1P09A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A01
3E6PH 4J2YB 1BJUA 2HNTC 4CRGA 1OYTH 1IQGA 3KHVA 3MU0A 2GMTB 1HAVA 2PWXA 2FOMB 4INLA 3OTJE 3TGIE 1L4DA 1GI0A 1ACBE 1H9HE 2B8OH 1AI8H 3ZZBA 3QWCH 4DGJA 1UTOA 4FU8A 2HWLB 1K9OE 1VITH 4AG2A 1UVUH 3ZZ6A 2VIQA 1RRKA 2CHAC 2F9PA 3MO3A 3MYWA 1C5SA 3P6ZB 1BRCE 2TIOA 2GDDA 1C5VA 1JBUH 4JZDH 3AAUA 4XSKU 1C5RA 1DY9A 2ZI2H 3UWIA 4CHAC 1VITG 3URCA 1FQ3A 2ZECA 5JBCS 3SGAE 4X8TH 3RXPA 2FTLE 1PQAA 4NA9H 4TY6A 3Q3YA 5L30H 1DPOA 5FCKA 1AUJA 1MTUA 1GBCA 2H5DA 4OS2A 4JZEH 1HLTH 1BT7A 4IBLH 2SNWA 4FUFA 3BF6H 1WTHD 1ABIH 3BTFE 3P8OA 3F9GA 3ZV8A 1UJ1A 4X1QU 1G37A 3R3GB 3T5FH 1TA2A 4XBCA 1NU7B 1GI2A 1H8DH 1P09A 4DT7B 2Q6GA 2AS9A 1ZHRA 3P8NA 5DK1A 1ARBA 1AUTC 5JBAS 1BRUP 1O2XA 1K1OA 1QIXB 2WYGA 1C1RA 1NFUA 3MNXA 2DE9A 1AGJA 3T29A 2ODYB 1N8OB 4A1XA 1BUIA 1AHTH 5FAHA 1BMMH 1TOCB 1JRTA 3ATKA 2ZDMA 1QGFA 1TGTA 4JMYA 4AYVB 3GYMA 2EEKA 2VNTA 1INCA 1NO9H 1O32A 3SN8A 1BBRK 1HXEH 1QRZA 3RU4D 5FPYA 1VZQH 2A4RA 2FWWA 1S81A 5A0AE 2IN2A 3GY3A 2ZFSA 2BVRH 1BTUA 1MAYA 2A5KA 2A45B 5DKMA 2JKHA 2ZU4A 3M5LA 2QIQA 1LDTT 3UQVA 1ZPBA 1O3KA 3GY7A 3JZ1B 4UFEH 1WQVH 3MHWU 3QK1A 3MTYA 1ZGVA 3PO1B 3RXSA 3P92A 1TBQH 2PSYA 2GDEH 4LOYH 4TYDA 1KIGH 1N1LA 3PWCA 1A7SA 1UK2A 1WAYB 1Y3WA 1GDNA 2YOLA 1DOJA 2PTNA 1FUJA 2D1JA 4KGAA 3QO6A 2ZHEH 1B0FA 1Y5BT 3RMLH 1O2KA 1A0HB 1PYTC 1GGDC 4B1TA 1IQIA 3E3TA 3GY5A 1C2DA 1SL3A 4NIXA 1OPHB 1BMLA 1P2JA 6CHAC 4MG3A 3SGBE 5GJ4B 4PROA 4HTCH 2P3UB 4ABFA 3BIUH 1NM6A 2NU1E 1QJ7B 1ZMJA 1FN8A 2VWOA 2TGTA 1C2FA 1DITH 1QR3E 2XBYA 2VVCA 3SUFA 1C9TA 2ZQ2A 3KQDA 4CH8B 1GMDG 1P10A 4BTIB 4AORA 1JIMA 1TX7A 1YPGH 2NWNA 2C4FH 1YP9A 1NN6A 2O9QA 2J95A 1AVXA 3DA9B 1YF4A 1EPTA 1A4WH 1TONA 3PMJA 1O3BA 2HPQH 1SHHB 1THSH 3RXIA 4BAMB 2A4GA 2D2DA 1A5IA 1ZPCA 1FZZA 1SVPA 3ZZ9A 1HAYB 2P95A 4YOJA 3ZZ5A 1A0LA 5E2OA 1GI1A 1C1QA 2GCTB 3GICB 1HYLA 3MWIU 1WV7H 1TNIA 1SI5H 3SUEA 4BAQB 2UWPA 1O2ZA 1HNEE 1MQ5A 2GCHG 1W2KH 3M5MA 3MO6A 4YTAA 2BLQA 1QB1A 2RG3A 2BXTH 3BG8A 2G4UA 2G00A 1RTFB 2O8MA 2GKVE 1OSSA 1T8LA 1CSOE 1ZMLA 2PW8H 2R9PA 4X6NA 1SR5C 1IQMA 4WY3A 1MQ6A 1DSUA 1P2KA 1YPHC 1EATA 4MPUA 5LPFA 2A31A 2OCVB 1TBZH 1NTPA 5PTPA 4CBNA 2PHBA 1ELDE 2OBOA 1GBEA 4IW4E 3HATH 1UVTH 2PGBB 2BQWB 3QZRA 1AE8H 1L0ZA 1KXFA 3RXLA 1GJ4H 2PKAB 1AZZA 2VIPA 4ZXYH 1IQFA 4JK6A 1FIWA 1QY6A 3SU6A 1J15A 2G4TA 3F9HA 3LU9B 1MTSA 2TGAA 1ELTA 1BMAA 1GJDB 4ZKSU 1GG6C 4BTUB 1YLCA 3AVZA 1P05A 4K60A 1P06A 3TIUA 5HMAA 3ZZ7A 1N6YA 5IDKA 2BB4A 2UUJB 3U8RH 2FDAA 2FYRA 1UO6A 5AFYH 2F9VA 1HDTH 4CREA 2OC7A 1C5OH 1Y5UT 3LOXA 5EODA 2GZ8A 1YCPH 5FPSA 1Z71A 2HNTF 4NIYA 1BMNH 1OKXA 1BRBE 2TGPZ 5DO4H 1Q31A 3OY6U 5BRRE 1HPGA 3EA8A 1AFQC 2BOKA 4GAWA 1DE7H 1Y5AT 3VXEH 1GHAG 1HGTH 1ZTJA 2FX6A 2VIDA 3TLOA 2FPZA 2BQ6B 3BSQA 2ZTZA 1ZJDA 4B74A 5DP6A 1QA7A 2G52A 2ZHQH 4U01A 4ZH8A 3NKKA 4FUEA 5EXLA 3E91A 1Y3YA 4XOJA 2FZZA 2A7JA 4B73A 3OY5U 3SJKA 4F4OC 1EP6A 4O03A 1MKWK 2OC8A 2Y6TA 4UEHH 4X1SU 2A2XH 1F2SE 2FEQH 2ZF0H 3BTGE 3H5CB 2BDHA 3NUMA 3QN7A 3TK9A 1DM4B 1OP8A 3LT3A 2ZPQA 1A0JA 2BDGA 1OP2A 1AY6H 1TX6A 1NRQH 3SNDA 1GJ5H 2BTCE 2ZGCA 4TY7A 3MNCA 1A1RA 3RXMA 1PQ8A 1RXPA 3U9AH 5AF9H 2FODA 4JYTA 2ULLA 4NG9H 3I29A 5JBTA 1UK4A 4JZ1A 1E34B 2VU8E 1P9UA 1CA8B 1DWCH 3W95A 1V2MT 2WPMS 1DSTA 1K28D 4GPGA 1P02A 3BTEE 1T4VH 3UR6A 4ZHLU 2EC9H 1C1UH 1SLXB 1GL0E 1MTNC 2FI4E 1QQUA 2BY9X 2BXUH 3U1JB 2Q1JA 5E0HA 3VXFH 2CHAB 1YYY1 2Y7ZA 1P3CA 4BANB 5FPTA 1C1OA 2LPRA 5HGGA 3SJIA 2FIRH 1ID5H 5EG4A 1C1WH 1C1NA 1ZHMA 2RCEA 2WPJS 4CHAB 3URDA 5A0BA 1TE0A 1ZTKA 5FCRA 4AG1A 2FX4A 4NIWA 2J38A 2RA0A 1UHBB 1B7XB 3EQ0H 3LIWA 4AFUA 4X1NU 3O8BA 2GCTC 1ELBA 1EZXC 2FOCA 1JMOH 2GZ7A 1GJAB 1UTKA 3OYPA 2PUXB 4GCHF 4INKA 1C5MD 3I78A 9LPRA 3MU4A 1LKAA 1BITA 1QL8A 3SNCA 1BCUH 1GBTA 5F8TA 2OD3B 3QZQA 2HNTE 2TRMA 2BD3A 1DXPA 1L1JA 8GCHF 3DHKH 5G4BA 1RGQA 5EXNA 1KSNA 1VITF 2WPHS 5E0JA 1O5BB 4ABIA 1XVMA 3B9FH 1VJ9U 5JB9S 1RFNA 5GIBA 4Q7YA 3WY8A 1EZQA 1SG8B 2YNAA 3FZZA 4Y10E 4MVNA 3QTVH 3EYDA 2V35A 1P12E 1MU8B 2VINA 4H6TA 4YO9A 1FAXA 2ZP0H 1E0FD 2BD4A 2SGAA 1K21H 6LPRA 2B9LA 1OWEA 1ANCA 2QGRA 3HPTB 5F6MA 4NIVA 1RJXB 4TWWA 1EPTC 2QXGA 4FVBA 4CRCA 1X7AC 4BOHA 2BZAA 1YC0A 3RXOA 3TNSA 1TGNA 2IJOB 4NFEA 1O38A 5JB8S 4WMFA 1HB0B 2WPIS 1O2IA 1TMUH 2OC1A 3GOVB 2Z7FE 3SI4H 1KTSB 1LPZB 1ARCA 1O31A 4I8JA 1ZSKA 1QCPA 3U8TH 4ABGA 1NFWA 5AFZH 4WMEA 3TJUA 3BEIB 1GJ7B 3RMOH 2BLWA 1TBRH 3UNRA 1O3NA 2H6MA 1C5NH 3RU4E 1CHOF 1O3GA 3U1IB 3EAJA 2I6SA 4Z6AH 2GD4B 4U30A 2ZHDA 1K1NA 4THNH 1HAGE 2SGEE 5AHGH 4FUJA 3UOUA 1TQ0B 1Y3XA 1GGDB 4LXBH 4KP0A 3LDXH 3A7YA 1AN1E 1C5WB 3FP6E 4E7NA 5EGMA 1DLKB 1PFXC 1ZSLA 4ZUHA 1KY9A 2P93A 2XYAA 1HAIH 1TPSA 1XUKA 3VB5A 4ABHA 3ZVFA 3T26A 1FDPA 1IHSH 1SPJA 5A09A 5JYIA 1GJBB 1P0SH 2OUAA 1W11U 1AVGH 1D4PB 3H7TA 4YM9A 2Z9JA 1H9LB 1D3QB 2AFQB 1T8NA 1CGJE 1GHBG 1XUGA 3A86A 2G55A 1DUAA 1ZPZA 1HJAC 4K8BA 1IQLA 1W0YH 3RMMH 2EI8A 4FUGA 3TVJB 3A7VA 1W14U 3ATIA 4K2YA 2ZDVH 5C2ZA 1S84A 2Y82A 1ZR0A 3KQCA 1O2YA 1UK3A 1SGEE 3PLPA 3Q00A 4AN7A 1C2GA 5DP5A 1EXFA 4NZQA 1O34A 2OP9A 