4I32A

Crystal structure of hcv ns3/4a d168v protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVVFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i32A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i32A01
2SNVA 1ZPCA 1MKWK 1AQ7A 1ARCA 3Q77A 1PPFE 4ZKSU 1Y3UA 1DUEA 1RFNA 1AI8H 1RTLA 4CHAB 5E2OA 1GG6B 3GCNA 2OBOA 5BRRE 3RM0H 2AS9A 1ZSKA 3VGCC 2CGAA 2GZ9A 2FLRH 1DXWA 2BX4A 2ZFFH 1TX7A 1C2EA 1DITH 5FX6A 1KLTA 3QZQA 2ZFTA 3TGIE 1MTVA 1DFPA 3MNXA 4YLQH 1JWTA 4ZXXH 3SU5A 2BMGB 3SNCA 3SGBE 2RG3A 1SGRE 2J94A 2Q6GA 1IQFA 1UK3A 1IQIA 1GHWH 3SW2B 4B74A 4ABAA 1F0UA 4O9VA 1EP6A 1AKSA 2G81E 1AMHA 1OWHA 1NRPH 5DP4A 1W13U 1T32A 3H7TA 3ZZDA 3DA9B 2IJOB 1O3NA 4ZAEA 5ABWA 1C4V2 2ZPQA 6LPRA 3K65B 3VB3A 4BTUB 2QIQA 1J17T 1GBHA 2Y80A 4NZQA 4DIHH 2BYAX 1UCYK 3RXCA 1FIZA 1L4ZA 5A8XA 2PUQH 3SI4H 1F5RA 1FY5A 1P57B 4NWKA 1S6FA 1TONA 1UVOA 2HNTE 4WVPE 1QQUA 1HBTH 5GJ4B 1BA8B 3SGQE 1MQ5A 1TX8A 5F8XA 1LHGH 3KN2A 1C1UH 1J14A 2BD8A 3A8AA 5FHTA 1HXEH 3P17H 1C1SA 3A7VA 2FPZA 1XUHA 2XWBI 4YZUA 1C4U2 4GCHG 1DSUA 3E16B 1K1PA 3SZEA 4XOJA 2QA9E 3LH3A 2RDLA 4I8HA 1GJ7B 4H4FA 3MU4A 2P8OB 3U8RH 3F9EA 3GDUA 6ESTA 1G2MA 3OY5U 4K1TA 3UIRA 3ZZ9A 1MTUA 1INCA 1ZR0A 2ZDLA 2J95A 1O3LA 4AX9H 2ZA5A 2FLBH 5ESBA 2GGVB 3W94A 1IQNA 1T7CA 1JRTA 1QIXB 1MD7A 1C2JA 2Y5FA 4X1NU 3D49H 4LOYH 3A7XA 4KGAA 2ZGXH 4K60A 2GV7A 2R9PA 1SLUB 1WQVH 3VB7A 1H8IH 2OK5A 2A2QH 2BOHB 5T6DA 1M9UA 1LHFH 1BBRH 5LPRA 2SGEE 2PUXB 4J1YA 4OS7A 2AIPA 2BD9A 4VGCB 5K7RA 1MTNC 5LH8A 2D2DA 5EQSA 1S6HA 1K9OE 1O3BA 1ZTKA 3RMLH 1AO5A 4LZ1H 4BAQB 3TH4H 4BTTB 1EPTB 1C5LH 2BVRH 4O03A 4RKOB 1O3GA 1YC0A 3HGNA 3M61U 4DURA 1TIOA 3K6YA 4OS6A 3BIVH 2QXHA 1P05A 2O8UA 1P2OA 2ZZUH 2F9OA 3PO1C 3TVJB 1A5HA 2VBCA 2BDBA 1V2QT 2H2ZA 2ZFRH 4K3JA 1TMTH 5JYIA 1HJAB 1XUJA 3KCGH 1FI8A 1TB6H 2D1JA 4AFZA 1CA0C 4I8GA 3VPKA 2AIQA 2JETB 1DWDH 1SLVB 2XNIA 1OWEA 1Y3XA 1J8AA 3EA7A 2G4TA 1FIWA 4WWYA 2XRCA 1TOCB 2BQ6B 3KGPA 1RIWC 4Y10E 3MNCA 3GY8A 3FVFB 2ZFQH 4WH6A 3LC5A 3RXJA 2ZCLP 4JYVH 4O3UA 3RXBA 1A7SA 1AU8A 1MD8A 1EAXA 2VNTA 4X2WA 1P3CA 1TRYA 2XXLA 5GXPA 4JZDH 2QAAA 1CT0E 3RUOA 4UFDH 3ESTA 1GBDA 4MPUA 3PLPA 2Z3DA 4NA8A 4CH8B 1NU7B 2PHBA 1HFDA 1C5YB 2Z7FE 1KXCA 1BCUH 3RXEA 1OWJA 1LKBA 1MQ6A 2C8ZB 5TCAA 1WTGH 1ID5H 2AH4X 4JZIA 1EASA 1KIGH 1D3QB 2TGDA 1NFXA 1GHBG 1GMCG 4KTSA 1YCPH 2FI4E 1O2RA 2VVVA 1FY8E 4WXIA 3SNEA 2ZHDA 1WAYB 1AD8H 2WYGA 5K0HA 1IQKA 4AOQA 1TNGA 2PGBB 1VCWA 4KTUA 5G4BA 3M3SA 3EE0B 3A80A 2SGFE 1GHAG 1HAGE 2Z9LA 3GDVA 3UOUA 1ZJKA 3FP7E 1MCVA 1GI0A 1YF4A 2JH6D 1CQQA 5EOKA 1PQ7A 3P95A 1ZRBA 1MZDA 3PMAB 4B2BA 2VH0A 3MU0A 3MU1A 5DP9A 1VGCB 2ZU2A 4D9QA 3LC3A 1T8LA 3SU1A 2DUCA 2PLXA 4BANB 4IMQA 3I77A 1ZTLA 4IN2A 2A5KA 4UONA 2C8XB 4Y11E 1AVGH 4ZHLU 3MNSA 4NSVA 3GCTG 5L30H 1OOKB 1SSXA 4ASHA 1C1QA 2XC4A 3OTPA 1TPAE 1D3DB 6GCHF 1ESAA 2JH0D 1PJPA 1DANH 1RJXB 4KTCA 3QGNB 5T6FA 3RXTA 1CVWH 1FN8A 3PWBA 5GPIB 1DY8A 5TCCA 5EODA 3RU4T 2BVSH 3KQDA 1GL0E 4YT6H 1H9HE 4HGCA 1O2NA 1LVBA 9LPRA 1NTPA 4IBLH 3SBKA 1PPGE 4X1PU 2HNTC 2FYRA 2ZNKH 1HCGA 1WCZA 4K8YA 1XXFA 1BITA 1KTSB 4Y7AA 2ZCKP 1SFIA 1O3IA 1TYNA 4AFQA 1D3TB 1NN6A 1P2NA 1DVAH 1C5XB 1FONA 2ZPSA 4X8SH 1OYQA 1S85A 1MH0A 2FO9A 1OKXA 1UMAH 4TPYA 1CU1A 1GI5A 4ZKRU 1P2QA 4ZUHA 2BDHA 2QXIA 4CHAC 4UFFH 1QY6A 3MMGA 1MAYA 3W95A 3ZV9A 3ZZBA 3BEIB 3QTOH 1SI5H 2RCEA 3PMBB 1TNJA 3P8GA 1KDQA 4DGJA 2ANMH 2O8WA 3U8OH 1ELEE 3BEFB 3TIUA 3BSQA 4D76A 1MKWH 4CRFA 5DJ7A 1TGCA 1FXYA 2AGEX 4QT8C 3RC6A 2H5DA 3ZVAA 3U9AH 3S7HB 1TBQH 1AWFH 2Y5HA 2PSYA 3SU0A 1GBKA 1GVZA 3SQHE 1A0LA 1O39A 3DT0H 3OX7U 1BBRK 3MYWA 4K8BA 1F2SE 1AVWA 1SMFE 1NFYA 1YPMH 2C8WB 2Q6FA 1WUNH 2EI8A 1O2UA 4ISLA 2FOBA 1B5GH 4MQAA 3HATH 2XC5A 3PM3A 3SHCH 1A2CH 2UUYA 1G30B 2UWLA 3FANA 1O5DH 3RXVA 1WBGB 4AFSA 1P01A 4ZHAA 2A5AA 2A5IA 1T8OA 1NT1A 1P02A 1MKXH 1XUIA 1YPJH 4NIXA 4FUJA 1EXFA 2A45B 1BOQA 1EZQA 2FESH 4GHTA 3ZZ3A 4AG1A 5C2ZA 3P8OA 5LPFA 3QGJA 4I31A 1MZAA 4DY7B 4GLYA 1FV9A 5FPYA 2RA0A 2BTCE 3IITA 1ZJDA 2NU1E 4X8UH 3TNSA 4LK4A 1DY9A 2ZECA 1YM0A 2FS8A 1BRUP 4A1TA 1HLTH 7LPRA 5F6MA 2NU0E 2OINA 4Y8XA 2CMYA 4DCDA 3MH7A 2FODA 3LONA 1O2JA 1EZXC 1LHDH 2PWXA 1GBIA 1XKAC 2B5TB 3RXGA 1SPJA 1UCYH 4ZXYH 4B73A 2C3SA 1ETTH 2WV5A 3AW1A 3OTJE 1DS2E 1A61H 1ZPBA 2FZZA 8LPRA 1V3XA 1Z1IA 3PWCA 2J9NA 2IOTA 4TWYA 3SV6A 2BLQA 3BTGE 1AHTH 1SVPA 5DGJA 1W8BH 1NY22 8GCHG 1SGEE 1KLJH 3PLKA 4THNH 1P12E 1BMLA 5FXLA 2ZDNA 4FUIA 5F8ZA 4Y8YA 2VVCA 2YNAA 4CR9A 5EW2H 4ZHMU 4FUGA 2VINA 2H9TH 1F0RA 4RSPA 3ZVCA 1SHHB 1UVUH 1ABJH 1NZQH 3KF2A 1V2RT 3GICB 4OM9A 1YCPK 1SGYE 1EPTC 4WF8A 1TPSA 4MLFB 4X2XA 3AK5A 2BLOA 1HAPH 3E0PB 2R0LA 4Q7XA 5L6NH 3P92A 4CR5A 2EC9H 1ZMLA 2XYAA 1O3FA 3QX5H 4Y0ZE 4FUDA 1P9UA 3R0FA 1T8NA 2F91A 1P06A 1PPEE 3S9BA 4MTBA 2WINI 5E8EH 1L4DA 1EUFA 1VR1H 1JXPA 1UTQA 1HJAC 1DWCH 4DJZB 2BHGA 1ELVA 1ZHMA 1GHVH 2ZDVH 1FLEE 2VB0A 3UY9A 2WPKS 3PTNA 3SV8A 2QF3A 1O2TA 1LQEA 4I8JA 2Z3EA 2UUKB 3UR6A 5JBCS 1C1WH 1QRXA 1CE5A 3MO6A 1QTFA 1N8OB 1C5OH 2ASUB 1F7ZA 4B2CA 1K1LA 4AORA 4GSOA 1ZRKA 1EJNA 1F0TA 3KL6A 2Z9JA 4Q2KA 1O3AA 2WPJS 