1P09A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase (serine proteinase)
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p09A01
1P06A 1ZPBA 2H5DA 4H6SB 3A7WA 1MKXK 1W8BH 1T8MA 2BLOA 1KDQA 1UHBA 3URDA 3GYLB 3IWMA 2OBQA 1C2GA 1CBWC 1W7GH 1ABIH 3OY5U 3M36A 5EQQA 2EA3A 1AHTH 2ZPRA 1UTKA 1QB1A 3PMHB 2PSXA 4ISHH 2OBOA 2P94A 1TWXB 3KEEA 5GIBA 1IQHA 1AFQC 3ENSB 1SGRE 4MTBA 4I33A 1EQ9A 1NRQH 1SQAA 1X7AC 5EXMA 2Y7XA 4MVNA 3LJJA 3PV4A 1GJ5H 2B5TB 4WXIA 1MAXA 1KYNA 1P2KA 2ZGHA 5FPSA 1TB6H 1P2NA 1O2OA 1PQAA 4A1TA 3SU5A 1ETSH 1V2MT 1JOUB 3K9XB 2O8UA 5FPTA 1P3CA 1W2KH 2A4RA 3KCGH 1DY9A 3B9FH 4H42U 3FVFB 3PTNA 4HFPB 1QQUA 5C1XA 1N8OB 2BDCA 2VH0A 1G3CA 4NGAH 2SGPE 1G32B 1SQTA 3GY2A 2IOTA 1C2DA 2P3FH 1IQFA 4AOQA 1RS0A 4AFUA 1T8LA 1HYLA 1GMCG 1YCPK 2XC5A 1VITH 2ZNKH 5K7RA 2G4UA 3V13A 3STIA 4WWYA 1GI2A 7GCHF 3RMMH 5AVDA 1HUTH 2ZDVH 1W11U 4FU7A 3RXVA 2OC0A 2G55A 1NM6A 2FIRH 3SV2H 2C8ZB 5EXLA 1Y3YA 1BRUP 1GVLA 3MNSA 1QIXB 1GGDC 2ANKH 1ELDE 1SGQE 1P0SH 1SG8B 5CE1A 3TIUA 1A5IA 1TGSZ 2ZU2A 2PKSB 2IPHA 1F5LA 1P03A 1W12U 5DKMA 1ZYOA 2YOLA 3M5NA 5GXPA 3MOCA 6ESTA 1Z8JB 2F9OA 2ZPSA 1C5VA 3QTVH 3VFEA 4GSOA 4YO9A 3OTJE 3K6ZA 2PUQH 1L1GA 1SB1H 2F9BH 4BXSA 1PFXC 3A8DA 1N8OC 3UUZA 3AW0A 2QF3A 2R0KA 1C1RA 1D3DB 1SGFG 4JCNA 2BLVA 1ZR0A 3LPRA 3PO1B 4Y76A 3S7HB 1OWKA 3N7OA 1S84A 1ELEE 3LGWA 1QRXA 1LHEH 2UWLA 3UWIA 1NS3A 1MMJN 3PM3A 1DXWA 3TH4H 1ETRH 2FTMA 3BTME 1TBRH 4K8YA 1J9CH 1A5HA 4ZH8A 1O3CA 3G01A 1CVWH 3KF2A 2ZEBA 3I77A 2XWBI 1SLUB 1O5CB 2BDYA 3MU4A 1K9OE 1O3HA 1C4Y2 1Z8RA 2HNTE 1SBWA 3LIWA 1TPSA 5SGAE 3RXKA 1O2MA 2VIQA 2BD5A 2G52A 2BD8A 4K8BA 5T3HA 3LGUA 3SJ9A 3JZ1B 1EZXC 2H9EH 4ISNA 2PKSC 2OLGA 3RXMA 1L1NA 3LGTA 3O8CA 2ZU3A 3FP7E 4IC5A 3Q3XA 2A5IA 1O33A 1ZJKA 3P8OA 1QY6A 1NU7B 2ZFSA 4NA9H 2FOEA 2R3YA 3DHKH 1A0HB 1DOJA 3KGPA 4BANB 5LPRA 3S9CA 1AVGH 1THSH 1QB6A 1O35A 4CR9A 3PO1C 1UVSH 5F03A 2GZ7A 1CQQA 1GBIA 1WOFA 1AKSB 2PFEA 1YGCH 5FHTA 2OQUA 2FM2A 3RXOA 3U98H 1RTKA 4ABHA 1C5WB 1F5RA 3GY6A 4X0WU 4BTIB 1UVTH 1GBEA 1YPMH 1O3LA 1GJ8B 1TYNA 4OS7A 3BTHE 2IJOB 1O3BA 2PKAA 1AQ7A 3V0XA 1Y3WA 1BBRH 2A7CA 1MU6B 5GDSH 2C93B 2A31A 1SVPA 2BYAX 4KELA 5DG6A 3UFAA 1UK3A 2FO9A 4HTCH 1RD3B 3RXRA 2ZU4A 1NFXA 1N6XA 1XVOA 1YPJH 4X1QU 5LGOA 1V2QT 1N1LA 1Q3XA 3M37A 3FZDA 1TNGA 2AERH 1DICA 2TIOA 4FUEA 3UOUA 4X8SH 2ZZUH 1W14U 1K22H 1C2KA 1XUJA 1MBQA 4I8JA 1D9IA 1OWJA 4WMFA 2WPLS 1BMMH 3EA8A 2B8OH 2ZGBH 2J4IA 3MTYA 2SFAA 4UE7H 3LOXA 2GV7A 2CXVA 2V3OH 1FAXA 2BQ7B 4LZ1H 4Q80A 1QL9A 1O2LA 1DSUA 2GCTB 3D65E 4FUJA 1RTLA 3MYWA 4DIIH 1GBCA 3LT3A 5FCRA 4R0IA 2BVRH 4Y71A 1VJAU 1WAYB 3ZVCA 2J94A 4IN1A 1OP2A 1Y59T 3L3TA 2Z6BD 2ZFFH 2PGBB 2BQ6B 1LVOA 3TNSA 1C5QA 3BIUH 4BTTB 2XRCA 6GCHG 1A0JA 2VH6A 1P9SA 1THPB 3ZZ7A 4BXWA 4K69A 4NFEA 3L6PA 2QV1A 3OSYA 3A86A 1P2JA 4X6NA 1GDUA 1TABE 4WF8A 2PSYA 2XCFA 1CT2E 2THFB 1MU8B 4ZAEA 2O8WA 2R3UA 2D26C 1C1QA 1P2OA 1PPCE 2RA0A 3A8AA 4ISIH 4O97A 1FPCH 1AU8A 2ZDKA 2FWWA 2VGCB 1C5TA 1FV9A 4Y11E 4B75A 4IBLH 1BITA 1TLDA 2ZA5A 2GCTC 1C5RA 2ALPA 1GHBG 1D3QB 2A32A 3FAOA 4INHA 1BMAA 1ZOMA 1SOZA 1K1IA 1IQNA 4U30A 4VGCB 3TH2H 1O34A 3GY7A 1IQJA 1O31A 2QC2A 1HIAB 1EZQA 3UNSA 4X8UH 3T62A 1KXCA 1V2WT 1OS8A 1LHDH 3M7UA 4KTCA 2Z3DA 5TJXA 3A80A 3BF6H 2SNWA 2Y81A 1OWHA 5GJ4B 2BD9A 1C5XB 1FZZA 4A92A 1ID5H 3PLKA 5AF9H 4ZHMU 1O32A 1LTOA 1ESTA 2W3KA 5DK1A 1BTHH 1GPZA 2YNBA 3RUOA 3VB7A 3UWJH 4ZKNU 1TA6A 1WTGH 1QTFA 3TPIZ 5B6OA 1BRBE 2QN5T 1HAHH 1AO5A 1BA8B 2GGVB 4Y8YA 1SLXB 1SL3A 3H5CB 1C1MA 1DY8A 1YF4A 5C1UA 1QBNA 2D1JA 2G00A 3HGPA 4B2AA 3LH3A 2HVXA 1ETTH 2VVUA 1S6FA 4KGAA 4JZIA 1FLEE 3BEUA 4TPIZ 5A0AE 1DSTA 3ZVDA 1OSSA 2VGCC 1NY22 5DP7A 1QJ7B 1AUJA 1VGCB 2WUBA 2B9LA 2FEQH 3U9AH 2ZG0H 3MU5A 4B2CA 1ELCA 1S83A 4MNXA 4XBBA 3SJIA 5GCHF 2VIPA 1LPKB 1PQ7A 4VGCC 4YOIA 1GI8B 1WQVH 1PQ8A 5HYOA 2VWLA 2Y5GA 3TH3H 1V2UT 1QGFA 5FX5A 5LPEA 2NU2E 3MHWU 3EE0B 3SI4H 1ZSLA 1Y3UA 4WMDA 5L30H 1E34B 4NG9H 2ZQ2A 4CH2B 1D3TB 1CSOE 2EI8A 3ZVGA 1K21H 2ZFQH 1O2GH 3A87A 4Q2KA 3TLOA 2YNAA 1FAKH 4UD9H 4ABJA 3LONA 1FI8A 1BTZA 1G36A 2W5EA 4Y7BA 4WH8A 2XTTB 3RXEA 3SI3H 5EXNA 1DLEA 2GZ8A 3SOSA 4GUXA 2P95A 1N6YA 4KTSA 2CJIA 5DO4H 1BOQA 1AE5A 3A8BA 4IC6A 1S85A 2BXUH 5C5OA 1HLTH 3LGIA 1HAZB 1KXDA 3L33A 4X8VH 4CRBA 1Z71A 1GBFA 1W0ZU 3BTKE 3SU0A 1ZZZA 1NN6A 1JRSA 5C1YA 2TRMA 1J16A 1O2VA 2CF9H 1VGCC 1GBBA 1XXDA 1EASA 1GMHF 5A8ZA 3VB5A 3M5LA 4YZUA 2NU3E 1SGYE 1O2YA 2FPZA 4FUDA 4D7FA 1NRRH 1C2FA 3RU4T 3ZZ4A 4DGJA 2ZWLH 1BMLA 4RKOB 1IQIA 1WYKA 2FLRH 4AB8A 4XOJA 4FVDA 2ANYA 4CRCA 4XDEA 3LU9B 1XX9A 2DE9A 2WPMS 1S81A 1A3EH 1HCGA 4ZXXH 2CMYA 2GD4B 4CH8B 3QN7A 1TGCA 6CHAB 1G3BA 1PPGE 3HPTB 4ZKSU 3GY4A 1BUIA 4Q7XA 4X1RU 1O3EA 1NT1A 3F9EA 3ATIA 2XYAA 2O9QA 2ZGJA 8ESTE 1HAPH 1CA8B 1O3AA 1E38B 2XNIA 1D6RA 1EKBB 1BIOA 1ZTLA 3GCTF 3QK1A 2GT8A 3T26A 4IN2A 5ABWA 4BTUB 4D7GA 3VGCB 3P95A 3EYDA 1HRTH 3A7YA 4AG1A 1AKSA 1LMWB 3GYMA 4HZHA 2OC1A 1GHYH 1O5EH 3DFJA 3MH5A 1J8AA 4JYUH 1YYY1 2W3IA 1W3CA 4GCHF 3R3GB 2G4TA 1FMGA 1C2LA 1UVOA 3KIDU 2BDHA 3GDSA 3PWBA 4JMYA 1RJXB 4SGBE 1ZMJA 4KTUA 