4A5TS 2AGIX 1ELAA 1TABE 2QF3A 3ZZ4A 5DP4A 1BTYA 3KGPA 2STBE 3M7QA 1EAWA 2H2ZA 4FUIA 4WH6A 3LGYA 4DOQA 2GGVB 1FLEE 2BDYA 1BBRH 2NU3E 3AW1A 4I32A 5C1UA 3PMBB 1O30A 2VH0A 2SGDE 2ZPRA 3S7KB 4OS1A 2GT8A 5T3HA 1O2NA 1V2RT 1TFXA 2AEIH 1FAKH 1OYQA 3P70B 2TGDA 3SNEA 3GDSA 2ZGHA 3PYHA 4MPVA 1AQ7A 2QXJA 2VWMA 3TH4H 1XM1A 2OQ5A 3BN9A 3E8LA 2B0FA 4X6OA 4NGAH 1EUFA 1KYNA 3RXEA 3TITA 4DCDA 4D7GA 1E38B 3U69H 4YESB 2QV1A 3GCHC 2Z3DA 1VR1H 3SI3H 3RDZA 2ZFQH 2GCHF 5C5NA 3SO3A 1O2PA 3A88A 3EE0B 1RIWB 2ZPSA 2Y5GA 1C1VH 1EZSC 2A7CA 1SGQE 2PLXA 1LHFH 2ODPA 2P3TB 1SC8U 3QX5H 1HV7A 2VIWA 1L2EA 5HM9A 1MMJN 1GG6B 1DWDH 2UUFB 1O2RA 1C5UA 5LGOA 4WVPE 1TMBH 3RLWH 1Y59T 2HOBA 3SJ8A 4CRBA 5EU8A 3TPIZ 1TA6A 2B5TB 3RXFA 1N6XA 3D65E 1HAVB 4ZROA 3RM0H 1IQHA 1V3XA 3ZVDA 2XCNA 2ZKSA 1XVOA 3BV9B 1UCYE 3Q3KA 3RXDA 1L1NA 3SV9A 3A7TA 3BIVH 3MOCA 2Z9KA 3VFEA 1YPHE 2G51A 1CA0C 5I25A 3SOSA 1CQQA 2ZCLP 5EW2H 1CT0E 1AFQB 4DVAU 2XBVA 1LPKB 1KLTA 1QRXA 1SGTA 1HIAA 1SMFE 3SU0A 4AFZA 3ATWA 1SGYE 1P11E 1ESTA 3IITA 1P57B 1GI4A 3SGQE 1ORFA 1E37B 1QB6A 2VB0A 3M5NA 3P95A 1C1SA 1FY8E 2BVXH 2ZFPH 2J9NA 1SQOA 2BX4A 3GY2A 4IC6A 1XUIA 4X8SH 2FESH 3R0FA 3B8JA 5DPAA 4DURA 7GCHF 3GY6A 2XNIA 3K65B 3TJNA 4CRAA 3FAOA 1AB9C 4BAHB 3EGKH 1B5GH 2R0KA 4RN6A 1EP5A 1MD8A 1GPZA 5LPEA 4A6LA 2UWOA 3K6YA 1VGCC 5E0GA 1LQEA 3E0NB 3Q3XA 1SQTA 1GHAF 1V2WT 3UNSA 4BTTB 4XBBA 4ISHH 4DIHH 4X2VA 4UONA 4YZUA 2ZFFH 5BPEA 1BRAA 3GCNA 4SGBE 2JETC 1PPZA 1C9PA 2FOGA 1S85A 4Y7BA 4YT6H 3DD2H 3MU1A 1Z8RA 1T31A 1NY22 4LZ4B 1AMHA 1BQYA 1JWTA 1V2ST 4MNYA 3LPRA 4B2CA 1DY8A 3SUDA 2J4IA 1GBIA 3TGJE 2AYWA 1LPGB 1MTNB 3PWBA 5GCHF 1ZRKA 1TRMA 1DDJA 3UREA 5C3NA 3MH6A 4Q80A 1GDUA 1SGCA 1Z1IA 1LHGH 7LPRA 1TOMH 4B76A 1O3CA 3MI4A 2EI6A 3T27A 2WUBA 1TLDA 3U98H 2AMQA 2XBWA 1NRRH 1AWHB 2BY7X 2QA9E 2IPHA 1EX3A 1YPMH 1H8IH 3KQBA 1MU6B 2FI3E 1PQ7A 2PGQB 3LJOA 1GJ9B 3UR9A 1ANBA 4INHA 4Q7XA 4FU7A 4D7FA 1NRPH 1QJ6B 4AB8A 1MUEB 1O2WA 1TGSZ 2ZFRH 1EQ9A 3O8DA 4I8KA 1LQDB 2FMJA 3JZ2B 3RC5A 2V6NA 2BY5X 3RU4T 4I8LA 3SUGA 3V12A 1WBGB 1UCYK 5DG6A 3SU3A 2H9TH 5EQQA 1WCZA 3HK6B 1GBJA 1MKXK 1Q3XA 3RXJA 1GMCF 5CMXH 4AFSA 4CR9A 3A87A 2XTTB 3TH2H 2ZU5A 3HK3B 3QUMP 3ELAH 4I31A 2FOBA 4MNWA 3UUZA 3KQEA 2OINA 1MKWH 5DGJA 1O3IA 3EA7A 3RXTA 2BD2A 4ZXXH 1FN6A 3CP7A 3M35A 1GJ8B 3NPSA 3ITIA 3C1KA 3SV8A 2BZ6H 1GCTC 1V2VT 2ZU2A 1ZGIA 1BDAA 2F83A 1K1JA 4XDEA 1E36B 1K22H 1GMHF 1UMAH 3KIDU 3SJ9A 1AWFH 1RIWC 1SOTA 1SQAA 2C93B 1DVAH 1EZUC 1Z8IB 1C2EA 3U8OH 1GBAA 2W26A 3S9BA 3P8GA 1EPTB 2GTBA 2VWLA 1GVZA 1D6RA 1C2HA 4LZ1H 1J8AA 2WINI 1J16A 8LPRA 4AGKA 1P2QA 4NSVA 3C27B 4X1RU 2P8OC 2FOAA 1O2LA 3P17H 3UWJH 2HPPH 5DP9A 1AFEH 3D62A 4WJG2 1KXAA 1FI8A 3NWUA 5FX6A 3ZVEA 1QQ4A 2C8ZB 3G01A 1H9IE 3DFLA 1EJNA 1KDQA 1ZJKA 5JDUB 4CRDA 3BTWE 1EOLA 3ZVAA 3RXRA 1G2LA 4J1YA 1HFDA 2QXIA 4RSPA 1NFXA 4DG4A 1P04A 4H4FA 1EKBB 3PMHB 1ELFA 1G36A 4IN1A 3S9CA 2ZG0H 3VPKA 1A2CH 2I6QA 1O5GH 4IS5A 1GI8B 3VB7A 4Y8XA 5I46H 3VB4A 2CJIA 1QBVH 1GI6A 1TALA 3D49H 5F8ZA 4O9VA 4Y71A 5E8EH 1ZMNA 5A8XA 1AVWA 4WWYA 4X2WA 2A1DB 5IYTA 3KL6A 3ZZ8A 4MQAA 4E7RG 1LHCH 2A32A 3NZIA 2A7HA 1DUEA 3E16B 1A3EH 1SOZA 1ZHPA 2FTMA 1PPFE 2PFEA 1HJAB 3KCGH 4IC5A 3SU5A 2ZEBA 3VB3A 2M5TA 5A8ZA 3D23A 4ESTE 4GSOA 2BVSH 3GISB 2VWNA 2QAAA 4KTCA 4NA7A 1DXWA 4WF8A 5SGAE 3AW0A 5T6DA 1CE5A 2UWLA 1BHXB 1CGIE 2D26C 3RXKA 3SV2H 5FBEA 2GV6A 3ZVBA 3SQHE 3ATMA 1D9IA 1TNLA 2AIPA 1THRH 4UFFH 1NPMA 2OQUA 1BOQA 9ESTA 1O3EA 1T8MA 4RKJB 1ETRH 1THPB 3KN2A 3LC3A 1W3CA 1GHBF 4M7GA 1KDQB 1AD8H 2P3FH 5DP8A 1O3DA 2VGCC 4X8VH 2ZDAH 1V6DA 3BTHE 2LNCA 3GCOA 2XRCA 3BTDE 1WU1A 3ODDA 2W3IA 3GCTF 3K6ZA 1S0RA 2ANMH 1S83A 1TAWA 4OS5A 1HRTH 4YT7H 4A92A 3UY9A 5A0CA 1H1BA 1O33A 5ABWA 1MTWA 1SB1H 3GCHB 3FP7E 1SGDE 3M37A 1O2QA 3TJVA 5K0HA 3BTTE 1NFYA 1C5LH 1UVPA 1W7XH 2FLRH 4X1PU 4NCYA 4YOIA 1JRSA 2Y81A 3HKJB 4WXVA 4Y76A 4B71A 3BG4C 2H1UA 2WV4A 3S9AA 2QXHA 2ANYA 2FM2A 4WH8A 1F92A 1KXCA 2ZWLH 2F3CE 3RP2A 4HZHA 2Z3CA 3A8DA 1RTLA 4AB9A 2O8LA 1YCPM 2F9UA 5LPRA 1C2KA 1O3FA 4FVDA 1CT4E 2A4OA 3A7ZA 1O2UA 2ODQA 4JYVH 4YLQH 4BAKB 4E06H 5L2YH 1G9IE 1BTPA 1OWKA 2NU4E 1QL9A 1XUHA 3UTUH 4H6SB 4NZLA 3KEEA 1O5FH 1RD3B 2Q6DA 4R0IA 3MFJA 1TRNA 3GY4A 3M7UA 5LH8A 2AMDA 4XFQA 3DFJA 3FANA 4Y6DA 1XUFA 5CHAC 4NSYA 2WPKS 1SGFG 1CA0B 3MH7A 3DT0H 1J14A 2W3KA 5DP7A 1F0UA 4GUXA 4DJZB 1Z7KA 3H7OA 1HAOH 4UFGH 3RXVA 2OBQA 1PJPA 4AGJA 4JZIA 1T8OA 1PPCE 5FBIA 4AYYB 1V2QT 1NRNH 1PPBH 3A83A 1MBMA 4FUDA 3QGJA 1XMNB 4ABEA 2BLVA 3FZDA 3SHAH 3TU7H 2TBSA 1P3EA 1WOFA 1RS0A 3A89A 3RXCA 3GYLB 4TPYA 5A2MH 5C67A 2J34A 3E1XB 1YBWA 1O5AB 1A61H 4Y0YE 3E90B 2ZCKP 1FPCH 1PPGE 1AB9B 4GHQA 4IMZA 1H4WA 2GT7A 2ZIQH 3V0XA 2O8WA 3GDVA 1DS2E 1VGCB 1VCPA 1FY5A 1ELEE 5JPMH 1YPLH 2XXLA 1GBKA 1S82A 2CF9H 1ZYOA 2FP7B 1TNHA 2VVVA 5A8YA 1C5XB 1XXFA 3NCLA 1IQNA 1C5YB 2WV5A 2FO9A 1CVWH 1LMWB 1SFQB 1C4V2 4MPXA 2C8WB 1FPHH 2JETB 1O2HA 2AMPA 3ATLA 1NT1A 1V2JT 4Y8YA 3F6UH 3HGPA 3VGCC 2RDLA 1GBLA 2C8YB 1HXFH 1BTWA 1P8VC 1SLUB 2GV7A 2ZGXH 3LGIA 2HALA 3UOPA 1WYKA 1Y8TA 2BOHB 2AH4X 3T2NA 1O2JA 