4DGJA

Structure of a human enteropeptidase light chain variant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
235
structure length
235
Chain Sequence
IVGGSDAKEGAWPWVVGLYYDDRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAILGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPISLPEENQVFPPGRNCSIAGWGTVVYQGTTADILQEADVPLLSNERCQQQMPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYECALPNRPGVYARVSRFTEWIQSFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enteropeptidase catalytic light chain
publication title Crystal structure of a supercharged variant of the human enteropeptidase light chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 235
sequence length 235
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dgjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dgjA01
1KXDA 2C3SA 2W5EA 3LGTA 4INLA 2WUCA 1K9OE 1EOJA 1HJ9A 1A5HA 1AY6H 4Q2KA 4WY3A 1TOMH 2IPHA 1CHOG 5AFYH 1FUJA 5DP3A 5DP6A 3MFJA 1ZPBA 1C1SA 2ZI2H 1O3PB 3E16B 3MYWA 4ZKRU 4DOQA 6LPRA 4KP0A 5DO4H 1V2TT 1DE7H 4BXSA 3BEFB 1BITA 1JIMA 2SGFE 1O3LA 3OU0A 3SU4A 3C27B 3E91A 1NY22 4WXVA 3B9FH 1UHBA 4NSVA 1N8OC 1GI8B 3BIVH 2UWLA 2G5VA 1AZ8A 4QT8C 1ZJKA 1BB0B 3AAVA 3RXHA 4NIWA 1ANEA 4X2VA 1ZTLA 3A89A 1IHTH 2W7SA 2J4IA 4OS6A 1P3EA 3LH3A 1EAUA 2PUXB 3MO9A 1RS0A 3RMNH 1IQKA 1C2LA 3T62A 2VIQA 1FAXA 3D49H 5GCHG 1EZXC 2CHAC 4HTCH 4ABIA 4X8TH 2TGPZ 2HNTF 2BY5X 2VGCB 2DE8A 3BTKE 3VB5A 1LVMA 1T8MA 4X8SH 4MDSA 1DOJA 1UVTH 3FP8E 4THNH 2SGDE 1VZQH 2O8MA 1OWJA 1V2OT 2ZHEH 2F9OA 2AGEX 1FDPA 2SNWA 2SGPE 4DY7B 8LPRA 1MBQA 2V6NA 1BDAA 2PKSB 1RTKA 3E90B 1T4UH 4NG9H 3IG6B 1GBIA 1HJ8A 2Y80A 3LGYA 1PYTC 1TBQH 3DUXH 3SZNA 3BTGE 2HPQH 2B9LA 1PQAA 4CBOA 1P57B 2ZF0H 1LVOA 2ZU3A 1VCWA 1MKXH 1ELAA 1EB1H 1NC6A 4CR5A 2G81E 1O3DA 4JZFH 1GHYH 5DG6A 1K1MA 2ZDVH 4BAQB 4MQAA 2PKAA 2VWMA 3URCA 3QTOH 4ABJA 2OBQA 2ZDLA 1V2LT 4NZLA 1HXEH 3TGKE 3ZVAA 5LPRA 1O5EH 1FQ3A 1OP8A 2J34A 2P3TB 4B76A 1ESTA 3O8RA 1CBWB 1F92A 4Q80A 4CRGA 1GJ7B 1C2FA 1KXEA 1O3AA 2IJOB 2ZGXH 3M37A 4J1YA 2OLGA 1O35A 2D1JA 1BHXB 4WWYA 4H6TA 2XBXA 4BTIB 1EAWA 1KXBA 2QXGA 1C1VH 2A0QB 1ESBA 1NFWA 4LK4A 3AW0A 2BD4A 5CMXH 1MZAA 1CE5A 3T28A 5JPMH 4B2BA 1D3TB 2H5CA 4OGYA 1O2MA 4ZUHA 2BYAX 1O37A 1TB6H 1EATA 2Q6FA 3PMHB 3TJUA 3PV4A 1C9TA 5HM9A 1SB1H 1ANBA 2BY7X 1O2ZA 1Z8JB 1A4WH 3MU0A 4F49A 3SU5A 3KQDA 1OWIA 2G4UA 3K6ZA 2NU0E 4ZKNU 2ZTYA 4K60A 2ZU4A 3A7YA 2SGQE 1YPLH 3SBKA 2TIOA 1ZYOA 2ZFTA 1JWTA 1GI6A 1BRCE 2ZFFH 1C1UH 1P04A 1ZPZA 1QJ7B 8KME2 5L6NH 3S7KB 1O3HA 5GWZA 1QL8A 1Z8GA 2Z3DA 2Y5GA 1CO7E 2FS9A 2FO9A 1DUEA 2CF8H 3A85A 1RGQA 3MU8A 3S0NA 1OXGA 3MOCA 4RN6A 1HV7A 1S0RA 1AE5A 1W13U 2P8OC 1F0SA 1NROH 4IC6A 1SOZA 9ESTA 2BD3A 1TONA 3Q77A 1EB2A 1TLDA 3GY3A 1P10A 1T8NA 1DWEH 3KF2A 3SV7A 1LQDB 3ZZ9A 2O8LA 4JK5A 2YNAA 3BTWE 3P8OA 2BDCA 1QIXB 1C5LH 1FXYA 1YPJH 1MKWK 4O03A 1B0EA 2H9HA 1GJ4H 4ABDA 1RTLA 6CHAC 1ELTA 1W14U 2Q1JA 3M5OA 2GD4B 3SU0A 3V0XA 3RXGA 1Q3XA 2ZECA 3W94A 2Z6BD 1Y3WA 1C1RA 3S69A 1O2GH 5FX6A 1FONA 4K3JA 2BX4A 1PQ5A 4LZ1H 1C5VA 2I6QA 1MMJN 1WYKA 2A2QH 5JBTA 1CU1A 5DPAA 1G2LA 2ZDAH 4NIXA 1YF4A 1LHEH 5J4SA 3L33A 2ZP0H 3I29A 1MTSA 1HBTH 1TA2A 2ZGBH 4WMDA 4ZHLU 1SQOA 2ZDKA 1MU8B 3RU4D 1S5SA 1FJSA 1HAGE 3T26A 3ZZ3A 3MI4A 3MU4A 1YPHC 4XDEA 4D8NA 2AH4X 2OQ5A 2WUBA 1V2NT 1QTFA 1O33A 3UUZA 4R8TB 1GL0E 2JH5D 1UTKA 1GHXH 3EQ0H 1GJDB 1P3CA 4UD9H 2ZFSA 1SC8U 1AIXH 3FZDA 1YLDA 1UTQA 3U8OH 1YYY1 1QURH 3E6PH 1IAUA 4HZHA 1HNEE 3FVFB 2GX4A 2ZFPH 3F9GA 2GCTB 3AW1A 1AN1E 3MWIU 3QTVH 5K0HA 3ZV9A 1FY1A 2VGCC 3KCGH 2PR3A 1A7SA 1MD8A 4A92A 2G8TA 4ABFA 1AGJA 2VIVA 4YZUA 3TJOA 1HAHH 1BT7A 1C5MD 1C2GA 2XRCA 3PM3A 3TIUA 7LPRA 2PSXA 1A46H 1W7XH 1ANCA 4UE7H 2CXVA 3TH3H 2H1UA 1JXPA 2RG3A 1AVGH 1BIOA 1UCYE 2BQ7B 3RLWH 2STAE 3CS7A 2AMQA 1A1RA 1P01A 2F9NA 5C1XA 4FUCA 4JZIA 1T8LA 3GY5A 1C5UA 1XM1A 1O2YA 1SG8B 1DDJA 1YM0A 3GY4A 2J94A 1N8OB 2ULLA 1W7GH 4D9RA 3ENSB 1C2DA 5IYTA 3KNXA 1H8DH 1ELGA 4A1VA 2Y5HA 4XBCA 1OYTH 5GJ4B 4CH2B 1W0ZU 1NRNH 1C2IA 1XUGA 4K8BA 4X1SU 3UNRA 5EPNA 3SU2A 1P0SH 1AE8H 1L2EA 1T4VH 2HPPH 4INHA 3LIWA 1CHGA 3ZZ7A 1O2IA 3NK8A 3ATWA 2GZ8A 1SGQE 2FOMB 1IQIA 5F8ZA 3M61U 3FFGA 3M36A 2AERH 2XBWA 4F4OC 2BM2A 3M5NA 3T29A 2Z3EA 1JRSA 1MCTA 1O3GA 5LGOA 3EE0B 1O3MA 7ESTE 1LO6A 1OWEA 2GT8A 1CBWC 3LONA 5GXPA 1TAWA 1FY8E 3SHAH 4Y79A 1PPFE 1Z8IB 3LGWA 2OUAA 5A8YA 2KAIA 4MLFB 1O2VA 1V2WT 2FTLE 2NU2E 2EI7A 3RDZA 1CT0E 1XXDA 2AMPA 4FVBA 1UTLM 5C67A 4E7NA 1DSTA 3LGVA 2VINA 3RMMH 2HWLB 2H9TH 3F6UH 1ARBA 1TX6A 3GYLB 1HIAB 1TYNA 4X1NU 1FPHH 2TPIZ 1A3EH 4H6SB 4JYVH 1SLXB 1H9IE 1O2NA 2C93B 1KLTA 5DP4A 2OD3B 2GTBA 1NFXA 5GPIB 1JIRA 1QGFA 5L30H 1EPTA 2ZEBA 4JCNA 1C5QA 1LHCH 3V3MA 2B8OH 3S9AA 4AN7A 1A2CH 4AYVB 1P02A 1K2I1 1UVOA 2ODQA 1C1PA 3ZYEA 3SV9A 2UUJB 2UWOA 1YBWA 3ZZAA 1AWFH 4SGBE 1CHOF 4GUXA 1HDTH 1JBUH 4AFQA 2G51A 1PPHE 2SGEE 5FX5A 1HAVA 1GHVH 2GDDA 2FESH 3AVZA 1KDQB 2FLBH 2WPHS 3SUFA 5HYOA 2WPMS 2NU1E 3JZ1B 2XTTB 2OXSA 2BLVA 2GCHF 2FIRH 4K2YA 3BTDE 1ZRKA 3ZZCA 3A8CA 3RC4A 1S0QA 3ODDA 4MPUA 1QA7A 3TH4H 4BOHA 5C20A 5I25A 1W12U 1GDQA 3STIA 1O5BB 1O2SA 2FMJA 2C8WB 1AZZA 1E0FD 2PGQB 4IMQA 1GG6B 