1P09A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase (serine proteinase)
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A01
1F0UA 3AW0A 4IGDA 1AE8H 1ZLRA 2GT7A 3RXCA 1AB9C 5EODA 4ABBA 5JPMH 1Y3VA 2XBYA 1DLKB 5FX5A 1V2NT 4ZMAH 3SGBE 3PLKA 1SVPA 5A0CA 1A46H 3RXEA 3QGNB 2XW9A 1QCPA 4BTUB 2H9HA 3SGAE 1ZJKA 3LGIA 2PTCE 2ZGBH 4MNWA 1OP2A 1XXFA 1CU1A 2QXJA 1TNKA 3ZZ9A 1NZQH 3NXPA 2ZGJA 1BTPA 1A5GH 1P2OA 3LU9B 2AGIX 3LJOA 3ZV8A 5DJ7A 1BHXF 4IBLH 1V2MT 3QWCH 3GYMA 2UUJB 3VB7A 3E6PH 2TPIZ 1PPBH 1Y3UA 1BA8B 1TWXB 3SHAH 1QL9A 1S5SA 1PQ8A 1SR5C 4K1SA 2TGAA 3RXHA 4DIIH 1YP9A 1EPTC 1GMCF 4TYDA 3HK3B 3ODDA 4BAOB 3PB1E 3SJIA 1ABIH 5J4SA 1EASA 1GI0A 2VVCA 1MTNB 2WYGA 4INKA 1ZMJA 2ZFSA 3DA9B 3EYDA 5EQQA 5LPEA 3SBKA 2GT8A 1C2MA 2JH0D 1ESBA 2R3UA 2IPHA 3ATLA 1ZRBA 1P57B 5GDSH 5FAHA 3UFAA 1HAVB 3CS0A 1DSUA 3F9EA 3T25A 3RXBA 1LMWB 1Z71A 1K1OA 5L2ZH 1SLWB 2BQ6B 1UVOA 1VITG 3MHWU 1YKTA 2B5TB 2Y7ZA 3HGNA 5DPAA 1MD8A 1QNJA 1EOLA 5C1YA 3SV7A 4E7NA 7GCHF 3GDVA 1C2JA 1NRRH 1AFQC 2SGFE 2AFQB 3P6ZB 2F91A 3SN8A 1SGIB 1SLUB 2ZIQH 1PJPA 4ABHA 3GCTF 4ABGA 3RMLH 1C1UH 4H6TA 2WINI 1H9LB 4CHAB 1C1VH 1TA6A 1J16A 2VIVA 1P2JA 3GDUA 2FMJA 2CV3A 3BTFE 2NWNA 3UUZA 3A7XA 4XBDA 1SGTA 3VGCC 2ZFPH 1THPB 4TWWA 2WPJS 2UUYA 1VR1H 1MQ6A 3KHVA 5DP3A 1VGCB 2RA0A 1F5KU 1AKSA 1KLTA 4DURA 3K6YA 1J17T 4CRGA 1XVOA 2XCNA 1Z6JH 1IAUA 3A81A 1SOZA 1ETRH 2OC0A 3GCTG 1IQKA 2P93A 1ZTKA 2PTNA 4JZIA 2JH6D 3D65E 4ZHMU 1HAGE 2Z9LA 5DKMA 3TJUA 1H1BA 1OKXA 2FPZA 3P8FA 1GBBA 1F0SA 1P0SH 3MYWA 2HWLB 1GJDB 3WY8A 8LPRA 3GCHB 1O2NA 1H8DH 4ZKNU 1GWAA 1O0DH 5ESTE 1DE7H 1BBRE 4FUFA 1LPKB 1G3DA 1TX8A 1K1MA 2G5NA 3I78A 8GCHF 4MQAA 1AUJA 4WMDA 1UK4A 1K21H 1NESE 1K22H 2NU4E 2ZU3A 6CHAC 3TH4H 1ACBE 2QXIA 2R9PA 1O32A 4VGCB 1QB9A 1EP6A 1FY5A 4A5TS 1P8VC 4XDEA 1O2SA 1GBDA 1DXPA 1GJ8B 1MKWH 1GJAB 1CT0E 4FVBA 2OP9A 2Z94A 1O3KA 1ELBA 1DFPA 2BDGA 1TALA 1GMDF 1TRMA 8GCHG 2EC9H 1HCGA 1Q31A 1AY6H 2FI4E 1VZQH 4CH2B 1KYNA 2AEIH 2AMPA 3SJKA 1O3CA 1EJNA 4I32A 1SGQE 4FUBA 3NWUA 1KXDA 2FESH 2Z9KA 1A0HB 1LHDH 1WCZA 3BTQE 5C3NA 3L33A 3R0FA 1XUGA 1LHFH 2BVSH 4X1RU 3PTNA 1Z6EA 3MO9A 3SUFA 1ZZZA 3TITA 2VVVA 3M3SA 2BXTH 5B6OA 1KXAA 2DE9A 3QTVH 1EP5A 1O34A 3OSYA 1C5UA 3UR9A 1O3IA 1AKSB 1C5SA 1QA7A 2BD8A 3RXPA 4GAWA 4D7GA 1GBAA 1EB2A 4BAKB 3RXGA 1BMLA 1EOJA 4CR5A 1GHYH 4TWYA 1WUNH 3ZV9A 1A3BH 5A8ZA 1SHHB 1HLTH 1FIZA 1SBWA 1W13U 1PYTC 2BY6X 3HK6B 1LHGH 4THNH 2VNTA 1EJAA 2CHAB 5T3HA 1SGNE 1SGFG 2FOEA 3SJOA 1O39A 3GY8A 2AIPA 1O2YA 4XE4A 2PKSB 2GMTC 4DVAU 1GJ9B 2A4QA 3MNXA 4Y10E 3H7TA 4IC5A 2XWBI 3ZVDA 1JMOH 4ZAEA 2ZDLA 3LONA 4DW2U 3ZYDA 3E90B 1F5RA 2GTBA 2O8MA 1ARBA 2SGAA 5A8YA 4YO9A 1O2HA 2BLOA 1SOTA 4GLYA 2AH4X 1O2OA 2HOBA 3TU7H 2BZAA 1O2ZA 4OS7A 1TABE 1DWCH 4IMQA 5PTPA 1VCQA 1PPGE 3TGKE 1YPGH 2QAAA 3T62A 1TPSA 1M9UA 1TAWA 2GCTB 4D9QA 4INLA 2B7DH 2C8YB 3RU4D 2BDYA 1SGCA 1TQ0B 1C2EA 1ELTA 3BTHE 2HGTH 1C2HA 2P3FH 1NU7B 3URDA 4KKDA 1A0JA 2TBSA 1THSH 3AAVA 3PO1B 4YT6H 5FCRA 2ANWA 4AB8A 2UWLA 1XXDA 1T4VH 2DE8A 1L4ZA 4JMYA 2QXHA 5JBTA 5FPYA 4O3UA 1ZTJA 1NFWA 2BY5X 4NZLA 5DGJA 2FX6A 2NU2E 3SV9A 5EXLA 1S84A 4HI3A 1O2XA 1P05A 3SU5A 4NGAH 5A2MH 3SJ8A 3U69H 2H5DA 1GI9B 1SMFE 1S6FA 4B2AA 4AB9A 2PUXB 1QBVH 1FN6A 2A1DB 2A4RA 3SQHE 1J8AA 1CHGA 1RIWC 4JCNA 1QY6A 2B9LA 1E36B 1ANCA 1O5DH 1GJCB 5JBAS 4WJG2 4X2XA 1C9PA 1DPOA 4BANB 2PGBB 1G9IE 2FOMB 1C4U2 2EEKA 1Y3WA 3RXDA 2D2DA 1YPHC 3BN9A 2LPRA 3TGIE 1GVKB 1BBRH 2ASUB 1NFXA 4ABJA 3P17H 4A1TA 3LIWA 4B71A 3HKIB 3A84A 3P92A 3ZZBA 4KGAA 3DT0H 3RXQA 3S9AA 3URCA 3BG8A 4Q7XA 2F3CE 1TB6H 1GCTB 2OXSA 4ISOA 3SUGA 1AD8H 1DUEA 2SGQE 3UNSA 1OWIA 4IW4E 4E7RG 1UO6A 1DS2E 1TPOA 3E1XB 1GGDC 1WTHD 3SNAA 2FTLE 2O8WA 3M61U 2ZZUH 1TMBH 1OOKB 1BQYA 1HV7A 2VU8E 3Q00A 2WPHS 1DUAA 1HRTH 2BDAA 1TNHA 2GVFA 1MTVA 4Y76A 4DJZB 1WQVH 1UTKA 3PTBA 4O97A 1MU6B 2VJ1A 4MNVA 4NZQA 2OCVB 1SQOA 6ESTA 2QV1A 3IG6B 1GBHA 1KTTB 2UWOA 3K2UA 3KGPA 2Y5HA 4AZ2B 1C2LA 4UE7H 1XUFA 2VGCB 2KAIA 3KNXA 1F0TA 1O3EA 1UHBA 3ZZ4A 4CR9A 3VFEA 3M5NA 5A0AE 1FONA 1EJMA 2FIRH 3M36A 4LXBH 2HALA 2ANMH 3MU0A 5H4IB 4CHAC 1GBCA 3DFLA 1TGCA 3BSQA 1BTYA 1AMHA 2BDBA 1P2KA 2ZECA 3GY4A 3RLYH 2UUFB 1BJVA 1YCPM 3LPRA 1D3PB 3W95A 1QBNA 1AI8H 4PROA 1AFEH 3TJVA 2BLQA 3PLBA 1C4Y2 5EU8A 3EA7A 4WMFA 3JZ1B 3HKJB 4CRDA 1HAOH 1UK2A 5G4BA 3UR6A 3RXKA 2PKAB 4NIYA 3MU8A 2BX4A 3NUMA 1NFUA 1SGYE 2ZNKH 1YPKH 1G30B 2A2QH 3V7TA 1LO6A 1KY9A 2ZDVH 1V2RT 4DGJA 1BMAA 1JOUB 2BHGA 1SGPE 3VXFH 2G55A 2ZCLP 1G37A 1P11E 1X7AC 3GY3A 3U9AH 2O8UA 5T6DA 1O2VA 1YCPK 1NM6A 1V2OT 2H9EH 4MPVA 3OTJE 2C8ZB 5FPSA 1WBGB 4BXSA 2XXLA 1BHXB 2ZPRA 1MKXH 1XKBC 4OS1A 1GDQA 5DP8A 4MPWA 2TGPZ 4YZUA 5C1UA 4BXWA 1EZSC 1N8OB 1F2SE 2PV9B 4A1VA 2GP9B 4YLQH 2TGTA 1GI7B 4GVUA 2RDLA 2B0FA 3A8BA 4CRBA 1O2TA 4RSPA 4ASHA 3M3VA 1W8BH 1C1MA 1QJ6B 2ZQ2A 2V0BA 2JETB 2KAIB 1Y5AT 4ISLA 1TNIA 2FX4A 4OS4A 3GICB 2BY8X 1UHBB 3PWCA 1XVMA 1QRZA 2XBXA 1T8LA 1MAYA 4XSKU 4X1QU 1IQHA 1OWHA 2A4OA 1B5GH 1FJSA 1AVXA 5GXPA 1XUJA 1QGFA 1RS0A 5EGMA 3RDZA 1IQFA 1H8IH 1SI5H 2ZP0H 5F8TA 1Z8RA 1C5QA 