E 1P3CA 2GCTB 3TIUA 1VCPA 2ANWA 2PV9B 1TRMA 1Z7KA 1DOJA 3RXFA 8GCHG 2J94A 5GPIB 1NN6A 1DM4B 1H9IE 1EUFA 2A1DB 3GCHC 3KIDU 3VXFH 2F9PA 4I8LA 1K9OE 3BG8A 1SI5H 3MH7A 1S81A 1PFXC 4KTCA 1QGFA 5FCKA 4K1EA 3UNRA 2DE8A 3UUZA 1JIMA 2BHGA 4Y10E 1XUJA 3JZ2B 1FN6A 1QQ4A 3BIVH 1UK4A 1ZJDA 2ZTXA 2A5KA 1JRSA 1P2IA 4MTBA 1BBRK 1MUEB 3UFAA 3GISB 2WV5A 3A8DA 4TPIZ 3GDVA 3HGNA 1H8IH 4HZHA 4D7GA 1Y5UT 5EU8A 3DT0H 4DG4A 4JMYA 4MNYA 2R3YA 1TX7A 1AHTH 2XBWA 4ZHMU 1O3FA 5A8ZA 1KXFA 1ZGIA 4Y7BA 1SGQE 3NKKA 1UTMA 3VGCC 1T8OA 2BMGB 4B74A 2BLWA 3GOVB 1ID5H 3HKJB 1TONA 4JYVH 2Z3EA 1NRRH 1O0DH 1C5WB 1THSH 2FPZA 4JZFH 1O2NA 2A4OA 1CGJE 5JBCS 1BCUH 1EP6A 3LPRA 4RKJB 1GJ7B 1AGJA 2G4UA 3A87A 2O8WA 3SNEA 4Z6AH 3SV8A 4RKOB 3T25A 4AG2A 2BDBA 4MNXA 3Q3XA 1KTSB 4Y8ZA 3T5FH 1A3BH 4NIXA 1SGYE 2Q1JA 2G5VA 3RXAA 3S0NA 3QTOH 3GY8A 1LO6A 7GCHF 3O8DA 1QJ1B 4YLQH 5C20A 3RM0H 5K0HA 2GD4B 2THFB 3F1SB 2ZCLP 1QJ7B 1GDUA 3A81A 3L3TA 2PLXA 2ZU5A 1GHYH 1BOQA 2A5IA 3LGVA 3SNBA 3GYMA 5GIBA 2TBSA 4FU7A 2ZGHA 2G8TA 3FZZA 5AVDA 1T8MA 2Y6TA 1ZZZA 1A1RA 4JYTA 4UD9H 1O2MA 2XYAA 1Y3WA 1XUGA 1IHTH 1XVMA 3MWIU 1ZOMA 2WUBA 2BLQA 1BRAA 3TGJE 4AYYB 3PWCA 3F9FA 3A8BA 2XBVA 1HAYB 1L1GA 4DURA 1SLUB 2GZ8A 5G4BA 5EW1H 2NU0E 4IGDA 3BG4C 1EAUA 1GI9B 1PQAA 2OQ5A 1TGNA 2ZU1A 3AAVA 2Z9JA 1ESBA 2VGCB 4UFGH 1F5RA 1QBVH 2EI6A 3PMHB 4I8HA 5E0GA 3SI3H 2XNIA 4TYDA 3UNQA 3MMGA 1ANDA 4D7FA 3ZYEA 3O8RA 3SV7A 1NFUA 5C1YA 2OC0A 2P59A 1G36A 1ELBA 1NPMA 1SGPE 3BEFB 2ZPSA 4FUCA 2ZGXH 1MKXK 2QF3A 1E37B 2ZDLA 1B5GH 2CMYA 5DPAA 2W7SA 7KMEH 1S82A 1PQ5A 2A2XH 2AERH 2BVSH 3PTNA 1OOKB 2FI3E 1KXBA 1UVPA 3A83A 1KDQB 1GBFA 2VWNA 3SZNA 3OY6U 3Q3KA 4K69A 3JZ1B 1DFPA 2ZHQH 1C5LH 2HALA 2VIOA 3ATMA 3PMJA 1W13U 1W0ZU 4AYVB 3Q76A 4Q2KA 3QGJA 4Y11E 5EXLA 3MOCA 2W7UA 4X0WU 1LDTT 3ZV8A 3RLWH 2B5TB 1ETTH 5DP4A 2GMTB 1DT2A 1TAWA 2AEIH 4GCHF 1K1LA 4BAOB 1OWDA 2G5NA 1UO6A 2WPMS 1DXWA 1O2IA 1EJMA 4Q80A 3SU2A 1JOUB 3SU3A 1O3JA 