1WSSH 1BHXB 4WH8A 2GT8A 1A4WH 2A7JA 1GBMA 1TWXB 2SGDE 1O2YA 1YPKH 3ZZ6A 2AEIH 4LXBH 4BNRA 2NWNA 1EKBB 2FP7B 1O5BB 2BQWB 4A92A 5EU8A 4MG3A 1P04A 1MU8B 2QYIA 3SJIA 2B0FA 7GCHF 2G8TA 1W7GH 2W3KA 1E37B 1B0FA 1AZZA 2PTNA 1GI2A 1BMNH 2GD4B 4A6LA 2VWNA 3RXLA 1GMDG 1A3EH 5HGGA 3BTFE 1ANDA 3TLOA 1HPGA 1Y3WA 1MU6B 1GJDB 3ATIA 2JH5D 1O2QA 2D8WA 2ZC9H 1CT4E 3NXPA 4K5ZA 1MCTA 4BTIB 2ZIQH 2Y82A 4TWWA 4X8TH 2IJD1 1K28D 1Q3XA 4U32A 1GJ8B 1IQMA 1YGCH 1ZMJA 2GCHF 1Z8IB 1RTKA 1CGHA 1BB0B 3RXPA 4E06H 2Y5GA 1Y5BT 2LPRA 2ZFSA 2Z6BD 3KQCA 2GTBA 1O3PB 1TRNA 2WYJA 1BTHH 3M3TA 1O5GH 1ELFA 4I8KA 4D7GA 3RXMA 4O3TA 1Y5AT 5E0GA 1VGCC 5PTPA 2GT7A 2ZU1A 1TQ0B 2AMDA 3V12A 2ALPA 1QGFA 1W3CA 3ZVEA 5IYTA 5A2MH 1HNEE 1SGIB 3BTTE 1HV7A 1ETRH 3FAOA 2OC8A 3QO6A 4NIYA 1LHEH 5EW1H 2PW8H 4E05H 4FXGH 1CSOE 2GCTC 1CHOG 1UTMA 1HGTH 2HOBA 2HRVA 3P8FA 1C5QA 5A8ZA 3EA8A 4ISIH 1XM1A 2FI3E 3SYJA 5JBBS 2AMQA 2BY7X 4D7FA 5JB9S 2CXVA 2BLVA 1O2XA 1MKXK 4X6MA 3BTQE 4DW2U 1GMHG 4JZEH 2ZTXA 1UHBB 4TPIZ 1NO9H 1V2JT 3LGUA 2XBXA 3HPTB 3LT3A 3U1JB 4FUCA 4JCNA 3RMOH 1J15A 2G55A 1OSSA 1GDNA 1HJ8A 2OD3B 2FOGA 1P03A 4X6OA 1LHCH 1V2PT 3NUMA 2ZO3H 1K2I1 1X7AC 5C5OA 1DM4B 4HFPB 1ACBE 4SGAE 5E0HA 2QXJA 4XDEA 3SJOA 1AFQB 5A0AE 1BTYA 2ZGJA 3KIDU 2Z3CA 3ZVFA 3NZIA 4WJG2 1FY1A 3SU3A 5FBIA 3MNBA 3T29A 3M5MA 1O33A 4H6TA 1GHXH 1SL3A 1GBAA 2AFQB 1C2MA 3KHVA 3AW0A 2P59A 2A4GA 1GBEA 1FPHH 1RGQA 4Y7BA 1O2GH 2Q1JA 1ELAA 1F92A 1ELGA 2Z94A 3DFLA 3TK5A 1BQYA 1BZXE 1C4Y2 2FEQH 3ZVDA 1C5PA 4GVUA 4RI0A 1O0DH 2GZ8A 1Z7KA 3CS0A 3SV2H 2OP9A 2VIQA 1KXEA 3MOCA 3UQVA 4NIVA 1C5TA 1A1RA 1GI3A 1JIRA 4ABHA 1NC6A 1UVPA 1YKTA 3NWUA 4U01A 2P95A 1JMOH 3ZZAA 1O2OA 5A0CA 1SG8B 4ZKNU 3V7TA 4B75A 2ZHEH 3LGWA 2XCFA 2XBYA 3Q76A 2O9QA 3S9CA 3A89A 3TJVA 4CRDA 1LCYA 1O35A 1PPCE 1BTXA 4I32A 3D62A 1DX5M 3PV5A 4Y8ZA 5EQQA 3GY4A 5EPNA 1FPCH 4AFUA 1PQ8A 4UEHH 1BMMH 3M5LA 1EOJA 4XBCA 2A4RA 5GIBA 2P3FH 2PSXA 3ENSB 4JYUH 3F9FA 1GVLA 4ZH8A 2V35A 1H9IE 5IDKA 1QBVH 5DP5A 1NESE 9ESTA 4B2AA 4CRBA 3RXHA 2F4LA 4MPXA 2K1QA 1HYLA 2FOFA 1LMWB 1S0RA 3ATKA 3TGJE 1TMUH 3BN9A 1SB1H 1JBUH 3URCA 1AKSB 1GBJA 2FTLE 1ZLRA 4JK5A 3ZZ8A 2TRMA 1SBWA 4K2YA 1C2KA 1TOMH 1O32A 3I29A 3SN8A 1TAWA 1O34A 2V6NA 2ZU5A 2F9BH 1O2IA 1ELTA 3CP7A 1Z1JA 4YOIA 4NFFA 3RXUA 2WUBA 2EEKA 1L0ZA 1P11E 2FDAA 1UCYE 3MFJA 2TGAA 1K1IA 1TABE 2BZ6H 2XTTB 4RN6A 4DOQA 3BV9B 3O8RA 1BIOA 4X6NA 2PKAA 4CRAA 3BTHE 5FBEA 2ZQ2A 2ZGCA 2BD4A 4JK6A 1ABIH 2B9LA 3U98H 4MPVA 3UNSA 3Q3KA 1QJ7B 4GCHF 3HKJB 1ELCA 1A3BH 1NFWA 2WHXA 3T5FH 1VZQH 4X6PA 4YO9A 4Z0KA 1WTHD 2P3UB 1CGIE 1Z8GA 2TBSA 6CHAB 3S7KB 1IAUA 2SGAA 3SNAA 1IQGA 4BXWA 2FX4A 3NKKA 1N8OC 1LTOA 1TGSZ 3PROA 1O3DA 1RXPA 2VIVA 1GBCA 1Q31A 1TA6A 1AVXA 2OLGA 2ZTYA 2ILNA 3DD2H 1UTJA 3A7TA 1TA2A 2OCVB 1IHTH 2Z9KA 4RKJB 1O3HA 1SQTA 4PROA 1QB1A 2BD7A 1V6DA 4B1TA 5CE1A 4H42U 3BTKE 1BJVA 2HPQH 3C27B 3ZZ5A 3OY6U 2C8YB 1BJUA 1W7XH 3H7OA 1MAXA 1S81A 1V2UT 2ZDAH 1Y8TA 2STBE 1DPOA 1ZMNA 4NIWA 2UUJB 2FX6A 3KNXA 2PKSB 3UFAA 4B6FA 2BXTH 2FYQA 4CBOA 4AYVB 2DE9A 4MVNA 1HAVA 2AMPA 2ANWA 1ZHRA 2SFAA 4Y0YE 2FXRA 4Y6DA 5CHAB 1WQSA 2VWMA 3TPIZ 2TGPZ 1K21H 3PLBA 1GJ5H 1QQ4A 1N6XA 3LGTA 3EAJA 4UFGH 3UOPA 1HJ9A 1FAKH 1C2DA 1OXGA 1CT2E 3TH3H 1NROH 2BD2A 2A1DB 2WV4A 1KXBA 2XC0A 4NWLA 1F5LA 1AIXH 1TNHA 5EXMA 3VGCB 3GYMA 1W0ZU 3NK8A 4X8VH 4Z6AH 1PPBH 2FI5E 2O8TA 3IG6B 3GCHB 2F9UA 5EG4A 4Q7ZA 4LZ4B 1V2VT 1GI4A 1AN1E 1T8MA 2RA3A 3G01A 3SUFA 1W12U 2C93B 2O8MA 1PPZA 3AAVA 1GG6C 1RS0A 1T31A 5A8YA 2ULLA 5DP6A 2Z9IA 5AVDA 3WY8A 2G4UA 3CS7A 3TITA 4KP0A 1HAIH 2GDEH 3SOSA 1OP2A 1C1VH 2VIDA 1FZZA 2A2XH 3MTYA 3S0NA 3RXIA 2OBQA 4IGDA 2HWLB 2P93A 1ESBA 1QJ6B 3T2NA 1HIAA 1PFXC 5E2PA 1GHBF 1O2SA 1GJ4H 1H8DH 1GMCF 1B0EA 1YPEH 4XSKU 1H9LB 2YOLA 1SC8U 4Y79A 1ZGIA 1L1JA 3SNBA 1OS8A 2XWAA 3ATLA 1TNKA 3ZYEA 1VJ9U 2UUFB 2H1UA 1V2LT 5SGAE 1TNLA 1GHAF 3T27A 1QA7A 4R8TB 2Y6TA 2OC0A 2PGQB 4Q80A 3LOXA 1NS3A 1P9SA 3LKWA 1PYTC 1C5MD 1GI8B 2BD3A 2ZEBA 1O3MA 1AFQC 2ZHQH 1S5SA 3LGYA 3ODDA 4DT7B 2ZU3A 1GHZA 1Y3YA 4D8NA 3B8JA 2M5TA 2JKHA 3IWMA 3SORA 2ZI2H 1QB6A 2BVXH 5L2YH 5JBAS 2WV9A 1GJAB 1LQDB 1XX9A 5ESTE 4M9FA 1PPHE 2VVUA 1P2IA 3GCTF 1O2PA 1J9CH 5C3NA 1SGNE 1SOZA 2PTCE 3GY2A 2B8OH 2OQ5A 3T28A 3P8NA 1G9IE 3FZZA 2P8OC 3RM2H 1LPKB 3S9AA 1PYTD 5CMXH 4Y71A 5JPMH 4UD9H 3A87A 1MTNB 3A88A 3BG8A 2KAIA 5DKMA 4CH2B 1HDTH 1O3OA 2V3OH 1GL1A 2H5CA 3KQEA 3SUEA 3RC4A 3E91A 3SZNA 1KYNA 1TBZH 4A1XA 1XVOA 2ZG0H 1KTTB 4M7GA 5H4IB 3E3TA 1Z6EA 3ZZ4A 1THPB 2I6SA 1GJ6A 1IQLA 3BEUA 3E1XB 3TJNA 2ESTE 1CHGA 3RC5A 4ABIA 4TY7A 4ABEA 1NRRH 1QCPA 4VGCC 3A81A 5DP3A 2QGRA 1A5IA 3SNDA 3ZZ7A 2CHAB 2A4QA 3JZ2B 1S82A 4AYYB 1E35B 2ANYA 1G3CA 1UTLM 1AWHB 1FUJA 1ANCA 1D6RA 3UPEA 2ZDMA 1CA0B 1KDQB 1FQ3A 1ZSJA 2NU3E 3A7WA 4ABFA 3SJ8A 1DLEA 1TFXA 2FWWA 3M36A 1AE5A 5GCHG 2CV3A 1XUFA 2LNCA 5J4QA 2UWOA 1MUEB 1EZSC 1RIWB 1OX1A 3RXKA 2VWLA 2NU4E 3M37A 2WZQA 3STIA 1RD3B 1TALA 4FVDA 3TJUA 1H1BA 1O3EA 3GCOA 1SGFG 1TLDA 1BBRE 3GY5A 4UE7H 1THRH 1DUAA 1QFKH 4JZFH 2JETC 1C2LA 4X1SU 3RXFA 5AFZH 3JZ1B 5C67A 4BXSA 1V2WT 1EOLA 1P3EA 3QDZB 