4I32A

Crystal structure of hcv ns3/4a d168v protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVVFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i32A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i32A01
1C9TA 1X7AC 3T27A 1AIXH 1NFXA 3GY4A 1LVBA 3QZRA 2Y6TA 2A4RA 2H9TH 1PQ7A 1F0RA 4H6TA 4ZXYH 1JBUH 2OC8A 3M3TA 2BY8X 2OTVA 3PV4A 4ABAA 2UUYA 1UTJA 2O9QA 1O3LA 1S5SA 4DG4A 1ZTJA 1E38B 2SGPE 4ZUHA 2ALPA 3GCTF 3TJNA 1DWEH 3IWMA 1HNEE 1Y3WA 2A7JA 2QY0B 4R8TB 3BTQE 1BTPA 3LGTA 3VB5A 1DDJA 1TQ7B 1O5GH 2ZF0H 2FOHA 3U1JB 1RJXB 1OKXA 3OSYA 1HAVB 1TBRH 1C1WH 1TNHA 2ZNKH 1GI4A 4LOYH 3P6ZB 4B6FA 3HGPA 3RXLA 4NZQA 1GJ8B 2AMPA 1Z8RA 1Z8JB 1VJAU 1MMJN 3MNBA 1AWHB 4OS2A 4FVDA 1C5OH 4FUEA 2ZDVH 4JYTA 3PLPA 5GCHF 1SGEE 2ZDAH 4AZ2B 1BIOA 4X6OA 2GMTC 3SGQE 3ENSB 5EQSA 3HK3B 3RMOH 3AAVA 2DUCA 2FOGA 4UONA 1N1LA 1DY8A 3MOCA 1HAPH 4GLYA 1KTSB 1SL3A 3Q3XA 1GL0E 4K2YA 2ZC9H 4HI3A 4XBDA 2FEQH 1KLJH 2ZGCA 4KTUA 1YP9A 1MKWH 2A1DB 2F91A 5T6DA 4M9FA 3A87A 3M7TA 2FDAA 2FTLE 2P8OC 3VPKA 1GJ6A 4YOIA 4FUJA 2PKSC 1FIZA 2GMTB 2ZECA 2V3HH 1ARCA 3P17H 1ELVA 5ETXA 1J14A 2VIPA 1MD8A 1MBMA 3HGNA 3QTVH 2WPLS 2FI5E 3SN8A 1P9UA 2BDIA 3V12A 3BTDE 3RXUA 1DANH 3KIDU 1GI6A 1DSUA 2Y81A 3JZ1B 2XWAA 3LJJA 3QN7A 1UVSH 4Y0ZE 4DGJA 3BTEE 1BBRH 3EAJA 1AGJA 1TONA 3HKJB 3SI4H 2V3OH 1MKXH 2TGTA 2AYWA 1C1UH 2P8OB 2LNCA 1GI2A 4K8BA 1A0LA 1IQJA 3M37A 4IC6A 2DE8A 1ZRBA 1Z8GA 1G30B 1NRSH 1BOQA 2Y80A 2QXHA 3SJ9A 1AN1E 1OWKA 2O8WA 1MD7A 1T4UH 2GT7A 2ZFSA 1PPCE 2CF8H 4AFUA 4AYVB 3ZYEA 4J1YA 1WSSH 3P8OA 4CR5A 2Y5FA 3SOSA 1O5CB 1UMAH 2GX4A 4DCDA 4LXBH 1ZHMA 1NRPH 2AGGX 1O31A 4XOJA 1AZ8A 1HGTH 2ZGHA 4OS7A 1BMAA 2F9BH 1ZGVA 3A89A 1MAXA 4CRCA 4ZKNU 1AB9C 4WJG2 1O5DH 1Y3UA 8KME2 1UK4A 5GWZA 1IQNA 2WPKS 4ISLA 4X1PU 3PROA 1IQMA 2FMJA 5EOKA 2CGAA 2ZU5A 1GBIA 2EI6A 1HCGA 2J38A 1O3OA 3VB7A 3TVJB 5C1UA 2A5AA 2ANMH 3L6PA 1UHBA 4BAKB 3K2UA 1O5AB 4MNXA 7GCHF 2PLXA 2BB4A 3ZV9A 3RU4D 3FP6E 1PPBH 2OLGA 5EQQA 4A92A 4JZFH 1W8BH 1AKSA 3SJKA 1C5TA 1GHWH 2ZGBH 4B2AA 1AB9B 1XUIA 2BOKA 4ZKRU 1GDNA 1HJAC 3P8FA 1IQGA 3Q76A 2A5KA 2Z3CA 4JCNA 1W0ZU 1RXPA 1HAIH 1O3NA 1W12U 1BUIA 1JIRA 1TX8A 3SUDA 4FXGH 1XVOA 3S9BA 2FS9A 2ZG0H 4X1NU 1HUTH 1XKBC 2RCEA 4KKDA 1LKBA 2VGCC 4WXIA 2AH4X 2SFAA 3ZVBA 1K1IA 1FJSA 4NZLA 4INKA 5FPTA 4MNWA 3ZZ3A 4Q2KA 3SNCA 5HM9A 4KP0A 1IQEA 4ZHLU 3ZZ5A 3OTPA 1HJAB 1DLKB 1TX6A 3KHVA 1TGSZ 6ESTA 4AFQA 1UK2A 3P8NA 6LPRA 2GV7A 1HV7A 4YOGA 2XNIA 2QV1A 1S85A 3SZEA 2FESH 1O2WA 2IJOB 3TH2H 1ZPBA 1QRWA 3NK8A 2ZU1A 2O8MA 4ZKOU 1L0ZA 2PKAB 1ESAA 3BIVH 1AE8H 3RXBA 3E1XB 4JZIA 1SGDE 2VGCB 1L1JA 1OXGA 1HAYB 1H8IH 2C8XB 2BQWB 7GCHG 3TH4H 2NWNA 1AVGH 2CHAC 3GY6A 1CVWH 1GBFA 1SGYE 1SVPA 1O3HA 2WV5A 1ID5H 5E0HA 3PTNA 1MTWA 1NS3A 2G55A 2XW9A 4CH8B 1HAGE 3BEUA 1D3TB 1NU9A 3MH6A 1K1JA 1KDQB 1GDQA 