1TMUH 1KSNA 4AGKA 1ZTJA 3K2UA 1EUFA 2VVCA 1VGCB 3GDUA 3SGBE 5GCHF 3FZZA 1VJAU 2GV6A 5FHTA 2Q6DA 4NWLA 3KIDU 5LH8A 2BY8X 1D6WA 4FUBA 3SW2B 4Y10E 1CQQA 3SU3A 1Y3VA 1O3KA 1O31A 1L4DA 3I77A 3RMLH 3HGNA 3SNAA 4X1RU 2ILNA 3P6ZB 3T27A 2BXUH 1AUTC 1X7AC 4CRCA 3FANA 3A7TA 3F9EA 5A09A 1SLWB 3M3VA 3SU1A 2FODA 1HAZB 3RLYH 2FOEA 4ZKSU 1EJAA 2IOTA 1AVXA 2DE9A 2A4RA 2RA3A 3SGAE 3SNEA 3P8NA 3SUDA 4DIHH 3RXQA 2VB0A 3OTJE 4NA7A 3VB4A 5LPEA 5SGAE 3PMJA 1BRAA 2VNTA 2AEIH 1H8IH 1C1QA 4NCYA 2GP9B 1AO5A 3QDZB 1TA6A 1PQ7A 2Y82A 3SJ9A 1T31A 4I8HA 2ZG0H 5E0JA 2HALA 1GBBA 1VR1H 6CHAB 2WPIS 2I6SA 3CENA 3JZ2B 4FUFA 3MMGA 1QRWA 1YPKH 4OS4A 1FIZA 1ARCA 1GL1A 4LXBH 1A3BH 2C8XB 2CJIA 2FOHA 3M5LA 3SQEE 1GI4A 4XBBA 1YPHE 1ZRBA 2FTMA 1O2RA 2Y7XA 3UR6A 2P93A 1D6RA 1GBDA 1GCDA 1IQJA 2PV9B 1TGSZ 1O5FH 4ZXYH 1MZDA 3T5FH 1O3JA 3T25A 1GVZA 2QY0B 3LC5A 1JOUB 4AYYB 1XUKA 4GHQA 3A80A 3QWCH 1BTYA 3PYHA 1XVMA 1GJ5H 3SI4H 4NFEA 4ZXXH 2TGAA 4Q7XA 2BD9A 2ODYB 4ISIH 1HGTH 3SO3A 3LDXH 3P8GA 1C5YB 1IQFA 4U32A 1T7CA 4B2CA 1K1OA 2ESTE 2R2MB 1Q31A 2GCHG 1GMCF 3ZZBA 1EXFA 3MNXA 3UNQA 4X1QU 1AB9C 4D7FA 1LKBA 1GI9B 4PROA 4ZH8A 2BVSH 1P8VC 1VJ9U 1L1GA 3DD2H 2TGDA 4B71A 1TALA 3PB1E 1TBRH 2A4OA 4TY6A 2RDLA 1QQ4A 1MKXK 1H1BA 1FAKH 1P2OA 1C1TA 1ZGVA 2PTNA 1E38B 4XFQA 2GGVB 3HKIB 3RXFA 1C1MA 4GLYA 1S6FA 1SGRE 1O2XA 1ZR0A 3RXUA 3BEUA 2VIDA 3GDVA 3RXRA 2XBYA 5FPTA 5A2MH 4Y8XA 4ISLA 3SNDA 1P2IA 1Z1IA 4ASHA 1TOCB 3GCHB 3Q3XA 4ABEA 3GICB 3UOUA 4X8VH 4DG4A 1BTUA 1O3CA 1ANDA 1Z71A 1O3FA 1FV9A 1K21H 2B0FA 2SNVA 4YOGA 1KTTB 1O5CB 5EXNA 1QBNA 4A7IB 1ID5H 2ZQ2A 4UFGH 1T8OA 3GY6A 1TNHA 4K1SA 2PFEA 1DSUA 4NFFA 1TNLA 2VIWA 2THFB 1QY6A 1SHYA 1WV7H 2C8ZB 5FCRA 1GBTA 1IQNA 1EP6A 2P3FH 1KYNA 1ELEE 1XVOA 2R3YA 1LPGB 1DWBH 1WQSA 1N1LA 2TGTA 2ANWA 3AAUA 1QRZA 3M5MA 3SHCH 4A5TS 3SUGA 1OOKB 1ETTH 1DVAH 1OX1A 1FY5A 1TRYA 1BHXF 1EZQA 1WTHD 4IGDA 4BAOB 1LTOA 2Z9GA 5C1UA 3F68H 3SOSA 1TABE 2OBOA 4I8LA 4K1TA 2F9PA 1C1OA 2EA3A 1H9HE 1GMDF 2ANKH 4FUHA 1GBFA 1MU6B 5HGGA 4E05H 1DANH 5DP8A 1YP9A 4X0WU 1ZZZA 1NT1A 3AASA 3E0PB 1GG6C 3MTYA 2AYWA 1SGFG 1T32A 1A5GH 3RXBA 3OY5U 4E7RG 1VGCC 1DT2A 1DY9A 1ZMJA 3MNSA 3DFLA 3TLOA 2BDHA 1FN6A 1O34A 4I7YH 3U9AH 2PGBB 4TWYA 3OYPA 1GMCG 3OSYA 2ZKSA 3DA9B 1ZSKA 4BTTB 1RIWB 4CHAB 4X1PU 1FN8A 1IQMA 1EOLA 4KTSA 3E1XB 3KGPA 1Y5UT 1Y3YA 3LU9B 1P9UA 1ZHPA 4BANB 3A8BA 5B6OA 3A8AA 1E35B 2NWNA 3ELAH 1OYQA 5C3NA 4ZAEA 1K28D 2D8WA 1GJ6A 3NCLA 1LPZB 1O2UA 3UY9A 1KTSB 4ISHH 1AKSA 5DP9A 5J4QA 1SGPE 1ETSH 1GVLA 2GT7A 4VGCB 2FDAA 2WPJS 2A7JA 2OC7A 1DICA 3MH4A 1YCPM 3K9XB 1UVPA 1EAIA 1RD3B 4YO9A 1LQEA 3S7HB 4NA8A 3RXAA 2WYJA 1V2UT 4NGAH 2PUQH 2OINA 5PTPA 1DM4B 1HXFH 3MO3A 4D7GA 4ISNA 2B5TB 2XC5A 1OS8A 4XE4A 1AFQB 3VB6A 1K1PA 2FX4A 2TBSA 3EAJA 2ZPRA 4ABGA 1PQ8A 1XUIA 2BOHB 2Z9KA 3BEIB 4ABAA 1UTMA 1EJNA 2OC0A 1BMNH 3GY8A 3NUMA 4I32A 2M5TA 2PSYA 4CR9A 4AZ2B 1Z7KA 2SFAA 4FUEA 2VH6A 2BLOA 4TY7A 1OP0A 3QN7A 5DK1A 3LKWA 1INCA 3LC3A 3M3TA 1SGFA 1O2HA 2LPRA 1TFXA 4X2WA 4YOJA 1TGCA 1V6DA 3OX7U 5AFZH 3ZVFA 1C5OH 4X2XA 2A5IA 1ACBE 5EXMA 1C5TA 2LNCA 4Y0YE 2ZNKH 1D3DB 1QFKH 3ZZDA 4OGXA 2WINI 4YLQH 4DCDA 2C90B 1KXFA 3SI3H 3TK6A 1PPGE 4CREA 1O3OA 1M9UA 2QN5T 1BMLA 1NZQH 4Y7AA 2ZCLP 1GMDG 5EU8A 1MQ6A 2JKHA 2WV5A 4XOJA 2ZU5A 1P2NA 3D23A 3TVJB 1YPEH 3IITA 4WVPE 2WPKS 5HM2A 2ZQ1A 4WH6A 5A0BA 3O8CA 1L1JA 1P12E 2QF3A 4I31A 3GYMA 4B75A 3ZVBA 1KXAA 2P3UB 3RM0H 4U01A 1J14A 3ESTA 5E0GA 2A5AA 2OCVB 5A0CA 3RC5A 4BAKB 1HAIH 7GCHF 1CVWH 1XKBC 1VCPA 1HCGA 1PPEE 2BZ6H 2GMTB 4KGAA 4IN2A 1CGJE 3SGQE 1GI2A 3ZV8A 1C1WH 1AMHA 1VITH 2ZHWH 2CMYA 1QL7A 3NPSA 3R3GB 3EYDA 1QB1A 1HAOH 1J15A 4UEHH 3GCHC 1TX7A 2EI8A 2BD5A 1KY9A 1TGBA 1D4PB 2ZHDA 4AFSA 4D9QA 1MTVA 4JZEH 1NS3A 4UONA 3QK1A 1NRQH 1DPOA 3P17H 2H2ZA 1SL3A 1UCYK 2Z9IA 5EODA 2XCFA 2BOKA 1AB9B 2SGAA 1C5RA 2AFQB 2ZO3H 1NU9A 1FZZA 3ZVDA 5A0AE 4O97A 1TBZH 1V3XA 1Z6EA 1NPMA 3SJKA 1SLVB 5AF9H 1NM6A 4E06H 4B2AA 1QHRB 2ALVA 3RUOA 1SSXA 1AU8A 3A83A 4MPVA 2V0BA 5T6FA 3VFEA 1HUTH 3QO6A 2O8TA 4B1TA 1BTHH 2ZTZA 1Q2WA 1KLIH 3PMBB 1GJAB 2D2DA 1AI8H 3U69H 1UHBB 1PYTD 1UCYH 1S83A 1GBCA 3RXMA 2QYIA 1THPB 1H9LB 1G3CA 3MU1A 1UTJA 2EEKA 3ODFA 4SGAE 1C1NA 1V2QT 3O8BA 2QV1A 3M35A 1AUJA 2FZZA 4Y11E 8ESTE 1LHDH 4A1TA 1GWAA 1F2SE 2XWBI 1RFNA 2XW9A 1THSH 2FX6A 4I8JA 6GCHF 1BJUA 2VIOA 1O2LA 1V2VT 1IQLA 3BTME 1Y59T 1O2WA 3D62A 1GBAA 5LPFA 1EP5A 1W11U 2ZFQH 3FAOA 1RIWC 4CHAC 1UK4A 1VITG 2ASUB 3BV9B 1MCVA 1S82A 4TPYA 3TK9A 2ZGCA 1BMMH 3UQVA 1HB0B 5CHAB 1L4ZA 1TPAE 1Y8TA 1YC0A 2PHBA 5EQSA 3SJIA 2G00A 1GHWH 1AWHB 1K1JA 3U98H 5EPYA 4DVAU 3RXJA 1GGDB 1XUHA 2BLQA 2BTCE 1EQ9A 2H9EH 2ZHQH 1O5AB 1P11E 3E8LA 5DJ7A 3TGJE 4VGCC 3V13A 7GCHG 4UDWH 4ISOA 2GZ7A 2FYQA 1XX9A 2Y5FA 1OPHB 1E37B 1OP2A 2XXLA 1GHZA 2PKAB 1O3IA 1HPGA 1C5PA 2FM2A 1G32B 4DJZB 2BXTH 2FOAA 4YTAA 1V2ST 3M7TA 3HKJB 1A0JA 1B5GH 1D3PB 1C5SA 1AFQC 1O30A 1TMTH 4MNWA 4YOIA 3RU4T 4O3TA 2A2XH 2O8WA 2A4GA 1C9PA 2R2WU 3PMAB 4YT6H 1S85A 3LOXA 1Y5AT 3OY6U 4RKOB 1IQHA 1P09A 1GHAF 2W26A 1SFIA 2F83A 2GKVE 3TNSA 3SJ8A 2FOFA 1Y3XA 1K1IA 1IHSH 3GOVB 5EW2H 4YT7H 4X8UH 1K1NA 3GY2A 3UFAA 1FNIA 3RXKA 4X6OA 1FMGA 1HFDA 