4CBNA 3FFGA 2F9VA 1E0FD 4UFDH 3OYPA 1G2MA 1A1RA 1TRNA 2IN2A 5IYTA 1HJ8A 2SGFE 1O3OA 3QO6A 1XXFA 1GJ7B 4AORA 2XWAA 1FY5A 3A81A 2JH5D 1XUGA 1XMNB 2J34A 4BAMB 2TGPZ 4ABBA 3F9FA 1UTJA 1ARCA 1V2JT 4B1TA 1V2RT 1VITF 2D8WA 6CHAC 2G81E 1SC8U 4U32A 2PUXB 3SHCH 2FX6A 2UWPA 3RM0H 2FI3E 3E0PB 4I8GA 4WH6A 4ZHLU 2OD3B 4MNWA 4MPWA 1O38A 2R0LA 2ZFTA 5FPYA 3DT0H 1L4ZA 4O03A 5L6NH 3RXPA 3SUEA 2FOGA 2AFQB 1RIWB 2ZDAH 3O8DA 1GJ6A 4MDSA 1NO9H 2QA9E 1C5SA 3T2NA 2P3TB 2BY7X 1A61H 1MKWH 2BY5X 2H1UA 2I6QA 3OY6U 1Z6EA 3VGCC 1P3EA 3ZZ3A 4JZEH 3MU1A 2ZGXH 2OQ5A 1P04A 1EJMA 2GCHF 1PPEE 3H7TA 1O36A 1F2SE 3RXBA 4X2YA 5JDUB 2WPHS 3PMJA 1A0LA 4TY7A 2Z9IA 2BD3A 4X2WA 2OXSA 3MU0A 4F4OC 1YPKH 2BHGA 2Q6DA 3GICB 3KN2A 3BTDE 4ABIA 3E1XB 1EP6A 1DS2E 2GP9B 3BEFB 2VVVA 3EDXB 2D2DA 3CS7A 1TRYA 1XM1A 3Q3YA 2FOCA 1UVPA 4NWKA 4WVPE 1TNKA 2HNTF 1ZSKA 3GOVB 1SGIB 2AMQA 1FY1A 3QGNB 2ILNA 3CENA 1BHXF 1QA7A 4B76A 2W7UA 2G5VA 4X1PU 3CS0A 1LQEA 1KXBA 4A6LA 2AGEX 3MO3A 2BVXH 3UNQA 3PB1E 1B0EA 1RIWC 1SR5C 1T8NA 1TMUH 1Y5UT 2ZP0H 5A0CA 3RMOH 1K1OA 2VB0A 2W7SA 1OOKB 4R8TB 1QFKH 1UMAH 1SQOA 5T6DA 3QUMP 1J15A 4FUBA 3U8TH 1O2WA 3ATLA 7GCHG 1S0QA 1AE8H 2TBSA 1WCZA 2LPRA 3E6PH 2GDDA 2ESTE 2BY8X 1ESBA 3GY5A 3TJUA 1T7CA 2GX4A 4YOJA 1L2EA 1HIAA 3KQCA 5DJ7A 1GI0A 1AGJA 1FN6A 2TGDA 3RXSA 3SN8A 2RA3A 5G4BA 3UOPA 4WY3A 1GBDA 3LJOA 3V12A 4NIXA 3RXQA 2FX4A 1KLJH 4NIYA 1DM4B 1OWEA 1YPGH 4A5TS 3DD2H 1F92A 3RXDA 1AB9B 9ESTA 3TJNA 3U8RH 3MFJA 1DXPA 2VWOA 4B2BA 1E37B 2OUAA 4I31A 5A2MH 1O3DA 3O8RA 3A85A 1FN8A 1TPPA 5FBEA 4DCDA 4ZKOU 3T28A 4FU9A 2BM2A 1C9PA 2GZ9A 3MNCA 4OS5A 1Y5AT 5T6GA 5H4IB 1MTNB 4CRGA 1NFWA 2TGTA 2ZCKP 3AASA 1MZDA 1C1OA 2F9UA 1CHOF 2STBE 1XUFA 1EAXA 3SW2B 3NZIA 1GHWH 1SMFE 4TPYA 1KTTB 1XVMA 1WU1A 1AWFH 5A8XA 1DDJA 2ZPQA 1OP8A 1NPMA 2OC7A 1UCYH 3PWCA 5HMAA 2UUYA 5E0HA 3A88A 3ZZBA 4H4FA 1BTUA 2F9PA 1RTFB 4K1EA 1PYTC 4CRAA 1G37A 1QL7A 1TE0A 4FXGH 3VB6A 2VU8E 4NIVA 4FUIA 1AB9C 2FI4E 3BG4B 3EA7A 3KQEA 3ODFA 2H6MA 1Z1IA 5EPNA 1P2IA 1GMDF 5ESBA 1GBHA 2JETB 4B73A 5DGJA 1PQ5A 1O3NA 3FANA 3ZVFA 1ZJDA 2GTBA 1CU1A 1C2JA 1G9IE 1UVUH 4K3JA 5TCCA 1MTNC 1B5GH 1C4V2 4MPVA 1W0YH 4K1SA 3VXFH 1PPBH 8LPRA 4AN7A 4ISLA 1IHSH 1O5AB 1PPZA 5CHAB 1HFDA 1PPHE 2ODYB 3ELAH 1CA0B 1BBRE 1SLVB 3E91A 4GHTA 3TGIE 1F0RA 4IMQA 3MNXA 4AGJA 1UTNA 3SV7A 1L0ZA 2V35A 1O39A 2SGDE 4ZMAH 2XBVA 3PYHA 1UO6A 3RXLA 2ZTYA 1MH0A 1EATA 2BDIA 1M9UA 2A7JA 3SU2A 1SGFA 1XKAC 1RGQA 1YC0A 2HLCA 4GPGA 1AVWA 5EW1H 1XUHA 1MTUA 1C1SA 4UDWH 1NTPA 4AB9A 3M3SA 1P01A 3NKKA 4K2YA 1UK4A 2HWLB 1QURH 1GJBB 3TITA 1TX7A 3S69A 4AX9H 3BG4C 2GMTB 2BY6X 3ITIA 1D6WA 1V2NT 4B74A 2JETC 4PROA 5IDKA 1ELVA 4GVUA 4XE4A 2BMGB 4NA7A 1MCTA 2NWNA 3ZV9A 1IOEA 1OYQA 4YLQH 3UREA 1SGNE 4GAWA 2GDEH 3SQEE 1EXFA 4ABAA 1O3KA 2GV6A 2PLXA 1K1JA 1DFPA 1SLWB 5EU8A 4XBCA 2ZKSA 2WPJS 4NSYA 2DUCA 2J2UA 3GDUA 1MKXH 3ZZAA 4K60A 2OC8A 4Z0KA 1K1NA 1YM0A 1OP0A 4I8LA 1HAYB 3SNAA 5CHAC 4BOHA 5A0BA 1O2KA 4YOGA 3SORA 1CA0C 2J95A 1YKTA 1ABJH 2AEIH 2VIOA 1S5SA 5HM2A 1GBAA 1V2OT 1TQ0B 1ZLRA 1C5PA 1YPHC 1P05A 2NU0E 1YLCA 1DWBH 1C5LH 5JB9S 1BTYA 1GG6B 3A7XA 1GL0E 1VJ9U 1NRNH 2BLQA 1ZHMA 2BZ6H 8GCHF 4DVAU 1ZHRA 2GMTC 2O8TA 4YT6H 1KIGH 2ZTXA 3AW1A 1HXEH 3TVJB 1GBJA 4XFQA 1UTPA 1TIOA 1O5FH 3RXCA 4TWWA 1IQLA 2B7DH 1O2IA 2QF0A 1XUKA 3A83A 5JBCS 1Z7KA 4BAHB 3VPKA 1MQ6A 4CRDA 3BEIB 3RP2A 3SU1A 1P12E 2VIWA 1C5YB 1QR3E 2BB4A 2B0FA 2A7HA 2P8OB 2C90B 4FUGA 4THNH 4NZLA 2AMPA 1TONA 1O5GH 1GHZA 1EOJA 2P93A 1FIWA 1HXFH 1GJAB 4X6PA 4CREA 1MTSA 5E2OA 2WYJA 2ZIQH 2ZC9H 1YCPH 1F0UA 1KXAA 1QA0A 2ULLA 3QLPH 3QZQA 4GHQA 1ANDA 1Z6JH 1MQ5A 4KP0A 4Y7AA 3E8LA 3JZ2B 4HI3A 1LHGH 3GCOA 1GG6C 1SI5H 2GVFA 3ZZ9A 1E35B 1Y5BT 3F6UH 3P92A 1TFXA 2A5AA 4H6TA 1C5UA 1ARBA 1G3EA 1HV7A 2UUKB 3T25A 1GBLA 1MUEB 4WMEA 1O3FA 3A7TA 3MH4A 2O8LA 3QX5H 3RU4D 3RLWH 1JXPA 1Q31A 4X1SU 4OGYA 3KHVA 3SUDA 1MAYA 4JYTA 4D8NA 1V2ST 1NRPH 2J38A 1CGIE 2NU1E 3P8NA 5EOKA 2CN0H 2ZO3H 2QXGA 2A4QA 1CHGA 2Z9JA 4DJZB 4DOQA 5DPAA 3ODDA 2AGIX 1DWCH 1GI4A 3ATMA 5GCHG 2ASUB 1TPAE 2P8OC 1GBMA 4E05H 2XC4A 1HAIH 2VINA 1FQ3A 3QGJA 4ABDA 1C2IA 4AFQA 1INCA 1EZUC 3SNCA 2A4OA 3SU4A 1K2I1 2BQWB 3K65B 3C1KA 1SFQB 5EQSA 4YT7H 1MD7A 3RXHA 3HKJB 1S82A 1TOMH 2OCVB 2Y82A 4MG3A 1H9HE 4FU8A 1BMNH 2M5TA 3SJ8A 1GHVH 1MBMA 5EODA 4UEHH 2Q6GA 4LZ4B 1ZRBA 1VZQH 1DPOA 3ZYEA 2AYWA 4F49A 2A4GA 3PMBB 4XSKU 3M61U 1UTMA 1FY4A 1OKXA 4WXVA 3NWUA 4I32A 1EP5A 1O2SA 2PKAB 3ATWA 2VIDA 4UFFH 2VJ1A 1GDNA 3M3VA 1EAIA 5BRRE 1BRCE 2A45B 3FP8E 2BY9X 1C5ZB 1GHAF 1SGTA 3A7VA 4CR5A 1GMHG 4Y6DA 2BX4A 2A2QH 1P10A 3A82A 3PROA 1TALA 1T8OA 1C2MA 3MH7A 1BQYA 2PGQB 3P70B 5EGMA 1TGBA 2VIVA 1P02A 1AWHB 2A0QB 2R2MB 4NFFA 5BPEA 2ZFRH 1AI8H 1TNLA 2Y5FA 3A84A 1OXGA 3VB3A 5LPFA 1LKAA 3RU4E 1BBRK 4DY7B 1AUTC 1O5BB 1V2KT 2STAE 1G30B 2F91A 1DUAA 2QIQA 1C2HA 4TY6A 1SGPE 4RN6A 2FOMB 1KSNA 2ZTZA 4INKA 3VEQB 3F68H 2RG3A 1TNIA 3D23A 1Y3XA 1C1NA 1C5MD 5EPYA 1QL8A 1VCPA 5FXLA 2FS9A 3QDZB 3PMAB 3RM2H 2V3HH 4CBOA 1FONA 3HKIB 3QTOH 4IS5A 4AFSA 3GCTG 1NRSH 3ZVEA 1KLIH 1UTQA 1K1PA 2ZCLP 1QJ1B 