4I32A

Crystal structure of hcv ns3/4a d168v protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVVFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i32A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i32A01
2BD2A 2ZU2A 3M7TA 3RXGA 5J4QA 2ODYB 1DDJA 3KQCA 3BTFE 2EEKA 3TH3H 2IN2A 4X1SU 1BZXE 3ENSB 3BEIB 2WINI 3GY8A 1SGEE 1G32B 1CO7E 1DWEH 4AZ2B 2TGTA 1GBFA 1NRNH 3A83A 4MNVA 3SN8A 1ZHRA 1AZ8A 1C1TA 2EC9H 2J34A 8LPRA 3P8OA 1CBWC 1E37B 3GYLB 4TWYA 2KAIB 1RD3B 3QTOH 4CRFA 4Y7BA 1TIOA 4J2YB 2BD5A 3ZYDA 1Z8RA 2C8ZB 3JZ1B 1IQHA 3QZRA 3OYPA 1TBRH 3VXFH 3UY9A 1C9PA 1BOQA 3AAUA 2C8XB 4O03A 4X8UH 5EQRA 2ZHEH 1BTUA 3FVFB 4RN6A 5EOKA 2ZFTA 1GGDC 1O2IA 3ZV8A 2J4IA 3CS7A 1YCPH 3E90B 1O32A 1XX9A 4D8NA 1XXFA 2GKVE 2HLCA 4Q80A 1EP5A 4U2WA 3BTKE 3MH5A 1HXEH 2Y7ZA 3LT3A 1UTPA 1SGFG 1C5UA 2A4QA 1ANEA 2JETC 4I33A 1PYTD 5FHTA 2VIPA 1MZDA 3V0XA 3BSQA 2PR3A 4K3JA 3C27B 1YLCA 5DP4A 4D9QA 2ZHFH 1AU8A 1C5XB 3RC4A 1Z1IA 3SZNA 5HYOA 2G4UA 1GI7B 2HWLB 4MNYA 4H6TA 1CT4E 1TLDA 1OYQA 4FVDA 4E06H 3BG4C 3LGVA 1WQSA 5SGAE 1GHAF 2ZF0H 4WMDA 4BXWA 2GD4B 4K60A 1K28D 2GZ9A 4BNRA 4GHTA 1EPTA 9ESTA 3O8CA 3ZVFA 1YM0A 4BOHA 1BDAA 5FBIA 1SB1H 4CRGA 3CP7A 2WV9A 2EI7A 3RXDA 3ZVCA 2RDLA 4Y0ZE 2Q1JA 1HRTH 1AY6H 3K6ZA 2CJIA 2BDBA 2IOTA 5F8TA 4KELA 4I32A 2XCFA 1P3EA 4RKOB 3GCHC 2ZA5A 1GBTA 5L2YH 2EA3A 2V6NA 1KLTA 1HPGA 4KKDA 3RXMA 1EAIA 4ISLA 3T27A 2OC8A 1PQ7A 2BX3A 3MHWU 4E05H 4YLUA 3ATMA 1Z8JB 2PSYA 3RC6A 4YOJA 2QA9E 1QA0A 3LC3A 1V2MT 1C5NH 2GCHG 1DE7H 4NIXA 4ZHAA 3TH4H 3UR9A 3BIUH 1BTHH 1Z71A 3P95A 1F5RA 1NN6A 1Q31A 2BY9X 2BOKA 1QGFA 2HPQH 3KN2A 3QZQA 5E0HA 1P04A 3OY6U 4X0WU 1HAHH 1GHZA 3A88A 4AFSA 4X6OA 1C2HA 4MPXA 1O2LA 3E0NB 4CR5A 1GJDB 1BRCE 1PQ5A 2G52A 1LHDH 1LHGH 4YOIA 2ZFSA 5DPAA 2WV5A 1ZZZA 4NSVA 1ELAA 4A92A 1ZHPA 1SQOA 1N1LA 2FZZA 3HKIB 3JZ2B 4JZEH 1L4DA 2Y81A 5IYTA 5T6GA 3UWJH 3T26A 3SUDA 1TMTH 2BMGB 4MLFB 1K1IA 1LVYA 4AGKA 1MD7A 2ILNA 2NU1E 1DSTA 2FX6A 1YBWA 4X2VA 1EJNA 1UCYE 1QB6A 5T6FA 2Z3EA 5L30H 1GDUA 1EZXC 2RG3A 1O36A 3G01A 4IC5A 4MPUA 1YKTA 1SPJA 1ZTJA 1QB1A 4NGAH 4OS6A 4X2YA 3RUOA 1NC6A 2H1UA 3ODDA 1X7AC 1GWAA 4OS1A 3PV4A 4D7FA 2SGQE 5JB9S 4CH8B 1A1RA 1D4PB 2WYGA 2FDAA 1A5HA 2OUAA 1UVPA 1P11E 2OQ5A 3LPRA 3SNEA 2Y5FA 3UREA 1GDNA 1K21H 3QDZB 2JKHA 2A2QH 4WJG2 2FOHA 3MMGA 3GCOA 5DP6A 1SVPA 3ATIA 3P6ZB 2ZGHA 4FU7A 1EPTB 5F8XA 3A7VA 3RM0H 2Z9GA 3SNCA 3WY8A 1KXCA 1XUFA 3AAVA 1FPCH 3VB7A 4NSYA 3GYMA 3UNRA 4NIWA 3LDXH 5EU8A 3NXPA 1WBGB 1O35A 3H5CB 1CHOG 1AKSA 1MZAA 4K5ZA 1S6HA 4GUXA 3K9XB 4XOJA 1GG6B 4JYUH 1WTGH 1ZSJA 2Q6GA 4Q2KA 4RKJB 4UFEH 1JRTA 1DSUA 3NCLA 3A7YA 1QL7A 1U6QA 1MKXK 4KTUA 1FIZA 2STBE 1K1OA 3HGPA 4GAWA 4Y10E 1QL9A 1V2PT 1EASA 4WMFA 1DFPA 1Q2WA 4IN1A 5EXLA 1O2MA 1O2VA 3FP6E 2F91A 2GZ7A 1BBRE 3FZZA 1W10U 3MWIU 1PPFE 4UFGH 5C2ZA 3MH6A 3P17H 2CF9H 1MBMA 1TBZH 4X6MA 3EA7A 3RXFA 1YPHE 1O31A 1S81A 2CGAA 2H9EH 1Z7KA 3PMBB 5EW1H 1RFNA 3KHVA 2W7SA 1KLJH 1THSH 3FFGA 2BD9A 1TRNA 3QTVH 2LPRA 2XW9A 5T6DA 3AW0A 2Z3DA 1W7XH 1TQ7B 3NWUA 1A61H 2FX4A 1UK2A 4GLYA 3A7TA 3RXKA 2ZECA 1T8OA 2G81E 1SOZA 5A0CA 1ZPBA 1HUTH 1TRMA 2J92A 4H42U 1S85A 3DFLA 3F68H 3PMJA 3GDSA 2B7DH 3QX5H 4YOGA 2G5NA 3TNSA 2GCTB 1RXPA 2ZGXH 4Y71A 1O37A 1GJ8B 3SHCH 1OP8A 1HIAA 5CE1A 3E91A 5JBBS 3ZV9A 1H8DH 3T25A 4B2AA 2Y7XA 2PTNA 1P2JA 1F0SA 2AIPA 3O8DA 1BUIA 3RMLH 1GI1A 2H9TH 5DP8A 2Y6TA 1SFQB 1GI5A 3SI4H 3PROA 1O2RA 3TK5A 1QRXA 2WUBA 1GBIA 1MU8B 3RP2A 3T2NA 1O2PA 1BMMH 2W3KA 3SGBE 2FOGA 5C5OA 2UUKB 3VB6A 3MI4A 1FY3A 5E2PA 1KXEA 3RM2H 3VPKA 1HAGE 4MPVA 1ZGIA 2A7HA 2DE9A 1BBRK 3A8BA 4RI0A 2XXLA 1NRQH 1O3JA 3MH4A 4I31A 2FPZA 1TX7A 1W7GH 1HCGA 2Z9LA 2FM2A 4XBDA 3MO3A 2XC5A 2ZGBH 3B23B 4DJZB 2AFQB 1VCWA 3NZIA 4CREA 2J95A 2BX4A 4JCNA 1XUHA 3LGIA 2GZ8A 1P2OA 1BMNH 2QIQA 3SNDA 1QJ6B 3A8CA 4WMEA 1GMCG 3ZVDA 3PYHA 5E2OA 4IGDA 1Y5BT 1P02A 5TJXA 3VGCB 3E0PB 1C5OH 3GY7A 1CHOF 4HTCH 4I8HA 1C5ZB 3SV8A 2D1JA 3SW2B 1JIRA 1FZZA 2GTBA 1RGQA 2JH0D 1CGJE 1ID5H 1C2IA 3SQEE 2ANKH 1LHFH 2FTMA 1FDPA 1EPTC 3DHKH 2SGPE 1CT2E 1TWXB 4FUBA 3MO6A 3UWIA 3F9EA 1PPBH 4K2YA 1O5CB 4YM9A 2XBYA 1D3TB 1C5YB 1TOCB 1T4UH 3TIUA 3QGJA 1ESAA 3GCTF 5K7RA 2XBVA 4XFQA 1SI5H 3BN9A 2KAIA 1DOJA 3UOPA 2A4RA 1DWDH 1C1WH 2QGRA 1A4WH 1BMLA 1GG6C 4O9VA 3DD2H 1V2WT 1GJ6A 2WUCA 1MQ6A 4OGYA 2O8LA 1NM6A 1O2OA 3GICB 2W26A 2ZHQH 3U98H 3V13A 1UVOA 3ATWA 2CN0H 1HAVB 2H9HA 1MCTA 4FUJA 2FP7B 3RXRA 4E7NA 4K1TA 1MTNB 1UTJA 2ZHWH 1SGQE 2PW8H 4OS7A 1ZMNA 1GBEA 2C90B 1IQKA 3EA9A 3ZVGA 3LKWA 1UVUH 1FV9A 3RXQA 2BYAX 1DPOA 4BTTB 3GDUA 4OM9A 1ZGVA 4ZHLU 8KME2 1NO9H 2ZPQA 2DUCA 3RXLA 2R2WU 3V12A 4CHAC 2VINA 3SJIA 3STIA 3RC5A 1K9OE 2FYQA 2HPPH 2W3IA 3MOCA 2OTVA 3QK1A 2VIWA 5FCRA 5GPIB 3ZZ5A 2VU8E 1GBJA 3A81A 2UUYA 4CR9A 1V2KT 3PLKA 3RXVA 1AGJA 1J14A 3ZVBA 2PLXA 1O5EH 4OGXA 1ESBA 2HOBA 2A5KA 3UNSA 1HLTH 4WH6A 1W12U 1RTKA 5DK1A 1TA6A 2WPMS 4R8TB 5AVDA 1GBDA 2A4OA 1BRBE 2WPJS 2JH5D 4Y11E 2ZTZA 1MTUA 2ZQ1A 1P9UA 3CS0A 1MTVA 4FUHA 1ETRH 1DY9A 2BVSH 4IW4E 3U8OH 2A45B 2VGCC 1S5SA 1C2GA 1TAWA 5JBCS 2G51A 1IOEA 4B74A 1QURH 2H5CA 