1MAXA 5H4IB 2GX4A 4HFPB 2ZFTA 2XC0A 4ZHAA 2BM2A 4K1EA 1O2MA 4RKOB 3K2UA 2FS8A 4O97A 1CBWC 2STAE 4O3UA 4K3JA 1G30B 2O8UA 1DX5M 2Y5FA 1O2OA 2J2UA 1D3DB 3T25A 1DWEH 1M9UA 4UD9H 1E35B 3OSYA 4AFQA 2ZU3A 4UE7H 1GMDF 1O2GH 3MU5A 3LGUA 1Z8GA 1VCQA 1D3TB 3TJOA 3SJOA 2P94A 4X0WU 5T6GA 1Y3UA 2A0QB 4JCNA 2Y80A 4XE4A 2BMGB 3RLYH 1IQJA 1ABJH 4GCHG 1TQ7B 3HKIB 4X6PA 4ZKRU 3L6PA 1QRWA 1D3PB 4JK5A 4WXIA 3BTQE 3ZYDA 1F5KU 1T4UH 1W0ZU 3TGKE 1FY4A 1C5ZB 1QHRB 4DY7B 1FNIA 1BA8B 3IG6B 5L2ZH 1O3JA 3LC5A 1K1LA 1GCDA 1GCTB 3M5OA 8GCHG 1JXPA 2FYQA 3SQEE 3DUXH 3RMNH 3A7XA 3A80A 4ABBA 4CBOA 1S5SA 1EB1H 3B23B 2ZNKH 5EQRA 4AOQA 2Y5HA 2A5IA 3PLBA 3SHCH 1LO6A 1C1TA 1OP0A 2R3UA 5TCAA 1C4U2 3SU2A 3SU1A 4DIIH 1HBTH 3OU0A 3ESTA 1KXEA 5EOKA 1JOUB 2BD9A 2VH6A 5GPIB 5DP3A 3TK5A 1F0RA 3O8CA 3A85A 3PMAB 1F0SA 2G5VA 1V2UT 3LKWA 5ETXA 2P8OB 2DE8A 2CF8H 2ALPA 1TWXB 2Z3EA 1IAUA 1GHVH 1O3HA 5T6FA 1QL7A 3PTNA 4Z0KA 4CRFA 1QTFA 2OXSA 1O2SA 2TPIZ 1WUNH 4ABDA 5F8XA 2QY0B 1Z1JA 4NWKA 1F5RA 2OC0A 1TGCA 4ZHMU 3UPEA 4UFDH 5EQSA 4UDWH 2G81E 2AGGX 4AZ2B 1ELCA 1LVMA 1SLWB 1HCGA 1QA0A 3Q77A 3KNXA 3QDZB 1S6HA 1O3MA 7ESTE 1CHOG 2NU2E 1C1MA 2ILNA 3AAVA 1A5HA 1YLDA 4Y79A 3F68H 3CS7A 3NXPA 1UCYH 4QT8C 3FVFB 1C4Y2 1W10U 2BDAA 3M3SA 1CU1A 3PLKA 1MBQA 3QTOH 3M7TA 4Y8ZA 3UQOA 4U32A 5DJ7A 1MKXH 1J17T 1FY3A 1C5PA 4K1TA 1UVOA 3A8BA 1NU9A 2P59A 1P03A 4FUBA 3ZVGA 1DANH 4IN2A 1TMTH 2HGTH 8KME2 2B7DH 1EOJA 1V2KT 2ZZUH 2BX3A 2PKSC 1AKSA 1C5TA 1MZDA 2QYIA 3LGTA 4NWLA 1CGHA 2UUKB 1J9CH 2O8TA 5TCCA 3NK8A 4Q2KA 1SGIB 2HLCA 3EA9A 3SV7A 3M61U 1EB2A 3EDXB 2F91A 3PB1E 1F7ZA 1B0EA 4CR5A 1GJ6A 1GHWH 2WUCA 1P9SA 2BY8X 2VVUA 6GCHG 4ZKNU 1FONA 4MLFB 4D9RA 1GVKB 1K1PA 1IHTH 5J4QA 1DICA 2C3SA 2VGCB 2F9OA 1YPEH 1P01A 2ZU1A 1HIAB 1S6FA 3Q76A 5FHTA 1TX8A 2PKAA 4GVUA 4K5ZA 2W7SA 3A81A 2BY6X 3BEUA 1PYTD 2R0LA 3MH5A 1ZLRA 2AIQA 2V0BA 4FU9A 2ZCHP 2J94A 1TNGA 3TK6A 1JIRA 4E05H 1OWDA 1DLEA 1BTXA 3CENA 5ESBA 4OS4A 3ENSB 1TIOA 2SFAA 2ANKH 3T62A 2BDBA 2F9NA 1WQSA 2IOTA 1C2JA 1QBOA 4R8TB 5C1XA 1ZSJA 3BG4B 1FMGA 2VJ1A 1NRSH 4VGCB 4TWYA 2JH6D 1DT2A 2GMTC 5B6OA 1LHEH 5GDSH 1ETSH 1GI3A 4B2AA 1KXBA 2SGQE 1KLJH 4JZFH 5J4SA 1HAZB 1GI9B 4ZAEA 5E2PA 2ALVA 1SFIA 1BJVA 3TH3H 3ZVCA 2C90B 2KAIA 1AKSB 4NA8A 1UTQA 1WTGH 3S7HB 1NZQH 4Y7AA 1O5DH 3SNAA 1TGBA 1G32B 3F9EA 2CGAA 3MNBA 1A46H 4I7YH 2Z6BD 5HM2A 2ZQ1A 2XCFA 1SGRE 4KTUA 2GVFA 3O8RA 5CHAB 2ZDKA 3QLPH 3HGNA 2GZ9A 1YM0A 1ETTH 1QNJA 4X2YA 5EXMA 4F49A 2WYJA 1T32A 1G3BA 3ZZ3A 1SGNE 1SHYA 1Z6EA 3M3TA 3RXAA 5FXLA 5CE1A 3PM3A 3SNBA 4WMDA 3RXHA 4GHTA 5EW1H 1MH0A 4Y0ZE 2JH0D 2OTVA 2ZGBH 2AERH 3CS0A 1O5EH 2BD5A 4LK4A 1OWHA 3MMGA 2ZHWH 3RM2H 3A7WA 4BAOB 5K7RA 1KLIH 1SGFA 2CXVA 1TNJA 3V13A 1O37A 1O0DH 2BYAX 4YOGA 4B2BA 1V2LT 2FI5E 1Y3VA 2QC2A 4H42U 1TPPA 1S0QA 1C5QA 5JBBS 1LVOA 1YPKH 1BTZA 2J92A 1BHXF 1GHXH 1O3LA 3QGNB 1HUTH 1L1GA 4D76A 2ANWA 4O3TA 2VIVA 1O3PB 1IQKA 3FP8E 4ASHA 1DWBH 4FUHA 7GCHG 1AO5A 1N8OC 2XWBI 1FY1A 1QB9A 3V7TA 1PPEE 2BDIA 4YLUA 1GJCB 1YPJH 4FXGH 4SGAE 1XX9A 3VGCB 1FIZA 2KAIB 3RXQA 1YGCH 2PV9B 3MU8A 3RXUA 3OX7U 5ESTE 3E0PB 4TPIZ 2CV3A 3L33A 2PSXA 4HI3A 6ESTA 4B75A 1QFKH 1GBDA 3BTKE 2G5NA 1SGPE 1GI7B 1UHBA 1V2PT 1GL1A 5AVDA 3RC4A 1G2MA 1TRYA 3UNQA 2QF0A 4OGYA 2BLOA 2GP9B 5HXFA 4KKDA 3PO1C 3I77A 1G3DA 4AX9H 1CBWB 2BD8A 1UVSH 1O35A 4K69A 5GCHG 1SLVB 2QN5T 5C1YA 3L3TA 4MNVA 2ZDLA 4IGDA 2RA3A 4CH2B 1XKBC 1PPHE 2R2MB 4OS7A 2Z94A 1MCTA 1HAPH 1GVLA 2BD7A 4D9QA 1GBFA 4OGXA 1GHYH 1FJSA 1MZAA 8ESTE 3RC6A 3P8FA 1T7CA 1BB0B 1HAXB 2FOHA 3FFGA 4A7IB 2FOEA 2W7UA 3LJJA 1GBMA 2K1QA 1AU8A 1HJ9A 3GY8A 4HGCA 2PUQH 1TNKA 1NS3A 1O2VA 4XBDA 3ZV9A 1VJAU 1XUJA 4ISLA 1CT2E 1Q2WA 3ODFA 4ISOA 2XW9A 1O3OA 1BTHH 3STIA 4DW2U 1AZ8A 3STJA 1EJMA 1HJ8A 3IWMA 3T28A 4X2XA 4I33A 1YCPK 2R2WU 1SBWA 1W13U 1XXDA 2Q6FA 2CMYA 1GMCG 1ESAA 1W7GH 2D8WA 2ZO3H 3A8AA 2FOFA 2PTCE 2ZGJA 1A3BH 4BXWA 2BHGA 2Z9IA 3W94A 1UTJA 1LVBA 1U6QA 4BXSA 2SGPE 5EPNA 1TPOA 1K1MA 2H5CA 3S69A 4I8GA 3SBKA 3BTME 2H9HA 1ZRBA 2AGEX 4VGCC 1OOKB 1UTMA 1PQ5A 1GBBA 1OXGA 4FUCA 4K1SA 1W8BH 4NFFA 4D8NA 1NESE 2Z9GA 3ZYEA 3MH4A 3PTBA 1C2LA 4KTSA 2EI7A 1EAXA 3BEFB 1GMHG 3LGVA 4X8UH 3RXGA 1V2OT 3A8CA 1O5CB 1RTKA 2THFB 2XC5A 1OWIA 3PV4A 4BNRA 1Z6JH 3A84A 2QCYA 4U2WA 1G3EA 1O39A 1MTVA 4I8HA 1P2NA 3SV6A 1GWAA 2CN0H 2EA3A 2ZC9H 3LONA 3LGWA 3MO9A 1LVYA 3A82A 4MNXA 2A2QH 1V2NT 3KF2A 3LH3A 4ISIH 1OS8A 1CHGA 1ELGA 7KMEH 1ELVA 1LKBA 1O36A 2ASUB 1MCVA 1IQEA 1TYNA 2PR3A 2JH5D 2BDCA 4GLYA 1C1PA 1O2TA 4ISNA 2ZTYA 1LTOA 3F9FA 1NC6A 5F03A 1SSXA 3RUOA 2ZHFH 4MPWA 2A4QA 2XBXA 1GDQA 1L4ZA 2ESTE 4ABJA 5GXPA 4ABAA 3UIRA 4IMQA 5GWZA 5FX5A 1MD7A 1WSSH 3RXBA 1ZZZA 1P2MA 3SZNA 2FXRA 1ANDA 1A5GH 4X6MA 4OS6A 2W5EA 1BIOA 1GI5A 3ZZDA 1GBHA 2C8XB 1QJ1B 1C2IA 5C5OA 1V2TT 3SORA 3M3VA 2WPLS 5HYOA 1LHDH 3MNSA 4KELA 3F1SB 4Q7ZA 4A1TA 4Y11E 1UTNA 2FLBH 2SNVA 3UFAA 2Y7XA 3SW2B 1G3CA 2PKSB 1EASA 1TB6H 1OX1A 1QBNA 1Z8JB 2F9BH 5C20A 1AIXH 2ZA5A 2NU0E 1FV9A 1W12U 1KTTB 2BQ7B 3V3MA 3TNTA 1ZTLA 3AASA 2XWAA 2SGFE 2VIOA 3VEQB 2HVXA 1ZOMA 2OLGA 1O3AA 1BZXE 4A1VA 4ZKOU 1CO7E 1F0TA 1UTLM 2XC4A 1VCWA 1EAUA 4K8YA 6CHAB 3LH1A 1UTPA 2YNBA 1HAHH 2UUYA 1D6WA 2HRVA 3K9XB 1NROH 1TPAE 3ZZCA 5EPYA 1GHZA 2V3OH 1OWJA 1EAIA 1K2I1 1QURH 3S0NA 1ESBA 1F5LA 1ANEA 1XKAC 2P16A 4ZMAH 2H9EH 3N7OA 2G8TA 1K1IA 1DFPA 4MTBA 1C2MA 1LCYA 1YKTA 1BBRE 1KXDA 2R3YA 3M36A 1FXYA 1IOEA 3PROA 3ZZAA 2A5AA 1EJAA 4MDSA 4JYUH 5L6NH 2ZDNA 2V3HH 3GDUA 2Z9LA 3GCTG 1P2IA 3VB6A 5TJXA 2FS9A 2DUCA 2ZTXA 3SU4A 6GCHF 1AE5A 1P2OA