3HPTB 3SUEA 3GDVA 4NA8A 1ETSH 2F9PA 4Q7ZA 2AMDA 3NPSA 2BDYA 3ELAH 4TY7A 1T8OA 1P06A 3TLOA 1MBQA 3BSQA 1P03A 2CHAB 1Q31A 1XUHA 3LJOA 2ESTE 1NFUA 4E05H 1B5GH 1P3CA 1QQUA 2R2MB 1CHOG 1GCTC 1MQ5A 4MPWA 3KQCA 3LH3A 1EB1H 3MNXA 5DP3A 1AU8A 5EXLA 2FX6A 2B0FA 2M5TA 4XE4A 3RC6A 3SU5A 2Z9KA 8GCHF 3RU4T 1C1NA 1ZSJA 1PPHE 1GGDB 2QCYA 1UVOA 1P11E 3GYLB 3E3TA 2CF9H 1OYQA 1C1VH 2BLVA 2ZCHP 3UQVA 2ZHFH 5EPYA 2FIRH 3A85A 2FLBH 1GBKA 1GCTB 3SNAA 5FX6A 2H9EH 1GI9B 1TMUH 1G3EA 1LHGH 4NWKA 4X2VA 8LPRA 5EXMA 2OXSA 1ETRH 4ABIA 1GJAB 4IW4E 5FBEA 2IJD1 3AK5A 3BTWE 1V2OT 1UO6A 3T26A 5C1YA 3ZVDA 3LT3A 2HGTH 1GBJA 1BBRE 1S83A 1SLWB 1GBLA 3ODDA 4RKJB 6GCHG 1K22H 1MZAA 2BZAA 1O2PA 4KTCA 3D65E 4K69A 5HYOA 1Z7KA 3KEEA 3S69A 1EAXA 1C5SA 1TLDA 1C5WB 1S0QA 1Z8IB 3GCHC 4ISIH 2H1UA 1H9LB 1GMDG 2F3CE 1O2RA 2Y7ZA 3UY9A 1OWJA 1HIAB 4NA9H 3KF2A 3VXFH 5JPMH 1RD3B 3E16B 2PUQH 3D49H 8GCHG 2C93B 2J94A 3U1IB 1AO5A 4HTCH 1EATA 1NN6A 1L4DA 1TA2A 5DP8A 2BVSH 1GHAF 1KSNA 4SGBE 3TPIZ 4Q7XA 1J9CH 1DPOA 1PPGE 3AW0A 3ESTA 4IMZA 3P92A 3GCHB 1LCYA 2Z3EA 1FN8A 4Y7AA 1V2RT 1Z1JA 1J16A 3E6PH 5EW2H 3SJIA 2GVFA 3SNBA 1LPZB 3LOXA 2J92A 1MU8B 1IQKA 1FDPA 1V2UT 1P2QA 5TCCA 2R0LA 4BOHA 3PMAB 2GV6A 1BTWA 3SV8A 3STIA 2XBXA 2XCFA 4E06H 1O2KA 4ISOA 3K6ZA 4MPVA 1BT7A 1RGQA 2C4FH 3A8DA 3B23B 5B6LA 1FY8E 1BB0B 1UCYK 5G4BA 1UTKA 2JH0D 1O2TA 1OYTH 2Y7XA 2PSYA 1YPMH 3MO3A 1TPOA 2NU0E 2CMYA 1JMOH 3EE0B 3HK6B 1KXFA 3UQOA 1OP0A 2ODYB 4IN1A 5HMAA 2EI8A 4BTIB 1BMLA 5C5NA 2ZU3A 1G37A 2ZHDA 1QA7A 3DFJA 3DUXH 3OY6U 2JH6D 1F5LA 2J2UA 3ZZ8A 1GPZA 3RXSA 4DURA 3ATLA 3SUGA 2Z9GA 1LKAA 2OINA 1TPAE 1S6HA 4B74A 1FAXA 1SMFE 1DWBH 1GHAG 5AHGH 4LZ4B 1WUNH 1GI5A 2BD7A 3PMJA 3LPRA 1KXBA 1W2KH 1O33A 5E2PA 1P2JA 1P02A 2A7HA 3M35A 1SQTA 3AW1A 3RXGA 1GI8B 1DT2A 3CENA 1C2LA 2OQUA 2G8TA 2WPJS 3TGIE 4XFQA 1C4V2 2FXRA 5GIBA 5FX5A 5FBIA 1A46H 1C2KA 1C2JA 3RMLH 2HOBA 2H5CA 1F92A 3L33A 4TPYA 4HGCA 1XM1A 1DICA 4Y8ZA 3KCGH 2BY5X 1YF4A 1AVXA 4OGYA 1ELAA 1DUEA 1VCPA 2OBQA 1H1BA 1UTQA 3F9GA 1C5VA 4MPXA 2BTCE 3SW2B 1YYY1 1O39A 5E0JA 2ZCLP 1TOMH 1LPGB 4GUXA 1GBMA 4BXWA 1SQOA 3RMNH 3A7WA 1TRNA 2PGBB 1A5GH 1CA0C 2Z7FE 4TY6A 2FWWA 4LK4A 1O2ZA 5GNDA 3F9EA 1ZJKA 4X2YA 1GMCF 2P3UB 2FOBA 1GBDA 1RIWC 2QXIA 1V2LT 1ESBA 2IN2A 2F9OA 4JZ1A 3V7TA 1Z1IA 4DY7B 5A8XA 3SORA 2BDAA 1C5PA 3SNEA 4BAQB 4IC5A 1ZR0A 3AAUA 3MMGA 1S0RA 1UVUH 2ZCKP 1H9HE 3GY8A 4MTBA 2FOFA 4ABHA 1NRQH 1C2MA 2FYQA 3T5FH 4AOQA 3TK6A 1CA0B 3I29A 1HXEH 1O2GH 5GXPA 3F68H 1BTZA 2P94A 4YO9A 2UWOA 3OU0A 4RI0A 2R3UA 4DIHH 2VWLA 1VITH 3MHWU 3BG4C 3SQEE 1GHBG 1N6XA 5AF9H 1P8VC 5F6MA 4NGAH 3F9FA 2ZQ1A 3R3GB 5JDUB 1TALA 5DK1A 1O3JA 3PLBA 2F9VA 1W13U 1XXDA 3BEIB 1QBNA 2R0KA 1V2MT 2BXTH 1K1PA 3NUMA 1SGNE 2NU1E 5LH8A 3RXEA 4DT7B 2Z9LA 1YM0A 3H09A 4IBLH 1N6YA 1L1NA 2A4OA 4FUIA 4E7RG 1O5BB 3MU4A 