2QAAA 1G36A 1E0FD 3ESTA 1C1OA 2Z9JA 3GY3A 1DUAA 1F0TA 5C3NA 2O8UA 2GDDA 1TGCA 2HVXA 1D3DB 2LNCA 2QXJA 2Z9KA 4VGCC 3E16B 3M5MA 1THPB 1UTLM 1UJ1A 1NT1A 1UK3A 2BD7A 5A0BA 2FI4E 3LC5A 1UMAH 1K2I1 1GBMA 1NROH 1YPHC 3KCGH 1TRYA 1P2KA 2A2XH 1BTXA 4NWKA 2WPIS 3SBKA 1GMCF 1ELFA 3TLOA 2P95A 1O3EA 3E1XB 1TE0A 5EXNA 1CHGA 3SNAA 3BG8A 4ZH8A 3SQHE 3VB5A 3M3TA 3T29A 4OS5A 3BTME 1TMUH 2PFEA 4CRDA 3EAJA 2IPHA 2BDIA 2OBOA 4O3UA 4FU8A 1ELTA 4ESTE 3D62A 2SGFE 1EB2A 3L3TA 3PO1B 2ZIQH 2Y5GA 3A7ZA 4LXBH 1YPKH 1PYTC 1C2FA 1Q3XA 2R0LA 1CGHA 2EI8A 3A89A 2PGQB 3E8LA 4X8SH 1V2LT 3GY2A 3GY5A 3EGKH 4CRBA 2OQUA 4Y79A 1DXWA 3A8DA 1BRAA 5L2ZH 2PKSB 4HFPB 4KGAA 5LGOA 1C2KA 4BAQB 1TALA 5PTPA 2VNTA 2Z94A 1SR5C 1EB1H 1HJAC 3M3VA 1V2TT 1O2TA 2Y80A 3BF6H 5G4BA 2SGDE 1QL8A 1BBRH 4R0IA 2BTCE 2FWWA 5LPFA 4TYDA 1Z6EA 2FOBA 3STJA 1JMOH 1GJ5H 4Y8ZA 4AGJA 2QN5T 1D6RA 1O5FH 4UD9H 1CT0E 2BDHA 2A31A 4AYVB 2HGTH 2CXVA 1V3XA 1ETTH 3FANA 3TVJB 2IJOB 1IQNA 2ZDVH 1NRRH 1AUTC 3TGIE 5EW2H 5DKMA 2R9PA 1O2NA 4JMYA 1MTNC 2PHBA 5EODA 3UIRA 3UNQA 3SHAH 5EGMA 5E0GA 1LVBA 4HZHA 1P2QA 2P59A 5F03A 3RU4T 2V3OH 3MU4A 1O3AA 1OWJA 4MQAA 3EQ0H 2ALVA 4ZKNU 3SO3A 4ZHMU 5DP3A 3EE0B 2OBQA 1C5SA 3RU4D 1BTYA 1QB9A 2UWLA 3KQDA 2CHAB 1J15A 2VWOA 1PQAA 1NTPA 2FLRH 3BTDE 1ABJH 1PPCE 1FIWA 2F9PA 5AF9H 4F4OC 1DLKB 5E8EH 3RLWH 1C1QA 1IQLA 1O33A 4WF8A 1EQ9A 1Y3YA 3TH2H 2V35A 2ZZUH 1D9IA 3AASA 4NG9H 3SJ9A 3SU4A 4J1YA 3B9FH 1TB6H 2P3UB 4X6PA 1XUJA 1CQQA 1DWBH 1HAYB 4JYVH 5HMAA 2A4GA 1HFDA 4WWYA 1FY5A 1EZQA 1SLUB 4NFEA 4X1NU 1GHXH 1T7CA 3N7OA 1O2ZA 1THRH 2Y5HA 1PPHE 1DT2A 3RXIA 1KXDA 3UUZA 3A82A 1JWTA 1C9TA 5GCHG 3M7UA 2QCYA 1K1MA 3VB3A 1EJMA 4ISOA 1PFXC 2R0KA 1SQAA 1QY6A 1AD8H 2R3YA 2XC0A 2XYAA 1Z1JA 4ABEA 1O3PB 3OTJE 1OS8A 2BY5X 2ZTXA 1F5LA 1YLDA 4UONA 4AB8A 2ZC9H 3GISB 7KMEH 1AB9B 2I6SA 1FXYA 1GMDG 1GHBG 5ABWA 3BTWE 1GBLA 2BVRH 1W8BH 4OS2A 4M7GA 1GJBB 2BLQA 2PGBB 1T4VH 1TNLA 1NZQH 2ASUB 1TPSA 1O3NA 1WAYB 1OYTH 1RS0A 2VWMA 3RMOH 3M36A 2B8OH 2ZGCA 3MNSA 1AN1E 3P92A 2BQ7B 1N8OB 4NZLA 3PO1C 3VFEA 1P3CA 3S7HB 4X1QU 1KYNA 2QXGA 2HRVA 3RXOA 4MDSA 1L0ZA 4ABAA 2BZ6H 1O2UA 3M35A 2OLGA 5IDKA 1GJ7B 3P8GA 1VR1H 1HAOH 2BM2A 4AX9H 1SGCA 4AG1A 2PKSC 3RXUA 3LGUA 2QF3A 1XVMA 1MQ5A 2I6QA 2HNTE 1LPZB 1WV7H 1TNHA 4K1EA 1LTOA 2HALA 1F5KU 1A0JA 4MTBA 1ORFA 1GI6A 1T8NA 1SBWA 2F9OA 4DURA 2J94A 1MCVA 1BJVA 1LDTT 1P8VC 4AFQA 1IQMA 1W13U 3ATLA 4YZUA 5HM2A 2Y82A 3PTNA 3FP7E 1OWDA 1S0QA 1ZPZA 3HGNA 4X8TH 1IAUA 3TK6A 3ELAH 2P3TB 5C1UA 2F9BH 2FS8A 2ZP0H 3MU0A 1BHXF 1QR3E 4QT8C 2YOLA 1A46H 3NK8A 4LZ4B 2BLOA 4B2BA 1GBCA 3MTYA 2O8TA 3R3GB 3ZZDA 2BQWB 1EOJA 1QJ7B 3SU2A 2BXTH 4YT6H 2GCHF 5DP9A 1TNJA 3U1JB 1UVSH 1L1JA 1SOTA 6GCHG 1L2EA 3SV9A 3GY4A 1LO6A 1OOKB 1S0RA 1FN8A 3QUMP 2W7UA 4NCYA 3A80A 1SGRE 4INLA 3TJNA 1CA8B 4Y0YE 1O3IA 3ZZAA 2R2MB 2ZFRH 3HK3B 1FQ3A 1OKXA 5E0JA 3SU5A 4AORA 1HAVA 2ZI2H 2BD8A 2ZFQH 4Z0KA 2Z6BD 1D3QB 3ZYEA 4H4FA 2A5IA 2G00A 2C3SA 1C2JA 3L33A 1TA2A 3SU0A 3OTPA 2ZDMA 1UTKA 1MAXA 1MTSA 1YYY1 1ZR0A 3O8BA 1WTHD 1IQFA 2QY0B 1L4ZA 2FI3E 3K2UA 1GMDF 1O3GA 1TBQH 1Y3WA 2BLVA 1G37A 1GHBF 2ULLA 1SGPE 2OC1A 2P93A 2FYRA 4MG3A 4I7YH 1ELGA 1KDQB 1CA0B 4XSKU 1AIXH 2FOCA 4U32A 4JZFH 3SYJA 2FOFA 3ATKA 3OSYA 2FXRA 1EJAA 1O3OA 4A7IB 1YPLH 1RIWB 3Q77A 2YNAA 3M5LA 1AB9C 1V2VT 4ABBA 1FLEE 1HAIH 4AB9A 5ESBA 3F9FA 3P70B 1SLVB 3D65E 2NU4E 1MH0A 4WXVA 4K8YA 1SGTA 1ETSH 3RXCA 2WZQA 2BB4A 1OP0A 4FU9A 3TK9A 1CU1A 2XBWA 3MO9A 1C2DA 1P12E 4RSPA 1VCPA 1O38A 1HV7A 1EAWA 3OX7U 4E7RG 3A8AA 1GPZA 3TITA 1SGFA 1V2UT 1Y59T 1FY4A 1OWIA 3L6PA 1YPMH 4UE7H 3BEUA 3RXHA 1W0YH 2JH6D 3RU4E 1TNGA 3TU7H 2D8WA 1LCYA 4D9RA 1Y5UT 2W5EA 1AZZA 1IQEA 1TX8A 1WQVH 1H9IE 2F83A 3I78A 3PMAB 3SU6A 1AE8H 3UFAA 4DCDA 1FJSA 2AGGX 3SGAE 1A0LA 1GHYH 1Y3XA 3BIVH 1H9LB 4U01A 2TGAA 1MUEB 1P05A 1C1UH 1O34A 1C4Y2 3SU3A 3H09A 4A1XA 2ZU5A 3MNBA 3S9BA 1CBWB 1P57B 3RMMH 1P03A 4KTCA 2ZPSA 3RXEA 1YPJH 3IG6B 3KL6A 3TGKE 1Z6JH 3RXTA 5LPEA 1Z8IB 4TPIZ 2ESTE 4NIYA 4SGBE 2AS9A 4X6NA 2GGVB 2H6MA 1H1BA 2VVUA 2ZDNA 1G2MA 2TIOA 5FX6A 5T1VA 3FP8E 3PWCA 1K1PA 2QXHA 3S9AA 1GGDB 2A1DB 4AFUA 1GCDA 1C1VH 4ZMAH 4X8VH 3UPEA 1G3BA 3A7WA 3OU0A 1FMGA 1QRZA 2VIDA 3S9CA 2CV3A 3D49H 1AWHB 1VJ9U 4IMZA 2ZNKH 4ABHA 6GCHF 1P0SH 1HB0B 7ESTE 1G9IE 1ELEE 1O3CA 1O5DH 4ZXYH 3M61U 1BQYA 4B1TA 2XCNA 2JETB 1H9HE 2VIOA 1GBHA 4NA7A 1Y8TA 5A09A 1QBNA 1V2OT 3TPIZ 3TNTA 5B6LA 1O2XA 3AW1A 2ZO3H 3HKJB 1SC8U 1TMBH 5DP7A 3UTUH 3AVZA 1NY22 2VWLA 1AUJA 1N6XA 2ZFFH 4I8LA 3H7TA 1ZRKA 1C1MA 2HNTC 1BIOA 1SGDE 3HK6B 1O3BA 1KTSB 1ANCA 2BY6X 4IMQA 3A87A 3DUXH 3U9AH 2O8WA 1NRPH 3C1KA 3LJJA 1V2QT 4DIIH 1AI8H 2B5TB 1O2GH 1TONA 2P8OB 1C5RA 3FAOA 3KIDU 4JZIA 1GI2A 2GDEH 1B7XB 3M3SA 5TCAA 1S6FA 4DT7B 1GBAA 2SFAA 1NU9A 1P2MA 2A7CA 1C5TA 2CMYA 2XNIA 1MBQA 5HXFA 4YO9A 3LH3A 1KLIH 1XXDA 4Y8XA 1TGTA 1XUGA 2FS9A 1T8MA 2RCEA 4B73A 1N6YA 1K1LA 4LOYH 1O2QA 1LMWB 2GCTC 1KSNA 1NU7B 2ZFPH 3QLPH 4AFZA 4YT7H 1ZLRA 4LZ1H 1ELBA 2STAE 2C8YB 5B6OA 4HI3A 2ANWA 5C5NA 4NIVA 1IQGA 2OC7A 4JK5A 3Q76A 4UDWH 4BAKB 2F9UA 1NS3A 3AK5A 3F9HA 1RIWC 1TGNA 