1CVWH 1HAHH 5AHGH 2BD7A 3QGNB 3RXVA 3A7YA 1N6YA 3BN9A 1GGDB 1H1BA 4BTTB 4IW4E 2G52A 4DJZB 4X6MA 5LPEA 1CE5A 2YOLA 1HJAB 1W0YH 1SVPA 1YCPH 3GICB 1MU8B 3VB3A 1BRUP 1Q3XA 4GUXA 1C1RA 3ZV9A 2ZFSA 1D3QB 1QCPA 1SBWA 5CMXH 3ZZ4A 2BDHA 1EAWA 3CP7A 4B2AA 2VIPA 1QL8A 1TPSA 2W3KA 1F0UA 2OXSA 2QXHA 5TCCA 2H6MA 5FBEA 1L4ZA 3ENSB 3NPSA 1S84A 4HI3A 1KYNA 1XX9A 1WAYB 3A7XA 4JZEH 5F8ZA 2O8UA 4K5ZA 1T4VH 5EG4A 1FJSA 1O5FH 1K22H 3U9AH 4JK6A 1LPZB 4OS5A 1FPHH 1GDNA 1RFNA 4YT6H 2PW8H 2A0QB 5B6OA 1GBCA 4ABDA 2C8XB 2BDIA 4ESTE 1KSNA 4RN6A 1ZHMA 2BXUH 5EXNA 5C1XA 1K1MA 1HB0B 2ZPQA 1E36B 3P17H 3W95A 1N1LA 1Z1JA 4LXBH 4AZ2B 3SOSA 1UVUH 5L6NH 6ESTA 1RGQA 2ZG0H 3M3VA 1J15A 2D2DA 3TK6A 3E3TA 4F49A 2FS9A 2OC1A 4GHQA 2SNWA 1MZDA 3STJA 1NS3A 1BTWA 1OWIA 2ANKH 1AVWA 5EQSA 1GBEA 2A31A 3S9AA 4B76A 1TNIA 2ODYB 1Z8JB 2R2WU 1C1UH 2QAAA 3LOXA 4X2YA 4YM9A 1UK2A 1WUNH 2OBQA 2OUAA 2ZTYA 4FU9A 2G51A 4K2YA 4BAHB 4BANB 1DICA 4NFFA 1DUEA 1S5SA 1XKBC 1GMHG 1V6DA 1B0EA 3KHVA 2ZHFH 1C9PA 3DHKH 3AAUA 1QJ6B 3MU1A 2UWPA 2ILNA 3LH3A 3AASA 1V2WT 3PB1E 1EZSC 2FIRH 1AKSA 1PJPA 2HLCA 3TH2H 4A6LA 4CBOA 1HIAB 4D8NA 1LQEA 1CO7E 3BTDE 1O3EA 1C2FA 3RXTA 1ACBE 5T6GA 2EC9H 1Y3YA 4THNH 1SGFG 4AGKA 3A89A 3LC3A 3UWIA 1YLCA 3TJVA 5L2ZH 1GJ6A 4A7IB 1AO5A 3MH4A 4ZROA 2BM2A 1P9UA 2AMDA 3HK6B 4X6PA 1DY8A 2GCHF 1UMAH 2PFEA 1TNLA 3MU5A 3PV4A 1O31A 5EODA 3MHWU 1CT4E 1HRTH 5CE1A 1BJVA 3BF6H 2F9VA 2AH4X 3M61U 2GTBA 2WPIS 4DW2U 2CHAB 5GCHG 1MKXH 1W14U 5C2ZA 4H6SB 2CGAA 2PKAA 1SGNE 1X7AC 1TFXA 3HKIB 4FU8A 1ARBA 2ZQ1A 1F5LA 2OQUA 1OXGA 1SFIA 1MZAA 3KQBA 1AZZA 1K21H 3QDZB 1PPHE 1D9IA 1V3XA 1P04A 3LGYA 3M5NA 1O3BA 3EE0B 1O3OA 2PKAB 1DSTA 2OLGA 5HM2A 1RD3B 1G30B 1EKBB 2JETC 3NWUA 1UJ1A 3RXBA 6CHAC 3GY7A 4GPGA 1AVGH 1TX6A 4INKA 2GCTC 1KXAA 5FAHA 2FDAA 1IQNA 3KN2A 1SLWB 3HGPA 1FAKH 1LHCH 1EXFA 1LCYA 3VB7A 2BY9X 4MQAA 3IG6B 1OWJA 2RCEA 1JIRA 2PUXB 1TQ7B 1O2VA 1GJ8B 1HGTH 2FX6A 1YPHC 2QN5T 4SGBE 