1DDJA 1IQMA 1GHVH 3ZZ7A 4K8BA 2BD5A 1SL3A 2HNTC 2P8OB 1LPZB 3B9FH 4SGAE 5C20A 2A7HA 4BNRA 1AZ8A 4ZKOU 1YPMH 3NK8A 1Z8IB 1ESAA 2OUAA 3BF6H 3EA8A 2CHAC 5TJXA 3RXJA 1SLXB 1C1TA 1SGFA 1FMGA 1UTMA 3SQEE 2D26C 5FCKA 4AG2A 1AE5A 3ATKA 4X8UH 1O3BA 1PPEE 1V6DA 2Y80A 2ZDNA 4CBNA 2G81E 3UOUA 1WV7H 2THFB 3KF2A 1O2JA 1W2KH 3RC6A 2ZU2A 3A80A 2F9BH 5ESBA 3TVJB 3PMHB 3RMNH 5AFYH 1FAXA 1QB6A 3SU4A 1O5CB 3D62A 1C2DA 1TPPA 1GHAF 5E0JA 4CBOA 1BMNH 4I33A 3S9BA 1D3QB 1FZZA 1ORFA 1T4UH 4NG9H 1RXPA 1TGSZ 1OP0A 2VWOA 1H4WA 1IQNA 1HYLA 3NCLA 5GCHF 1BUIA 1C2KA 2H6MA 5L6NH 1P10A 5T6FA 5L2YH 1AHTH 1P02A 4F49A 1ELGA 5HM2A 3RU4E 1SFQB 1DXWA 4HTCH 3UY9A 3RXIA 5HYOA 1Z7KA 3EGKH 1YYY1 4WVPE 3GY2A 3BIUH 1ARCA 4AFQA 1UTOA 1K1IA 1DOJA 1GMCG 2QA9E 4B73A 6LPRA 1O3PB 3MTYA 5ETXA 1AVWA 3M5OA 3H5CB 3GCOA 2J34A 3PROA 1MD7A 3EQ0H 1O3JA 2BD4A 1LQDB 4Y8ZA 4MDSA 4JZDH 2GD4B 4KTCA 1NU9A 2W26A 1O35A 1YCPH 4X8TH 4D9RA 3M35A 5CHAC 2QN5T 2RCEA 4DIHH 1ZMLA 1ZJDA 1P9UA 1GHXH 1O37A 1TMTH 3ATMA 4IN1A 3UNRA 2ZU4A 3K6ZA 4JZEH 4LZ4B 2Z3CA 1BZXE 3RXLA 1DT2A 2WPMS 4ZKRU 1P2QA 1A7SA 1GBMA 1ESTA 2FZZA 3SI4H 1V2TT 1FI8A 2O8LA 5TCAA 4DG4A 3BG4C 2SNVA 2BY9X 2H9TH 3HPTB 3M37A 5A8XA 3OY5U 4WY3A 1SG8B 2CF8H 7GCHG 2XC0A 2BD7A 1GBIA 1P3CA 1A1RA 1TMUH 1U6QA 4D8NA 1O3OA 2VINA 1P01A 1LPGB 1K1PA 1EXFA 2FTMA 2V3OH 2OTVA 2ZU1A 1KIGH 5DO4H 3LC5A 4X2VA 5FBIA 3MH5A 5C1XA 1THRH 2A31A 5E0HA 1S82A 3FANA 4ABIA 2ZHDA 4A1XA 2PGQB 2VIOA 4UFFH 3BEFB 1O5EH 2TGDA 1RFNA 3A8AA 2HLCA 1GCTC 1EATA 2LNCA 4NIVA 1UCYH 4AYYB 1A0LA 2ZHEH 2CJIA 2J9NA 4FUCA 1MTWA 2J4IA 3UTUH 3T26A 2W3KA 4IS5A 1SPJA 1XX9A 2C8XB 1ELCA 3SV2H 3PMAB 4ZKSU 3ZVBA 3A83A 3E3TA 5F8ZA 1BT7A 3E0NB 3KQEA 2AMQA 2ESTE 2IOTA 2QC2A 1HNEE 3T27A 2XC4A 3FP6E 2VB0A 2BY7X 5E8EH 1UVSH 1T32A 2ZHWH 3G01A 3SU3A 3TJOA 1JBUH 3RXFA 1XKAC 3NZIA 1TX6A 4MVNA 3SO3A 4YOGA 1ZHMA 1GPZA 2XRCA 4D76A 1O36A 4UEHH 2OBOA 2SGPE 4I7YH 1QR3E 3MNBA 4Z6AH 3ATIA 2YNBA 4JK5A 5F03A 1C1WH 1WYKA 4DT7B 1C1NA 1G3CA 1V3XA 4B2CA 1LKAA 4U2WA 3RXMA 1BJUA 2ZCHP 1OSSA 3S7HB 5LGOA 1W12U 1BRAA 1OPHB 1Y5BT 1P2IA 2F83A 2XYAA 4DCDA 4XBBA 2GV7A 1C5TA 2UUKB 2ZFRH 4BOHA 2SGEE 1GJ5H 1JRTA 3A85A 1GMDG 3T5FH 5C2ZA 4AX9H 1HAIH 4I8GA 1V2PT 4I8HA 3UPEA 3A7ZA 2ZQ1A 2OQUA 2ZHFH 3NKKA 4B74A 3VB3A 5A09A 3PMBB 1AB9B 4O03A 5JB8S 1HAPH 4KELA 3RM0H 3A7WA 5EXNA 4X6NA 3KN2A 4DY7B 1MMJN 2A7JA 1RTKA 2P16A 3LT3A 4KP0A 1NS3A 4LZ1H 1ELEE 1SFIA 5DP4A 2VWNA 2SFAA 3V12A 1AGJA 1RTLA 2XC5A 2XCFA 4O9VA 4XOJA 1KXEA 2FODA 5EW2H 2BDIA 1BRCE 1LTOA 2Y7XA 1HFDA 2VIWA 3DUXH 1DWBH 1C1QA 3SHCH 1W7GH 1WOFA 2F9VA 4UONA 2FOAA 1NN6A 3LH3A 1GMHF 2VH0A 1CO7E 5K7RA 3UQVA 2ODYB 2A5AA 1YLCA 2B8OH 5DP6A 4K5ZA 3V3MA 1KLJH 3E0PB 5FPTA 1QBOA 1TLDA 4TPIZ 1JIMA 1Q3XA 3SNBA 3Q3XA 3M3TA 1ZGVA 1O5FH 2GZ8A 2BOKA 2SGDE 4ZXYH 1GJ7B 3M5MA 3BV9B 3MOCA 5AVDA 5IDKA 3A7TA 1LDTT 4JYUH 2WPLS 3IWMA 2M5TA 1CHOF 2ODPA 3U8TH 1AU8A 4AFZA 3GY7A 1O3NA 4AFUA 1C1SA 4FVDA 1EPTB 2WYJA 2Q6FA 4MPXA 1ANDA 1L1GA 2ZGCA 1UTNA 1TFXA 2AS9A 4NFFA 1L0ZA 4UD9H 1GG6B 1OXGA 1XMNB 3FVFB 1C5XB 3A7VA 2FXRA 2ILNA 3PV4A 5EOKA 3RM2H 4X8SH 4XBCA 3MU1A 4NA8A 3RXSA 1J14A 1ZPZA 3P95A 1AZZA 4U30A 1YM0A 2P8OC 2QY0B 1G2LA 1BRUP 1AIXH 2VIQA 1UTJA 1XM1A 1Z1IA 1TRYA 2F9NA 3FFGA 3V0XA 1C1PA 1YBWA 6GCHF 1G3BA 1RTFB 1BB0B 1OS8A 2QCYA 2HNTF 2BX3A 2ANYA 1V2WT 3A88A 1WU1A 3K65B 2BD3A 3BTDE 4INHA 2V3HH 1OX1A 1AFQB 1YPJH 1A3EH 1JRSA 2BM2A 3QGJA 1SB1H 3S7KB 3PMJA 1C1OA 2FLRH 4I8KA 1C5PA 4E06H 1PQAA 3KL6A 3NPSA 4FU7A 4WWYA 5BPEA 4FUEA 4HGCA 2H2ZA 2PKAA 1QQ4A 1INCA 3KQCA 1ZPBA 3GYLB 3UWJH 4FUGA 1GBTA 2WPIS 2H1UA 2XTTB 2RA3A 3D23A 4UFEH 1BTHH 3U8RH 1DM4B 2PLXA 4NFEA 3C1KA 2Z9GA 3FP8E 4BTIB 1MTNC 2G4UA 1W7XH 3MMGA 3SUDA 1CGJE 4YM9A 5HXFA 1D6RA 2AGEX 2IJOB 4WF8A 1N1LA 2K1QA 1P9SA 4B75A 2HPPH 4BTTB 1SLVB 1LHEH 1V2LT 2PFEA 4GCHF 3O8CA 1OYTH 2Z3EA 4BAMB 1DSTA 3QUMP 3BEIB 1D3DB 1P2NA 1TIOA 3ZZAA 4FUDA 3VB5A 5AHGH 1GHZA 2ZCKP 1HUTH 2ZKSA 1C1RA 2ZGXH 2VWLA 4BAQB 4GPGA 4K3JA 4I8LA 2I6QA 3PLPA 1UVUH 1J15A 5E0GA 5HGGA 6CHAB 4Y0YE 1O2MA 1IQJA 1SGDE 3AVZA 2CGAA 4Q80A 1PPHE 1SQTA 4AGKA 1ID5H 1Y5UT 1TGNA 1NRPH 1D4PB 2Q6GA 1SSXA 2FOCA 5JBCS 1LHCH 2GCHF 4YTAA 4UDWH 2BQWB 2AYWA 5CMXH 1PFXC 3PWBA 5FX6A 2ALPA 2FO9A 3QX5H 1HXEH 1V2VT 1FY1A 1ELDE 1SHYA 2OC8A 1O2QA 1FY8E 3VXEH 1AQ7A 1CGHA 2FWWA 3GCNA 4K69A 4QT8C 2C8WB 1VGCC 4JK6A 7ESTE 2BYAX 1BIOA 5LPRA 3RC5A 2VH6A 4YT7H 1BTUA 1QURH 2J2UA 1EAIA 1JXPA 2J92A 1A5HA 2VIPA 2PUQH 4GHTA 5J4QA 5F6MA 2W5EA 1ZTLA 1S0RA 4TY6A 1PQ7A 2CF9H 2V35A 1TNJA 1GDUA 1WSSH 3E91A 1P04A 3GCHC 1TRNA 1IQGA 1C9TA 4ISIH 4ZXXH 1HDTH 2C3SA 4YLUA 1G3EA 1BTWA 1HJAB 1GBFA 1TX7A 1FPCH 2FLBH 7KMEH 2BD2A 1QFKH 1IOEA 1V2ST 1GJ6A 1ZR0A 2G4TA 3C27B 3BIVH 1V2KT 2WV4A 3ZVGA 1E0FD 2XBVA 5GIBA 1UCYE 1UMAH 4VGCC 1FQ3A 1GI2A 4AN7A 1NPMA 2GGVB 2ZO3H 1TOMH 2G51A 5EPYA 4K1TA 1P2MA 2FOHA 2GMTB 4WXIA 2CMYA 2PWXA 1C2FA 2OBQA 5K0HA 3ZYEA 2Y5GA 1VJAU 1KDQA 3ZVEA 1EZUC 1O33A 2EI6A 2Z6BD 4Z0KA 3TH3H 3TH2H 5F8XA 3ZZDA 1K28D 3SUEA 2RG3A 2AIQA 2Q6DA 2BD9A 2ZDKA 4AOQA 3DFJA 4AFSA 2V6NA 3B8JA 1C2GA 1HB0B 1TQ7B 