chains in the Genus database with same CATH superfamily
3E6PH 4J2YB 1BJUA 2HNTC 4CRGA 1OYTH 1IQGA 3KHVA 3MU0A 2GMTB 1HAVA 2PWXA 2FOMB 4INLA 3OTJE 3TGIE 1L4DA 1GI0A 1ACBE 1H9HE 2B8OH 1AI8H 3ZZBA 3QWCH 4DGJA 1UTOA 4FU8A 2HWLB 1K9OE 1VITH 4AG2A 1UVUH 3ZZ6A 2VIQA 1RRKA 2CHAC 2F9PA 3MO3A 3MYWA 1C5SA 3P6ZB 1BRCE 2TIOA 2GDDA 1C5VA 1JBUH 4JZDH 3AAUA 4XSKU 1C5RA 1DY9A 2ZI2H 3UWIA 4CHAC 1VITG 3URCA 5KEDA 1FQ3A 2ZECA 5JBCS 3SGAE 4X8TH 3RXPA 2FTLE 1PQAA 4NA9H 4TY6A 3Q3YA 5L30H 1DPOA 2XNDD 5FCKA 1AUJA 1MTUA 1GBCA 2H5DA 4OS2A 4JZEH 1NBMD 1HLTH 1BT7A 4IBLH 2SNWA 3VG8A 4FUFA 3BF6H 1WTHD 5FL7D 1ABIH 3BTFE 3P8OA 3F9GA 3ZV8A 1UJ1A 4X1QU 1G37A 3R3GB 3T5FH 1TA2A 4XBCA 1NU7B 1GI2A 1H8DH 1P09A 4DT7B 2Q6GA 2AS9A 1ZHRA 3P8NA 5DK1A 1ARBA 1AUTC 2JDID 5JBAS 1BRUP 1O2XA 1K1OA 1QIXB 2WYGA 1C1RA 1NFUA 3MNXA 2DE9A 1AGJA 3T29A 2ODYB 1N8OB 4A1XA 1BUIA 1AHTH 5FAHA 1BMMH 1TOCB 1JRTA 3ATKA 2ZDMA 1QGFA 1TGTA 4JMYA 4AYVB 3GYMA 2EEKA 2VNTA 1INCA 1NO9H 1O32A 3SN8A 1BBRK 1HXEH 1QRZA 3RU4D 5FPYA 1VZQH 2A4RA 2FWWA 4FOUC 1S81A 5A0AE 2IN2A 3GY3A 2ZFSA 2BVRH 3UB0A 1BTUA 1MAYA 2A5KA 2A45B 5DKMA 2JKHA 2ZU4A 3M5LA 2QIQA 1LDTT 3UQVA 1ZPBA 1O3KA 3GY7A 3JZ1B 4UFEH 1WQVH 3MHWU 3QK1A 3MTYA 1ZGVA 3PO1B 4Z1MD 3RXSA 3P92A 1TBQH 2PSYA 2GDEH 4LOYH 4TYDA 1KIGH 1N1LA 3PWCA 3WWBA 1A7SA 4ACBA 1UK2A 1WAYB 1Y3WA 1GDNA 2YOLA 1DOJA 2PTNA 1FUJA 2D1JA 4KGAA 3QO6A 2ZHEH 1B0FA 1Y5BT 1W0JD 3RMLH 1O2KA 1A0HB 1PYTC 1GGDC 4B1TA 1IQIA 3E3TA 3GY5A 1C2DA 1SL3A 4NIXA 1OPHB 1BMLA 1P2JA 6CHAC 4MG3A 2M2AA 3SGBE 5GJ4B 4PROA 4HTCH 2P3UB 4ABFA 3BIUH 1NM6A 2NU1E 1QJ7B 1ZMJA 1FN8A 2VWOA 2TGTA 1C2FA 1DITH 1QR3E 2XBYA 2VVCA 3SUFA 1C9TA 2ZQ2A 3KQDA 4CH8B 1GMDG 1P10A 4BTIB 4AORA 1JIMA 1TX7A 1YPGH 2NWNA 2C4FH 1YP9A 1NN6A 3KYGA 2O9QA 2J95A 1AVXA 3DA9B 1YF4A 1EPTA 1A4WH 1TONA 3PMJA 1O3BA 2HPQH 1SHHB 1THSH 3RXIA 4BAMB 2A4GA 2D2DA 1A5IA 1ZPCA 1FZZA 1SVPA 3ZZ9A 1HAYB 2P95A 4YOJA 3ZZ5A 1A0LA 5E2OA 2WV9A 1GI1A 1C1QA 2GCTB 3GICB 1HYLA 3MWIU 1WV7H 1TNIA 1SI5H 3SUEA 4BAQB 2UWPA 1O2ZA 1HNEE 1MQ5A 2GCHG 1W2KH 3M5MA 3MO6A 4YTAA 2BLQA 1QB1A 2RG3A 2BXTH 3BG8A 2G4UA 2G00A 1RTFB 2O8MA 2GKVE 1OSSA 1T8LA 1CSOE 1ZMLA 2PW8H 2R9PA 3DSPA 4X6NA 1SR5C 1IQMA 4WY3A 1MQ6A 1DSUA 1P2KA 1YPHC 2KR7A 1EATA 4MPUA 5LPFA 2A31A 2OCVB 1TBZH 1NTPA 5PTPA 4CBNA 2PHBA 1ELDE 2OBOA 1GBEA 4IW4E 3HATH 1UVTH 2PGBB 2BQWB 3QZRA 1AE8H 1L0ZA 1KXFA 3RXLA 1GJ4H 2PKAB 1AZZA 2K0QA 2VIPA 4RT1A 4ZXYH 1IQFA 4JK6A 1FIWA 1QY6A 3SU6A 1J15A 2G4TA 3F9HA 3LU9B 1MTSA 2TGAA 1ELTA 1BMAA 1GJDB 4ZKSU 1GG6C 4BTUB 1YLCA 3AVZA 1P05A 4K60A 1P06A 3TIUA 5HMAA 2OK5A 3ZZ7A 1N6YA 2KCAA 5IDKA 2BB4A 2UUJB 3U8RH 2FDAA 2FYRA 1UO6A 5AFYH 2F9VA 1HDTH 4CREA 2OC7A 1C5OH 1Y5UT 3LOXA 5EODA 2GZ8A 1YCPH 5FPSA 1Z71A 2HNTF 4NIYA 1BMNH 1OKXA 1BRBE 2TGPZ 5DO4H 1Q31A 3OY6U 5BRRE 1HPGA 3EA8A 1AFQC 2BOKA 4GAWA 1DE7H 1Y5AT 3VXEH 5F53A 1GHAG 1HGTH 1ZTJA 2FX6A 2VIDA 3TLOA 2FPZA 2BQ6B 3BSQA 2ZTZA 1ZJDA 4B74A 5DP6A 1QA7A 2G52A 2ZHQH 4U01A 4ZH8A 3NKKA 4FUEA 5EXLA 3E91A 3OAAD 1Y3YA 4XOJA 2FZZA 2A7JA 4B73A 3OY5U 3SJKA 4F4OC 1EP6A 4O03A 1MKWK 2OC8A 2Y6TA 4UEHH 4X1SU 2A2XH 1F2SE 2FEQH 2ZF0H 3BTGE 3H5CB 2BDHA 3NUMA 3QN7A 3TK9A 2WZQA 1DM4B 1OP8A 3LT3A 2RFKC 2ZPQA 1A0JA 2BDGA 1OP2A 1AY6H 1TX6A 1NRQH 3SNDA 1GJ5H 2BTCE 2ZGCA 4TY7A 3MNCA 1A1RA 3RXMA 1PQ8A 1RXPA 3U9AH 5AF9H 2FODA 4JYTA 2ULLA 4NG9H 3I29A 5JBTA 1UK4A 4JZ1A 1E34B 2VU8E 4P00A 1P9UA 1CA8B 1DWCH 3W95A 1V2MT 2WPMS 1DSTA 5CHBA 1K28D 4GPGA 1P02A 3BTEE 1MABB 1T4VH 3UR6A 4ZHLU 2EC9H 1C1UH 1SLXB 1GL0E 1MTNC 2FI4E 1QQUA 2BY9X 2BXUH 3U1JB 2Q1JA 5E0HA 3VXFH 2CHAB 1YYY1 2Y7ZA 1P3CA 4BANB 5FPTA 1C1OA 2LPRA 5HGGA 3SJIA 2FIRH 1ID5H 5EG4A 1C1WH 1C1NA 1ZHMA 2RCEA 2WPJS 4CHAB 3URDA 5A0BA 1TE0A 1ZTKA 5FCRA 4AG1A 2FX4A 2V7QD 4NIWA 4OM9A 2J38A 2XOKD 2RA0A 1UHBB 1B7XB 3EQ0H 3LIWA 4AFUA 4X1NU 3O8BA 2GCTC 1ELBA 1EZXC 5DN6D 2FOCA 1JMOH 2GZ7A 1GJAB 1UTKA 3OYPA 2PUXB 4GCHF 4INKA 1C5MD 3I78A 9LPRA 3MU4A 1LKAA 1S6LA 1BITA 1QL8A 3SNCA 1BCUH 1GBTA 5F8TA 2OD3B 3QZQA 2HNTE 2TRMA 2BD3A 1DXPA 1L1JA 8GCHF 3DHKH 5G4BA 1RGQA 5EXNA 1KSNA 1VITF 4HG6A 2WPHS 5E0JA 1YLNA 3OTPA 1O5BB 4ABIA 1XVMA 3B9FH 1VJ9U 5JB9S 1RFNA 5GIBA 1NBME 4Q7YA 3WY8A 1EZQA 3F2HA 1SG8B 2YNAA 3FZZA 4Y10E 4MVNA 3EE7A 3QTVH 3EYDA 2V35A 1P12E 3SZEA 1MU8B 2VINA 2JJ2D 4H6TA 4YO9A 1FAXA 2ZP0H 1E0FD 2BD4A 2SGAA 1K21H 6LPRA 2B9LA 1OWEA 1ANCA 2QGRA 3HPTB 5F6MA 4NIVA 2KCYA 1RJXB 4TWWA 1EPTC 2QXGA 4FVBA 4CRCA 1X7AC 4BOHA 2BZAA 1YC0A 3RXOA 3TNSA 1TGNA 2IJOB 4NFEA 1O38A 5JB8S 4WMFA 1HB0B 2WPIS 1O2IA 1TMUH 2OC1A 3GOVB 2Z7FE 1E1RD 3SI4H 1KTSB 1LPZB 1ARCA 1O31A 4I8JA 