4BOHA 3Q00A 3T25A 3PMHB 2BB4A 1W0YH 2BY9X 2WPLS 4AG2A 2ZQ1A 3T26A 3STJA 3LU9B 1DSTA 1LVMA 3UWJH 1ARBA 1V2OT 3AVZA 1TPPA 3SU4A 4SGBE 3SQEE 3QZRA 2J38A 3SJKA 3DHKH 2OC7A 4YTAA 2CJIA 4BAOB 2GVFA 3BTME 4WMFA 2BDIA 1L1NA 3OU0A 1O2KA 1Y5UT 5FPTA 4I8LA 4TY6A 2ZCHP 1THSH 4HI3A 1MBMA 1ELBA 1SLXB 1O2HA 2TGTA 2XBVA 1C2IA 1AE8H 2H6MA 3K9XB 2HNTF 1ELDE 1C1MA 1YBWA 1F0SA 4F49A 2BXUH 1GCTB 1FAXA 2BDAA 3UR9A 1UVSH 1LKAA 1ZYOA 3ZZCA 3TK9A 5ETXA 2WPIS 2BQ7B 8GCHF 1GI6A 2ZPRA 4YOJA 1P2MA 1O5FH 1F5KU 2FS9A 4XFQA 5JB8S 3P70B 1OYTH 2W3IA 2ZKSA 2J92A 7KMEH 1O2ZA 3FP8E 1ANEA 2CF8H 2GDDA 1S83A 2H9EH 1BDAA 4IS5A 1LVOA 3GISB 1FJSA 4CREA 1Y3VA 1HAZB 3EDXB 3QN7A 1BTUA 1MTSA 3BTWE 3LDXH 4AZ2B 1O2MA 3HGPA 3ZV8A 3MWIU 4MNXA 2XW9A 1EAIA 3LJJA 1VITF 2DE8A 2PKSC 1FY3A 5EGMA 4NSYA 2VWOA 5DK1A 8KME2 3S69A 1U6QA 3K6ZA 3DFJA 4F4OC 2BD5A 3RXDA 1IQEA 2Y81A 1JRSA 1P2JA 1JIMA 2VIPA 2TIOA 3M3VA 1XUKA 1WXRA 2ZHFH 4FVBA 2WUCA 3MH6A 3EGKH 4B71A 2QC2A 1Z8RA 5FCKA 1SR5C 2ODPA 1C5NH 2ZHWH 2G51A 5FX5A 1OWKA 4FUBA 4INHA 4ZMAH 2VGCB 2IPHA 1GDQA 5C1UA 3I78A 2FOAA 1DOJA 2QY0B 3KQBA 1EPTA 2G5NA 3GCHC 2P16A 2EA3A 2QXGA 5A09A 4U30A 2BDCA 4A5TS 4O97A 1CBWB 1YPLH 1G32B 1G37A 2BLWA 3LPRA 4A1VA 4NA7A 5F03A 3U1IB 3ZYDA 1QA0A 1ZGVA 2OC1A 3B9FH 3V3MA 4ABBA 1YLCA 3LIWA 1K1OA 1RTFB 1QJ1B 1C1OA 3BTDE 2THFB 3PB1E 1QURH 2P3TB 1A0HB 3TH2H 1SQOA 3L33A 4ISNA 3GOVB 3UTUH 1C1RA 3ZVBA 4HZHA 1QBNA 2CN0H 1GMDF 1C5UA 4BAKB 3UREA 1W14U 2I6QA 4ABDA 4AGJA 1GBLA 1AB9B 3K2UA 4AB8A 1FNIA 1GGDB 1ZSLA 4IMZA 1NPMA 1UTKA 5JDUB 1UK4A 1ZZZA 4FUHA 1VCPA 2W26A 1YLDA 5EPYA 1VJAU 1ZTJA 4AB9A 1NRQH 4I33A 3QLPH 1XKBC 1SFQB 2R3UA 1YPHE 5BPEA 1FY4A 1QL8A 3ATMA 3SU2A 1JOUB 4K1SA 1G3DA 2STAE 1AUJA 2V3HH 3RP2A 5C20A 4DG4A 1CO7E 4J2YB 1GDUA 1XMNB 4E7RG 1C2GA 4JMYA 2ZGHA 2IN2A 5FPSA 1O5EH 4ABGA 3TGKE 3F9HA 3FFGA 2P94A 1HXFH 3V0XA 1VCQA 1CHOF 1KY9A 2A31A 3AAUA 4IC5A 1O5CB 4INKA 2F9VA 3U8TH 3AASA 3ITIA 2OTVA 4GHQA 1HAOH 3BTEE 2F83A 2ZFPH 1T4UH 5B6OA 4MNVA 4H6SB 4FUFA 3BG4B 3C1KA 1GMHF 5TJXA 1D4PB 1G3EA 2EI7A 1KXAA 4WY3A 5FCRA 1C2HA 1E0FD 2D26C 4YESB 4BAHB 4X2VA 1IQJA 2ZTZA 1DXPA 1Z8JB 1O36A 1TBRH 1GI9B 4NFEA 1C1TA 2WPMS 3TNTA 5DO4H 6GCHG 1C9TA 2CHAC 4WMDA 3ELAH 2GMTB 2BY8X 1GHYH 4MNYA 2V0BA 1YYY1 2F9PA 1G36A 2F9NA 2SGQE 2PV9B 1K22H 5T3HA 3SGAE 1P0SH 3PYHA 1EJMA 4CRGA 4YM9A 3LJOA 2NU2E 1HUTH 1TGBA 3MU5A 3R3GB 1D9IA 1GVKB 2GV6A 3EYDA 2Y7XA 1XXDA 2FMJA 2GP9B 3PTBA 3MH5A 5HMAA 4BAMB 3DUXH 3SHAH 2PFEA 3GYLB 1TQ7B 1FN6A 4KKDA 4NG9H 1WOFA 1WU1A 4AN7A 1O3KA 1QBOA 3MI4A 3EQ0H 4OS2A 3RU4D 1UTOA 1YP9A 1CGJE 1NRSH 1BTZA 3GY3A 1MMJN 1RRKA 2ZP0H 1ETSH 1V2ST 1UTPA 3P6ZB 1EZUC 3RXOA 1UTNA 2G5VA 2VU8E 3MH4A 1EAWA 1SGTA 3NPSA 3ZVGA 3H5CB 3QWCH 1TE0A 1GWAA 1PQ5A 2G52A 3E90B 1UK2A 5T6GA 1BUIA 2R0KA 1MBQA 1QRWA 4X1RU 1GI1A 1H4WA 2CF9H 1Q2WA 2QF0A 2OUAA 3VXEH 3RLYH 5GDSH 2ODYB 1GCDA 1OP8A 1EB1H 1V2TT 4TYDA 1QL9A 1GJ9B 1LPZB 4NCYA 3VB5A 1E36B 2HLCA 2QCYA 2WPHS 3MHWU 1UVTH 2H9HA 1WYKA 2HALA 1O2LA 4OS5A 1EAUA 2ZDKA 1C5RA 4Q7YA 5C1YA 3OYPA 1GCTC 2HPPH 1QNJA 1SQAA 1UO6A 3A8CA 1IOEA 3L6PA 4R0IA 3D23A 1OP0A 1AZ8A 1DWEH 1HRTH 1J16A 5AHGH 3GDSA 1AFEH 4GAWA 2A7HA 2FOMB 1XUGA 4NGAH 1TX6A 3F9GA 1OPHB 2B7DH 4YLUA 3UQOA 1BRCE 2GX4A 1O2WA 3HKIB 3OSYA 5FAHA 8ESTE 1NM6A 3PV2A 2GCTB 2FTMA 2PR3A 3LGIA 2HGTH 1FMGA 1G3BA 1ANBA 3URDA 1BTWA 1ORFA 1O3JA 1BRBE 1C5WB 4X2YA 2BY6X 1KXDA 1OWIA 2FOCA 5HXFA 3M35A 3EA9A 2G00A 5HM2A 3RXSA 1EQ9A 4HTCH 4DIIH 2PKAB 2W5EA 4INLA 5F8TA 1NFUA 1OWDA 1D3PB 3BF6H 1WV7H 1O31A 3O8DA 5DP8A 1S84A 5HM9A 1K1JA 3SI3H 4CBNA 1TGNA 4XBBA 1EATA 1KLIH 1YPHC 2OQUA 3VEQB 4E7NA 1EX3A 5HYOA 3A82A 4UDWH 3U69H 1TGTA 1T4VH 3T62A 2VGCC 4MDSA 2HVXA 1SHYA 3UUZA 1KXFA 1L2EA 3SUGA 2ANKH 1VITH 1CA8B 1C1PA 3QK1A 4GPGA 4K69A 1ZOMA 1ESTA 2Y7ZA 1CBWC 1A46H 5T1VA 2BDGA 4XE4A 2BM2A 2AERH 1B7XB 4ISOA 2AGGX 3RXQA 2ZWLH 5C1XA 2BZAA 1A0JA 4MNWA 1P2KA 1ZPZA 3F1SB 3SJ9A 1SGDE 4I7YH 2J4IA 4GUXA 5J4SA 1BT7A 3GY7A 1FDPA 1AGJA 3ATWA 4B76A 1P09A 1TNIA 2O8LA 1K1NA 1TRMA 2AYWA 1YCPM 3PMJA 1DLKB 1HAVB 2J34A 2AGIX 1AB9C 1GJBB 3SV7A 1DDJA 2A32A 1DT2A 4NZLA 1GGDC 4Y76A 3TU7H 4K1EA 1LDTT 1TPOA 3RXAA 5A0BA 1C5VA 3RMMH 1GI7B 3QTVH 4JYTA 1QR3E 4B6EA 4YOGA 2R3YA 7GCHG 4D9RA 4OS4A 1AUTC 3M5OA 1HAHH 4ZKOU 1KSNA 4UFEH 2A0QB 1L1GA 3SO3A 2R2MB 4IC6A 2BX3A 3FZDA 5I25A 3MO3A 3TK6A 1SOTA 3ODFA 1W10U 3Q3XA 4U2WA 2VH6A 2UWPA 2SNWA 3NCLA 3E6PH 5LPEA 5B6LA 1GPZA 3PO1B 4OGYA 2A4OA 3A8BA 1EB2A 3CENA 3SU6A 3SUDA 5AF9H 4YT7H 1C5SA 3M7UA 2Z9GA 3M7QA 1GBBA 2F3CE 3HK3B 3UNQA 1N6YA 1Z6JH 3BIUH 4ISHH 2GCHG 3M5NA 3UWIA 1G2LA 1V2KT 1QL7A 3RDZA 1HIAB 4OGXA 3QUMP 5EXNA 4ZROA 1Y59T 3BG4C 3A7YA 4WXVA 3VXFH 2GKVE 2SGPE 1P10A 3TJOA 2ZU4A 3GY6A 2BDYA 1XVMA 2VIWA 1Z71A 7ESTE 1HAXB 2W7UA 3O8CA 3A86A 5EXLA 1TMBH 1BMAA 1VITG 4AGKA 3B23B 3LH1A 1O37A 1BHXF 3FP6E 3A7ZA 1NU9A 1SLWB 5GWZA 1UJ1A 1GBTA 1HAYB 4MPWA 1E38B 2OXSA 1IQHA 2GMTC 2QN5T 2XBWA 2QV1A 5L2ZH 1EP5A 4FU7A 2ALVA 1IHSH 1A5GH 5DP7A 2TPIZ 1PQAA 4OS1A 3F68H 1QHRB 4FU9A 5EQRA 3VFEA 1BTPA 1UHBA 3L3TA 4IN1A 3UNRA 1O5AB 1SGCA 2J2UA 1O38A 2A7CA 3Q3YA 1NRNH 4ABJA 2ODQA 2FM2A 2GZ7A 1C2FA 1SGFA 3M7TA 3O8BA 4X0WU 3RMNH 1P8VC 5DG6A 1LPGB 1E34B 1ZHPA 3PV4A 3N7OA 4JZ1A 1W2KH 6CHAC 2VJ1A 3F6UH 4IW4E 5AFYH 1AY6H 1YPGH 3RU4E 1SGPE 5I46H 3RXRA 3LGVA 1SGQE 2KAIB 2BOKA 5E0JA 2C90B 1MTWA 1DICA 3VB4A 5GNDA 1V2MT 3A8DA 1N1LA 3RLWH 4FU8A 3A85A 1V2NT 3SV9A 1QRZA 2ZGBH 3V13A 3E0NB 1QB9A 4NA9H 4WMEA 3HK6B 4FUEA 2Q6DA 1LVYA 4XBDA 2W7SA 3MO9A 2EI6A 2ZF0H 1BRAA 4X1QU 1K1MA 4CRCA 1DE7H 1EJAA 3VB6A 2C4FH 1LO6A 2FOHA 5DPAA 4DVAU 3A83A 1O3CA 2BY5X 1C5ZB 5C5NA 1O2VA 4ESTE 2VIOA 3KEEA 3E8LA 3A84A 5JBTA 2YNBA 1D6WA 1DWBH 1S0QA 1W11U 2FOEA 5GCHF 1GJCB 1GBFA 4A7IB 3MU8A 2R2WU 2XCNA 1C9PA 1HB0B 3H09A 3D65E 1C1NA 1O30A 5CHAC 5LGOA 2FIRH 4KELA