1LPKB 1HAVA 2TRMA 1YKTA 4OS6A 4X1SU 1GMCG 1MCTA 1P2NA 3BG4B 1C2HA 2VIOA 1K1LA 2ZKSA 4UEHH 4FUHA 1HAZB 4D76A 1C1OA 4AYYB 4Y8XA 1UCYH 1THSH 2PR3A 4YM9A 2OP9A 3QO6A 1DY9A 3LGIA 3VEQB 1SGFA 3LC5A 1FPHH 2RA0A 3EA8A 1BHXF 4A1VA 2VH6A 2SGDE 2PSXA 1TWXB 1GBTA 1TFXA 5AFZH 2JH5D 1F5KU 1G2MA 3PWCA 3FAOA 1A3BH 1GHYH 1UVPA 4NSYA 2GDEH 7ESTE 5IDKA 4NFFA 1BZXE 1XKAC 1O3BA 4MVNA 1EJAA 2GZ7A 1BMNH 2HLCA 3PLKA 1CBWC 3BIUH 3PYHA 2WHXA 1QQ4A 4YESB 3T25A 4NSVA 3RXCA 4AFSA 4AGJA 1VITG 4Z6AH 2SGEE 1TIOA 3QDZB 3EYDA 1VCWA 4ISNA 1WBGB 2UUJB 5FCRA 1FY3A 2GP9B 4I8HA 1YPHE 3S9CA 3C27B 1SGPE 3MU0A 1C1PA 1EX3A 1TE0A 4WY3A 3MYWA 1EAUA 3SYJA 1F5RA 4FUGA 1TNKA 1CGJE 2QXJA 3SV2H 1LQEA 1XVMA 2A4QA 2R9PA 1CBWB 2BVXH 2WPHS 3U8TH 1TGBA 2PTNA 4CRFA 1BA8B 3QZQA 4D9QA 5FPYA 1ZOMA 1T8MA 3QWCH 3RM2H 1O3CA 1OS8A 3A8AA 3SU1A 4XBCA 4J2YB 2XBYA 4KTSA 1N8OC 1J15A 4AGKA 3F1SB 1O2IA 5L2ZH 3O8RA 3MU5A 1FY4A 3RMMH 1O2MA 2TGAA 2BDGA 1C2IA 2O8UA 2ANYA 1NRRH 1ZGIA 1C1QA 1C5LH 3TH3H 1XMNB 1O3FA 2FPZA 2W3IA 4K1SA 1G36A 3BEFB 1WOFA 3GDSA 5T1VA 2CV3A 2XC5A 1QJ6B 1NC6A 1OX1A 4UFDH 4AB9A 2QGRA 1QJ1B 2BZ6H 1FIWA 3DHKH 2VIDA 1TPSA 3L3TA 2ILNA 2PKSB 5A8YA 3M61U 2STBE 1XUJA 2GKVE 4JMYA 1SPJA 1ELFA 2AGIX 4Y11E 4A1TA 2B5TB 1RTLA 2HPQH 4WMDA 3IITA 5J4QA 3SU4A 3D23A 1IQIA 1QL8A 1TX7A 3BTGE 2O8LA 3MTYA 3LONA 1MTSA 2J9NA 4ZKSU 2GT8A 3M5MA 2QN5T 1UTNA 2ZDNA 1DXWA 1QFKH 5BRRE 3AASA 1HFDA 1C1MA 1DM4B 1EPTA 1NY22 1VR1H 1BITA 3UNSA 3ZZCA 2F9UA 6CHAC 3WY8A 5A2MH 1E36B 1QB1A 1FQ3A 1EUFA 1KLTA 3U69H 5JBAS 1F0UA 5DGJA 1YLDA 2SNVA 2FI4E 5ESBA 1GG6C 1ZPCA 1TMTH 2BX4A 4DW2U 5DO4H 2P3FH 1D3DB 1VCQA 1XX9A 1ETTH 3FFGA 1MAYA 2GDDA 3SHAH 2HNTE 3QX5H 1DX5M 1XUFA 2A2QH 2VU8E 4X2XA 2XC4A 4X6MA 2G51A 1Y5AT 1B0EA 1OWIA 3UWIA 5LGOA 1TRYA 1SR5C 2FLRH 6CHAB 1O37A 1ZHPA 2B9LA 2XCNA 1C5YB 2C8ZB 3ZZBA 5K0HA 2PUXB 3S7HB 1CU1A 4ZXXH 1C1TA 1LHEH 2ANKH 5SGAE 2A2XH 4O97A 1GG6B 1NRNH 5EXNA 4AN7A 3LGYA 4I8GA 1O5FH 1Z6JH 1WTHD 1NESE 1K1NA 2W7UA 1D6WA 2XWBI 4IN2A 1K2I1 2DE9A 2ANWA 2BQ6B 1IQFA 3DA9B 1PYTD 4FU8A 2A0QB 1LTOA 3SO3A 2ZDMA 2I6SA 4CRDA 1PJPA 3GY7A 2ZGJA 2FO9A 1H4WA 1O34A 1V2ST 4B75A 1OWDA 4SGAE 3RXAA 2Q6FA 3GCNA 1PQ8A 2BD9A 1KDQA 3MU1A 1ZMLA 1LMWB 3SU6A 2K1QA 1CHOF 4D7FA 3NXPA 1NT1A 4H6SB 5I46H 1QR3E 3RXMA 2NU4E 3Q3KA 1P10A 1P2OA 4AFZA 2OC1A 2A45B 1J8AA 2BMGB 1FUJA 5CHAC 1FONA 1UCYE 3S0NA 2HPPH 4B1TA 1O3GA 1C2GA 3EA7A 4X8VH 4BAHB 5E8EH 1ELTA 4BAMB 1O2OA 5DP5A 1AKSB 1K28D 2JETC 4GAWA 4OGXA 3M5LA 3SU0A 1LO6A 1PQAA 1V3XA 1DWCH 2D8WA 1TOCB 1Y59T 2V35A 2A31A 1P0SH 3SV7A 1AUTC 4U32A 3LDXH 3SNDA 5CHAB 4X0WU 4JZEH 2F4LA 2VWNA 1B0FA 3ZZAA 3TJOA 6GCHF 1NROH 1MCVA 4AORA 5C3NA 4NG9H 3VXEH 5T3HA 2JETB 1C9PA 1O35A 1V2PT 3RXFA 5HGGA 1FI8A 4I8JA 3BTME 2G00A 2ULLA 2XC0A 2ZU4A 4A6LA 2A32A 5A0CA 3CS0A 3O8BA 3SU2A 3T29A 1QNJA 1GMDF 