1J17T 1ZPZA 1DANH 4Y8XA 1H8DH 3MMGA 3SUGA 1O3IA 1OPHB 2PWXA 1HGTH 2FI5E 3BTGE 1KXEA 1AZ8A 1H4WA 3ESTA 1FDPA 1FXYA 2H2ZA 1ZHPA 1TNHA 5C20A 2BZAA 3T27A 3BTEE 2FZZA 1JBUH 1KY9A 3TK6A 3RXAA 3RXJA 5HGGA 2ZDMA 2R9PA 2BVSH 3KQDA 1EAUA 1LVMA 4FUFA 4J2YB 5F8TA 3E3TA 1ZTKA 2HOBA 4K1TA 2QXHA 2OTVA 1MTWA 5ETXA 3TK9A 3LGVA 1AD8H 4BNRA 2ANWA 3RXFA 2V6NA 1UK2A 4Y10E 2ODQA 2PR3A 1Y8TA 1G2LA 2A1DB 2GKVE 1TA2A 3SGQE 1VITG 1UTLM 2G5NA 3SV6A 2XW9A 1K1MA 2SGQE 3HK3B 5DP8A 1OWIA 3MI4A 1T31A 4FUHA 1BT7A 1TX6A 4OS1A 2WPIS 3RC4A 1YP9A 4E7NA 1JMOH 1VCQA 2XBXA 1A4WH 5DP3A 2QAAA 1OWDA 2EC9H 1C5OH 2ZHWH 3TK5A 4MQAA 1GL1A 3MO9A 1QHRB 4FUCA 1WQSA 4ABEA 2ZU5A 1ZRKA 1HAXB 3RLYH 5DP9A 1GGDB 2Z7FE 3MH6A 4MPXA 2F3CE 3SGAE 2GCHG 1Z8IB 2PW8H 5I46H 1C4U2 4MNYA 2ZDNA 1D4PB 1HJAB 2VWMA 4NSVA 4X6MA 3KL6A 3FP6E 3LKWA 1ELTA 1DT2A 1ZGIA 2CV3A 3SJKA 1EAWA 3SV9A 1UJ1A 1BJUA 1ANCA 1SHYA 1W10U 3ZZ8A 2WUCA 1TMBH 1ELAA 1ORFA 2BXTH 3T29A 1LKBA 1C1WH 2Z9LA 1V2LT 4WJG2 1AMHA 1GMCF 4CHAB 5EW2H 3I29A 1GJ4H 1VCWA 1YPEH 3SZNA 2FMJA 4DG4A 3SO3A 5DP6A 1CO7E 1GWAA 3RXGA 1V2TT 1BTWA 1O3PB 2UUFB 5F6MA 3AAVA 2C8YB 1UTOA 2EI6A 1HAGE 2F9NA 3P8FA 3LH1A 3EQ0H 1IQKA 4YTAA 3ZYDA 4E7RG 1DUEA 1LVYA 3LC5A 1CGJE 1EUFA 1FPHH 1C5NH 1LPZB 5JBBS 4OGXA 1GCTB 4JYVH 2OP9A 1V6DA 4GLYA 4CRFA 1P9UA 1SFIA 1P57B 1V3XA 3NK8A 1BRAA 1A7SA 3TNTA 4ASHA 3W95A 1EPTB 2Z9KA 1O2NA 3ATKA 3EA9A 4Q7YA 1P2MA 5F8XA 1JIRA 1HJAC 3B23B 4RSPA 5FAHA 3BV9B 3PTBA 3LC3A 1DLKB 1C9TA 2BX3A 4D9RA 2FOFA 3GCNA 1QJ6B 3BG8A 3FZZA 2C8WB 3RMLH 1QQ4A 3K2UA 3HK6B 3NUMA 1DX5M 2G51A 3IITA 1MTVA 1TBQH 4CHAC 4BAKB 3DA9B 1QNJA 2QY0B 1EX3A 3S9BA 1A46H 4OS2A 1IQMA 1J14A 1SGEE 4O3TA 2AMDA 5L2ZH 7ESTE 4UFGH 3UNRA 3TGJE 4YESB 2ZCHP 1TAWA 1O30A 1BB0B 2H5CA 2Q1JA 2VWNA 1EOLA 5JYIA 3WY8A 1GI3A 2ZI2H 1WV7H 1BDAA 1P8VC 3SHAH 3LGYA 3Q76A 4O3UA 1BTXA 1O3MA 1C1VH 1HAVB 3BN9A 2RDLA 4DIHH 1A2CH 5E0JA 1GI1A 4ZHAA 4D76A 2SGAA 1CHOG 1DWDH 3NCLA 4NA8A 1YBWA 3GCHB 1GCTC 1T4UH 2Z3EA 2BD4A 5HM9A 3EGKH 1F5KU 1LDTT 1AIXH 3LDXH 4MPUA 3TU7H 2HGTH 7LPRA 3Q00A 1E36B 5C5NA 1NFUA 1ZTJA 1ELFA 1EPTC 1TPOA 3BSQA 1O2UA 5FX6A 1H9IE 3PLPA 4IMZA 2HPPH 1WUNH 2XC0A 1UCYE 2ZGCA 2FODA 2FOBA 4IW4E 1CT4E 1EB2A 1TMTH 3BTTE 3VXEH 5E2PA 1KTSB 4AFZA 3UY9A 1AFEH 4UONA 1XUIA 3B8JA 1JWTA 1O2JA 2QXIA 2DE8A 1LO6A 4JZFH 5JPMH 7KMEH 1THRH 4UFEH 2V0BA 2BTCE 1MD8A 3SNDA 5E8EH 2C4FH 3SV8A 1EJAA 1EJNA 1KLTA 2KAIB 4ZKRU 2ZHDA 1T32A 2AIQA 3GDVA 1O3JA 3RC6A 1GMDG 2GT7A 4LXBH 4FVBA 3GISB 3E0NB 2ZFPH 1NZQH 2AGGX 3W94A 2HPQH 3M35A 1O2TA 4LK4A 1VR1H 3SBKA 2ZQ1A 5CMXH 2FESH 3MWIU 1P2QA 4KKDA 1DWEH 3RXUA 2ANMH 3GY3A 1KDQB 2A5KA 2BD7A 1UHBB 1XKBC 3RXIA 4K5ZA 3GCHC 2J92A 2QGRA 2UUJB 2SNVA 5AHGH 3T5FH 3UIRA 4ABFA 4BAQB 2PTNA 2TGAA 3I78A 3URCA 2Y6TA 4X2VA 1TQ7B 1ZSJA 2CF8H 3EAJA 1ZMLA 2R2WU 2XBWA 2FXRA 3M3TA 2FS8A 1TRMA 1LVBA 1GBKA 2WYGA 4JK5A 1YLDA 1GVKB 3F9GA 3CP7A 4NCYA 3U8OH 1AY6H 1NU9A 1GVZA 2PV9B 3A7ZA 3P8GA 1NC6A 1TOCB 3STJA 4DW2U 3RC5A 3MU8A 3KQBA 2NU4E 3U69H 4DURA 5I25A 3TGKE 2EI7A 2PHBA 2CHAB 5C2ZA 3AAUA 3BTWE 4NWLA 1O5DH 1T4VH 1K1LA 1PJPA 3ZZDA 2FLBH 4JK6A 2XBYA 6GCHF 4DT7B 3AVZA 4ISOA 1G3DA 1U6QA 3UTUH 1A5GH 4TWYA 4MNVA 3HATH 1HPGA 2G8TA 4ZXYH 2K1QA 3P6ZB 1DE7H 1HBTH 4YLUA 1C1PA 1WTHD 2JH0D 5EG4A 1BJVA 5E0GA 1MKWK 4B71A 1ELBA 1HNEE 2FOHA 1HB0B 3E16B 2H9TH 3A89A 1GI7B 2FYRA 2VNTA 4BAOB 2HALA 4O9VA 1F0SA 1ANBA 2FOAA 4HGCA 1JIMA 3SNBA 1PYTD 3UQVA 3V3MA 1V2VT 2P3UB 1GBTA 3H7OA 4Y0YE 5ESTE 5L2YH 4U2WA 1O2RA 5PTPA 1W13U 1S6HA 2ZECA 3M5OA 3OX7U 1DVAH 2WV4A 1GHBF 2XCNA 2C3SA 4ABGA 1GCDA 4D9QA 8GCHG 1GJDB 2LNCA 4AYVB 1LQDB 1CT0E 4I8KA 4ZUHA 3ZZ6A 1EZSC 1S0RA 4A1XA 1W7XH 2I6SA 3D62A 3ZVAA 4J1YA 4A1VA 1TGTA 5DP4A 2CHAC 2O8MA 2C8XB 2QXJA 5F8ZA 3DUXH 2ZHEH 1O2PA 4A7IB 2SGEE 1TNJA 4QT8C 2OINA 1H1BA 1ELGA 2ALVA 3UPEA 4MLFB 1GI6A 1PPFE 3R0FA 1O2ZA 1P09A 1YCPM 2P59A 4Z6AH 1AVXA 1FUJA 5C3NA 3O8BA 6LPRA 5K0HA 1WSSH 1TX8A 4I7YH 4LOYH 3MO6A 5JBAS 1WBGB 1QBVH 1LHCH 2W26A 3DFLA 4YM9A 9LPRA 1Q2WA 1GHXH 3M7QA 4X1NU 3UR9A 1FY8E 3IG6B 1FY3A 3OU0A 5JB8S 3P17H 3TJOA 4NZQA 1C1TA 3VB4A 5J4SA 1TGNA 4NIWA 2P16A 5TCAA 1DITH 5AFZH 3KNXA 3C27B 1LHFH 3S7KB 1TBZH 3RXTA 4ZROA 3SUFA 1D3PB 2FTLE 5T6FA 1F0TA 2BD2A 4INLA 1SSXA 2XXLA 3K6YA 3Q77A 4AZ2B 2H9HA 4JZDH 2ZF0H 1ZPCA 1L4DA 1ZGVA 1BCUH 1BTPA 4X2XA 2ZHFH 1EB1H 3U1JB 1MCVA 1IQGA 1QRZA 2Y5HA 2J9NA 1HAOH 1ESAA 5J4QA 1YPLH 4X8TH 1FIZA 1BHXB 4M7GA 2FYQA 4OS6A 5FBIA 1HJ9A 3F1SB 1F7ZA 2FDAA 4IGDA 1NROH 1L1JA 3SNEA 1CGHA 3BTFE 4U01A 3UQOA 3ZV8A 4AYYB 1NESE 2Q6FA 2BOKA 3SU6A 1P11E 3TJVA 8KME2 1QRWA 1GJCB 4Y79A 1O0DH 1EPTA 2CGAA 1O2QA 4AGKA 3HGNA 3NXPA 4OS4A 1HDTH 2QYIA 2Y7ZA 4ESTE 5A09A 2A2XH 3E90B 2WPKS 2BOHB 2AH4X 4JZ1A 2ZDLA 1UCYK 1Z8GA 1RFNA 1SHHB 1GDQA 3M7TA 1OX1A 2WINI 1AN1E 2RCEA 2Y80A 1QBOA 1K28D 2FP7B 4RKJB 3SU3A 5HXFA 3S9AA 1KXFA 2AS9A 1SPJA 1SOTA 3ZZ5A 3PLBA 3F9HA 4XBDA 3SGBE 3ZZCA 3NPSA 1GI9B 3S0NA 1FJSA 1OYTH 4E06H 1GI5A 1GHAG 1AZZA 3QZRA 1GJ9B 1H9LB 5DP5A 1FNIA 1IHTH 3SJOA 2HNTC 4X6OA 1BZXE 3U1IB 2VVCA 1HAVA 1O2XA 2JKHA 3RMNH 1A3BH 1QCPA 3QWCH 4I8HA 1IAUA 1H8IH 2BDAA 1LCYA 2TPIZ 1CBWB 3MNBA 1CE5A 5JBTA 2HRVA 1V2PT 2ZHQH 3SQHE 2Z94A 3V7TA 1ZMNA 3M5MA 2Z3CA 1RRKA 5GWZA 2AIPA 2BDBA 1RXPA 5EQRA 3UR6A 2Z9GA 1ANEA 4Y8ZA 1B7XB 2EEKA 2PTCE 4AG2A 1O37A 1JRTA 1ACBE 1IQEA 1SGDE 2BLWA 1AFQB 1Y3VA 1MZAA 3Q3KA 4TYDA 3D49H 3BTQE 5AFYH 1O3GA 1C1UH 4Q7ZA 3RDZA 3BIVH 2BDGA 5A8YA 2KAIA 5C67A 1O2HA 2UWOA 3ZVBA 1QB9A 2JH6D 1NFYA 2ZU1A 1B0FA 1YPHE 3A8CA 5GPIB 5LH8A 2QCYA 1LPGB 1Z1JA 5FCKA 4GCHG 1C2EA 1SGCA 4SGAE 2WV5A 3GY8A 2F83A 4Y0ZE 2ODPA