5AHGH 5BRRE 2ALPA 1O5GH 2ZC9H 2BD7A 1O3EA 4WMFA 1DS2E 5F03A 1PJPA 5C5OA 1NU7B 2CN0H 1E36B 2ANYA 3K6YA 4MNXA 1ZSJA 1Y3UA 1GI5A 2ZPQA 5F8XA 5TJXA 4K5ZA 1WU1A 1ELCA 2FOGA 1XXFA 1UK2A 1P03A 1W0YH 1F0RA 3EA8A 1DITH 1WOFA 2J92A 1GBMA 1W3CA 1E34B 1ZJDA 2XYAA 1C2JA 4NSYA 1C5XB 5ESTE 1ELBA 1C5WB 2ZCKP 1MTNB 2ZCHP 3RC6A 1BCUH 3PLKA 2ODPA 3SN8A 4K69A 4UFFH 3S9BA 1MUEB 5DGJA 4RSPA 5FBEA 1W2KH 5I46H 1QRXA 2A7HA 5FPSA 1N6YA 2FP7B 5EW1H 1BBRE 3RXEA 2UUYA 3UOPA 3DFJA 6GCHG 2AGIX 4JK6A 1U6QA 2Z94A 4JMYA 3UQOA 2STBE 2A31A 5GDSH 3UREA 4Y7BA 1CGIE 1QBOA 1WQVH 1YKTA 8GCHF 4H42U 4HGCA 1RRKA 3NWUA 2QCYA 2K1QA 1J17T 5E8EH 1EZUC 1O38A 2P59A 1BBRK 2GMTC 2O8UA 2BDIA 5FAHA 3TITA 2V3OH 4HI3A 4OS1A 3E3TA 1C5NH 3RM2H 2ZPSA 2BHGA 4KKDA 5F8TA 3HGPA 2BDBA 3V12A 1YPGH 4YLUA 1SI5H 4JZDH 2J95A 2C8YB 1WTGH 1D3QB 1ORFA 1MTUA 3I78A 3MH5A 2JH6D 1DWCH 2QAAA 1UMAH 2R0LA 3F9FA 3TH2H 3M3SA 1LHGH 1RXPA 3UIRA 1C2KA 2HVXA 1MH0A 1YLCA 4ABBA 1J8AA 3SNBA 1B0FA 3PTNA 1SGCA 1ZTKA 3TPIZ 2FLRH 4B74A 1GI3A 3P95A 1BBRH 1V2JT 1FLEE 1N6XA 4UFEH 1SLUB 1C4U2 1THRH 1RJXB 3NZIA 4IBLH 4ZKOU 2FI4E 2BX3A 2HNTE 4RKJB 1G36A 4O9VA 3P70B 3HK6B 1GJBB 4GPGA 4WH8A 1GHAG 1GBEA 1UVUH 1CT4E 3A84A 1SOTA 1BTZA 2PTCE 2G55A 1TNJA 3HK3B 3MU5A 2H6MA 2BMGB 3A88A 3A86A 3VPKA 1HIAA 1XKAC 4I8KA 4U30A 2QXHA 3L3TA 3F1SB 1D9IA 1SQAA 3Q00A 4ZMAH 1HLTH 5E0HA 1ELDE 4AB9A 3QZQA 1TPSA 2Z3CA 4GAWA 2Z7FE 1RTFB 4OS7A 4ZHAA 2ZA5A 3WY8A 1SGIB 1QL9A 1AVWA 4X6PA 5K7RA 5EG4A 4A6LA 1W10U 4WJG2 1GCTC 2GV7A 1Z8RA 2RCEA 3E0NB 4DURA 3LGUA 1KDQA 5AVDA 1TMBH 1L1NA 2VVUA 5H4IB 1F5KU 3VGCB 1O2TA 3BG8A 1DXPA 3BG4C 4DW2U 1P9SA 4K8YA 4GHTA 1K1LA 2GZ9A 5C2ZA 1LVBA 3UTUH 1DY8A 5CHAC 4CRFA 3LJOA 3HATH 4OS2A 3L6PA 2QF0A 5F6MA 3RXSA 2W3IA 1GMHF 3SUEA 2R9PA 4CBNA 1GGDC 2ZTXA 3ITIA 5CE1A 1G3DA 4R0IA 1UO6A 1AFEH 1FIWA 2G52A 3QZRA 4XBDA 5C5NA 3RP2A 3BTEE 4GVUA 8GCHG 2FI5E 2O9QA 6ESTA 2W7UA 1CA0B 2P95A 1SFQB 2DUCA 1V2MT 3N7OA 4B73A 2FOCA 1HAYB 3V7TA 4JZ1A 1O32A 4K1EA 1NRSH 3LH1A 3SJOA 3RXVA 4ESTE 3MHWU 1SBWA 1AHTH 3GDSA 1GJCB 5EOKA 3FP6E 3UWIA 5JBBS 2CGAA 1UJ1A 1HAXB 2V3HH 3SV6A 1W8BH 2HRVA 1BUIA 3M7QA 3VEQB 3W95A 1AD8H 1ZMLA 1TGTA 3QLPH 3D65E 4FVDA 1GBKA 3IWMA 1B7XB 3C1KA 1GBHA 2KAIB 3RXIA 4INKA 4TWWA 1XUJA 1SVPA 3ATLA 3MNBA 1IQEA 2BD2A 3TU7H 2XCNA 5L2ZH 3ATKA 1TPPA 4MNYA 5ESBA 3ZZ6A 2AIPA 2ZU1A 1GHBF 1DLKB 1Y5BT 5E2PA 1WCZA 4KELA 4NZQA 3ZYDA 3H7OA 3EGKH 1LHFH 3ZVCA 5A8ZA 1ZSLA 3LJJA 1C2MA 1YCPK 4CRBA 2EC9H 2XBVA 1ZHMA 2CV3A 2EI6A 2C4FH 3DT0H 1EPTB 1BOQA 3STJA 1G3BA 5JDUB 5IDKA 1F7ZA 4J2YB 3LGIA 2Y6TA 4MVNA 3ZZ4A 2BD8A 1MTWA 1ZGIA 1MTNC 1MAYA 3SORA 1UTPA 3K65B 2BDGA 1VCQA 4HFPB 5T6DA 4Y76A 9LPRA 1K22H 2AIQA 1HAVB 4Z0KA 5FPYA 3RXCA 5JBAS 4Q7ZA 1NESE 3BTQE 3QX5H 1GPZA 1UTOA 1NRRH 1ELFA 2QGRA 4AFZA 1DLEA 4FUJA 3LPRA 2J38A 1P2KA 1TIOA 2UUKB 3PO1B 5EXLA 2P16A 2J2UA 1YCPH 1BJVA 1C2HA 1CSOE 3BSQA 2PW8H 1NO9H 1SR5C 3TJNA 5TCCA 1BTPA 3KQEA 2F3CE 5EGMA 3UWJH 5DP7A 4WXIA 2BDAA 1GDNA 5JB9S 1GMHG 2FS8A 2ZZUH 3CP7A 1TNIA 1JRTA 1GBLA 1QJ6B 1WBGB 3EA7A 3A82A 2BY9X 1PPBH 1HYLA 4Y8YA 4GCHF 1TGNA 4FUDA 1XMNB 1L0ZA 1P05A 1ZOMA 1ELVA 1QNJA 2F91A 2FOBA 3RU4E 4X6NA 1IQGA 2F9VA 3PWCA 3TK5A 1O3BA 1VITF 1J16A 2QXJA 1NFUA 4NWKA 1PPZA 1QJ1B 1O39A 4DT7B 3ATMA 1MKWH 2GVFA 1S81A 2JETB 2UWPA 1MAXA 4MTBA 2QA9E 3RXPA 3PLPA 1O36A 1FY4A 1SGDE 1G37A 1FY3A 3H7TA 2Y7ZA 1G3EA 2ZWLH 1GVKB 4AFUA 1O2JA 1OSSA 4BTUB 3QUMP 4Y0ZE 2VVVA 4BXWA 1C4Y2 1EJMA 3BTHE 1EZSC 2FXRA 2VJ1A 4D76A 1KLJH 2YOLA 1GJ8B 1LMWB 1XUFA 3BF6H 1HJAB 2UUFB 2VWLA 4I33A 2ZHFH 1O2KA 4GSOA 1GI1A 2NU3E 3GCOA 3KN2A 1UTNA 2AMDA 3HPTB 3P8FA 5E2OA 3A7XA 2FPZA 2BVRH 1TNKA 3BTTE 2VU8E 1LDTT 4BAHB 1J9CH 4Z6AH 2WPLS 2OP9A 1WUNH 1QQUA 1EASA 2QIQA 3RXDA 1IOEA 3RXTA 1GHBG 1ETRH 2VH0A 3GCNA 2HNTC 4UFDH 3ZZ5A 5C1YA 3P92A 2VIPA 2H5DA 2WYGA 1KIGH 5DKMA 3B8JA 4AGJA 4AOQA 2PKSC 2VWOA 1EKBB 1O2OA 3Q3KA 1MD7A 1NRPH 5FXLA 1TX8A 3A8DA 3VGCC 1TPOA 1O2QA 2G4TA 4WF8A 3UNSA 4YESB 2A45B 4AG2A 1O3NA 2D26C 4FU9A 1LKAA 5L2YH 3KQCA 1WSSH 2XC0A 3ATIA 2BLWA 2ZIQH 1QB6A 2R3UA 4X2YA 1F0UA 1O5DH 4FU7A 4Y71A 1Z6JH 2A5KA 4X6MA 2A32A 1SGEE 3U8TH 4DGJA 1Z1JA 1SPJA 1ESAA 2IN2A 1S6HA 3RXLA 1SHHB 1CA0C 2AS9A 2ZU2A 4O3UA 4WMEA 2CHAB 2XWAA 1P2QA 3SV2H 4AG1A 3SU6A 1DFPA 1BRBE 1ZLRA 5ABWA 2ZGJA 3KHVA 1BTXA 1ZHRA 2BQWB 1TRNA 2QXIA 1BRUP 1G30B 2BDYA 3LT3A 1QB9A 3MO6A 3TNTA 4Q7YA 1A5IA 3QGNB 1SGYE 3TGIE 1QA0A 5DP5A 2NU4E 1BMAA 5A8XA 2G5NA 1ZMNA 3ZVGA 3A7VA 1GCTB 3A7ZA 1SQTA 4FUGA 4Y8ZA 2BY6X 2HLCA 3RXOA 4ABHA 3PTBA 4DIIH 4GCHG 4IS5A 4AORA 2ZDMA 3VXEH 3PROA 3KEEA 3B23B 4AB8A 1UVSH 4IMZA 1WAYB 2AGGX 1DUAA 3BG4B 3O8DA 1CGHA 1DXWA 2HOBA 4NIVA 3VB3A 3MH6A 4A1XA 3GCTF 5ETXA 1V2PT 2P94A 5G4BA 1O2PA 2V35A 4ZROA 1F0TA 2HGTH 5T3HA 2PLXA 3GISB 1TQ7B 1BA8B 3MNCA 4I8GA 4M7GA 1A0LA 1OKXA 1V2KT 1PFXC 2FWWA 2Z9JA 1EAXA 5HMAA 1LPKB 1OWKA 4LOYH 1SGTA 1TNGA 3VB7A 1QR3E 1OWDA 1C4V2 1EX3A 2PWXA 3G01A 3BTFE 4JYTA 5JBCS 3EDXB 2Y81A 3H5CB 1ABJH 1EPTC 4CRAA 1P2JA 5FBIA 4AX9H 3FP7E 3U8RH 1GI7B 1MBMA 2R0KA 3Q3YA 1G9IE 1ABIH 4FUIA 2W3KA 1C5ZB 1LCYA 4JYUH 5FCKA 3F9HA 2F9UA 5GIBA 1OWHA 5T6GA 5EQRA 1TRMA 4IW4E 2ZDNA 3U1JB 4OS5A 4H4FA 4KTCA 