4DGJA

Structure of a human enteropeptidase light chain variant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
235
structure length
235
Chain Sequence
IVGGSDAKEGAWPWVVGLYYDDRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAILGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPISLPEENQVFPPGRNCSIAGWGTVVYQGTTADILQEADVPLLSNERCQQQMPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYECALPNRPGVYARVSRFTEWIQSFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Enteropeptidase catalytic light chain
publication title Crystal structure of a supercharged variant of the human enteropeptidase light chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 235
sequence length 235
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.9: Enteropeptidase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dgjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dgjA01
2ZU1A 1K9OE 1MD8A 4MPWA 2AFQB 5ETXA 2FS8A 1NU9A 2FO9A 2R9PA 2GDDA 2BD8A 1F7ZA 1LPGB 2A31A 1B5GH 1HJ8A 1IQMA 1OP0A 1ELTA 4MDSA 3PMAB 3T2NA 3ZZ5A 1TMTH 4WWYA 3E0PB 1XX9A 1TWXB 1IQLA 2ZTYA 4ZAEA 1LHCH 1YBWA 2OD3B 2UUKB 3TH2H 4O3UA 3UNQA 5LH8A 2PKSC 1NY22 1FV9A 2PUQH 4GSOA 1WQSA 1O3KA 5A0AE 2V3OH 3OSYA 3RXOA 3LGUA 4DY7B 2ZFQH 1EOLA 2Z9GA 3BEIB 3ZV8A 1BBRE 3GY6A 3OY6U 4TY7A 5DP3A 2Y80A 4MVNA 1AY6H 1XKAC 1AWHB 3UFAA 1FZZA 2BDCA 1GHVH 4XBDA 2SGAA 3UREA 1MBQA 1ANBA 4NA9H 1SFQB 1W11U 3E1XB 4Z6AH 4NIWA 5HYOA 3A7WA 1SVPA 4KKDA 1D3PB 1KLIH 2BQWB 1AHTH 5FX6A 1TFXA 2EI8A 2GD4B 3RMNH 1IQHA 2XW9A 2Z3EA 1CGIE 1SB1H 2SNVA 3HATH 1K2I1 4O3TA 1S83A 5GWZA 4NSYA 3SJOA 4AB9A 1OWKA 2J95A 2SFAA 1C5OH 3RP2A 1BMLA 1C5YB 1CA8B 1SGDE 1YCPH 4XBCA 4D9RA 3BTWE 1BMAA 1HAOH 1BTZA 1WV7H 1VCQA 2ZU4A 2SNWA 1FLEE 2W26A 1KXEA 4K5ZA 4JCNA 1V2KT 1PJPA 3TK5A 2SGFE 4MTBA 1BBRH 3PWBA 3F9HA 4UFFH 1ANCA 2ZO3H 2B8OH 1BTWA 1F5KU 5J4QA 3GDSA 2BLOA 3M5NA 2OLGA 3RXUA 3SHCH 2AERH 1TRNA 3QUMP 3A83A 3MH6A 1QHRB 3ZVFA 1V2JT 1HUTH 3C1KA 1SHHB 3VGCB 1F5RA 5GCHF 3A86A 2AMPA 2ZHDA 2F91A 3SORA 4Y8XA 1OYQA 2C8XB 2FOCA 2A7HA 3F1SB 1ZRKA 4FUJA 4RN6A 3A8BA 1OKXA 2NU2E 2FLBH 1KSNA 4O03A 2QXGA 1OWIA 4DVAU 2SGEE 3ZZ4A 3KN2A 1JMOH 1WTGH 3SGAE 2TRMA 1A5GH 1FN6A 5EXNA 1ARBA 3MWIU 2Z9KA 1UO6A 4E06H 2UUFB 1KTTB 3JZ1B 1SQTA 2BLWA 1NN6A 1KIGH 2OC8A 3BTGE 1TYNA 1ZSKA 3U9AH 1THSH 2GP9B 1DITH 4Y0YE 1Z8IB 5HXFA 2G55A 1SGTA 4BAHB 1QJ7B 1HGTH 1O38A 3PROA 3A8CA 1Z6EA 1DM4B 1FY8E 1YPJH 1GJ9B 2BVSH 5E2OA 1T7CA 1JRTA 2TGAA 1QTFA 2THFB 4ABIA 4YO9A 2AEIH 4X2WA 1TALA 1TE0A 2P8OC 3S7HB 1CSOE 1IHTH 3SV9A 1JOUB 1D3QB 1WOFA 3L3TA 5PTPA 5CHAC 2QA9E 2HPQH 3LGWA 1ZJKA 1P2MA 1GJCB 4FU8A 2W7UA 1NZQH 3TJNA 2AGGX 3U1IB 1ZSJA 1O3DA 2FMJA 2BDGA 2FLRH 2GV6A 4Y10E 2FZZA 4AFUA 1W12U 1K1IA 1FNIA 1P2IA 1T31A 1GI4A 2OCVB 2ZDLA 5A0CA 3ODFA 1S5SA 3RLYH 1ELFA 1QBVH 2BQ6B 1UVPA 1BTYA 2WPMS 3A7YA 3K9XB 3EA7A 3TH4H 2QN5T 4TY6A 2W5EA 2ILNA 1GJ8B 1YPMH 3RXLA 1LPKB 4SGBE 2Y5HA 1C5LH 1HDTH 1O5CB 3A7XA 2QAAA 1FONA 2XBVA 2XWAA 2ZGXH 3ATWA 4I8LA 3SU0A 3U98H 2J38A 2BLVA 1GHZA 3MH5A 1PPHE 1NFUA 1PPEE 3SU4A 2ASUB 1QQ4A 1KDQA 1TAWA 3SU2A 1PPCE 5E0HA 4OGXA 2P93A 1Q2WA 1ZMJA 3PO1C 2IPHA 5JDUB 3T26A 4BAOB 2GZ7A 1GBCA 3BG4C 4AYYB 1SGQE 5A09A 1GJ4H 3VB5A 2VWMA 1QURH 2KAIA 1AE5A 3M5OA 4YT7H 1LMWB 1ZMLA 1C1SA 2A0QB 5FBIA 2FTMA 1ANEA 5LPFA 1DY9A 1ZR0A 2Y81A 1O3PB 2PKAA 4DURA 3K6ZA 1G30B 2HWLB 1Y8TA 5A8YA 2C90B 5JYIA 4A1TA 2GV7A 2Z3DA 1P2JA 3V7TA 3UNRA 4ZMAH 1IQNA 3M7UA 3SU1A 2ZG0H 3SJ8A 5JPMH 4U01A 3FAOA 1CGJE 3D65E 1UHBB 2Q6FA 8ESTE 4JMYA 1C5UA 1MUEB 2NU3E 3TITA 4NFEA 5GXPA 3TK6A 4Q7YA 2A2XH 3M3SA 4WMDA 1VCWA 4FUIA 1O34A 1TQ0B 1V2WT 5DP7A 4HZHA 1SMFE 3SV7A 4U32A 2D26C 3VB4A 5EPYA 3RXCA 3E90B 1KDQB 4ABEA 1ZPZA 2G4TA 2TPIZ 4HI3A 1L4DA 1EOJA 1QIXB 1SFIA 2YOLA 1ELVA 1Y3VA 4UONA 1ZPBA 4TPIZ 4Y0ZE 3RXQA 3PWCA 5TCCA 3W95A 2ZTXA 2RA0A 1C1VH 1C5XB 2P59A 3SGQE 2QF3A 3T29A 1TBRH 2GTBA 2JETC 3QWCH 4ABJA 3DFLA 2ZHEH 1A0LA 2B7DH 2CHAC 2ZPRA 4I32A 2O8UA 1C9PA 3TJVA 3EA8A 1MQ5A 1O3OA 1OWHA 2FIRH 2J2UA 2XBXA 1BHXB 4ABBA 1MAYA 3LT3A 2Z7FE 4WXVA 2OC0A 4I31A 3SW2B 1G3DA 2VIVA 2XBYA 5ESBA 1UCYK 2ZDMA 1LVBA 1A3EH 2BMGB 2OQUA 1WAYB 2A7CA 1LHDH 1H8DH 2G4UA 1TQ7B 1OS8A 3TGKE 4FUEA 2ZTZA 3TGJE 1Y3XA 3UWIA 1WTHD 3OYPA 1GHAF 1CBWB 1AFEH 3PV4A 1QL7A 2XTTB 3EAJA 1HAPH 4I7YH 5EQQA 1FY5A 1E35B 4CRDA 4WMEA 1HAXB 3SNDA 1O2SA 1Y59T 1W8BH 1SGFA 2ZFSA 2ZFFH 3V13A 1E38B 1UTLM 1GDNA 4XDEA 1LDTT 4X6MA 2HPPH 9LPRA 3BIVH 3GY3A 1SGRE 1Z8RA 1O5BB 2FYQA 1GHBF 2GX4A 2ANMH 3Q3XA 3SJ9A 1TX7A 4Y79A 4THNH 4OS2A 1ID5H 5F8TA 3SBKA 1GI1A 1O37A 1Y3UA 2VU8E 4K69A 1MKXK 1G2MA 1QFKH 2WV5A 1LO6A 4O9VA 1O3NA 1UK4A 5GJ4B 4MPVA 2Z94A 1PYTC 2BD9A 3CS0A 4ABFA 2HVXA 3ZV9A 2Z9IA 1A0HB 1IQFA 3T62A 2F9OA 1TABE 2F9UA 1O5FH 1SPJA 2GVFA 4I8GA 6CHAB 1GBFA 1ZHRA 1XXFA 3AVZA 4H4FA 3EGKH 3M3TA 2OP9A 1AD8H 2FODA 4WF8A 3DUXH 4ISOA 1HAGE 4F49A 5LGOA 1DICA 3M5LA 2AIQA 3MU1A 4ISHH 1MZDA 1S6HA 4MG3A 2BYAX 1YPKH 3SUDA 4B1TA 4NZLA 4ZUHA 3MOCA 4DOQA 1A46H 1SOTA 1MH0A 4AZ2B 1GJAB 1YPLH 2XCFA 3BEFB 2AGIX 1FAXA 4OS4A 3TVJB 1QGFA 5EQRA 1EJNA 1FY1A 4OS7A 1G3EA 3LJJA 3GYLB 1HXEH 2QXIA 1EUFA 1D3TB 1TGSZ 2A4RA 2FPZA 1TNLA 3ZZAA 