4B6EA 1P12E 2BX3A 3FZZA 1L4ZA 2PFEA 2ALVA 4BXSA 2EI7A 1FY5A 1DE7H 1KYNA 5GDSH 5JBCS 1C4Y2 2TPIZ 3ATKA 4ABFA 4MLFB 1QB6A 1HJ8A 2KAIA 3M36A 1HLTH 1T32A 2F9NA 3EQ0H 5JBBS 3ZZDA 2QYIA 1GDUA 2BY6X 1AHTH 1ELEE 1HAXB 3U8OH 1SC8U 1SGRE 2ZGXH 2ODPA 2UWLA 2HALA 2QIQA 1HIAA 1DS2E 3PV2A 2G81E 4X1RU 9LPRA 2H2ZA 1MUEB 3A80A 1AZZA 2PWXA 1NU7B 4E7NA 1O0DH 3KNXA 3UNRA 4X6NA 4JZDH 1JXPA 1SI5H 5DKMA 1O2LA 2BLOA 4WXVA 3STJA 4DOQA 1T8NA 2A5IA 2IPHA 1TGNA 2OBOA 3SBKA 3TK5A 2UUFB 3R0FA 1SLXB 1UTPA 4DIIH 3OX7U 2ZQ2A 2ZZUH 3P95A 3TGJE 1W10U 2BY9X 3RUOA 4FUBA 4HZHA 1P9SA 4FU7A 2Z94A 1P01A 1TA6A 2VIQA 3FVFB 2BD8A 2ODQA 1CGIE 1NFWA 5EU8A 4HFPB 2ZPRA 5CMXH 2Z3DA 3MH4A 1UTLM 3M3VA 5A0AE 3EGKH 1ACBE 1K9OE 2ZFTA 1T31A 1HAOH 1TMBH 1ZJDA 1Y3XA 3PB1E 1O2QA 3RC5A 1FN6A 4X1QU 3U8RH 3MU8A 2WPMS 4THNH 2C8YB 1O2VA 1WYKA 3U9AH 3SZNA 1ZTKA 2AS9A 1T8LA 1NO9H 3ZZ4A 3VB4A 1AFQC 4BANB 3TIUA 1LHFH 5F03A 3T62A 1O2YA 1A61H 1O30A 1DWDH 1FNIA 2ZI2H 1TQ0B 4TYDA 1EKBB 4CHAC 3A7XA 4GCHG 1YC0A 5ABWA 3ITIA 1W3CA 3MFJA 1OSSA 4NCYA 1NM6A 2G52A 3A7YA 4FVBA 2STAE 3NZIA 4NA7A 1PYTC 3MO6A 1FLEE 4Y8YA 1O3DA 2F83A 3O8CA 1GVZA 1W11U 4WF8A 4I33A 1NTPA 1SFQB 1Z71A 1AFQB 4IMQA 2BLQA 2VVVA 3DT0H 1ANCA 1ZPZA 1C5MD 3AVZA 3FZDA 1Y3YA 2FZZA 1H9IE 1QIXB 4WMEA 1JIMA 4FUFA 1SGQE 5LPFA 3UUZA 2C90B 4CHAB 1HXFH 2AIPA 3KQEA 3G01A 1BQYA 5E0GA 1MQ6A 3B9FH 2FOCA 1LVYA 5BPEA 4DJZB 3LU9B 5DG6A 2FX4A 4AG1A 4Y79A 4INHA 1GVLA 3BTHE 1ZMNA 1A2CH 1GVKB 2SGQE 5ESTE 3TK9A 3ZYDA 1E0FD 5HXFA 1GHBF 1QCPA 4WH8A 3A88A 4M7GA 3KN2A 1DSTA 1O2NA 3QLPH 1ELBA 1TNIA 2C3SA 2JKHA 1EOJA 3PMBB 1P2MA 2ZO3H 2A4GA 4UE7H 3SV9A 3SV6A 4UFGH 2D1JA 4RKOB 1GBEA 2ZHEH 3PWBA 1JRTA 1SGTA 4ZROA 3URDA 4YTAA 5FCKA 4K1TA 2FODA 1ZYOA 4U30A 4B73A 3URCA 4NWLA 3RXQA 2TBSA 3RC4A 5L2YH 1W0YH 2HNTF 3VB3A 3E91A 3NKKA 1PPZA 3U98H 1O3PB 2Q1JA 1IOEA 2ZTYA 5HM2A 1FV9A 1KXDA 1TBZH 1PFXC 1WAYB 5B6OA 2OC7A 3LGVA 1LQDB 4FUCA 2Q6GA 1WQSA 3Q77A 1EAWA 3ZZ9A 1GI7B 5IYTA 3KGPA 2FOAA 3P70B 1QA0A 3UFAA 1HJ9A 4CRGA 2HVXA 1BTXA 4PROA 1RIWB 1FPCH 1GBHA 1EJNA 1ZHRA 4OS5A 1FXYA 3VFEA 2VWOA 4MNYA 3F9HA 4CBOA 4Y6DA 4OS1A 1BBRK 3LC3A 1MU6B 3GICB 3PO1C 1DXPA 1VITF 3A81A 3QGJA 1MKXK 1C5UA 3KQBA 1RRKA 4MPUA 2AGEX 1ELDE 1GBCA 4BTUB 3BV9B 1XXFA 2H5DA 1YGCH 3TJVA 1V2QT 1MTVA 3SQHE 4QT8C 2ZA5A 1GMHF 1CO7E 1PQ5A 2PGQB 1ABIH 1HAHH 1WCZA 1GJ9B 3ZV8A 2R3YA 1IAUA 1ABJH 3SU3A 1GBAA 2GTBA 3PO1B 1RS0A 1TABE 1W14U 1IHTH 1O3EA 4WMFA 3B8JA 4WVPE 1MTNC 3TU7H 1TAWA 4YT7H 3A86A 2BYAX 2ZDKA 3UPEA 4B2CA 2BD2A 4DVAU 2OUAA 5K7RA 3N7OA 1CSOE 2WV4A 2ZFRH 2OC0A 1AY6H 3BN9A 3BG8A 3TNTA 3VGCC 1V2TT 2H9HA 2IOTA 3T28A 4BTTB 1T4VH 1Y3VA 1HDTH 1EXFA 2SGAA 1UVTH 1PPFE 1UTOA 1ZSKA 1MTNB 1QURH 2BXUH 5T6GA 2G5VA 3OYPA 3A83A 4O9VA 1IHSH 3LGUA 4Y7BA 1O32A 1MH0A 4MNVA 1THRH 5DP9A 3TGKE 4ZHMU 1SGFG 4ESTE 1F7ZA 3RXRA 