1BTWA 1TE0A 4Y6DA 5EQQA 1BZXE 1ZPCA 3PO1C 3S9CA 3BN9A 1TWXB 1GJ9B 3RMOH 3ZZ8A 2BZAA 1C2EA 1FI8A 1O0DH 4NA9H 2J9NA 1GDUA 1V2RT 5BPEA 1HRTH 5TCAA 1A61H 2Q6GA 2CF9H 3CS0A 4MPXA 1DWDH 1SMFE 1TQ0B 5JB8S 4CRDA 2OC1A 2FEQH 1CA8B 4ZHMU 4NIYA 2FI3E 2B7DH 2QC2A 2ZGHA 1CT2E 2Z9LA 4TYDA 3SNCA 3U1IB 3TJVA 3URDA 1SGNE 1F5RA 1KXCA 2TRMA 2A1DB 4IC5A 2VWNA 2XC4A 1DX5M 2JH0D 1S84A 2OQUA 1YPMH 4BAMB 4TPIZ 1JMOH 1QCPA 1G2MA 2ANMH 1YGCH 4MG3A 4XSKU 4LZ4B 3UPEA 2WV4A 2YNBA 4IN1A 1GI0A 3A87A 4U2WA 2JETC 2P8OB 4KTUA 3T2NA 1BQYA 1FPCH 1A0HB 2XNIA 4YM9A 1UK3A 2BB4A 1GBJA 1P2MA 2BQ6B 3PWBA 3ZVEA 1F5LA 5JYIA 3A81A 1AKSB 3QGJA 3R0FA 1NFYA 2BVXH 3M7UA 2A7CA 3MH7A 3A7WA 1QBVH 3NXPA 4MNVA 3KL6A 2RA0A 2OTVA 1AQ7A 3GY7A 2F9BH 1H4WA 2A4QA 4FXGH 1NTPA 1P06A 1LVYA 4MPWA 1HJAC 4FU8A 2GDEH 1HAPH 2OC8A 3Q76A 3SV8A 5HXFA 3EA9A 2FYRA 3KQBA 3DHKH 3VXFH 3GCTG 2GCTC 2ZFRH 3NKKA 1PPCE 4CH8B 1NN6A 3UR9A 7KMEH 1MQ5A 3SQHE 3BIUH 4BNRA 3PLBA
chains in the Genus database with same CATH superfamily
1KXDA 2C3SA 2W5EA 3LGTA 4INLA 2WUCA 1K9OE 1EOJA 1HJ9A 1A5HA 1AY6H 4Q2KA 4WY3A 1TOMH 2IPHA 1CHOG 5AFYH 1FUJA 5DP3A 5DP6A 3MFJA 1ZPBA 1SKYE 1C1SA 2ZI2H 1O3PB 3E16B 3MYWA 4ZKRU 4DOQA 6LPRA 4KP0A 5DO4H 1V2TT 1DE7H 4BXSA 3BEFB 1BITA 1JIMA 2SGFE 1O3LA 3OU0A 4P02A 3SU4A 3C27B 3UB0A 3E91A 1NY22 4WXVA 3B9FH 1UHBA 4NSVA 1N8OC 1GI8B 3BIVH 2UWLA 2G5VA 2J5UA 1AZ8A 4QT8C 1ZJKA 1BB0B 3AAVA 3RXHA 4NIWA 1ANEA 4X2VA 1ZTLA 3A89A 1IHTH 2W7SA 2J4IA 4OS6A 3SZEA 1P3EA 3LH3A 1EAUA 2PUXB 3MO9A 1RS0A 3RMNH 1IQKA 1C2LA 3T62A 2VIQA 1FAXA 3D49H 5GCHG 1EZXC 2CHAC 4HTCH 4ABIA 4X8TH 2TGPZ 2HNTF 2BY5X 2VGCB 2DE8A 3BTKE 1W0JD 3VB5A 1LVMA 1T8MA 4X8SH 4MDSA 1DOJA 1UVTH 3FP8E 4THNH 2SGDE 1VZQH 2O8MA 1OWJA 1V2OT 2ZHEH 2F9OA 2RFKC 2AGEX 1FDPA 2SNWA 2SGPE 4DY7B 8LPRA 1MBQA 2V6NA 2EY4C 1BDAA 2LELA 2PKSB 1RTKA 3PV5A 3E90B 1T4UH 4NG9H 3IG6B 1GBIA 1HJ8A 3DSOA 2Y80A 3LGYA 1PYTC 1TBQH 3DUXH 3SZNA 3BTGE 2HPQH 3CNRA 2B9LA 1PQAA 4CBOA 1P57B 2ZF0H 1LVOA 2ZU3A 1VCWA 1MKXH 1ELAA 1EB1H 1NC6A 4CR5A 2G81E 1O3DA 4JZFH 1GHYH 5DG6A 1K1MA 1YLNA 2ZDVH 4BAQB 4MQAA 2PKAA 2VWMA 3OFND 3QTOH 3URCA 4ABJA 2OBQA 2ZDLA 1V2LT 4NZLA 1HXEH 3UAIC 3TGKE 3ZVAA 3F0PA 5LPRA 1O5EH 1FQ3A 1OP8A 2J34A 2P3TB 4B76A 1ESTA 3O8RA 1CBWB 1F92A 2J97A 4Q80A 4CRGA 1GJ7B 4HG6A 1C2FA 1KXEA 1O3AA 2IJOB 2ZGXH 3M37A 4J1YA 2OLGA 1O35A 2D1JA 1BHXB 4WWYA 4H6TA 1MABB 2WPDD 2XBXA 4BTIB 1EAWA 1KXBA 2QXGA 1C1VH 4ZCNA 2A0QB 1ESBA 1NFWA 4LK4A 3AW0A 2BD4A 5CMXH 1MZAA 1CE5A 3T28A 5JPMH 5DN6D 4B2BA 1D3TB 2H5CA 4OGYA 1O2MA 4ZUHA 2BYAX 1O37A 1TB6H 1EATA 2Q6FA 3PMHB 3TJUA 3PV4A 1C9TA 5HM9A 1SB1H 1ANBA 2BY7X 5C0TA 1O2ZA 2KZ4A 1Z8JB 1A4WH 3MU0A 4F49A 3SU5A 3KQDA 1OWIA 2G4UA 2GJGA 3K6ZA 2NU0E 4ZKNU 2ZTYA 4K60A 2PP6A 2YMSD 2ZU4A 3A7YA 2SGQE 2WZQA 1YPLH 3SBKA 2TIOA 1ZYOA 2ZFTA 1JWTA 1GI6A 1BRCE 2ZFFH 1C1UH 1P04A 1ZPZA 1QJ7B 8KME2 5L6NH 3S7KB 1O3HA 5GWZA 1QL8A 1Z8GA 2Z3DA 2Y5GA 1CO7E 2FS9A 2FO9A 1DUEA 2CF8H 3A85A 1RGQA 3MU8A 3S0NA 1OXGA 3MOCA 4RN6A 1HV7A 1S0RA 1AE5A 1W13U 2P8OC 4OM9A 1F0SA 1NROH 4IC6A 1SOZA 9ESTA 3H09A 2BD3A 1TONA 3Q77A 1EB2A 1TLDA 3GY3A 1P10A 1T8NA 1DWEH 3KF2A 3SV7A 1LQDB 3ZZ9A 2O8LA 4JK5A 2YNAA 3BTWE 3P8OA 2BDCA 1QIXB 1C5LH 1FXYA 1YPJH 1MKWK 4O03A 1B0EA 2H9HA 1GJ4H 4ABDA 1RTLA 6CHAC 1ELTA 1W14U 2Q1JA 3M5OA 2GD4B 3SU0A 3V0XA 4RI0A 3RXGA 1Q3XA 2ZECA 1NBMD 3W94A 2Z6BD 1Y3WA 1C1RA 3S69A 1O2GH 5FX6A 1FONA 4K3JA 2BX4A 1PQ5A 4LZ1H 1C5VA 2I6QA 1MMJN 1WYKA 2A2QH 2L74A 5JBTA 1CU1A 5DPAA 1G2LA 2ZDAH 4NIXA 5KECA 1YF4A 1LHEH 1W0KD 5J4SA 3L33A 2ZP0H 3I29A 1MTSA 1HBTH 1TA2A 2ZGBH 4WMDA 4ZHLU 1SQOA 2ZDKA 1MU8B 3RU4D 1S5SA 1FJSA 1HAGE 3T26A 3ZZ3A 3MI4A 3MU4A 1YPHC 4XDEA 4D8NA 2AH4X 2OQ5A 2KFWA 2WUBA 1V2NT 1QTFA 1O33A 3UUZA 4R8TB 2KCYA 1GL0E 2JH5D 1UTKA 1GHXH 3EQ0H 1GJDB 1P3CA 4UD9H 5HKKD 2ZFSA 1SC8U 1AIXH 3FZDA 1YLDA 1UTQA 3U8OH 1YYY1 1QURH 3E6PH 1IAUA 4HZHA 1HNEE 3FVFB 2GX4A 2ZFPH 3F9GA 2GCTB 3AW1A 1AN1E 3MWIU 3QTVH 5K0HA 3ZV9A 1FY1A 2VGCC 3KCGH 2PR3A 1A7SA 1MD8A 4A92A 2G8TA 4ABFA 1AGJA 2VIVA 4YZUA 3TJOA 1HAHH 1BT7A 1C5MD 1E79D 1C2GA 2XRCA 3PM3A 3TIUA 7LPRA 2PSXA 1A46H 1W7XH 1ANCA 4UE7H 2CXVA 3TH3H 2H1UA 1JXPA 2RG3A 1AVGH 1BIOA 1UCYE 2BQ7B 3RLWH 2STAE 3CS7A 2AMQA 1A1RA 1P01A 2F9NA 5C1XA 4FUCA 4JZIA 1T8LA 3GY5A 1C5UA 1XM1A 1O2YA 1SG8B 4RT1A 1DDJA 1YM0A 3GY4A 2J94A 1N8OB 2ULLA 1W7GH 4D9RA 3ENSB 1C2DA 5IYTA 3KNXA 1H8DH 1ELGA 4A1VA 2Y5HA 4XBCA 1OYTH 5GJ4B 4CH2B 1W0ZU 1NRNH 1C2IA 1XUGA 4K8BA 4X1SU 3UNRA 5EPNA 3SU2A 1P0SH 1AE8H 1L2EA 1T4VH 2HPPH 4INHA 3LIWA 1CHGA 3ZZ7A 1O2IA 3NK8A 3ATWA 2GZ8A 1SGQE 2FOMB 3MQKC 1IQIA 5F8ZA 3M61U 3OAAD 3FFGA 3M36A 2AERH 2XBWA 4XD7D 4F4OC 2BM2A 3M5NA 3T29A 2Z3EA 3OEHD 1JRSA 1MCTA 1O3GA 2QF4A 5B6LA 5LGOA 3EE0B 1O3MA 7ESTE 1LO6A 1OWEA 2GT8A 1CBWC 3LONA 5GXPA 2OK5A 1TAWA 1FY8E 3SHAH 2F43B 4Y79A 1PPFE 1Z8IB 3LGWA 2OUAA 5A8YA 2KAIA 4MLFB 1O2VA 1V2WT 2FTLE 2NU2E 2EI7A 3RDZA 1CT0E 1XXDA 2AMPA 4FVBA 1UTLM 5C67A 4E7NA 1DSTA 3LGVA 2VINA 3RMMH 2HWLB 2H9TH 3F6UH 3F2FA 1ARBA 1TX6A 3GYLB 1HIAB 1TYNA 4X1NU 1FPHH 2TPIZ 1A3EH 4ASUD 4H6SB 4JYVH 1SLXB 1H9IE 1O2NA 2C93B 1KLTA 5DP4A 2OD3B 2GTBA 1NFXA 5GPIB 1JIRA 1QGFA 5L30H 1EPTA 