4FU8A 4Q7YA 4ZUHA 1TBRH 3LOXA 1QB1A 3QZRA 1TBQH 2A32A 2WPKS 4FUJA 3W94A 3KEEA 2ZHQH 1GVLA 1AWFH 1SGRE 4X6OA 4X6MA 3OU0A 4MG3A 1B0FA 1O2GH 5A0BA 1NRNH 2EI8A 2ZFFH 1CA0B 3B23B 4RKJB 1FV9A 1LVOA 1O3AA 1O3GA 3ENSB 5HMAA 3A8DA 1W0ZU 1C5LH 3SZNA 1O2UA 2GZ9A 1ZSKA 4AYVB 3T2NA 1DVAH 2FDAA 1TYNA 3SJ9A 2AGGX 2AERH 2FEQH 2YOLA 3MFJA 4Y7AA 4UFGH 5DG6A 3M7QA 1ETSH 2BDCA 3A86A 3P8NA 3Q76A 4NCYA 1G32B 1ELAA 3F9HA 2ULLA 1BRBE 2BXUH 2PKSC 4NIWA 2O9QA 2JKHA 1P3EA 3R3GB 1DLEA 1FUJA 1HIAA 2OC7A 1MKWK 4RKOB 3RU4T 2NU3E 2UWPA 3MI4A 2FS8A 1RIWB 1H9HE 5BRRE 3LGTA 1AN1E 3AAUA 1LQEA 4FXGH 3TNTA 1S81A 3STIA 2J38A 4JYVH 3SOSA 1JWTA 1CBWB 1BOQA 1MQ5A 3EDXB 3L6PA 4K8YA 2EI7A 2QF3A 3SU6A 1ZHRA 3UREA 2GCTC 1ZRKA 1KDQB 4E05H 5EW1H 1VITF 3GY5A 1C5RA 5FBEA 4NWLA 1ZPCA 1YLDA 1IQIA 1A5IA 1N6YA 1VCWA 1CA8B 4ABDA 5DP9A 1EAXA 1QJ1B 4HFPB 1CSOE 1C5MD 1O30A 2C4FH 3F1SB 3UWIA 3P8GA 4Y6DA 2ZFTA 2F9UA 1GI8B 1YC0A 2A5IA 1F92A 1JIRA 3PO1C 4CH8B 1GHAG 9ESTA 2ZTXA 1GG6C 1F0RA 5GJ4B 2O8TA 5GPIB 1KLIH 3SNCA 4WH8A 2BB4A 2WUCA 3A7YA 3BEUA 1HBTH 3BTME 4CRFA 1GGDB 4OS5A 1SGEE 4RN6A 3SORA 4CRCA 2FM2A 3EE0B 3LC3A 3V13A 3JZ2B 1O2KA 3RXOA 3O8DA 4KTSA 1G2MA 1DWDH 2EA3A 4X1NU 5GCHG 1HAHH 1XUKA 1AVGH 1CE5A 1UJ1A 2P95A 3VB4A 1GI3A 3LGUA 4B76A 1C5YB 3UIRA 3RMMH 1K1JA 1ABJH 3CP7A 1ZGIA 1O5GH 2ALVA 3QK1A 2Z9JA 5DP7A 1C5NH 1KXBA 1FLEE 2AMDA 2QYIA 4NSVA 4MNYA 1HGTH 3MNCA 2XBWA 1RRKA 2PHBA 1D6WA 1Y8TA 2PR3A 2OC1A 3BTKE 4OS2A 4ISNA 4NA9H 4MPUA 1HIAB 3H7OA 3EA9A 3RUOA 1O3LA 1ZYOA 1F7ZA 1YPHE 1TNGA 1C4V2 2Z3DA 5EPNA 1LVMA 2IN2A 1P06A 2TRMA 3ZZ6A 3E16B 1K9OE 3ZVFA 1H9IE 3UOPA 4X1PU 4F4OC 2WV5A 1QRXA 2PW8H 1GJBB 1RD3B 3F9GA 1Y59T 2QIQA 4TPYA 3ZZ5A 1SC8U 7LPRA 1TNLA 1CT4E 4IC6A 1LVYA 1FIWA 1ZSJA 3TLOA 3UNQA 3CS7A 3ESTA 4GSOA 3A89A 1W10U 3AASA 1AO5A 2CXVA 4OS6A 1L4DA 3CENA 1DITH 1BTXA 1ELVA 3TK6A 1OWKA 4MNXA 1VCPA 3MNSA 3SNDA 2NU1E 3T28A 1GI1A 1YGCH 1TGTA 5AF9H 1EQ9A 5C5NA 1QQUA 2J94A 4Y8XA 3GDSA 5L30H 2R0KA 2VVUA 2VGCC 4CREA 2SNWA 3U98H 1FY4A 2BDHA 1XUIA 2G52A 3GISB 4K2YA 1W0YH 1BDAA 1HAZB 1EPTA 1OYQA 5EG4A 1NTPA 4ZHAA 2Q1JA 8KME2 1HAYB 1Y3XA 1ELFA 2DUCA 2QF0A 1TE0A 5T6GA 4B1TA 2C90B 1A4WH 1NROH 3TGJE 1MCVA 2FI3E 2ZC9H 1NFYA 3MO6A 2ZA5A 2W7SA 4XFQA 1BBRK 3DHKH 3MWIU 4X8VH 1J9CH 1T8NA 3SNEA 1S0QA 1ZSLA 4I31A 1WAYB 5IYTA 3LGWA 3ATWA 3KIDU 2ZGHA 1BTZA 1T8OA 3QTOH 1KTSB 1FPHH 1O38A 3M5LA 4K60A 1RGQA 3QDZB 1WTGH 2XNIA 2HRVA 1K2I1 2D8WA 1UTQA 3RXUA 4IN2A 3DD2H 1MUEB 1C5OH 1DX5M 2FS9A 3RP2A 1PYTD 1V2QT 3ITIA 3U1JB 1O5AB 2ZF0H 5DK1A 3A82A 5SGAE 1GCDA 1Q2WA 3O8BA 5JB9S 1HJ9A 4YESB 3SW2B 1TONA 4WMEA 1FAKH 2Y6TA 3ZVAA 4ABFA 1OWEA 5EQSA 1HJAC 3LH1A 3O8RA 3Q3YA 1HAXB 2STBE 3FZDA 1MBMA 3RXRA 1TPAE 4A92A 1HPGA 4FUIA 1VITH 4TY7A 3SU2A 2VIDA 2ZPQA 1O2LA 4FU9A 2G00A 4X2WA 1NC6A 2ODQA 1GL0E 1MZDA 4H42U 2PSXA 1GHBF 3U1IB 3K9XB 2W3IA 2Y81A 1N8OC 4X6PA 1MAXA 4ABEA 4Y79A 4GUXA 1TOCB 2ZG0H 4MLFB 1TGBA 2GX4A 1EZQA 2FYQA 2G5VA 2JETC 4Y7BA 1E38B 1O2PA 2BVRH 1Z8GA 1MBQA 1HJ8A 2OD3B 3MH4A 3RXAA 2P94A 5LPFA 3ODFA 1O2IA 1FDPA 2P59A 2HPQH 1YPEH 1ZHPA 1O2WA 3I29A 4H6SB 5E2OA 1O2RA 1UVPA 2PSYA 1GMHG 3KQBA 1C5WB 5CE1A 2BLWA 1GHBG 3Q77A 1IQEA 1MU8B 1E37B 1GI6A 3SGQE 1O5BB 5I46H 1GVZA 3MO3A 2OLGA 5TCCA 2BZ6H 4IMZA 1QJ7B 4O3TA 4WH6A 5DP5A 1CA0C 1OWJA 1EX3A 1P03A 4I8JA 3TNSA 4YOIA 3FZZA 1CHOG 2R3YA 2OINA 2HNTE 1QRWA 2TIOA 2WUBA 4LOYH 3BTGE 1B7XB 2FYRA 1OP8A 2D1JA 4AGJA 4ABAA 1FN8A 4X1SU 4K1EA 1DWEH 1Z1JA 1QL7A 2A0QB 1VJ9U 1AWHB 1GBEA 3ZVCA 1ETTH 3VB6A 1UTLM 3KCGH 1CVWH 4X2YA 5ABWA 1NRSH 1K1NA 4DOQA 3OX7U 5EQRA 3S0NA 1QL8A 2NU0E 2ZEBA 1MKXK 3ZZ8A 5CHAB 8ESTE 2BOHB 3TK5A 3UQOA 1E35B 1BMMH 1T31A 3RXTA 1O31A 1P12E 1T7CA 1DY9A 4U01A 2VWMA 3TPIZ 2XWAA 5E2PA 1TA2A 1EUFA 4U32A 2BQ7B 4WXVA 3BG4B 1OWDA 3VGCB 1O3MA 1ANEA 1FY3A 1GBLA 2A45B 5JDUB 6GCHG 1KXCA 2BLVA 1GDNA 3FAOA 2A4GA 2ZU5A 3HATH 1HXFH 1W11U 4J1YA 4R0IA 1ZOMA 3LJJA 2ZDMA 4BAHB 3LKWA 3QO6A 1P09A 1YF4A 1CBWC 3FP7E 3LGYA 4ZROA 1T8MA 3MU4A 4Y0ZE 4ISHH 4NA7A 1W3CA 3QN7A 2R2MB 4NWKA 1KXFA 4NSYA 2BMGB 4H4FA 4OGXA 3RLWH 2FP7B 1EZXC 4SGBE 5FHTA 5C67A 1UK3A 2H5CA 2ZPSA 1GHWH 1D3TB 2BVXH 5HM9A 1LVBA 1CQQA 2JH5D 1PPZA 1DANH 1O3FA 3STJA 3OY6U 3N7OA 3LDXH 4A7IB 1V2JT 1GBKA 1AUTC 2G8TA 3MH7A 2GDDA 4GHQA 1S83A 1O3HA 2R2WU 2Y82A 1B0EA 1L1NA 1DICA 1GI5A 1QHRB 1N6XA 2ZDAH 2GKVE 1UTPA 3SI3H 3M7UA 3VPKA 4GCHG 3S69A 2F9PA 1L2EA 4R8TB 2STAE 1WQSA 2A7CA 2OQ5A 3EAJA 3SU1A 1E34B 1MZAA 5I25A 2GV6A 1V2UT 3GY6A 4UFDH 3SU0A 4JZ1A 3VEQB 3D49H 3TJNA 2W7UA 1GL1A 1S6HA 3F68H 3A8CA 3HGPA 4Y11E 4YOJA 3LGVA 3T29A 5AFZH 3E8LA 1QTFA 1O3DA 1LCYA 1MTSA 3Q3KA 4M7GA 2A5KA 1SQAA 1UVTH 4Y71A 3IITA 1GBJA 1ZMNA 2GCHG 4Q2KA 2YNAA 3RMOH 1RJXB 1EAWA 1PQ5A 4ZHLU 1KSNA 1A61H 1EKBB 4ESTE 2HVXA 4Q7ZA 2GZ7A 3QLPH 5C5OA 3P8OA 1QA0A 2GDEH 4HZHA 4JZFH 1CGIE 1TBZH 3RXVA 4B2BA 3MU5A 4FUHA 1W14U 2J95A 2FOGA 1NRQH 1C2IA 3ZZ3A 2ZTYA 1CT2E 3F9FA 1BITA 2Z9IA 4JYTA 1MH0A 4X0WU 2A2XH 3F6UH 3SV8A 5JYIA 1FXYA 3A87A 2ANKH 1IHSH 2QGRA 1FNIA 1L1JA 1GI4A 2Z7FE 2I6SA 3PM3A 1Z8JB 2CN0H 3OYPA 1GJ4H 1EB1H 1D9IA 5FXLA 2P3UB 3I77A 1A2CH 4NIXA 3PYHA 4ZH8A 3BTWE 3BTEE 3S9CA 1LKBA 5GWZA 2FOFA 4LK4A 1EAUA 1MCTA 9LPRA 3L3TA 3M7TA 3TIUA 1BCUH 2ZWLH 2R0LA 2C93B 1QIXB 3SV6A 3QZQA 2ZFQH 1G36A 1IQLA 3KQDA 1S85A 1IHTH 3ELAH 1F5LA 1NT1A 1NO9H 3P70B 5JBBS 2QXGA 4CRAA 3MH6A 2ZI2H 1XUHA 3TK9A 4A6LA 4AG1A 1HAVA 1YPLH 4AORA 4D7FA 4J2YB 3ZZCA 2BTCE 2P3TB 5EXMA 1PPFE 1C5ZB 3GOVB 3AW1A 1K1LA 4OGYA 5LH8A 2Y5FA 4Y8YA 1NY22 4KTUA 2FI5E 1ANBA 1MTUA 4MTBA 1DY8A 2ZTZA 3RC4A 3BTTE 2FOBA 1Y3YA 2F9OA 1PPCE 3U8OH 1C5VA 1UCYK