3M5NA 5EW1H 4I32A 1GMHG 4GPGA 3VGCB 3DFLA 4MQAA 1YPEH 1O3AA 3I77A 1P57B 3K6YA 3RLYH 1AUJA 1O3MA 4U01A 1EQ9A 1FAKH 1C4U2 4CR9A 2CXVA 5CE1A 5DP6A 4ABGA 2WUBA 2ZP0H 3RLWH 3OTJE 2XYAA 1NZQH 3RXVA 4RN6A 1BDAA 1K1MA 1YPJH 3V13A 3RXJA 3ATIA 4TWWA 1E35B 3OY5U 2AERH 4IS5A 2XBWA 5GJ4B 2BM2A 1MZDA 1KIGH 4O03A 5DP7A 2B8OH 1E34B 1LHDH 1ZRKA 2GZ9A 4D8NA 2ZFFH 5DPAA 1QL7A 1LVMA 2GD4B 1W7GH 4FUDA 4ABEA 1TBQH 1TPPA 3A8CA 3H7TA 1TYNA 1JOUB 1UJ1A 1BHXB 1LVOA 5E2OA 2VH0A 3GCTG 1OWEA 2BD3A 1GBBA 1EP5A 1GCDA 1N8OB 1GI3A 5JBTA 1WTGH 5C5OA 3RXIA 3SGAE 2XTTB 2VBCA 2O8TA 5F8XA 2BLWA 4WH6A 1C5XB 1A0JA 1ANEA 1G32B 3RXDA 3LKWA 4JK6A 2P93A 4RSPA 2WUCA 3NCLA 4ZH8A 3CP7A 4X8TH 4XDEA 1BTUA 5GCHG 3SJ8A 1ELGA 1EZSC 3V3MA 3UOPA 5AFYH 1G9IE 1DUAA 2Y82A 1KXAA 1GJCB 4UDWH 4YLQH 1BCUH 5FXLA 2P3TB 2RDLA 4X6PA 1B7XB 2FOMB 2Z9IA 4JYUH 3TJUA 1DITH 2VINA 1V2JT 2AFQB 1AD8H 1QBOA 5EGMA 2AMQA 1VJ9U 1WV7H 2ZEBA 1EASA 1EB2A 1TRMA 2W5EA 5C2ZA 3RXTA 1QGFA 4O3UA 2TGDA 2PV9B 1XUGA 3MH5A 3MNCA 4MDSA 4OS4A 3BTTE 1S84A 1YPLH 1INCA 1ZTLA 2YNAA 4WWYA 1M9UA 2Y5GA 2G4UA 3IG6B 1L1GA 1YCPM 2J4IA 2FM2A 4ZHAA 1VZQH 3A8BA 1EPTC 1GI0A 5L30H 1A4WH 3ZZ6A 4XBBA 2RG3A 3GDUA 4BNRA 1D6RA 1KLIH 1G3BA 1ESTA 2PKAA 4KELA 3RXHA 1P3EA 1TGTA 4YLUA 1S81A 2ZTXA 3O8DA 2BY7X 1Q3XA 3LIWA 1F0SA 1GHZA 1O38A 1LHCH 1G3CA 1ANDA 3M7UA 1CHGA 1AFEH 2ZHQH 1C1SA 1JRSA 2FS8A 4ASHA 1CT4E 1NFYA 3BTKE 1EPTB 1UK3A 1WQVH 3S9AA 1YLCA 1AMHA 2VWMA 1BJVA 1SSXA 2BD4A 2WZQA 1CQQA 3Q3YA 2FYRA 3MO9A 1SLVB 1BJUA 2BDHA 2BDBA 1C5NH 2NU3E 4VGCC 2ZWLH 3A7ZA 1U6QA 1O2SA 4UFFH 3QGNB 1RTKA 3GCOA 4A1XA 3QTOH 2WYGA 3M7QA 1GHXH 1UHBB 4CRBA 4CRAA 1SLUB 2TIOA 1GJDB 1SQAA 3KQDA 4KGAA 2Z9JA 3SUFA 1O5EH 1K1OA 3SJOA 1A5HA 1TNGA 4JYVH 2OQ5A 2WPIS 1TNJA 1JWTA 1V2KT 2UWPA 4VGCB 4Q7YA 4X2WA 5EPNA 2GCTC 1C5RA 4R0IA 1DLEA 1A0HB 4OM9A 1VGCC 5EG4A 1G3DA 1OP2A 3JZ2B 1CA8B 4K1EA 5TCAA 3A84A 1A7SA 1GWAA 3FANA 1V2WT 1EP6A 4Y10E 2QF3A 1EJMA 3A82A 3W94A 1ELCA 1SFIA 1S6FA 1T7CA 2FTMA 1L2EA 3F6UH 2GCTB 1C2EA 1QRXA 1GGDC 3GISB 1TGCA 1G2LA 2HWLB 4FU9A 1K21H 1A1RA 3E0PB 3TNSA 5A09A 3BTFE 2B7DH 2TGPZ 3UNQA 4MG3A 1VGCB 4IGDA 3M3SA 1CT0E 5EODA 5C67A 4Z0KA 2G5NA 1AE5A 1KTTB 1BRCE 3A7TA 1IQLA 3ZVFA 1Y5UT 1A5IA 4Y76A 1QRZA 4F49A 3UOUA 5F8ZA 2FI3E 2YOLA 5PTPA 2AIQA 4H42U 4XSKU 1P05A 4I8LA 4F4OC 1D9IA 3SI3H 4B2BA 3Q00A 4CBNA 1SOTA 1A3EH 1BMMH 1XUKA 2W26A 4YZUA 1ANBA 1ARBA 3RM0H 3UR6A 1WU1A 3T2NA 1TNLA 3M5OA 4GCHF 1YCPK 1TB6H 3FP7E 1HPGA 2BOHB 1C2DA 5LPRA 1V2VT 5JB8S 1ORFA 2ASUB 4GSOA 3QK1A 2XXLA 4D9RA 1NPMA 1J17T 1THPB 4LZ1H 3RDZA 3ODFA 4Y71A 1OP8A 3MWIU 3H7OA 1YPKH 1D3PB 1OOKB 1D3QB 2QXGA 4K5ZA 4NIYA 1ZSLA 3GOVB 2CJIA 7KMEH 5H4IB 1KXCA 1QTFA 2EEKA 1BTHH 3A7VA 1GJ4H 1QB9A 2HRVA 2PW8H 3RXKA 1UTMA 1ZLRA 2KAIB 4ISHH 4ABBA 4YT6H 1QBVH 3HATH 3ATWA 1EZQA 4GHQA 1KXEA 3C1KA 