2ZEBA 4JCNA 1C5QA 1LHCH 3V3MA 2B8OH 3S9AA 4AN7A 1A2CH 4AYVB 1P02A 1K2I1 4DT4A 1UVOA 2ODQA 1C1PA 3ZYEA 3SV9A 2UUJB 2UWOA 1YBWA 3ZZAA 1AWFH 4SGBE 1CHOF 4GUXA 1HDTH 1JBUH 4AFQA 2G51A 1PPHE 5EJZA 2SGEE 5FX5A 1HAVA 1GHVH 2GDDA 2FESH 3AVZA 1KDQB 2FLBH 2WPHS 3SUFA 5HYOA 2WPMS 2IJD1 5C0UA 2NU1E 3JZ1B 2XTTB 2OXSA 2BLVA 2GCHF 2FIRH 4K2YA 3BTDE 1ZRKA 3ZZCA 3A8CA 3RC4A 1S0QA 3ODDA 4MPUA 1QA7A 3TH4H 4BOHA 5C20A 5I25A 1W12U 1GDQA 3STIA 5C17A 1O5BB 1O2SA 2FMJA 2C8WB 1AZZA 1E0FD 2PGQB 4IMQA 1GG6B 1TMUH 1KSNA 4AGKA 1ZTJA 3K2UA 1WXRA 1EUFA 2VVCA 1VGCB 3GDUA 3SGBE 5GCHF 3FZZA 1VJAU 2GV6A 5FHTA 2Q6DA 4NWLA 3KIDU 5LH8A 2BY8X 1D6WA 4FUBA 3SW2B 4Y10E 1CQQA 3SU3A 1Y3VA 1O3KA 1O31A 5F53A 1L4DA 3I77A 3RMLH 3HGNA 4TT3D 3SNAA 4X1RU 2ILNA 3P6ZB 3T27A 2BXUH 3PRBA 1AUTC 1X7AC 4CRCA 3FANA 3A7TA 3F9EA 5A09A 1SLWB 3M3VA 3SU1A 2FODA 1HAZB 3RLYH 2FOEA 4ZKSU 1EJAA 2IOTA 1AVXA 3FO8D 2DE9A 2A4RA 2RA3A 3SGAE 3SNEA 3P8NA 3SUDA 4DIHH 3RXQA 2VB0A 3OTJE 4NA7A 3VB4A 5LPEA 5SGAE 3PMJA 1BRAA 2VNTA 2AEIH 1H8IH 1C1QA 2XNDD 4NCYA 2GP9B 1AO5A 3QDZB 1TA6A 1PQ7A 2Y82A 3SJ9A 5C94A 1T31A 4I8HA 2ZG0H 5E0JA 2HALA 1GBBA 1VR1H 2HVYB 6CHAB 1H8ED 2WPIS 2I6SA 3CENA 3JZ2B 4FUFA 2CK3D 3MMGA 1QRWA 1YPKH 4OS4A 1FIZA 1ARCA 1GL1A 4LXBH 1A3BH 1YWUA 4ACBA 2C8XB 2CJIA 2LP6A 2FOHA 3M5LA 3SQEE 1GI4A 4XBBA 1YPHE 1ZRBA 2FTMA 1O2RA 3OE7D 2Y7XA 3UR6A 2P93A 1D6RA 1GBDA 1GCDA 1IQJA 2PV9B 1TGSZ 1O5FH 4ZXYH 1MZDA 3T5FH 1O3JA 3T25A 1GVZA 2QY0B 3LC5A 1JOUB 4AYYB 1XUKA 4GHQA 3A80A 3QWCH 1BTYA 3PYHA 1XVMA 1GJ5H 3SI4H 4NFEA 4ZXXH 2TGAA 4Q7XA 2BD9A 2ODYB 4ISIH 1HGTH 3SO3A 3LDXH 3P8GA 1C5YB 1IQFA 4U32A 1T7CA 4B2CA 1K1OA 3F3BA 2ESTE 2R2MB 1Q31A 2GCHG 1BMFD 1GMCF 3ZZBA 4F48B 1EXFA 3MNXA 3UNQA 4X1QU 1AB9C 4D7FA 1LKBA 1GI9B 3KYGA 4PROA 4ZH8A 2BVSH 1P8VC 1VJ9U 1L1GA 3DD2H 2TGDA 4TSFD 4B71A 1TALA 3PB1E 1TBRH 2A4OA 4TY6A 4YXWD 2RDLA 4B6FA 2KCPA 1QQ4A 1MKXK 1H1BA 1FAKH 1P2OA 1C1TA 1ZGVA 2PTNA 1E38B 2KCOA 4XFQA 2GGVB 3HKIB 3RXFA 1C1MA 4GLYA 1S6FA 1SGRE 1O2XA 2K0QA 1ZR0A 3RXUA 3BEUA 2QF5A 2VIDA 3GDVA 3RXRA 5EIYA 3PV2A 2XBYA 5FPTA 5A2MH 4Y8XA 4ISLA 3SNDA 1P2IA 1Z1IA 4ASHA 2IPQX 1TOCB 3GCHB 2JJ1D 3Q3XA 4ABEA 3GICB 3UOUA 4X8VH 4DG4A 1BTUA 1O3CA 1ANDA 1S6LA 1Z71A 1O3FA 1FV9A 1K21H 2B0FA 2SNVA 4YOGA 1KTTB 1O5CB 5EXNA 1QBNA 4A7IB 3DSPA 1ID5H 2ZQ2A 4UFGH 1T8OA 3GY6A 1TNHA 4K1SA 2PFEA 1DSUA 4NFFA 1TNLA 2VIWA 2THFB 1QY6A 5EJLA 1SHYA 1WV7H 2C8ZB 5FCRA 1GBTA 1IQNA 1EP6A 1KYNA 2P3FH 1ELEE 1XVOA 4FETA 2R3YA 1LPGB 1DWBH 1WQSA 3FN8A 1N1LA 2TGTA 2ANWA 3AAUA 1QRZA 3M5MA 3SHCH 4A5TS 3SUGA 1OOKB 1ETTH 1DVAH 1OX1A 1FY5A 1TRYA 1BHXF 1EZQA 1WTHD 4IGDA 4BAOB 1LTOA 2Z9GA 5C1UA 3F68H 3SOSA 1TABE 2OBOA 4I8LA 4K1TA 2F9PA 1C1OA 3WWFA 2EA3A 1H9HE 1GMDF 2ANKH 4FUHA 1GBFA 1MU6B 5HGGA 4E05H 1DANH 5DP8A 1YP9A 4X0WU 1ZZZA 1NT1A 3AASA 3E0PB 1GG6C 3MTYA 2AYWA 1SGFG 1T32A 1A5GH 3RXBA 3OY5U 4E7RG 1VGCC 1DT2A 1DY9A 1ZMJA 3MNSA 3DFLA 3TLOA 2BDHA 1FN6A 1O34A 4I7YH 5HIZA 3U9AH 2PGBB 4TWYA 3OYPA 1GMCG 3OSYA 2ZKSA 3DA9B 1ZSKA 4BTTB 1WDIA 1RIWB 4CHAB 4Q63A 4X1PU 1FN8A 1IQMA 1EOLA 4KTSA 3E1XB 3KGPA 1Y5UT 1Y3YA 3LU9B 1P9UA 1ZHPA 2KM0A 3A8BA 4BANB 5B6OA 3A8AA 1E35B 2NWNA 3ELAH 1OYQA 5C3NA 4ZAEA 5CDFE 1K28D 2D8WA 1GJ6A 3NCLA 1LPZB 1O2UA 3UY9A 1KTSB 4ISHH 1AKSA 5DP9A 5J4QA 1SGPE 1ETSH 1GVLA 2GT7A 4VGCB 2FDAA 2WPJS 3F2HA 2A7JA 2OC7A 1DICA 3MH4A 1YCPM 3K9XB 1UVPA 1EAIA 1RD3B 4YO9A 1LQEA 3S7HB 4NA8A 3RXAA 2WYJA 1V2UT 4NGAH 2PUQH 2OINA 5PTPA 1DM4B 1HXFH 3MO3A 4D7GA 4ISNA 2B5TB 2XC5A 1OS8A 4XE4A 1AFQB 3VB6A 1K1PA 2FX4A 2TBSA 3EAJA 3N99A 1E1QD 2ZPRA 4ABGA 1PQ8A 3PRDA 1XUIA 2BOHB 2Z9KA 3BEIB 4ABAA 1UTMA 3SYJA 1EJNA 2OC0A 1BMNH 3GY8A 3NUMA 4I32A 2M5TA 2PSYA 4CR9A 4AZ2B 1Z7KA 2SFAA 4FUEA 2VH6A 2BLOA 4TY7A 1OP0A 3QN7A 5DK1A 3LKWA 1INCA 3LC3A 3M3TA 1SGFA 1O2HA 2LPRA 1TFXA 4X2WA 4YOJA 1TGCA 1V6DA 3OX7U 5AFZH 3ZVFA 1C5OH 4X2XA 2A5IA 1ACBE 5EXMA 1C5TA 2LNCA 4Y0YE 2ZNKH 2WHXA 1D3DB 1QFKH 3ZZDA 4OGXA 2WINI 4YLQH 4DCDA 2C90B 1KXFA 3SI3H 3TK6A 1PPGE 4CREA 1O3OA 1M9UA 2QN5T 1BMLA 1NZQH 4Y7AA 2ZCLP 1GMDG 5EU8A 1MQ6A 2JKHA 2WV5A 4XOJA 2ZU5A 1P2NA 3D23A 3TVJB 1YPEH 3IITA 4WVPE 2WPKS 5HM2A 2ZQ1A 4WH6A 5A0BA 3O8CA 1L1JA 1P12E 2QF3A 4I31A 3GYMA 4B75A 2HLDD 3ZVBA 1KXAA 2P3UB 3RM0H 4U01A 1J14A 3ESTA 5E0GA 3VG8A 2A5AA 2OCVB 5A0CA 3RC5A 4BAKB 1HAIH 2JIZD 2J98B 7GCHF 1CVWH 1XKBC 4AC9A 1VCPA 1HCGA 1PPEE 2BZ6H 2GMTB 4KGAA 4IN2A 1CGJE 3SGQE 2W6ID 1GI2A 3ZV8A 1C1WH 1AMHA 1VITH 2ZHWH 2CMYA 1QL7A 3NPSA 3R3GB 3EYDA 1QB1A 1HAOH 1J15A 4UEHH 3N7EA 3GCHC 1TX7A 2EI8A 2BD5A 1KY9A 1TGBA 1D4PB 2ZHDA 4AFSA 4D9QA 1MTVA 4JZEH 1NS3A 5CHBA 4UONA 3QK1A 1NRQH 1DPOA 3P17H 2H2ZA 1SL3A 1UCYK 2Z9IA 5EODA 1FX0B 2XCFA 2BOKA 1AB9B 2SGAA 1C5RA 2AFQB 2ZO3H 1NU9A 1FZZA 3ZVDA 5A0AE 4O97A 1TBZH 1V3XA 1Z6EA 1NPMA 3SJKA 1SLVB 5AF9H 1NM6A 4E06H 4B2AA 1QHRB 2ALVA 3RUOA 1SSXA 1AU8A 3A83A 4MPVA 2V0BA 3WW7A 5T6FA 3VFEA 1HUTH 3QO6A 2O8TA 4B1TA 1BTHH 2ZTZA 1Q2WA 1KLIH 3PMBB 1GJAB 2D2DA 1AI8H 3U69H 5KGOA 1UHBB 1PYTD 1UCYH 1S83A 1GBCA 3RXMA 2QYIA 4P00A 1THPB 1H9LB 1G3CA 3MU1A 1UTJA 2EEKA 3ODFA 4SGAE 1C1NA 1V2QT 3O8BA 2QV1A 3M35A 1AUJA 2FZZA 4Y11E 8ESTE 1LHDH 4A1TA 1GWAA 1F2SE 