1KIGH 1YP9A 1C5PA 3O8RA 2FEQH 1J8AA 1YF4A 3QWCH 2AMQA 1MKWH 1UTOA 2D26C 3VB4A 1O3KA 4B75A 3SJKA 2O9QA 1SMFE 4WH8A 3M5NA 4ZKSU 1DY8A 1GMHG 2C93B 1W14U 1C1NA 2RA3A 5EQQA 1C2EA 4ABJA 1GCTB 1PQ8A 3CENA 1BMAA 1EXFA 5FPTA 3SORA 1C2MA 1C5WB 4DG4A 4B2CA 1ELVA 1YGCH 2BHGA 1Z8GA 2ALPA 4FUFA 1DANH 1SQTA 1EAUA 1ZYOA 1O3LA 2FOAA 3U8RH 1S83A 1J9CH 3EA8A 3BV9B 1BHXB 4XDEA 1UHBB 1JOUB 4A1VA 2UUFB 5FCKA 1XKBC 1HAXB 5JB8S 3DT0H 2J38A 5C67A 1QQUA 3VGCC 3PV5A 1O3HA 1QFKH 1RTFB 2Z3CA 3K65B 4D7GA 1ELDE 1TPOA 1EZUC 1XM1A 5DO4H 3OY5U 1SL3A 1JXPA 5AHGH 5TCCA 4XBBA 5JBTA 1D6WA 2M5TA 4WXIA 1O5GH 2AH4X 1MU6B 4GPGA 1O5BB 1RJXB 1SGYE 1S82A 3SJOA 1L1GA 1MAYA 1BTWA 1Y3UA 3UOUA 2AYWA 2FLBH 4TWWA 5A8YA 1A7SA 1C1RA 3T62A 3LU9B 1O3MA 4M9FA 4IN2A 4B76A 4ABGA 2NU0E 4KP0A 3SV7A 1AFEH 2QXIA 4MVNA 2RA0A 1GI9B 4B6FA 3ZZ9A 2FMJA 2J9NA 1ABIH 2WV4A 1ZJDA 3PMHB 1O2HA 4HGCA 1FY1A 3I29A 1DICA 1A3EH 4MNWA 3VEQB 3DA9B 3MU8A 3RXBA 1BA8B 1E38B 1VJAU 1W2KH 4CBNA 1O2KA 1GI3A 2WPHS 3URCA 3BEFB 1XKAC 3PWBA 1KTTB 1TOMH 1G30B 4GHQA 4ISIH 2ZTYA 2BQ6B 3DFJA 1CGIE 1P9SA 2GMTB 4NA9H 3LJOA 2VJ1A 1AFQB 3ZZBA 4FXGH 4ZXXH 5I46H 4DIHH 5ETXA 4ABFA 4ZAEA 1LKAA 2PKAB 1P2NA 1QJ1B 1SFIA 1C5VA 4ZKRU 4NFFA 5C1YA 1LPKB 2XWBI 8ESTE 5I25A 4CRCA 1C5MD 2CF8H 2SGAA 1NPMA 5A8ZA 2PTCE 1NFYA 1QA7A 1WU1A 4H6SB 1YPEH 2P8OC 2WPKS 1QBOA 3ITIA 5DG6A 1ZHMA 3LGYA 3F6UH 2FOEA 1ELCA 5K0HA 1INCA 2A5AA 1DUEA 1IHSH 1CE5A 4X2XA 2SNVA 2ZDAH 3MH7A 5CMXH 1UVTH 4YLQH 1DVAH 1WUNH 2ZCLP 2H2ZA 3KF2A 3E6PH 3UQOA 1F0RA 1XVOA 4NWLA 4DGJA 4NZQA 1S84A 1VGCB 1WOFA 1EX3A 3V3MA 3E3TA 3KNXA 1GMHF 5A0AE 1AE5A 2QF0A 4ZROA 4FUIA 2WHXA 2A32A 4AN7A 4CH2B 1NFXA 3RXSA 1ARBA 4BAOB 1C2LA 3LH1A 1G3CA 1BRUP 3ZZ8A 3NPSA 1QCPA 3GDVA 3T5FH 1O0DH 1SLWB 2XTTB 4ASHA 1QTFA 3ZVEA 1VITG 4YTAA 5JYIA 3D23A 4IBLH 1C4V2 1ZMLA 1GDQA 3QGNB 5DJ7A 1D3PB 1GCTC 3M5OA 2Z7FE 4INHA 3ZZ6A 5HGGA 1GVZA 2XC4A 1ACBE 1ANDA 1V2ST 2OP9A 3KGPA 1AVWA 1UTMA 1UO6A 1FPHH 2K1QA 3BTQE 5DP5A 2P3FH 3SV6A 1UTNA 1SHYA 5C1XA 4A6LA 2VWNA 2ZDKA 1O2WA 1SHHB 3TJUA 4FUDA 1KDQA 4X1PU 1GL0E 1W0ZU 4JZDH 1PJPA 2D2DA 2R3UA 3K6YA 2OD3B 4JYTA 4KTSA 1EKBB 4CRAA 4K1SA 4IC6A 2NU2E 1RTLA 3QN7A 5LPRA 4GSOA 5AFZH 3BTEE 4Q7YA 2AIQA 3S69A 2GV7A 2OC0A 1KXFA 1OWHA 1EZSC 3SUGA 1TQ0B 5T3HA 5GXPA 1BTPA 3UR6A 3LGWA 1C5QA 3P8FA 1FI8A 1L1NA 3R0FA 1FY8E 4BANB 3IITA 4INKA 3EDXB 4UEHH 3SOSA 2XWAA 1FONA 4X1RU 2BY7X 1ARCA 4Q7ZA 3W94A 1AVXA 1IHTH 2TBSA 3KEEA 1EP6A 1O39A 2AERH 1OWEA 4Z6AH 2A0QB 2NWNA 3MFJA 1PPEE 1BCUH 1WSSH 2AMDA 2TRMA 1FN6A 1VZQH 1HDTH 2B9LA 1QIXB 4WVPE 2ZHDA 2VIVA 2F4LA 1O2JA 1F2SE 4BAMB 4ZKOU 2BXUH 1GHVH 3GCNA 3T28A 3RXJA 2BDGA 1HGTH 2BD3A 4K69A 1G3EA 1GJCB 1K22H 1DM4B 1V2JT 3SUFA 4OS4A 3SNBA 3SJ8A 1XUKA 5F8ZA 3NKKA 3RXAA 2ODQA 2YNBA 4MNXA 2OK5A 3PLBA 1O30A 4JK6A 4O97A 8GCHG 2ZGJA 3EYDA 6ESTA 7GCHG 1HBTH 1GVKB 3HATH 1EAXA 2GMTC 2ZU1A 1TPAE 1AFQC 1RRKA 1O5AB 4Y7AA 1C5LH 1ZSKA 2PWXA 2P94A 3SZEA 2ZKSA 2VBCA 1GJ9B 2F9NA 3QO6A 2G4TA 5DGJA 2BOHB 1V6DA 1GI0A 2DE8A 2PUQH 4ABDA 2ZU3A 2CHAC 3BTTE 5BRRE 1FUJA 1QRWA 5FXLA 1C4U2 2THFB 5FAHA 5HM9A 5EPNA 3S7KB 1Y5AT 3RXPA 3W95A 1KY9A 1HJ8A 2BLWA 3GCTG 2O8MA 3PV2A 1UCYK 1A5GH 1DLEA 1A2CH 1NESE 1P01A 1KXBA 2GVFA 2ZG0H 1DS2E 3A84A 3IWMA 1MKWK 1BT7A 1PPGE 3ZZ3A 1YPGH 3SUEA 1ZTKA 1P09A 1PPZA 2OCVB 6CHAB 4ISNA 5GCHF 1GBKA 1TGSZ 1AO5A 2OXSA 3SV2H 4CHAB 1IQIA 2FTLE 1VGCC 4BAHB 4MPWA 4JZ1A 1OWKA 4Y8YA 2SNWA 1M9UA 5J4SA 2J2UA 1VITF 2G5VA 4F49A 5CHAB 1H8IH 1LHEH 1O3DA 1QNJA 2ZCKP 4GCHG 4B6EA 1OP2A 4ISHH 4UFFH 3Q3YA 2BDYA 1ZOMA 4FUEA 1BJUA 1VITH 3LGTA 1ANBA 1MTWA 3Q3XA 3U69H 1J16A 4Q7XA 3I77A 3BTHE 5A8XA 1GI8B 2ODPA 1G3DA 5GIBA 3UQVA 1J17T 1SG8B 3H7OA 2IJD1 2ZDLA 1NFUA 2Q6DA 3LOXA 1GBBA 5EXMA 4Y6DA 3MU5A 5FX5A 1FAXA 4WY3A 1W11U 3M37A 2VGCB 1E36B 4Y76A 1OSSA 5L6NH 4U30A 1P10A 1JIMA 1ZJKA 1UK4A 1ZSLA 1GJAB 5FBEA 4D76A 2Z9IA 1P06A 1SSXA 1V2NT 1HJ9A 1WCZA 2A7JA 2GT7A 5ESTE 2VVCA 4PROA 3M7QA 1WYKA 4VGCB 2EI6A 3PB1E 3ZZCA 3VXEH 1CSOE 2QYIA 1ZMJA 2H5DA 1N8OC 1YCPK 5H4IB 2ZU4A 1GL1A 4I8JA 1GHWH 2VB0A 5EG4A 5C20A 2ANMH 1A3BH 1T8LA 5GWZA 2ZPRA 2C8WB 4TY7A 1KXAA 1DX5M 2BVXH 3KQBA 2UWPA 1K1JA 1C1PA 4A5TS 4DW2U 1LKBA 1SLXB 3Q3KA 4BTUB 1IQJA 1GJ4H 4XE4A 5AFYH 1AKSB 1ZPCA 2OINA 5GJ4B 3B8JA 4DOQA 4BXSA 1C1SA 1UTQA 1XUIA 2V3HH 3F1SB 1F7ZA 3RMNH 4DVAU 8GCHF 7GCHF 3HPTB 1TYNA 3S0NA 3PLPA 1Y3VA 5JBAS 1EUFA 1OPHB 1JRSA 1OXGA 3NUMA 4FUGA 5LH8A 1B5GH 3MYWA 2ANYA 3V7TA 1LQEA 4I8GA 1BB0B 2AGIX 2FODA 1E35B 1T31A 1UHBA 1O2YA 1DWCH 3BTGE 1TNKA 2FESH 2AGEX 4BTIB 2FI5E 1HJAB 4THNH 3ZVAA 2V0BA 5GNDA 1A5IA 2PV9B 2PSXA 4IS5A 5JDUB 3F9GA 4FUCA 3P8NA 3SU1A 1EATA 2UWOA 1ZRBA 6LPRA 1AMHA 2UUJB 2VVVA 1P2IA 1B0FA 1HYLA 1JBUH 2GV6A 3GY6A 3MNCA 4TPYA 5EPYA 1H4WA 1F92A 2GT8A 1YCPM 1HNEE 3U1IB 4YESB 1HAPH 1OX1A 1TPPA 4ABIA 3A86A 1BITA 1LVOA 4A1TA 2BDCA 1WXRA 4UFDH 1DXPA 1HXFH 3URDA 4AG2A 1QHRB 2QC2A 3BG4B 4K8BA 3RLYH 1T32A 4LK4A 4GCHF 3LIWA 1K1NA 1E34B 4GVUA 3ZZ4A 2BZAA 6CHAC 1F0UA 2TGPZ 1YC0A 1GI4A 3LONA 5BPEA 2WYJA 2XBXA 2Q6FA 1TFXA 1ZTLA 3MU1A 3Q00A 1G2LA 2ZEBA 2F9VA 2ZQ2A 3TJOA 2AEIH 4TY6A 1HIAB 1TX6A 1VCQA 2FOMB 2VH0A 1A0HB 7LPRA 1QBVH 1TNIA 2TGDA 1TGBA 5CHAC 1FAKH 1FNIA 2AMPA 1MMJN 3GCHB 3GOVB 3ZZ7A 1XMNB 3TGJE 1GHAG 4SGAE 3SI3H 1AQ7A 3U8TH 1NFWA 2XRCA 1V2RT 2ZCHP 1ESTA 1AVGH 1CA0C 1CVWH 4O3TA 1LVMA 2PKAA 3FZDA 3TJVA 2B0FA 4XBCA 2G55A 1NRSH 9LPRA 4AYYB 2BY8X 2VIQA 1MKXH 2BD4A 1AWFH 1MD8A 1GVLA 1O2SA 3MNXA 1AHTH 4DY7B 4AOQA 1SGNE 1QQ4A 2SGEE 2WPLS 5GDSH 1B0EA 1LHCH 2NU3E 2QV1A 5EQSA 1UCYH 5F6MA 1HAZB 1TABE 3PM3A 2C4FH 4FVBA 2TPIZ 4X2WA 1SGIB 3SGQE 2ZWLH 2VH6A 5FPSA 3ODFA 5FPYA 1W3CA 2F3CE 2GX4A 1DITH 4I8KA 2FIRH 1LQDB 4B71A 2BDAA 3A85A 1BTZA 3KQEA 5A2MH 1LPGB 2PUXB 4ZUHA 2GP9B 3PTBA 2P16A 4CBOA 4NA8A 1O3FA 2FO9A 3RDZA 2HNTF 3A7XA 2G8TA 1EOLA 5JPMH