4YOJA 4X6NA 5C5OA 3E3TA 3QZQA 5CMXH 3TJOA 1ELGA 1GI9B 3SQEE 3M7TA 1TLDA 3Q77A 3URDA 1V2LT 4DW2U 1O2ZA 1C2EA 5DJ7A 3M36A 3MU8A 4Y6DA 3E16B 2ODPA 2V3HH 1HB0B 4UFDH 3TK9A 3RMOH 4WVPE 1V2PT 2UWPA 4NA7A 1GJ5H 5K7RA 1SLWB 3C27B 3M5MA 4K1TA 4AX9H 1CU1A 1P8VC 4RKOB 1MCTA 2BZ6H 1OWDA 4OS6A 1QY6A 5I46H 1DOJA 1GWAA 2G51A 2R0LA 3LGYA 2ZF0H 5C20A 1TB6H 2UUJB 1A5HA 1P02A 3TJUA 2F3CE 2XC4A 3P8GA 2I6SA 2G5NA 4Y8YA 1V6DA 4B76A 4ZHLU 3FP7E 2FP7B 3VB3A 1HAZB 2FX4A 2QGRA 3B23B 5EXMA 2PLXA 1PYTD 1MKWK 3UR9A 2ZQ1A 1GBEA 4K8BA 2BDBA 3FANA 4QT8C 3BTEE 2DUCA 1X7AC 1QBNA 3VGCC 4A6LA 3ODDA 1EB1H 4FVBA 2OUAA 4XSKU 4Z0KA 1CHOF 1YKTA 1GBDA 1OP8A 1O2XA 4LOYH 1GVKB 3RU4E 4CH8B 1F0TA 5LPRA 1HJAB 2BVXH 1XMNB 2C3SA 3VFEA 2PWXA 5DP6A 4YESB 3QN7A 3BTFE 1XUFA 1PFXC 1G32B 3QGNB 4ZKRU 5ESTE 1Z6JH 4INKA 1QL9A 4FUFA 1TNJA 4GLYA 1TA6A 3QZRA 4FUGA 3T27A 3RMLH 4IGDA 4FU7A 1MTSA 1K1NA 3DD2H 1EPTA 1XXDA 1YM0A 2FS9A 4NA8A 3KEEA 4TPYA 2PW8H 1YPHE 1ZGIA 1HAVA 1UTJA 5TJXA 3GY2A 3M37A 1DLKB 3ATIA 2WV4A 1VJ9U 1AVGH 1WSSH 3A88A 3KQBA 1C1MA 1DWBH 2AMDA 5DG6A 1LHFH 3LPRA 4JZEH 4IC6A 1Z8JB 2F9NA 4GCHF 2FXRA 4D7GA 3V0XA 1BTUA 1K28D 1K22H 1FN8A 1UTQA 3ATKA 1C1UH 1ZHMA 2GCHG 2Z9LA 2R0KA 4X1PU 1AB9B 2BB4A 4A7IB 1KTSB 2GDEH 4NWKA 3KCGH 1FIWA 1BRCE 1TA2A 3CENA 3F9FA 2H5DA 4H42U 3OTJE 3SHAH 2ESTE 5DP5A 2WPIS 2FX6A 2GZ8A 1GBLA 4XFQA 3SU3A 4DT7B 2BOHB 1SGCA 1GBBA 1N6YA 2FOAA 1BIOA 1DSUA 4IMQA 1ELCA 3MU0A 3T28A 1DWEH 2XC0A 7GCHG 1INCA 4OGYA 1GHXH 1DSTA 1BTPA 1SBWA 2VH0A 3SGBE 3HGPA 1BITA 3MO9A 3RC6A 2IOTA 3LGTA 1J14A 5TCAA 2Z6BD 1UMAH 1W14U 3K2UA 3TNSA 3ZZ6A 3QDZB 3KGPA 2B5TB 3A85A 2UWLA 1SGFG 2OC1A 2BY8X 1TPPA 1C9TA 1XUJA 2PHBA 3UQVA 2Q6GA 1ELAA 3SUGA 2XYAA 1EPTB 1S84A 1H8IH 1EASA 1BMMH 2BQ7B 3BF6H 1HAVB 1IQKA 1YCPK 1EZSC 1VITG 1P3EA 1V2NT 1NO9H 1TONA 1UTKA 1THPB 1F0SA 1JXPA 1V3XA 4A92A 1TOCB 2OTVA 1ZHPA 3U69H 1NM6A 1KXFA 1Y5BT 2BD2A 4D76A 5EW2H 3NCLA 3P92A 3ELAH 2BDHA 1TNIA 2EEKA 1MTVA 1UTNA 3ATMA 1GI5A 1AFQB 2BLQA 3G01A 3H5CB 1SLXB 1G3CA 3SNBA 1AMHA 2H9HA 3PMJA 2QY0B 3NPSA 4AYVB 1O2JA 2H9EH 5I25A 2B0FA 2GT7A 2AS9A 3W94A 1XUKA 2WPHS 3S7KB 1FXYA 2J9NA 1NESE 5EODA 4IMZA 5L6NH 8GCHF 4CRFA 1QNJA 1O3FA 1O35A 2JKHA 5FPYA 1TRMA 5GIBA 2AYWA 1ZLRA 1F0UA 4GHTA 2XXLA 3GDUA 5EPNA 5L2ZH 1P3CA 5GDSH 2PTCE 1LTOA 1Q31A 2ANWA 1SG8B 4CBOA 1Z8GA 1P12E 3NUMA 1TBQH 4BOHA 1O32A 2H6MA 4BXSA 4KTSA 1O3BA 1JIRA 1MU8B 2JH0D 3TGIE 2QXHA 2QV1A 4XBBA 1AZ8A 3RU4D 1SOZA 2FOFA 3SV8A 2TGDA 1MAXA 1DS2E 3MNBA 4E05H 4HFPB 2XNIA 1O3JA 1OX1A 1FPHH 1VZQH 1BT7A 1O2PA 2AMQA 3EYDA 4X1NU 1VGCB 1FIZA 2AH4X 2ALPA 2D1JA 3FVFB 4FVDA 1MMJN 6ESTA 2BY5X 4AB8A 1FY3A 1UK2A 1PPBH 3MNXA 1RTLA 1AQ7A 3KQDA 6GCHG 3S9AA 1GHWH 5A0BA 2EA3A 4JYTA 1ZTKA 4Y7BA 2ZCKP 4JZIA 1V2RT 4UD9H 2HALA 3KQCA 2VB0A 2VWNA 1HXFH 3ZZ7A 1LHEH 2HOBA 1FI8A 2F83A 2D2DA 3VB6A 5E2PA 3AAVA 2FDAA 1TX6A 1DUEA 4H6SB 1MTNB 3UOUA 4PROA 2C93B 2WUBA 1O2LA 1Y3YA 2PR3A 3GCNA 3RXDA 1BJUA 1GCTB 1D4PB 1GPZA 1U6QA 3NK8A 2RG3A 1HYLA 3URCA 2ZC9H 1CBWC 2LNCA 3HKJB 1C5VA 4F4OC 4ABGA 3GISB 1N8OB 3SJIA 2ZDNA 1EAXA 1H9HE 1SGNE 3ZVAA 1J15A 4AN7A 3ZYEA 3AW1A 1CT2E 1BHXF 1GG6B 2FESH 1O0DH 3KHVA 1TGCA 2FEQH 5AFYH 4WH6A 3RXIA 4NIVA 4CR9A 4CRGA 1IHSH 4KGAA 3MYWA 1GCDA 3UTUH 3A7TA 1H1BA 1Q3XA 1AU8A 3KL6A 5E0GA 1T4UH 3F9GA 2SGPE 2VIWA 2Y5FA 2WUCA 3RXBA 4O97A 4B75A 3P95A 5JBBS 2WPKS 4DIHH 1L4ZA 3TLOA 3RXVA 1LPZB 1AVXA 4CBNA 7ESTE 1Z7KA 2Q1JA 5FPTA 3M35A 5C1YA 4FXGH 4YM9A 4WY3A 4RSPA 1TGTA 1C1NA 1EB2A 3SQHE 1GMDG 2F9PA 1HCGA 1T32A 2A32A 3OU0A 2PUXB 2HNTE 1C2HA 3FP6E 2C8WB 3EQ0H 6CHAC 2GMTB 4ISIH 1JBUH 9ESTA 3MU4A 2XC5A 2FI4E 2J92A 3T25A 1AIXH 1PQ5A 3ZVGA 1CE5A 1O36A 3SU5A 3NWUA 1MU6B 5JBAS 2TBSA 1GJ6A 2VJ1A 3QK1A 2IN2A 3SNAA 3STJA 1EAWA 4X8VH 1UCYE 2ZGJA 1O3MA 3GCHB 4AFSA 1EZQA 1G36A 2W3KA 3V12A 2TGPZ 1BRBE 1DXWA 1C1QA 1O39A 1VITH 2W3IA 3NKKA 1P03A 1Y3WA 7GCHF 4AOQA 1AVWA 1P2OA 3TH3H 4YZUA 3ZZBA 4ABAA 2A4QA 5FXLA 2FTLE 4TWYA 1O3GA 5FX5A 2FOGA 1V2UT 2KAIB 3LKWA 1O2QA 2R2MB 3RXTA 4B74A 3RXKA 3SUEA 1UJ1A 1EATA 4CHAB 5EOKA 1AE8H 4DIIH 1AN1E 2NU4E 3K6YA 3MMGA 2PKAB 2HNTC 3U8RH 4X2VA 1HFDA 1BOQA 3RU4T 1GBMA 3RC4A 3PTBA 1ETTH 3HPTB 1S0QA 1GBHA 3Q3YA 1VITF 4UFGH 1GMCG 2ZA5A 3CS7A 3H7TA 3VEQB 5F8XA 3PB1E 1DE7H 5T6GA 4GVUA 3A7ZA 5FPSA 3ZVEA 4VGCB 3E91A 4XE4A 3ZVDA 1UVUH 2ZU3A 1TGNA 2ZDAH 3V3MA 1QB1A 1TNHA 4I33A 5AFZH 3KNXA 3LGIA 5A8XA 1S85A 4TYDA 2FM2A 1L1JA 1GBAA 3PMBB 1SHYA 5DPAA 1EAIA 1O2IA 1TRYA 3BTHE 4X6OA 5H4IB 3UQOA 2VWLA 1LVOA 1UVSH 1TNGA 3CP7A 4IC5A 2ZFRH 5F8ZA 3MFJA 4BAMB 1LQEA 3GY4A 3P70B 1QL8A 1RJXB 3HKIB 4Y76A 3FFGA 3TNTA 3VPKA 5DK1A 1KLJH 2ZGBH 1HJAC 3HK3B 4KP0A 3RXMA 1O3EA 1AI8H 1ZTLA 2BY9X 1OWJA 5HMAA 1BA8B 3MH4A 1AO5A 1NS3A 1V2TT 2VVUA 4B2AA 4BTIB 1ABIH 4UEHH 1YC0A 1KYNA 1HNEE 2G52A 5E8EH 1W7GH 3ZZDA 1M9UA 1GI2A 4ISLA 4TWWA 1O3CA 2A45B 3SOSA 2A5IA 4MQAA 3SJKA 3KF2A 1CT0E 1CGHA 1V2ST 2B9LA 2ODYB 2QXJA 2J34A 2FOHA 4K60A 3O8RA 2R3YA 3LC3A 3FP8E 3MNCA 1O2YA 5JB9S 3FZZA 4JYUH 5T6DA 3P8NA 4NCYA 5FCKA 1CQQA 5GCHG 4GPGA 1NRPH 2EC9H 5FCRA 3SO3A 1AUTC 1T8NA 2ZHQH 4YLQH 2GCTB 1EZUC 1VJAU 5G4BA 6GCHF 5CE1A 1GI8B 1DY8A 1HLTH 1RIWB 2C8YB 2Y7ZA 4I8HA 1V2QT 