chains in the Genus database with same CATH superfamily
1F0UA 3AW0A 4IGDA 1AE8H 1ZLRA 2GT7A 4OM9A 3RXCA 2XOKD 1AB9C 5EODA 5KECA 4ABBA 5JPMH 1Y3VA 2XBYA 1DLKB 5FX5A 4YXWD 1V2NT 4ZMAH 3SGBE 3PLKA 1SVPA 5A0CA 1A46H 3RXEA 3QGNB 2XW9A 1QCPA 4BTUB 2H9HA 3SGAE 1ZJKA 3LGIA 2PTCE 2ZGBH 4MNWA 1YY3A 1OP2A 1XXFA 1CU1A 2QXJA 1TNKA 3ZZ9A 1NZQH 3NXPA 2ZGJA 1BTPA 1A5GH 1P2OA 2KCAA 3LU9B 2AGIX 3LJOA 3ZV8A 5DJ7A 1BHXF 4IBLH 2YMSD 1V2MT 3QWCH 3GYMA 2UUJB 3VB7A 3E6PH 2TPIZ 1PPBH 1Y3UA 1BA8B 1TWXB 3SHAH 1QL9A 1S5SA 1PQ8A 1SR5C 4K1SA 2TGAA 3RXHA 4DIIH 1YP9A 1EPTC 1GMCF 4TYDA 3HK3B 3ODDA 4BAOB 3PB1E 3SJIA 1ABIH 5J4SA 1EASA 1GI0A 2VVCA 1MTNB 2WYGA 4INKA 1ZMJA 2ZFSA 3DA9B 3EYDA 5EQQA 5LPEA 3SBKA 2GT8A 1C2MA 2JH0D 1ESBA 2R3UA 2IPHA 3ATLA 1ZRBA 1P57B 5GDSH 5FAHA 3UFAA 1HAVB 3CS0A 1DSUA 3F9EA 3T25A 3RXBA 1LMWB 2RFKC 1Z71A 1K1OA 5L2ZH 1SLWB 2BQ6B 1UVOA 1VITG 3MHWU 1YKTA 2B5TB 2Y7ZA 3HGNA 2KX4A 5DPAA 1MD8A 1QNJA 1EOLA 5C1YA 3SV7A 4E7NA 7GCHF 3GDVA 1C2JA 2GJGA 1NRRH 1AFQC 2SGFE 2AFQB 3P6ZB 2F91A 3SN8A 1SGIB 1SLUB 2ZIQH 1PJPA 4ABHA 3GCTF 4ABGA 2L74A 2PP6A 3RMLH 1C1UH 4H6TA 2WINI 1H9LB 4CHAB 1C1VH 1TA6A 1J16A 2VIVA 1P2JA 3GDUA 2FMJA 2CV3A 3BTFE 2NWNA 3UUZA 3A7XA 4XBDA 1SGTA 3VGCC 2ZFPH 1THPB 4TWWA 2W6ID 2WPJS 2UUYA 1VR1H 2CK3D 1MQ6A 3KHVA 5DP3A 1COWD 1VGCB 2RA0A 1F5KU 1AKSA 1KLTA 4DURA 3K6YA 1J17T 4CRGA 1XVOA 2XCNA 1Z6JH 1IAUA 3A81A 1SOZA 1ETRH 2OC0A 3GCTG 1IQKA 2P93A 1ZTKA 2PTNA 3W1EA 4JZIA 2JH6D 3D65E 4ZHMU 1HAGE 2Z9LA 5DKMA 3TJUA 1H1BA 1OKXA 2FPZA 3P8FA 1GBBA 1F0SA 1P0SH 3MYWA 2HWLB 1GJDB 3WY8A 8LPRA 3GCHB 1O2NA 1H8DH 4ZKNU 1GWAA 1O0DH 5ESTE 1DE7H 1BBRE 4FUFA 1LPKB 1G3DA 1TX8A 1K1MA 2G5NA 3I78A 8GCHF 4MQAA 1AUJA 4WMDA 1UK4A 1K21H 1NESE 1K22H 2NU4E 2ZU3A 6CHAC 3TH4H 1ACBE 2QXIA 2R9PA 1O32A 5KGOA 4VGCB 1H8ED 1QB9A 1EP6A 1FY5A 4A5TS 1P8VC 4XDEA 1O2SA 3FO8D 3DCLA 1GBDA 1DXPA 1GJ8B 1MKWH 1WDIA 1GJAB 1CT0E 4FVBA 2OP9A 2Z94A 1O3KA 1ELBA 1DFPA 2BDGA 1TALA 1GMDF 1TRMA 3SZEA 8GCHG 2EC9H 1HCGA 1Q31A 1AY6H 2FI4E 1VZQH 4CH2B 1KYNA 2AEIH 2AMPA 3SJKA 1O3CA 1EJNA 4I32A 2WHXA 1SGQE 4FUBA 3NWUA 1KXDA 2FESH 3AK5A 2Z9KA 1A0HB 1LHDH 1WCZA 3BTQE 5C3NA 3L33A 3R0FA 1XUGA 1LHFH 2BVSH 4X1RU 3PTNA 1Z6EA 5HIZA 3MO9A 3SUFA 1ZZZA 3TITA 2VVVA 3M3SA 2BXTH 5B6OA 1KXAA 2DE9A 3QTVH 1EP5A 1O34A 3OSYA 1C5UA 3UR9A 1O3IA 3H09A 1AKSB 1C5SA 1QA7A 2BD8A 3RXPA 4GAWA 4D7GA 1GBAA 1EB2A 4BAKB 3RXGA 1BMLA 1EOJA 4CR5A 1GHYH 4TWYA 1WUNH 3ZV9A 1A3BH 5A8ZA 1SHHB 1HLTH 1FIZA 1SBWA 1W13U 1PYTC 2BY6X 3HK6B 1LHGH 4THNH 2VNTA 1EJAA 2CHAB 5T3HA 1SGNE 1W0JD 1SGFG 2FOEA 3SJOA 1O39A 3GY8A 2AIPA 1O2YA 4XE4A 2PKSB 2GMTC 4DVAU 1GJ9B 2A4QA 3MNXA 4Y10E 3H7TA 4IC5A 2XWBI 3ZVDA 1JMOH 4ZAEA 2ZDLA 3LONA 4DW2U 3ZYDA 3E90B 1F5RA 2GTBA 2O8MA 1ARBA 2SGAA 5A8YA 4YO9A 1O2HA 2BLOA 1SOTA 4GLYA 2AH4X 1O2OA 2HOBA 3TU7H 2BZAA 1O2ZA 1SQRA 4OS7A 1TABE 1DWCH 4IMQA 5PTPA 1NBME 1PPGE 1VCQA 3TGKE 1YPGH 2YMSB 2QAAA 3T62A 1TPSA 1M9UA 1TAWA 2GCTB 4D9QA 4INLA 2B7DH 2C8YB 3RU4D 2BDYA 1SGCA 1TQ0B 1C2EA 1ELTA 3BTHE 2HGTH 1C2HA 2P3FH 1NU7B 3URDA 4KKDA 1A0JA 2TBSA 1THSH 3AAVA 3KYGA 4I86A 3PO1B 4YT6H 5FCRA 2ANWA 4AB8A 2UWLA 2JIZD 1XXDA 1T4VH 2DE8A 1L4ZA 4JMYA 2QXHA 5JBTA 5FPYA 4O3UA 1ZTJA 1NFWA 2BY5X 4NZLA 5DGJA 2FX6A 2NU2E 3SV9A 5EXLA 1S84A 4HI3A 1O2XA 1P05A 3SU5A 4NGAH 5A2MH 3SJ8A 3U69H 2H5DA 1GI9B 1SMFE 1S6FA 4B2AA 2IJD1 4AB9A 2PUXB 1QBVH 1FN6A 2A1DB 2A4RA 3SQHE 1J8AA 1CHGA 1RIWC 4JCNA 1QY6A 2B9LA 1E36B 1ANCA 1O5DH 1GJCB 5JBAS 3N99A 4WJG2 4X2XA 1C9PA 3FOAA 1DPOA 4BANB 2PGBB 1G9IE 2FOMB 1C4U2 2EEKA 3N7EA 1Y3WA 2KR7A 2D2DA 3RXDA 1YPHC 3BN9A 2KZ4A 2LPRA 3TGIE 1GVKB 1BBRH 2ASUB 1NFXA 4ABJA 3P17H 4A1TA 3LIWA 4B71A 3HKIB 3A84A 3P92A 3ZZBA 4KGAA 3DT0H 3RXQA 3S9AA 3URCA 3BG8A 4Q7XA 2F3CE 1TB6H 1GCTB 2OXSA 4ISOA 3SUGA 1AD8H 1DUEA 2SGQE 3UNSA 1OWIA 4IW4E 4E7RG 5C17A 1VKYA 1UO6A 1DS2E 1TPOA 3E1XB 1GGDC 1WTHD 3SNAA 4Q4LA 2FTLE 2O8WA 3M61U 2ZZUH 1TMBH 1OOKB 2LP6A 1BQYA 1HV7A 2VU8E 3Q00A 2WPHS 1DUAA 1HRTH 2BDAA 1TNHA 4RI0A 2GVFA 1MTVA 4Z1MD 4Y76A 4DJZB 1WQVH 1UTKA 3PTBA 4O97A 1MU6B 2VJ1A 4MNVA 4NZQA 2OCVB 1SQOA 6ESTA 2QV1A 3IG6B 1GBHA 1KTTB 2UWOA 3K2UA 3KGPA 2Y5HA 4AZ2B 2KCOA 5EJ1A 1C2LA 4UE7H 1XUFA 2VGCB 2KAIA 3KNXA 3PRDA 1F0TA 1O3EA 1UHBA 3ZZ4A 4CR9A 3VFEA 3M5NA 5A0AE 1FONA 1EJMA 2FIRH 3M36A 4LXBH 2HALA 2ANMH 3MU0A 5H4IB 4CHAC 1GBCA 3DFLA 1TGCA 3BSQA 1BTYA 1AMHA 2BDBA 2WSSD 1P2KA 2ZECA 3GY4A 3RLYH 2UUFB 1BJVA 1YCPM 3LPRA 2VBCA 4XD7D 1D3PB 3W95A 1QBNA 1AI8H 4PROA 1AFEH 2KFWA 3TJVA 2BLQA 3PLBA 1C4Y2 2XNDD 5EU8A 3EA7A 4WMFA 3JZ1B 3HKJB 4CRDA 