1ZSKA 1QCPA 3U8TH 4ABGA 1NFWA 5AFZH 4WMEA 3TJUA 3BEIB 1GJ7B 3RMOH 2BLWA 1TBRH 3UNRA 1O3NA 2H6MA 2F4LA 1C5NH 2AHME 1CHOF 1O3GA 3RU4E 3U1IB 3EAJA 2I6SA 4Z6AH 2GD4B 4U30A 3SYJA 5CDFE 2ZHDA 1K1NA 4THNH 1HAGE 2SGEE 5AHGH 4FUJA 2LP6A 3UOUA 4Q4LA 1TQ0B 1Y3XA 1GGDB 4LXBH 4KP0A 3LDXH 3A7YA 1AN1E 1C5WB 3MQKC 3FP6E 4E7NA 5EGMA 1DLKB 1PFXC 1ZSLA 2L6OA 1KY9A 2P93A 4ZUHA 2XYAA 2JIZD 1HAIH 1TPSA 1XUKA 3VB5A 4ABHA 3ZVFA 3T26A 1FDPA 1IHSH 1SPJA 5A09A 5JYIA 1GJBB 1P0SH 2OUAA 1W11U 1AVGH 1D4PB 3H7TA 4YM9A 2Z9JA 1H9LB 1D3QB 2AFQB 1T8NA 1CGJE 1GHBG 1XUGA 3OFND 2J98A 3A86A 2G55A 1DUAA 3F0PA 1ZPZA 1HJAC 4K8BA 1IQLA 1W0YH 3RMMH 2EI8A 4FUGA 3TVJB 3A7VA 1W14U 3ATIA 4K2YA 2ZDVH 5C2ZA 1S84A 2Y82A 1ZR0A 3KQCA 1O2YA 1UK3A 1SGEE 3PLPA 3Q00A 4AN7A 1C2GA 5DP5A 1EXFA 4NZQA 1O34A 2OP9A 4A5TS 2AGIX 1ELAA 1TABE 1SQRA 2YMSC 2QF3A 4RT0A 3ZZ4A 5DP4A 1BTYA 3KGPA 2STBE 3M7QA 1EAWA 2H2ZA 4FUIA 4WH6A 3LGYA 2KX4A 4DOQA 2GGVB 1FLEE 3PRBA 2BDYA 1BBRH 2NU3E 3AW1A 4I32A 5C1UA 3PMBB 1O30A 2VH0A 2SGDE 2ZPRA 3S7KB 2RDEA 4OS1A 2GT8A 5T3HA 1O2NA 1V2RT 1TFXA 2AEIH 1FAKH 1OYQA 3P70B 2TGDA 3SNEA 3GDSA 2ZGHA 3PYHA 4MPVA 1AQ7A 5T1VA 2QXJA 5C0TA 2VWMA 3TH4H 1XM1A 2YMSD 3FKSD 2OQ5A 3BN9A 3E8LA 2B0FA 4X6OA 4NGAH 1EUFA 1KYNA 3RXEA 3TITA 4DCDA 4D7GA 1E38B 3U69H 4YESB 2QV1A 3GCHC 2Z3DA 1VR1H 3SI3H 3RDZA 2ZFQH 2GCHF 5C5NA 2KFWA 3SO3A 3DSOA 1O2PA 3A88A 3EE0B 1RIWB 2ZPSA 3FN8A 1H8ED 2Y5GA 1C1VH 1EZSC 2A7CA 1SGQE 2PLXA 1LHFH 2ODPA 2P3TB 1OHHD 1SC8U 3QX5H 1HV7A 2VIWA 1L2EA 5HM9A 1MMJN 1GG6B 1DWDH 2UUFB 1O2RA 1C5UA 5LGOA 4WVPE 1TMBH 3RLWH 1Y59T 2HOBA 3SJ8A 4CRBA 5EU8A 3TPIZ 1TA6A 2B5TB 3RXFA 1N6XA 3D65E 1HAVB 4ZROA 3RM0H 1IQHA 2QF5A 1V3XA 3ZVDA 2XCNA 2ZKSA 1XVOA 3BV9B 1UCYE 3Q3KA 3RXDA 1L1NA 3SV9A 3A7TA 3BIVH 3MOCA 2Z9KA 3VFEA 1YPHE 2G51A 1CA0C 3ZIAD 3SOSA 5I25A 4FETA 1CQQA 2ZCLP 5EW2H 1CT0E 1AFQB 4DVAU 2XBVA 1LPKB 1KLTA 1QRXA 4B6FA 1SGTA 1HIAA 1SMFE 3SU0A 4AFZA 3ATWA 1SGYE 1P11E 1ESTA 3IITA 1P57B 1GI4A 3PV2A 3SGQE 1ORFA 1E37B 1QB6A 2VB0A 3M5NA 3P95A 1C1SA 1FY8E 5EJ1A 3W1EA 2BVXH 2ZFPH 2J9NA 1SQOA 2BX4A 3GY2A 4IC6A 1XUIA 4X8SH 2FESH 3R0FA 3B8JA 5DPAA 4DURA 7GCHF 3GY6A 2XNIA 3K65B 3TJNA 4CRAA 3FAOA 1AB9C 4BAHB 3EGKH 1B5GH 2R0KA 4RN6A 1EP5A 1MD8A 1GPZA 5LPEA 3GS9A 4A6LA 5GNDA 2UWOA 3AK5A 3K6YA 1VGCC 5E0GA 1LQEA 3E0NB 1K0HA 3Q3XA 1SQTA 1GHAF 1V2WT 3UNSA 4BTTB 4XBBA 4ISHH 4DIHH 4X2VA 4UONA 4YZUA 2ZFFH 5BPEA 1BRAA 3GCNA 4SGBE 2JETC 1PPZA 1C9PA 2FOGA 1S85A 3N7DA 4Y7BA 4YT6H 3DD2H 3MU1A 1Z8RA 1T31A 1NY22 4LZ4B 1AMHA 1BQYA 1JWTA 1V2ST 4MNYA 3LPRA 4B2CA 1DY8A 3SUDA 3OEHD 2J4IA 1GBIA 3TGJE 2AYWA 1LPGB 1MTNB 2J97A 3PWBA 5GCHF 1ZRKA 1TRMA 1DDJA 3UREA 5C3NA 3MH6A 4Q80A 1GDUA 1SGCA 1Z1IA 1LHGH 7LPRA 1TOMH 4B76A 1O3CA 3MI4A 2EI6A 3T27A 2WUBA 1TLDA 3U98H 2AMQA 2XBWA 1NRRH 1AWHB 2BY7X 2QA9E 2HVYB 2IPHA 1EX3A 1YPMH 2HLDD 1H8IH 3KQBA 1MU6B 2FI3E 1PQ7A 2PGQB 3LJOA 1GJ9B 3UR9A 1ANBA 4INHA 4Q7XA 4FU7A 4D7FA 1NRPH 1QJ6B 4AB8A 1MUEB 1O2WA 1TGSZ 2ZFRH 1EQ9A 3O8DA 4I8KA 1LQDB 2FMJA 3JZ2B 3RC5A 2V6NA 2BY5X 3RU4T 4I8LA 3SUGA 3V12A 1WBGB 1UCYK 5DG6A 3SU3A 3N7EA 2KZ4A 2H9TH 5EQQA 1WCZA 3HK6B 1GBJA 1MKXK 1Q3XA 3RXJA 1GMCF 5CMXH 4AFSA 4CR9A 3A87A 2XTTB 3TH2H 2ZU5A 3HK3B 3QUMP 3ELAH 4I31A 2FOBA 4MNWA 3UUZA 3KQEA 2OINA 1MKWH 5DGJA 1O3IA 2KCPA 3EA7A 3RXTA 2BD2A 4ZXXH 1FN6A 3CP7A 3M35A 1GJ8B 3NPSA 3ITIA 3C1KA 3DSGA 3SV8A 2BZ6H 1GCTC 1V2VT 2ZU2A 1ZGIA 1BDAA 2F83A 1K1JA 4XDEA 1E36B 1K22H 1GMHF 1UMAH 3KIDU 3SJ9A 1AWFH 1RIWC 1SOTA 1SQAA 2C93B 1DVAH 1EZUC 2QF4A 1Z8IB 1C2EA 3U8OH 1GBAA 2W26A 3S9BA 3P8GA 5B6LA 1EPTB 2GTBA 2VWLA 1GVZA 1D6RA 1C2HA 4LZ1H 1J8AA 2WINI 2EY4C 1J16A 8LPRA 4AGKA 1P2QA 4NSVA 3C27B 3CNRA 4X1RU 2P8OC 3FOAA 2FOAA 1O2LA 3P17H 3UWJH 2HPPH 5DP9A 1AFEH 4I86A 3D62A 4WJG2 1KXAA 1FI8A 3NWUA 5FX6A 3ZVEA 1QQ4A 2WHXA 2C8ZB 3G01A 1H9IE 3DFLA 1EJNA 1KDQA 1ZJKA 5JDUB 4CRDA 3BTWE 1EOLA 3ZVAA 3RXRA 1G2LA 4J1YA 1HFDA 2QXIA 4RI0A 4RSPA 1NFXA 4DG4A 1P04A 1E79D 4H4FA 1EKBB 3PMHB 1ELFA 1G36A 4IN1A 3S9CA 2ZG0H 3KQ5A 3VPKA 1A2CH 2I6QA 1O5GH 4IS5A 1GI8B 3VB7A 4Y8XA 5I46H 3VB4A 2CJIA 1QBVH 1GI6A 3WWFA 1TALA 3D49H 5F8ZA 4O9VA 4Y71A 5E8EH 1ZMNA 5A8XA 1AVWA 4WWYA 4X2WA 2A1DB 5IYTA 3KL6A 3ZZ8A 4MQAA 4E7RG 1LHCH 2A32A 3NZIA 2A7HA 1DUEA 3E16B 1A3EH 1SOZA 1ZHPA 2FTMA 1PPFE 2PFEA 1HJAB 3KCGH 4IC5A 3SU5A 2ZEBA 3VB3A 2M5TA 5A8ZA 3D23A 4ESTE 4GSOA 1E1QD 2BVSH 3GISB 2VWNA 2QAAA 3OEED 4KTCA 4NA7A 1DXWA 4WF8A 5SGAE 2F43B 3AW0A 5T6DA 1CE5A 2YMSB 2UWLA 1BHXB 1CGIE 2D26C 3RXKA 3SV2H 5FBEA 2GV6A 3ZVBA 3SQHE 3ATMA 1D9IA 1TNLA 2AIPA 1THRH 4UFFH 1NPMA 2OQUA 1BOQA 9ESTA 1O3EA 1T8MA 4RKJB 1ETRH 1THPB 3KN2A 3LC3A 1W3CA 1GHBF 4M7GA 1KDQB 1AD8H 2P3FH 5DP8A 1O3DA 3UAIC 2VGCC 4X8VH 1VKYA 2ZDAH 1V6DA 3BTHE 2LNCA 3GCOA 2XRCA 3BTDE 1WU1A 2PP6A 3ODDA 2W3IA 3GCTF 3K6ZA 1S0RA 2ANMH 1S83A 1TAWA 4OS5A 1HRTH 4YT7H 4A92A 3UY9A 5A0CA 1H1BA 1O33A 5ABWA 1MTWA 1YWUA 1SB1H 3GCHB 3FP7E 1SGDE 3M37A 1O2QA 3TJVA 5K0HA 3BTTE 1NFYA 1C5LH 1KMHB 1UVPA 1W7XH 2FLRH 4X1PU 4NCYA 4YOIA 1JRSA 2Y81A 3HKJB 4WXVA 4Y76A 4B71A 3BG4C 2H1UA 2WV4A 3S9AA 