chains in the Genus database with same CATH superfamily
3H09A 1P06A 1ZPBA 2H5DA 4H6SB 3A7WA 1MKXK 1W8BH 1T8MA 2BLOA 1KDQA 1UHBA 3URDA 3GYLB 3IWMA 2OBQA 1C2GA 1CBWC 1W7GH 1ABIH 3OY5U 3M36A 5EQQA 5CDFE 2EA3A 1AHTH 2ZPRA 1UTKA 2L74A 1QB1A 3PMHB 2PSXA 4ISHH 2OBOA 2P94A 1TWXB 3KEEA 5GIBA 1IQHA 1AFQC 3ENSB 1SGRE 4MTBA 4I33A 1EQ9A 1NRQH 1SQAA 1X7AC 5EXMA 2Y7XA 4MVNA 3LJJA 3PV4A 1GJ5H 2B5TB 4WXIA 3KYFA 1MAXA 1KYNA 1P2KA 2ZGHA 5FPSA 1TB6H 1P2NA 1O2OA 1PQAA 4A1TA 3SU5A 1ETSH 2J97A 1V2MT 1JOUB 3K9XB 2O8UA 5FPTA 1P3CA 1W2KH 2A4RA 3KCGH 1DY9A 3B9FH 4H42U 3FVFB 3PTNA 4HFPB 1QQUA 5C1XA 1N8OB 1KMHB 2BDCA 2VH0A 1G3CA 4NGAH 2SGPE 1G32B 1SQTA 3GY2A 2IOTA 1C2DA 2P3FH 1IQFA 4AOQA 1RS0A 3OEHD 4AFUA 1T8LA 1HYLA 1GMCG 1YCPK 2XC5A 1VITH 2ZNKH 5K7RA 2G4UA 3V13A 3STIA 4WWYA 1GI2A 7GCHF 3RMMH 5AVDA 1HUTH 2ZDVH 1W11U 4FU7A 3RXVA 2OC0A 2G55A 1NM6A 2J98A 2FIRH 3SV2H 2C8ZB 5EXLA 1Y3YA 1BRUP 1GVLA 3MNSA 1QIXB 1WDIA 1GGDC 2ANKH 1ELDE 1SGQE 4ZCNA 1P0SH 5FL7D 1SG8B 5CE1A 3TIUA 1A5IA 1TGSZ 2ZU2A 2PKSB 2IPHA 1F5LA 1P03A 1W12U 4YXWD 5DKMA 1ZYOA 2YOLA 3M5NA 5GXPA 3MOCA 4RT0A 6ESTA 1Z8JB 2F9OA 2ZPSA 1C5VA 3QTVH 3VFEA 4GSOA 4YO9A 3WWBA 3OTJE 3K6ZA 2PUQH 1L1GA 1SB1H 2F9BH 4BXSA 1PFXC 3A8DA 1N8OC 3UUZA 3AW0A 2QF3A 2R0KA 1C1RA 1D3DB 1SGFG 4JCNA 2BLVA 1ZR0A 3LPRA 1E1RD 3PO1B 4Y76A 3S7HB 1OWKA 3N7OA 3DSPA 1S84A 1ELEE 4F48B 3LGWA 1QRXA 1LHEH 2UWLA 3UWIA 1NS3A 1MMJN 3PM3A 1DXWA 3TH4H 1ETRH 2FTMA 3BTME 1TBRH 4K8YA 1J9CH 1A5HA 4ZH8A 1O3CA 3G01A 1CVWH 3KF2A 2ZEBA 3I77A 2XWBI 1SLUB 1O5CB 2BDYA 3MU4A 1K9OE 4XD7D 1O3HA 1C4Y2 5IK2D 1Z8RA 2HNTE 4Q4LA 1SBWA 3LIWA 1TPSA 5SGAE 3RXKA 1O2MA 2VIQA 2BD5A 2G52A 2BD8A 3PRDA 4K8BA 2WPDD 5T3HA 3LGUA 3SJ9A 3JZ1B 1EZXC 4FETA 4Q63A 2H9EH 4ISNA 5EIYA 2PKSC 2OLGA 3RXMA 1L1NA 3LGTA 3O8CA 2ZU3A 3FP7E 4IC5A 3Q3XA 2A5IA 1O33A 1ZJKA 3P8OA 1QY6A 1NU7B 2ZFSA 4NA9H 2FOEA 2R3YA 3DHKH 1A0HB 1DOJA 2JIZD 3KGPA 4BANB 5LPRA 3S9CA 1AVGH 1THSH 1QB6A 1O35A 4CR9A 3PO1C 1UVSH 5F03A 2GZ7A 1CQQA 1GBIA 1WOFA 1AKSB 2PFEA 1YGCH 5FHTA 2OQUA 2FM2A 3RXOA 3U98H 1RTKA 4ABHA 1C5WB 1F5RA 3GY6A 4X0WU 4BTIB 1MABB 1UVTH 1GBEA 1YPMH 1O3LA 1GJ8B 1TYNA 4OS7A 3BTHE 2IJOB 1O3BA 2PKAA 1AQ7A 3V0XA 1Y3WA 1BBRH 2A7CA 1MU6B 5GDSH 2C93B 2A31A 1SVPA 2BYAX 4KELA 5DG6A 3UFAA 1UK3A 2FO9A 4HTCH 1RD3B 3RXRA 2ZU4A 1NFXA 1N6XA 1XVOA 1YPJH 5C94A 4X1QU 5LGOA 1V2QT 1N1LA 1Q3XA 3M37A 3FZDA 1TNGA 2AERH 1DICA 2TIOA 4FUEA 3UOUA 4X8SH 2ZZUH 1W14U 1K22H 1C2KA 1XUJA 1MBQA 4I8JA 1D9IA 1OWJA 4WMFA 2WPLS 1BMMH 3EA8A 2B8OH 5EJ1A 2ZGBH 2J4IA 3MTYA 2SFAA 4UE7H 5DN6D 3LOXA 2IJD1 5C0UA 2GV7A 2CXVA 2V3OH 1FAXA 2BQ7B 4LZ1H 4Q80A 1QL9A 1O2LA 1DSUA 2GCTB 3D65E 4FUJA 1RTLA 3MYWA 4DIIH 1GBCA 3LT3A 5FCRA 4R0IA 2BVRH 4Y71A 1VJAU 1WAYB 3ZVCA 3N99A 2J94A 4IN1A 1OP2A 1Y59T 3L3TA 2Z6BD 2ZFFH 2PGBB 2BQ6B 1LVOA 3TNSA 1C5QA 3BIUH 4BTTB 2XRCA 6GCHG 1A0JA 2VH6A 1P9SA 1THPB 3ZZ7A 4BXWA 4K69A 4NFEA 3L6PA 4B6FA 2QV1A 3OSYA 3A86A 1P2JA 2W6ID 4X6NA 1GDUA 1TABE 4WF8A 2PSYA 2XCFA 1CT2E 2THFB 1MU8B 4ZAEA 2O8WA 2R3UA 2D26C 1C1QA 2F4LA 5C0TA 1P2OA 1PPCE 2RA0A 3A8AA 4ISIH 1K0HA 4O97A 1FPCH 1AU8A 2ZDKA 2FWWA 2PP6A 2VGCB 1C5TA 2QF4A 1FV9A 4Y11E 4B75A 4IBLH 1BITA 1TLDA 2ZA5A 2GCTC 1C5RA 2ALPA 1GHBG 1D3QB 2A32A 3FAOA 4INHA 1BMAA 1ZOMA 1SOZA 1K1IA 5KGOA 1IQNA 4U30A 4VGCB 3TH2H 1O34A 3GY7A 1IQJA 1O31A 2QC2A 1HIAB 1EZQA 2VBCA 3UNSA 4X8UH 3T62A 1KXCA 1V2WT 5GNDA 1OS8A 1LHDH 3M7UA 4KTCA 2Z3DA 5TJXA 3A80A 1COWD 3BF6H 2SNWA 2YMSB 2Y81A 1OWHA 5GJ4B 2BD9A 1C5XB 1FZZA 4A92A 1ID5H 3PLKA 5AF9H 4ZHMU 1O32A 2KCYA 1LTOA 1ESTA 2W3KA 5DK1A 1BTHH 1GPZA 2YNBA 3RUOA 3VB7A 3UWJH 4ZKNU 1TA6A 1WTGH 1QTFA 3TPIZ 5B6OA 1BRBE 2QN5T 1HAHH 1AO5A 1BA8B 2GGVB 4Y8YA 1SLXB 1SL3A 3H5CB 1C1MA 3SYJA 1DY8A 1YF4A 5C1UA 1QBNA 2D1JA 2G00A 3HGPA 4B2AA 3LH3A 2HVXA 1ETTH 2VVUA 1S6FA 4KGAA 4JZIA 1FLEE 3BEUA 4TPIZ 5A0AE 1DSTA 1H8HD 3ZVDA 1OSSA 2VGCC 1NY22 5DP7A 2KFWA 1QJ7B 1AUJA 1VGCB 2WUBA 2B9LA 2FEQH 3U9AH 2ZG0H 3MU5A 4B2CA 1ELCA 1S83A 4MNXA 4XBBA 3SJIA 5GCHF 2VIPA 3CNRA 1LPKB 1PQ7A 5HIYA 4VGCC 4YOIA 1GI8B 1WQVH 1PQ8A 5HYOA 2VWLA 2Y5GA 3TH3H 1V2UT 4ACBA 1QGFA 5FX5A 5LPEA 2NU2E 3MHWU 3EE0B 3SI4H 1ZSLA 1Y3UA 4WMDA 5L30H 1E34B 4NG9H 2ZQ2A 4CH2B 1D3TB 1CSOE 5C17A 2YMSC 2EI8A 3ZVGA 1K21H 2ZFQH 1O2GH 3A87A 4Q2KA 3TLOA 2YNAA 1FAKH 4UD9H 4ABJA 3LONA 1E1QD 1FI8A 1BTZA 1G36A 2W5EA 4Y7BA 4WH8A 2XTTB 3RXEA 3SI3H 5EXNA 1DLEA 2GZ8A 3SOSA 4GUXA 2P95A 1N6YA 4KTSA 1YY3A 2CJIA 4XRNA 3PV2A 1BOQA 1AE5A 3A8BA 4IC6A 5DO4H 1S85A 2BXUH 2KCAA 5C5OA 1HLTH 3LGIA 1HAZB 1KXDA 3L33A 4X8VH 4CRBA 2KX4A 