4JZDH 1AB9C 2H2ZA 3VXFH 2VVVA 5EG4A 2FOBA 1HAHH 1HIAA 3ESTA 1FQ3A 2CN0H 1EZXC 3IITA 3PLPA 2H9TH 4ISNA 3E0NB 3MO3A 3GY8A 1CA0B 1RFNA 3B9FH 1C5ZB 1ORFA 1P0SH 3QO6A 5LPEA 1V2MT 1HBTH 3I77A 1GI0A 4CRBA 1W7XH 3O8CA 2VGCB 1ABJH 1B7XB 2P3FH 1T4VH 2PSYA 3S69A 4H6TA 1SLUB 1C2IA 2BD7A 5DKMA 1ZMNA 4BTTB 2C8ZB 4JYVH 3F9EA 4B2CA 1THRH 1EPTC 1T8MA 5BPEA 2ZEBA 3M3VA 1NRSH 4E7NA 3MU5A 4A5TS 1C5WB 1O3IA 3A8DA 4FUHA 2SGDE 1MQ6A 4A1VA 1D3DB 4BANB 3IWMA 2VIQA 2XBWA 3H7OA 4NFFA 1NC6A 3Q3KA 6LPRA 3ZYDA 2BDAA 1RXPA 2BVRH 4WJG2 1Y5AT 3UOPA 2ZU5A 2NU0E 1F2SE 1AFQC 2UWOA 2P95A 5E0JA 3U8OH 1BUIA 1QRZA 4AFQA 3HK6B 3NZIA 3S9BA 1GI6A 2BX3A 2FI3E 3E6PH 3EDXB 1RGQA 2IJOB 5JBCS 1O3HA 3RM2H 1GBKA 1HIAB 1SSXA 3UIRA 4X8SH 2JH6D 2ZHWH 2WYGA 4Y8ZA 3RDZA 3QX5H 1RTKA 1A4WH 1P57B 4IS5A 3PLKA 3DA9B 1D6RA 3TU7H 4CH2B 4ZH8A 3GCOA 1YYY1 4ZKSU 3RXGA 4X1RU 2A5AA 3HGNA 3SV6A 1JIMA 1GGDB 1MBMA 3ZZ9A 2ZFPH 2VWOA 1T8OA 1TMUH 1A0JA 1LKBA 1NU7B 2ZQ2A 1ZSLA 2RCEA 2EI7A 1PQ8A 3DT0H 3MNSA 1Z1JA 2SGQE 1NT1A 2A5KA 2ALVA 3IG6B 3VXEH 1BB0B 5IYTA 2LPRA 1A2CH 4DJZB 4ZHMU 1MZAA 2BD3A 2ZCHP 3PTNA 1TIOA 2QC2A 2ANKH 4BAKB 2J4IA 3PYHA 1RRKA 2GT8A 1O2UA 1VGCC 2OXSA 4M7GA 4MNWA 1F92A 1O2NA 3ZZ3A 1EX3A 1QJ1B 1S81A 3M7QA 1EAUA 1WYKA 3ZVCA 5EW1H 2STAE 1ESBA 1C5RA 5L2YH 2FOEA 5C2ZA 3NXPA 1O5GH 3BEUA 1GL1A 1XVOA 1G2LA 4ABHA 2YNBA 1BRAA 2BDIA 2BD5A 1AUJA 1RS0A 1C2KA 2ZCLP 4OS5A 3RM0H 5T3HA 2H1UA 5F03A 5L30H 2ZPQA 4Q7XA 4UE7H 2CV3A 3B8JA 4DGJA 2F9BH 5BRRE 4E7RG 4FUDA 1DX5M 3PM3A 2AGEX 3GDVA 2BY6X 1MTNC 3LH3A 2QCYA 1FJSA 2V35A 5HM9A 1YCPM 1O2OA 1GCTC 1GMCF 4A1XA 1NRRH 4D9QA 8KME2 1MD7A 1C2JA 1HAYB 1BDAA 1XM1A 2VVCA 1OOKB 1MTWA 1MTUA 2ZGHA 1H9LB 1HV7A 5DO4H 2M5TA 1AZZA 4Q80A 3ZZ8A 2ANYA 1ZZZA 1N8OC 1P2QA 1C5NH 1YPHC 1SLVB 4ZKOU 1LVMA 1NTPA 2VIDA 2VH6A 2VIPA 1KLTA 3A87A 4INLA 1GG6C 1C2LA 3RLWH 5JB8S 4ABDA 2ZI2H 1E0FD 1C1OA 2BY7X 4ASHA 1C5PA 1PQAA 3F68H 1WBGB 1CVWH 1BTXA 2UUYA 4JZ1A 1GJ7B 1UVTH 4K2YA 3A84A 4NG9H 1BBRK 4X6PA 1QA7A 1TNKA 1GVLA 1CHGA 1H4WA 2GKVE 5FAHA 1DANH 2F9VA 1BTHH 1GMHG 2PSXA 3AW0A 1OYTH 1OSSA 1HJ9A 4Y71A 1UTOA 1P01A 3D23A 3WY8A 2ODQA 4Q7ZA 1GHAG 4BAQB 1CT4E 1OPHB 1VR1H 1K1LA 2V6NA 4YT6H 5EQSA 3Q00A 1TPSA 3ITIA 3LGVA 3LH1A 3P8OA 1A7SA 2GMTC 1H9IE 5EXLA 3GCTG 3LC5A 1GBJA 1DFPA 1J9CH 3TPIZ 1GHBG 4X8UH 1S6FA 3QTVH 1O5DH 3UUZA 4NIYA 1GI3A 3LIWA 1BRUP 1NFWA 4MLFB 4OS1A 4ZKNU 3GCHC 2CF9H 1C5SA 2ZHFH 1P2KA 1OWEA 3BTTE 1RTFB 1LVYA 2ZU2A 3D49H 4K8YA 2OC7A 1SGEE 1ZGVA 2FYRA 4X2YA 1DLEA 3RXJA 3UR6A 3UY9A 2CGAA 5EGMA 1GJBB 2Y7XA 1SQOA 3I78A 4IN2A 2G8TA 2ZNKH 3LJOA 1P06A 2Z3CA 3R3GB 5SGAE 3BTQE 4UDWH 1MCVA 1O2MA 1PPFE 1QJ6B 3UPEA 1V2VT 4AGKA 4UFEH 4Q2KA 2H5CA 1W10U 1C1RA 2G81E 4CHAC 2ZPSA 1IOEA 1KXAA 1GDQA 1WU1A 3O8DA 1EKBB 1HAIH 1GJDB 2PKSB 2RA3A 1N6XA 4INHA 4B2BA 4YTAA 1B0FA 3AASA 3ZVBA 1BCUH 3LU9B 2WINI 1O5EH 1C4V2 1OXGA 1P04A 1T8LA 2G5VA 3BTDE 4ZXYH 4NZQA 1QB9A 1UTMA 4CRAA 1IQGA 2DE8A 4HGCA 1GBTA 1ZRBA 1Y5UT 1O2GH 4R8TB 1ELBA 4VGCC 2HRVA 1PPGE 3BTKE 5C1UA 1E37B 1LCYA 3I29A 1K1MA 1PQ7A 1EJAA 1C1PA 5C5NA 2WPLS 4BNRA 3UWJH 4B73A 3VB7A 5HGGA 3ZZCA 1ARCA 3EE0B 1K21H 4YLUA 3QGJA 5HM2A 2K1QA 1PPZA 1GBIA 5FBEA 3PLBA 3MH7A 2ZDVH 4DG4A 1UHBA 3D62A 1EP6A 4ZXXH 4AFZA 5AF9H 4I8JA 5FHTA 2ULLA 1XKBC 3BN9A 1A1RA 1K1OA 2A4GA 2XCNA 4MNYA 2PV9B 4LXBH 1QQUA 2HLCA 1IQIA 1BJVA 1HPGA 2Y5GA 3BG8A 5T6FA 3SNEA 2CMYA 1E34B 1UVOA 1TGBA 1LQDB 1GI7B 2JH5D 4YOGA 4AG2A 1ZOMA 4D7FA 1O3LA 2WPJS 1B0EA 4JZFH 3SUFA 1YPEH 3A89A 4I8KA 4JK5A 4ESTE 1P11E 2BZAA 3RXRA 3Q76A 1WQVH 2HGTH 1YP9A 1XVMA 2QIQA 1CO7E 1D9IA 1NPMA 1W13U 1C2MA 1O3AA 3L6PA 2FWWA 2ZP0H 1GDUA 4IN1A 1UK3A 3T5FH 2GCTC 1CHOG 1S0RA 2GZ9A 1WCZA 4KTUA 3MTYA 2TGTA 1SGPE 1V2OT 4Y7AA 5JBTA 2GCHF 1EQ9A 1RIWC 1O31A 3O8BA 3QLPH 1C5QA 1TBZH 4NSVA 1ETSH 1G37A 2J94A 4GUXA 4MNVA 1QBOA 4CREA 1O2WA 1WUNH 4X1SU 1DUAA 1DWDH 3P8FA 1YPGH 2BDYA 3U8TH 2BXTH 1SGIB 1CA0C 2ZGCA 4YOIA 1SC8U 1FMGA 5IDKA 3S0NA 1XUHA 2Q6DA 1G9IE 4JK6A 1XUIA 3KIDU 2ZKSA 4U2WA 4WH8A 8LPRA 2VGCC 4LZ1H 1C4U2 1A3BH 3QTOH 5B6OA 2BXUH 1F5LA 1UTPA 4MPUA 1N1LA 3RUOA 3BIUH 1ESTA 2ZDKA 2PFEA 4X0WU 4K1SA 2P8OB 4GCHG 4J2YB 2P3TB 4FUCA 5J4SA 1ZYOA 3RC5A 2R3UA 4X2XA 1QR3E 1YF4A 3AAUA 3PMHB 5CHAB 2W7SA 1FAKH 1BZXE 3ENSB 3MI4A 4XOJA 4LK4A 2BM2A 2VIOA 2O8LA 1C5TA 3SV2H 1FPCH 3RXFA 2BHGA 2BX4A 1UCYH 2BTCE 1BMNH 1XUGA 3SI4H 4RKJB 1G3BA 2XWBI 3ATLA 2A4OA 1GMHF 3GY5A 3STIA 1LKAA 2OBOA 1C2GA 1C2FA 1ELDE 1KXBA 2HNTF 3A82A 1Z71A 3GICB 3GYMA 2GGVB 3LONA 1W0YH 2CXVA 4LZ4B 1O30A 5DGJA 1C4Y2 1P10A 1SQAA 2VINA 4D8NA 5C1XA 2WYJA 2O8TA 2NWNA 1ACBE 1GGDC 2QF0A 3DFJA 4CRCA 1O2TA 3L33A 1EXFA 1C1WH 1C1TA 1YGCH 4K1EA 2R2WU 1QA0A 4FUBA 3RXHA 4X1QU 4KELA 2DE9A 2V0BA 1SI5H 1AKSA 1DVAH 3GCTF 4GHQA 1DPOA 1JRSA 4MPXA 1GHYH 4DCDA 4AORA 5GPIB 2C4FH 1O2KA 4X8TH 3PO1B 2OBQA 1NFYA 2P94A 3A7VA 1A5IA 2D8WA 2O9QA 1MKXH 3P6ZB 3K65B 3MHWU 3A81A 3BG4B 1E36B 2PGBB 1O33A 3SNCA 1P9SA 1L1NA 1EP5A 2ZECA 5A8ZA 4CR5A 1FY4A 2A7JA 2OQ5A 5A2MH 8GCHG 1W0ZU 1W2KH 2NU1E 3N7OA 1P05A 1IQEA 1O2RA 3OX7U 1P09A 1ANDA 4NWLA 1JWTA 4R0IA 1K1JA 1FUJA 1C2DA 1OP2A 1P2NA 5EU8A 1K1PA 1L0ZA 4AGJA 1J8AA 1F0RA 3RMMH 1NROH 1KY9A 2ZWLH 4B71A 