2QXHA 2ANYA 2FM2A 4WH8A 1F92A 1KXCA 2ZWLH 2F3CE 3RP2A 4HZHA 2Z3CA 3A8DA 1YY3A 1RTLA 4AB9A 2O8LA 1YCPM 2F9UA 5LPRA 1C2KA 1O3FA 4M9FA 4FVDA 1CT4E 2A4OA 3A7ZA 1O2UA 2ODQA 4JYVH 4YLQH 4BAKB 4E06H 5L2YH 1G9IE 1WDIA 1BTPA 1OWKA 2NU4E 1QL9A 1XUHA 3UTUH 4H6SB 4NZLA 3KEEA 1O5FH 3F2GA 1RD3B 2Q6DA 4R0IA 1WXRA 3MFJA 1TRNA 3GY4A 3M7UA 5LH8A 2AMDA 4XFQA 3DFJA 3FANA 4Y6DA 1XUFA 5CHAC 4NSYA 4AC9A 2WPKS 1SGFG 1CA0B 3MH7A 3DT0H 1J14A 2W3KA 5DP7A 1F0UA 4GUXA 4DJZB 1Z7KA 3H7OA 1HAOH 4UFGH 3RXVA 2OBQA 1PJPA 4AGJA 4JZIA 1T8OA 1PPCE 5FBIA 4AYYB 1V2QT 1NRNH 1PPBH 3A83A 1MBMA 4FUDA 4YXWD 2J5UA 3QGJA 1XMNB 4ABEA 2BLVA 3FZDA 3SHAH 3TU7H 2TBSA 1FX0B 1P3EA 1WOFA 1RS0A 3A89A 3RXCA 3GYLB 4TPYA 5A2MH 5C67A 2J34A 3E1XB 1YBWA 1O5AB 1A61H 4Y0YE 3E90B 2ZCKP 1FPCH 1PPGE 1AB9B 4GHQA 4IMZA 1H4WA 2GT7A 2ZIQH 3V0XA 2O8WA 3GDVA 1DS2E 1VGCB 1VCPA 1FY5A 1ELEE 5JPMH 1YPLH 2XXLA 1GBKA 1S82A 2CF9H 1ZYOA 2FP7B 1TNHA 2VVVA 5A8YA 1C5XB 1XXFA 3NCLA 1IQNA 1C5YB 2WV5A 2FO9A 1CVWH 1LMWB 1SFQB 1C4V2 4MPXA 2C8WB 1FPHH 2JETB 1O2HA 2AMPA 3ATLA 1NT1A 1V2JT 4Y8YA 3F6UH 3HGPA 3VGCC 2RDLA 1GBLA 2C8YB 1HXFH 1BTWA 1P8VC 1SLUB 2GV7A 2ZGXH 3LGIA 2HALA 3UOPA 1WYKA 1Y8TA 2BOHB 2AH4X 3T2NA 1O2JA 1MAXA 5H4IB 2GX4A 4HFPB 2ZFTA 2XC0A 4ZHAA 2BM2A 4K1EA 1O2MA 3U28C 4RKOB 3K2UA 2FS8A 4O97A 1CBWC 2STAE 4O3UA 4K3JA 1G30B 2O8UA 1DX5M 2Y5FA 1O2OA 5HIYA 2J2UA 1H8HD 1D3DB 3T25A 1DWEH 1M9UA 4UD9H 1E35B 2KCOA 3OSYA 4AFQA 2ZU3A 4TSFD 4UE7H 1GMDF 1O2GH 3MU5A 3LGUA 1Z8GA 1VCQA 1D3TB 3TJOA 3SJOA 2P94A 4X0WU 5T6GA 1Y3UA 2A0QB 4JCNA 2Y80A 4XE4A 2BMGB 3RLYH 1IQJA 2K8IA 1ABJH 4GCHG 1TQ7B 3HKIB 4X6PA 4ZKRU 3L6PA 1QRWA 1D3PB 4JK5A 4WXIA 3BTQE 3ZYDA 1F5KU 1T4UH 1W0ZU 3TGKE 1FY4A 1C5ZB 1QHRB 4DY7B 1FNIA 1BA8B 3IG6B 5C94A 5L2ZH 1O3JA 3LC5A 1K1LA 1GCDA 1GCTB 3M5OA 8GCHG 1JXPA 2FYQA 3SQEE 3DUXH 1SKYE 3RMNH 3A7XA 3A80A 4ABBA 4CBOA 1S5SA 1EB1H 3B23B 2W6JD 2ZNKH 5EQRA 4AOQA 2Y5HA 2J98B 2A5IA 3PLBA 3SHCH 1LO6A 1C1TA 1OP0A 2R3UA 5TCAA 1C4U2 3SU2A 3SU1A 3DCLA 4DIIH 1HBTH 3OU0A 3ESTA 1KXEA 5EOKA 1JOUB 2BD9A 2VH6A 5GPIB 5DP3A 3TK5A 1F0RA 3O8CA 3A85A 3PMAB 1F0SA 2G5VA 1V2UT 3LKWA 5ETXA 2P8OB 2DE8A 2CF8H 2ALPA 1TWXB 2Z3EA 1IAUA 1GHVH 1O3HA 5T6FA 1QL7A 2VBCA 3PTNA 4Z0KA 4CRFA 1QTFA 2OXSA 1O2SA 2TPIZ 1WUNH 2L74A 4ABDA 5F8XA 2QY0B 4Q63A 1Z1JA 4NWKA 1F5RA 2OC0A 1TGCA 4ZHMU 3UPEA 4UFDH 5EQSA 1EFRD 4UDWH 2G81E 2AGGX 4AZ2B 1ELCA 2LELA 3FO8D 1LVMA 1SLWB 1HCGA 1QA0A 3Q77A 4ACAA 3KNXA 3QDZB 1S6HA 1O3MA 7ESTE 1CHOG 2NU2E 1C1MA 2ILNA 3AAVA 1A5HA 1YLDA 4Y79A 3F68H 3CS7A 3NXPA 1UCYH 4QT8C 3FVFB 1C4Y2 1W10U 2BDAA 3M3SA 1CU1A 3PLKA 1MBQA 3QTOH 3M7TA 4Y8ZA 3UQOA 4U32A 3NRLA 5DJ7A 1MKXH 1J17T 1FY3A 1C5PA 4K1TA 1UVOA 3A8BA 1NU9A 2P59A 1P03A 4FUBA 3ZVGA 1DANH 4IN2A 4F48B 1TMTH 2HGTH 8KME2 2B7DH 1EOJA 1V2KT 2ZZUH 2BX3A 2PKSC 1AKSA 1C5TA 1MZDA 2QYIA 3LGTA 4NWLA 1CGHA 2UUKB 1J9CH 2O8TA 5TCCA 3NK8A 3WW7A 4Q2KA 1SGIB 2HLCA 3EA9A 3SV7A 3M61U 1EB2A 3EDXB 2F91A 3PB1E 1F7ZA 1B0EA 4CR5A 1GJ6A 1GHWH 2WUCA 1P9SA 2BY8X 2VVUA 6GCHG 4ZKNU 1FONA 4MLFB 4D9RA 1GVKB 1K1PA 1IHTH 5J4QA 1DICA 2C3SA 2QE7D 2VGCB 2F9OA 1YPEH 1P01A 2ZU1A 1HIAB 1S6FA 3Q76A 5FHTA 1TX8A 2PKAA 4GVUA 4K5ZA 2W7SA 3A81A 2BY6X 3BEUA 1PYTD 2IPQX 2R0LA 3MH5A 1ZLRA 2AIQA 2V0BA 3OE7D 4FU9A 4TT3D 2ZCHP 3H09A 2J94A 5HIZA 1TNGA 3TK6A 1JIRA 4E05H 1OWDA 1DLEA 1BTXA 3CENA 5ESBA 4OS4A 3ENSB 1TIOA 2SFAA 5DSFA 2ANKH 3T62A 2BDBA 2F9NA 1WQSA 2IOTA 1C2JA 1QBOA 4R8TB 5C1XA 1ZSJA 3BG4B 1FMGA 2VJ1A 1NRSH 4VGCB 4TWYA 2JH6D 1DT2A 2GMTC 5B6OA 1LHEH 5GDSH 1ETSH 1GI3A 4B2AA 1KXBA 2SGQE 1KLJH 4JZFH 5J4SA 1HAZB 1GI9B 4ZAEA 5E2PA 2ALVA 1SFIA 1BJVA 3PV5A 3TH3H 3ZVCA 2C90B 2KAIA 1AKSB 4NA8A 1UTQA 1WTGH 3S7HB 1NZQH 4Y7AA 1O5DH 3SNAA 1TGBA 1G32B 3F9EA 2CGAA 3MNBA 2WSSD 1A46H 4I7YH 2Z6BD 5HM2A 2ZQ1A 2XCFA 1SGRE 4KTUA 2GVFA 3O8RA 5CHAB 2ZDKA 3QLPH 3HGNA 2GZ9A 1YM0A 1ETTH 1QNJA 4X2YA 5EXMA 4F49A 2WYJA 1T32A 1G3BA 3ZZ3A 1SGNE 1SHYA 1Z6EA 3M3TA 3RXAA 5FXLA 5CE1A 3PM3A 3SNBA 4WMDA 3RXHA 5IK2D 4GHTA 5EW1H 1MH0A 4Y0ZE 2JH0D 2OTVA 2ZGBH 2AERH 2IJD1 3CS0A 1O5EH 2BD5A 4LK4A 1OWHA 3MMGA 2ZHWH 3RM2H 3A7WA 4BAOB 5K7RA 1KLIH 4P02A 1SGFA 2CXVA 1TNJA 3V13A 1O37A 1O0DH 2BYAX 4YOGA 4B2BA 1V2LT 2FI5E 1Y3VA 2QC2A 4H42U 1TPPA 1S0QA 1C5QA 5JBBS 1LVOA 1YPKH 1BTZA 2J92A 1BHXF 4XRNA 1GHXH 1O3LA 3QGNB 1HUTH 1L1GA 4D76A 2ANWA 4O3TA 2VIVA 1O3PB 4ZCNA 3F0OA 1IQKA 3FP8E 4ASHA 1DWBH 4FUHA 4ASUD 1AO5A 7GCHG 1N8OC 2XWBI 1FY1A 1QB9A 3V7TA 1PPEE 2BDIA 4YLUA 1GJCB 1YPJH 2KM0A 4FXGH 4SGAE 1XX9A 3VGCB 1FIZA 2KAIB 5EJLA 1YGCH 3RXQA 2PV9B 3MU8A 3RXUA 3OX7U 5ESTE 4B6EA 3E0PB 5EJZA 4TPIZ 2CV3A 3L33A 2PSXA 4HI3A 6ESTA 4B75A 1QFKH 1GBDA 3BTKE 2G5NA 1SGPE 1GI7B 1UHBA 1V2PT 1GL1A 5AVDA 3RC4A 1G2MA 1TRYA 3UNQA 2QF0A 4OGYA 2BLOA 2GP9B 5HXFA 4KKDA 3PO1C 3I77A 1G3DA 4AX9H 1CBWB 2BD8A 1UVSH 1O35A 4K69A 5GCHG 1SLVB 2QN5T 5C1YA 3L3TA 4MNVA 2ZDLA 4IGDA 2GJGA 2RA3A 4CH2B 5HKKD 1XKBC 1PPHE 2R2MB 2EQNA 4OS7A 2Z94A 2JJ1D 1MCTA 1HAPH 1GVLA 2BD7A 4D9QA 1GBFA 4OGXA 1GHYH 1FJSA 1MZAA 8ESTE 3RC6A 3P8FA 1T7CA 1BB0B 1HAXB 2FOHA 3FFGA 4A7IB 2FOEA 