1AQ7A 1OPHB 1SG8B 2UUKB 3MH7A 3GYMA 1IQHA 7LPRA 1GI1A 1GJ5H 4B76A 1C5QA 1BRBE 1Z6EA 1EOLA 1RTFB 4I8KA 1AI8H 1C5ZB 2SGFE 3UR9A 4A5TS 1DOJA 1HB0B 2GCHF 2V6NA 1DFPA 1O2UA 3RP2A 1OWHA 5J4SA 1P2KA 4U2WA 2OCVB 3UTUH 2VB0A 1GJ7B 3V0XA 2EC9H 1EAIA 2EA3A 3SHCH 2THFB 4H4FA 2P59A 5C1XA 3LH1A 2VVCA 1CT2E 4CH2B 1RFNA 3ZVCA 2XBVA 1ZMJA 4TWYA 3NWUA 2P16A 1O2XA 3KL6A 1F2SE 3DD2H 5A8ZA 4UFEH 3HKIB 1V6DA 4Q80A 3W95A 2QAAA 2ZHWH 1GJBB 4AG2A 3E8LA 4ZAEA 1MTUA 3ZVAA 1PPEE 4O3TA 2ZPSA 3MNSA 2ZFQH 3GY2A 2BVRH 1EZXC 2VNTA 5EQRA 3UREA 3S7KB 5C20A 2WYJA 4AX9H 2WINI 9ESTA 5L6NH 5F8TA 1YPHC 3P8GA 2ZDLA 4NIWA 2ZTZA 4K60A 1F0TA 4X8SH 3ATMA 2NU2E 2XRCA 3MI4A 2FP7B 5FHTA 4GHTA 4ABDA 2PHBA 4INLA 2P95A 5FAHA 5A0BA 3GY3A 3PM3A 2GCHG 2RA3A 3PTBA 4D7GA 1ZZZA 1BTYA 2VVUA 2W3KA 1O3KA 5DP4A 1O3IA 2OD3B 1P04A 1GHVH 3I78A 1AWFH 1SHHB 2C8WB 4BAOB 2H6MA 2LPRA 3EA9A 1SHYA 1FY1A 4X8UH 4I7YH 5T6FA 5JYIA 1KY9A 4NIXA 1C2FA 1SOZA 3H5CB 5I25A 1YPGH 1DVAH 4TPIZ 1CE5A 2GGVB 4K8YA 1FZZA 1E37B 1Q2WA 2BD5A 2ZPQA 2AEIH 4AB8A 1D4PB 1YCPH 3GY5A 4B71A 4ZMAH 5AVDA 2YNBA 1HRTH 1MKWK 4UD9H 1O36A 3BF6H 2VJ1A 4A7IB 4YOJA 4Y0YE 2D26C 3SGBE 2QF0A 3UWJH 2ZFPH 3RXPA 4I31A 5GPIB 2BDCA 1Y5BT 4ABJA 2A7CA 2SNWA 3ZVGA 5LPEA 2CN0H 5DJ7A 1P09A 2W7SA 3PV5A 2I6QA 1V2NT 2VIWA 1SGIB 1W7XH 2Q6DA 1H8DH 1O2HA 1QHRB 1QJ7B 3EDXB 3LGWA 1GL1A 1QL9A 3PMHB 1BRUP 1SB1H 2ZIQH 2BHGA 1SGCA 2R2WU 3RXOA 1YBWA 1HBTH 3ZVEA 4CREA 1P2IA 2VIVA 3QUMP 1Y8TA 3E90B 1EZUC 1S82A 1LDTT 2G4TA 3K9XB 4NFEA 2BQ7B 1SBWA 1BRAA 5TJXA 2GZ8A 4K3JA 2V0BA 4GVUA 2J34A 8ESTE 2Y5HA 2HNTC 3K65B 2WV9A 1O2JA 2QA9E 3UIRA 1HYLA 1C1RA 5FPSA 3D62A 3FP8E 1AVWA 2OK5A 1QY6A 3ZZ7A 1WXRA 1CGHA 3RU4E 2Z6BD 1FMGA 2D2DA 2J95A 3CS7A 2QC2A 3VB6A 2ZU2A 2FOEA 2PTCE 5JB9S 4NIVA 3E0NB 3TITA 4JK5A
chains in the Genus database with same CATH superfamily
1C9TA 1X7AC 3T27A 1AIXH 1NFXA 4F55A 3GY4A 1LVBA 3QZRA 2Y6TA 2A4RA 2H9TH 3F2FA 1PQ7A 1F0RA 4H6TA 4ZXYH 1JBUH 2OC8A 3M3TA 2BY8X 2OTVA 3PV4A 4ABAA 2UUYA 1UTJA 2O9QA 1O3LA 1S5SA 4DG4A 1ZTJA 1E38B 2SGPE 4ZUHA 2ALPA 3GCTF 3TJNA 1DWEH 3IWMA 1HNEE 1Y3WA 2A7JA 2QY0B 4R8TB 3BTQE 1BTPA 2KCPA 3LGTA 3VB5A 1DDJA 1TQ7B 1O5GH 2ZF0H 2FOHA 3U1JB 1RJXB 1OKXA 3OSYA 1HAVB 1TBRH 1C1WH 1TNHA 2ZNKH 1GI4A 4LOYH 3P6ZB 4B6FA 3HGPA 3RXLA 4NZQA 1GJ8B 2AMPA 3F0PA 1Z8RA 1Z8JB 1VJAU 1MMJN 3MNBA 1AWHB 4OS2A 4FVDA 1MABB 4YXWD 1C5OH 4FUEA 2ZDVH 4JYTA 3PLPA 5GCHF 1SGEE 2ZDAH 4AZ2B 1BIOA 4X6OA 2GMTC 3SGQE 3ENSB 5EQSA 3ZIAD 3HK3B 3RMOH 5DN6D 3AAVA 2DUCA 2FOGA 4UONA 1N1LA 1DY8A 3MOCA 1HAPH 4GLYA 1KTSB 1SL3A 3Q3XA 1GL0E 4K2YA 2ZC9H 4HI3A 4XBDA 2FEQH 1KLJH 2ZGCA 4KTUA 1YP9A 1MKWH 2A1DB 2F91A 4M9FA 5T6DA 3A87A 3M7TA 2FDAA 2FTLE 2P8OC 3VPKA 1GJ6A 4YOIA 4FUJA 5C17A 2PKSC 1FIZA 2GMTB 2ZECA 2V3HH 1ARCA 3P17H 1ELVA 5ETXA 1J14A 2VIPA 1MD8A 1MBMA 3HGNA 3QTVH 