3OY5U 4NGAH 1IQJA 4FU9A 2BOKA 5F6MA 1J17T 1SL3A 1YLDA 2ZIQH 2A2QH 1O2HA 2P3UB 3SU6A 2CF8H 4ZROA 1NRNH 2Y6TA 2BD4A 1D6WA 2I6QA 3F6UH 3DHKH 3RXAA 1QB6A 1AGJA 2A1DB 1O2VA 2P16A 3RXPA 1NRQH 5K0HA 2AIPA 1AKSB 1L1GA 1TMBH 1FDPA 3BTME 3FZDA 3P17H 2O8MA 3SZNA 1NFXA 5DP8A 2O8WA 1QRXA 2TIOA 3S9CA 3BSQA 4IBLH 1A61H 2OINA 1J16A 3M61U 4SGAE 1ESAA 3MO6A 7KMEH 2JETB 4KTCA 2XRCA 3BV9B 1QRWA 4MNXA 1W3CA 3EA9A 2CHAB 3JZ2B 4U30A 5DP9A 4BXWA 3TIUA 4Y11E 4AG1A 1AWFH 7LPRA 2FOMB 3GOVB 4J1YA 5C67A 2EI6A 2STBE 2G00A 2VNTA 2RDLA 4GAWA 3RXEA 1ELEE 1BQYA 3E8LA 4WMFA 3SN8A 1TPAE 2ZZUH 1HRTH 1IAUA 1KXCA 4ZHAA 3RXSA 5AHGH 3SI3H 1ZJDA 1Z1IA 1ZTJA 1S82A 2Z9JA 3A80A 4BTUB 4WXIA 1DDJA 3A8AA 2ZFTA 1KXDA 2Y82A 1GMDF 1SGYE 1MKWH 2YNAA 1GL0E 1C5MD 1TX8A 1TOMH 5AVDA 5ABWA 4NIXA 2PTNA 4IW4E 1L2EA 2PGQB 4HTCH 3GY7A 3U1JB 1DT2A 1TPOA 2CJIA 1EJMA 3UNSA 1P9UA 1DXPA 3LOXA 2FI5E 1YLCA 5DP4A 1LHGH 4K3JA 1ZPCA 3R0FA 1QCPA 1O5AB 1SR5C 1DWCH 3LDXH 1ETRH 3KQEA 1VCPA 1GVZA 5C3NA 1RD3B 2QYIA
chains in the Genus database with same CATH superfamily
2ZU1A 3OEHD 1K9OE 1MD8A 4MPWA 2AFQB 5ETXA 2FS8A 1NU9A 2FO9A 2R9PA 2GDDA 2BD8A 1F7ZA 2RFKC 1LPGB 2A31A 1B5GH 1HJ8A 1IQMA 1OP0A 1ELTA 4MDSA 3PMAB 3T2NA 3ZZ5A 1TMTH 4WWYA 3E0PB 3U28C 1XX9A 1TWXB 1IQLA 2ZTYA 4ZAEA 1LHCH 1YBWA 2OD3B 2UUKB 3TH2H 4O3UA 3UNQA 5LH8A 2PKSC 1NY22 1FV9A 2PUQH 4GSOA 1WQSA 1O3KA 5A0AE 2V3OH 3OSYA 1BMFD 3RXOA 3LGUA 4DY7B 2ZFQH 1EOLA 2Z9GA 3BEIB 3ZV8A 1BBRE 3GY6A 3OY6U 4TY7A 5DP3A 2Y80A 4MVNA 1AY6H 1XKAC 1E79D 1AWHB 3UFAA 1FZZA 2BDCA 1COWD 1GHVH 4XBDA 2SGAA 3UREA 1MBQA 3MQKC 1ANBA 2AHME 4NA9H 1SFQB 1W11U 3E1XB 4Z6AH 4NIWA 4Z1MD 5HYOA 3A7WA 1SVPA 4KKDA 1D3PB 1KLIH 2BQWB 1AHTH 5FX6A 1TFXA 2EI8A 2GD4B 5HKKD 3RMNH 1IQHA 2XW9A 2Z3EA 4P02A 1CGIE 1SB1H 2SNVA 3HATH 1K2I1 4O3TA 1S83A 5GWZA 4NSYA 3SJOA 1EFRD 4AB9A 1OWKA 2J95A 2SFAA 1C5OH 3RP2A 1BMLA 1C5YB 1CA8B 1SGDE 1YCPH 4XBCA 2WSSD 4D9RA 3BTWE 1BMAA 1HAOH 1BTZA 1WV7H 1VCQA 2ZU4A 2SNWA 1FLEE 3PRBA 2W26A 1KXEA 4K5ZA 4JCNA 1V2KT 1PJPA 3TK5A 2SGFE 4MTBA 1BBRH 3PWBA 3F9HA 4UFFH 1ANCA 2ZO3H 2B8OH 1BTWA 1F5KU 5J4QA 3GDSA 3WWBA 2BLOA 3M5NA 2OLGA 3RXUA 3SHCH 2AERH 1TRNA 3QUMP 3A83A 3MH6A 1QHRB 3ZVFA 1V2JT 1HUTH 3C1KA 1SHHB 3VGCB 1F5RA 5GCHF 3A86A 2AMPA 2ZHDA 2F91A 3SORA 4Y8XA 1OYQA 2C8XB 2FOCA 2A7HA 3F1SB 1ZRKA 4FUJA 4RN6A 3A8BA 1OKXA 2NU2E 2FLBH 1KSNA 4O03A 2QXGA 1OWIA 4DVAU 2SGEE 3ZZ4A 3KN2A 1JMOH 1WTGH 3SGAE 3N7EA 2TRMA 1A5GH 1FN6A 5EXNA 1ARBA 3MWIU 2Z9KA 1UO6A 4E06H 2UUFB 1KTTB 3JZ1B 1SQTA 2BLWA 1NN6A 1KIGH 2OC8A 3BTGE 1TYNA 1ZSKA 3U9AH 1THSH 2GP9B 1DITH 4Y0YE 1Z8IB 5HXFA 2G55A 1SGTA 5EJ1A 4BAHB 1QJ7B 1HGTH 1O38A 3PROA 3A8CA 1Z6EA 5HIZA 1DM4B 1FY8E 1YPJH 1GJ9B 2BVSH 5E2OA 1T7CA 4ASUD 1JRTA 2TGAA 4HG6A 1QTFA 2THFB 4ABIA 4YO9A 2AEIH 3N99A 4X2WA 1TALA 1TE0A 2P8OC 3S7HB 1CSOE 1IHTH 3SV9A 1JOUB 1D3QB 1WOFA 3L3TA 5PTPA 5CHAC 2QA9E 2HPQH 3LGWA 1ZJKA 1P2MA 1GJCB 4FU8A 2W7UA 1NZQH 3TJNA 2AGGX 3U1IB 1ZSJA 1O3DA 2FMJA 2KX4A 2BDGA 2FLRH 2GV6A 4Y10E 2FZZA 4AFUA 1W12U 1K1IA 1FNIA 1P2IA 1T31A 1GI4A 2OCVB 2ZDLA 5A0CA 3ODFA 1S5SA 3RLYH 1ELFA 1QBVH 2BQ6B 4B6FA 1UVPA 1BTYA 2WPMS 3A7YA 3K9XB 3EA7A 3TH4H 2QN5T 4TY6A 2W5EA 2ILNA 1GJ8B 1YPMH 3RXLA 1LPKB 4SGBE 3CNRA 2Y5HA 1C5LH 1HDTH 1O5CB 1UW7A 3A7XA 2QAAA 1FONA 2XBVA 2XWAA 2ZGXH 3ATWA 4I8LA 3SU0A 3UB0A 3U98H 2J38A 2BLVA 1GHZA 3MH5A 1PPHE 1NFUA 1PPEE 3SU4A 2ASUB 1QQ4A 1KDQA 1TAWA 3SU2A 3WW7A 2W6ID 1PPCE 5E0HA 4OGXA 2P93A 2IJD1 1Q2WA 1ZMJA 3PO1C 2IPHA 5JDUB 3T26A 4BAOB 2GZ7A 2KCOA 1GBCA 3BG4C 4AYYB 1SGQE 5A09A 1GJ4H 3VB5A 2VWMA 1QURH 3W1EA 2KAIA 1AE5A 3M5OA 4YT7H 1LMWB 1ZMLA 1C1SA 2A0QB 5FBIA 2FTMA 1ANEA 5LPFA 1DY9A 1ZR0A 2Y81A 1O3PB 2PKAA 4DURA 3K6ZA 1G30B 2HWLB 1Y8TA 5A8YA 2C90B 5JYIA 4A1TA 2GV7A 2Z3DA 1P2JA 3V7TA 3UNRA 4ZMAH 2JJ1D 1IQNA 3M7UA 3SU1A 2ZG0H 3SJ8A 5JPMH 3KQ5A 4U01A 3FAOA 1CGJE 3D65E 1UHBB 2Q6FA 8ESTE 4JMYA 1C5UA 1H8ED 1MUEB 3DSOA 2NU3E 3TITA 4NFEA 5GXPA 3TK6A 4Q7YA 4ACAA 2A2XH 3M3SA 4WMDA 1VCWA 4FUIA 1O34A 1TQ0B 1V2WT 5DP7A 4HZHA 1SMFE 3SV7A 4U32A 2D26C 3VB4A 5EPYA 3RXCA 3E90B 1KDQB 4ABEA 1ZPZA 2G4TA 2TPIZ 4HI3A 1L4DA 1EOJA 1QIXB 1SFIA 1QZ8A 2YOLA 1ELVA 1Y3VA 4UONA 1ZPBA 4TPIZ 4Y0ZE 3RXQA 3PWCA 5TCCA 3W95A 2ZTXA 2RA0A 1C1VH 1C5XB 2P59A 3SGQE 2QF3A 3T29A 1TBRH 2GTBA 2JETC 3QWCH 4ABJA 3DFLA 2ZHEH 1A0LA 2B7DH 2CHAC 2ZPRA 4I32A 2O8UA 1C9PA 3TJVA 3EA8A 1MQ5A 1O3OA 1OWHA 2FIRH 2J2UA 2XBXA 1BHXB 4ABBA 1MAYA 3LT3A 2Z7FE 2QE7D 4WXVA 2OC0A 4I31A 3SW2B 1G3DA 3OAAD 2VIVA 2XBYA 5ESBA 1UCYK 2J98A 1LVBA 1OHHD 2ZDMA 1A3EH 2BMGB 2OQUA 2JIZD 1WAYB 2A7CA 1LHDH 1H8DH 2G4UA 1TQ7B 1OS8A 3TGKE 4FUEA 2ZTZA 3F2HA 3TGJE 1Y3XA 3UWIA 1WTHD 3OYPA 1GHAF 1CBWB 1AFEH 3PV4A 1QL7A 2XTTB 3EAJA 1HAPH 4I7YH 5EQQA 1FY5A 1E35B 4CRDA 4WMEA 1HAXB 3SNDA 4RT1A 1O2SA 1Y59T 1W8BH 1SGFA 2ZFSA 2ZFFH 3V13A 1E38B 1UTLM 1GDNA 4XDEA 2JJ2D 1LDTT 4X6MA 2HPPH 9LPRA 3BIVH 3GY3A 5C0TA 1SGRE 1Z8RA 1O5BB 2FYQA 1GHBF 5IK2D 2GX4A 2ANMH 2LELA 3Q3XA 3SJ9A 1TX7A 4Y79A 4THNH 4OS2A 1ID5H 5F8TA 3SBKA 1WXRA 1GI1A 1O37A 1Y3UA 2VU8E 4K69A 1MKXK 1G2MA 1QFKH 2WV5A 1LO6A 4O9VA 1K0HA 1O3NA 1UK4A 5GJ4B 4MPVA 2Z94A 1PYTC 2BD9A 3CS0A 4ABFA 2HVXA 3ZV9A 2Z9IA 