chains in the Genus database with same CATH superfamily
2SNVA 1ZPCA 3OFND 5DN6D 1MKWK 1AQ7A 1ARCA 3Q77A 1PPFE 4ZKSU 1Y3UA 1DUEA 1RFNA 1AI8H 1RTLA 2AHME 4CHAB 2KR7A 5E2OA 1GG6B 3GCNA 2OBOA 5BRRE 3RM0H 2AS9A 1ZSKA 3VGCC 2CGAA 1WDIA 2GZ9A 2FLRH 1DXWA 2BX4A 2ZFFH 1TX7A 1C2EA 1DITH 5FX6A 1KLTA 3QZQA 2ZFTA 3TGIE 1MTVA 1DFPA 3MNXA 4YLQH 1JWTA 4ZXXH 3SU5A 2BMGB 3DSOA 3SNCA 1BMFD 3SGBE 2RG3A 2WPDD 1SGRE 2J94A 2Q6GA 1IQFA 1UK3A 1IQIA 1GHWH 3SW2B 4B74A 4ABAA 1F0UA 4O9VA 1EP6A 1AKSA 2G81E 1AMHA 1OWHA 1NRPH 5DP4A 1W13U 1T32A 3H7TA 3ZZDA 3DA9B 2IJOB 1O3NA 4ZAEA 5ABWA 1C4V2 2ZPQA 6LPRA 3K65B 3VB3A 4BTUB 2QIQA 1J17T 1GBHA 2Y80A 4NZQA 3F3BA 4DIHH 2BYAX 1UCYK 3RXCA 1FIZA 1L4ZA 1OHHD 2PUQH 3SI4H 5A8XA 1F5RA 1FY5A 1P57B 4NWKA 1S6FA 1TONA 1UVOA 2HNTE 4WVPE 1QQUA 1HBTH 5GJ4B 1BA8B 3DSPA 3SGQE 1MQ5A 1TX8A 5F8XA 1LHGH 3KN2A 1C1UH 1J14A 2BD8A 3A8AA 5FHTA 1HXEH 3P17H 1C1SA 3A7VA 2FPZA 1XUHA 2XWBI 4YZUA 1C4U2 4GCHG 1DSUA 3E16B 1K1PA 3SZEA 4XOJA 2QA9E 3LH3A 2RDLA 4I8HA 1GJ7B 4H4FA 3MU4A 2P8OB 3U8RH 3F9EA 3GDUA 6ESTA 1G2MA 3OY5U 4K1TA 3UIRA 3ZZ9A 1MTUA 1INCA 1ZR0A 2ZDLA 2J95A 1O3LA 4AX9H 2ZA5A 2FLBH 5ESBA 2LELA 2GGVB 3W94A 1IQNA 1T7CA 3F2GA 1JRTA 2HLDD 1QIXB 1MD7A 1C2JA 2Y5FA 4X1NU 3D49H 4LOYH 3A7XA 4KGAA 2ZGXH 4K60A 2GV7A 2R9PA 1SLUB 1WQVH 3VB7A 1H8IH 2OK5A 2A2QH 2BOHB 5T6DA 1M9UA 1LHFH 1BBRH 2XOKD 5LPRA 2SGEE 2PUXB 4J1YA 4OS7A 2AIPA 2BD9A 4VGCB 5K7RA 1MTNC 5LH8A 2D2DA 5EQSA 1S6HA 1K9OE 1O3BA 1ZTKA 3RMLH 1AO5A 4I86A 4LZ1H 4BAQB 3KQ5A 3TH4H 4BTTB 1EPTB 1C5LH 2BVRH 4O03A 4RKOB 1O3GA 1YC0A 3HGNA 3M61U 2KX4A 4DURA 1TIOA 3K6YA 4OS6A 3BIVH 2QXHA 1P05A 5CDFE 2O8UA 1P2OA 2ZZUH 2F9OA 3PO1C 3TVJB 1A5HA 2VBCA 2BDBA 1V2QT 2H2ZA 2ZFRH 4K3JA 1TMTH 5JYIA 1HJAB 1XUJA 3KCGH 1FI8A 1TB6H 2D1JA 4AFZA 1CA0C 4I8GA 3VPKA 4XRNA 2AIQA 2JETB 1DWDH 1SLVB 2XNIA 1OWEA 1Y3XA 1J8AA 3EA7A 2G4TA 1FIWA 4WWYA 2XRCA 1TOCB 2BQ6B 3KGPA 1RIWC 4Y10E 5KGOA 3MNCA 3GY8A 3FVFB 2ZFQH 4WH6A 3LC5A 3RXJA 2ZCLP 4JYVH 4O3UA 3RXBA 2J97A 1A7SA 1AU8A 1MD8A 1EAXA 2VNTA 4X2WA 1P3CA 1TRYA 2XXLA 5GXPA 4JZDH 2QAAA 1CT0E 3EE7A 3RUOA 4UFDH 2J5UA 3ESTA 1GBDA 4MPUA 3PLPA 2Z3DA 4NA8A 4CH8B 2J98A 1NU7B 2PHBA 1HFDA 1C5YB 2Z7FE 1KXCA 1BCUH 3RXEA 1OWJA 1LKBA 1MQ6A 2C8ZB 5TCAA 1WTGH 1ID5H 2AH4X 4JZIA 1EASA 1KIGH 1D3QB 2TGDA 1NFXA 1GHBG 5C94A 1GMCG 4KTSA 1YCPH 2FI4E 1O2RA 2VVVA 1FY8E 4WXIA 3SNEA 2ZHDA 1WAYB 2V7QD 1AD8H 2WYGA 5K0HA 1IQKA 4AOQA 1TNGA 2PGBB 1VCWA 4KTUA 5G4BA 3M3SA 3EE0B 3A80A 2SGFE 1GHAG 1HAGE 2Z9LA 3GDVA 3UOUA 1ZJKA 3FP7E 1MCVA 1GI0A 1YF4A 2JH6D 1CQQA 3CNRA 5EOKA 1PQ7A 3P95A 1ZRBA 1MZDA 3PMAB 4B2BA 2VH0A 3MU0A 3MU1A 5DP9A 1VGCB 2ZU2A 4D9QA 3LC3A 1T8LA 3SU1A 2DUCA 2PLXA 4BANB 4IMQA 3I77A 1ZTLA 4IN2A 2A5KA 4UONA 2C8XB 4Y11E 1AVGH 4ZHLU 3MNSA 4NSVA 3GCTG 5L30H 1OOKB 1SSXA 4ASHA 1C1QA 2XC4A 3OTPA 1TPAE 1D3DB 6GCHF 1ESAA 2JH0D 1PJPA 1DANH 1RJXB 4KTCA 3QGNB 5T6FA 3RXTA 1CVWH 1FN8A 3PWBA 5GPIB 1DY8A 5TCCA 5EODA 3RU4T 2BVSH 3KQDA 1GL0E 4YT6H 1H9HE 4HGCA 1O2NA 1LVBA 1MABB 9LPRA 1NTPA 4F48B 4IBLH 3SBKA 1PPGE 4X1PU 2HNTC 2FYRA 2ZNKH 1HCGA 1WCZA 4K8YA 1XXFA 3VG8A 1BITA 1KTSB 4Y7AA 2ZCKP 1SFIA 1O3IA 1TYNA 4AFQA 1D3TB 1NN6A 1P2NA 1DVAH 1C5XB 1FONA 2ZPSA 4X8SH 1OYQA 1S85A 1MH0A 2FO9A 1OKXA 1UMAH 4TPYA 1CU1A 1GI5A 4ZKRU 4FOUC 1P2QA 4ZUHA 2BDHA 2QXIA 4CHAC 4UFFH 1QY6A 3MMGA 1MAYA 3KYGA 3W95A 3ZV9A 3ZZBA 3BEIB 3QTOH 1SI5H 2RCEA 3PMBB 1SKYE 1TNJA 3P8GA 1KDQA 4DGJA 2ANMH 2O8WA 3U8OH 1ELEE 3BEFB 3TIUA 3BSQA 4D76A 1MKWH 4CRFA 5DJ7A 1TGCA 1FXYA 2AGEX 4QT8C 3RC6A 2H5DA 3ZVAA 3U9AH 3S7HB 1TBQH 1AWFH 2Y5HA 2PSYA 3SU0A 1GBKA 1GVZA 3SQHE 1A0LA 1O39A 3DT0H 3OX7U 1BBRK 3MYWA 4K8BA 1F2SE 4ASUD 1AVWA 1SMFE 1NFYA 1YPMH 2C8WB 2Q6FA 1WUNH 2EI8A 1O2UA 4ISLA 2FOBA 1B5GH 4MQAA 3HATH 2QE7D 2XC5A 1QZ8A 3PM3A 3SHCH 1A2CH 2UUYA 1G30B 2UWLA 3FANA 1O5DH 3RXVA 3MQKC 1WBGB 4AFSA 1P01A 4ZHAA 2A5AA 2A5IA 1T8OA 1NT1A 1P02A 1MKXH 1XUIA 1YPJH 4NIXA 4FUJA 1EXFA 2A45B 1BOQA 1EZQA 2FESH 4GHTA 3ZZ3A 4AG1A 5C2ZA 3P8OA 5LPFA 3QGJA 4I31A 1MZAA 4DY7B 4GLYA 1FV9A 5FPYA 4ZCNA 2RA0A 2BTCE 3IITA 1ZJDA 2NU1E 4X8UH 3TNSA 4LK4A 1DY9A 2ZECA 1YM0A 2FS8A 1BRUP 4A1TA 1HLTH 2L6OA 7LPRA 5F6MA 2NU0E 2OINA 4Y8XA 2CMYA 4DCDA 3MH7A 2FODA 3LONA 1O2JA 1EZXC 1LHDH 2PWXA 1GBIA 1XKAC 2B5TB 4TSFD 3RXGA 1SPJA 1UCYH 4ZXYH 4B73A 2C3SA 1ETTH 2WV5A 3AW1A 3OTJE 1DS2E 1A61H 1ZPBA 2FZZA 8LPRA 