chains in the Genus database with same CATH superfamily
2BD2A 2J5UA 3FKSD 2ZU2A 3M7TA 3RXGA 5J4QA 2ODYB 1DDJA 3KQCA 3BTFE 2EEKA 3TH3H 2IN2A 4X1SU 1BZXE 3ENSB 3BEIB 2WINI 3GY8A 1SGEE 1G32B 1CO7E 1DWEH 4AZ2B 2TGTA 1GBFA 1NRNH 3A83A 4MNVA 3SN8A 1ZHRA 1AZ8A 1C1TA 2EC9H 2J34A 8LPRA 3P8OA 1CBWC 1E37B 5HIZA 3GYLB 4TWYA 2KAIB 1RD3B 3QTOH 3OE7D 4CRFA 4Y7BA 1TIOA 4J2YB 2BD5A 3ZYDA 1Z8RA 2C8ZB 2GJGA 3JZ1B 1IQHA 3QZRA 3OYPA 1TBRH 3VXFH 3UY9A 1C9PA 1BOQA 3AAUA 2C8XB 4O03A 4X8UH 5EQRA 2ZHEH 1BTUA 3FVFB 4RN6A 5EOKA 2ZFTA 1GGDC 1O2IA 3N99A 3ZV8A 2J4IA 3CS7A 1YCPH 3E90B 1O32A 1XX9A 4D8NA 1XXFA 2GKVE 2HLCA 4Q80A 1EP5A 4U2WA 3BTKE 3MH5A 1HXEH 2Y7ZA 3LT3A 1UTPA 1SGFG 1C5UA 2A4QA 1ANEA 2JETC 4I33A 2KCAA 1PYTD 5FHTA 2VIPA 1MZDA 3V0XA 3BSQA 2PR3A 4K3JA 3C27B 1YLCA 5DP4A 4D9QA 2ZHFH 1AU8A 1C5XB 3RC4A 1Z1IA 3SZNA 5HYOA 2G4UA 1GI7B 2HWLB 4MNYA 4H6TA 1CT4E 1TLDA 1OYQA 1YWUA 4FVDA 4E06H 3BG4C 3LGVA 1WQSA 5EJ1A 5SGAE 1GHAF 2ZF0H 4WMDA 4BXWA 1VKYA 2GD4B 4K60A 1K28D 2GZ9A 4BNRA 4GHTA 1EPTA 9ESTA 3O8CA 3ZVFA 1YM0A 4BOHA 1BDAA 5FBIA 1SB1H 4CRGA 3OFND 3CP7A 2WV9A 2EI7A 3RXDA 3ZVCA 2M2AA 2RDLA 4Y0ZE 2Q1JA 1HRTH 1AY6H 3K6ZA 2CJIA 2BDBA 2IOTA 5F8TA 4KELA 4I32A 2XCFA 1P3EA 4RKOB 3GCHC 2ZA5A 1GBTA 5L2YH 2EA3A 2V6NA 1KLTA 1HPGA 4KKDA 3RXMA 1EAIA 4ISLA 3T27A 2OC8A 1PQ7A 2BX3A 3MHWU 4E05H 4YLUA 3ATMA 1Z8JB 2PSYA 3RC6A 4YOJA 2QA9E 1QA0A 3LC3A 1V2MT 1C5NH 2GCHG 1DE7H 4NIXA 4ZHAA 3TH4H 3UR9A 3BIUH 1BTHH 1Z71A 3P95A 1F5RA 1NN6A 1Q31A 2BY9X 2BOKA 1QGFA 2HPQH 3KN2A 3QZQA 2K0QA 5E0HA 1P04A 3OY6U 4X0WU 1HAHH 1GHZA 3A88A 2YMSC 4AFSA 4X6OA 3MQKC 1C2HA 4MPXA 1O2LA 3E0NB 4CR5A 1GJDB 1BRCE 1PQ5A 2G52A 1LHDH 1LHGH 4YOIA 2ZFSA 5DPAA 2J97A 2WV5A 1ZZZA 1E79D 4NSVA 1ELAA 4A92A 1ZHPA 1SQOA 1N1LA 2FZZA 3HKIB 3JZ2B 4JZEH 1L4DA 2Y81A 5IYTA 5T6GA 3UWJH 3T26A 3SUDA 1TMTH 2BMGB 4MLFB 1K1IA 2WSSD 1LVYA 4AGKA 1MD7A 2ILNA 2NU1E 1DSTA 2FX6A 1YBWA 4X2VA 1EJNA 3F2FA 1UCYE 1QB6A 5T6FA 4YXWD 2Z3EA 5L30H 1GDUA 1EZXC 2RG3A 1O36A 3G01A 4IC5A 4MPUA 1YKTA 1SPJA 3CNRA 1ZTJA 1QB1A 4NGAH 4OS6A 4X2YA 3RUOA 1NC6A 2H1UA 3ODDA 1X7AC 1GWAA 4OS1A 3PV4A 4D7FA 2SGQE 5JB9S 4CH8B 1A1RA 1D4PB 2WYGA 2FDAA 1A5HA 2OUAA 1UVPA 1P11E 2OQ5A 3LPRA 3SNEA 2Y5FA 3UREA 1GDNA 1K21H 3QDZB 2JKHA 2A2QH 4WJG2 2FOHA 3MMGA 3GCOA 5DP6A 1SVPA 3ATIA 3P6ZB 2ZGHA 4FU7A 1EPTB 5F8XA 3A7VA 3RM0H 2Z9GA 3SNCA 3WY8A 1KXCA 1XUFA 3AAVA 1FPCH 3VB7A 4NSYA 3GYMA 3UNRA 4NIWA 3LDXH 3F2GA 5EU8A 3NXPA 1WBGB 4HG6A 1O35A 3H5CB 1CHOG 1AKSA 1MZAA 4K5ZA 5HIYA 1S6HA 4GUXA 3K9XB 2JJ2D 4XOJA 1GG6B 2JDID 4JYUH 1WTGH 3VG8A 1ZSJA 2KR7A 2Q6GA 4Q2KA 4RKJB 4UFEH 1JRTA 1DSUA 3NCLA 3A7YA 1QL7A 1U6QA 1MKXK 4KTUA 1E1QD 1FIZA 2STBE 1K1OA 3HGPA 4GAWA 4Y10E 1QL9A 1V2PT 1EASA 4WMFA 1DFPA 1Q2WA 4IN1A 5EXLA 1O2MA 1O2VA 3FP6E 5CDFE 2F91A 2GZ7A 1BBRE 3FZZA 1W10U 3MWIU 1PPFE 4UFGH 5C2ZA 3MH6A 3P17H 2CF9H 1MBMA 1TBZH 4X6MA 3EA7A 3RXFA 1YPHE 1O31A 1S81A 2CGAA 2H9EH 5DN6D 1Z7KA 3PMBB 5EW1H 1RFNA 3KHVA 2W7SA 1KLJH 2KX4A 3DCLA 1THSH 3FFGA 2BD9A 1TRNA 3QTVH 2LPRA 2XW9A 2RDEA 5T6DA 3AW0A 2Z3DA 1W7XH 1TQ7B 3NWUA 1A61H 2FX4A 1UK2A 4GLYA 3A7TA 3RXKA 2ZECA 1T8OA 2G81E 1SOZA 5A0CA 1ZPBA 1HUTH 1TRMA 2J92A 4H42U 1S85A 3DFLA 3F68H 3PMJA 3GDSA 2B7DH 3QX5H 4YOGA 2G5NA 3TNSA 2GCTB 1RXPA 2ZGXH 4Y71A 1O37A 1GJ8B 1MABB 3SHCH 1BMFD 1OP8A 1HIAA 5CE1A 3E91A 5JBBS 3ZV9A 1H8DH 3T25A 4B2AA 2Y7XA 2PTNA 1P2JA 1F0SA 2AIPA 3O8DA 1BUIA 5CHBA 3RMLH 1GI1A 2H9TH 5DP8A 2Y6TA 1SFQB 1GI5A 3SI4H 3PROA 1O2RA 3TK5A 1QRXA 2WUBA 1GBIA 1MU8B 3RP2A 3T2NA 1O2PA 1BMMH 2W3KA 3SGBE 2FOGA 5C5OA 4Q63A 2UUKB 3VB6A 3MI4A 1FY3A 5E2PA 1KXEA 3RM2H 3VPKA 1HAGE 4MPVA 1ZGIA 2A7HA 2DE9A 1BBRK 3A8BA 4RI0A 2XXLA 1NRQH 1O3JA 3MH4A 4I31A 2FPZA 1TX7A 1W7GH 1HCGA 2Z9LA 2FM2A 4XBDA 3MO3A 2XC5A 2ZGBH 3B23B 4DJZB 2AFQB 1VCWA 3NZIA 3DSGA 4CREA 2J95A 2BX4A 4JCNA 1XUHA 3LGIA 2GZ8A 1P2OA 1BMNH 2QIQA 3SNDA 1QJ6B 3A8CA 4WMEA 1GMCG 3ZVDA 3PYHA 5E2OA 4IGDA 1Y5BT 1P02A 5TJXA 3VGCB 3E0PB 1C5OH 3GY7A 1CHOF 4HTCH 4I8HA 1C5ZB 3SV8A 2D1JA 3SW2B 4DT4A 1JIRA 1FZZA 2GTBA 1RGQA 2JH0D 1CGJE 1ID5H 1C2IA 3SQEE 2ANKH 1LHFH 3FOAA 2FTMA 1FDPA 1EPTC 3DHKH 2SGPE 1CT2E 1TWXB 4FUBA 3MO6A 3UWIA 3F9EA 1PPBH 4K2YA 1O5CB 4YM9A 2XBYA 1D3TB 1C5YB 1TOCB 1T4UH 3TIUA 3QGJA 1ESAA 3GCTF 5K7RA 2XBVA 4XFQA 1SI5H 3BN9A 2KAIA 1DOJA 3UOPA 2A4RA 1DWDH 1C1WH 2QGRA 1A4WH 1BMLA 1GG6C 4O9VA 3DD2H 