1A0HB 1VKYA 1IQFA 3T62A 2F9OA 1TABE 2F9UA 1O5FH 1SPJA 2GVFA 4I8GA 6CHAB 1GBFA 1ZHRA 1XXFA 3AVZA 4H4FA 3EGKH 3M3TA 2OP9A 1AD8H 2FODA 4WF8A 3DUXH 4ISOA 1HAGE 4F49A 5LGOA 1DICA 3M5LA 2AIQA 3MU1A 4ISHH 1MZDA 1S6HA 4TT3D 4MG3A 2BYAX 1YPKH 3SUDA 4B1TA 4NZLA 4ZUHA 3MOCA 4DOQA 1A46H 1SOTA 1MH0A 4AZ2B 1GJAB 1YPLH 2XCFA 3BEFB 2AGIX 1FAXA 4OS4A 3TVJB 1QGFA 5EQRA 1EJNA 1FY1A 4OS7A 1G3EA 3LJJA 3GYLB 1HXEH 2QXIA 1EUFA 1D3TB 1TGSZ 2A4RA 2FPZA 1TNLA 3ZZAA 4YOJA 4X6NA 5C5OA 3E3TA 3QZQA 5CMXH 3TJOA 1ELGA 1GI9B 3SQEE 2HVYB 3M7TA 1TLDA 3Q77A 3URDA 1V2LT 4DW2U 1O2ZA 1C2EA 5DJ7A 3M36A 3MU8A 4Y6DA 5GNDA 3E16B 2ODPA 5C0UA 1W0JD 2V3HH 1HB0B 4UFDH 3TK9A 3RMOH 4WVPE 1V2PT 2UWPA 4NA7A 1GJ5H 5K7RA 1SLWB 3C27B 3M5MA 4K1TA 4AX9H 1CU1A 1P8VC 4RKOB 1MCTA 2BZ6H 1OWDA 4OS6A 1QY6A 5I46H 1DOJA 1GWAA 2G51A 4FOUC 2R0LA 3LGYA 2ZF0H 5C20A 1TB6H 2UUJB 1A5HA 1P02A 3TJUA 2F3CE 2XC4A 3P8GA 2I6SA 2G5NA 4Y8YA 1V6DA 4B76A 4ZHLU 3FP7E 2FP7B 3VB3A 1HAZB 2FX4A 2QGRA 3B23B 5EXMA 2PLXA 1PYTD 1MKWK 3UR9A 2ZQ1A 1GBEA 4K8BA 2BDBA 3FANA 4QT8C 3BTEE 2DUCA 1X7AC 1QBNA 3VGCC 4A6LA 3ODDA 1EB1H 4FVBA 2OUAA 4XSKU 4Z0KA 1CHOF 1YKTA 1GBDA 1OP8A 1O2XA 4LOYH 1GVKB 3RU4E 4CH8B 1F0TA 5LPRA 1HJAB 2BVXH 1XMNB 2C3SA 3VFEA 2PWXA 4XRNA 5DP6A 4YESB 3QN7A 3BTFE 1XUFA 1PFXC 1G32B 3QGNB 4ZKRU 5ESTE 1Z6JH 4INKA 1QL9A 4FUFA 1TNJA 4GLYA 1TA6A 3QZRA 4FUGA 3T27A 3RMLH 4IGDA 4FU7A 1MTSA 1K1NA 3DD2H 1EPTA 1XXDA 1YM0A 2FS9A 4NA8A 3KEEA 4TPYA 2PW8H 1YPHE 1ZGIA 1HAVA 1UTJA 5TJXA 3GY2A 3M37A 1DLKB 4ZCNA 3ATIA 2WV4A 1VJ9U 1AVGH 1WSSH 3A88A 3KQBA 1C1MA 1DWBH 2AMDA 5DG6A 1LHFH 3LPRA 4JZEH 4IC6A 1Z8JB 2F9NA 4GCHF 2FXRA 4D7GA 3V0XA 1BTUA 1K28D 4Q63A 3ZIAD 1K22H 1FN8A 1UTQA 2QF5A 1NBME 3ATKA 1C1UH 1ZHMA 2GCHG 2Z9LA 2R0KA 4X1PU 1AB9B 2BB4A 2J5UA 4A7IB 1KTSB 2GDEH 1S6LA 4NWKA 3KCGH 1FIWA 1BRCE 1TA2A 3CENA 3F9FA 2H5DA 4H42U 3OTJE 3F0OA 3SHAH 2ESTE 5DP5A 2WPIS 2FX6A 2GZ8A 1GBLA 4XFQA 3SU3A 4DT7B 2BOHB 1SGCA 1GBBA 1N6YA 2FOAA 1BIOA 1DSUA 4IMQA 1ELCA 3MU0A 3T28A 1DWEH 2XC0A 7GCHG 1INCA 4OGYA 1GHXH 1DSTA 2L6OA 1BTPA 1SBWA 2VH0A 3SGBE 3HGPA 1BITA 3MO9A 3RC6A 2IOTA 3LGTA 1J14A 5TCAA 3F0PA 2Z6BD 1UMAH 1W14U 3K2UA 3TNSA 3ZZ6A 3QDZB 3KGPA 2B5TB 3A85A 2UWLA 1SGFG 2OC1A 2BY8X 1TPPA 1C9TA 1XUJA 2PHBA 3UQVA 2Q6GA 1ELAA 3SUGA 2XYAA 1EPTB 1S84A 1H8IH 1EASA 1W0KD 1BMMH 2BQ7B 3BF6H 1HAVB 1IQKA 1YCPK 1EZSC 1VITG 1P3EA 1V2NT 1NO9H 1TONA 1UTKA 1THPB 1F0SA 1JXPA 1V3XA 4A92A 1TOCB 2OTVA 1ZHPA 3U69H 1NM6A 1KXFA 1Y5BT 2BD2A 4D76A 5EW2H 3NCLA 3P92A 3ELAH 2BDHA 1TNIA 2EEKA 1MTVA 1UTNA 3ATMA 1GI5A 1AFQB 2BLQA 3G01A 3VG8A 3H5CB 1SLXB 1G3CA 3SNBA 1AMHA 2H9HA 3PMJA 2QY0B 3NPSA 4AYVB 1O2JA 2H9EH 5I25A 2B0FA 2GT7A 2AS9A 3W94A 3DSGA 1XUKA 2WPHS 3S7KB 1FXYA 2J9NA 1NESE 5EODA 4IMZA 5L6NH 8GCHF 4CRFA 1E1QD 3SZEA 1QNJA 1O3FA 1O35A 5CDFE 2JKHA 3F2GA 5FPYA 1TRMA 5GIBA 2AYWA 1ZLRA 1F0UA 4GHTA 2XXLA 3GDUA 2CK3D 5EPNA 1P3CA 5L2ZH 5GDSH 2PTCE 1LTOA 1Q31A 2ANWA 1SG8B 4CBOA 1Z8GA 1P12E 5DN6D 3NUMA 1TBQH 4BOHA 1O32A 2H6MA 3F2FA 4BXSA 4KTSA 1O3BA 1JIRA 1MU8B 2JH0D 3TGIE 2QXHA 2QV1A 4XBBA 1AZ8A 3RU4D 1SOZA 2FOFA 1SQRA 3SV8A 2TGDA 1MAXA 1DS2E 2GJGA 3MNBA 4E05H 4HFPB 2XNIA 1O3JA 1OX1A 1FPHH 1VZQH 1BT7A 1O2PA 2AMQA 3EYDA 4X1NU 1VGCB 1FIZA 2AH4X 2ALPA 2D1JA 3FVFB 4FVDA 1MMJN 6ESTA 2BY5X 4AB8A 1FY3A 1UK2A 1PPBH 3MNXA 1RTLA 2JDID 1AQ7A 3KQDA 6GCHG 3S9AA 1GHWH 5A0BA 2EA3A 4JYTA 1ZTKA 4Y7BA 2ZCKP 4JZIA 1V2RT 4UD9H 2HALA 3KQCA 2VB0A 2VWNA 1HXFH 3ZZ7A 1LHEH 2HOBA 1FI8A 2F83A 2D2DA 3VB6A 5E2PA 3AAVA 2FDAA 1TX6A 1DUEA 2K0QA 4H6SB 1MTNB 3UOUA 4PROA 2C93B 2WUBA 1O2LA 1KMHB 1Y3YA 1NBMD 2PR3A 3GCNA 3RXDA 4B6EA 1BJUA 1GCTB 3OEED 1D4PB 1GPZA 1U6QA 3NK8A 2RG3A 1HYLA 3URCA 2ZC9H 1CBWC 2LNCA 5EJZA 3HKJB 1C5VA 4F4OC 4ABGA 3GISB 1N8OB 3SJIA 2ZDNA 1EAXA 1H9HE 1SGNE 3ZVAA 1J15A 4AN7A 3ZYEA 3AW1A 1CT2E 1BHXF 3KYFA 1GG6B 2FESH 1O0DH 3KHVA 1TGCA 2FEQH 5AFYH 3OE7D 4WH6A 3RXIA 4NIVA 4CR9A 4CRGA 1IHSH 5FL7D 4KGAA 3MYWA 2L74A 1GCDA 3UTUH 3A7TA 1H1BA 1Q3XA 1AU8A 3KL6A 5E0GA 1T4UH 3F9GA 2SGPE 2VIWA 2Y5FA 2WUCA 3RXBA 4O97A 4B75A 3P95A 5JBBS 2WPKS 4DIHH 5C94A 1L4ZA 3TLOA 3RXVA 1LPZB 1AVXA 4CBNA 7ESTE 1Z7KA 2Q1JA 5FPTA 3M35A 5C1YA 4FXGH 4YM9A 4WY3A 4RSPA 1TGTA 1C1NA 1EB2A 3SQHE 1GMDG 2F9PA 1HCGA 1T32A 2A32A 3OU0A 2PUXB 5KECA 2HNTE 1C2HA 3FP6E 2C8WB 3EQ0H 6CHAC 2GMTB 4ISIH 1JBUH 9ESTA 3MU4A 2XC5A 2FI4E 2J92A 3T25A 1AIXH 1PQ5A 3ZVGA 1CE5A 1O36A 3SU5A 3NWUA 1MU6B 5JBAS 2TBSA 1GJ6A 2VJ1A 3QK1A 2IN2A 3SNAA 3STJA 1EAWA 4X8VH 1UCYE 2ZGJA 1O3MA 3GCHB 4AFSA 1EZQA 1G36A 2W3KA 3V12A 2TGPZ 1BRBE 1DXWA 1C1QA 1O39A 1VITH 2W3IA 3NKKA 1P03A 1Y3WA 3OFND 7GCHF 4AOQA 1AVWA 1P2OA 3TH3H 4YZUA 3ZZBA 4ABAA 2A4QA 5FXLA 2FTLE 4TWYA 1O3GA 5FX5A 2FOGA 1V2UT 2KAIB 3LKWA 1O2QA 2R2MB 3RXTA 4B74A 3RXKA 3SUEA 1UJ1A 1EATA 4CHAB 5EOKA 1AE8H 4DIIH 1AN1E 4AC9A 2KM0A 2NU4E 3K6YA 3MMGA 2PKAB 2HNTC 3U8RH 4X2VA 4OM9A 1HFDA 1BOQA 3RU4T 1GBMA 3RC4A 3PTBA 1ETTH 3HPTB 1S0QA 1GBHA 2M2AA 3Q3YA 1VITF 4UFGH 1GMCG 2ZA5A 3CS7A 3H7TA 3VEQB 5F8XA 3PB1E 1DE7H 5T6GA 4GVUA 3A7ZA 5FPSA 3KYGA 3FO8D 4VGCB 3E91A 3ZVEA 4XE4A 3ZVDA 1UVUH 2ZU3A 1TGNA 2ZDAH 3V3MA 1QB1A 1TNHA 4I33A 5AFZH 3FN8A 3KNXA 3LGIA 5A8XA 