1Z71A 1GBFA 1W0ZU 3BTKE 3SU0A 1ZZZA 1NN6A 1JRSA 5C1YA 2TRMA 1J16A 1O2VA 2CF9H 1VGCC 1GBBA 1XXDA 1EASA 1GMHF 5A8ZA 3VB5A 3M5LA 4YZUA 2NU3E 1SGYE 1O2YA 2FPZA 4FUDA 4D7FA 1NRRH 1C2FA 3RU4T 4FOUC 3ZZ4A 3FKSD 4DGJA 2KCPA 2ZWLH 1BMLA 4RKOB 1IQIA 1WYKA 2FLRH 4AB8A 1W0KD 4I86A 4FVDA 4XOJA 2ANYA 4CRCA 4XDEA 3LU9B 1XX9A 2DE9A 2WPMS 1S81A 1A3EH 1HCGA 4P02A 2CMYA 4ZXXH 2GD4B 4CH8B 3F0OA 3QN7A 1TGCA 6CHAB 1G3BA 1PPGE 3HPTB 4ZKSU 3GY4A 1BUIA 4Q7XA 2V3MA 2K8IA 4X1RU 1O3EA 1NT1A 3F9EA 3ATIA 2XYAA 2O9QA 2ZGJA 8ESTE 1HAPH 1CA8B 1O3AA 1E38B 2XNIA 1D6RA 1EKBB 1BIOA 1ZTLA 3GCTF 3QK1A 1W0JD 2GT8A 3T26A 4IN2A 5ABWA 4BTUB 1NBME 4D7GA 3VGCB 3P95A 3EYDA 1HRTH 3A7YA 4AG1A 1AKSA 1LMWB 3GYMA 2HVYB 4HZHA 2OC1A 1GHYH 1O5EH 3DFJA 3MH5A 1J8AA 4JYUH 1YYY1 2W3IA 1W3CA 4GCHF 3R3GB 2G4TA 1FMGA 1C2LA 1UVOA 3KIDU 5B6LA 2BDHA 3GDSA 3PWBA 2QF5A 4JMYA 1RJXB 4SGBE 1ZMJA 4KTUA 4CBNA 3FFGA 2F9VA 1E0FD 4UFDH 3OYPA 1G2MA 1A1RA 1TRNA 2IN2A 5IYTA 1HJ8A 2SGFE 1O3OA 3QO6A 1XXFA 1GJ7B 4AORA 2XWAA 1FY5A 3A81A 2JH5D 1XUGA 1XMNB 2J34A 4BAMB 2TGPZ 4ABBA 3F9FA 1UTJA 3FN8A 1ARCA 1V2JT 4B1TA 1V2RT 1VITF 2D8WA 6CHAC 2G81E 1SC8U 4U32A 2PUXB 3SHCH 2FX6A 2UWPA 3RM0H 2FI3E 3E0PB 4I8GA 4WH6A 4ZHLU 2OD3B 4MNWA 4MPWA 1O38A 2R0LA 2ZFTA 5FPYA 3DT0H 1L4ZA 4O03A 5L6NH 3RXPA 3SUEA 2FOGA 2AFQB 1RIWB 4TSFD 2ZDAH 3O8DA 1GJ6A 4MDSA 1NO9H 2QA9E 1C5SA 3T2NA 2P3TB 2BY7X 1A61H 1MKWH 2BY5X 2H1UA 2I6QA 3OY6U 1Z6EA 3VGCC 1P3EA 3ZZ3A 4JZEH 3MU1A 2ZGXH 2OQ5A 1P04A 1EJMA 2GCHF 1PPEE 3H7TA 1O36A 1F2SE 3RXBA 4X2YA 5JDUB 2WPHS 2M2AA 3PMJA 1A0LA 4TY7A 3WWFA 2Z9IA 2CK3D 2BD3A 4X2WA 2OXSA 3MU0A 4F4OC 1YPKH 2BHGA 2Q6DA 3GICB 3KN2A 3BTDE 4ABIA 3E1XB 1EP6A 1DS2E 2GP9B 3BEFB 2VVVA 3EDXB 2D2DA 3CS7A 1TRYA 1XM1A 3Q3YA 2FOCA 1UVPA 4NWKA 4WVPE 1TNKA 2HNTF 1ZSKA 3GOVB 1SGIB 2AMQA 1FY1A 3QGNB 2ILNA 3CENA 1BHXF 1QA7A 4B76A 2W7UA 2G5VA 4X1PU 3CS0A 1LQEA 1KXBA 4A6LA 2AGEX 3MO3A 2BVXH 3UNQA 5HKKD 3PB1E 1B0EA 1RIWC 1SR5C 1T8NA 1TMUH 3ZIAD 1Y5UT 2ZP0H 5A0CA 3F2GA 3RMOH 1K1OA 2VB0A 2W7SA 1OOKB 4R8TB 1QFKH 1UMAH 1SQOA 5T6DA 4Z1MD 3QUMP 1J15A 4FUBA 3U8TH 1O2WA 3ATLA 7GCHG 1S0QA 1AE8H 2TBSA 1WCZA 2LPRA 3E6PH 2GDDA 2ESTE 2BY8X 1ESBA 3GY5A 3TJUA 1T7CA 3N7DA 2GX4A 4YOJA 1L2EA 1HIAA 5KECA 3KQCA 5DJ7A 5EJZA 1GI0A 1AGJA 1FN6A 2TGDA 3RXSA 1YWUA 3SN8A 2RA3A 5G4BA 3UOPA 4WY3A 1GBDA 3LJOA 3V12A 4NIXA 3RXQA 2FX4A 1KLJH 4NIYA 1DM4B 1OWEA 1YPGH 3VG8A 4A5TS 3DD2H 1F92A 3RXDA 1AB9B 9ESTA 3TJNA 3U8RH 3MFJA 1DXPA 2VWOA 4B2BA 1E37B 2OUAA 4I31A 5A2MH 1O3DA 3O8RA 3A85A 1FN8A 1TPPA 5FBEA 4DCDA 4ZKOU 2WZQA 3T28A 4FU9A 2BM2A 1C9PA 2GZ9A 3MNCA 4OS5A 1Y5AT 5T6GA 5H4IB 1MTNB 4CRGA 1NFWA 2TGTA 2ZCKP 3AASA 1MZDA 1C1OA 2F9UA 1CHOF 2KR7A 2STBE 1XUFA 1EAXA 3SW2B 5CHBA 3NZIA 1GHWH 1SMFE 4TPYA 1KTTB 1XVMA 1WU1A 1AWFH 5A8XA 1DDJA 2ZPQA 1OP8A 1NPMA 2OC7A 1UCYH 3PWCA 5HMAA 2UUYA 5E0HA 3A88A 3ZZBA 4H4FA 1BTUA 5F53A 2F9PA 1RTFB 4K1EA 1PYTC 4CRAA 1G37A 1QL7A 1TE0A 4FXGH 3VB6A 2VU8E 4NIVA 4FUIA 1AB9C 2FI4E 3BG4B 3EA7A 3KQEA 3ODFA 3UB0A 2H6MA 1Z1IA 5EPNA 1P2IA 1GMDF 5ESBA 1GBHA 2JETB 4B73A 5DGJA 1PQ5A 1O3NA 5KEDA 3FANA 3ZVFA 1ZJDA 2GTBA 1CU1A 2GJGA 1C2JA 1G9IE 1UVUH 4K3JA 5TCCA 1MTNC 1B5GH 1C4V2 4MPVA 1W0YH 4K1SA 3VXFH 1PPBH 8LPRA 4AN7A 4ISLA 1IHSH 1O5AB 1PPZA 2RFKC 5CHAB 1HFDA 4B6EA 1PPHE 2ODYB 3ELAH 1CA0B 1BBRE 1SLVB 3E91A 4GHTA 3TGIE 1F0RA 4IMQA 3MNXA 4AGJA 1UTNA 3SV7A 1L0ZA 2V35A 1O39A 2SGDE 4ZMAH 2KCOA 2XBVA 3PYHA 1UO6A 3RXLA 2ZTYA 1MH0A 2BDIA 1EATA 1M9UA 2A7JA 3SU2A 1SGFA 1XKAC 1RGQA 1YC0A 2HLCA 4GPGA 1AVWA 5EW1H 1XUHA 1MTUA 1C1SA 4UDWH 1NTPA 4AB9A 3M3SA 1P01A 3NKKA 4K2YA 1UK4A 2HWLB 3MQKC 1QURH 1GJBB 3TITA 1TX7A 3S69A 4AX9H 3BG4C 2GMTB 2BY6X 3ITIA 1D6WA 1V2NT 4B74A 2JETC 4PROA 5IDKA 1ELVA 4GVUA 4XE4A 2BMGB 2KZ4A 1MCTA 2NWNA 4NA7A 3ZV9A 1IOEA 1OYQA 4YLQH 3UREA 1SGNE 4GAWA 2GDEH 3SQEE 1EXFA 4ABAA 1O3KA 2GV6A 2PLXA 3WW7A 1K1JA 1DFPA 1SLWB 5EU8A 4XBCA 2ZKSA 2WPJS 4NSYA 2DUCA 2J2UA 3GDUA 1MKXH 3ZZAA 4K60A 2OC8A 4Z0KA 1K1NA 1YM0A 1OP0A 4I8LA 1HAYB 3SNAA 5CHAC 4BOHA 5A0BA 1O2KA 4YOGA 3SORA 1CA0C 2J95A 2K0QA 1YKTA 1ABJH 2AEIH 2VIOA 1S5SA 5HM2A 1GBAA 1V2OT 1TQ0B 1ZLRA 1C5PA 1YPHC 1P05A 2XOKD 3OEED 2NU0E 1YLCA 1DWBH 1E79D 1C5LH 2AHME 5JB9S 1BTYA 1GG6B 3A7XA 1GL0E 1VJ9U 1NRNH 2BLQA 1ZHMA 2BZ6H 8GCHF 4DVAU 1ZHRA 2GMTC 2O8TA 4YT6H 1KIGH 2ZTXA 3AW1A 1HXEH 3TVJB 1GBJA 4XFQA 1UTPA 1TIOA 1O5FH 3RXCA 4TWWA 1IQLA 2B7DH 2J98B 3DCLA 1O2IA 2QF0A 1XUKA 3A83A 5JBCS 1Z7KA 4BAHB 3VPKA 1MQ6A 4CRDA 3BEIB 3RP2A 3SU1A 1P12E 2VIWA 1C5YB 1QR3E 2BB4A 2B0FA 2A7HA 2P8OB 2C90B 4FUGA 4THNH 4NZLA 2AMPA 1TONA 1O5GH 1GHZA 1EOJA 2P93A 1FIWA 1HXFH 1GJAB 4X6PA 4CREA 1MTSA 5E2OA 2WYJA 2ZIQH 2ZC9H 1YCPH 1F0UA 1KXAA 1QA0A 2ULLA 3QLPH 3QZQA 4GHQA 1ANDA 1Z6JH 1MQ5A 4KP0A 2JJ2D 1WXRA 4Y7AA 4RT1A 3E8LA 3JZ2B 4HI3A 1LHGH 3GCOA 1GG6C 1SI5H 2GVFA 3ZZ9A 1E35B 1Y5BT 3F6UH 3P92A 1TFXA 2A5AA 4H6TA 1C5UA 1ARBA 1G3EA 1HV7A 2UUKB 3T25A 1GBLA 1MUEB 4WMEA 1O3FA 3A7TA 3MH4A 2O8LA 3QX5H 3RU4D 3RLWH 1JXPA 1Q31A 4X1SU 4OGYA 3KHVA 3SUDA 1MAYA 3PV5A 4JYTA 4D8NA 1V2ST 1NRPH 2J38A 1CGIE 2NU1E 