2W7UA 3LJJA 1GBMA 2K1QA 1AU8A 1HJ9A 3GY8A 4HGCA 2PUQH 1TNKA 1NS3A 1O2VA 4XBDA 3ZV9A 1VJAU 1XUJA 4ISLA 1CT2E 1Q2WA 3ODFA 4ISOA 2XW9A 2V3MA 1O3OA 1BTHH 3STIA 4DW2U 1W0KD 1AZ8A 3STJA 1EJMA 1HJ8A 3IWMA 3T28A 4X2XA 4I33A 1YCPK 2R2WU 1SBWA 1W13U 1XXDA 2Q6FA 2CMYA 1GMCG 1ESAA 1W7GH 2D8WA 2ZO3H 3A8AA 2FOFA 2PTCE 2ZGJA 1A3BH 4BXWA 2BHGA 2Z9IA 3W94A 1UTJA 1LVBA 1U6QA 4BXSA 2SGPE 5EPNA 1TPOA 1K1MA 2H5CA 3S69A 4I8GA 3SBKA 3BTME 2H9HA 1ZRBA 2AGEX 2WPDD 4VGCC 1OOKB 1UTMA 1PQ5A 1GBBA 1OXGA 4FUCA 4K1SA 1W8BH 4NFFA 4D8NA 1NESE 2Z9GA 3ZYEA 3MH4A 1COWD 3PTBA 1C2LA 4KTSA 2EI7A 1EAXA 3BEFB 2CK3D 1GMHG 3LGVA 4X8UH 3RXGA 1V2OT 3A8CA 1O5CB 1RTKA 2THFB 2XC5A 1OWIA 3PV4A 4BNRA 1Z6JH 3A84A 3F3BA 2QCYA 4U2WA 1G3EA 1O39A 1MTVA 4I8HA 1P2NA 3SV6A 4XD7D 1GWAA 3KYFA 2CN0H 2EA3A 2ZC9H 3LONA 3LGWA 3MO9A 1LVYA 3A82A 4MNXA 2W6ID 2A2QH 1V2NT 3KF2A 3LH3A 4ISIH 3F2FA 1OS8A 1BMFD 1CHGA 1ELGA 7KMEH 1ELVA 1LKBA 1O36A 2ASUB 5KGOA 1MCVA 1IQEA 1TYNA 2PR3A 2JH5D 2BDCA 4GLYA 1C1PA 1O2TA 4ISNA 2ZTYA 1LTOA 3F9FA 1NC6A 5F03A 1SSXA 3RUOA 2ZHFH 4MPWA 2A4QA 2XBXA 1GDQA 1L4ZA 2ESTE 4ABJA 5GXPA 4ABAA 3UIRA 4IMQA 5GWZA 5FX5A 1MD7A 1WSSH 3RXBA 1ZZZA 1P2MA 3SZNA 2FXRA 1ANDA 1A5GH 4X6MA 4OS6A 3PRDA 2W5EA 1BIOA 1GI5A 3ZZDA 1GBHA 2C8XB 1QJ1B 1C2IA 5C5OA 1V2TT 3SORA 3M3VA 2WPLS 5HYOA 1LHDH 4DT4A 1UW7A 3MNSA 5EIYA 4KELA 3F1SB 4Q7ZA 4A1TA 4Y11E 1UTNA 2FLBH 2SNVA 3UFAA 2Y7XA 3SW2B 1G3CA 2PKSB 1EASA 1TB6H 1OX1A 1QBNA 1Z8JB 2F9BH 3N99A 5C20A 1AIXH 2ZA5A 2NU0E 1FV9A 1W12U 1KTTB 2BQ7B 1QZ8A 3V3MA 5C17A 3TNTA 1ZTLA 3AASA 2XWAA 2SGFE 2VIOA 3VEQB 2HVXA 5KECA 1ZOMA 2OLGA 1O3AA 1BZXE 4A1VA 4ZKOU 1CO7E 1F0TA 1UTLM 2XC4A 1VCWA 1EAUA 4K8YA 6CHAB 3LH1A 1UTPA 2YNBA 1HAHH 2UUYA 1D6WA 2HRVA 3K9XB 1NROH 1TPAE 3ZZCA 5EPYA 1GHZA 2V3OH 1OWJA 1EAIA 1K2I1 1QURH 3S0NA 1ESBA 1F5LA 1ANEA 1XKAC 2P16A 4ZMAH 2H9EH 3N7OA 2G8TA 1K1IA 1DFPA 4MTBA 1C2MA 1LCYA 1YKTA 1BBRE 1KXDA 2R3YA 3M36A 1FXYA 1IOEA 3PROA 3ZZAA 4F55A 2A5AA 5C0UA 1EJAA 4MDSA 4JYUH 5L6NH 2ZDNA 2V3HH 3GDUA 2Z9LA 3GCTG 1P2IA 3VB6A 5TJXA 2FS9A 2DUCA 2ZTXA 3SU4A 6GCHF 1AE5A 1P2OA
chains in the Genus database with same CATH topology
3E6PH 4J2YB 1BJUA 2HNTC 4CRGA 1OYTH 1IQGA 3KHVA 3MU0A 2GMTB 1HAVA 2PWXA 2FOMB 4INLA 3OTJE 3TGIE 1L4DA 1GI0A 1ACBE 1H9HE 2B8OH 1AI8H 3ZZBA 3QWCH 4DGJA 1UTOA 4FU8A 2HWLB 1K9OE 1VITH 4AG2A 1UVUH 3ZZ6A 2VIQA 1RRKA 2CHAC 2F9PA 3MO3A 3MYWA 1C5SA 3P6ZB 1BRCE 2TIOA 2GDDA 1C5VA 1JBUH 4JZDH 3AAUA 4XSKU 1C5RA 1DY9A 2ZI2H 3UWIA 4CHAC 1VITG 3URCA 1FQ3A 2ZECA 5JBCS 3SGAE 4X8TH 3RXPA 2FTLE 1PQAA 4NA9H 4TY6A 3Q3YA 5L30H 1DPOA 5FCKA 1AUJA 1MTUA 1GBCA 2H5DA 4OS2A 4JZEH 1HLTH 1BT7A 4IBLH 2SNWA 4FUFA 3BF6H 1WTHD 1ABIH 3BTFE 3P8OA 3F9GA 3ZV8A 1UJ1A 4X1QU 1G37A 3R3GB 3T5FH 1TA2A 4XBCA 1NU7B 1GI2A 1H8DH 1P09A 4DT7B 2Q6GA 2AS9A 1ZHRA 3P8NA 5DK1A 1ARBA 1AUTC 5JBAS 1BRUP 1O2XA 1K1OA 1QIXB 2WYGA 1C1RA 1NFUA 3MNXA 2DE9A 1AGJA 3T29A 2ODYB 1N8OB 4A1XA 1BUIA 1AHTH 5FAHA 1BMMH 1TOCB 1JRTA 3ATKA 2ZDMA 1QGFA 1TGTA 4JMYA 4AYVB 3GYMA 2EEKA 2VNTA 1INCA 1NO9H 1O32A 3SN8A 1BBRK 1HXEH 1QRZA 3RU4D 5FPYA 1VZQH 2A4RA 2FWWA 1S81A 5A0AE 2IN2A 3GY3A 2ZFSA 2BVRH 1BTUA 1MAYA 2A5KA 2A45B 5DKMA 2JKHA 2ZU4A 3M5LA 2QIQA 1LDTT 3UQVA 1ZPBA 1O3KA 3GY7A 3JZ1B 4UFEH 1WQVH 3MHWU 3QK1A 3MTYA 1ZGVA 3PO1B 3RXSA 3P92A 1TBQH 2PSYA 2GDEH 4LOYH 4TYDA 1KIGH 1N1LA 3PWCA 1A7SA 1UK2A 1WAYB 1Y3WA 1GDNA 2YOLA 1DOJA 2PTNA 1FUJA 2D1JA 4KGAA 3QO6A 2ZHEH 1B0FA 1Y5BT 3RMLH 1O2KA 1A0HB 1PYTC 1GGDC 4B1TA 1IQIA 3E3TA 3GY5A 1C2DA 1SL3A 4NIXA 1OPHB 1BMLA 1P2JA 6CHAC 4MG3A 3SGBE 5GJ4B 4PROA 4HTCH 2P3UB 4ABFA 3BIUH 1NM6A 2NU1E 1QJ7B 1ZMJA 1FN8A 2VWOA 2TGTA 1C2FA 1DITH 1QR3E 2XBYA 2VVCA 3SUFA 1C9TA 2ZQ2A 3KQDA 4CH8B 1GMDG 1P10A 4BTIB 4AORA 1JIMA 1TX7A 1YPGH 2NWNA 2C4FH 1YP9A 1NN6A 2O9QA 2J95A 1AVXA 3DA9B 1YF4A 1EPTA 1A4WH 1TONA 3PMJA 1O3BA 2HPQH 1SHHB 1THSH 3RXIA 4BAMB 2A4GA 2D2DA 1A5IA 1ZPCA 1FZZA 1SVPA 3ZZ9A 1HAYB 2P95A 4YOJA 3ZZ5A 1A0LA 5E2OA 1GI1A 1C1QA 2GCTB 3GICB 1HYLA 3MWIU 1WV7H 1TNIA 1SI5H 3SUEA 4BAQB 2UWPA 1O2ZA 1HNEE 1MQ5A 2GCHG 1W2KH 3M5MA 3MO6A 4YTAA 2BLQA 1QB1A 2RG3A 2BXTH 3BG8A 2G4UA 2G00A 1RTFB 2O8MA 2GKVE 1OSSA 1T8LA 1CSOE 1ZMLA 2PW8H 2R9PA 4X6NA 1SR5C 1IQMA 4WY3A 1MQ6A 1DSUA 1P2KA 1YPHC 1EATA 4MPUA 5LPFA 2A31A 2OCVB 1TBZH 1NTPA 5PTPA 4CBNA 2PHBA 1ELDE 2OBOA 1GBEA 4IW4E 3HATH 1UVTH 2PGBB 2BQWB 3QZRA 1AE8H 1L0ZA 1KXFA 3RXLA 1GJ4H 2PKAB 1AZZA 2VIPA 4ZXYH 1IQFA 4JK6A 1FIWA 1QY6A 3SU6A 1J15A 2G4TA 3F9HA 3LU9B 1MTSA 2TGAA 1ELTA 1BMAA 1GJDB 4ZKSU 1GG6C 4BTUB 1YLCA 3AVZA 1P05A 4K60A 1P06A 3TIUA 5HMAA 3ZZ7A 1N6YA 5IDKA 2BB4A 2UUJB 3U8RH 2FDAA 2FYRA 1UO6A 5AFYH 2F9VA 1HDTH 4CREA 2OC7A 1C5OH 1Y5UT 3LOXA 5EODA 2GZ8A 1YCPH 5FPSA 1Z71A 2HNTF 4NIYA 1BMNH 1OKXA 1BRBE 2TGPZ 5DO4H 1Q31A 3OY6U 5BRRE 1HPGA 3EA8A 1AFQC 2BOKA 4GAWA 1DE7H 1Y5AT 3VXEH 1GHAG 1HGTH 1ZTJA 2FX6A 2VIDA 3TLOA 2FPZA 2BQ6B 3BSQA 2ZTZA 1ZJDA 4B74A 5DP6A 1QA7A 2G52A 2ZHQH 4U01A 4ZH8A 3NKKA 4FUEA 5EXLA 3E91A 1Y3YA 4XOJA 2FZZA 2A7JA 4B73A 3OY5U 3SJKA 4F4OC 1EP6A 4O03A 1MKWK 2OC8A 2Y6TA 4UEHH 