1S85A 4TYDA 2FM2A 1L1JA 1GBAA 3PMBB 1SHYA 5DPAA 1EAIA 1O2IA 1TRYA 3BTHE 4X6OA 5H4IB 3UQOA 2VWLA 1LVOA 1UVSH 1TNGA 3CP7A 4IC5A 2HLDD 2ZFRH 5F8ZA 3MFJA 4BAMB 1LQEA 3GY4A 3P70B 1QL8A 1RJXB 3HKIB 4Y76A 3FFGA 3TNTA 3VPKA 5DK1A 1KLJH 2ZGBH 1HJAC 3HK3B 4KP0A 3RXMA 1O3EA 3OTPA 1AI8H 1ZTLA 2BY9X 1OWJA 5HMAA 1BA8B 3MH4A 1AO5A 1NS3A 1V2TT 2VVUA 4B2AA 4BTIB 1ABIH 4UEHH 1YC0A 1KYNA 1HNEE 2G52A 5E8EH 1W7GH 3ZZDA 1M9UA 1GI2A 4ISLA 2XOKD 4TWWA 1O3CA 2A45B 3SOSA 2F43B 2A5IA 2IPQX 4MQAA 4XD7D 3SJKA 3KF2A 1CT0E 1CGHA 1V2ST 2B9LA 2ODYB 2QXJA 2J34A 2FOHA 4K60A 3O8RA 2J98B 2R3YA 3LC3A 3FP8E 3MNCA 1O2YA 5JB9S 3FZZA 4JYUH 5T6DA 3P8NA 4NCYA 5FCKA 1CQQA 5GCHG 4GPGA 1NRPH 2EC9H 5FCRA 3SO3A 1AUTC 1T8NA 2ZHQH 4YLQH 2GCTB 3DSPA 1EZUC 1VJAU 1FX0B 5G4BA 5T1VA 6GCHF 5CE1A 1GI8B 2EY4C 1DY8A 1HLTH 1RIWB 2C8YB 2Y7ZA 4I8HA 1V2QT 4JZDH 1AB9C 2H2ZA 3VXFH 2VVVA 5EG4A 2FOBA 1HAHH 1HIAA 3ESTA 1FQ3A 2CN0H 1EZXC 3IITA 3PLPA 2H9TH 2W6JD 4ISNA 3E0NB 3EE7A 3MO3A 3GY8A 1CA0B 1RFNA 3B9FH 1C5ZB 1ORFA 1P0SH 3QO6A 5LPEA 1V2MT 1HBTH 3I77A 3PRDA 1GI0A 4CRBA 1W7XH 3O8CA 2VGCB 1ABJH 1B7XB 2P3FH 1T4VH 2PSYA 3S69A 4H6TA 1SLUB 1C2IA 2BD7A 5DKMA 1ZMNA 4BTTB 2C8ZB 4JYVH 3F9EA 4B2CA 1THRH 1EPTC 1T8MA 5BPEA 2WV9A 2ZEBA 3M3VA 1NRSH 4E7NA 3MU5A 4A5TS 5DSFA 1C5WB 1O3IA 3A8DA 4FUHA 2SGDE 1MQ6A 4A1VA 1D3DB 4BANB 3IWMA 2VIQA 2XBWA 3H7OA 4NFFA 1NC6A 3Q3KA 6LPRA 3ZYDA 2BDAA 1RXPA 2BVRH 4WJG2 1Y5AT 3UOPA 2ZU5A 2NU0E 1F2SE 1AFQC 2UWOA 2P95A 5E0JA 3U8OH 1BUIA 1QRZA 4AFQA 3HK6B 1WDIA 3NZIA 3S9BA 1GI6A 4F48B 2BX3A 2FI3E 3E6PH 3EDXB 1RGQA 2IJOB 5JBCS 1O3HA 3RM2H 1GBKA 1HIAB 1SSXA 3UIRA 4X8SH 2JH6D 2ZHWH 2WYGA 4Y8ZA 3RDZA 3QX5H 1RTKA 1A4WH 1P57B 4IS5A 3PLKA 3DA9B 1D6RA 3TU7H 4CH2B 4ZH8A 3GCOA 1YYY1 4ZKSU 3RXGA 4X1RU 2A5AA 3HGNA 3SV6A 1JIMA 1GGDB 1MBMA 2V7QD 3ZZ9A 2ZFPH 2VWOA 1T8OA 1TMUH 1A0JA 4FETA 2XNDD 1LKBA 1NU7B 2ZQ2A 1ZSLA 2RCEA 4TSFD 2EI7A 1PQ8A 3DT0H 3MNSA 1Z1JA 2SGQE 1NT1A 2A5KA 2ALVA 3IG6B 1MABB 3VXEH 1BB0B 5IYTA 2LPRA 1A2CH 3GS9A 4DJZB 4ZHMU 3UAIC 1MZAA 2BD3A 2ZCHP 3PTNA 1TIOA 2YMSB 2QC2A 2ANKH 4BAKB 2J4IA 3PYHA 1RRKA 2GT8A 1O2UA 1VGCC 2OXSA 4M7GA 4MNWA 1F92A 1O2NA 2VBCA 3ZZ3A 1EX3A 1QJ1B 1S81A 3M7QA 1EAUA 1WYKA 3ZVCA 5EW1H 2STAE 1ESBA 1C5RA 5L2YH 2FOEA 5C2ZA 3NXPA 1O5GH 3BEUA 1GL1A 1XVOA 1G2LA 4ABHA 2YNBA 1YY3A 1BRAA 4F55A 2BDIA 2BD5A 1AUJA 5KGOA 1RS0A 1C2KA 2ZCLP 4OS5A 3RM0H 5T3HA 2H1UA 5F03A 5L30H 2ZPQA 4Q7XA 4UE7H 2CV3A 3B8JA 4DGJA 2F9BH 5BRRE 4E7RG 4FUDA 1DX5M 3PM3A 2AGEX 3GDVA 2BY6X 1MTNC 3LH3A 2KFWA 2QCYA 1FJSA 2V35A 5HM9A 1YCPM 1O2OA 1GCTC 1GMCF 4A1XA 1NRRH 4D9QA 8KME2 1MD7A 1C2JA 1HAYB 1BDAA 1XM1A 2VVCA 1OOKB 1MTWA 1MTUA 2EQNA 2ZGHA 1H9LB 1HV7A 5DO4H 2M5TA 5KEDA 1AZZA 4Q80A 3ZZ8A 2ANYA 1ZZZA 1N8OC 1P2QA 1C5NH 1YPHC 1SLVB 2V3MA 4ZKOU 1LVMA 1NTPA 2VIDA 2VH6A 2VIPA 4M9FA 1KLTA 3A87A 4INLA 1GG6C 1C2LA 3RLWH 5JB8S 4ABDA 2ZI2H 1E0FD 1C1OA 2BY7X 4ASHA 1C5PA 1PQAA 3F68H 1WBGB 1CVWH 1BTXA 2UUYA 4JZ1A 1GJ7B 1UVTH 4K2YA 3A84A 4NG9H 1BBRK 4X6PA 1QA7A 1TNKA 2PP6A 1GVLA 1CHGA 1H4WA 2GKVE 5FAHA 1DANH 2F9VA 1BTHH 1GMHG 2PSXA 3AW0A 1OYTH 1OSSA 1HJ9A 4Y71A 1UTOA 1P01A 3D23A 5F53A 3WY8A 2ODQA 4Q7ZA 1GHAG 4BAQB 1CT4E 1OPHB 1VR1H 4RI0A 1K1LA 2WPDD 2V6NA 4YT6H 5EQSA 3Q00A 1TPSA 3ITIA 3LGVA 3LH1A 3P8OA 1A7SA 2GMTC 1H9IE 5EXLA 3GCTG 3LC5A 1GBJA 1DFPA 1J9CH 3TPIZ 1GHBG 4X8UH 1S6FA 3QTVH 1O5DH 3UUZA 4NIYA 1GI3A 3LIWA 1BRUP 1NFWA 4MLFB 4OS1A 4ZKNU 3GCHC 2CF9H 1C5SA 2ZHFH 1P2KA 1OWEA 3BTTE 1RTFB 1LVYA 2ZU2A 3D49H 4K8YA 2OC7A 1SGEE 1ZGVA 2FYRA 4X2YA 1DLEA 3RXJA 3UR6A 3UY9A 2CGAA 5EGMA 1GJBB 2Y7XA 1SQOA 3I78A 4IN2A 2G8TA 2ZNKH 3LJOA 1P06A 2Z3CA 3R3GB 5SGAE 3BTQE 4UDWH 1MCVA 1O2MA 1PPFE 1QJ6B 3UPEA 2K8IA 1V2VT 4AGKA 4UFEH 4Q2KA 2H5CA 1W10U 1C1RA 2G81E 4CHAC 2ZPSA 1IOEA 1KXAA 1GDQA 1WU1A 3O8DA 1EKBB 1HAIH 3NRLA 1GJDB 2PKSB 2RA3A 1N6XA 4INHA 4B2BA 4YTAA 1B0FA 2KCAA 3AASA 3ZVBA 1BCUH 3LU9B 2WINI 1O5EH 1C4V2 1OXGA 1P04A 1T8LA 2G5VA 3BTDE 4ZXYH 3FOAA 4NZQA 1QB9A 1UTMA 4CRAA 1IQGA 2DE8A 4HGCA 5EIYA 1GBTA 1ZRBA 1Y5UT 1O2GH 4R8TB 1ELBA 4VGCC 2HRVA 1PPGE 3BTKE 5C1UA 1E37B 1LCYA 3I29A 1K1MA 1PQ7A 1EJAA 1C1PA 5C5NA 2WPLS 4BNRA 3UWJH 4B73A 3VB7A 5HGGA 3ZZCA 1ARCA 3EE0B 1K21H 4YLUA 3QGJA 5HM2A 2K1QA 1PPZA 1GBIA 5FBEA 3PLBA 3MH7A 2ZDVH 4DG4A 2F4LA 1UHBA 3D62A 1EP6A 4ZXXH 4AFZA 5AF9H 4I8JA 5FHTA 2ULLA 1XKBC 3BN9A 1A1RA 1K1OA 2A4GA 2XCNA 4MNYA 2PV9B 4LXBH 1QQUA 2HLCA 1IQIA 1BJVA 1HPGA 2Y5GA 3BG8A 5T6FA 3SNEA 2CMYA 1E34B 1UVOA 1TGBA 1LQDB 1GI7B 2JH5D 4YOGA 4AG2A 1ZOMA 4D7FA 1O3LA 2WPJS 1B0EA 4JZFH 3SUFA 1YPEH 3A89A 4I8KA 4JK5A 4ESTE 1P11E 2BZAA 3RXRA 3Q76A 1WQVH 2HGTH 1YP9A 1XVMA 2QIQA 1CO7E 1D9IA 1NPMA 1W13U 1C2MA 1O3AA 3L6PA 2FWWA 2ZP0H 1GDUA 4IN1A 1UK3A 3T5FH 4I86A 2GCTC 1CHOG 3PV5A 1S0RA 2GZ9A 1WCZA 4KTUA 3MTYA 2TGTA 1SGPE 1V2OT 4Y7AA 5JBTA 2GCHF 1EQ9A 1RIWC 1O31A 3O8BA 3QLPH 1C5QA 1TBZH 4NSVA 1G37A 1ETSH 2J94A 4GUXA 4MNVA 1QBOA 1E1RD 4CREA 1O2WA 1WUNH 4X1SU 1DUAA 1DWDH 1SKYE 3P8FA 1YPGH 2BDYA 3U8TH 2BXTH 1SGIB 1CA0C 3WWFA 2ZGCA 4YOIA 1SC8U 1FMGA 5IDKA 3S0NA 1XUHA 2Q6DA 1G9IE 4JK6A 1XUIA 3KIDU 2ZKSA 4U2WA 4WH8A 8LPRA 2VGCC 4LZ1H 1C4U2 1A3BH 3QTOH 5B6OA 2BXUH 1F5LA 1UTPA 3H09A 