2XWBI 1RFNA 2XW9A 1THSH 2FX6A 4I8JA 6GCHF 1BJUA 2VIOA 1O2LA 1V2VT 1IQLA 3BTME 3FKSD 1Y59T 1O2WA 3D62A 1GBAA 5LPFA 1EP5A 1W11U 2ZFQH 3FAOA 1RIWC 4CHAC 2KCAA 1UK4A 1VITG 2ASUB 3NRLA 3BV9B 1MCVA 1S82A 4TPYA 3TK9A 2ZGCA 1SQRA 1BMMH 2WSSD 3UQVA 1HB0B 5CHAB 1L4ZA 1TPAE 1Y8TA 1YC0A 2PHBA 5EQSA 3SJIA 2G00A 1GHWH 1AWHB 1K1JA 3U98H 5EPYA 4DVAU 3RXJA 1YY3A 1GGDB 1XUHA 2BLQA 2BTCE 1EQ9A 5KEDA 2H9EH 2ZHQH 1O5AB 1P11E 3E8LA 5DJ7A 3TGJE 4VGCC 1COWD 3V13A 7GCHG 4UDWH 4ISOA 2GZ7A 2FYQA 1XX9A 2Y5FA 1OPHB 1E37B 1OP2A 2XXLA 1GHZA 2W6JD 2PKAB 1O3IA 4F55A 1HPGA 1C5PA 2FM2A 1G32B 4DJZB 2BXTH 2FOAA 4YTAA 1V2ST 3M7TA 3HKJB 1A0JA 1B5GH 1D3PB 1C5SA 1AFQC 1O30A 1TMTH 4MNWA 4YOIA 3RU4T 4O3TA 2A2XH 2O8WA 2A4GA 1C9PA 2R2WU 3PMAB 4YT6H 1S85A 3LOXA 1Y5AT 3OY6U 4RKOB 1IQHA 1P09A 1GHAF 2W26A 1SFIA 2F83A 2GKVE 3TNSA 3SJ8A 2FOFA 1Y3XA 1K1IA 1IHSH 3GOVB 5EW2H 4YT7H 4X8UH 1K1NA 3GY2A 3UFAA 1FNIA 3RXKA 4RT0A 4X6OA 1FMGA 1HFDA 5AHGH 5BRRE 2ALPA 1O5GH 2ZC9H 2BD7A 1O3EA 4WMFA 1DS2E 5F03A 1PJPA 5C5OA 1NU7B 2CN0H 1E36B 2ANYA 3K6YA 4MNXA 1ZSJA 1Y3UA 1GI5A 3KYFA 2ZPQA 5F8XA 5TJXA 4K5ZA 1WU1A 1ELCA 2FOGA 1XXFA 1UK2A 1P03A 1W0YH 1F0RA 3EA8A 1DITH 1WOFA 2J92A 1GBMA 1W3CA 1E34B 1ZJDA 2XYAA 1C2JA 4Q4LA 4NSYA 1C5XB 5ESTE 1ELBA 1C5WB 2ZCKP 1MTNB 2ZCHP 3RC6A 1BCUH 3PLKA 2ODPA 3SN8A 4K69A 4UFFH 3S9BA 1MUEB 5DGJA 4RSPA 5FBEA 1W2KH 5I46H 1QRXA 2A7HA 5FPSA 1N6YA 2FP7B 5EW1H 1BBRE 3RXEA 2UUYA 3UOPA 3DFJA 6GCHG 2AGIX 4JK6A 1U6QA 2Z94A 4JMYA 3UQOA 2STBE 2A31A 4B6EA 5GDSH 3UREA 4Y7BA 1CGIE 1QBOA 1WQVH 1YKTA 8GCHF 4H42U 4HGCA 1RRKA 3NWUA 2QCYA 2K1QA 1J17T 5E8EH 1EZUC 1O38A 2P59A 1BBRK 2GMTC 2O8UA 2BDIA 5FAHA 3TITA 2V3OH 4HI3A 4OS1A 3E3TA 1C5NH 3RM2H 2ZPSA 2BHGA 4KKDA 5F8TA 3HGPA 2BDBA 3V12A 2K8IA 1YPGH 4YLUA 1SI5H 4JZDH 2J95A 2C8YB 1WTGH 1D3QB 1ORFA 1MTUA 3I78A 3MH5A 2JH6D 1DWCH 2QAAA 1UMAH 2R0LA 5HIYA 3F9FA 3TH2H 3M3SA 1LHGH 1RXPA 3UIRA 1C2KA 2HVXA 1MH0A 1YLCA 4ABBA 1J8AA 3SNBA 1B0FA 3PTNA 1SGCA 1ZTKA 3TPIZ 2FLRH 4B74A 1GI3A 3P95A 1BBRH 1V2JT 1FLEE 3AK5A 1N6XA 4UFEH 1SLUB 1C4U2 1THRH 1RJXB 3NZIA 2L6OA 4IBLH 4ZKOU 2FI4E 2BX3A 2HNTE 4RKJB 1G36A 4O9VA 3P70B 2QE7D 3HK6B 1GJBB 4GPGA 4WH8A 1GHAG 1GBEA 1UVUH 3DCLA 1CT4E 3A84A 1SOTA 1BTZA 2PTCE 2G55A 1TNJA 2M2AA 3HK3B 3MU5A 2H6MA 2BMGB 3A88A 3A86A 3VPKA 1HIAA 1XKAC 4I8KA 4U30A 2QXHA 3EE7A 3L3TA 4ACAA 3F1SB 1D9IA 1SQAA 3Q00A 4ZMAH 1HLTH 5E0HA 1ELDE 4AB9A 3QZQA 1TPSA 2Z3CA 4GAWA 2Z7FE 2RDEA 1RTFB 4OS7A 4ZHAA 2ZA5A 3WY8A 1SGIB 1QL9A 1AVWA 4X6PA 5K7RA 5EG4A 4A6LA 1W10U 4WJG2 1GCTC 2GV7A 1Z8RA 2RCEA 2KX4A 3E0NB 4DURA 3LGUA 1KDQA 5AVDA 1TMBH 1L1NA 2VVUA 5H4IB 1QZ8A 1F5KU 3VGCB 1O2TA 3BG8A 1DXPA 3BG4C 4DW2U 1P9SA 4K8YA 4GHTA 1K1LA 2GZ9A 5C2ZA 1LVBA 3UTUH 3DSGA 1DY8A 5CHAC 4CRFA 3LJOA 3HATH 4OS2A 3L6PA 5EJ1A 2QF0A 5F6MA 3RXSA 2W3IA 1GMHF 3SUEA 2R9PA 4CBNA 1GGDC 2ZTXA 3ITIA 5CE1A 1G3DA 4R0IA 1UO6A 1AFEH 1FIWA 2G52A 3QZRA 4XBDA 5C5NA 5T1VA 3RP2A 3BTEE 4GVUA 8GCHG 2FI5E 2O9QA 6ESTA 2W7UA 1CA0B 2P95A 1SFQB 2DUCA 1V2MT 3N7OA 4B73A 2V7QD 2FOCA 1HAYB 3V7TA 4JZ1A 3KQ5A 1O32A 4K1EA 1NRSH 3LH1A 3SJOA 3RXVA 4ESTE 3MHWU 1SBWA 1AHTH 3GDSA 1GJCB 5EOKA 3FP6E 3UWIA 5JBBS 2CGAA 1UJ1A 1HAXB 2V3HH 3SV6A 1W8BH 2HRVA 1BUIA 3M7QA 3VEQB 3W95A 1AD8H 1ZMLA 1TGTA 3QLPH 3D65E 4FVDA 1GBKA 3IWMA 1B7XB 3C1KA 1GBHA 2XOKD 2KAIB 3RXIA 4INKA 4TWWA 1XUJA 1SVPA 3ATLA 3MNBA 1IQEA 2AHME 2BD2A 3TU7H 2XCNA 5L2ZH 3ATKA 1TPPA 4MNYA 5ESBA 3ZZ6A 2AIPA 2ZU1A 1GHBF 1DLKB 1Y5BT 5E2PA 1WCZA 4KELA 4NZQA 3ZYDA 3H7OA 3EGKH 1LHFH 3ZVCA 5A8ZA 1ZSLA 3LJJA 1C2MA 1YCPK 4CRBA 2EC9H 2XBVA 1ZHMA 2CV3A 2YMSB 2EI6A 2C4FH 3DT0H 1EPTB 1BOQA 3STJA 1G3BA 5JDUB 5IDKA 2JDID 1F7ZA 4J2YB 3LGIA 2Y6TA 4MVNA 3ZZ4A 2BD8A 1MTWA 1ZGIA 1MTNC 1MAYA 3SORA 1UTPA 3K65B 2BDGA 1VCQA 4HFPB 5T6DA 4Y76A 1E1RD 9LPRA 1K22H 2AIQA 1HAVB 4Z0KA 5FPYA 3RXCA 5JBAS 4Q7ZA 1NESE 3BTQE 3QX5H 1GPZA 1UTOA 1NRRH 1ELFA 2QGRA 4AFZA 1DLEA 4FUJA 3LPRA 2J38A 2JJ2D 5GNDA 1NBME 1P2KA 1TIOA 2UUKB 3PO1B 5EXLA 2P16A 2J2UA 1YCPH 1BJVA 1C2HA 1CSOE 3BSQA 2PW8H 1NO9H 1SR5C 3TJNA 5TCCA 1BTPA 3KQEA 2F3CE 5EGMA 3UWJH 5DP7A 4WXIA 2BDAA 1GDNA 5JB9S 1GMHG 2FS8A 2ZZUH 3CP7A 1TNIA 1JRTA 1GBLA 1QJ6B 1WBGB 3EA7A 3A82A 2BY9X 1PPBH 1HYLA 3OTPA 4Y8YA 4GCHF 1TGNA 4FUDA 1XMNB 1L0ZA 1P05A 1ZOMA 1ELVA 1QNJA 2F91A 2FOBA 3RU4E 4X6NA 1IQGA 2F9VA 3PWCA 3TK5A 1O3BA 1VITF 1J16A 2QXJA 1NFUA 2KR7A 4NWKA 1PPZA 1QJ1B 1O39A 4DT7B 3ATMA 1MKWH 2GVFA 1S81A 2JETB 2UWPA 1MAXA 4MTBA 2QA9E 3RXPA 3PLPA 1O36A 1FY4A 1SGDE 1G37A 1FY3A 3H7TA 2Y7ZA 1G3EA 2ZWLH 1GVKB 1EFRD 4AFUA 5FL7D 1O2JA 1OSSA 4BTUB 3QUMP 4Y0ZE 2VVVA 4BXWA 1C4Y2 1EJMA 3BTHE 1EZSC 2FXRA 2VJ1A 4D76A 1KLJH 2YOLA 1GJ8B 1LMWB 1XUFA 3BF6H 4I86A 1HJAB 2UUFB 2VWLA 4I33A 2ZHFH 1O2KA 4GSOA 1GI1A 2NU3E 4FOUC 3GCOA 3KN2A 1UTNA 2AMDA 3HPTB 3P8FA 5E2OA 3A7XA 2FPZA 2WV9A 2BVRH 1TNKA 3BTTE 2VU8E 3F0OA 1LDTT 4BAHB 1J9CH 4Z6AH 2WPLS 2OP9A 1WUNH 1QQUA 1EASA 2QIQA 3RXDA 1IOEA 3RXTA 1GHBG 1ETRH 2VH0A 3GCNA 2HNTC 4UFDH 3ZZ5A 5C1YA 3P92A 2VIPA 2H5DA 2WYGA 1KIGH 5DKMA 3B8JA 4AGJA 4AOQA 3WWBA 2PKSC 2VWOA 1EKBB 1O2OA 3Q3KA 1MD7A 1NRPH 5FXLA 1TX8A 3A8DA 3VGCC 1TPOA 2V3MA 1O2QA 2G4TA 4WF8A 3UNSA 4YESB 