1V3XA 1Z1IA 3PWCA 2J9NA 2IOTA 4TWYA 3SV6A 2BLQA 3BTGE 1AHTH 1SVPA 5DGJA 1W8BH 1NY22 8GCHG 1SGEE 1KLJH 3PLKA 4THNH 1P12E 1BMLA 5FXLA 2ZDNA 4FUIA 5F8ZA 4Y8YA 2VVCA 2XNDD 2YNAA 4CR9A 5EW2H 4ZHMU 2KCPA 4FUGA 2VINA 2H9TH 1F0RA 4RSPA 3ZVCA 1SHHB 1UVUH 1ABJH 1NZQH 3KF2A 1V2RT 3GICB 4OM9A 1YCPK 1SGYE 1EPTC 4WF8A 1TPSA 4MLFB 4X2XA 3AK5A 2BLOA 1HAPH 3E0PB 2R0LA 4FETA 4Q7XA 5L6NH 3P92A 4CR5A 2EC9H 1ZMLA 2XYAA 1O3FA 3QX5H 4Y0ZE 4FUDA 1P9UA 3R0FA 1T8NA 2F91A 1P06A 1PPEE 3S9BA 4MTBA 2WINI 5E8EH 1L4DA 1EUFA 1VR1H 1JXPA 1UTQA 1HJAC 1DWCH 4DJZB 2BHGA 1ELVA 1ZHMA 1GHVH 2KZ4A 2ZDVH 1FLEE 2VB0A 3UY9A 2WPKS 3PTNA 3SV8A 2QF3A 1O2TA 1LQEA 4I8JA 2Z3EA 2UUKB 3UR6A 5JBCS 1C1WH 1QRXA 5CHBA 1CE5A 3MO6A 1QTFA 1N8OB 1C5OH 2ASUB 1F7ZA 4B2CA 1K1LA 4AORA 4GSOA 1ZRKA 1EJNA 1F0TA 3KL6A 2Z9JA 4Q2KA 1O3AA 2WPJS 1WSSH 1BHXB 4WH8A 2GT8A 1A4WH 2A7JA 1GBMA 1TWXB 2SGDE 1O2YA 1YPKH 3ZZ6A 2AEIH 4LXBH 4BNRA 2NWNA 1EKBB 2FP7B 1O5BB 2BQWB 4A92A 5EU8A 4MG3A 1P04A 1MU8B 2QYIA 3SJIA 2B0FA 7GCHF 2G8TA 1W7GH 2W3KA 1E37B 1B0FA 1AZZA 1E1QD 1YWUA 2PTNA 1GI2A 1BMNH 2GD4B 4A6LA 2VWNA 3RXLA 1GMDG 1A3EH 5HGGA 3BTFE 1ANDA 3TLOA 1HPGA 1Y3WA 1MU6B 4Q4LA 1GJDB 3ATIA 2JH5D 1O2QA 2D8WA 2ZC9H 1CT4E 3NXPA 4K5ZA 1MCTA 4BTIB 2ZIQH 2Y82A 2IJD1 4TWWA 4X8TH 3NRLA 1K28D 1Q3XA 4U32A 1GJ8B 1IQMA 1YGCH 1ZMJA 2GCHF 1Z8IB 1RTKA 1CGHA 1BB0B 3RXPA 4E06H 2Y5GA 1Y5BT 2LPRA 3FO8D 2ZFSA 2Z6BD 3KQCA 2GTBA 1O3PB 1TRNA 2WYJA 1BTHH 3M3TA 1O5GH 1ELFA 4I8KA 4D7GA 3RXMA 4O3TA 1Y5AT 1NBMD 5E0GA 1VGCC 5PTPA 2GT7A 2ZU1A 1TQ0B 2AMDA 3V12A 2ALPA 1QGFA 1W3CA 3ZVEA 5IYTA 5A2MH 1HNEE 1SGIB 3BTTE 1HV7A 1ETRH 3FAOA 2OC8A 3QO6A 4NIYA 1LHEH 5EW1H 2PW8H 4E05H 4FXGH 1CSOE 2GCTC 1CHOG 1UTMA 1HGTH 2L74A 2HOBA 2HRVA 3P8FA 1C5QA 5A8ZA 3EA8A 4ISIH 1XM1A 2FI3E 3SYJA 5JBBS 2AMQA 2BY7X 4D7FA 5JB9S 2CXVA 2BLVA 1O2XA 1MKXK 4X6MA 3BTQE 4DW2U 1GMHG 4JZEH 2ZTXA 1UHBB 4TPIZ 1NO9H 1V2JT 3LGUA 2XBXA 3HPTB 3LT3A 3U1JB 4FUCA 4JCNA 3RMOH 1J15A 2G55A 1OSSA 5F53A 1GDNA 3ZIAD 1HJ8A 2OD3B 2FOGA 1P03A 4X6OA 1LHCH 1V2PT 3NUMA 2ZO3H 2RFKC 1K2I1 1X7AC 5C5OA 1DM4B 4HFPB 1ACBE 4SGAE 5E0HA 2QXJA 4XDEA 3SJOA 1AFQB 5A0AE 1BTYA 2ZGJA 3KIDU 2Z3CA 3ZVFA 3NZIA 4WJG2 1FY1A 3SU3A 5FBIA 3MNBA 3T29A 3M5MA 1O33A 4H6TA 1GHXH 1SL3A 1GBAA 2AFQB 1C2MA 3KHVA 3AW0A 2P59A 3F0OA 2A4GA 1GBEA 1FPHH 1RGQA 4Y7BA 1O2GH 2Q1JA 1ELAA 1F92A 1ELGA 2Z94A 3DFLA 3TK5A 1BQYA 1BZXE 1C4Y2 2FEQH 3ZVDA 1C5PA 4GVUA 4RI0A 1O0DH 2GZ8A 1Z7KA 3CS0A 3SV2H 2OP9A 2VIQA 1KXEA 3MOCA 3UQVA 4NIVA 1C5TA 1A1RA 1GI3A 1JIRA 4ABHA 1NC6A 1UVPA 1YKTA 3NWUA 4U01A 2P95A 4P00A 1JMOH 3ZZAA 1O2OA 5A0CA 1SG8B 4ZKNU 3WWBA 3V7TA 4B75A 2ZHEH 3LGWA 2XCFA 2XBYA 3Q76A 2O9QA 3S9CA 3A89A 3TJVA 4CRDA 1LCYA 1O35A 1PPCE 1BTXA 4I32A 3D62A 1DX5M 3PV5A 4Y8ZA 5EQQA 3GY4A 5EPNA 1FPCH 4AFUA 1PQ8A 4UEHH 1BMMH 3M5LA 1EOJA 4XBCA 2A4RA 5GIBA 2P3FH 2PSXA 3ENSB 4JYUH 3F9FA 1GVLA 4ZH8A 2V35A 1H9IE 5IDKA 1QBVH 5DP5A 1NESE 9ESTA 4B2AA 4CRBA 4RT0A 3RXHA 2F4LA 4MPXA 2K1QA 1HYLA 2FOFA 1LMWB 1S0RA 2LP6A 3ATKA 1TMUH 3TGJE 3BN9A 1SB1H 1JBUH 3URCA 1AKSB 3PRDA 1GBJA 2FTLE 1ZLRA 4JK5A 3ZZ8A 1FX0B 2TRMA 1SBWA 4K2YA 1C2KA 1TOMH 1O32A 3I29A 3SN8A 1TAWA 1O34A 2V6NA 2ZU5A 2F9BH 1O2IA 1ELTA 3CP7A 1Z1JA 4YOIA 4NFFA 3RXUA 2WUBA 2EEKA 1L0ZA 1P11E 2FDAA 1UCYE 3MFJA 2TGAA 1K1IA 1TABE 2BZ6H 2XTTB 4RN6A 4DOQA 3BV9B 3O8RA 1BIOA 4X6NA 2PKAA 4CRAA 3BTHE 5FBEA 2ZQ2A 2ZGCA 2BD4A 4JK6A 1ABIH 2B9LA 3U98H 1EFRD 2M2AA 4MPVA 3UNSA 3Q3KA 1QJ7B 4GCHF 3HKJB 1ELCA 1A3BH 1NFWA 2WHXA 3T5FH 1H8ED 1VZQH 5C17A 4X6PA 4YO9A 4Z0KA 1WTHD 2P3UB 1CGIE 1Z8GA 2TBSA 6CHAB 3S7KB 1IAUA 2SGAA 2JJ1D 3SNAA 3OEHD 1IQGA 4BXWA 2KCYA 2FX4A 3NKKA 1N8OC 1LTOA 1TGSZ 3PROA 1O3DA 1RXPA 2VIVA 1GBCA 1W0JD 1Q31A 1TA6A 1AVXA 2OLGA 2ZTYA 3F2FA 2ILNA 3DD2H 1UTJA 3A7TA 1TA2A 2OCVB 1IHTH 2Z9KA 4RKJB 1O3HA 3FOAA 1SQTA 4PROA 1QB1A 2BD7A 1V6DA 4B1TA 5CE1A 4H42U 3BTKE 1BJVA 2HPQH 3C27B 3ZZ5A 3OY6U 2C8YB 1BJUA 1W7XH 3H7OA 1MAXA 1S81A 1V2UT 2ZDAH 1Y8TA 2STBE 1DPOA 1ZMNA 4NIWA 2UUJB 2FX6A 3KNXA 2PKSB 3UFAA 4B6FA 2BXTH 5C0UA 2FYQA 4CBOA 4AYVB 2DE9A 4MVNA 1HAVA 2AMPA 2ANWA 1ZHRA 2SFAA 4Y0YE 2FXRA 4Y6DA 5CHAB 1WQSA 2VWMA 3TPIZ 3DSGA 2TGPZ 1K21H 3PLBA 1GJ5H 1QQ4A 1N6XA 3LGTA 3EAJA 4UFGH 3UOPA 1HJ9A 1FAKH 1C2DA 1OXGA 1CT2E 3TH3H 1NROH 2BD2A 2A1DB 2WV4A 1KXBA 2XC0A 4NWLA 1F5LA 1AIXH 1TNHA 5EXMA 3VGCB 4RT1A 3GYMA 1W0ZU 3NK8A 4X8VH 4Z6AH 1PPBH 2FI5E 1NBME 2O8TA 3IG6B 3GCHB 2F9UA 5EG4A 4Q7ZA 4LZ4B 1V2VT 1GI4A 1AN1E 1T8MA 2RA3A 3G01A 3SUFA 1W12U 2C93B 2O8MA 1PPZA 3AAVA 1GG6C 1RS0A 1T31A 5EJLA 5A8YA 2ULLA 5DP6A 2Z9IA 5AVDA 3WY8A 2G4UA 3CS7A 3TITA 4KP0A 1HAIH 1UW7A 2GDEH 2J98B 2KCOA 3SOSA 1OP2A 1C1VH 2VIDA 1FZZA 2A2XH 3MTYA 3S0NA 3RXIA 2OBQA 4IGDA 2HWLB 2P93A 1ESBA 1QJ6B 3T2NA 1HIAA 1PFXC 5E2PA 1GHBF 1O2SA 1GJ4H 1H8DH 1GMCF 1B0EA 1YPEH 4XSKU 1H9LB 2YOLA 1SC8U 4Y79A 2GJGA 1ZGIA 1L1JA 3SNBA 1OS8A 2XWAA 3ATLA 1TNKA 1E1RD 3ZYEA 1VJ9U 2UUFB 2H1UA 2RDEA 1V2LT 5SGAE 1TNLA 1GHAF 3T27A 1QA7A 4R8TB 2Y6TA 2OC0A 2PGQB 4Q80A 3LOXA 1NS3A 1P9SA 3LKWA 1PYTC 1C5MD 1GI8B 4YXWD 2BD3A 2ZEBA 1O3MA 1AFQC 2ZHQH 1S5SA 