1MTWA 3I77A 4DVAU 1O3NA 2QF0A 1UK3A 3ZVEA 1Q31A 1DWCH 3F9GA 1G32B 1Y8TA 3SJOA 3GY5A 1MD7A 1C2LA 1PQ8A 1ANBA 1O2PA 1QRWA 1SGDE 2GV6A 3SUGA 1TQ0B 1O3LA 4B2CA 1ZMLA 2ZCKP 3D23A 5IYTA 1UCYE 6LPRA 1QIXB 4JCNA 1AVXA 1EZXC 1OYTH 2BD3A 2O8TA 1LVBA 1GL1A 3ZVGA 2H9EH 1EPTB 3M37A 1FPCH 1O2LA 1TOCB 1GMDF 1NRQH 5JB9S 1GBDA 2NU4E 3M7QA 1SFQB 4F4OC 5DJ7A 1V2UT 3UTUH 3DFJA 2ZHEH 4WH8A 1HAXB 2P3UB 2FOMB 8KME2 4NG9H 1FV9A 1QURH 2FZZA 4U32A 1ELDE 1EJAA 5HGGA 5TJXA 4E06H 3IWMA 2M5TA 2Y7ZA 2O8MA 1TGTA 2TPIZ 3M3SA 3SU0A 1GBBA 1RRKA 1XUIA 2GKVE 2H5CA 3GY3A 3SU1A 1HBTH 4BXSA 3BTEE 5GWZA 1VITH 1P11E 1Y5AT 7GCHG 1YCPK 4I8JA 1Z6EA 2VGCC 2BD5A 3ZVFA 2CF9H 1GMDG 3RXKA 4A5TS 1WQVH 1JWTA 2F83A 3SUDA 2QYIA 1HFDA 2SGAA 4ASHA 4YESB 1F0RA 2XRCA 1XUKA 5C5NA 1FIZA 4YO9A 3ZZ5A 5JB8S 2R3UA 3LGIA 1C2MA 4MNWA 1S6FA 1UVTH 1ELAA 4WMDA 1DX5M 2CXVA 1Y59T 1HXEH 1PPEE 3NCLA 1O35A 5DGJA 3VB4A 1G2MA 1C5NH 1CHOG 3BTKE 4U01A 6GCHF 2BOKA 1SMFE 2ALVA 3FFGA 5H4IB 4GSOA 3UPEA 2FXRA 4CRDA 1DDJA 2BTCE 2WUCA 1BTZA 2P95A 4MDSA 1QB1A 4JZDH 3KGPA 1LKAA 3RP2A 2G4TA 2AGEX 2XCNA 5E2OA 2A32A 1O33A 4Y0YE 1MQ6A 2Q6DA 1AWHB 1AFQB 4OS1A 1BTUA 1FN8A 1EPTC 4BTUB 1PPGE 2QGRA 1FXYA 4D76A 2TGPZ 3GCHB 2H1UA 1CBWC 3A80A 1SLXB 4FUHA 5E0JA 1SQOA 4FVDA 4AN7A 5JPMH 2P93A 1GBMA 1O30A 1DS2E 3SBKA 1OYQA 3LH1A 1IQEA 3SV9A 2JETB 2O8LA 3D49H 3DA9B 1NESE 2WPKS 2ZHWH 1IAUA 1EASA 2BVRH 2BD4A 1BMMH 1GJBB 1HAOH 3SU5A 2G00A 5EGMA 1KXEA 1YPEH 2D26C 4ISIH 3ITIA 3RU4T 2C93B 2ZDVH 1QB9A 1FLEE 2FLBH 4B73A 1O2JA 1VGCC 4ZH8A 1GHAG 2GDEH 4H6TA 2OP9A 3A82A 1K28D 1SOTA 4YOJA 5HM9A 3A7WA 1MKWH 1GI6A 3O8BA 2ZFPH 1RJXB 1O36A 3TNSA 4X8VH 3BTHE 5AFYH 1BTXA 3MU8A 1PPCE 2ZF0H 1O2ZA 4ABFA 1VZQH 5F03A 3RXHA 1YPKH 1K1IA 4IC6A 2PTNA 2B8OH 1J16A 1LQDB 2GP9B 1BUIA 4Q7XA 4WXIA 1Q2WA 2B0FA 1AN1E 4TY6A 3TK9A 2QIQA 1NRPH 3BTGE 4I7YH 2OC7A 2I6SA 1O3AA 1TNHA 4TWWA 2SNVA 1RS0A 2BVXH 5FCRA 4B1TA 3SGQE 1GI4A 4ZKRU 4HTCH 4DIHH 1AUJA 