2W6JD 3P8NA 5EOKA 2CN0H 2ZO3H 2QXGA 2A4QA 1CHGA 2Z9JA 4DJZB 4DOQA 5DPAA 3ODDA 2AGIX 1DWCH 3DSOA 1GI4A 3UAIC 3ATMA 5GCHG 2ASUB 1TPAE 2P8OC 1GBMA 4E05H 2XC4A 1HAIH 2VINA 1FQ3A 1NBMD 3QGJA 4ABDA 1C2IA 4AFQA 1INCA 1EZUC 3SNCA 2A4OA 3SU4A 1K2I1 2BQWB 3K65B 2F43B 3C1KA 1SFQB 5EQSA 4YT7H 1MD7A 3RXHA 3HKJB 1S82A 1TOMH 2OCVB 2Y82A 4MG3A 1H9HE 4FU8A 1BMNH 2M5TA 3SJ8A 1GHVH 4TT3D 1MBMA 5EODA 4UEHH 2Q6GA 4LZ4B 1ZRBA 1VZQH 1DPOA 3ZYEA 2AYWA 4F49A 2A4GA 3PMBB 4XSKU 3M61U 1UTMA 1FY4A 1OKXA 4WXVA 3NWUA 4I32A 1EP5A 1O2SA 2PKAB 3ATWA 2VIDA 4UFFH 2VJ1A 3OAAD 1GDNA 3M3VA 1EAIA 5BRRE 1BRCE 2A45B 3FP8E 2BY9X 1C5ZB 1GHAF 1SGTA 3A7VA 4CR5A 1GMHG 4Y6DA 2BX4A 2A2QH 1P10A 3A82A 3PROA 1TALA 1T8OA 1C2MA 3MH7A 1BQYA 2PGQB 3P70B 5EGMA 1TGBA 2VIVA 3OFND 1P02A 1AWHB 2A0QB 2R2MB 4NFFA 5BPEA 2ZFRH 1AI8H 1TNLA 2Y5FA 3A84A 1OXGA 2EY4C 4RI0A 3VB3A 5LPFA 1LKAA 3RU4E 1BBRK 4DY7B 1AUTC 1O5BB 1V2KT 2STAE 1G30B 2F91A 1DUAA 2QIQA 1C2HA 4TY6A 1SGPE 4RN6A 2FOMB 1KSNA 2ZTZA 4INKA 3VEQB 3F68H 2RG3A 1TNIA 3D23A 1Y3XA 1C1NA 1C5MD 5EPYA 1QL8A 1VCPA 5FXLA 2FS9A 3QDZB 3PMAB 3RM2H 2V3HH 4CBOA 1FONA 3HKIB 1SQRA 3QTOH 4IS5A 4AFSA 3GCTG 1NRSH 3ZVEA 1KLIH 1UTQA 1K1PA 2ZCLP 1QJ1B 1J17T 1ZPZA 1DANH 4Y8XA 1H8DH 3MMGA 3SUGA 1O3IA 1OPHB 2PWXA 1HGTH 2FI5E 3BTGE 1KXEA 1AZ8A 1H4WA 3ESTA 1FDPA 1FXYA 2H2ZA 1ZHPA 1TNHA 5C20A 2BZAA 3T27A 3BTEE 5EJLA 2FZZA 1JBUH 1KY9A 3TK6A 3RXAA 3RXJA 5HGGA 2ZDMA 2R9PA 2BVSH 4F55A 3KQDA 1EAUA 1LVMA 4FUFA 4J2YB 5F8TA 3E3TA 1ZTKA 2YMSD 2HOBA 4K1TA 2QXHA 2OTVA 1MTWA 5ETXA 3TK9A 3LGVA 1AD8H 4BNRA 2ANWA 3RXFA 2V6NA 1UK2A 4Y10E 2ODQA 2PR3A 1Y8TA 1G2LA 2A1DB 2GKVE 1TA2A 5DSFA 3SGQE 1VITG 1UTLM 2G5NA 3SV6A 2XW9A 1K1MA 2SGQE 2RDEA 3HK3B 5DP8A 1OWIA 3MI4A 1T31A 4FUHA 1BT7A 1TX6A 4OS1A 2XNDD 4OM9A 2WPIS 3RC4A 1YP9A 4E7NA 1JMOH 1VCQA 2XBXA 1A4WH 5DP3A 2QAAA 1OWDA 2EC9H 1C5OH 2ZHWH 3TK5A 1SKYE 1GL1A 4MQAA 3MO9A 1QHRB 4FUCA 1WQSA 4ABEA 2ZU5A 1ZRKA 1HAXB 3RLYH 5DP9A 1GGDB 2Z7FE 3MH6A 4MPXA 2F3CE 3SGAE 2GCHG 1Z8IB 2PW8H 5I46H 1C4U2 4MNYA 2ZDNA 1D4PB 1HJAB 2VWMA 4NSVA 4X6MA 3KL6A 3FP6E 3LKWA 1ELTA 1DT2A 1ZGIA 2CV3A 3SJKA 1EAWA 3SV9A 3NRLA 1UJ1A 1BJUA 1ANCA 1SHYA 1W10U 3ZZ8A 2WUCA 1TMBH 1ELAA 1ORFA 2BXTH 5T1VA 3T29A 1LKBA 1C1WH 2Z9LA 1V2LT 4WJG2 3F2FA 1AMHA 1GMCF 4CHAB 5EW2H 3KYGA 3I29A 1GJ4H 1VCWA 1H8ED 1YPEH 3SZNA 2FMJA 4DG4A 3SO3A 5DP6A 1CO7E 1GWAA 3RXGA 1V2TT 2IPQX 1BTWA 1O3PB 2UUFB 5F6MA 3AAVA 2C8YB 1UTOA 2EI6A 1HAGE 2F9NA 1UW7A 3P8FA 3LH1A 3EQ0H 1IQKA 4YTAA 3ZYDA 4E7RG 1DUEA 1LVYA 3LC5A 1CGJE 1EUFA 1FPHH 1C5NH 1LPZB 3KQ5A 5JBBS 4OGXA 1GCTB 4JYVH 2OP9A 1V6DA 4GLYA 4CRFA 1P9UA 1SFIA 1P57B 1V3XA 3NK8A 1BRAA 1A7SA 3TNTA 4ASHA 3W95A 1EPTB 2Z9KA 1O2NA 3ATKA 3EA9A 4Q7YA 1P2MA 5F8XA 1JIRA 1HJAC 3B23B 4RSPA 5FAHA 3BV9B 3PTBA 3AK5A 3LC3A 1DLKB 1C9TA 2BX3A 4D9RA 2FOFA 3GCNA 1QJ6B 3BG8A 3FZZA 2C8WB 2JJ1D 3RMLH 1QQ4A 3K2UA 3HK6B 3NUMA 1DX5M 2G51A 3IITA 1MTVA 1TBQH 4CHAC 4BAKB 3DA9B 1QNJA 2QY0B 1EX3A 3S9BA 1A46H 4OS2A 1IQMA 1J14A 1SGEE 4O3TA 2AMDA 5L2ZH 7ESTE 4UFGH 3UNRA 3TGJE 4YESB 2ZCHP 1TAWA 1O30A 1BB0B 2H5CA 2Q1JA 2VWNA 1EOLA 5JYIA 3WY8A 1GI3A 2ZI2H 1WV7H 1BDAA 1P8VC 3SHAH 3LGYA 3Q76A 4O3UA 1BTXA 1O3MA 1C1VH 1HAVB 3BN9A 2RDLA 4AC9A 1A2CH 4DIHH 5E0JA 1GI1A 4ZHAA 4D76A 2SGAA 1CHOG 1DWDH 3NCLA 4NA8A 1YBWA 2V7QD 1GCTC 1T4UH 2Z3EA 2BD4A 3GCHB 5HM9A 1QZ8A 3EGKH 1F5KU 1LDTT 1AIXH 3LDXH 4MPUA 3TU7H 2HGTH 7LPRA 3Q00A 1E36B 5C5NA 1NFUA 1YLNA 1ZTJA 1ELFA 1EPTC 1TPOA 3BSQA 1O2UA 5FX6A 1H9IE 3PLPA 4IMZA 2HPPH 1WUNH 2XC0A 1UCYE 2ZGCA 2FODA 2FOBA 4IW4E 3FO8D 1CT4E 1EB2A 1TMTH 3BTTE 3VXEH 3EE7A 5E2PA 1KTSB 4AFZA 3UY9A 1AFEH 4UONA 1XUIA 3B8JA 1JWTA 1O2JA 2QXIA 2DE8A 1LO6A 4JZFH 5JPMH 7KMEH 1THRH 4UFEH 2V0BA 2BTCE 1MD8A 3SNDA 5E8EH 2C4FH 3SV8A 1EJAA 1EJNA 1KLTA 2KAIB 4ZKRU 2ZHDA 1T32A 2AIQA 3GDVA 1O3JA 3RC6A 1GMDG 2GT7A 4LXBH 4FVBA 1EFRD 3GISB 3E0NB 2ZFPH 1NZQH 4ACAA 2AGGX 3W94A 2HPQH 3M35A 1O2TA 4LK4A 1VR1H 3SBKA 2ZQ1A 5CMXH 2FESH 3MWIU 1P2QA 4KKDA 1DWEH 3RXUA 2ANMH 3GY3A 1KDQB 2A5KA 3W1EA 2BD7A 1UHBB 1XKBC 3RXIA 4K5ZA 3GCHC 2J92A 2QGRA 2UUJB 2SNVA 5AHGH 3T5FH 3UIRA 4ABFA 4HG6A 2PTNA 2TGAA 4BAQB 3I78A 3URCA 2Y6TA 4X2VA 1TQ7B 1ZSJA 2CF8H 3EAJA 1ZMLA 2R2WU 2XBWA 2WSSD 2FXRA 3M3TA 2FS8A 1TRMA 1LVBA 1GBKA 2WYGA 4M9FA 4JK5A 1YLDA 1GVKB 3F9GA 3CP7A 4NCYA 3U8OH 1AY6H 1NU9A 1GVZA 2PV9B 3OTPA 3A7ZA 3P8GA 1NC6A 1TOCB 3STJA 4DW2U 3RC5A 3MU8A 1S6LA 3KQBA 2NU4E 3U69H 4DURA 5I25A 3TGKE 2EI7A 2PHBA 2CHAB 5C2ZA 3AAUA 3BTWE 4NWLA 1O5DH 1T4VH 1K1LA 1PJPA 3ZZDA 2FLBH 4JK6A 2XBYA 6GCHF 2LP6A 4DT7B 3AVZA 4ISOA 1G3DA 1U6QA 3UTUH 1A5GH 4TWYA 4MNVA 3HATH 1HPGA 2G8TA 4ZXYH 2K1QA 3P6ZB 1DE7H 1HBTH 4YLUA 1C1PA 1WTHD 2JH0D 5EG4A 1BJVA 5E0GA 1MKWK 4B71A 1ELBA 1HNEE 2FOHA 1HB0B 3E16B 2H9TH 3A89A 1GI7B 2FYRA 2VNTA 4BAOB 2HALA 4O9VA 1F0SA 1ANBA 2FOAA 4HGCA 1JIMA 3SNBA 1PYTD 2JDID 3UQVA 3V3MA 1V2VT 2P3UB 1GBTA 3H7OA 4Y0YE 5ESTE 5L2YH 4U2WA 1O2RA 4DT4A 5PTPA 1W13U 1S6HA 2ZECA 3M5OA 3OX7U 1DVAH 2WV4A 1GHBF 2XCNA 2C3SA 4ABGA 1GCDA 4D9QA 8GCHG 1GJDB 2LNCA 4AYVB 1LQDB 1CT0E 4I8KA 4ZUHA 3ZZ6A 