4X1SU 2A2XH 1F2SE 2FEQH 2ZF0H 3BTGE 3H5CB 2BDHA 3NUMA 3QN7A 3TK9A 1DM4B 1OP8A 3LT3A 2ZPQA 1A0JA 2BDGA 1OP2A 1AY6H 1TX6A 1NRQH 3SNDA 1GJ5H 2BTCE 2ZGCA 4TY7A 3MNCA 1A1RA 3RXMA 1PQ8A 1RXPA 3U9AH 5AF9H 2FODA 4JYTA 2ULLA 4NG9H 3I29A 5JBTA 1UK4A 4JZ1A 1E34B 2VU8E 1P9UA 1CA8B 1DWCH 3W95A 1V2MT 2WPMS 1DSTA 1K28D 4GPGA 1P02A 3BTEE 1T4VH 3UR6A 4ZHLU 2EC9H 1C1UH 1SLXB 1GL0E 1MTNC 2FI4E 1QQUA 2BY9X 2BXUH 3U1JB 2Q1JA 5E0HA 3VXFH 2CHAB 1YYY1 2Y7ZA 1P3CA 4BANB 5FPTA 1C1OA 2LPRA 5HGGA 3SJIA 2FIRH 1ID5H 5EG4A 1C1WH 1C1NA 1ZHMA 2RCEA 2WPJS 4CHAB 3URDA 5A0BA 1TE0A 1ZTKA 5FCRA 4AG1A 2FX4A 4NIWA 2J38A 2RA0A 1UHBB 1B7XB 3EQ0H 3LIWA 4AFUA 4X1NU 3O8BA 2GCTC 1ELBA 1EZXC 2FOCA 1JMOH 2GZ7A 1GJAB 1UTKA 3OYPA 2PUXB 4GCHF 4INKA 1C5MD 3I78A 9LPRA 3MU4A 1LKAA 1BITA 1QL8A 3SNCA 1BCUH 1GBTA 5F8TA 2OD3B 3QZQA 2HNTE 2TRMA 2BD3A 1DXPA 1L1JA 8GCHF 3DHKH 5G4BA 1RGQA 5EXNA 1KSNA 1VITF 2WPHS 5E0JA 1O5BB 4ABIA 1XVMA 3B9FH 1VJ9U 5JB9S 1RFNA 5GIBA 4Q7YA 3WY8A 1EZQA 1SG8B 2YNAA 3FZZA 4Y10E 4MVNA 3QTVH 3EYDA 2V35A 1P12E 1MU8B 2VINA 4H6TA 4YO9A 1FAXA 2ZP0H 1E0FD 2BD4A 2SGAA 1K21H 6LPRA 2B9LA 1OWEA 1ANCA 2QGRA 3HPTB 5F6MA 4NIVA 1RJXB 4TWWA 1EPTC 2QXGA 4FVBA 4CRCA 1X7AC 4BOHA 2BZAA 1YC0A 3RXOA 3TNSA 1TGNA 2IJOB 4NFEA 1O38A 5JB8S 4WMFA 1HB0B 2WPIS 1O2IA 1TMUH 2OC1A 3GOVB 2Z7FE 3SI4H 1KTSB 1LPZB 1ARCA 1O31A 4I8JA 1ZSKA 1QCPA 3U8TH 4ABGA 1NFWA 5AFZH 4WMEA 3TJUA 3BEIB 1GJ7B 3RMOH 2BLWA 1TBRH 3UNRA 1O3NA 2H6MA 1C5NH 3RU4E 1CHOF 1O3GA 3U1IB 3EAJA 2I6SA 4Z6AH 2GD4B 4U30A 2ZHDA 1K1NA 4THNH 1HAGE 2SGEE 5AHGH 4FUJA 3UOUA 1TQ0B 1Y3XA 1GGDB 4LXBH 4KP0A 3LDXH 3A7YA 1AN1E 1C5WB 3FP6E 4E7NA 5EGMA 1DLKB 1PFXC 1ZSLA 4ZUHA 1KY9A 2P93A 2XYAA 1HAIH 1TPSA 1XUKA 3VB5A 4ABHA 3ZVFA 3T26A 1FDPA 1IHSH 1SPJA 5A09A 5JYIA 1GJBB 1P0SH 2OUAA 1W11U 1AVGH 1D4PB 3H7TA 4YM9A 2Z9JA 1H9LB 1D3QB 2AFQB 1T8NA 1CGJE 1GHBG 1XUGA 3A86A 2G55A 1DUAA 1ZPZA 1HJAC 4K8BA 1IQLA 1W0YH 3RMMH 2EI8A 4FUGA 3TVJB 3A7VA 1W14U 3ATIA 4K2YA 2ZDVH 5C2ZA 1S84A 2Y82A 1ZR0A 3KQCA 1O2YA 1UK3A 1SGEE 3PLPA 3Q00A 4AN7A 1C2GA 5DP5A 1EXFA 4NZQA 1O34A 2OP9A 4A5TS 2AGIX 1ELAA 1TABE 2QF3A 3ZZ4A 5DP4A 1BTYA 3KGPA 2STBE 3M7QA 1EAWA 2H2ZA 4FUIA 4WH6A 3LGYA 4DOQA 2GGVB 1FLEE 2BDYA 1BBRH 2NU3E 3AW1A 4I32A 5C1UA 3PMBB 1O30A 2VH0A 2SGDE 2ZPRA 3S7KB 4OS1A 2GT8A 5T3HA 1O2NA 1V2RT 1TFXA 2AEIH 1FAKH 1OYQA 3P70B 2TGDA 3SNEA 3GDSA 2ZGHA 3PYHA 4MPVA 1AQ7A 2QXJA 2VWMA 3TH4H 1XM1A 2OQ5A 3BN9A 3E8LA 2B0FA 4X6OA 4NGAH 1EUFA 1KYNA 3RXEA 3TITA 4DCDA 4D7GA 1E38B 3U69H 4YESB 2QV1A 3GCHC 2Z3DA 1VR1H 3SI3H 3RDZA 2ZFQH 2GCHF 5C5NA 3SO3A 1O2PA 3A88A 3EE0B 1RIWB 2ZPSA 2Y5GA 1C1VH 1EZSC 2A7CA 1SGQE 2PLXA 1LHFH 2ODPA 2P3TB 1SC8U 3QX5H 1HV7A 2VIWA 1L2EA 5HM9A 1MMJN 1GG6B 1DWDH 2UUFB 1O2RA 1C5UA 5LGOA 4WVPE 1TMBH 3RLWH 1Y59T 2HOBA 3SJ8A 4CRBA 5EU8A 3TPIZ 1TA6A 2B5TB 3RXFA 1N6XA 3D65E 1HAVB 4ZROA 3RM0H 1IQHA 1V3XA 3ZVDA 2XCNA 2ZKSA 1XVOA 3BV9B 1UCYE 3Q3KA 3RXDA 1L1NA 3SV9A 3A7TA 3BIVH 3MOCA 2Z9KA 3VFEA 1YPHE 2G51A 1CA0C 5I25A 3SOSA 1CQQA 2ZCLP 5EW2H 1CT0E 1AFQB 4DVAU 2XBVA 1LPKB 1KLTA 1QRXA 1SGTA 1HIAA 1SMFE 3SU0A 4AFZA 3ATWA 1SGYE 1P11E 1ESTA 3IITA 1P57B 1GI4A 3SGQE 1ORFA 1E37B 1QB6A 2VB0A 3M5NA 3P95A 1C1SA 1FY8E 2BVXH 2ZFPH 2J9NA 1SQOA 2BX4A 3GY2A 4IC6A 1XUIA 4X8SH 2FESH 3R0FA 3B8JA 5DPAA 4DURA 7GCHF 3GY6A 2XNIA 3K65B 3TJNA 4CRAA 3FAOA 1AB9C 4BAHB 3EGKH 1B5GH 2R0KA 4RN6A 1EP5A 1MD8A 1GPZA 5LPEA 4A6LA 2UWOA 3K6YA 1VGCC 5E0GA 1LQEA 3E0NB 3Q3XA 1SQTA 1GHAF 1V2WT 3UNSA 4BTTB 4XBBA 4ISHH 4DIHH 4X2VA 4UONA 4YZUA 2ZFFH 5BPEA 1BRAA 3GCNA 4SGBE 2JETC 1PPZA 1C9PA 2FOGA 1S85A 4Y7BA 4YT6H 3DD2H 3MU1A 1Z8RA 1T31A 1NY22 4LZ4B 1AMHA 1BQYA 1JWTA 1V2ST 4MNYA 3LPRA 4B2CA 1DY8A 3SUDA 2J4IA 1GBIA 3TGJE 2AYWA 1LPGB 1MTNB 3PWBA 5GCHF 1ZRKA 1TRMA 1DDJA 3UREA 5C3NA 3MH6A 4Q80A 1GDUA 1SGCA 1Z1IA 1LHGH 7LPRA 1TOMH 4B76A 1O3CA 3MI4A 2EI6A 3T27A 2WUBA 1TLDA 3U98H 2AMQA 2XBWA 1NRRH 1AWHB 2BY7X 2QA9E 2IPHA 1EX3A 1YPMH 1H8IH 3KQBA 1MU6B 2FI3E 1PQ7A 2PGQB 3LJOA 1GJ9B 3UR9A 1ANBA 4INHA 4Q7XA 4FU7A 4D7FA 1NRPH 1QJ6B 4AB8A 1MUEB 1O2WA 1TGSZ 2ZFRH 1EQ9A 3O8DA 4I8KA 1LQDB 2FMJA 3JZ2B 3RC5A 2V6NA 2BY5X 3RU4T 4I8LA 3SUGA 3V12A 1WBGB 1UCYK 5DG6A 3SU3A 2H9TH 5EQQA 1WCZA 3HK6B 1GBJA 1MKXK 1Q3XA 3RXJA 1GMCF 5CMXH 4AFSA 4CR9A 3A87A 2XTTB 3TH2H 2ZU5A 3HK3B 3QUMP 3ELAH 4I31A 2FOBA 4MNWA 3UUZA 3KQEA 2OINA 1MKWH 5DGJA 1O3IA 3EA7A 3RXTA 2BD2A 4ZXXH 1FN6A 3CP7A 3M35A 1GJ8B 3NPSA 3ITIA 3C1KA 3SV8A 2BZ6H 1GCTC 1V2VT 2ZU2A 1ZGIA 1BDAA 2F83A 1K1JA 4XDEA 1E36B 1K22H 1GMHF 1UMAH 3KIDU 3SJ9A 1AWFH 1RIWC 1SOTA 1SQAA 2C93B 1DVAH 1EZUC 1Z8IB 1C2EA 3U8OH 1GBAA 2W26A 3S9BA 3P8GA 1EPTB 2GTBA 2VWLA 1GVZA 1D6RA 1C2HA 4LZ1H 1J8AA 2WINI 1J16A 8LPRA 4AGKA 1P2QA 4NSVA 3C27B 4X1RU 2P8OC 2FOAA 1O2LA 3P17H 3UWJH 2HPPH 5DP9A 1AFEH 3D62A 4WJG2 1KXAA 1FI8A 3NWUA 5FX6A 3ZVEA 1QQ4A 2C8ZB 3G01A 1H9IE 3DFLA 1EJNA 1KDQA 1ZJKA 5JDUB 4CRDA 3BTWE 1EOLA 3ZVAA 3RXRA 1G2LA 4J1YA 1HFDA 2QXIA 4RSPA 1NFXA 4DG4A 1P04A 4H4FA 1EKBB 3PMHB 1ELFA 1G36A 4IN1A 3S9CA 2ZG0H 3VPKA 1A2CH 2I6QA 1O5GH 4IS5A 1GI8B 3VB7A 4Y8XA