3LGYA 3ODDA 4DT7B 2ZU3A 1GHZA 1Y3YA 4D8NA 3B8JA 2M5TA 2JKHA 3IWMA 3SORA 2ZI2H 1QB6A 2BVXH 5L2YH 5JBAS 2WV9A 1GJAB 1LQDB 1XX9A 5ESTE 4M9FA 2IPQX 1PPHE 2VVUA 1P2IA 3GCTF 1O2PA 1J9CH 5C3NA 1SGNE 1SOZA 2PTCE 3GY2A 2B8OH 2OQ5A 3T28A 3P8NA 1G9IE 3FZZA 2P8OC 3RM2H 1LPKB 3S9AA 1PYTD 5CMXH 4Y71A 1W0KD 5JPMH 4UD9H 3A87A 1MTNB 2W6JD 3A88A 3BG8A 2KAIA 5DKMA 4CH2B 1HDTH 1O3OA 2V3OH 1GL1A 2H5CA 3KQEA 3SUEA 2HVYB 3RC4A 3E91A 3SZNA 1KYNA 1TBZH 4A1XA 1XVOA 2ZG0H 1KTTB 4M7GA 5H4IB 3E3TA 1Z6EA 1S6LA 3ZZ4A 1THPB 2I6SA 1GJ6A 1IQLA 3BEUA 3E1XB 3TJNA 2ESTE 1CHGA 3RC5A 4ABIA 4TY7A 4ABEA 1NRRH 1QCPA 4VGCC 3A81A 3F2HA 5DP3A 2QGRA 1A5IA 3SNDA 3ZZ7A 2CHAB 2A4QA 3JZ2B 1S82A 4AYYB 3FN8A 1E35B 2ANYA 4F55A 1G3CA 1UTLM 1AWHB 2EQNA 1FUJA 1ANCA 1D6RA 3UPEA 2ZDMA 1CA0B 1KDQB 1FQ3A 1ZSJA 2NU3E 3A7WA 4ABFA 3SJ8A 1DLEA 1TFXA 2FWWA 3M36A 1AE5A 5GCHG 2CV3A 1XUFA 2LNCA 5J4QA 2UWOA 1MUEB 1EZSC 2V3MA 1RIWB 1OX1A 3RXKA 2VWLA 2NU4E 3M37A 1YY3A 2WZQA 3STIA 1RD3B 1TALA 4FVDA 3TJUA 1H1BA 1O3EA 3GCOA 1SGFG 1TLDA 1BBRE 3GY5A 4UE7H 1THRH 1DUAA 1QFKH 4JZFH 2JETC 1C2LA 4X1SU 3RXFA 4P02A 5AFZH 3JZ1B 2KM0A 5C67A 4BXSA 1V2WT 1EOLA 4Q63A 1K0HA 1P3EA 3QDZB 4BOHA 3Q00A 3T25A 3PMHB 2BB4A 1W0YH 4ACBA 2BY9X 2WPLS 4AG2A 2ZQ1A 3T26A 3STJA 3LU9B 1DSTA 1LVMA 3UWJH 1ARBA 1V2OT 3AVZA 1TPPA 3SU4A 4SGBE 3SQEE 3QZRA 2J38A 3SJKA 3DHKH 2OC7A 4YTAA 2CJIA 4BAOB 2GVFA 3BTME 4WMFA 2BDIA 1L1NA 3OU0A 1O2KA 1Y5UT 5FPTA 4I8LA 4TY6A 2ZCHP 1THSH 4HI3A 1MBMA 1ELBA 1SLXB 1O2HA 2TGTA 2XBVA 1C2IA 1AE8H 2H6MA 3K9XB 2HNTF 1ELDE 1C1MA 1YBWA 5KEDA 1F0SA 4F49A 2EY4C 2BXUH 1GCTB 1FAXA 2BDAA 3UR9A 1UVSH 2YMSB 1LKAA 1ZYOA 3ZZCA 3TK9A 5ETXA 2WPIS 2BQ7B 8GCHF 1GI6A 2ZPRA 4YOJA 1P2MA 1O5FH 1F5KU 2FS9A 4XFQA 5JB8S 3P70B 1OYTH 2W3IA 2ZKSA 2J92A 7KMEH 1O2ZA 3FP8E 1ANEA 2CF8H 2GDDA 1S83A 2H9EH 1BDAA 4IS5A 1LVOA 3GISB 1FJSA 4CREA 1Y3VA 1HAZB 3EDXB 3QN7A 1BTUA 1MTSA 3BTWE 3LDXH 4AZ2B 1O2MA 3HGPA 3ZV8A 5EJ1A 3MWIU 4MNXA 2XW9A 1EAIA 3LJJA 1VITF 2DE8A 2PKSC 1FY3A 5EGMA 4NSYA 2VWOA 5DK1A 8KME2 3S69A 1U6QA 3K6ZA 3DFJA 4F4OC 2BD5A 3RXDA 1IQEA 2Y81A 1JRSA 1P2JA 1JIMA 2VIPA 2TIOA 3M3VA 1XUKA 1WXRA 2ZHFH 4FVBA 2WUCA 3MH6A 2K0QA 3EGKH 4B71A 2QC2A 1Z8RA 5FCKA 1SR5C 2ODPA 1C5NH 2ZHWH 2G51A 5FX5A 1OWKA 4FUBA 4INHA 4ZMAH 2VGCB 3UAIC 2IPHA 1GDQA 5C1UA 3I78A 2FOAA 1DOJA 2QY0B 3KQBA 1EPTA 2G5NA 3GCHC 2P16A 2EA3A 2QXGA 5A09A 4U30A 2BDCA 4A5TS 4O97A 1CBWB 1YPLH 3FKSD 1G32B 1G37A 2BLWA 3LPRA 4A1VA 4NA7A 5F03A 3U1IB 3ZYDA 1QA0A 1ZGVA 2OC1A 3B9FH 3V3MA 4ABBA 1YLCA 3LIWA 1K1OA 1RTFB 1QJ1B 1C1OA 3BTDE 2THFB 3PB1E 1QURH 2P3TB 1A0HB 3TH2H 1SQOA 3L33A 4ISNA 3GOVB 3UTUH 1C1RA 3ZVBA 4HZHA 1QBNA 2CN0H 1GMDF 1C5UA 4BAKB 3UREA 1W14U 2K8IA 2I6QA 4ABDA 4AGJA 1GBLA 1AB9B 3K2UA 4AB8A 2JIZD 1FNIA 1GGDB 1ZSLA 4Z1MD 4IMZA 1NPMA 1UTKA 5JDUB 1UK4A 1ZZZA 4FUHA 1VCPA 2W26A 1YLDA 5EPYA 1VJAU 1ZTJA 4AB9A 1NRQH 3F0PA 4I33A 3QLPH 1XKBC 3GS9A 1SFQB 2R3UA 1YPHE 1VKYA 1FY4A 2JJ2D 1QL8A 3ATMA 5BPEA 3SU2A 1JOUB 1SQRA 4K1SA 1G3DA 2STAE 1AUJA 2V3HH 3RP2A 5C20A 4DG4A 1CO7E 4J2YB 1GDUA 1XMNB 4E7RG 1C2GA 4JMYA 2ZGHA 2IN2A 5FPSA 1O5EH 4ABGA 3TGKE 3F9HA 3FFGA 2P94A 1HXFH 3V0XA 1VCQA 1KMHB 1CHOF 1KY9A 2A31A 3AAUA 4IC5A 1O5CB 4INKA 2F9VA 3U8TH 3AASA 3ITIA 2OTVA 1COWD 4GHQA 1HAOH 3BTEE 2F83A 2ZFPH 1T4UH 5B6OA 5EJZA 4MNVA 4H6SB 4FUFA 3BG4B 3C1KA 4AC9A 1GMHF 5TJXA 1D4PB 1G3EA 2EI7A 1KXAA 4WY3A 5FCRA 1C2HA 1E0FD 2D26C 4YESB 4BAHB 4X2VA 1IQJA 2ZTZA 1DXPA 1Z8JB 1O36A 1TBRH 1E79D 1GI9B 4NFEA 1C1TA 2WPMS 3TNTA 5DO4H 6GCHG 1C9TA 3KYFA 2CHAC 4WMDA 5C0TA 3ELAH 2GMTB 2BY8X 1GHYH 4MNYA 2V0BA 1YYY1 2W6ID 2F9PA 1G36A 2F9NA 2SGQE 2PV9B 1K22H 5T3HA 3SGAE 1P0SH 3PYHA 1EJMA 4CRGA 4YM9A 3LJOA 2NU2E 1HUTH 1TGBA 3MU5A 3R3GB 1D9IA 1GVKB 2GV6A 2CK3D 3EYDA 2Y7XA 1XXDA 2FMJA 2GP9B 3PTBA 3MH5A 5HMAA 4BAMB 3DUXH 3SHAH 2PFEA 3GYLB 1TQ7B 1FN6A 4KKDA 4NG9H 1WOFA 1WU1A 4AN7A 1O3KA 1QBOA 3MI4A 3EQ0H 4OS2A 3RU4D 3DCLA 1UTOA 1YP9A 1CGJE 2PP6A 1NRSH 1BTZA 3GY3A 1MMJN 1RRKA 2ZP0H 1ETSH 1V2ST 1UTPA 3P6ZB 1EZUC 3RXOA 1UTNA 2G5VA 2VU8E 3MH4A 1EAWA 1SGTA 3NPSA 3ZVGA 3H5CB 3QWCH 1TE0A 1GWAA 1PQ5A 2G52A 3E90B 1UK2A 5T6GA 1BUIA 2R0KA 1MBQA 1QRWA 4X1RU 1GI1A 1H4WA 2CF9H 1Q2WA 2QF0A 1H8HD 2OUAA 3VXEH 3RLYH 5GDSH 2ODYB 1GCDA 1OP8A 1EB1H 1V2TT 4TYDA 1QL9A 3N99A 1GJ9B 1LPZB 4NCYA 3VB5A 1E36B 2HLCA 2QCYA 2WPHS 3MHWU 1UVTH 2H9HA 1WYKA 2HALA 1O2LA 4OS5A 1EAUA 2ZDKA 1C5RA 3OEED 4Q7YA 5C1YA 5HKKD 3OYPA 1GCTC 2HPPH 1QNJA 1SQAA 1UO6A 3A8CA 1IOEA 3L6PA 2YMSC 4R0IA 3D23A 1OP0A 1AZ8A 1DWEH 1HRTH 1J16A 5IK2D 5AHGH 3GDSA 1AFEH 4GAWA 2A7HA 2FOMB 3N7EA 1XUGA 4NGAH 1TX6A 3F9GA 3U28C 1OPHB 2B7DH 4YLUA 3UQOA 1BRCE 2GX4A 1O2WA 2KFWA 3HKIB 3OSYA 5FAHA 8ESTE 1NM6A 3PV2A 2GCTB 2FTMA 2PR3A 5HIYA 3LGIA 2HGTH 1FMGA 1G3BA 1ANBA 2F43B 3URDA 1BTWA 1ORFA 1O3JA 5HIZA 1BRBE 1C5WB 4X2YA 2BY6X 1KXDA 1OWIA 2FOCA 5HXFA 3M35A 3EA9A 2G00A 5HM2A 3RXSA 1EQ9A 4HTCH 4DIIH 2PKAB 2W5EA 4INLA 2YMSD 5F8TA 1NFUA 1OWDA 1D3PB 3BF6H 1WV7H 1O31A 3O8DA 5DP8A 1S84A 5HM9A 1K1JA 3SI3H 4CBNA 1TGNA 4XBBA 1EATA 1KLIH 1YPHC 2OQUA 3VEQB 4E7NA 1EX3A 5HYOA 3A82A 