1V2WT 1GJ6A 2WUCA 1MQ6A 4OGYA 2O8LA 1NM6A 1O2OA 3GICB 2W26A 2ZHQH 3U98H 3V13A 1UVOA 3ATWA 2CN0H 1HAVB 2H9HA 1MCTA 4FUJA 2FP7B 3RXRA 4E7NA 4K1TA 1MTNB 1UTJA 1WDIA 2ZHWH 1SGQE 2PW8H 4OS7A 1ZMNA 1GBEA 2C90B 1IQKA 3EA9A 3ZVGA 3LKWA 1UVUH 1FV9A 3RXQA 2BYAX 1DPOA 4BTTB 3GDUA 4OM9A 5FL7D 1ZGVA 4ZHLU 8KME2 1NO9H 2ZPQA 2DUCA 3RXLA 2R2WU 4ACAA 3V12A 4CHAC 2VINA 3SJIA 3STIA 3RC5A 1K9OE 2FYQA 2HPPH 2W3IA 3MOCA 2OTVA 3QK1A 2VIWA 5FCRA 4Q4LA 5GPIB 3ZZ5A 2VU8E 1GBJA 3A81A 2UUYA 4CR9A 1V2KT 3PLKA 3RXVA 1AGJA 1J14A 3DSOA 2PLXA 1O5EH 4OGXA 3ZVBA 1ESBA 2HOBA 2LELA 2A5KA 3UNSA 1HLTH 4WH6A 1W12U 1RTKA 5DK1A 1TA6A 2WPMS 4R8TB 5AVDA 1GBDA 2A4OA 1BRBE 2WPJS 2JH5D 4Y11E 2ZTZA 1MTUA 2ZQ1A 1P9UA 3CS0A 1MTVA 4FUHA 1H8ED 1ETRH 1DY9A 2BVSH 4IW4E 3U8OH 2A45B 2VGCC 1S5SA 1C2GA 1TAWA 5JBCS 2G51A 1IOEA 4B74A 1QURH 2H5CA 2QAAA 1G36A 4ASUD 1E0FD 3ESTA 1C1OA 2Z9JA 3GY3A 1DUAA 4XRNA 1F0TA 5DSFA 5C3NA 2O8UA 2GDDA 1TGCA 2HVXA 1D3DB 2LNCA 2QXJA 2Z9KA 4VGCC 3E16B 3M5MA 1THPB 1UTLM 1UJ1A 1NT1A 1UK3A 2BD7A 5A0BA 2FI4E 3LC5A 1UMAH 1K2I1 1GBMA 1NROH 1YPHC 3KCGH 1TRYA 1P2KA 2A2XH 1BTXA 4NWKA 2WPIS 3SBKA 1GMCF 1ELFA 3TLOA 2P95A 1O3EA 3E1XB 1TE0A 5EXNA 1CHGA 3SNAA 3BG8A 4ZH8A 3SQHE 3VB5A 3M3TA 3T29A 4OS5A 3BTME 1TMUH 2PFEA 4CRDA 3EAJA 2IPHA 2BDIA 2OBOA 4O3UA 4FU8A 1ELTA 4ESTE 3D62A 2SGFE 1EB2A 3L3TA 3PO1B 2ZIQH 2Y5GA 3A7ZA 4LXBH 1YPKH 3F3BA 2EQNA 1PYTC 1C2FA 1Q3XA 2R0LA 1CGHA 1E1RD 2EI8A 2PGQB 3A89A 3E8LA 4X8SH 1V2LT 3GY2A 3GY5A 3EGKH 4CRBA 2OQUA 4Y79A 1DXWA 3A8DA 1BRAA 5L2ZH 2PKSB 4HFPB 4KGAA 5LGOA 1C2KA 4BAQB 1TALA 5PTPA 2VNTA 2Z94A 1SR5C 1EB1H 1HJAC 3M3VA 1V2TT 1O2TA 2Y80A 3BF6H 5G4BA 2SGDE 1QL8A 1BBRH 4R0IA 2BTCE 2FWWA 5LPFA 2KCYA 1Z6EA 2FOBA 4TYDA 3STJA 1JMOH 1GJ5H 4Y8ZA 4AGJA 2QN5T 1D6RA 1O5FH 4UD9H 1CT0E 2BDHA 2A31A 4AYVB 2HGTH 2CXVA 1V3XA 1ETTH 3FANA 3TVJB 2IJOB 1IQNA 2ZDVH 1NRRH 1AUTC 3TGIE 5EW2H 5DKMA 2R9PA 3KYFA 1O2NA 4JMYA 1MTNC 2PHBA 5EODA 3UIRA 3UNQA 3SHAH 5EGMA 5E0GA 1LVBA 4HZHA 1P2QA 2P59A 5F03A 3RU4T 2V3OH 3MU4A 1O3AA 1OWJA 4MQAA 3EQ0H 2ALVA 4ZKNU 3SO3A 4ZHMU 5DP3A 3EE0B 2OBQA 1C5SA 3RU4D 1BTYA 1QB9A 2UWLA 3KQDA 2CHAB 1J15A 2VWOA 1PQAA 1NTPA 2FLRH 3BTDE 1ABJH 1PPCE 1FIWA 2F9PA 5AF9H 4F4OC 1DLKB 2QE7D 5E8EH 3RLWH 1C1QA 1IQLA 1O33A 4WF8A 1EQ9A 4ZCNA 1Y3YA 3TH2H 2V35A 2ZZUH 1D9IA 3AASA 4NG9H 3SJ9A 3SU4A 4J1YA 3B9FH 1TB6H 2P3UB 4X6PA 1XUJA 1CQQA 1DWBH 1HAYB 4JYVH 5HMAA 2A4GA 1HFDA 4WWYA 1FY5A 1EZQA 1SLUB 4NFEA 4X1NU 1GHXH 1T7CA 3N7OA 1O2ZA 1THRH 2Y5HA 1PPHE 5F53A 1DT2A 3RXIA 1KXDA 2K8IA 3UUZA 3A82A 1JWTA 1C9TA 5GCHG 3M7UA 2QCYA 1K1MA 2CK3D 3VB3A 1EJMA 4ISOA 4F55A 1PFXC 2R0KA 1SQAA 1QY6A 1AD8H 2R3YA 2XC0A 2XYAA 1Z1JA 4ABEA 1O3PB 3OTJE 1OS8A 2BY5X 2ZTXA 1F5LA 1YLDA 4UONA 4Z1MD 4AB8A 2ZC9H 3GISB 7KMEH 1AB9B 2I6SA 1FXYA 2J98A 1GMDG 1GHBG 5ABWA 3BTWE 1GBLA 2BVRH 1W8BH 4OS2A 4M7GA 1GJBB 2BLQA 3PRBA 2PGBB 1T4VH 1TNLA 1NZQH 2ASUB 1TPSA 1O3NA 1EFRD 1WAYB 1OYTH 1RS0A 2VWMA 3RMOH 3M36A 2B8OH 2ZGCA 3MNSA 1AN1E 3P92A 2BQ7B 1N8OB 4NZLA 3PO1C 3VFEA 1P3CA 3S7HB 4X1QU 1KYNA 2QXGA 5C0UA 2HRVA 3RXOA 2HLDD 4MDSA 1L0ZA 4ABAA 2BZ6H 1O2UA 3M35A 2OLGA 5IDKA 1GJ7B 3P8GA 1VR1H 1HAOH 2BM2A 4AX9H 1SGCA 4AG1A 2PKSC 3RXUA 3LGUA 2QF3A 1XVMA 1MQ5A 2I6QA 2HNTE 1LPZB 1WV7H 1TNHA 4K1EA 1LTOA 2HALA 1F5KU 1A0JA 4MTBA 1ORFA 1GI6A 1T8NA 1SBWA 2F9OA 4DURA 2J94A 1MCVA 1BJVA 1LDTT 1P8VC 4ACBA 4AFQA 1IQMA 1W13U 3ATLA 4YZUA 5HM2A 2Y82A 3PTNA 3FP7E 1OWDA 1S0QA 1ZPZA 3HGNA 4X8TH 1IAUA 3TK6A 3ELAH 2P3TB 5C1UA 2F9BH 2FS8A 2ZP0H 3MU0A 1BHXF 1QR3E 4QT8C 2YOLA 1A46H 3NK8A 4LZ4B 2BLOA 4B2BA 1GBCA 3MTYA 4RT1A 2O8TA 3R3GB 3ZZDA 3DSPA 2BQWB 1EOJA 1QJ7B 3SU2A 2BXTH 4YT6H 3W1EA 2GCHF 5DP9A 1TNJA 3U1JB 1UVSH 1L1JA 1SOTA 6GCHG 1L2EA 3SV9A 3GY4A 1LO6A 1OOKB 1S0RA 1FN8A 3QUMP 2W7UA 4NCYA 3A80A 1SGRE 4INLA 3TJNA 1CA8B 4Y0YE 1O3IA 3ZZAA 2R2MB 2ZFRH 3HK3B 1FQ3A 1OKXA 5E0JA 3SU5A 4AORA 2J98B 1HAVA 2ZI2H 2BD8A 2ZFQH 4Z0KA 2Z6BD 1D3QB 3ZYEA 4H4FA 2A5IA 2G00A 2C3SA 1C2JA 3L33A 1TA2A 3OTPA 3SU0A 2ZDMA 1UTKA 1MAXA 1MTSA 5C17A 1YYY1 1ZR0A 3O8BA 1WTHD 1IQFA 2QY0B 1L4ZA 2FI3E 3K2UA 1GMDF 1O3GA 1TBQH 1Y3WA 2BLVA 1G37A 1GHBF 2ULLA 1SGPE 2OC1A 2P93A 2FYRA 4MG3A 4I7YH 1ELGA 1KDQB 1CA0B 3NRLA 4XSKU 1AIXH 2FOCA 4U32A 4JZFH 3SYJA 2FOFA 3ATKA 3OSYA 1FX0B 2FXRA 1EJAA 1O3OA 4RT0A 4A7IB 1YPLH 1RIWB 3Q77A 2YNAA 3M5LA 1AB9C 1V2VT 4ABBA 1FLEE 1HAIH 4AB9A 5ESBA 3F9FA 3P70B 1SLVB 3D65E 2NU4E 1MH0A 4WXVA 4K8YA 1SGTA 1ETSH 2WZQA 3RXCA 2BB4A 1OP0A 4FU9A 3TK9A 1CU1A 2XBWA 3MO9A 1C2DA 1P12E 4RSPA 1VCPA 1O38A 1HV7A 1EAWA 3OX7U 4E7RG 3A8AA 1GPZA 3TITA 1SGFA 1V2UT 1Y59T 1FY4A 1OWIA 3L6PA 1YPMH 4UE7H 3BEUA 3RXHA 1W0YH 2JH6D 3RU4E 1TNGA 3TU7H 2D8WA 1LCYA 4D9RA 1Y5UT 2W5EA 1AZZA 1IQEA 1TX8A 1WQVH 1H9IE 2F83A 3I78A 3PMAB 3SU6A 1AE8H 3UFAA 4DCDA 1FJSA 2AGGX 3SGAE 1A0LA 1GHYH 1Y3XA 3BIVH 1H9LB 4U01A 2TGAA 1MUEB 1P05A 1C1UH 5HKKD 1O34A 1C4Y2 3H09A 3SU3A 4A1XA 3UB0A 2ZU5A 3MNBA 3S9BA 1CBWB 1P57B 3RMMH 1P03A 4KTCA 2ZPSA 3RXEA 1YPJH 3IG6B 3KL6A 3TGKE 1Z6JH 3RXTA 5LPEA 1Z8IB 4TPIZ 2ESTE 4NIYA 4SGBE 2AS9A 2IPQX 4X6NA 2GGVB 2H6MA 