3T27A 2PGQB 1L4DA 1ZR0A 2J38A 1HDTH 1BA8B 1DWDH 1OPHB 1S83A 1YKTA 4WY3A 3MNXA 4SGAE 3LKWA 1GWAA 5A09A 1P12E 2FOAA 2Z9IA 2Z9GA 2JH0D 1RTFB 4K1SA 3VB6A 2BB4A 4X2VA 2Z3DA 1DWEH 4GLYA 3S9BA 3ZZCA 1DITH 1Y3UA 5EQRA 4BNRA 2A7HA 1NU9A 1XM1A 2FESH 2ZO3H 1JRTA 2FS8A 1VJ9U 1C5VA 4I8GA 5ESBA 1IQHA 2PKSC 4AX9H 2J92A 2Y5HA 3SGBE 4CR5A 1GMCG 2GZ7A 1NTPA 2BD9A 3A7VA 2HNTF 1BJUA 4Q7YA 1GBJA 2OCVB 1W11U 4YZUA 1T7CA 3VFEA 1UCYH 3MYWA 2ESTE 2BDGA 3ATIA 1UTKA 2H9HA 1Z8RA 3SI4H 2UWOA 1NY22 4LZ1H 2ZA5A 1CGIE 5A0CA 1XVOA 3GY6A 1D4PB 2VNTA 3BIUH 1TNGA 5SGAE 3F9HA 1EOJA 1E38B 3E16B 4K8BA 1P09A 3EQ0H 2ZKSA 1V2NT 3V3MA 4ISLA 3VEQB 1SL3A 4K3JA 1O2SA 4CBNA 4A1XA 4WMEA 1ZSJA 3T29A 4MVNA 1QL9A 4J2YB 2ZIQH 3U8RH 2STAE 1UTOA 5EQQA 2J9NA 5GJ4B 1KLTA 1UTLM 4CHAC 1MBQA 1ORFA 2FX4A 1UVSH 1TNKA 4X1NU 1GHWH 5HYOA 1D3TB 3UQOA 2STBE 2WPLS 2ZZUH 1QA0A 2TRMA 2WINI 3LU9B 1E35B 3PLBA 4WWYA 3S7HB 1GVLA 2FOCA 3MNSA 3BV9B 1K1JA 1TMBH 3I78A 4FXGH 5T3HA 1CA0C 2A4GA 4NZQA 1EPTA 3VPKA 3NK8A 4OS6A 3ZZ6A 2FYQA 1WSSH 3BTWE 1HYLA 2ZHDA 2OBOA 2GCHG 2GZ9A 3DFLA 3PLPA 2HGTH 4NFEA 4AB8A 4Z0KA 2FOHA 1YPHE 3AW1A 4ZHLU 2DE9A 2FO9A 1MTNC 3I29A 1N8OC 3S7KB 3F6UH 1B0FA 1BHXB 3Q00A 8ESTE 1IQMA 1O3DA 1C2EA 1ELTA 1LHEH 5LPFA 1SB1H 2GDDA 3K9XB 2AIPA 4MPXA 5DP7A 2A2QH 2B7DH 2BLVA 1OP8A 1S6HA 5DP8A 4CR9A 2YNAA 3TGIE 1F0TA 3G01A 3RXOA 2V0BA 3SNDA 2VINA 1AZ8A 1TB6H 3A7TA 1GI2A 3U8OH 1C1NA 3E0NB 3PROA 2XW9A 1NFXA 2P8OC 1FIWA 7ESTE 1L2EA 1SGEE 2JH5D 3M5LA 1DLEA 4BAMB 1N6XA 3A84A 4KKDA 1ARCA 2ZDAH 3WY8A 2ZDKA 2ZQ2A 4YT7H 1P02A 1GI5A 1P10A 1C4U2 4ZHAA 1YPMH 2VVVA 3HK3B 3SNCA 1L1NA 3TVJB 1YM0A 1GBHA 2V6NA 1D3DB 3MU0A 3B8JA 1TMUH 1UCYK 1EZQA 2DUCA 2VJ1A 1SQAA 1V2RT 2I6QA 1C1QA 3PMAB 4IBLH 1C2DA 4AG1A 2FYRA 1THPB 3E1XB 4KELA 4ISNA 1PPFE 2VWMA 2FTLE 2BQ7B 1HAIH 2ZFRH 1JBUH 1DANH 1HAVB 3QZRA 5J4SA 1ZJKA 1K1NA 2PKSB 3KQDA 1T32A 2F3CE 5EPYA 1QBOA 4Y8XA 2FEQH 2PTCE 2HOBA 1P0SH 4GVUA 1KDQA 5E0HA 4X