1HAOH 1UK2A 5G4BA 3UR6A 3RXKA 2PKAB 4NIYA 3MU8A 2BX4A 3NUMA 1NFUA 1SGYE 2ZNKH 1YPKH 1G30B 5HKKD 2A2QH 3V7TA 1LO6A 1KY9A 2ZDVH 1V2RT 4DGJA 1BMAA 1JOUB 4ASUD 2BHGA 1SGPE 3VXFH 2G55A 2ZCLP 1G37A 1P11E 1X7AC 3GY3A 3U9AH 2O8UA 5T6DA 1O2VA 1YCPK 1NM6A 1V2OT 2H9EH 4MPVA 3OTJE 2C8ZB 5FPSA 1WBGB 2QF4A 4BXSA 2XXLA 1BHXB 4M9FA 2ZPRA 1MKXH 1XKBC 4OS1A 1GDQA 5DP8A 4MPWA 2TGPZ 4YZUA 5C1UA 1NBMD 4BXWA 1EZSC 1N8OB 1F2SE 2PV9B 4A1VA 2GP9B 4YLQH 2TGTA 1GI7B 4GVUA 2RDLA 2B0FA 3A8BA 4CRBA 1O2TA 4RSPA 4ASHA 3M3VA 1W8BH 4RT0A 1C1MA 1QJ6B 2ZQ2A 2V0BA 2JETB 2KAIB 1Y5AT 4ISLA 1TNIA 2FX4A 4OS4A 3GICB 2BY8X 1UHBB 3PWCA 1XVMA 1QRZA 2XBXA 1T8LA 2KCPA 1MAYA 4XSKU 4X1QU 1IQHA 1OWHA 3KYFA 2A4OA 1B5GH 1FJSA 1AVXA 5GXPA 1XUJA 1QGFA 1RS0A 5EGMA 3RDZA 1IQFA 1H8IH 1SI5H 2ZP0H 5F8TA 1Z8RA 1C5QA 1DDJA 1IQMA 1GHVH 3ZZ7A 4K8BA 2BD5A 1SL3A 2HNTC 2P8OB 1LPZB 3B9FH 4SGAE 3UB0A 5C20A 2A7HA 4BNRA 1AZ8A 4ZKOU 1YPMH 3NK8A 1Z8IB 1ESAA 2OUAA 3BF6H 3EA8A 2CHAC 5TJXA 3RXJA 1SLXB 1C1TA 1SGFA 1FMGA 1UTMA 3SQEE 2D26C 5FCKA 4AG2A 1AE5A 3ATKA 2JJ2D 4X8UH 1O3BA 1PPEE 1V6DA 2Y80A 2ZDNA 4CBNA 2G81E 3UOUA 1WV7H 2THFB 3KF2A 1O2JA 1W2KH 3RC6A 2ZU2A 3A80A 2F9BH 5ESBA 3TVJB 1BMFD 3PMHB 3RMNH 5AFYH 1FAXA 1QB6A 3SU4A 1O5CB 3D62A 1C2DA 1TPPA 1GHAF 5E0JA 4CBOA 2AHME 1BMNH 4I33A 3S9BA 1D3QB 1FZZA 1ORFA 1T4UH 2YMSC 4NG9H 1RXPA 1TGSZ 1OP0A 2VWOA 1H4WA 1IQNA 1HYLA 3NCLA 1E1RD 1EFRD 1BUIA 1C2KA 5GCHF 2H6MA 5L6NH 1P10A 5T6FA 5L2YH 1AHTH 1P02A 4F49A 1ELGA 5HM2A 3RU4E 1SFQB 1DXWA 4HTCH 3UY9A 2QE7D 3RXIA 5HYOA 1Z7KA 3EGKH 1YYY1 4WVPE 3GY2A 3BIUH 1ARCA 4AFQA 1UTOA 1K1IA 1DOJA 1GMCG 2QA9E 4B73A 6LPRA 1O3PB 3MTYA 5ETXA 1AVWA 3M5OA 3H5CB 3GCOA 2J34A 3PROA 3F2HA 1MD7A 3EQ0H 1O3JA 2BD4A 1LQDB 4Y8ZA 4MDSA 3F0OA 4JZDH 2GD4B 4KTCA 1NU9A 2W26A 1O35A 1YCPH 4X8TH 4D9RA 3M35A 5CHAC 2QN5T 2RCEA 4DIHH 1ZMLA 1ZJDA 1P9UA 1GHXH 1O37A 1TMTH 3ATMA 4IN1A 3UNRA 2ZU4A 3K6ZA 4JZEH 4LZ4B 2Z3CA 1BZXE 3RXLA 1DT2A 2WPMS 4ZKRU 1P2QA 1A7SA 1GBMA 1ESTA 2FZZA 3SI4H 1V2TT 1FI8A 2O8LA 5TCAA 4ACBA 4DG4A 3BG4C 2SNVA 2BY9X 2H9TH 3HPTB 4Q63A 3M37A 5A8XA 3OY5U 4WY3A 1SG8B 2CF8H 7GCHG 2XC0A 2BD7A 1GBIA 1P3CA 1A1RA 1TMUH 1U6QA 4D8NA 1O3OA 2VINA 1P01A 1LPGB 1K1PA 1EXFA 2FTMA 2V3OH 2OTVA 2ZU1A 1KIGH 5DO4H 3LC5A 4X2VA 5FBIA 1SKYE 3MH5A 5C1XA 1THRH 2A31A 5E0HA 1S82A 3FANA 4ABIA 2ZHDA 4A1XA 2PGQB 2VIOA 4UFFH 3BEFB 1O5EH 2TGDA 4AC9A 1RFNA 3A8AA 2HLCA 1GCTC 1EATA 2LNCA 4NIVA 1UCYH 4AYYB 1A0LA 2ZHEH 2CJIA 2J9NA 4FUCA 1MTWA 2J4IA 3UTUH 3T26A 2J5UA 2W3KA 4IS5A 1SPJA 1XX9A 2C8XB 1ELCA 3SV2H 3PMAB 4ZKSU 3WWBA 3ZVBA 3A83A 3E3TA 5F8ZA 1BT7A 3E0NB 3KQEA 3UAIC 2AMQA 4TSFD 2ESTE 2IOTA 2QC2A 1HNEE 3T27A 2XC4A 3FP6E 3OTPA 1MABB 3PV5A 2VB0A 2BY7X 5E8EH 5EJLA 1UVSH 1T32A 2ZHWH 3G01A 3SU3A 3TJOA 3MQKC 1JBUH 3RXFA 1XKAC 3NZIA 1TX6A 4MVNA 3SO3A 4YOGA 1ZHMA 1GPZA 2XRCA 4D76A 1O36A 4UEHH 2OBOA 2SGPE 4I7YH 1QR3E 3MNBA 3VG8A 4Z6AH 3ATIA 1WXRA 2YNBA 4JK5A 5F03A 5GNDA 1C1WH 1WYKA 4DT7B 1C1NA 1G3CA 1V3XA 4B2CA 3DSPA 1LKAA 4U2WA 3RXMA 1BJUA 3F3BA 5DSFA 2ZCHP 1OSSA 3S7HB 5LGOA 1W12U 1BRAA 1OPHB 1Y5BT 1P2IA 2F83A 2XYAA 4DCDA 4XBBA 2GV7A 1C5TA 2UUKB 2ZFRH 4BOHA 2SGEE 1GJ5H 1JRTA 3A85A 1GMDG 3T5FH 5C2ZA 4AX9H 1HAIH 4I8GA 1V2PT 4HG6A 4I8HA 3UPEA 3A7ZA 2ZQ1A 2OQUA 2ZHFH 3NKKA 4B74A 3VB3A 5A09A 3PMBB 1AB9B 4O03A 5JB8S 1HAPH 1UW7A 4KELA 3RM0H 3A7WA 5EXNA 4X6NA 3KN2A 4DY7B 1MMJN 1E79D 2A7JA 1RTKA 2P16A 3LT3A 4KP0A 1NS3A 4LZ1H 1ELEE 1SFIA 5DP4A 2VWNA 2SFAA 3V12A 1AGJA 1RTLA 2XC5A 2XCFA 4O9VA 4XOJA 1KXEA 2FODA 5C94A 5EW2H 2BDIA 1BRCE 1LTOA 2Y7XA 1HFDA 2VIWA 3DUXH 1DWBH 1C1QA 3SHCH 1W7GH 1WOFA 2F9VA 4UONA 2FOAA 1NN6A 3LH3A 1GMHF 2VH0A 1CO7E 5K7RA 3UQVA 2ODYB 2A5AA 2RDEA 1YLCA 2B8OH 5DP6A 4K5ZA 3V3MA 1KLJH 3E0PB 5FPTA 1QBOA 1TLDA 4TPIZ 1JIMA 1FX0B 1Q3XA 4TT3D 3Q3XA 3SNBA 3M3TA 1ZGVA 1O5FH 2GZ8A 2BOKA 2SGDE 4ZXYH 1GJ7B 3M5MA 4ACAA 3BV9B 3MOCA 1S6LA 5AVDA 5IDKA 3N7DA 3A7TA 1LDTT 4JYUH 2WPLS 3IWMA 5CDFE 2M5TA 1CHOF 2ODPA 3U8TH 1AU8A 4AFZA 3GY7A 1O3NA 4AFUA 5C0UA 1C1SA 4FVDA 1EPTB 2WYJA 2Q6FA 4MPXA 1ANDA 1L1GA 2ZGCA 3DSGA 1UTNA 1TFXA 2AS9A 4NFFA 1L0ZA 4UD9H 2HVYB 1GG6B 1OXGA 1XMNB 3FVFB 1C5XB 2WPDD 3A7VA 2FXRA 2ILNA 3PV4A 5EOKA 3RM2H 4X8SH 4XBCA 3MU1A 4NA8A 3RXSA 1J14A 1ZPZA 2WV9A 3P95A 3PRBA 1AZZA 4U30A 1YM0A 2P8OC 2QY0B 1G2LA 1BRUP 1AIXH 2VIQA 5EIYA 1UTJA 1XM1A 1Z1IA 1TRYA 2F9NA 3FFGA 3V0XA 1C1PA 1YBWA 2JDID 6GCHF 1G3BA 1YWUA 1RTFB 1BB0B 1OS8A 2QCYA 2HNTF 2BX3A 2ANYA 1V2WT 3A88A 1WU1A 3K65B 2BD3A 3BTDE 4INHA 2V3HH 1OX1A 1AFQB 1YPJH 1A3EH 1JRSA 2BM2A 3QGJA 1SB1H 3S7KB 3PMJA 1C1OA 2FLRH 4I8KA 1C5PA 4E06H 1PQAA 3KL6A 3NPSA 4FU7A 4WWYA 5BPEA 4FUEA 4HGCA 2H2ZA 2WZQA 2PKAA 1QQ4A 1INCA 3KQCA 1ZPBA 2V7QD 3GYLB 3UWJH 4FUGA 1GBTA 2WPIS 2H1UA 2XTTB 2RA3A 3D23A 5T1VA 4UFEH 1BTHH 3U8RH 1DM4B 2PLXA 4NFEA 3C1KA 2Z9GA 3FP8E 4BTIB 5B6LA 1MTNC 2G4UA 1W7XH 3MMGA 3SUDA 1CGJE 4YM9A 5HXFA 1D6RA 2AGEX 2IJOB 4WF8A 1N1LA 2K1QA 1P9SA 4B75A 4ZCNA 2HPPH 4BTTB 1SLVB 1LHEH 1V2LT 2PFEA 4GCHF 3O8CA 1OYTH 2Z3EA 4BAMB 1DSTA 3QUMP 3BEIB 1D3DB 1P2NA 1TIOA 3ZZAA 4FUDA 3VB5A 5AHGH 