2WPLS 2FI5E 3SN8A 1P9UA 2BDIA 3V12A 3BTDE 3RXUA 1DANH 3KIDU 1GI6A 1DSUA 2Y81A 3JZ1B 2XWAA 3LJJA 3QN7A 1UVSH 4Y0ZE 4DGJA 1OHHD 3BTEE 1BBRH 3EAJA 1AGJA 1TONA 1YY3A 3HKJB 5DSFA 3SI4H 2V3OH 1MKXH 2TGTA 2AYWA 1C1UH 2P8OB 2LNCA 1GI2A 4K8BA 1A0LA 1IQJA 3M37A 4IC6A 2DE8A 1ZRBA 1Z8GA 1G30B 1NRSH 1BOQA 2Y80A 2QXHA 3SJ9A 1AN1E 1OWKA 3KQ5A 2O8WA 1MD7A 1T4UH 2GT7A 2ZFSA 5C0UA 1PPCE 2CF8H 2LELA 4AFUA 4AYVB 3ZYEA 4J1YA 1WSSH 3P8OA 4CR5A 2Y5FA 3SOSA 1O5CB 1UMAH 2GX4A 4DCDA 4LXBH 1ZHMA 1NRPH 2AGGX 1O31A 4XOJA 1AZ8A 1WDIA 1HGTH 2ZGHA 4OS7A 1BMAA 2F9BH 1ZGVA 3A89A 1MAXA 4CRCA 2KR7A 4ZKNU 1AB9C 4WJG2 1O5DH 1Y3UA 8KME2 1UK4A 5GWZA 1IQNA 2WPKS 4ISLA 4X1PU 4DT4A 3PROA 1IQMA 2FMJA 5EOKA 2CGAA 2ZU5A 1GBIA 2EI6A 1HCGA 2J38A 1O3OA 3VB7A 3TVJB 5C1UA 2A5AA 2ANMH 3L6PA 1UHBA 4BAKB 3K2UA 1O5AB 4MNXA 7GCHF 2PLXA 2BB4A 3ZV9A 3RU4D 3FP6E 1PPBH 2OLGA 5EQQA 4A92A 4JZFH 1W8BH 1AKSA 3SJKA 1C5TA 1GHWH 2ZGBH 4B2AA 1AB9B 1XUIA 2BOKA 4ZKRU 1GDNA 1HJAC 3P8FA 1IQGA 3Q76A 2A5KA 2Z3CA 4JCNA 1W0ZU 1RXPA 1HAIH 1O3NA 1W12U 1BUIA 1JIRA 1TX8A 3SUDA 4FXGH 1XVOA 3S9BA 2FS9A 2ZG0H 4X1NU 5HKKD 1HUTH 1XKBC 2RCEA 4KKDA 1LKBA 2VGCC 4WXIA 2AH4X 2SFAA 3ZVBA 1K1IA 1FJSA 4NZLA 4INKA 5FPTA 4MNWA 3ZZ3A 4Q2KA 3SNCA 5HM9A 4KP0A 1IQEA 4ZHLU 3ZZ5A 3OTPA 1HJAB 1DLKB 1TX6A 3KHVA 1TGSZ 6ESTA 4AFQA 1UK2A 3P8NA 6LPRA 2GV7A 1HV7A 4YOGA 2XNIA 2QV1A 1S85A 3SZEA 2FESH 1O2WA 2IJOB 3TH2H 1ZPBA 1QRWA 3NK8A 2ZU1A 2O8MA 4ZKOU 1L0ZA 2PKAB 1ESAA 3BIVH 1AE8H 3RXBA 3E1XB 4JZIA 1SGDE 2VGCB 1L1JA 1OXGA 1HAYB 3OEED 1H8IH 2C8XB 2BQWB 7GCHG 3TH4H 2NWNA 1AVGH 2CHAC 3FOAA 3GY6A 1CVWH 1GBFA 1SGYE 1SVPA 1O3HA 2WV5A 1ID5H 5E0HA 3PTNA 1MTWA 1NS3A 2G55A 2XW9A 4CH8B 1HAGE 3BEUA 1D3TB 1NU9A 3MH6A 1K1JA 1KDQB 4ZCNA 1GDQA 3HPTB 3SUEA 3GDVA 4NA8A 1ETSH 2F9PA 4Q7ZA 2AMDA 3NPSA 5EJLA 2BDYA 3ELAH 4TY7A 1T8OA 1P06A 1SQRA 3TLOA 4Q63A 4HG6A 1MBQA 3BSQA 1P03A 2CHAB 1Q31A 1XUHA 3LJOA 2ESTE 1NFUA 4E05H 1B5GH 1P3CA 1QQUA 2R2MB 1CHOG 1GCTC 1MQ5A 4MPWA 3KQCA 3LH3A 1EB1H 4RT1A 3MNXA 5DP3A 3OAAD 2KCYA 1AU8A 5EXLA 2FX6A 2B0FA 2M5TA 4XE4A 3RC6A 3SU5A 2Z9KA 8GCHF 3RU4T 1C1NA 1ZSJA 1PPHE 1GGDB 2QCYA 1UVOA 1P11E 3GYLB 3E3TA 2CF9H 1OYQA 1C1VH 2BLVA 2ZCHP 3UQVA 2ZHFH 5EPYA 2FIRH 3A85A 2FLBH 1GBKA 1GCTB 3SNAA 5C94A 5KECA 5FX6A 2H9EH 1GI9B 1TMUH 1G3EA 1LHGH 4NWKA 4X2VA 8LPRA 5EXMA 2OXSA 1ETRH 4ABIA 1GJAB 1VKYA 2IJD1 4IW4E 5FBEA 3AK5A 3BTWE 1V2OT 1UO6A 3T26A 5C1YA 3ZVDA 3LT3A 2HGTH 1GBJA 1BBRE 1S83A 1SLWB 1GBLA 2XOKD 3ODDA 4RKJB 6GCHG 1K22H 1MZAA 2BZAA 1O2PA 4KTCA 2JJ1D 3D65E 4K69A 5HYOA 2KX4A 1Z7KA 3KEEA 3S69A 1EAXA 1C5SA 1TLDA 1C5WB 1S0QA 1Z8IB 3GCHC 4ISIH 2H1UA 1H9LB 1GMDG 3FN8A 2F3CE 1O2RA 2Y7ZA 3UY9A 1OWJA 1HIAB 4FOUC 4NA9H 3KF2A 3VXFH 5JPMH 1RD3B 3E16B 2PUQH 3D49H 8GCHG 2C93B 2YMSD 2J94A 3U1IB 1AO5A 4HTCH 1EATA 2KCOA 1NN6A 1L4DA 1TA2A 5DP8A 