1H1BA 2VVUA 2ZDNA 1G2MA 2TIOA 5FX6A 5T1VA 3FP8E 3PWCA 1K1PA 2QXHA 3S9AA 1GGDB 2A1DB 4AFUA 1GCDA 1C1VH 4ZMAH 4X8VH 3UPEA 2QF5A 1G3BA 3A7WA 3OU0A 1FMGA 1QRZA 2VIDA 3S9CA 5KEDA 2CV3A 3D49H 1AWHB 1VJ9U 4IMZA 2ZNKH 4ABHA 6GCHF 1P0SH 1HB0B 7ESTE 1G9IE 1ELEE 1O3CA 1O5DH 4ZXYH 3M61U 1BQYA 4B1TA 2XCNA 2JETB 1H9HE 2VIOA 1GBHA 4NA7A 1Y8TA 5A09A 1QBNA 1V2OT 3TPIZ 3TNTA 5B6LA 1W0JD 1O2XA 3AW1A 2ZO3H 3KYGA 2JJ1D 3HKJB 1SC8U 1TMBH 2AHME 5DP7A 3UTUH 3AVZA 1NY22 2VWLA 1AUJA 1N6XA 2ZFFH 4I8LA 4XD7D 3H7TA 1ZRKA 1C1MA 2HNTC 1BIOA 1SGDE 3HK6B 1O3BA 1KTSB 2KM0A 1ANCA 2BY6X 4IMQA 3A87A 3DUXH 3U9AH 2O8WA 1NRPH 3C1KA 3LJJA 1V2QT 4DIIH 1AI8H 2B5TB 1O2GH 1TONA 2P8OB 1C5RA 3FAOA 3KIDU 4JZIA 1GI2A 2GDEH 1B7XB 3M3SA 5TCAA 1S6FA 4DT7B 1GBAA 2SFAA 1NU9A 1S6LA 1P2MA 2A7CA 1C5TA 2CMYA 2XNIA 1MBQA 5HXFA 4YO9A 3LH3A 1KLIH 1KMHB 1XXDA 3U28C 4Y8XA 1TGTA 1XUGA 2FS9A 1T8MA 2RCEA 4B73A 1N6YA 1K1LA 4LOYH 1O2QA 1LMWB 2GCTC 1KSNA 1NU7B 2ZFPH 3QLPH 4AFZA 4YT7H 1ZLRA 4LZ1H 1ELBA 2STAE 2C8YB 5B6OA 4HI3A 2ANWA 5C5NA 4NIVA 1IQGA 2OC7A 4JK5A 3Q76A 4UDWH 4BAKB 2F9UA 1NS3A 3AK5A 3F9HA 1RIWC 1TGNA 1KIGH 1YP9A 1C5PA 3O8RA 2FEQH 1J8AA 3EE7A 1YF4A 3QWCH 2AMQA 1MKWH 1UTOA 2D26C 3VB4A 1O3KA 4B75A 3SJKA 2O9QA 1SMFE 4WH8A 3M5NA 4ZKSU 1DY8A 1GMHG 2C93B 1W14U 1C1NA 2RA3A 3F2HA 5EQQA 1C2EA 4ABJA 1GCTB 1PQ8A 3CENA 1BMAA 1EXFA 5FPTA 3SORA 1C2MA 1C5WB 4DG4A 4B2CA 1ELVA 1YGCH 2BHGA 1Z8GA 2ALPA 4FUFA 1DANH 1SQTA 1EAUA 1ZYOA 1O3LA 2FOAA 1COWD 3U8RH 4P00A 1S83A 1J9CH 3EA8A 3BV9B 1BHXB 4XDEA 1UHBB 1JOUB 4A1VA 2UUFB 5FCKA 1XKBC 1HAXB 5JB8S 3DT0H 2J38A 5C67A 1QQUA 3PV5A 3VGCC 1O3HA 1QFKH 1RTFB 2Z3CA 3K65B 1UW7A 4D7GA 1ELDE 2F43B 1TPOA 1EZUC 1XM1A 5DO4H 3OY5U 1SL3A 1JXPA 5AHGH 5TCCA 4XBBA 5JBTA 1D6WA 2M5TA 4WXIA 1O5GH 2AH4X 1MU6B 4GPGA 1O5BB 1RJXB 1SGYE 1S82A 3SJOA 3OEHD 1L1GA 1MAYA 1BTWA 1Y3UA 3UOUA 2AYWA 2FLBH 4TWWA 5A8YA 1A7SA 1C1RA 3T62A 3LU9B 1O3MA 4M9FA 4IN2A 4B76A 4ABGA 2NU0E 4KP0A 3SV7A 1AFEH 5KECA 2QXIA 4MVNA 2RA0A 1GI9B 4B6FA 3ZZ9A 2FMJA 2J9NA 1ABIH 3WWFA 2WV4A 1W0KD 3KQ5A 1ZJDA 3PMHB 1O2HA 4HGCA 5IK2D 1FY1A 3F0PA 3I29A 1DICA 1A3EH 4MNWA 3VEQB 3DA9B 3MU8A 3RXBA 1BA8B 1E38B 1VJAU 1W2KH 4TSFD 4CBNA 1O2KA 1GI3A 3GS9A 2WPHS 3URCA 3BEFB 1XKAC 3PWBA 1KTTB 1TOMH 1G30B 4GHQA 4ISIH 2ZTYA 2BQ6B 3DFJA 1CGIE 1P9SA 2GMTB 4NA9H 3LJOA 2VJ1A 1AFQB 3ZZBA 4FXGH 4ZXXH 5I46H 1K0HA 4DIHH 5ETXA 4ABFA 4ZAEA 1LKAA 2PKAB 1P2NA 1QJ1B 2V3MA 1SFIA 1C5VA 4ZKRU 4NFFA 5C1YA 1LPKB 2XWBI 8ESTE 5I25A 4CRCA 1C5MD 2CF8H 2SGAA 1NPMA 5A8ZA 2PTCE 1NFYA 1QA7A 1WU1A 4FETA 4H6SB 1YPEH 2LP6A 2P8OC 2WPKS 1QBOA 3ITIA 5DG6A 1ZHMA 3LGYA 3F6UH 2FOEA 1ELCA 5K0HA 1INCA 2A5AA 1DUEA 1IHSH 1CE5A 4X2XA 2SNVA 2ZDAH 3MH7A 5CMXH 1UVTH 4YLQH 1DVAH 1WUNH 2ZCLP 2H2ZA 3KF2A 2RFKC 3E6PH 3UQOA 1F0RA 1XVOA 4NWLA 4DGJA 4NZQA 1S84A 1VGCB 4FOUC 1WOFA 1EX3A 3V3MA 3E3TA 3KNXA 1GMHF 5A0AE 1AE5A 2QF0A 4ZROA 4FUIA 2WHXA 2A32A 4AN7A 4CH2B 1YLNA 1NFXA 3RXSA 1ARBA 1YY3A 4BAOB 1C2LA 3LH1A 1G3CA 1BRUP 3ZZ8A 3NPSA 1QCPA 3GDVA 3T5FH 1O0DH 1SLWB 3PRDA 2XTTB 4ASHA 1QTFA 3ZVEA 1VITG 4YTAA 5JYIA 3D23A 4IBLH 1C4V2 1ZMLA 4P02A 3OEED 1GDQA 3QGNB 5DJ7A 1D3PB 1GCTC 3M5OA 2Z7FE 4INHA 3ZZ6A 5HGGA 1GVZA 2XC4A 3F0OA 1ACBE 1ANDA 1V2ST 2OP9A 3KGPA 1AVWA 1UTMA 1UO6A 1FPHH 2K1QA 3BTQE 5DP5A 2P3FH 3SV6A 1UTNA 1SHYA 5C1XA 4A6LA 2VWNA 2ZDKA 1O2WA 1SHHB 3TJUA 2YMSD 4FUDA 1KDQA 4X1PU 1GL0E 1W0ZU 4JZDH 1PJPA 2D2DA 2R3UA 3K6YA 2OD3B 4JYTA 5C0TA 4KTSA 1EKBB 4CRAA 5EJLA 4K1SA 4IC6A 2NU2E 2WPDD 1RTLA 2KZ4A 3QN7A 5LPRA 4GSOA 5AFZH 3BTEE 4Q7YA 2AIQA 3UAIC 3S69A 2GV7A 2OC0A 1KXFA 1NBME 1OWHA 1EZSC 3SUGA 1TQ0B 2JIZD 5T3HA 5GXPA 1BTPA 3UR6A 3LGWA 1C5QA 3P8FA 1FI8A 1L1NA 3R0FA 1FY8E 4BANB 3IITA 4INKA 3EDXB 4UEHH 3SOSA 2XWAA 1FONA 4X1RU 2BY7X 1ARCA 4Q7ZA 3W94A 1AVXA 1IHTH 2TBSA 3KEEA 1EP6A 1SKYE 1O39A 2AERH 2QF4A 1OWEA 4Z6AH 2A0QB 2NWNA 3MFJA 1PPEE 1BCUH 1WSSH 2AMDA 2TRMA 1FN6A 1VZQH 1HDTH 2B9LA 1QIXB 2V7QD 2ZHDA 4WVPE 2VIVA 2F4LA 1O2JA 1F2SE 4BAMB 4ZKOU 2BXUH 1GHVH 3GCNA 3T28A 3RXJA 2BDGA 1HGTH 2BD3A 4K69A 1G3EA 1GJCB 1K22H 1DM4B 1V2JT 3SUFA 4OS4A 3SNBA 5EIYA 3SJ8A 1XUKA 3N7EA 5F8ZA 3NKKA 3RXAA 2ODQA 2YNBA 4MNXA 2OK5A 3PLBA 1O30A 4JK6A 4O97A 8GCHG 2ZGJA 3EYDA 6ESTA 7GCHG 1HBTH 2L74A 4I86A 1GVKB 3HATH 1EAXA 2GMTC 2ZU1A 1TPAE 1AFQC 1RRKA 1O5AB 4Y7AA 1C5LH 1ZSKA 2PWXA 2P94A 3SZEA 2ZKSA 2VBCA 1GJ9B 2F9NA 3QO6A 2G4TA 5DGJA 2BOHB 1V6DA 1GI0A 2DE8A 2PUQH 2HVYB 4ABDA 2ZU3A 2CHAC 2W6ID 3BTTE 3WWBA 5BRRE 1FUJA 1QRWA 5FXLA 1C4U2 2THFB 5FAHA 5HM9A 5EPNA 3S7KB 1Y5AT 3RXPA 3W95A 1KY9A 1HJ8A 2BLWA 3GCTG 2O8MA 2PP6A 3PV2A 1UCYK 1A5GH 1DLEA 1A2CH 1NESE 1P01A 1KXBA 2GVFA 2ZG0H 3WW7A 1DS2E 3A84A 3IWMA 1MKWK 1BT7A 1PPGE 3ZZ3A 1YPGH 3SUEA 1ZTKA 1P09A 1PPZA 2OCVB 6CHAB 4ISNA 5GCHF 1GBKA 1TGSZ 1AO5A 2OXSA 3SV2H 4CHAB 1IQIA 2FTLE 1VGCC 4BAHB 4MPWA 4JZ1A 1OWKA 4Y8YA 2SNWA 1M9UA 5J4SA 2J2UA 1VITF 2G5VA 4F49A 5CHAB 1H8IH 1LHEH 1O3DA 1QNJA 2ZCKP 4GCHG 4B6EA 1OP2A 4ISHH 4UFFH 3Q3YA 2BDYA 1ZOMA 4FUEA 1BJUA 1VITH 1H8HD 3LGTA 1ANBA 1MTWA 3Q3XA 3U69H 1J16A 4Q7XA 3I77A 3BTHE 5A8XA 1GI8B 2ODPA 1G3DA 