1GHZA 2ZCKP 3SYJA 2ZKSA 1HUTH 1C1RA 2ZGXH 2VWLA 4BAQB 4GPGA 4K3JA 4I8LA 2I6QA 3PLPA 1UVUH 1J15A 5E0GA 5HGGA 6CHAB 4Y0YE 1O2MA 1IQJA 1SGDE 3AVZA 2CGAA 4Q80A 1PPHE 1SQTA 4AGKA 1ID5H 1Y5UT 1TGNA 1NRPH 1D4PB 2Q6GA 1SSXA 2FOCA 5JBCS 1LHCH 2GCHF 4YTAA 4UDWH 2BQWB 2AYWA 5CMXH 1PFXC 3PWBA 5FX6A 2ALPA 2FO9A 3QX5H 1HXEH 1V2VT 1FY1A 1ELDE 3WWFA 1SHYA 2OC8A 1O2QA 1FY8E 2K0QA 1AQ7A 3VXEH 1CGHA 2FWWA 3GCNA 4K69A 4QT8C 2C8WB 1VGCC 4JK6A 7ESTE 2BYAX 1BIOA 5LPRA 3RC5A 2VH6A 4YT7H 1BTUA 1QURH 2J2UA 1EAIA 1JXPA 2J92A 1A5HA 2VIPA 2PUQH 4GHTA 5J4QA 5F6MA 2W5EA 1ZTLA 1S0RA 4TY6A 1PQ7A 2CF9H 2V35A 1TNJA 1GDUA 1WSSH 3E91A 1P04A 3GCHC 1TRNA 1IQGA 1C9TA 4ISIH 4ZXXH 2C3SA 1HDTH 4YLUA 1G3EA 1BTWA 1HJAB 1GBFA 1TX7A 1FPCH 2FLBH 7KMEH 2F4LA 2BD2A 1QFKH 1IOEA 1V2ST 1GJ6A 1ZR0A 2G4TA 3C27B 3BIVH 1V2KT 4P00A 2WV4A 3ZVGA 1E0FD 2XBVA 5GIBA 1UCYE 1UMAH 4VGCC 1FQ3A 3OFND 1GI2A 4AN7A 1NPMA 2GGVB 2ZO3H 1TOMH 2G51A 5EPYA 4K1TA 1P2MA 2FOHA 2W6JD 2GMTB 4WXIA 2CMYA 2PWXA 1C2FA 2OBQA 5K0HA 3ZYEA 2Y5GA 1VJAU 1KDQA 3ZVEA 1EZUC 1O33A 2EI6A 2Z6BD 4Z0KA 3TH3H 3TH2H 5F8XA 3ZZDA 1K28D 3SUEA 2RG3A 2AIQA 5C0TA 2Q6DA 2BD9A 2ZDKA 4AOQA 3DFJA 4AFSA 2V6NA 3B8JA 1C2GA 1HB0B 1TQ7B 4FU8A 4Q7YA 4ZUHA 1TBRH 3LOXA 1QB1A 3QZRA 1TBQH 2A32A 2WPKS 4FUJA 3W94A 3KEEA 2ZHQH 1GVLA 1AWFH 1SGRE 4FOUC 4X6OA 4X6MA 3OU0A 4MG3A 1B0FA 1O2GH 5A0BA 1NRNH 2EI8A 2ZFFH 3OEHD 1CA0B 3B23B 3FN8A 4RKJB 1FV9A 2QF5A 1LVOA 1O3AA 1O3GA 3ENSB 3PV2A 5HMAA 3A8DA 1W0ZU 2KM0A 1C5LH 3SZNA 1O2UA 2GZ9A 1ZSKA 4AYVB 3T2NA 1DVAH 2FDAA 1TYNA 3SJ9A 2AGGX 2AERH 2FEQH 2YOLA 3MFJA 4Y7AA 4UFGH 5DG6A 3M7QA 1ETSH 2BDCA 5EJZA 3A86A 3P8NA 3Q76A 4NCYA 3NRLA 1G32B 1ELAA 3F9HA 2ULLA 1BRBE 3GS9A 2BXUH 2PKSC 4NIWA 2JKHA 2O9QA 1P3EA 3R3GB 1E1QD 1DLEA 1FUJA 1HIAA 2OC7A 1MKWK 4RKOB 3RU4T 2NU3E 2UWPA 3MI4A 2FS8A 1RIWB 1H9HE 5BRRE 3LGTA 1AN1E 3AAUA 1LQEA 4FXGH 3TNTA 1S81A 3STIA 2J38A 4JYVH 3SOSA 1JWTA 2M2AA 1CBWB 1BOQA 1MQ5A 3EDXB 3L6PA 4K8YA 2EI7A 2QF3A 3SU6A 1ZHRA 3UREA 2GCTC 1ZRKA 1KDQB 4E05H 5EW1H 1VITF 3GY5A 1C5RA 5FBEA 4NWLA 1ZPCA 1YLDA 1IQIA 1A5IA 1N6YA 1VCWA 1CA8B 4RT1A 4ABDA 5DP9A 1EAXA 1QJ1B 4HFPB 1CSOE 1C5MD 1O30A 2C4FH 3F1SB 3UWIA 3P8GA 4Y6DA 2ZFTA 2F9UA 1GI8B 1YC0A 2A5IA 1F92A 1JIRA 3PO1C 4CH8B 1GHAG 9ESTA 2ZTXA 1GG6C 1F0RA 5GJ4B 2O8TA 5GPIB 1KLIH 3SNCA 4WH8A 2BB4A 2WUCA 3A7YA 3BEUA 1HBTH 3BTME 4CRFA 1GGDB 4OS5A 1SGEE 4RN6A 3SORA 4CRCA 2FM2A 3EE0B 3LC3A 3V13A 3JZ2B 1O2KA 3RXOA 3O8DA 4KTSA 1G2MA 1DWDH 2EA3A 4X1NU 5GCHG 1HAHH 1XUKA 2V3MA 1AVGH 1CE5A 1UJ1A 2P95A 3FKSD 3VB4A 1GI3A 3LGUA 4B76A 1C5YB 3UIRA 3RMMH 1K1JA 1ABJH 3CP7A 1ZGIA 1O5GH 2ALVA 3QK1A 5IK2D 2Z9JA 4F55A 5DP7A 3KQ5A 1C5NH 1KXBA 1FLEE 2AMDA 2QYIA 4NSVA 4MNYA 1HGTH 3MNCA 2XBWA 2J98A 1RRKA 2PHBA 1D6WA 1Y8TA 2PR3A 2OC1A 1OHHD 3BTKE 4OS2A 4ISNA 4NA9H 4MPUA 1HIAB 3H7OA 3EA9A 3RUOA 1O3LA 4XRNA 1ZYOA 1F7ZA 1YPHE 1TNGA 1C4V2 2Z3DA 5EPNA 1LVMA 2IN2A 1P06A 2TRMA 3ZZ6A 3E16B 1K9OE 3ZVFA 1H9IE 2EY4C 3UOPA 4X1PU 4F4OC 2WV5A 1QRXA 2PW8H 1GJBB 1RD3B 3F9GA 1Y59T 2QIQA 4P02A 4TPYA 3ZZ5A 1SC8U 7LPRA 1TNLA 1CT4E 3OAAD 1LVYA 4IC6A 1FIWA 1ZSJA 3TLOA 3UNQA 3F0PA 3CS7A 3ESTA 4GSOA 3A89A 1W10U 3AASA 1AO5A 2CXVA 4OS6A 1L4DA 5CHBA 3CENA 1DITH 1BTXA 1ELVA 4B6EA 3TK6A 1OWKA 4MNXA 1VCPA 3MNSA 5KEDA 3SNDA 2NU1E 3T28A 1GI1A 1YGCH 1TGTA 5AF9H 1EQ9A 5C5NA 1QQUA 2J94A 4Y8XA 3GDSA 5L30H 2R0KA 2L6OA 2VVUA 2VGCC 4CREA 4DT4A 2SNWA 3U98H 1FY4A 2BDHA 1XUIA 2G52A 3GISB 4K2YA 1W0YH 1BDAA 1HAZB 1EPTA 1OYQA 5EG4A 1NTPA 4ZHAA 2Q1JA 1KMHB 8KME2 1HAYB 1Y3XA 1ELFA 2DUCA 2QF0A 1TE0A 5T6GA 4B1TA 2C90B 1A4WH 1NROH 3TGJE 1MCVA 2FI3E 2ZC9H 2OK5A 1NFYA 3MO6A 2ZA5A 2W7SA 4XFQA 1BBRK 3DHKH 3MWIU 4X8VH 1J9CH 2J98B 1T8NA 2F43B 1S0QA 1ZSLA 3SNEA 4I31A 1WAYB 5IYTA 3LGWA 3ATWA 3KIDU 2ZGHA 1BTZA 1T8OA 3QTOH 1KTSB 1FPHH 1O38A 3M5LA 4K60A 1RGQA 3QDZB 1WTGH 2XNIA 2HRVA 1K2I1 2D8WA 1UTQA 3RXUA 4IN2A 3DD2H 1MUEB 1C5OH 1DX5M 2FS9A 3RP2A 1PYTD 1V2QT 3ITIA 3U1JB 1O5AB 2ZF0H 5DK1A 3A82A 5SGAE 1GCDA 1Q2WA 3O8BA 5JB9S 1HJ9A 2EQNA 4YESB 3SW2B 1TONA 4WMEA 1FAKH 2Y6TA 3ZVAA 4ABFA 1OWEA 5EQSA 1HJAC 3LH1A 3O8RA 3Q3YA 4FETA 1HAXB 2STBE 3FZDA 1MBMA 3RXRA 1TPAE 4A92A 1HPGA 4FUIA 1VITH 4TY7A 3SU2A 2VIDA 2ZPQA 1O2LA 4FU9A 2G00A 4X2WA 1NC6A 2ODQA 1GL0E 1MZDA 3EE7A 4H42U 2PSXA 1GHBF 3U1IB 3K9XB 2W3IA 2Y81A 1N8OC 4X6PA 1MAXA 4ABEA 4Y79A 4GUXA 1TOCB 2ZG0H 4MLFB 1TGBA 2GX4A 1EZQA 2FYQA 2G5VA 2JETC 4Y7BA 1E38B 1O2PA 2BVRH 1Z8GA 1MBQA 1HJ8A 2OD3B 3MH4A 3RXAA 2P94A 5LPFA 3ODFA 1O2IA 1FDPA 2P59A 5DN6D 2HPQH 1YPEH 1ZHPA 1O2WA 3I29A 4H6SB 5E2OA 1O2RA 1UVPA 2PSYA 1GMHG 3KQBA 1C5WB 5CE1A 2BLWA 1GHBG 3Q77A 1IQEA 1MU8B 1E37B 1GI6A 3SGQE 1O5BB 5I46H 1GVZA 3MO3A 2OLGA 5TCCA 2BZ6H 4IMZA 1QJ7B 4O3TA 4WH6A 5DP5A 1CA0C 1OWJA 1EX3A 1P03A 4I8JA 2HLDD 3TNSA 4YOIA 3FZZA 1CHOG 2R3YA 2OINA 2HNTE 1QRWA 2TIOA 2WUBA 4LOYH 3BTGE 1B7XB 2FYRA 1OP8A 2D1JA 4AGJA 4ABAA 2KCYA 1FN8A 4X1SU 4K1EA 1DWEH 1Z1JA 1QL7A 2A0QB 1VJ9U 1AWHB 1GBEA 3ZVCA 1ETTH 3VB6A 1UTLM 3KCGH 1CVWH 4X2YA 5ABWA 1W0KD 1NRSH 1K1NA 4DOQA 3OX7U 5EQRA 3S0NA 1QL8A 2NU0E 2ZEBA 1MKXK 