4MPUA 1N1LA 3RUOA 3BIUH 1ESTA 2ZDKA 2PFEA 4X0WU 4K1SA 5HIYA 1YWUA 2P8OB 4GCHG 3F3BA 2P3TB 4J2YB 4FUCA 5J4SA 1ZYOA 3RC5A 2R3UA 4X2XA 1QR3E 1YF4A 3AAUA 3PMHB 5CHAB 2W7SA 1FAKH 1BZXE 3ENSB 3MI4A 4XOJA 2WHXA 4LK4A 2BM2A 2VIOA 2O8LA 1C5TA 3PV2A 3SV2H 1FPCH 3RXFA 2BHGA 2BX4A 1UCYH 2WZQA 2BTCE 1BMNH 1XUGA 3SI4H 4RKJB 1G3BA 2XWBI 3ATLA 2A4OA 1GMHF 3GY5A 3STIA 1LKAA 2OBOA 1C2GA 1C2FA 1ELDE 1KXBA 2HNTF 3A82A 3N7DA 1Z71A 3GICB 3GYMA 2GGVB 3LONA 1W0YH 2CXVA 4LZ4B 1O30A 5DGJA 1C4Y2 1P10A 1SQAA 2VINA 4D8NA 5C1XA 2WYJA 2O8TA 2NWNA 1ACBE 1GGDC 5C17A 2QF0A 3DFJA 4CRCA 1O2TA 3L33A 1EXFA 1C1WH 1C1TA 1YGCH 4K1EA 2R2WU 1QA0A 4FUBA 3FKSD 4X1QU 4KELA 2DE9A 3RXHA 2V0BA 1SI5H 1AKSA 1DVAH 3GCTF 4GHQA 1DPOA 1JRSA 4MPXA 1GHYH 4DCDA 4AORA 5GPIB 2C4FH 2KCYA 1H8HD 1O2KA 4X8TH 3PO1B 2OBQA 1NFYA 2KR7A 2P94A 3A7VA 1A5IA 2D8WA 2O9QA 1MKXH 2YMSC 3P6ZB 3K65B 3MHWU 3A81A 3BG4B 1E36B 2PGBB 1O33A 3SNCA 1P9SA 1L1NA 1EP5A 2ZECA 5A8ZA 4CR5A 1FY4A 4YXWD 2A7JA 2OQ5A 5A2MH 8GCHG 1W0ZU 1W2KH 2NU1E 3N7OA 1P05A 2KCPA 1IQEA 1O2RA 3OX7U 4Q4LA 1P09A 1ANDA 4NWLA 1JWTA 4R0IA 1K1JA 1FUJA 1C2DA 1OP2A 1P2NA 5EU8A 1K1PA 1L0ZA 4AGJA 1J8AA 1F0RA 3RMMH 1NROH 1KY9A 2ZWLH 4B71A 3OY5U 4NGAH 1IQJA 1YLNA 2BOKA 4FU9A 5F6MA 1J17T 4P00A 1SL3A 1YLDA 2ZIQH 2A2QH 1O2HA 2P3UB 2OK5A 3SU6A 2CF8H 4ZROA 1NRNH 2Y6TA 2BD4A 1D6WA 2I6QA 3F6UH 3DHKH 3RXAA 1QB6A 1AGJA 2A1DB 1O2VA 2P16A 3RXPA 1NRQH 5K0HA 2AIPA 1AKSB 1L1GA 1TMBH 1FDPA 2RDEA 3BTME 3FZDA 3P17H 4RT0A 2O8MA 3SZNA 1NFXA 4DT4A 5DP8A 2O8WA 5EJLA 1QRXA 2TIOA 3S9CA 3AK5A 3BSQA 2J97A 4IBLH 1A61H 2OINA 1J16A 3M61U 4SGAE 1ESAA 3MO6A 7KMEH 2JETB 4KTCA 2XRCA 3BV9B 1QRWA 4MNXA 1W3CA 4ACBA 3EA9A 2CHAB 3JZ2B 4U30A 5DP9A 4BXWA 3TIUA 4Y11E 5CHBA 4AG1A 1AWFH 7LPRA 2FOMB 3GOVB 4J1YA 5C67A 2EI6A 2STBE 2G00A 2VNTA 2RDLA 4GAWA 3RXEA 1ELEE 1BQYA 3E8LA 4WMFA 3SN8A 1TPAE 2ZZUH 1HRTH 1IAUA 2LP6A 1KXCA 4ZHAA 3RXSA 2YMSD 5AHGH 3SI3H 1ZJDA 1Z1IA 1ZTJA 1S82A 2Z9JA 3A80A 4BTUB 4WXIA 1DDJA 3A8AA 2ZFTA 1KXDA 2Y82A 1GMDF 1SGYE 1MKWH 3DCLA 2YNAA 1GL0E 1C5MD 1TX8A 1TOMH 3SYJA 5AVDA 5ABWA 4NIXA 2PTNA 5B6LA 4IW4E 1L2EA 2PGQB 4HTCH 3GY7A 3U1JB 1DT2A 1TPOA 2CJIA 2QF4A 1EJMA 3UNSA 1P9UA 1DXPA 3LOXA 2FI5E 1YLCA 5DP4A 1LHGH 4K3JA 1ZPCA 3R0FA 1QCPA 1O5AB 1SR5C 1DWCH 3LDXH 2KZ4A 1ETRH 3KQEA 1VCPA 1GVZA 5C3NA 1RD3B 2QYIA
chains in the Genus database with same CATH topology
2ZU1A 1K9OE 1MD8A 4MPWA 2AFQB 5ETXA 2FS8A 1NU9A 2FO9A 2R9PA 2GDDA 2BD8A 1F7ZA 1LPGB 2A31A 1B5GH 1HJ8A 1IQMA 1OP0A 1ELTA 4MDSA 3PMAB 3T2NA 3ZZ5A 1TMTH 4WWYA 3E0PB 1XX9A 1TWXB 1IQLA 2ZTYA 4ZAEA 1LHCH 1YBWA 2OD3B 2UUKB 3TH2H 4O3UA 3UNQA 5LH8A 2PKSC 1NY22 1FV9A 2PUQH 4GSOA 1WQSA 1O3KA 5A0AE 2V3OH 3OSYA 3RXOA 3LGUA 4DY7B 2ZFQH 1EOLA 2Z9GA 3BEIB 3ZV8A 1BBRE 3GY6A 3OY6U 4TY7A 5DP3A 2Y80A 4MVNA 1AY6H 1XKAC 1AWHB 3UFAA 1FZZA 2BDCA 1GHVH 4XBDA 2SGAA 3UREA 1MBQA 1ANBA 4NA9H 1SFQB 1W11U 3E1XB 4Z6AH 4NIWA 5HYOA 3A7WA 1SVPA 4KKDA 1D3PB 1KLIH 2BQWB 1AHTH 5FX6A 1TFXA 2EI8A 2GD4B 3RMNH 1IQHA 2XW9A 2Z3EA 1CGIE 1SB1H 2SNVA 3HATH 1K2I1 4O3TA 1S83A 5GWZA 4NSYA 3SJOA 4AB9A 1OWKA 2J95A 2SFAA 1C5OH 3RP2A 1BMLA 1C5YB 1CA8B 1SGDE 1YCPH 4XBCA 4D9RA 3BTWE 1BMAA 1HAOH 1BTZA 1WV7H 1VCQA 2ZU4A 2SNWA 1FLEE 2W26A 1KXEA 4K5ZA 4JCNA 1V2KT 1PJPA 3TK5A 2SGFE 4MTBA 1BBRH 3PWBA 3F9HA 4UFFH 1ANCA 2ZO3H 2B8OH 1BTWA 1F5KU 5J4QA 3GDSA 2BLOA 3M5NA 2OLGA 3RXUA 3SHCH 2AERH 1TRNA 3QUMP 3A83A 3MH6A 1QHRB 3ZVFA 1V2JT 1HUTH 3C1KA 1SHHB 3VGCB 1F5RA 5GCHF 3A86A 2AMPA 2ZHDA 2F91A 3SORA 4Y8XA 1OYQA 2C8XB 2FOCA 2A7HA 3F1SB 1ZRKA 4FUJA 4RN6A 3A8BA 1OKXA 2NU2E 2FLBH 1KSNA 4O03A 2QXGA 1OWIA 4DVAU 2SGEE 3ZZ4A 3KN2A 1JMOH 1WTGH 3SGAE 2TRMA 1A5GH 1FN6A 5EXNA 1ARBA 3MWIU 2Z9KA 1UO6A 4E06H 2UUFB 1KTTB 3JZ1B 1SQTA 2BLWA 1NN6A 1KIGH 2OC8A 3BTGE 1TYNA 1ZSKA 3U9AH 1THSH 2GP9B 1DITH 4Y0YE 1Z8IB 5HXFA 2G55A 1SGTA 4BAHB 1QJ7B 1HGTH 1O38A 3PROA 3A8CA 1Z6EA 1DM4B 1FY8E 1YPJH 1GJ9B 2BVSH 5E2OA 1T7CA 1JRTA 2TGAA 1QTFA 2THFB 4ABIA 4YO9A 2AEIH 4X2WA 1TALA 1TE0A 2P8OC 3S7HB 1CSOE 1IHTH 3SV9A 1JOUB 1D3QB 1WOFA 3L3TA 5PTPA 5CHAC 2QA9E 2HPQH 3LGWA 1ZJKA 1P2MA 1GJCB 4FU8A 2W7UA 1NZQH 3TJNA 2AGGX 3U1IB 1ZSJA 1O3DA 2FMJA 2BDGA 2FLRH 2GV6A 4Y10E 2FZZA 4AFUA 1W12U 1K1IA 1FNIA 1P2IA 1T31A 1GI4A 2OCVB 2ZDLA 5A0CA 3ODFA 1S5SA 3RLYH 1ELFA 1QBVH 2BQ6B 1UVPA 1BTYA 2WPMS 3A7YA 3K9XB 3EA7A 3TH4H 2QN5T 4TY6A 2W5EA 2ILNA 1GJ8B 1YPMH 3RXLA 1LPKB 4SGBE 2Y5HA 1C5LH 1HDTH 1O5CB 3A7XA 2QAAA 1FONA 2XBVA 2XWAA 2ZGXH 3ATWA 4I8LA 3SU0A 3U98H 2J38A 2BLVA 1GHZA 3MH5A 1PPHE 1NFUA 1PPEE 3SU4A 2ASUB 1QQ4A 1KDQA 1TAWA 3SU2A 1PPCE 5E0HA 4OGXA 2P93A 1Q2WA 1ZMJA 3PO1C 2IPHA 5JDUB 3T26A 4BAOB 2GZ7A 1GBCA 3BG4C 4AYYB 1SGQE 5A09A 1GJ4H 3VB5A 2VWMA 1QURH 2KAIA 1AE5A 3M5OA 4YT7H 1LMWB 1ZMLA 1C1SA 2A0QB 5FBIA 2FTMA 1ANEA 5LPFA 1DY9A 1ZR0A 2Y81A 1O3PB 2PKAA 4DURA 3K6ZA 1G30B 2HWLB 1Y8TA 5A8YA 2C90B 5JYIA 4A1TA 2GV7A 2Z3DA 1P2JA 3V7TA 3UNRA 4ZMAH 1IQNA 3M7UA 3SU1A 2ZG0H 3SJ8A 5JPMH 4U01A 3FAOA 1CGJE 3D65E 1UHBB 2Q6FA 8ESTE 4JMYA 1C5UA 1MUEB 2NU3E 3TITA 4NFEA 5GXPA 3TK6A 4Q7YA 2A2XH 3M3SA 4WMDA 1VCWA 4FUIA 1O34A 1TQ0B 1V2WT 5DP7A 4HZHA 1SMFE 3SV7A 4U32A 2D26C 3VB4A 5EPYA 3RXCA 3E90B 