1EZSC 1S0RA 4A1XA 1W7XH 2I6SA 3D62A 3ZVAA 4J1YA 4A1VA 1TGTA 5DP4A 2CHAC 2O8MA 2C8XB 2QXJA 5F8ZA 3DUXH 2ZHEH 1O2PA 4A7IB 2SGEE 1TNJA 4QT8C 4ASUD 1H1BA 1ELGA 2OINA 2ALVA 3UPEA 4MLFB 1GI6A 1PPFE 3R0FA 3GS9A 1O2ZA 1P09A 1YCPM 3N7EA 3F3BA 2P59A 4Z6AH 1AVXA 1FUJA 5C3NA 3O8BA 6LPRA 5K0HA 1WSSH 1TX8A 4I7YH 4LOYH 3MO6A 2QE7D 5JBAS 5HIZA 1WBGB 1QBVH 1LHCH 2W26A 3DFLA 4YM9A 9LPRA 1Q2WA 1GHXH 3M7QA 4X1NU 3UR9A 1FY8E 2WHXA 3IG6B 1FY3A 3OU0A 5JB8S 3P17H 3TJOA 4NZQA 1C1TA 3VB4A 5J4SA 1TGNA 4NIWA 2P16A 5TCAA 1DITH 5AFZH 3KNXA 3C27B 1LHFH 3S7KB 1TBZH 3RXTA 4ZROA 3SUFA 1D3PB 3FOAA 2FTLE 5T6FA 1F0TA 2BD2A 4INLA 1SSXA 2XXLA 3K6YA 3Q77A 4AZ2B 2H9HA 4JZDH 2KM0A 2ZF0H 1ZPCA 1L4DA 1OHHD 1ZGVA 1BCUH 1BTPA 4X2XA 2ZHFH 1EB1H 3U1JB 1MCVA 1IQGA 1QRZA 2Y5HA 2J9NA 1HAOH 1ESAA 5J4QA 3OE7D 1YPLH 4X8TH 1FIZA 1BHXB 4M7GA 2FYQA 4OS6A 5FBIA 1HJ9A 3F1SB 1F7ZA 2FDAA 4IGDA 1NROH 1L1JA 3SNEA 1CGHA 3BTFE 4U01A 3UQOA 3ZV8A 4AYYB 1NESE 2Q6FA 2BOKA 3SU6A 1P11E 3F0PA 3TJVA 8KME2 1QRWA 1GJCB 4Y79A 1O0DH 1EPTA 2CGAA 1O2QA 4AGKA 3HGNA 3NXPA 4OS4A 1HDTH 2QYIA 2Y7ZA 4ESTE 5A09A 2A2XH 3E90B 2WPKS 2BOHB 2AH4X 4JZ1A 2ZDLA 1UCYK 1Z8GA 2LELA 3U28C 1RFNA 1SHHB 1GDQA 2L6OA 1OX1A 3M7TA 2WINI 1AN1E 2RCEA 2Y80A 1QBOA 1K28D 2FP7B 4RKJB 3SU3A 5HXFA 3S9AA 1KXFA 2AS9A 1SPJA 1SOTA 4P00A 3PLBA 3ZZ5A 3F9HA 4XBDA 3SGBE 3ZZCA 3NPSA 2OK5A 3F2HA 1GI9B 3S0NA 1FJSA 1OYTH 4E06H 1GI5A 1GHAG 1AZZA 3QZRA 1GJ9B 1H9LB 5DP5A 1FNIA 1IHTH 3SJOA 2HNTC 4X6OA 1BZXE 2HLDD 3U1IB 2VVCA 1HAVA 1O2XA 2JKHA 3RMNH 1A3BH 1QCPA 3QWCH 4I8HA 1IAUA 1H8IH 2BDAA 1LCYA 3SZEA 2TPIZ 1CBWB 3MNBA 1CE5A 5JBTA 2HRVA 1V2PT 2ZHQH 3SQHE 2Z94A 3V7TA 1ZMNA 3M5MA 2Z3CA 1RRKA 5GWZA 2AIPA 2BDBA 1RXPA 2J5UA 5EQRA 3UR6A 2Z9GA 1ANEA 4Y8ZA 1B7XB 2EEKA 2PTCE 4AG2A 1O37A 1JRTA 1ACBE 1IQEA 1SGDE 3DSGA 2BLWA 1AFQB 1FX0B 1Y3VA 1MZAA 3PRBA 3Q3KA 4TYDA 3D49H 3BTQE 2EQNA 2WV9A 5AFYH 1O3GA 1C1UH 4Q7ZA 1VKYA 3RDZA 3BIVH 2BDGA 5A8YA 2KAIA 5C67A 1O2HA 2UWOA 3ZVBA 1QB9A 2JH6D 1NFYA 2ZU1A 1B0FA 1YPHE 3A8CA 1BMFD 5GPIB 5LH8A 2QCYA 1LPGB 1Z1JA 5FCKA 4GCHG 1C2EA 1SGCA 4SGAE 2WV5A 3GY8A 2F83A 4Y0ZE 2ODPA
chains in the Genus database with same CATH topology
1P06A 1ZPBA 2H5DA 4H6SB 3A7WA 1MKXK 1W8BH 1T8MA 2BLOA 1KDQA 1UHBA 3URDA 3GYLB 3IWMA 2OBQA 1C2GA 1CBWC 1W7GH 1ABIH 3OY5U 3M36A 5EQQA 2EA3A 1AHTH 2ZPRA 1UTKA 1QB1A 3PMHB 2PSXA 4ISHH 2OBOA 2P94A 1TWXB 3KEEA 5GIBA 1IQHA 1AFQC 3ENSB 1SGRE 4MTBA 4I33A 1EQ9A 1NRQH 1SQAA 1X7AC 5EXMA 2Y7XA 4MVNA 3LJJA 3PV4A 1GJ5H 2B5TB 4WXIA 1MAXA 1KYNA 1P2KA 2ZGHA 5FPSA 1TB6H 1P2NA 1O2OA 1PQAA 4A1TA 3SU5A 1ETSH 1V2MT 1JOUB 3K9XB 2O8UA 5FPTA 1P3CA 1W2KH 2A4RA 3KCGH 1DY9A 3B9FH 4H42U 3FVFB 3PTNA 4HFPB 1QQUA 5C1XA 1N8OB 2BDCA 2VH0A 1G3CA 4NGAH 2SGPE 1G32B 1SQTA 3GY2A 2IOTA 1C2DA 2P3FH 1IQFA 4AOQA 1RS0A 4AFUA 1T8LA 1HYLA 1GMCG 1YCPK 2XC5A 1VITH 2ZNKH 5K7RA 2G4UA 3V13A 3STIA 4WWYA 1GI2A 7GCHF 3RMMH 5AVDA 1HUTH 2ZDVH 1W11U 4FU7A 3RXVA 2OC0A 2G55A 1NM6A 2FIRH 3SV2H 2C8ZB 5EXLA 1Y3YA 1BRUP 1GVLA 3MNSA 1QIXB 1GGDC 2ANKH 1ELDE 1SGQE 1P0SH 1SG8B 5CE1A 3TIUA 1A5IA 1TGSZ 2ZU2A 2PKSB 2IPHA 1F5LA 1P03A 1W12U 5DKMA 1ZYOA 2YOLA 3M5NA 5GXPA 3MOCA 6ESTA 1Z8JB 2F9OA 2ZPSA 1C5VA 3QTVH 3VFEA 4GSOA 4YO9A 3OTJE 3K6ZA 2PUQH 1L1GA 1SB1H 2F9BH 4BXSA 1PFXC 3A8DA 1N8OC 3UUZA 3AW0A 2QF3A 2R0KA 1C1RA 1D3DB 1SGFG 4JCNA 2BLVA 1ZR0A 3LPRA 3PO1B 4Y76A 3S7HB 1OWKA 3N7OA 1S84A 1ELEE 3LGWA 1QRXA 1LHEH 2UWLA 3UWIA 1NS3A 1MMJN 3PM3A 1DXWA 3TH4H 1ETRH 2FTMA 3BTME 1TBRH 4K8YA 1J9CH 1A5HA 4ZH8A 1O3CA 3G01A 1CVWH 3KF2A 2ZEBA 3I77A 2XWBI 1SLUB 1O5CB 2BDYA 3MU4A 1K9OE 1O3HA 1C4Y2 1Z8RA 2HNTE 1SBWA 3LIWA 1TPSA 5SGAE 3RXKA 1O2MA 2VIQA 2BD5A 2G52A 2BD8A 4K8BA 5T3HA 3LGUA 3SJ9A 3JZ1B 1EZXC 2H9EH 4ISNA 2PKSC 2OLGA 3RXMA 1L1NA 3LGTA 3O8CA 2ZU3A 3FP7E 4IC5A 3Q3XA 2A5IA 1O33A 1ZJKA 3P8OA 1QY6A 1NU7B 2ZFSA 4NA9H 2FOEA 2R3YA 3DHKH 1A0HB 1DOJA 3KGPA 4BANB 5LPRA 3S9CA 1AVGH 1THSH 1QB6A 1O35A 4CR9A 3PO1C 1UVSH 5F03A 2GZ7A 1CQQA 1GBIA 1WOFA 1AKSB 2PFEA 1YGCH 5FHTA 2OQUA 2FM2A 3RXOA 3U98H 1RTKA 4ABHA 1C5WB 1F5RA 3GY6A 4X0WU 4BTIB 1UVTH 1GBEA 1YPMH 1O3LA 1GJ8B 1TYNA 4OS7A 3BTHE 2IJOB 1O3BA 2PKAA 1AQ7A 3V0XA 1Y3WA 1BBRH 2A7CA 1MU6B 5GDSH 2C93B 2A31A 1SVPA 2BYAX 4KELA 5DG6A 3UFAA 1UK3A 2FO9A 4HTCH 1RD3B 3RXRA 2ZU4A 1NFXA 1N6XA 1XVOA 1YPJH 4X1QU 5LGOA 1V2QT 1N1LA 1Q3XA 3M37A 3FZDA 1TNGA 2AERH 1DICA 2TIOA 4FUEA 3UOUA 4X8SH 2ZZUH 1W14U 1K22H 1C2KA 1XUJA 1MBQA 4I8JA 1D9IA 1OWJA 4WMFA 2WPLS 1BMMH 3EA8A 2B8OH 2ZGBH 2J4IA 3MTYA 2SFAA 4UE7H 3LOXA 2GV7A 2CXVA 2V3OH 1FAXA 2BQ7B 4LZ1H 4Q80A 1QL9A 1O2LA 1DSUA 2GCTB 3D65E 4FUJA 1RTLA 3MYWA 4DIIH 1GBCA 3LT3A 5FCRA 4R0IA 2BVRH 4Y71A 1VJAU 1WAYB 3ZVCA 2J94A 4IN1A 1OP2A 1Y59T 3L3TA 2Z6BD 2ZFFH 2PGBB 2BQ6B 1LVOA 3TNSA 1C5QA 3BIUH 4BTTB 2XRCA 6GCHG 1A0JA 2VH6A 1P9SA 1THPB 3ZZ7A 4BXWA 4K69A 4NFEA 3L6PA 2QV1A 3OSYA 3A86A 1P2JA 4X6NA 1GDUA 1TABE 4WF8A 2PSYA 2XCFA 1CT2E 2THFB 1MU8B 4ZAEA 2O8WA 2R3UA 2D26C 1C1QA 1P2OA 1PPCE 2RA0A 3A8AA 4ISIH 4O97A 1FPCH 1AU8A 2ZDKA 2FWWA 2VGCB 1C5TA 1FV9A 4Y11E 4B75A 4IBLH 1BITA 1TLDA 2ZA5A 2GCTC 