3ZZ8A 5CHAB 8ESTE 2BOHB 3TK5A 3UQOA 1E35B 1BMMH 1T31A 3RXTA 1O31A 1P12E 1T7CA 1DY9A 4U01A 2VWMA 3TPIZ 2XWAA 5E2PA 1TA2A 1EUFA 4U32A 1YLNA 2BQ7B 2K8IA 4WXVA 3BG4B 1OWDA 3VGCB 1O3MA 1ANEA 1FY3A 1GBLA 2A45B 5JDUB 6GCHG 1KXCA 2BLVA 1GDNA 3FAOA 2A4GA 2ZU5A 3HATH 1HXFH 1W11U 4J1YA 4R0IA 1ZOMA 3LJJA 3ZIAD 2ZDMA 4BAHB 3LKWA 3QO6A 1P09A 1YF4A 1CBWC 3FP7E 3LGYA 4ZROA 1T8MA 3MU4A 4Y0ZE 4ISHH 4NA7A 1W3CA 3QN7A 2R2MB 4NWKA 1KXFA 4NSYA 2BMGB 4H4FA 4OGXA 3RLWH 2FP7B 1EZXC 4SGBE 5FHTA 5C67A 1UK3A 2H5CA 2ZPSA 1GHWH 1D3TB 2BVXH 5HM9A 1LVBA 2J97A 1CQQA 2JH5D 1PPZA 1DANH 1O3FA 3STJA 3OE7D 3OY6U 3N7OA 3LDXH 4A7IB 1V2JT 1GBKA 3F2FA 1AUTC 2G8TA 3MH7A 2GDDA 5HIYA 4GHQA 1S83A 2LELA 1O3HA 2R2WU 2Y82A 1B0EA 1L1NA 1DICA 1GI5A 1QHRB 1N6XA 2ZDAH 2GKVE 1UTPA 3SI3H 5FL7D 3M7UA 3VPKA 4GCHG 3S69A 2F9PA 1L2EA 4R8TB 2STAE 1WQSA 2A7CA 2OQ5A 3EAJA 3SU1A 1QZ8A 1E34B 1MZAA 5I25A 2GV6A 1V2UT 3GY6A 4UFDH 3SU0A 4JZ1A 3VEQB 3D49H 3TJNA 2W7UA 1GL1A 1S6HA 3F68H 3A8CA 3HGPA 4Y11E 4YOJA 3LGVA 3T29A 5AFZH 3E8LA 1QTFA 1O3DA 1LCYA 1MTSA 3Q3KA 2IPQX 4M7GA 2A5KA 1SQAA 1UVTH 4Y71A 3IITA 1GBJA 1ZMNA 2GCHG 4Q2KA 2YNAA 3RMOH 1RJXB 1EAWA 1PQ5A 4ZHLU 3OEED 1KSNA 1A61H 1EKBB 4ESTE 1K0HA 2HVXA 1H8HD 3F2GA 4Q7ZA 2GZ7A 3QLPH 5C5OA 3P8OA 1QA0A 2GDEH 4HZHA 4JZFH 1CGIE 1TBZH 3RXVA 4B2BA 3MU5A 3DSOA 3WW7A 4FUHA 1W14U 2J95A 2FOGA 5F53A 1NRQH 1C2IA 3CNRA 3ZZ3A 2ZTYA 1CT2E 3F9FA 1BITA 2Z9IA 4JYTA 1MH0A 4X0WU 2A2XH 3F6UH 3SV8A 5JYIA 1FXYA 3A87A 2ANKH 1IHSH 2QGRA 1FNIA 1L1JA 1GI4A 2Z7FE 2I6SA 3PM3A 1Z8JB 2CN0H 3OYPA 1GJ4H 1EB1H 1D9IA 5FXLA 2P3UB 3I77A 1A2CH 4NIXA 3PYHA 4ZH8A 3BTWE 3BTEE 3S9CA 1LKBA 5GWZA 3U28C 2FOFA 4LK4A 1EAUA 1MCTA 9LPRA 3L3TA 3M7TA 3TIUA 1BCUH 2ZWLH 2R0LA 2C93B 1QIXB 3SV6A 3QZQA 2ZFQH 1G36A 1IQLA 3KQDA 1S85A 1IHTH 2JJ1D 1F5LA 3ELAH 1NT1A 1NO9H 3P70B 5JBBS 2QXGA 4CRAA 3MH6A 2ZI2H 1XUHA 3TK9A 4A6LA 4F48B 4AG1A 1HAVA 1YPLH 4AORA 4D7FA 4J2YB 3ZZCA 2BTCE 2P3TB 5EXMA 1PPFE 1C5ZB 3GOVB 3AW1A 1K1LA 4OGYA 5LH8A 2Y5FA 4Y8YA 1NY22 4B6FA 4KTUA 2FI5E 1ANBA 1MTUA 4MTBA 1DY8A 2ZTZA 3RC4A 3BTTE 2FOBA 1Y3YA 2F9OA 1PPCE 3U8OH 1C5VA 1UCYK
chains in the Genus database with same CATH topology
1F0UA 3AW0A 4IGDA 1AE8H 1ZLRA 2GT7A 3RXCA 1AB9C 5EODA 4ABBA 5JPMH 1Y3VA 2XBYA 1DLKB 5FX5A 1V2NT 4ZMAH 3SGBE 3PLKA 1SVPA 5A0CA 1A46H 3RXEA 3QGNB 2XW9A 1QCPA 4BTUB 2H9HA 3SGAE 1ZJKA 3LGIA 2PTCE 2ZGBH 4MNWA 1OP2A 1XXFA 1CU1A 2QXJA 1TNKA 3ZZ9A 1NZQH 3NXPA 2ZGJA 1BTPA 1A5GH 1P2OA 3LU9B 2AGIX 3LJOA 3ZV8A 5DJ7A 1BHXF 4IBLH 1V2MT 3QWCH 3GYMA 2UUJB 3VB7A 3E6PH 2TPIZ 1PPBH 1Y3UA 1BA8B 1TWXB 3SHAH 1QL9A 1S5SA 1PQ8A 1SR5C 4K1SA 2TGAA 3RXHA 4DIIH 1YP9A 1EPTC 1GMCF 4TYDA 3HK3B 3ODDA 4BAOB 3PB1E 3SJIA 1ABIH 5J4SA 1EASA 1GI0A 2VVCA 1MTNB 2WYGA 4INKA 1ZMJA 2ZFSA 3DA9B 3EYDA 5EQQA 5LPEA 3SBKA 2GT8A 1C2MA 2JH0D 1ESBA 2R3UA 2IPHA 3ATLA 1ZRBA 1P57B 5GDSH 5FAHA 3UFAA 1HAVB 3CS0A 1DSUA 3F9EA 3T25A 3RXBA 1LMWB 1Z71A 1K1OA 5L2ZH 1SLWB 2BQ6B 1UVOA 1VITG 3MHWU 1YKTA 2B5TB 2Y7ZA 3HGNA 5DPAA 1MD8A 1QNJA 1EOLA 5C1YA 3SV7A 4E7NA 7GCHF 3GDVA 1C2JA 1NRRH 1AFQC 2SGFE 2AFQB 3P6ZB 2F91A 3SN8A 1SGIB 1SLUB 2ZIQH 1PJPA 4ABHA 3GCTF 4ABGA 3RMLH 1C1UH 4H6TA 2WINI 1H9LB 4CHAB 1C1VH 1TA6A 1J16A 2VIVA 1P2JA 3GDUA 2FMJA 2CV3A 3BTFE 2NWNA 3UUZA 3A7XA 4XBDA 1SGTA 3VGCC 2ZFPH 1THPB 4TWWA 2WPJS 2UUYA 1VR1H 1MQ6A 3KHVA 5DP3A 1VGCB 2RA0A 1F5KU 1AKSA 1KLTA 4DURA 3K6YA 1J17T 4CRGA 1XVOA 2XCNA 1Z6JH 1IAUA 3A81A 1SOZA 1ETRH 2OC0A 3GCTG 1IQKA 2P93A 1ZTKA 2PTNA 4JZIA 2JH6D 3D65E 4ZHMU 1HAGE 2Z9LA 5DKMA 3TJUA 1H1BA 1OKXA 2FPZA 3P8FA 1GBBA 1F0SA 1P0SH 3MYWA 2HWLB 1GJDB 3WY8A 8LPRA 3GCHB 1O2NA 1H8DH 4ZKNU 1GWAA 1O0DH 5ESTE 1DE7H 1BBRE 4FUFA 1LPKB 1G3DA 1TX8A 1K1MA 2G5NA 3I78A 8GCHF 4MQAA 1AUJA 4WMDA 1UK4A 1K21H 1NESE 1K22H 2NU4E 2ZU3A 6CHAC 3TH4H 1ACBE 2QXIA 2R9PA 1O32A 4VGCB 1QB9A 1EP6A 1FY5A 4A5TS 1P8VC 4XDEA 1O2SA 1GBDA 1DXPA 1GJ8B 1MKWH 1GJAB 1CT0E 4FVBA 2OP9A 2Z94A 1O3KA 1ELBA 1DFPA 2BDGA 1TALA 1GMDF 1TRMA 8GCHG 2EC9H 1HCGA 1Q31A 1AY6H 2FI4E 1VZQH 4CH2B 1KYNA 2AEIH 2AMPA 3SJKA 1O3CA 1EJNA 4I32A 1SGQE 4FUBA 3NWUA 1KXDA 2FESH 2Z9KA 1A0HB 1LHDH 1WCZA 3BTQE 5C3NA 3L33A 3R0FA 1XUGA 1LHFH 2BVSH 4X1RU 3PTNA 1Z6EA 3MO9A 3SUFA 1ZZZA 3TITA 2VVVA 3M3SA 2BXTH 5B6OA 1KXAA 2DE9A 3QTVH 1EP5A 1O34A 3OSYA 1C5UA 3UR9A 1O3IA 1AKSB 1C5SA 1QA7A 2BD8A 3RXPA 4GAWA 4D7GA 1GBAA 1EB2A 4BAKB 3RXGA 1BMLA 1EOJA 4CR5A 1GHYH 4TWYA 1WUNH 3ZV9A 1A3BH 5A8ZA 1SHHB 1HLTH 1FIZA 1SBWA 1W13U 1PYTC 2BY6X 3HK6B 1LHGH 4THNH 2VNTA 1EJAA 2CHAB 5T3HA 1SGNE 1SGFG 2FOEA 3SJOA 1O39A 3GY8A 2AIPA 1O2YA 4XE4A 2PKSB 2GMTC 4DVAU 1GJ9B 2A4QA 3MNXA 4Y10E 3H7TA 4IC5A 2XWBI 3ZVDA 1JMOH 4ZAEA 2ZDLA 3LONA 4DW2U 3ZYDA 3E90B 1F5RA 2GTBA 2O8MA 1ARBA 2SGAA 5A8YA 4YO9A 1O2HA 2BLOA 1SOTA 4GLYA 2AH4X 1O2OA 2HOBA 3TU7H 2BZAA 1O2ZA 4OS7A 1TABE 1DWCH 4IMQA 5PTPA 1VCQA 1PPGE 3TGKE 1YPGH 2QAAA 3T62A 1TPSA 1M9UA 1TAWA 2GCTB 4D9QA 4INLA 2B7DH 2C8YB 3RU4D 2BDYA 1SGCA 1TQ0B 1C2EA 1ELTA 3BTHE 2HGTH 1C2HA 2P3FH 1NU7B 3URDA 4KKDA 1A0JA 2TBSA 1THSH 3AAVA 3PO1B 4YT6H 5FCRA 2ANWA 4AB8A 2UWLA 1XXDA 1T4VH 