1KDQB 4ABEA 1ZPZA 2G4TA 2TPIZ 4HI3A 1L4DA 1EOJA 1QIXB 1SFIA 2YOLA 1ELVA 1Y3VA 4UONA 1ZPBA 4TPIZ 4Y0ZE 3RXQA 3PWCA 5TCCA 3W95A 2ZTXA 2RA0A 1C1VH 1C5XB 2P59A 3SGQE 2QF3A 3T29A 1TBRH 2GTBA 2JETC 3QWCH 4ABJA 3DFLA 2ZHEH 1A0LA 2B7DH 2CHAC 2ZPRA 4I32A 2O8UA 1C9PA 3TJVA 3EA8A 1MQ5A 1O3OA 1OWHA 2FIRH 2J2UA 2XBXA 1BHXB 4ABBA 1MAYA 3LT3A 2Z7FE 4WXVA 2OC0A 4I31A 3SW2B 1G3DA 2VIVA 2XBYA 5ESBA 1UCYK 2ZDMA 1LVBA 1A3EH 2BMGB 2OQUA 1WAYB 2A7CA 1LHDH 1H8DH 2G4UA 1TQ7B 1OS8A 3TGKE 4FUEA 2ZTZA 3TGJE 1Y3XA 3UWIA 1WTHD 3OYPA 1GHAF 1CBWB 1AFEH 3PV4A 1QL7A 2XTTB 3EAJA 1HAPH 4I7YH 5EQQA 1FY5A 1E35B 4CRDA 4WMEA 1HAXB 3SNDA 1O2SA 1Y59T 1W8BH 1SGFA 2ZFSA 2ZFFH 3V13A 1E38B 1UTLM 1GDNA 4XDEA 1LDTT 4X6MA 2HPPH 9LPRA 3BIVH 3GY3A 1SGRE 1Z8RA 1O5BB 2FYQA 1GHBF 2GX4A 2ANMH 3Q3XA 3SJ9A 1TX7A 4Y79A 4THNH 4OS2A 1ID5H 5F8TA 3SBKA 1GI1A 1O37A 1Y3UA 2VU8E 4K69A 1MKXK 1G2MA 1QFKH 2WV5A 1LO6A 4O9VA 1O3NA 1UK4A 5GJ4B 4MPVA 2Z94A 1PYTC 2BD9A 3CS0A 4ABFA 2HVXA 3ZV9A 2Z9IA 1A0HB 1IQFA 3T62A 2F9OA 1TABE 2F9UA 1O5FH 1SPJA 2GVFA 4I8GA 6CHAB 1GBFA 1ZHRA 1XXFA 3AVZA 4H4FA 3EGKH 3M3TA 2OP9A 1AD8H 2FODA 4WF8A 3DUXH 4ISOA 1HAGE 4F49A 5LGOA 1DICA 3M5LA 2AIQA 3MU1A 4ISHH 1MZDA 1S6HA 4MG3A 2BYAX 1YPKH 3SUDA 4B1TA 4NZLA 4ZUHA 3MOCA 4DOQA 1A46H 1SOTA 1MH0A 4AZ2B 1GJAB 1YPLH 2XCFA 3BEFB 2AGIX 1FAXA 4OS4A 3TVJB 1QGFA 5EQRA 1EJNA 1FY1A 4OS7A 1G3EA 3LJJA 3GYLB 1HXEH 2QXIA 1EUFA 1D3TB 1TGSZ 2A4RA 2FPZA 1TNLA 3ZZAA 4YOJA 4X6NA 5C5OA 3E3TA 3QZQA 5CMXH 3TJOA 1ELGA 1GI9B 3SQEE 3M7TA 1TLDA 3Q77A 3URDA 1V2LT 4DW2U 1O2ZA 1C2EA 5DJ7A 3M36A 3MU8A 4Y6DA 3E16B 2ODPA 2V3HH 1HB0B 4UFDH 3TK9A 3RMOH 4WVPE 1V2PT 2UWPA 4NA7A 1GJ5H 5K7RA 1SLWB 3C27B 3M5MA 4K1TA 4AX9H 1CU1A 1P8VC 4RKOB 1MCTA 2BZ6H 1OWDA 4OS6A 1QY6A 5I46H 1DOJA 1GWAA 2G51A 2R0LA 3LGYA 2ZF0H 5C20A 1TB6H 2UUJB 1A5HA 1P02A 3TJUA 2F3CE 2XC4A 3P8GA 2I6SA 2G5NA 4Y8YA 1V6DA 4B76A 4ZHLU 3FP7E 2FP7B 3VB3A 1HAZB 2FX4A 2QGRA 3B23B 5EXMA 2PLXA 1PYTD 1MKWK 3UR9A 2ZQ1A 1GBEA 4K8BA 2BDBA 3FANA 4QT8C 3BTEE 2DUCA 1X7AC 1QBNA 3VGCC 4A6LA 3ODDA 1EB1H 4FVBA 2OUAA 4XSKU 4Z0KA 1CHOF 1YKTA 1GBDA 1OP8A 1O2XA 4LOYH 1GVKB 3RU4E 4CH8B 1F0TA 5LPRA 1HJAB 2BVXH 1XMNB 2C3SA 3VFEA 2PWXA 5DP6A 4YESB 3QN7A 3BTFE 1XUFA 1PFXC 1G32B 3QGNB 4ZKRU 5ESTE 1Z6JH 4INKA 1QL9A 4FUFA 1TNJA 4GLYA 1TA6A 3QZRA 4FUGA 3T27A 3RMLH 4IGDA 4FU7A 1MTSA 1K1NA 3DD2H 1EPTA 1XXDA 1YM0A 2FS9A 4NA8A 3KEEA 4TPYA 2PW8H 1YPHE 1ZGIA 1HAVA 1UTJA 5TJXA 3GY2A 3M37A 1DLKB 3ATIA 2WV4A 1VJ9U 1AVGH 1WSSH 3A88A 3KQBA 1C1MA 1DWBH 2AMDA 5DG6A 1LHFH 3LPRA 4JZEH 4IC6A 1Z8JB 2F9NA 4GCHF 2FXRA 4D7GA 3V0XA 1BTUA 1K28D 1K22H 1FN8A 1UTQA 3ATKA 1C1UH 1ZHMA 2GCHG 2Z9LA 2R0KA 4X1PU 1AB9B 2BB4A 4A7IB 1KTSB 2GDEH 4NWKA 3KCGH 1FIWA 1BRCE 1TA2A 3CENA 3F9FA 2H5DA 4H42U 3OTJE 3SHAH 2ESTE 5DP5A 2WPIS 2FX6A 2GZ8A 1GBLA 4XFQA 3SU3A 4DT7B 2BOHB 1SGCA 1GBBA 1N6YA 2FOAA 1BIOA 1DSUA 4IMQA 1ELCA 3MU0A 3T28A 1DWEH 2XC0A 7GCHG 1INCA 4OGYA 1GHXH 1DSTA 1BTPA 1SBWA 2VH0A 3SGBE 3HGPA 1BITA 3MO9A 3RC6A 2IOTA 3LGTA 1J14A 5TCAA 2Z6BD 1UMAH 1W14U 3K2UA 3TNSA 3ZZ6A 3QDZB 3KGPA 2B5TB 3A85A 2UWLA 1SGFG 2OC1A 2BY8X 1TPPA 1C9TA 1XUJA 2PHBA 3UQVA 2Q6GA 1ELAA 3SUGA 2XYAA 1EPTB 1S84A 1H8IH 1EASA 1BMMH 2BQ7B 3BF6H 1HAVB 1IQKA 1YCPK 1EZSC 1VITG 1P3EA 1V2NT 1NO9H 1TONA 1UTKA 1THPB 1F0SA 1JXPA 1V3XA 4A92A 1TOCB 2OTVA 1ZHPA 3U69H 1NM6A 1KXFA 1Y5BT 2BD2A 4D76A 5EW2H 3NCLA 3P92A 3ELAH 2BDHA 1TNIA 2EEKA 1MTVA 1UTNA 3ATMA 1GI5A 1AFQB 2BLQA 3G01A 3H5CB 1SLXB 1G3CA 3SNBA 1AMHA 2H9HA 3PMJA 2QY0B 3NPSA 4AYVB 1O2JA 2H9EH 5I25A 2B0FA 2GT7A 2AS9A 3W94A 1XUKA 2WPHS 3S7KB 1FXYA 2J9NA 1NESE 5EODA 4IMZA 5L6NH 8GCHF 4CRFA 1QNJA 1O3FA 1O35A 2JKHA 5FPYA 1TRMA 5GIBA 2AYWA 1ZLRA 1F0UA 4GHTA 2XXLA 3GDUA 5EPNA 5L2ZH 1P3CA 5GDSH 2PTCE 1LTOA 1Q31A 2ANWA 1SG8B 4CBOA 1Z8GA 1P12E 3NUMA 1TBQH 4BOHA 1O32A 2H6MA 4BXSA 4KTSA 1O3BA 1JIRA 1MU8B 2JH0D 3TGIE 2QXHA 2QV1A 4XBBA 1AZ8A 3RU4D 1SOZA 2FOFA 3SV8A 2TGDA 1MAXA 1DS2E 3MNBA 4E05H 4HFPB 2XNIA 1O3JA 1OX1A 1FPHH 1VZQH 1BT7A 1O2PA 2AMQA 3EYDA 4X1NU 1VGCB 1FIZA 2AH4X 2ALPA 2D1JA 3FVFB 4FVDA 1MMJN 6ESTA 2BY5X 4AB8A 1FY3A 1UK2A 1PPBH 3MNXA 1RTLA 1AQ7A 3KQDA 6GCHG 3S9AA 1GHWH 5A0BA 2EA3A 4JYTA 1ZTKA 4Y7BA 2ZCKP 4JZIA 1V2RT 4UD9H 2HALA 3KQCA 2VB0A 2VWNA 1HXFH 3ZZ7A 1LHEH 2HOBA 1FI8A 2F83A 2D2DA 3VB6A 5E2PA 3AAVA 2FDAA 1TX6A 1DUEA 4H6SB 1MTNB 3UOUA 4PROA 2C93B 2WUBA 1O2LA 1Y3YA 2PR3A 3GCNA 3RXDA 1BJUA 1GCTB 1D4PB 1GPZA 1U6QA 3NK8A 2RG3A 1HYLA 3URCA 2ZC9H 1CBWC 2LNCA 3HKJB 1C5VA 4F4OC 4ABGA 3GISB 1N8OB 3SJIA 2ZDNA 1EAXA 1H9HE 1SGNE 3ZVAA 1J15A 4AN7A 3ZYEA 3AW1A 1CT2E 1BHXF 1GG6B 2FESH 1O0DH 3KHVA 1TGCA 2FEQH 5AFYH 4WH6A 3RXIA 4NIVA 4CR9A 4CRGA 1IHSH 4KGAA 3MYWA 1GCDA 3UTUH 3A7TA 1H1BA 1Q3XA 1AU8A 3KL6A 5E0GA 1T4UH 3F9GA 2SGPE 2VIWA 2Y5FA 2WUCA 3RXBA 4O97A 4B75A 3P95A 5JBBS 2WPKS 4DIHH 1L4ZA 3TLOA 3RXVA 1LPZB 1AVXA 4CBNA 7ESTE 1Z7KA 2Q1JA 5FPTA 3M35A 5C1YA 4FXGH 4YM9A 4WY3A 4RSPA 1TGTA 1C1NA 1EB2A 3SQHE 1GMDG 2F9PA 1HCGA 1T32A 2A32A 3OU0A 2PUXB 2HNTE 1C2HA 3FP6E 2C8WB 3EQ0H 6CHAC 2GMTB 4ISIH 1JBUH 9ESTA 3MU4A 2XC5A 2FI4E 2J92A 3T25A 1AIXH 1PQ5A 3ZVGA 1CE5A 1O36A 3SU5A 3NWUA 1MU6B 5JBAS 2TBSA 1GJ6A <