5GIBA 3UQVA 1J17T 1SG8B 2IJD1 3H7OA 2ZDLA 1NFUA 2Q6DA 3LOXA 1GBBA 5EXMA 4Y6DA 3MU5A 5FX5A 1FAXA 4WY3A 1W11U 3M37A 2VGCB 1E36B 4Y76A 1OSSA 5L6NH 4U30A 1P10A 5C94A 3N7DA 1JIMA 1ZJKA 1UK4A 1ZSLA 1GJAB 5FBEA 4D76A 1SQRA 2Z9IA 1P06A 1SSXA 1V2NT 2W6JD 1HJ9A 1WCZA 2A7JA 2GT7A 5ESTE 2VVCA 4PROA 3M7QA 1WYKA 4VGCB 2EI6A 3PB1E 3ZZCA 3VXEH 1CSOE 2QYIA 1ZMJA 2H5DA 1N8OC 1YCPK 5H4IB 2ZU4A 1GL1A 4I8JA 1GHWH 2VB0A 5EG4A 5C20A 2ANMH 2XNDD 1A3BH 1T8LA 1OHHD 5GWZA 2ZPRA 2C8WB 4TY7A 1KXAA 1DX5M 2BVXH 1QZ8A 3KQBA 2UWPA 1K1JA 1C1PA 4A5TS 4DW2U 1LKBA 1SLXB 3Q3KA 4BTUB 1IQJA 1GJ4H 4XE4A 5AFYH 1AKSB 4TT3D 1ZPCA 2OINA 5GJ4B 3B8JA 4DOQA 4BXSA 1C1SA 1UTQA 1XUIA 2V3HH 3F1SB 2XOKD 1F7ZA 3RMNH 4DVAU 8GCHF 4AC9A 7GCHF 3HPTB 1TYNA 5KGOA 3S0NA 3PLPA 1Y3VA 5JBAS 1EUFA 1OPHB 1JRSA 1OXGA 3NUMA 4FUGA 5LH8A 1B5GH 3MYWA 2ANYA 3V7TA 3ZIAD 1LQEA 4I8GA 4F48B 1BB0B 2AGIX 2FODA 1E35B 1T31A 1UHBA 1O2YA 1DWCH 3BTGE 1TNKA 2FESH 2AGEX 4BTIB 2FI5E 1HJAB 4THNH 3ZVAA 2V0BA 5GNDA 1A5IA 2KCOA 2PSXA 2PV9B 4IS5A 5JDUB 3F9GA 4FUCA 3P8NA 3SU1A 1EATA 2UWOA 1ZRBA 3FN8A 6LPRA 1AMHA 2UUJB 2VVVA 1P2IA 1B0FA 1HYLA 1JBUH 2GV6A 3GY6A 3MNCA 4TPYA 5EPYA 1H4WA 1F92A 2GT8A 1YCPM 1HNEE 3U1IB 4YESB 1HAPH 1OX1A 1TPPA 4ABIA 3A86A 1BITA 1LVOA 4A1TA 2BDCA 1WXRA 4UFDH 1DXPA 1HXFH 3URDA 4AG2A 1QHRB 2QC2A 3BG4B 4K8BA 3RLYH 2KFWA 1T32A 4LK4A 4GCHF 3LIWA 1K1NA 1E34B 1NBMD 4GVUA 3ZZ4A 2BZAA 6CHAC 1F0UA 2TGPZ 1YC0A 1GI4A 3LONA 5BPEA 2WYJA 2XBXA 2Q6FA 1TFXA 1ZTLA 3MU1A 3Q00A 1G2LA 2ZEBA 2F9VA 2ZQ2A 3TJOA 2AEIH 4TY6A 1HIAB 1TX6A 1VCQA 2FOMB 2VH0A 1A0HB 7LPRA 1QBVH 1TNIA 2TGDA 1TGBA 5CHAC 1FAKH 1FNIA 2AMPA 1MMJN 3GCHB 3GOVB 3OAAD 3ZZ7A 1XMNB 3TGJE 1GHAG 4SGAE 3SI3H 1AQ7A 3U8TH 1NFWA 2XRCA 1V2RT 2ZCHP 1ESTA 1AVGH 1CA0C 1CVWH 4O3TA 1LVMA 2PKAA 3FZDA 3TJVA 2B0FA 4XBCA 2G55A 1NRSH 9LPRA 4AYYB 2BY8X 2VIQA 1MKXH 2BD4A 1AWFH 1MD8A 1GVLA 1O2SA 3MNXA 1AHTH 4DY7B 4AOQA 1SGNE 1QQ4A 2SGEE 2WPLS 5GDSH 1B0EA 1LHCH 2EY4C 2NU3E 2QV1A 5EQSA 1UCYH 5F6MA 1HAZB 1TABE 3PM3A 3FO8D 2C4FH 4FVBA 2TPIZ 4X2WA 1SGIB 3SGQE 2ZWLH 2VH6A 2YMSB 5FPSA 3ODFA 5FPYA 1W3CA 2F3CE 2GX4A 1DITH 4I8KA 2FIRH 1LQDB 4B71A 2BDAA 3A85A 1BTZA 3KQEA 2L6OA 5A2MH 5EJZA 1LPGB 2PUXB 4ZUHA 2GP9B 3PTBA 2P16A 4CBOA 4NA8A 1O3FA 2KCPA 2FO9A 3RDZA 2HNTF 3A7XA 2G8TA 1EOLA 5JPMH
chains in the Genus database with same CATH topology
2BD2A 2J5UA 3FKSD 2ZU2A 3M7TA 3RXGA 5J4QA 2ODYB 1DDJA 3KQCA 3BTFE 2EEKA 3TH3H 2IN2A 4X1SU 1BZXE 3ENSB 3BEIB 2WINI 3GY8A 1SGEE 1G32B 1CO7E 1DWEH 4AZ2B 2TGTA 1GBFA 1NRNH 3A83A 4MNVA 3SN8A 1ZHRA 1AZ8A 1C1TA 2EC9H 2J34A 8LPRA 3P8OA 1CBWC 1E37B 3GYLB 4TWYA 2KAIB 1RD3B 3QTOH 3OE7D 4CRFA 4Y7BA 1TIOA 4J2YB 2BD5A 3ZYDA 1Z8RA 2C8ZB 3JZ1B 1IQHA 3QZRA 3OYPA 1TBRH 3VXFH 3UY9A 1C9PA 1BOQA 3AAUA 2C8XB 4O03A 4X8UH 5EQRA 2ZHEH 1BTUA 3FVFB 4RN6A 5EOKA 2ZFTA 1GGDC 1O2IA 3ZV8A 3N99A 2J4IA 3CS7A 1YCPH 3E90B 1O32A 1XX9A 4D8NA 1XXFA 2GKVE 2HLCA 4Q80A 1EP5A 4U2WA 3BTKE 3MH5A 1HXEH 2Y7ZA 3LT3A 1UTPA 1SGFG 1C5UA 2A4QA 1ANEA 2JETC 4I33A 2KCAA 1PYTD 5FHTA 2VIPA 1MZDA 3V0XA 3BSQA 2PR3A 4K3JA 3C27B 1YLCA 5DP4A 4D9QA 2ZHFH 1AU8A 1C5XB 3RC4A 1Z1IA 3SZNA 5HYOA 2G4UA 1GI7B 2HWLB 4MNYA 4H6TA 1CT4E 1TLDA 1OYQA 4FVDA 4E06H 3BG4C 3LGVA 1WQSA 5SGAE 1GHAF 2ZF0H 4WMDA 4BXWA 2GD4B 4K60A 1K28D 2GZ9A 4BNRA 4GHTA 1EPTA 9ESTA 3O8CA 3ZVFA 1YM0A 4BOHA 1BDAA 5FBIA 1SB1H 4CRGA 3OFND 3CP7A 2WV9A 2EI7A 3RXDA 3ZVCA 2M2AA 2RDLA 4Y0ZE 2Q1JA 1HRTH 1AY6H 3K6ZA 2CJIA 2BDBA 2IOTA 5F8TA 4KELA 4I32A 2XCFA 1P3EA 4RKOB 3GCHC 2ZA5A 1GBTA 5L2YH 2EA3A 2V6NA 1KLTA 1HPGA 4KKDA 3RXMA 1EAIA 4ISLA 3T27A 2OC8A 1PQ7A 2BX3A 3MHWU 4E05H 4YLUA 3ATMA 1Z8JB 2PSYA 3RC6A 4YOJA 2QA9E 1QA0A 3LC3A 1V2MT 1C5NH 2GCHG 1DE7H 4NIXA 4ZHAA 3TH4H 3UR9A 3BIUH 1BTHH 1Z71A 3P95A 1F5RA 1NN6A 1Q31A 2BY9X 2BOKA 1QGFA 2HPQH 3KN2A 3QZQA 2K0QA 5E0HA 1P04A 3OY6U 4X0WU 1HAHH 1GHZA 3A88A 4AFSA 2YMSC 4X6OA 1C2HA 4MPXA 1O2LA 3E0NB 4CR5A 1GJDB 1BRCE 1PQ5A 2G52A 1LHDH 1LHGH 4YOIA 2ZFSA 5DPAA 2WV5A 1ZZZA 4NSVA 1E79D 1ELAA 4A92A 1ZHPA 1SQOA 1N1LA 2FZZA 3HKIB 3JZ2B 4JZEH 1L4DA 2Y81A 5IYTA 5T6GA 3UWJH 3T26A 3SUDA 1TMTH 2BMGB 4MLFB 1K1IA 2WSSD 1LVYA 4AGKA 1MD7A 2ILNA 2NU1E 1DSTA 2FX6A 1YBWA 4X2VA 1EJNA 3F2FA 1UCYE 1QB6A 5T6FA 4YXWD 2Z3EA 5L30H 1GDUA 1EZXC 2RG3A 1O36A 3G01A 4IC5A 4MPUA 1YKTA 1SPJA 1ZTJA 1QB1A 4NGAH 4OS6A 4X2YA 3RUOA 1NC6A 2H1UA 3ODDA 1X7AC 1GWAA 4OS1A 3PV4A 4D7FA 2SGQE 5JB9S 4CH8B 1A1RA 1D4PB 2WYGA 2FDAA 1A5HA 2OUAA 1UVPA 1P11E 2OQ5A 3LPRA 3SNEA 2Y5FA 3UREA 1GDNA 1K21H 3QDZB 2JKHA 2A2QH 4WJG2 2FOHA 3MMGA 3GCOA 5DP6A 1SVPA 3ATIA 3P6ZB 2ZGHA 4FU7A 1EPTB 5F8XA 3A7VA 3RM0H 2Z9GA 3SNCA 3WY8A 1KXCA 1XUFA 3AAVA 1FPCH 3VB7A 4NSYA 3GYMA 3UNRA 4NIWA 3LDXH 3F2GA 5EU8A 3NXPA 1WBGB 1O35A 3H5CB 1CHOG 1AKSA 1MZAA 4K5ZA 1S6HA 4GUXA 3K9XB 2JJ2D 4XOJA 1GG6B 2JDID 4JYUH 1WTGH 3VG8A 1ZSJA 2KR7A 2Q6GA 4Q2KA 4RKJB 4UFEH 1JRTA 1DSUA 3NCLA 3A7YA 1QL7A 1U6QA 1MKXK 4KTUA 1E1QD 1FIZA 2STBE 1K1OA 3HGPA 4GAWA 4Y10E 1QL9A 1V2PT 1EASA 4WMFA 1DFPA 1Q2WA 4IN1A 5EXLA 1O2MA 1O2VA 3FP6E 5CDFE 2F91A 2GZ7A 1BBRE 3FZZA 1W10U 3MWIU 1PPFE 