2A45B 4AG2A 1O3NA 2D26C 4FU9A 1LKAA 5L2YH 3KQCA 1WSSH 2XC0A 3ATIA 2BLWA 2ZIQH 1QB6A 2R3UA 4X2YA 1F0UA 1O5DH 4FU7A 4Y71A 1Z6JH 2A5KA 4X6MA 2A32A 1SGEE 1KMHB 4Z1MD 3U8TH 4DGJA 1Z1JA 1SPJA 1ESAA 2IN2A 1S6HA 3RXLA 1SHHB 1CA0C 2AS9A 2ZU2A 4O3UA 4WMEA 2CHAB 2XWAA 1P2QA 3SV2H 4AG1A 3SU6A 1DFPA 1BRBE 1ZLRA 5ABWA 2ZGJA 3KHVA 1BTXA 1ZHRA 2BQWB 1TRNA 2QXIA 1BRUP 1G30B 2BDYA 3LT3A 1QB9A 1VKYA 3MO6A 3TNTA 4Q7YA 1A5IA 3QGNB 1SGYE 3TGIE 1QA0A 5DP5A 2NU4E 1BMAA 5A8XA 2G5NA 1ZMNA 3ZVGA 3A7VA 1GCTB 3A7ZA 1SQTA 4FUGA 4Y8ZA 2BY6X 2HLCA 3RXOA 4ABHA 3GS9A 3PTBA 4DIIH 4GCHG 4IS5A 4AORA 2ZDMA 3VXEH 3PROA 3KEEA 3B23B 4AB8A 1UVSH 4IMZA 1WAYB 2AGGX 1DUAA 3BG4B 3O8DA 1CGHA 1DXWA 2HOBA 4NIVA 3VB3A 3MH6A 2VBCA 4A1XA 3GCTF 5ETXA 1V2PT 2P94A 5G4BA 1O2PA 2V35A 4ZROA 1F0TA 2HGTH 5T3HA 1H8HD 2PLXA 3GISB 1TQ7B 1OHHD 1BA8B 3MNCA 4I8GA 4M7GA 1A0LA 1OKXA 1V2KT 1PFXC 2FWWA 2Z9JA 1EAXA 5HMAA 1LPKB 1OWKA 4LOYH 1SGTA 1TNGA 3VB7A 1QR3E 1OWDA 1C4V2 1EX3A 2PWXA 3G01A 3BTFE 4JYTA 5JBCS 3EDXB 2Y81A 3H5CB 2YMSC 1ABJH 1EPTC 4CRAA 1P2JA 5FBIA 4AX9H 3FP7E 3U8RH 1GI7B 1MBMA 2R0KA 3W1EA 3Q3YA 1G9IE 2EQNA 1ABIH 4FUIA 2W3KA 1C5ZB 1LCYA 4JYUH 5FCKA 3F9HA 2F9UA 5GIBA 1OWHA 5T6GA 5EQRA 1TRMA 4IW4E 2ZDNA 4XRNA 3U1JB 4OS5A 3OEED 5IK2D 1K0HA 3U28C 4H4FA 3ZIAD 4KTCA 1BTWA 1TE0A 4Y6DA 5EQQA 1BZXE 1ZPCA 3PO1C 3S9CA 3BN9A 1TWXB 1GJ9B 3RMOH 3ZZ8A 2BZAA 1C2EA 1FI8A 1O0DH 4NA9H 2J9NA 3F2GA 1GDUA 1V2RT 5BPEA 1HRTH 5TCAA 1A61H 2Q6GA 2CF9H 3CS0A 4MPXA 1DWDH 1SMFE 1TQ0B 5JB8S 4CRDA 5DSFA 2OC1A 2FEQH 1CA8B 3FOAA 4ZHMU 4M9FA 4NIYA 2FI3E 2B7DH 2QC2A 2ZGHA 3N7DA 1CT2E 2Z9LA 4TYDA 3SNCA 3U1IB 3TJVA 3URDA 1SGNE 1F5RA 1KXCA 2TRMA 2A1DB 4IC5A 2VWNA 2XC4A 1DX5M 2JH0D 1S84A 2OQUA 1YPMH 4BAMB 1UW7A 4TPIZ 1JMOH 1QCPA 1G2MA 2ANMH 1YGCH 4MG3A 4XSKU 4LZ4B 3UPEA 2WV4A 2YNBA 4IN1A 1GI0A 3A87A 4U2WA 2J98A 2JETC 2P8OB 4KTUA 3T2NA 1BQYA 1FPCH 2F4LA 1A0HB 2XNIA 4YM9A 1UK3A 2BB4A 1GBJA 1P2MA 2BQ6B 3PWBA 3ZVEA 1F5LA 5JYIA 3A81A 1AKSB 3QGJA 3R0FA 1NFYA 2BVXH 3M7UA 2A7CA 3MH7A 3A7WA 1QBVH 3NXPA 4MNVA 3KL6A 2RA0A 2OTVA 1AQ7A 3GY7A 2F9BH 1H4WA 2A4QA 4FXGH 1NTPA 1P06A 1LVYA 4MPWA 1HJAC 4FU8A 2GDEH 1HAPH 2OC8A 3Q76A 3SV8A 5HXFA 3EA9A 2FYRA 3KQBA 3DHKH 3VXFH 3GCTG 2GCTC 2ZFRH 3NKKA 1PPCE 4CH8B 1NN6A 3UR9A 7KMEH 1MQ5A 3SQHE 3BIUH 4BNRA 3PLBA
chains in the Genus database with same CATH topology
1KXDA 2C3SA 2W5EA 3LGTA 4INLA 2WUCA 1K9OE 1EOJA 1HJ9A 1A5HA 1AY6H 4Q2KA 4WY3A 1TOMH 2IPHA 1CHOG 5AFYH 1FUJA 5DP3A 5DP6A 3MFJA 1ZPBA 1C1SA 2ZI2H 1O3PB 3E16B 3MYWA 4ZKRU 4DOQA 6LPRA 4KP0A 5DO4H 1V2TT 1DE7H 4BXSA 3BEFB 1BITA 1JIMA 2SGFE 1O3LA 3OU0A 3SU4A 3C27B 3E91A 1NY22 4WXVA 3B9FH 1UHBA 4NSVA 1N8OC 1GI8B 3BIVH 2UWLA 2G5VA 1AZ8A 4QT8C 1ZJKA 1BB0B 3AAVA 3RXHA 4NIWA 1ANEA 4X2VA 1ZTLA 3A89A 1IHTH 2W7SA 2J4IA 4OS6A 1P3EA 3LH3A 1EAUA 2PUXB 3MO9A 1RS0A 3RMNH 1IQKA 1C2LA 3T62A 2VIQA 1FAXA 3D49H 5GCHG 1EZXC 2CHAC 4HTCH 4ABIA 4X8TH 2TGPZ 2HNTF 2BY5X 2VGCB 2DE8A 3BTKE 3VB5A 1LVMA 1T8MA 4X8SH 4MDSA 1DOJA 1UVTH 3FP8E 4THNH 2SGDE 1VZQH 2O8MA 1OWJA 1V2OT 2ZHEH 2F9OA 2AGEX 1FDPA 2SNWA 2SGPE 4DY7B 8LPRA 1MBQA 2V6NA 1BDAA 2PKSB 1RTKA 3E90B 1T4UH 4NG9H 3IG6B 1GBIA 1HJ8A 2Y80A 3LGYA 1PYTC 1TBQH 3DUXH 3SZNA 3BTGE 2HPQH 2B9LA 1PQAA 4CBOA 1P57B 2ZF0H 1LVOA 2ZU3A 1VCWA 1MKXH 1ELAA 1EB1H 1NC6A 4CR5A 2G81E 1O3DA 4JZFH 1GHYH 5DG6A 1K1MA 2ZDVH 4BAQB 4MQAA 2PKAA 2VWMA 3URCA 3QTOH 4ABJA 2OBQA 2ZDLA 1V2LT 4NZLA 1HXEH 3TGKE 3ZVAA 5LPRA 1O5EH 1FQ3A 1OP8A 2J34A 2P3TB 4B76A 1ESTA 3O8RA 1CBWB 1F92A 4Q80A 4CRGA 1GJ7B 1C2FA 1KXEA 1O3AA 2IJOB 2ZGXH 3M37A 4J1YA 2OLGA 1O35A 2D1JA 1BHXB 4WWYA 4H6TA 2XBXA 4BTIB 1EAWA 1KXBA 2QXGA 1C1VH 2A0QB 1ESBA 1NFWA 4LK4A 3AW0A 2BD4A 5CMXH 1MZAA 1CE5A 3T28A 5JPMH 4B2BA 1D3TB 2H5CA 4OGYA 1O2MA 4ZUHA 2BYAX 1O37A 1TB6H 1EATA 2Q6FA 3PMHB 3TJUA 3PV4A 1C9TA 5HM9A 1SB1H 1ANBA 2BY7X 1O2ZA 1Z8JB 1A4WH 3MU0A 4F49A 3SU5A 3KQDA 1OWIA 2G4UA 3K6ZA 2NU0E 4ZKNU 2ZTYA 4K60A 2ZU4A 3A7YA 2SGQE 1YPLH 3SBKA 2TIOA 1ZYOA 2ZFTA 1JWTA 1GI6A 1BRCE 2ZFFH 1C1UH 1P04A 1ZPZA 1QJ7B 8KME2 5L6NH 3S7KB 1O3HA 5GWZA 1QL8A 1Z8GA 2Z3DA 2Y5GA 1CO7E 2FS9A 2FO9A 1DUEA 2CF8H 3A85A 1RGQA 3MU8A 3S0NA 1OXGA 3MOCA 4RN6A 1HV7A 1S0RA 1AE5A 1W13U 2P8OC 1F0SA 1NROH 4IC6A 1SOZA 9ESTA 2BD3A 1TONA 3Q77A 1EB2A 1TLDA 3GY3A 1P10A 1T8NA 1DWEH 3KF2A 3SV7A 1LQDB 3ZZ9A 2O8LA 4JK5A 2YNAA 3BTWE 3P8OA 2BDCA 1QIXB 1C5LH 1FXYA 1YPJH 1MKWK 4O03A 1B0EA 2H9HA 1GJ4H 4ABDA 1RTLA 6CHAC 1ELTA 1W14U 2Q1JA 3M5OA 2GD4B 3SU0A 3V0XA 3RXGA 1Q3XA 2ZECA 3W94A 2Z6BD 1Y3WA 1C1RA 3S69A 1O2GH 5FX6A 1FONA 4K3JA 2BX4A 1PQ5A 4LZ1H 1C5VA 2I6QA 1MMJN 1WYKA 2A2QH 5JBTA 1CU1A 5DPAA 1G2LA 2ZDAH 4NIXA 1YF4A 1LHEH 5J4SA 3L33A 2ZP0H 3I29A 1MTSA 1HBTH 1TA2A 2ZGBH 4WMDA 4ZHLU 1SQOA 2ZDKA 1MU8B 3RU4D 1S5SA 1FJSA 1HAGE 3T26A 3ZZ3A 3MI4A 3MU4A 1YPHC 4XDEA 4D8NA 2AH4X 2OQ5A 2WUBA 1V2NT 1QTFA 1O33A 3UUZA 4R8TB 1GL0E 2JH5D 1UTKA 1GHXH 3EQ0H 1GJDB 1P3CA 4UD9H 2ZFSA 1SC8U 1AIXH 3FZDA 1YLDA 1UTQA 3U8OH 1YYY1 1QURH 3E6PH 1IAUA 4HZHA 1HNEE 3FVFB 2GX4A 2ZFPH 3F9GA 2GCTB 3AW1A 1AN1E 3MWIU 3QTVH 5K0HA 3ZV9A 1FY1A 2VGCC 3KCGH 2PR3A 1A7SA 1MD8A 4A92A 2G8TA 4ABFA 1AGJA 2VIVA 4YZUA 3TJOA 1HAHH 