4UDWH 3U69H 1TGTA 1T4VH 3T62A 5KECA 2VGCC 4MDSA 2HVXA 1SHYA 3UB0A 3UUZA 1KXFA 1L2EA 3SUGA 5DSFA 2ANKH 1VITH 1CA8B 3WW7A 1C1PA 3QK1A 4GPGA 4K69A 1ZOMA 1ESTA 2Y7ZA 1CBWC 1A46H 5T1VA 2BDGA 4XE4A 2BM2A 2AERH 1B7XB 4ISOA 2AGGX 3RXQA 2ZWLH 5C1XA 2BZAA 1A0JA 4MNWA 1P2KA 1ZPZA 3F1SB 3SJ9A 1SGDE 4I7YH 2J4IA 4GUXA 5J4SA 1BT7A 3N7DA 3GY7A 1FDPA 1AGJA 3ATWA 4B76A 1P09A 1TNIA 3OAAD 2O8LA 1K1NA 1TRMA 2AYWA 1YCPM 2KCAA 3PMJA 1DLKB 1HAVB 2J34A 2AGIX 1AB9C 1GJBB 2JDID 3SV7A 1DDJA 2A32A 1DT2A 2QF4A 4NZLA 1GGDC 4Y76A 3TU7H 4K1EA 1LDTT 1TPOA 3RXAA 5A0BA 1C5VA 3RMMH 1GI7B 3QTVH 4JYTA 4TT3D 1QR3E 4B6EA 4YOGA 2R3YA 7GCHG 4D9RA 3W1EA 4OS4A 1AUTC 3M5OA 1HAHH 4ZKOU 1KSNA 4UFEH 2A0QB 1L1GA 3SO3A 2R2MB 4IC6A 2BX3A 3FZDA 5I25A 3MO3A 3TK6A 1SOTA 3ODFA 1W10U 3Q3XA 4U2WA 2VH6A 2UWPA 2SNWA 3NCLA 3E6PH 5LPEA 5B6LA 1GPZA 3PO1B 4OGYA 2A4OA 3A8BA 1EB2A 3CENA 3SU6A 3SUDA 5AF9H 4YT7H 1C5SA 2QF5A 2Z9GA 3M7QA 3M7UA 1GBBA 2F3CE 3HK3B 3UNQA 1N6YA 1Z6JH 3BIUH 4ISHH 2GCHG 3M5NA 3UWIA 1G2LA 1V2KT 1QL7A 3RDZA 1HIAB 4OGXA 3QUMP 5EXNA 4ZROA 1Y59T 3BG4C 3A7YA 4WXVA 3VXFH 2GKVE 2SGPE 1P10A 3TJOA 2ZU4A 3GY6A 2BDYA 1XVMA 2VIWA 1Z71A 7ESTE 1HAXB 2W7UA 3O8CA 3A86A 5EXLA 1TMBH 1BMAA 1VITG 4AGKA 3WWFA 5FL7D 3B23B 3LH1A 1O37A 1BHXF 3FP6E 3A7ZA 1NU9A 1SLWB 5GWZA 4HG6A 1UJ1A 1GBTA 1HAYB 4MPWA 1E38B 2OXSA 3PRBA 1IQHA 2GMTC 2QN5T 2XBWA 2QV1A 5L2ZH 1EP5A 5EIYA 4FU7A 2ALVA 1IHSH 1A5GH 5DP7A 2TPIZ 1PQAA 4OS1A 3F68H 1QHRB 4FU9A 5EQRA 3VFEA 1BTPA 1UHBA 3L3TA 4IN1A 3UNRA 1O5AB 1SGCA 2J2UA 1O38A 2A7CA 3Q3YA 1NRNH 4ABJA 2ODQA 2FM2A 2GZ7A 1C2FA 1SGFA 3M7TA 3O8BA 4X0WU 3RMNH 1P8VC 5DG6A 1LPGB 1E34B 1ZHPA 3OE7D 3PV4A 3N7OA 4JZ1A 1W2KH 2WSSD 6CHAC 1YLNA 2VJ1A 3F6UH 4IW4E 5AFYH 1AY6H 1YPGH 3RU4E 1SGPE 5I46H 3RXRA 3LGVA 1SGQE 2KAIB 2BOKA 5E0JA 4DT4A 2C90B 1MTWA 1DICA 3VB4A 5GNDA 1V2MT 3A8DA 1N1LA 3RLWH 4FU8A 3A85A 1V2NT 3SV9A 1QRZA 2ZGBH 3V13A 3E0NB 1QB9A 4NA9H 4WMEA 3HK6B 4FUEA 4XD7D 2Q6DA 1LVYA 4XBDA 2W7SA 3MO9A 2EI6A 2ZF0H 4ACAA 1BRAA 4X1QU 1K1MA 4CRCA 1DE7H 1EJAA 3VB6A 2C4FH 1LO6A 2FOHA 5DPAA 4DVAU 3A83A 1O3CA 2BY5X 1C5ZB 5C5NA 1O2VA 4ESTE 2VIOA 3KEEA 3E8LA 3A84A 5JBTA 2YNBA 1D6WA 1DWBH 1S0QA 1W11U 2FOEA 5GCHF 1GJCB 1GBFA 4A7IB 3MU8A 2R2WU 2XCNA 1C9PA 1HB0B 3H09A 3D65E 1C1NA 1O30A 5CHAC 5LGOA 2FIRH 4KELA
chains in the Genus database with same CATH topology
2SNVA 1ZPCA 3OFND 5DN6D 1MKWK 1AQ7A 1ARCA 3Q77A 1PPFE 4ZKSU 1Y3UA 1DUEA 1RFNA 1AI8H 1RTLA 2AHME 4CHAB 5E2OA 2KR7A 1GG6B 3GCNA 2OBOA 5BRRE 3RM0H 2AS9A 1ZSKA 3VGCC 2CGAA 2GZ9A 2FLRH 1DXWA 2BX4A 2ZFFH 1TX7A 1C2EA 1DITH 5FX6A 1KLTA 3QZQA 2ZFTA 3TGIE 1MTVA 1DFPA 3MNXA 4YLQH 1JWTA 4ZXXH 3SU5A 2BMGB 3DSOA 3SNCA 1BMFD 3SGBE 2RG3A 2WPDD 1SGRE 2J94A 2Q6GA 1IQFA 1UK3A 1IQIA 1GHWH 3SW2B 4B74A 4ABAA 1F0UA 4O9VA 1EP6A 1AKSA 2G81E 1AMHA 1OWHA 1NRPH 5DP4A 1W13U 1T32A 3H7TA 3ZZDA 3DA9B 2IJOB 1O3NA 4ZAEA 5ABWA 1C4V2 2ZPQA 6LPRA 3K65B 3VB3A 4BTUB 2QIQA 1J17T 1GBHA 2Y80A 4NZQA 3F3BA 4DIHH 2BYAX 1UCYK 3RXCA 1FIZA 1L4ZA 5A8XA 2PUQH 3SI4H 1OHHD 1F5RA 1FY5A 1P57B 4NWKA 1S6FA 1TONA 1UVOA 2HNTE 4WVPE 1QQUA 1HBTH 5GJ4B 1BA8B 3DSPA 3SGQE 1MQ5A 1TX8A 5F8XA 1LHGH 3KN2A 1C1UH 1J14A 2BD8A 3A8AA 5FHTA 1HXEH 3P17H 1C1SA 3A7VA 2FPZA 1XUHA 2XWBI 4YZUA 1C4U2 4GCHG 1DSUA 3E16B 1K1PA 3SZEA 4XOJA 2QA9E 3LH3A 2RDLA 4I8HA 1GJ7B 4H4FA 3MU4A 2P8OB 3U8RH 3F9EA 3GDUA 6ESTA 1G2MA 3OY5U 4K1TA 3UIRA 3ZZ9A 1MTUA 1INCA 1ZR0A 2ZDLA 2J95A 1O3LA 4AX9H 2ZA5A 2FLBH 5ESBA 2LELA 2GGVB 3W94A 1IQNA 1T7CA 3F2GA 1JRTA 2HLDD 1QIXB 1MD7A 1C2JA 2Y5FA 4X1NU 3D49H 4LOYH 3A7XA 4KGAA 2ZGXH 4K60A 2GV7A 2R9PA 1SLUB 1WQVH 3VB7A 1H8IH 2OK5A 2A2QH 2BOHB 5T6DA 1M9UA 1LHFH 1BBRH 2XOKD 5LPRA 2SGEE 2PUXB 4J1YA 4OS7A 2AIPA 2BD9A 4VGCB 5K7RA 1MTNC 5LH8A 2D2DA 5EQSA 1S6HA 1K9OE 1O3BA 1ZTKA 3RMLH 1AO5A 4LZ1H 4BAQB 3TH4H 4BTTB 1EPTB 1C5LH 2BVRH 4O03A 4RKOB 1O3GA 1YC0A 3HGNA 3M61U 4DURA 1TIOA 3K6YA 4OS6A 3BIVH 2QXHA 1P05A 5CDFE 2O8UA 1P2OA 2ZZUH 2F9OA 3PO1C 3TVJB 1A5HA 2VBCA 2BDBA 1V2QT 2H2ZA 2ZFRH 4K3JA 1TMTH 5JYIA 1HJAB 1XUJA 3KCGH 1FI8A 1TB6H 2D1JA 4AFZA 1CA0C 4I8GA 3VPKA 2AIQA 2JETB 1DWDH 1SLVB 2XNIA 1OWEA 1Y3XA 1J8AA 3EA7A 2G4TA 1FIWA 4WWYA 2XRCA 1TOCB 2BQ6B 3KGPA 1RIWC 4Y10E 3MNCA 3GY8A 3FVFB 2ZFQH 4WH6A 3LC5A 3RXJA 2ZCLP 4JYVH 4O3UA 3RXBA 1A7SA 1AU8A 1MD8A 1EAXA 2VNTA 4X2WA 1P3CA 1TRYA 2XXLA 5GXPA 4JZDH 2QAAA 1CT0E 3RUOA 4UFDH 2J5UA 3ESTA 1GBDA 4MPUA 3PLPA 2Z3DA 4NA8A 4CH8B 1NU7B 2PHBA 1HFDA 1C5YB 2Z7FE 1KXCA 1BCUH 3RXEA 1OWJA 1LKBA 1MQ6A 2C8ZB 5TCAA 1WTGH 1ID5H 2AH4X 4JZIA 1EASA 1KIGH 1D3QB 2TGDA 1NFXA 1GHBG 1GMCG 4KTSA 1YCPH 2FI4E 1O2RA 2VVVA 1FY8E 4WXIA 3SNEA 2ZHDA 1WAYB 2V7QD 1AD8H 2WYGA 5K0HA 1IQKA 4AOQA 1TNGA 2PGBB 1VCWA 4KTUA 5G4BA 3M3SA 3EE0B 3A80A 2SGFE 1GHAG 1HAGE 2Z9LA 3GDVA 3UOUA 1ZJKA 3FP7E 1MCVA 1GI0A 1YF4A 2JH6D 1CQQA 5EOKA 1PQ7A 3P95A 1ZRBA 1MZDA 3PMAB 4B2BA 2VH0A 3MU0A 3MU1A 5DP9A 1VGCB 2ZU2A 4D9QA 3LC3A 1T8LA 3SU1A 2DUCA 2PLXA 4BANB 4IMQA 3I77A 1ZTLA 4IN2A 2A5KA 4UONA 2C8XB 4Y11E 1AVGH 4ZHLU 3MNSA 4NSVA 3GCTG 5L30H 1OOKB 1SSXA 4ASHA 1C1QA 2XC4A 3OTPA 1TPAE 1D3DB 