4UFGH 5C2ZA 3MH6A 3P17H 2CF9H 1MBMA 1TBZH 4X6MA 3EA7A 3RXFA 1YPHE 1O31A 1S81A 2CGAA 2H9EH 5DN6D 1Z7KA 3PMBB 5EW1H 1RFNA 3KHVA 2W7SA 1KLJH 3DCLA 1THSH 3FFGA 2BD9A 1TRNA 3QTVH 2LPRA 2XW9A 5T6DA 3AW0A 2Z3DA 1W7XH 1TQ7B 3NWUA 1A61H 2FX4A 1UK2A 4GLYA 3A7TA 3RXKA 2ZECA 1T8OA 2G81E 1SOZA 5A0CA 1ZPBA 1HUTH 1TRMA 2J92A 4H42U 1S85A 3DFLA 3F68H 3PMJA 3GDSA 2B7DH 3QX5H 4YOGA 2G5NA 3TNSA 2GCTB 1RXPA 2ZGXH 4Y71A 1O37A 1GJ8B 1MABB 3SHCH 1OP8A 1BMFD 1HIAA 5CE1A 3E91A 5JBBS 3ZV9A 1H8DH 3T25A 4B2AA 2Y7XA 2PTNA 1P2JA 1F0SA 2AIPA 3O8DA 1BUIA 5CHBA 3RMLH 1GI1A 2H9TH 5DP8A 2Y6TA 1SFQB 1GI5A 3SI4H 3PROA 1O2RA 3TK5A 1QRXA 2WUBA 1GBIA 1MU8B 3RP2A 3T2NA 1O2PA 1BMMH 2W3KA 3SGBE 2FOGA 5C5OA 4Q63A 2UUKB 3VB6A 3MI4A 1FY3A 5E2PA 1KXEA 3RM2H 3VPKA 1HAGE 4MPVA 1ZGIA 2A7HA 2DE9A 1BBRK 3A8BA 4RI0A 2XXLA 1NRQH 1O3JA 3MH4A 4I31A 2FPZA 1TX7A 1W7GH 1HCGA 2Z9LA 2FM2A 4XBDA 3MO3A 2XC5A 2ZGBH 3B23B 4DJZB 2AFQB 1VCWA 3NZIA 4CREA 2J95A 2BX4A 4JCNA 1XUHA 3LGIA 2GZ8A 1P2OA 1BMNH 2QIQA 3SNDA 1QJ6B 3A8CA 4WMEA 1GMCG 3ZVDA 3PYHA 5E2OA 4IGDA 1Y5BT 1P02A 5TJXA 3VGCB 3E0PB 1C5OH 3GY7A 1CHOF 4HTCH 4I8HA 1C5ZB 3SV8A 2D1JA 3SW2B 4DT4A 1JIRA 1FZZA 2GTBA 1RGQA 2JH0D 1CGJE 1ID5H 1C2IA 3SQEE 2ANKH 1LHFH 3FOAA 2FTMA 1FDPA 1EPTC 3DHKH 2SGPE 1CT2E 1TWXB 4FUBA 3MO6A 3UWIA 3F9EA 1PPBH 4K2YA 1O5CB 4YM9A 2XBYA 1D3TB 1C5YB 1TOCB 1T4UH 3TIUA 3QGJA 1ESAA 3GCTF 5K7RA 2XBVA 4XFQA 1SI5H 3BN9A 2KAIA 1DOJA 3UOPA 2A4RA 1DWDH 1C1WH 2QGRA 1A4WH 1BMLA 1GG6C 4O9VA 3DD2H 1V2WT 1GJ6A 2WUCA 1MQ6A 4OGYA 2O8LA 1NM6A 1O2OA 3GICB 2W26A 2ZHQH 3U98H 3V13A 1UVOA 3ATWA 2CN0H 1HAVB 2H9HA 1MCTA 4FUJA 2FP7B 3RXRA 4E7NA 4K1TA 1MTNB 1UTJA 2ZHWH 1SGQE 2PW8H 4OS7A 1ZMNA 1GBEA 2C90B 1IQKA 3EA9A 3ZVGA 3LKWA 1UVUH 1FV9A 3RXQA 2BYAX 1DPOA 4BTTB 3GDUA 4OM9A 5FL7D 1ZGVA 4ZHLU 8KME2 1NO9H 2ZPQA 2DUCA 3RXLA 2R2WU 3V12A 4CHAC 2VINA 3SJIA 3STIA 3RC5A 1K9OE 2FYQA 2HPPH 2W3IA 3MOCA 2OTVA 3QK1A 2VIWA 5FCRA 5GPIB 4Q4LA 3ZZ5A 2VU8E 1GBJA 3A81A 2UUYA 4CR9A 1V2KT 3PLKA 3RXVA 1AGJA 1J14A 3ZVBA 2PLXA 1O5EH 4OGXA 3DSOA 1ESBA 2HOBA 2LELA 2A5KA 3UNSA 1HLTH 4WH6A 1W12U 1RTKA 5DK1A 1TA6A 2WPMS 4R8TB 5AVDA 1GBDA 2A4OA 1BRBE 2WPJS 2JH5D 4Y11E 2ZTZA 1MTUA 2ZQ1A 1P9UA 3CS0A 1MTVA 4FUHA 1H8ED 1ETRH 1DY9A 2BVSH 4IW4E 3U8OH 2A45B 2VGCC 1S5SA 1C2GA 1TAWA 5JBCS 2G51A 1IOEA 4B74A 1QURH 2H5CA 2QAAA 1G36A 4ASUD 1E0FD 3ESTA 1C1OA 2Z9JA 3GY3A 1DUAA 1F0TA 5DSFA 5C3NA 2O8UA 2GDDA 1TGCA 2HVXA 1D3DB 2LNCA 2QXJA 2Z9KA 4VGCC 3E16B 3M5MA 1THPB 1UTLM 1UJ1A 1NT1A 1UK3A 2BD7A 5A0BA 2FI4E 3LC5A 1UMAH 1K2I1 1GBMA 1NROH 1YPHC 3KCGH 1TRYA 1P2KA 2A2XH 1BTXA 4NWKA 2WPIS 3SBKA 1GMCF 1ELFA 3TLOA 2P95A 1O3EA 3E1XB 1TE0A 5EXNA 1CHGA 3SNAA 3BG8A 4ZH8A 3SQHE 3VB5A 3M3TA 3T29A 4OS5A 3BTME 1TMUH 2PFEA 4CRDA 3EAJA 2IPHA 2BDIA 2OBOA 4O3UA 4FU8A 1ELTA 4ESTE 3D62A 2SGFE 1EB2A 3L3TA 3PO1B 2ZIQH 2Y5GA 3A7ZA 4LXBH 1YPKH 3F3BA 1PYTC 1C2FA 1Q3XA 2R0LA 1CGHA 2EI8A 3A89A 2PGQB 3E8LA 4X8SH 1E1RD 1V2LT 3GY2A 3GY5A 3EGKH 4CRBA 2OQUA 4Y79A 1DXWA 3A8DA 1BRAA 5L2ZH 2PKSB 4HFPB 4KGAA 5LGOA 1C2KA 4BAQB 1TALA 5PTPA 2VNTA 2Z94A 1SR5C 1EB1H 1HJAC 3M3VA 1V2TT 1O2TA 2Y80A 3BF6H 5G4BA 2SGDE 1QL8A 1BBRH 4R0IA 2BTCE 2FWWA 5LPFA 4TYDA 1Z6EA 2FOBA 2KCYA 3STJA 1JMOH 1GJ5H 4Y8ZA 4AGJA 2QN5T 1D6RA 1O5FH 4UD9H 1CT0E 2BDHA 2A31A 4AYVB 2HGTH 2CXVA 1V3XA 1ETTH 3FANA 3TVJB 2IJOB 1IQNA 2ZDVH 1NRRH 1AUTC 3TGIE 5EW2H 5DKMA 2R9PA 1O2NA 4JMYA 1MTNC 2PHBA 5EODA 3UIRA 3UNQA 3SHAH 5EGMA 5E0GA 1LVBA 4HZHA 1P2QA 2P59A 5F03A 3RU4T 2V3OH 3MU4A 1O3AA 1OWJA 4MQAA 3EQ0H 2ALVA 4ZKNU 3SO3A 4ZHMU 5DP3A 3EE0B 2OBQA 1C5SA 3RU4D 1BTYA 1QB9A 2UWLA 3KQDA 2CHAB 1J15A 2VWOA 1PQAA 1NTPA 2FLRH 3BTDE 1ABJH 1PPCE 1FIWA 2F9PA 5AF9H 4F4OC 1DLKB 2QE7D 5E8EH 3RLWH 1C1QA 1IQLA 1O33A 4WF8A 1EQ9A 4ZCNA 1Y3YA 3TH2H 2V35A 2ZZUH 1D9IA 3AASA 4NG9H 3SJ9A 3SU4A 4J1YA 3B9FH 1TB6H 2P3UB 4X6PA 1XUJA 1CQQA 1DWBH 1HAYB 4JYVH 5HMAA 2A4GA 1HFDA 4WWYA 1FY5A 1EZQA 1SLUB 4NFEA 4X1NU 1GHXH 1T7CA 3N7OA 1O2ZA 1THRH 2Y5HA 1PPHE 5F53A 1DT2A 3RXIA 1KXDA 2K8IA 3UUZA 3A82A 1JWTA 1C9TA 5GCHG 3M7UA 2QCYA 1K1MA 2CK3D 3VB3A 1EJMA 4ISOA 4F55A 1PFXC 2R0KA 1SQAA 1QY6A 1AD8H 2R3YA 2XC0A 2XYAA 1Z1JA 4ABEA 1O3PB 3OTJE 1OS8A 2BY5X 2ZTXA 1F5LA 1YLDA 4UONA 4Z1MD 4AB8A 2ZC9H 3GISB 7KMEH 1AB9B 2I6SA 1FXYA 1GMDG 1GHBG 5ABWA 3BTWE 1GBLA 2BVRH 1W8BH 4OS2A 4M7GA 1GJBB 2BLQA 3PRBA 2PGBB 1T4VH 1TNLA 1NZQH 2ASUB 1TPSA 1O3NA 1EFRD 1WAYB 1OYTH 1RS0A 2VWMA 3RMOH 3M36A 2B8OH 2ZGCA 3MNSA 1AN1E 3P92A 2BQ7B 1N8OB 4NZLA 3PO1C 3VFEA 1P3CA 3S7HB 4X1QU 1KYNA 2QXGA 5C0UA 2HRVA 3RXOA 4MDSA 2HLDD 1L0ZA 4ABAA 2BZ6H 1O2UA 3M35A 2OLGA 5IDKA 1GJ7B 3P8GA 1VR1H 1HAOH 2BM2A 4AX9H 1SGCA 4AG1A 2PKSC 3RXUA 3LGUA 2QF3A 1XVMA 1MQ5A 2I6QA 2HNTE 1LPZB 1WV7H 1TNHA 4K1EA 1LTOA 2HALA 1F5KU 1A0JA 4MTBA 1ORFA 1GI6A 1T8NA 1SBWA 2F9OA 4DURA 2J94A 1MCVA 1BJVA 1LDTT 1P8VC 4AFQA 1IQMA 1W13U 3ATLA 4YZUA 5HM2A 2Y82A 3PTNA 3FP7E 1OWDA 1S0QA 1ZPZA 3HGNA 4X8TH 1IAUA 3TK6A 3ELAH 2P3TB 5C1UA 2F9BH 2FS8A 2ZP0H 3MU0A 1BHXF 1QR3E 4QT8C 2YOLA 1A46H 3NK8A 4LZ4B 2BLOA 4B2BA 1GBCA 3MTYA 2O8TA 3R3GB 3ZZDA 3DSPA 2BQWB