1BT7A 1C5MD 1C2GA 2XRCA 3PM3A 3TIUA 7LPRA 2PSXA 1A46H 1W7XH 1ANCA 4UE7H 2CXVA 3TH3H 2H1UA 1JXPA 2RG3A 1AVGH 1BIOA 1UCYE 2BQ7B 3RLWH 2STAE 3CS7A 2AMQA 1A1RA 1P01A 2F9NA 5C1XA 4FUCA 4JZIA 1T8LA 3GY5A 1C5UA 1XM1A 1O2YA 1SG8B 1DDJA 1YM0A 3GY4A 2J94A 1N8OB 2ULLA 1W7GH 4D9RA 3ENSB 1C2DA 5IYTA 3KNXA 1H8DH 1ELGA 4A1VA 2Y5HA 4XBCA 1OYTH 5GJ4B 4CH2B 1W0ZU 1NRNH 1C2IA 1XUGA 4K8BA 4X1SU 3UNRA 5EPNA 3SU2A 1P0SH 1AE8H 1L2EA 1T4VH 2HPPH 4INHA 3LIWA 1CHGA 3ZZ7A 1O2IA 3NK8A 3ATWA 2GZ8A 1SGQE 2FOMB 1IQIA 5F8ZA 3M61U 3FFGA 3M36A 2AERH 2XBWA 4F4OC 2BM2A 3M5NA 3T29A 2Z3EA 1JRSA 1MCTA 1O3GA 5LGOA 3EE0B 1O3MA 7ESTE 1LO6A 1OWEA 2GT8A 1CBWC 3LONA 5GXPA 1TAWA 1FY8E 3SHAH 4Y79A 1PPFE 1Z8IB 3LGWA 2OUAA 5A8YA 2KAIA 4MLFB 1O2VA 1V2WT 2FTLE 2NU2E 2EI7A 3RDZA 1CT0E 1XXDA 2AMPA 4FVBA 1UTLM 5C67A 4E7NA 1DSTA 3LGVA 2VINA 3RMMH 2HWLB 2H9TH 3F6UH 1ARBA 1TX6A 3GYLB 1HIAB 1TYNA 4X1NU 1FPHH 2TPIZ 1A3EH 4H6SB 4JYVH 1SLXB 1H9IE 1O2NA 2C93B 1KLTA 5DP4A 2OD3B 2GTBA 1NFXA 5GPIB 1JIRA 1QGFA 5L30H 1EPTA 2ZEBA 4JCNA 1C5QA 1LHCH 3V3MA 2B8OH 3S9AA 4AN7A 1A2CH 4AYVB 1P02A 1K2I1 1UVOA 2ODQA 1C1PA 3ZYEA 3SV9A 2UUJB 2UWOA 1YBWA 3ZZAA 1AWFH 4SGBE 1CHOF 4GUXA 1HDTH 1JBUH 4AFQA 2G51A 1PPHE 2SGEE 5FX5A 1HAVA 1GHVH 2GDDA 2FESH 3AVZA 1KDQB 2FLBH 2WPHS 3SUFA 5HYOA 2WPMS 2NU1E 3JZ1B 2XTTB 2OXSA 2BLVA 2GCHF 2FIRH 4K2YA 3BTDE 1ZRKA 3ZZCA 3A8CA 3RC4A 1S0QA 3ODDA 4MPUA 1QA7A 3TH4H 4BOHA 5C20A 5I25A 1W12U 1GDQA 3STIA 1O5BB 1O2SA 2FMJA 2C8WB 1AZZA 1E0FD 2PGQB 4IMQA 1GG6B 1TMUH 1KSNA 4AGKA 1ZTJA 3K2UA 1EUFA 2VVCA 1VGCB 3GDUA 3SGBE 5GCHF 3FZZA 1VJAU 2GV6A 5FHTA 2Q6DA 4NWLA 3KIDU 5LH8A 2BY8X 1D6WA 4FUBA 3SW2B 4Y10E 1CQQA 3SU3A 1Y3VA 1O3KA 1O31A 1L4DA 3I77A 3RMLH 3HGNA 3SNAA 4X1RU 2ILNA 3P6ZB 3T27A 2BXUH 1AUTC 1X7AC 4CRCA 3FANA 3A7TA 3F9EA 5A09A 1SLWB 3M3VA 3SU1A 2FODA 1HAZB 3RLYH 2FOEA 4ZKSU 1EJAA 2IOTA 1AVXA 2DE9A 2A4RA 2RA3A 3SGAE 3SNEA 3P8NA 3SUDA 4DIHH 3RXQA 2VB0A 3OTJE 4NA7A 3VB4A 5LPEA 5SGAE 3PMJA 1BRAA 2VNTA 2AEIH 1H8IH 1C1QA 4NCYA 2GP9B 1AO5A 3QDZB 1TA6A 1PQ7A 2Y82A 3SJ9A 1T31A 4I8HA 2ZG0H 5E0JA 2HALA 1GBBA 1VR1H 6CHAB 2WPIS 2I6SA 3CENA 3JZ2B 4FUFA 3MMGA 1QRWA 1YPKH 4OS4A 1FIZA 1ARCA 1GL1A 4LXBH 1A3BH 2C8XB 2CJIA 2FOHA 3M5LA 3SQEE 1GI4A 4XBBA 1YPHE 1ZRBA 2FTMA 1O2RA 2Y7XA 3UR6A 2P93A 1D6RA 1GBDA 1GCDA 1IQJA 2PV9B 1TGSZ 1O5FH 4ZXYH 1MZDA 3T5FH 1O3JA 3T25A 1GVZA 2QY0B 3LC5A 1JOUB 4AYYB 1XUKA 4GHQA 3A80A 3QWCH 1BTYA 3PYHA 1XVMA 1GJ5H 3SI4H 4NFEA 4ZXXH 2TGAA 4Q7XA 2BD9A 2ODYB 4ISIH 1HGTH 3SO3A 3LDXH 3P8GA 1C5YB 1IQFA 4U32A 1T7CA 4B2CA 1K1OA 2ESTE 2R2MB 1Q31A 2GCHG 1GMCF 3ZZBA 1EXFA 3MNXA 3UNQA 4X1QU 1AB9C 4D7FA 1LKBA 1GI9B 4PROA 4ZH8A 2BVSH 1P8VC 1VJ9U 1L1GA 3DD2H 2TGDA 4B71A 1TALA 3PB1E 1TBRH 2A4OA 4TY6A 2RDLA 1QQ4A 1MKXK 1H1BA 1FAKH 1P2OA 1C1TA 1ZGVA 2PTNA 1E38B 4XFQA 2GGVB 3HKIB 3RXFA 1C1MA 4GLYA 1S6FA 1SGRE 1O2XA 1ZR0A 3RXUA 3BEUA 2VIDA 3GDVA 3RXRA 2XBYA 5FPTA 5A2MH 4Y8XA 4ISLA 3SNDA 1P2IA 1Z1IA 4ASHA 1TOCB 3GCHB 3Q3XA 4ABEA 3GICB 3UOUA 4X8VH 4DG4A 1BTUA 1O3CA 1ANDA 1Z71A 1O3FA 1FV9A 1K21H 2B0FA 2SNVA 4YOGA 1KTTB 1O5CB 5EXNA 1QBNA 4A7IB 1ID5H 2ZQ2A 4UFGH 1T8OA 3GY6A 1TNHA 4K1SA 2PFEA 1DSUA 4NFFA 1TNLA 2VIWA 2THFB 1QY6A 1SHYA 1WV7H 2C8ZB 5FCRA 1GBTA 1IQNA 1EP6A 2P3FH 1KYNA 1ELEE 1XVOA 2R3YA 1LPGB 1DWBH 1WQSA 1N1LA 2TGTA 2ANWA 3AAUA 1QRZA 3M5MA 3SHCH 4A5TS 3SUGA 1OOKB 1ETTH 1DVAH 1OX1A 1FY5A 1TRYA 1BHXF 1EZQA 1WTHD 4IGDA 4BAOB 1LTOA 2Z9GA 5C1UA 3F68H 3SOSA 1TABE 2OBOA 4I8LA 4K1TA 2F9PA 1C1OA 2EA3A 1H9HE 1GMDF 2ANKH 4FUHA 1GBFA 1MU6B 5HGGA 4E05H 1DANH 5DP8A 1YP9A 4X0WU 1ZZZA 1NT1A 3AASA 3E0PB 1GG6C 3MTYA 2AYWA 1SGFG 1T32A 1A5GH 3RXBA 3OY5U 4E7RG 1VGCC 1DT2A 1DY9A 1ZMJA 3MNSA 3DFLA 3TLOA 2BDHA 1FN6A 1O34A 4I7YH 3U9AH 2PGBB 4TWYA 3OYPA 1GMCG 3OSYA 2ZKSA 3DA9B 1ZSKA 4BTTB 1RIWB 4CHAB 4X1PU 1FN8A 1IQMA 1EOLA 4KTSA 3E1XB 3KGPA 1Y5UT 1Y3YA 3LU9B 1P9UA 1ZHPA 4BANB 3A8BA 5B6OA 3A8AA 1E35B 2NWNA 3ELAH 1OYQA 5C3NA 4ZAEA 1K28D 2D8WA 1GJ6A 3NCLA 1LPZB 1O2UA 3UY9A 1KTSB 4ISHH 1AKSA 5DP9A 5J4QA 1SGPE 1ETSH 1GVLA 2GT7A 4VGCB 2FDAA 2WPJS 2A7JA 2OC7A 1DICA 3MH4A 1YCPM 3K9XB 1UVPA 1EAIA 1RD3B 4YO9A 1LQEA 3S7HB 4NA8A 3RXAA 2WYJA 1V2UT 4NGAH 2PUQH 2OINA 5PTPA 1DM4B 1HXFH 3MO3A 4D7GA 4ISNA 2B5TB 2XC5A 1OS8A 4XE4A 1AFQB 3VB6A 1K1PA 2FX4A 2TBSA 3EAJA 2ZPRA 4ABGA 1PQ8A 1XUIA 2BOHB 2Z9KA 3BEIB 4ABAA 1UTMA 1EJNA 2OC0A 1BMNH 3GY8A 3NUMA 4I32A 2M5TA 2PSYA 4CR9A 4AZ2B 1Z7KA 2SFAA 4FUEA 2VH6A 2BLOA 4TY7A 1OP0A 3QN7A 5DK1A 3LKWA 1INCA 3LC3A 3M3TA 1SGFA 1O2HA 2LPRA 1TFXA 4X2WA 4YOJA 1TGCA 1V6DA 3OX7U 5AFZH 3ZVFA 1C5OH 4X2XA 2A5IA 1ACBE 5EXMA 1C5TA 2LNCA 4Y0YE 2ZNKH 1D3DB 1QFKH 3ZZDA 4OGXA 2WINI 4YLQH 4DCDA 2C90B 1KXFA 3SI3H 3TK6A 1PPGE 4CREA 1O3OA 1M9UA 2QN5T 1BMLA 1NZQH 4Y7AA 2ZCLP 1GMDG 5EU8A 1MQ6A 2JKHA 2WV5A 4XOJA 2ZU5A 1P2NA 3D23A 3TVJB 1YPEH 3IITA 4WVPE 2WPKS 5HM2A 2ZQ1A 4WH6A 5A0BA 3O8CA 1L1JA 1P12E 2QF3A 4I31A 3GYMA 4B75A 3ZVBA 1KXAA 2P3UB 3RM0H 4U01A 1J14A 3ESTA 5E0GA 2A5AA 2OCVB 5A0CA 3RC5A 4BAKB 1HAIH 7GCHF 1CVWH 1XKBC 1VCPA 1HCGA 1PPEE 2BZ6H 2GMTB 4KGAA 4IN2A 1CGJE 3SGQE 1GI2A 3ZV8A 1C1WH 1AMHA 1VITH 2ZHWH 2CMYA 1QL7A 3NPSA 3R3GB 3EYDA 1QB1A 1HAOH<