2DE8A 1L4ZA 4JMYA 2QXHA 5JBTA 5FPYA 4O3UA 1ZTJA 1NFWA 2BY5X 4NZLA 5DGJA 2FX6A 2NU2E 3SV9A 5EXLA 1S84A 4HI3A 1O2XA 1P05A 3SU5A 4NGAH 5A2MH 3SJ8A 3U69H 2H5DA 1GI9B 1SMFE 1S6FA 4B2AA 4AB9A 2PUXB 1QBVH 1FN6A 2A1DB 2A4RA 3SQHE 1J8AA 1CHGA 1RIWC 4JCNA 1QY6A 2B9LA 1E36B 1ANCA 1O5DH 1GJCB 5JBAS 4WJG2 4X2XA 1C9PA 1DPOA 4BANB 2PGBB 1G9IE 2FOMB 1C4U2 2EEKA 1Y3WA 3RXDA 2D2DA 1YPHC 3BN9A 2LPRA 3TGIE 1GVKB 1BBRH 2ASUB 1NFXA 4ABJA 3P17H 4A1TA 3LIWA 4B71A 3HKIB 3A84A 3P92A 3ZZBA 4KGAA 3DT0H 3RXQA 3S9AA 3URCA 3BG8A 4Q7XA 2F3CE 1TB6H 1GCTB 2OXSA 4ISOA 3SUGA 1AD8H 1DUEA 2SGQE 3UNSA 1OWIA 4IW4E 4E7RG 1UO6A 1DS2E 1TPOA 3E1XB 1GGDC 1WTHD 3SNAA 2FTLE 2O8WA 3M61U 2ZZUH 1TMBH 1OOKB 1BQYA 1HV7A 2VU8E 3Q00A 2WPHS 1DUAA 1HRTH 2BDAA 1TNHA 2GVFA 1MTVA 4Y76A 4DJZB 1WQVH 1UTKA 3PTBA 4O97A 1MU6B 2VJ1A 4MNVA 4NZQA 2OCVB 1SQOA 6ESTA 2QV1A 3IG6B 1GBHA 1KTTB 2UWOA 3K2UA 3KGPA 2Y5HA 4AZ2B 1C2LA 4UE7H 1XUFA 2VGCB 2KAIA 3KNXA 1F0TA 1O3EA 1UHBA 3ZZ4A 4CR9A 3VFEA 3M5NA 5A0AE 1FONA 1EJMA 2FIRH 3M36A 4LXBH 2HALA 2ANMH 3MU0A 5H4IB 4CHAC 1GBCA 3DFLA 1TGCA 3BSQA 1BTYA 1AMHA 2BDBA 1P2KA 2ZECA 3GY4A 3RLYH 2UUFB 1BJVA 1YCPM 3LPRA 1D3PB 3W95A 1QBNA 1AI8H 4PROA 1AFEH 3TJVA 2BLQA 3PLBA 1C4Y2 5EU8A 3EA7A 4WMFA 3JZ1B 3HKJB 4CRDA 1HAOH 1UK2A 5G4BA 3UR6A 3RXKA 2PKAB 4NIYA 3MU8A 2BX4A 3NUMA 1NFUA 1SGYE 2ZNKH 1YPKH 1G30B 2A2QH 3V7TA 1LO6A 1KY9A 2ZDVH 1V2RT 4DGJA 1BMAA 1JOUB 2BHGA 1SGPE 3VXFH 2G55A 2ZCLP 1G37A 1P11E 1X7AC 3GY3A 3U9AH 2O8UA 5T6DA 1O2VA 1YCPK 1NM6A 1V2OT 2H9EH 4MPVA 3OTJE 2C8ZB 5FPSA 1WBGB 4BXSA 2XXLA 1BHXB 2ZPRA 1MKXH 1XKBC 4OS1A 1GDQA 5DP8A 4MPWA 2TGPZ 4YZUA 5C1UA 4BXWA 1EZSC 1N8OB 1F2SE 2PV9B 4A1VA 2GP9B 4YLQH 2TGTA 1GI7B 4GVUA 2RDLA 2B0FA 3A8BA 4CRBA 1O2TA 4RSPA 4ASHA 3M3VA 1W8BH 1C1MA 1QJ6B 2ZQ2A 2V0BA 2JETB 2KAIB 1Y5AT 4ISLA 1TNIA 2FX4A 4OS4A 3GICB 2BY8X 1UHBB 3PWCA 1XVMA 1QRZA 2XBXA 1T8LA 1MAYA 4XSKU 4X1QU 1IQHA 1OWHA 2A4OA 1B5GH 1FJSA 1AVXA 5GXPA 1XUJA 1QGFA 1RS0A 5EGMA 3RDZA 1IQFA 1H8IH 1SI5H 2ZP0H 5F8TA 1Z8RA 1C5QA 1DDJA 1IQMA 1GHVH 3ZZ7A 4K8BA 2BD5A 1SL3A 2HNTC 2P8OB 1LPZB 3B9FH 4SGAE 5C20A 2A7HA 4BNRA 1AZ8A 4ZKOU 1YPMH 3NK8A 1Z8IB 1ESAA 2OUAA 3BF6H 3EA8A 2CHAC 5TJXA 3RXJA 1SLXB 1C1TA 1SGFA 1FMGA 1UTMA 3SQEE 2D26C 5FCKA 4AG2A 1AE5A 3ATKA 4X8UH 1O3BA 1PPEE 1V6DA 2Y80A 2ZDNA 4CBNA 2G81E 3UOUA 1WV7H 2THFB 3KF2A 1O2JA 1W2KH 3RC6A 2ZU2A 3A80A 2F9BH 5ESBA 3TVJB 3PMHB 3RMNH 5AFYH 1FAXA 1QB6A 3SU4A 1O5CB 3D62A 1C2DA 1TPPA 1GHAF 5E0JA 4CBOA 1BMNH 4I33A 3S9BA 1D3QB 1FZZA 1ORFA 1T4UH 4NG9H 1RXPA 1TGSZ 1OP0A 2VWOA 1H4WA 1IQNA 1HYLA 3NCLA 5GCHF 1BUIA 1C2KA 2H6MA 5L6NH 1P10A 5T6FA 5L2YH 1AHTH 1P02A 4F49A 1ELGA 5HM2A 3RU4E 1SFQB 1DXWA 4HTCH 3UY9A 3RXIA 5HYOA 1Z7KA 3EGKH 1YYY1 4WVPE 3GY2A 3BIUH 1ARCA 4AFQA 1UTOA 1K1IA 1DOJA 1GMCG 2QA9E 4B73A 6LPRA 1O3PB 3MTYA 5ETXA 1AVWA 3M5OA 3H5CB 3GCOA 2J34A 3PROA 1MD7A 3EQ0H 1O3JA 2BD4A 1LQDB 4Y8ZA 4MDSA 4JZDH 2GD4B 4KTCA 1NU9A 2W26A 1O35A 1YCPH 4X8TH 4D9RA 3M35A 5CHAC 2QN5T 2RCEA 4DIHH 1ZMLA 1ZJDA 1P9UA 1GHXH 1O37A 1TMTH 3ATMA 4IN1A 3UNRA 2ZU4A 3K6ZA 4JZEH 4LZ4B 2Z3CA 1BZXE 3RXLA 1DT2A 2WPMS 4ZKRU 1P2QA 1A7SA 1GBMA 1ESTA 2FZZA 3SI4H 1V2TT 1FI8A 2O8LA 5TCAA 4DG4A 3BG4C 2SNVA 2BY9X 2H9TH 3HPTB 3M37A 5A8XA 3OY5U 4WY3A 1SG8B 2CF8H 7GCHG 2XC0A 2BD7A 1GBIA 1P3CA 1A1RA 1TMUH 1U6QA 4D8NA 1O3OA 2VINA 1P01A 1LPGB 1K1PA 1EXFA 2FTMA 2V3OH 2OTVA 2ZU1A 1KIGH 5DO4H 3LC5A 4X2VA 5FBIA 3MH5A 5C1XA 1THRH 2A31A 5E0HA 1S82A 3FANA 4ABIA 2ZHDA 4A1XA 2PGQB 2VIOA 4UFFH 3BEFB 1O5EH 2TGDA 1RFNA 3A8AA 2HLCA 1GCTC 1EATA 2LNCA 4NIVA 1UCYH 4AYYB 1A0LA 2ZHEH 2CJIA 2J9NA 4FUCA 1MTWA 2J4IA 3UTUH 3T26A 2W3KA 4IS5A 1SPJA 1XX9A 2C8XB 1ELCA 3SV2H 3PMAB 4ZKSU 3ZVBA 3A83A 3E3TA 5F8ZA 1BT7A 3E0NB 3KQEA 2AMQA 2ESTE 2IOTA 2QC2A 1HNEE 3T27A 2XC4A 3FP6E 2VB0A 2BY7X 5E8EH 1UVSH 1T32A 2ZHWH 3G01A 3SU3A 3TJOA 1JBUH 3RXFA 1XKAC 3NZIA 1TX6A 4MVNA 3SO3A 4YOGA 1ZHMA 1GPZA 2XRCA 4D76A 1O36A 4UEHH 2OBOA 2SGPE 4I7YH 1QR3E 3MNBA 4Z6AH 3ATIA 2YNBA 4JK5A 5F03A 1C1WH 1WYKA 4DT7B 1C1NA 1G3CA 1V3XA 4B2CA 1LKAA 4U2WA 3RXMA 1BJUA 2ZCHP 1OSSA 3S7HB 5LGOA 1W12U 1BRAA 1OPHB 1Y5BT 1P2IA 2F83A 2XYAA 4DCDA 4XBBA 2GV7A 1C5TA 2UUKB 2ZFRH 4BOHA 2SGEE 1GJ5H 1JRTA 3A85A 1GMDG 3T5FH 5C2ZA 4AX9H 1HAIH 4I8GA 1V2PT 4I8HA 3UPEA 3A7ZA 2ZQ1A 2OQUA 2ZHFH 3NKKA 4B74A 3VB3A 5A09A 3PMBB 1AB9B 4O03A 5JB8S 1HAPH 4KELA 3RM0H 3A7WA 5EXNA 4X6NA 3KN2A 4DY7B 1MMJN 2A7JA 1RTKA 2P16A 3LT3A 4KP0A 1NS3A 4LZ1H 1ELEE 1SFIA 5DP4A 2VWNA 2SFAA 3V12A 1AGJA 1RTLA 2XC5A 2XCFA 4O9VA 4XOJA 1KXEA 2FODA 5EW2H 2BDIA 1BRCE 1LTOA 2Y7XA 1HFDA 2VIWA 3DUXH 1DWBH 1C1QA 3SHCH 1W7GH 1WOFA 2F9VA 4UONA 2FOAA 1NN6A 3LH3A 1GMHF 2VH0A 1CO7E 5K7RA 3UQVA 2ODYB 2A5AA 1YLCA 2B8OH 5DP6A 4K5ZA 3V3MA 1KLJH 3E0PB 5FPTA 1QBOA 1TLDA 4TPIZ 1JIMA 1Q3XA 3SNBA 3Q3XA 3M3TA 1ZGVA 1O5FH 2GZ8A 2BOKA 2SGDE 4ZXYH 1GJ7B 3M5MA 3BV9B 3MOCA 5AVDA 5IDKA 3A7TA 1LDTT 4JYUH 2WPLS 3IWMA 2M5TA 1CHOF 2ODPA 3U8TH 1AU8A 4AFZA 3GY7A 1O3NA 4AFUA 1C1SA 4FVDA 1EPTB 2WYJA 2Q6FA 4MPXA 1ANDA 1L1GA 2ZGCA 1UTNA 1TFXA 2AS9A 4NFFA 1L0ZA 4UD9H 1GG6B 1OXGA