1C5RA 2ALPA 1GHBG 1D3QB 2A32A 3FAOA 4INHA 1BMAA 1ZOMA 1SOZA 1K1IA 1IQNA 4U30A 4VGCB 3TH2H 1O34A 3GY7A 1IQJA 1O31A 2QC2A 1HIAB 1EZQA 3UNSA 4X8UH 3T62A 1KXCA 1V2WT 1OS8A 1LHDH 3M7UA 4KTCA 2Z3DA 5TJXA 3A80A 3BF6H 2SNWA 2Y81A 1OWHA 5GJ4B 2BD9A 1C5XB 1FZZA 4A92A 1ID5H 3PLKA 5AF9H 4ZHMU 1O32A 1LTOA 1ESTA 2W3KA 5DK1A 1BTHH 1GPZA 2YNBA 3RUOA 3VB7A 3UWJH 4ZKNU 1TA6A 1WTGH 1QTFA 3TPIZ 5B6OA 1BRBE 2QN5T 1HAHH 1AO5A 1BA8B 2GGVB 4Y8YA 1SLXB 1SL3A 3H5CB 1C1MA 1DY8A 1YF4A 5C1UA 1QBNA 2D1JA 2G00A 3HGPA 4B2AA 3LH3A 2HVXA 1ETTH 2VVUA 1S6FA 4KGAA 4JZIA 1FLEE 3BEUA 4TPIZ 5A0AE 1DSTA 3ZVDA 1OSSA 2VGCC 1NY22 5DP7A 1QJ7B 1AUJA 1VGCB 2WUBA 2B9LA 2FEQH 3U9AH 2ZG0H 3MU5A 4B2CA 1ELCA 1S83A 4MNXA 4XBBA 3SJIA 5GCHF 2VIPA 1LPKB 1PQ7A 4VGCC 4YOIA 1GI8B 1WQVH 1PQ8A 5HYOA 2VWLA 2Y5GA 3TH3H 1V2UT 1QGFA 5FX5A 5LPEA 2NU2E 3MHWU 3EE0B 3SI4H 1ZSLA 1Y3UA 4WMDA 5L30H 1E34B 4NG9H 2ZQ2A 4CH2B 1D3TB 1CSOE 2EI8A 3ZVGA 1K21H 2ZFQH 1O2GH 3A87A 4Q2KA 3TLOA 2YNAA 1FAKH 4UD9H 4ABJA 3LONA 1FI8A 1BTZA 1G36A 2W5EA 4Y7BA 4WH8A 2XTTB 3RXEA 3SI3H 5EXNA 1DLEA 2GZ8A 3SOSA 4GUXA 2P95A 1N6YA 4KTSA 2CJIA 5DO4H 1BOQA 1AE5A 3A8BA 4IC6A 1S85A 2BXUH 5C5OA 1HLTH 3LGIA 1HAZB 1KXDA 3L33A 4X8VH 4CRBA 1Z71A 1GBFA 1W0ZU 3BTKE 3SU0A 1ZZZA 1NN6A 1JRSA 5C1YA 2TRMA 1J16A 1O2VA 2CF9H 1VGCC 1GBBA 1XXDA 1EASA 1GMHF 5A8ZA 3VB5A 3M5LA 4YZUA 2NU3E 1SGYE 1O2YA 2FPZA 4FUDA 4D7FA 1NRRH 1C2FA 3RU4T 3ZZ4A 4DGJA 2ZWLH 1BMLA 4RKOB 1IQIA 1WYKA 2FLRH 4AB8A 4XOJA 4FVDA 2ANYA 4CRCA 4XDEA 3LU9B 1XX9A 2DE9A 2WPMS 1S81A 1A3EH 1HCGA 4ZXXH 2CMYA 2GD4B 4CH8B 3QN7A 1TGCA 6CHAB 1G3BA 1PPGE 3HPTB 4ZKSU 3GY4A 1BUIA 4Q7XA 4X1RU 1O3EA 1NT1A 3F9EA 3ATIA 2XYAA 2O9QA 2ZGJA 8ESTE 1HAPH 1CA8B 1O3AA 1E38B 2XNIA 1D6RA 1EKBB 1BIOA 1ZTLA 3GCTF 3QK1A 2GT8A 3T26A 4IN2A 5ABWA 4BTUB 4D7GA 3VGCB 3P95A 3EYDA 1HRTH 3A7YA 4AG1A 1AKSA 1LMWB 3GYMA 4HZHA 2OC1A 1GHYH 1O5EH 3DFJA 3MH5A 1J8AA 4JYUH 1YYY1 2W3IA 1W3CA 4GCHF 3R3GB 2G4TA 1FMGA 1C2LA 1UVOA 3KIDU 2BDHA 3GDSA 3PWBA 4JMYA 1RJXB 4SGBE 1ZMJA 4KTUA 4CBNA 3FFGA 2F9VA 1E0FD 4UFDH 3OYPA 1G2MA 1A1RA 1TRNA 2IN2A 5IYTA 1HJ8A 2SGFE 1O3OA 3QO6A 1XXFA 1GJ7B 4AORA 2XWAA 1FY5A 3A81A 2JH5D 1XUGA 1XMNB 2J34A 4BAMB 2TGPZ 4ABBA 3F9FA 1UTJA 1ARCA 1V2JT 4B1TA 1V2RT 1VITF 2D8WA 6CHAC 2G81E 1SC8U 4U32A 2PUXB 3SHCH 2FX6A 2UWPA 3RM0H 2FI3E 3E0PB 4I8GA 4WH6A 4ZHLU 2OD3B 4MNWA 4MPWA 1O38A 2R0LA 2ZFTA 5FPYA 3DT0H 1L4ZA 4O03A 5L6NH 3RXPA 3SUEA 2FOGA 2AFQB 1RIWB 2ZDAH 3O8DA 1GJ6A 4MDSA 1NO9H 2QA9E 1C5SA 3T2NA 2P3TB 2BY7X 1A61H 1MKWH 2BY5X 2H1UA 2I6QA 3OY6U 1Z6EA 3VGCC 1P3EA 3ZZ3A 4JZEH 3MU1A 2ZGXH 2OQ5A 1P04A 1EJMA 2GCHF 1PPEE 3H7TA 1O36A 1F2SE 3RXBA 4X2YA 5JDUB 2WPHS 3PMJA 1A0LA 4TY7A 2Z9IA 2BD3A 4X2WA 2OXSA 3MU0A 4F4OC 1YPKH 2BHGA 2Q6DA 3GICB 3KN2A 3BTDE 4ABIA 3E1XB 1EP6A 1DS2E 2GP9B 3BEFB 2VVVA 3EDXB 2D2DA 3CS7A 1TRYA 1XM1A 3Q3YA 2FOCA 1UVPA 4NWKA 4WVPE 1TNKA 2HNTF 1ZSKA 3GOVB 1SGIB 2AMQA 1FY1A 3QGNB 2ILNA 3CENA 1BHXF 1QA7A 4B76A 2W7UA 2G5VA 4X1PU 3CS0A 1LQEA 1KXBA 4A6LA 2AGEX 3MO3A 2BVXH 3UNQA 3PB1E 1B0EA 1RIWC 1SR5C 1T8NA 1TMUH 1Y5UT 2ZP0H 5A0CA 3RMOH 1K1OA 2VB0A 2W7SA 1OOKB 4R8TB 1QFKH 1UMAH 1SQOA 5T6DA 3QUMP 1J15A 4FUBA 3U8TH 1O2WA 3ATLA 7GCHG 1S0QA 1AE8H 2TBSA 1WCZA 2LPRA 3E6PH 2GDDA 2ESTE 2BY8X 1ESBA 3GY5A 3TJUA 1T7CA 2GX4A 4YOJA 1L2EA 1HIAA 3KQCA 5DJ7A 1GI0A 1AGJA 1FN6A 2TGDA 3RXSA 3SN8A 2RA3A 5G4BA 3UOPA 4WY3A 1GBDA 3LJOA 3V12A 4NIXA 3RXQA 2FX4A 1KLJH 4NIYA 1DM4B 1OWEA 1YPGH 4A5TS 3DD2H 1F92A 3RXDA 1AB9B 9ESTA 3TJNA 3U8RH 3MFJA 1DXPA 2VWOA 4B2BA 1E37B 2OUAA 4I31A 5A2MH 1O3DA 3O8RA 3A85A 1FN8A 1TPPA 5FBEA 4DCDA 4ZKOU 3T28A 4FU9A 2BM2A 1C9PA 2GZ9A 3MNCA 4OS5A 1Y5AT 5T6GA 5H4IB 1MTNB 4CRGA 1NFWA 2TGTA 2ZCKP 3AASA 1MZDA 1C1OA 2F9UA 1CHOF 2STBE 1XUFA 1EAXA 3SW2B 3NZIA 1GHWH 1SMFE 4TPYA 1KTTB 1XVMA 1WU1A 1AWFH 5A8XA 1DDJA 2ZPQA 1OP8A 1NPMA 2OC7A 1UCYH 3PWCA 5HMAA 2UUYA 5E0HA 3A88A 3ZZBA 4H4FA 1BTUA 2F9PA 1RTFB 4K1EA 1PYTC 4CRAA 1G37A 1QL7A 1TE0A 4FXGH 3VB6A 2VU8E 4NIVA 4FUIA 1AB9C 2FI4E 3BG4B 3EA7A 3KQEA 3ODFA 2H6MA 1Z1IA 5EPNA 1P2IA 1GMDF 5ESBA 1GBHA 2JETB 4B73A 5DGJA 1PQ5A 1O3NA 3FANA 3ZVFA 1ZJDA 2GTBA 1CU1A 1C2JA 1G9IE 1UVUH 4K3JA 5TCCA 1MTNC 1B5GH 1C4V2 4MPVA 1W0YH 4K1SA 3VXFH 1PPBH 8LPRA 4AN7A 4ISLA 1IHSH 1O5AB 1PPZA 5CHAB 1HFDA 1PPHE 2ODYB 3ELAH 1CA0B 1BBRE 1SLVB 3E91A 4GHTA 3TGIE 1F0RA 4IMQA 3MNXA 4AGJA 1UTNA 3SV7A 1L0ZA 2V35A 1O39A 2SGDE 4ZMAH 2XBVA 3PYHA 1UO6A 3RXLA 2ZTYA 1MH0A 1EATA 2BDIA 1M9UA 2A7JA 3SU2A 1SGFA 1XKAC 1RGQA 1YC0A 2HLCA 4GPGA 1AVWA 5EW1H 1XUHA 1MTUA 1C1SA 4UDWH 1NTPA 4AB9A 3M3SA 1P01A 3NKKA 4K2YA 1UK4A 2HWLB 1QURH 1GJBB 3TITA 1TX7A 3S69A 4AX9H 3BG4C 2GMTB 2BY6X 3ITIA 1D6WA 1V2NT 4B74A 2JETC 4PROA 5IDKA 1ELVA 4GVUA 4XE4A 2BMGB 4NA7A 1MCTA 2NWNA 3ZV9A 1IOEA 1OYQA 4YLQH 3UREA 1SGNE 4GAWA 2GDEH 3SQEE 1EXFA 4ABAA 1O3KA 2GV6A 2PLXA 1K1JA 1DFPA 1SLWB 5EU8A 4XBCA 2ZKSA 2WPJS 4NSYA 2DUCA 2J2UA 3GDUA 1MKXH 3ZZAA 4K60A 2OC8A 4Z0KA 1K1NA 1YM0A 1OP0A 4I8LA 1HAYB 3SNAA 5CHAC 4BOHA 5A0BA 1O2KA 4YOGA 3SORA 1CA0C 2J95A 1YKTA 1ABJH 2AEIH 2VIOA 1S5SA 5HM2A 1GBAA