6GCHF 1ESAA 2JH0D 1PJPA 1DANH 1RJXB 4KTCA 3QGNB 5T6FA 3RXTA 1CVWH 1FN8A 3PWBA 5GPIB 1DY8A 5TCCA 5EODA 3RU4T 2BVSH 3KQDA 1GL0E 4YT6H 1H9HE 4HGCA 1O2NA 1LVBA 9LPRA 1MABB 1NTPA 4IBLH 3SBKA 1PPGE 4X1PU 2HNTC 2FYRA 2ZNKH 1HCGA 1WCZA 4K8YA 1XXFA 3VG8A 1BITA 1KTSB 4Y7AA 2ZCKP 1SFIA 1O3IA 1TYNA 4AFQA 1D3TB 1NN6A 1P2NA 1DVAH 1C5XB 1FONA 2ZPSA 4X8SH 1OYQA 1S85A 1MH0A 2FO9A 1OKXA 1UMAH 4TPYA 1CU1A 1GI5A 4ZKRU 1P2QA 4ZUHA 2BDHA 2QXIA 4CHAC 4UFFH 1QY6A 3MMGA 1MAYA 3W95A 3ZV9A 3ZZBA 3BEIB 3QTOH 1SI5H 2RCEA 3PMBB 1SKYE 1TNJA 3P8GA 1KDQA 4DGJA 2ANMH 2O8WA 3U8OH 1ELEE 3BEFB 3TIUA 3BSQA 4D76A 1MKWH 4CRFA 5DJ7A 1TGCA 1FXYA 2AGEX 4QT8C 3RC6A 2H5DA 3ZVAA 3U9AH 3S7HB 1TBQH 1AWFH 2Y5HA 2PSYA 3SU0A 1GBKA 1GVZA 3SQHE 1A0LA 1O39A 3DT0H 3OX7U 1BBRK 3MYWA 4K8BA 1F2SE 4ASUD 1AVWA 1SMFE 1NFYA 1YPMH 2C8WB 2Q6FA 1WUNH 2EI8A 1O2UA 4ISLA 2FOBA 1B5GH 4MQAA 3HATH 2XC5A 2QE7D 3PM3A 3SHCH 1A2CH 2UUYA 1G30B 2UWLA 3FANA 1O5DH 3RXVA 1WBGB 4AFSA 1P01A 4ZHAA 2A5AA 2A5IA 1T8OA 1NT1A 1P02A 1MKXH 1XUIA 1YPJH 4NIXA 4FUJA 1EXFA 2A45B 1BOQA 1EZQA 2FESH 4GHTA 3ZZ3A 4AG1A 5C2ZA 3P8OA 5LPFA 3QGJA 4I31A 1MZAA 4DY7B 4GLYA 1FV9A 5FPYA 4ZCNA 2RA0A 2BTCE 3IITA 1ZJDA 2NU1E 4X8UH 3TNSA 4LK4A 1DY9A 2ZECA 1YM0A 2FS8A 1BRUP 4A1TA 1HLTH 2L6OA 7LPRA 5F6MA 2NU0E 2OINA 4Y8XA 2CMYA 4DCDA 3MH7A 2FODA 3LONA 1O2JA 1EZXC 1LHDH 2PWXA 1GBIA 1XKAC 2B5TB 4TSFD 3RXGA 1SPJA 1UCYH 4ZXYH 4B73A 2C3SA 1ETTH 2WV5A 3AW1A 3OTJE 1DS2E 1A61H 1ZPBA 2FZZA 8LPRA 1V3XA 1Z1IA 3PWCA 2J9NA 2IOTA 4TWYA 3SV6A 2BLQA 3BTGE 1AHTH 1SVPA 5DGJA 1W8BH 1NY22 8GCHG 1SGEE 1KLJH 3PLKA 4THNH 1P12E 1BMLA 5FXLA 2ZDNA 4FUIA 5F8ZA 4Y8YA 2VVCA 2XNDD 2YNAA 4CR9A 5EW2H 4ZHMU 2KCPA 4FUGA 2VINA 2H9TH 1F0RA 4RSPA 3ZVCA 1SHHB 1UVUH 1ABJH 1NZQH 3KF2A 1V2RT 3GICB 4OM9A 1YCPK 1SGYE 1EPTC 4WF8A 1TPSA 4MLFB 4X2XA 3AK5A 2BLOA 1HAPH 3E0PB 2R0LA 4FETA 4Q7XA 5L6NH 3P92A 4CR5A 2EC9H 1ZMLA 2XYAA 1O3FA 3QX5H 4Y0ZE 4FUDA 1P9UA 3R0FA 1T8NA 2F91A 1P06A 1PPEE 3S9BA 4MTBA 2WINI 5E8EH 1L4DA 1EUFA 1VR1H 1JXPA 1UTQA 1HJAC 1DWCH 4DJZB 2BHGA 1ELVA 1ZHMA 1GHVH 2KZ4A 2ZDVH 1FLEE 2VB0A 3UY9A 2WPKS 3PTNA 3SV8A 2QF3A 1O2TA 1LQEA 4I8JA 2Z3EA 2UUKB 3UR6A 5JBCS 1C1WH 1QRXA 5CHBA 1CE5A 3MO6A 1QTFA 1N8OB 1C5OH 2ASUB 1F7ZA 4B2CA 1K1LA 4AORA 4GSOA 1ZRKA 1EJNA 1F0TA 3KL6A 2Z9JA 4Q2KA 1O3AA 2WPJS 1WSSH 1BHXB 4WH8A 2GT8A 1A4WH 2A7JA 1GBMA 1TWXB 2SGDE 1O2YA 1YPKH 3ZZ6A 2AEIH 4LXBH 4BNRA 2NWNA 1EKBB 2FP7B 1O5BB 2BQWB 4A92A 5EU8A 4MG3A 1P04A 1MU8B 2QYIA 3SJIA 2B0FA 7GCHF 2G8TA 1W7GH 2W3KA 1E37B 1B0FA 1AZZA 1E1QD 2PTNA 1GI2A 1BMNH 2GD4B 4A6LA 2VWNA 3RXLA 1GMDG 1A3EH 5HGGA 3BTFE 1ANDA 3TLOA 1HPGA 1Y3WA 1MU6B 4Q4LA 1GJDB 3ATIA 2JH5D 1O2QA 2D8WA 2ZC9H 1CT4E 3NXPA 4K5ZA 1MCTA 4BTIB 2ZIQH 2Y82A 4TWWA 4X8TH 2IJD1 3NRLA 1K28D 1Q3XA 4U32A 1GJ8B 1IQMA 1YGCH 1ZMJA 2GCHF 1Z8IB 1RTKA 1CGHA 1BB0B 3RXPA 4E06H 2Y5GA 1Y5BT 2LPRA 3FO8D 2ZFSA 2Z6BD 3KQCA 2GTBA 1O3PB 1TRNA 2WYJA 1BTHH 3M3TA 1O5GH 1ELFA 4I8KA 4D7GA 3RXMA 4O3TA 1Y5AT 1NBMD 5E0GA 1VGCC 5PTPA 2GT7A 2ZU1A 1TQ0B 2AMDA 3V12A 2ALPA 1QGFA 1W3CA 3ZVEA 5IYTA 5A2MH 1HNEE 1SGIB 3BTTE 1HV7A 1ETRH 3FAOA 2OC8A 3QO6A 4NIYA 1LHEH 5EW1H 2PW8H 4E05H 4FXGH 1CSOE 2GCTC 1CHOG 1UTMA 1HGTH 2HOBA 2HRVA 3P8FA 1C5QA 5A8ZA 3EA8A 4ISIH 1XM1A 2FI3E 3SYJA 5JBBS 2AMQA 2BY7X 4D7FA 5JB9S 2CXVA 2BLVA 1O2XA 1MKXK 4X6MA 3BTQE 4DW2U 1GMHG 4JZEH 2ZTXA 1UHBB 4TPIZ 1NO9H 1V2JT 3LGUA 2XBXA 3HPTB 3LT3A 3U1JB 4FUCA 4JCNA 3RMOH 1J15A 2G55A 1OSSA 5F53A 1GDNA 3ZIAD 1HJ8A 2OD3B 2FOGA 1P03A 4X6OA 1LHCH 1V2PT 3NUMA 2ZO3H 1K2I1 1X7AC 5C5OA 1DM4B 4HFPB 1ACBE 4SGAE 5E0HA 2QXJA 4XDEA 3SJOA 1AFQB 5A0AE 1BTYA 2ZGJA 3KIDU 2Z3CA 3ZVFA 3NZIA 4WJG2 1FY1A 3SU3A 5FBIA 3MNBA 3T29A 3M5MA 1O33A 4H6TA 1GHXH 1SL3A 1GBAA 2AFQB 1C2MA 3KHVA 3AW0A 2P59A 3F0OA 2A4GA 1GBEA 1FPHH 1RGQA 4Y7BA 1O2GH 2Q1JA 1ELAA 1F92A 1ELGA 2Z94A 3DFLA 3TK5A 1BQYA 1BZXE 1C4Y2 2FEQH 3ZVDA 1C5PA 4GVUA 4RI0A 1O0DH 2GZ8A 1Z7KA 3CS0A 3SV2H 2OP9A 2VIQA 1KXEA 3MOCA 3UQVA 4NIVA 1C5TA 1A1RA 1GI3A 1JIRA 4ABHA 1NC6A 1UVPA 1YKTA 3NWUA 4U01A 2P95A 1JMOH 3ZZAA 1O2OA 5A0CA 1SG8B 4ZKNU 3WWBA 3V7TA 4B75A 2ZHEH 3LGWA 2XCFA 2XBYA 3Q76A 2O9QA 3S9CA 3A89A 3TJVA 4CRDA 1LCYA 1O35A 1PPCE 1BTXA 4I32A 3D62A 1DX5M 3PV5A 4Y8ZA 5EQQA 3GY4A 5EPNA 1FPCH 4AFUA 1PQ8A 4UEHH 1BMMH 3M5LA 1EOJA 4XBCA 2A4RA 5GIBA 2P3FH 2PSXA 3ENSB 4JYUH 3F9FA 1GVLA 4ZH8A 2V35A 1H9IE 5IDKA 1QBVH 5DP5A 1NESE 9ESTA 4B2AA 4CRBA 3RXHA 2F4LA 4MPXA 2K1QA 1HYLA 2FOFA 1LMWB 1S0RA 3ATKA 3TGJE 1TMUH 3BN9A 1SB1H 1JBUH 3URCA 1AKSB 3PRDA 1GBJA 2FTLE 1ZLRA 4JK5A 3ZZ8A 1FX0B 2TRMA 1SBWA 4K2YA 1C2KA 1TOMH 1O32A 3I29A 3SN8A 1TAWA 1O34A 2V6NA 2ZU5A 2F9BH 1O2IA 1ELTA 3CP7A 1Z1JA 4YOIA 4NFFA 3RXUA 2WUBA 2EEKA 1L0ZA 1P11E 2FDAA 1UCYE 3MFJA 2TGAA 1K1IA 1TABE 2BZ6H 2XTTB 4RN6A 4DOQA 3BV9B 3O8RA 1BIOA 4X6NA 2PKAA 4CRAA 3BTHE 5FBEA 2ZQ2A 2ZGCA 2BD4A 4JK6A 1ABIH 2B9LA 3U98H 1EFRD 2M2AA 4MPVA 3UNSA 3Q3KA 1QJ7B 4GCHF 3HKJB 1ELCA 1A3BH 1NFWA 2WHXA 3T5FH 1VZQH 1H8ED 5C17A 4X6PA 4YO9A 4Z0KA 1WTHD 2P3UB 1CGIE 1Z8GA 2TBSA 6CHAB 3S7KB 1IAUA 2SGAA 2JJ1D 3SNAA 3OEHD 1IQGA 4BXWA 2KCYA