2BVSH 2WSSD 1GHAF 1KSNA 4SGBE 3TPIZ 4Q7XA 1J9CH 1DPOA 1PPGE 3AW0A 3ESTA 4IMZA 3P92A 3GCHB 1LCYA 2Z3EA 1FN8A 4Y7AA 1V2RT 1Z1JA 1J16A 3E6PH 5EW2H 3SJIA 2GVFA 3SNBA 1LPZB 3LOXA 2J92A 1MU8B 1IQKA 1FDPA 1V2UT 1P2QA 5TCCA 2R0LA 4BOHA 3PMAB 2GV6A 1BTWA 5HIZA 3SV8A 3STIA 2XBXA 2XCFA 4E06H 1O2KA 4ISOA 3K6ZA 2RDEA 4MPVA 1BT7A 1RGQA 2C4FH 3A8DA 3B23B 5B6LA 1FY8E 1BB0B 1UCYK 5G4BA 1UTKA 2JH0D 4ASUD 1O2TA 1OYTH 2Y7XA 3U28C 2PSYA 1YPMH 3MO3A 1TPOA 2NU0E 5IK2D 2CMYA 1JMOH 3EE0B 3HK6B 1KXFA 3UQOA 1OP0A 2ODYB 4IN1A 5HMAA 2EI8A 4BTIB 1BMLA 5C5NA 2ZU3A 1G37A 2ZHDA 1QA7A 3DFJA 3DUXH 3OY6U 2JH6D 1F5LA 2J2UA 3ZZ8A 1GPZA 3RXSA 4DURA 3ATLA 3SUGA 2Z9GA 1LKAA 2OINA 1TPAE 1S6HA 4B74A 1FAXA 1SMFE 1DWBH 1GHAG 4Z1MD 5AHGH 4LZ4B 1WUNH 1GI5A 2BD7A 3PMJA 3LPRA 1KXBA 1W2KH 1O33A 5E2PA 1P2JA 1P02A 2A7HA 3M35A 1SQTA 3AW1A 3RXGA 1GI8B 1DT2A 3CENA 1C2LA 1YLNA 2OQUA 2G8TA 2WPJS 3TGIE 4XFQA 1C4V2 2FXRA 5GIBA 5FX5A 5FBIA 1A46H 1C2KA 1C2JA 3RMLH 2HOBA 2H5CA 1F92A 3L33A 4TPYA 4HGCA 1XM1A 3NRLA 1DICA 4Y8ZA 3KCGH 2BY5X 1YF4A 1AVXA 4OGYA 1ELAA 1DUEA 1VCPA 2OBQA 1H1BA 1UTQA 3F9GA 1C5VA 2HLDD 4MPXA 2BTCE 3SW2B 1YYY1 1O39A 5E0JA 2ZCLP 3OE7D 1TOMH 1LPGB 4GUXA 1GBMA 4BXWA 1SQOA 3RMNH 3A7WA 1TRNA 2PGBB 1A5GH 1CA0C 3EE7A 2F43B 2Z7FE 4TY6A 2HVYB 2FWWA 4LK4A 1O2ZA 3F3BA 5GNDA 3F9EA 1ZJKA 4X2YA 1GMCF 2P3UB 2FOBA 1GBDA 1RIWC 2QXIA 1V2LT 1ESBA 2IN2A 2F9OA 4JZ1A 3V7TA 1Z1IA 4DY7B 5A8XA 3SORA 2BDAA 2M2AA 1C5PA 3SNEA 4BAQB 4IC5A 1ZR0A 3AAUA 3MMGA 1S0RA 1UVUH 2ZCKP 1H9HE 3GY8A 4MTBA 2FOFA 4ABHA 1NRQH 1C2MA 2FYQA 3T5FH 4AOQA 3TK6A 1BMFD 1CA0B 3I29A 1HXEH 1O2GH 5GXPA 3F68H 1BTZA 2P94A 4YO9A 2UWOA 3OU0A 4RI0A 2R3UA 4DIHH 2VWLA 1VITH 3MQKC 3MHWU 3BG4C 3SQEE 1GHBG 1N6XA 5AF9H 1P8VC 5F6MA 4NGAH 3F9FA 2ZQ1A 3R3GB 5C0TA 5JDUB 1TALA 5DK1A 1O3JA 3PLBA 2F9VA 1W13U 1XXDA 3BEIB 1QBNA 2R0KA 1V2MT 2BXTH 1K1PA 3NUMA 1SGNE 2NU1E 5LH8A 3RXEA 4DT7B 2Z9LA 1YM0A 3H09A 4IBLH 1N6YA 1L1NA 2A4OA 4FUIA 4E7RG 1O5BB 3MU4A 1LPKB 1HAVA 2TRMA 1YKTA 3CNRA 4OS6A 4X1SU 1GMCG 1MCTA 1NBME 1P2NA 3BG4B 1C2HA 2VIOA 1K1LA 2ZKSA 4UEHH 4FUHA 1HAZB 4D76A 1C1OA 4AYYB 4Y8XA 1UCYH 1THSH 2PR3A 4YM9A 2OP9A 3QO6A 3N7DA 1DY9A 3LGIA 3VEQB 1SGFA 3LC5A 1FPHH 2RA0A 3EA8A 1BHXF 4A1VA 2VH6A 2SGDE 2PSXA 1TWXB 1GBTA 2YMSC 1TFXA 5AFZH 2JH5D 1F5KU 1G2MA 3PWCA 3FAOA 1A3BH 1GHYH 1UVPA 4NSYA 2GDEH 7ESTE 5IDKA 4NFFA 1BZXE 1XKAC 1O3BA 4MVNA 1EJAA 2GZ7A 1BMNH 2HLCA 3PLKA 1CBWC 3BIUH 3PYHA 2WHXA 1QQ4A 4YESB 3T25A 4NSVA 3RXCA 4AFSA 4AGJA 2J98B 1VITG 2L6OA 4Z6AH 2SGEE 1TIOA 3QDZB 3EYDA 1VCWA 4ISNA 1WBGB 2UUJB 5FCRA 1FY3A 2GP9B 4I8HA 1YPHE 3S9CA 1S6LA 3C27B 1SGPE 3MU0A 1EFRD 1C1PA 1EX3A 1TE0A 2YMSB 4WY3A 3MYWA 1EAUA 3SYJA 1F5RA 3DCLA 4FUGA 1TNKA 1CGJE 2QXJA 3SV2H 1LQEA 1XVMA 2A4QA 2R9PA 1CBWB 2BVXH 2WPHS 3U8TH 1TGBA 2PTNA 4CRFA 1E79D 1BA8B 3QZQA 4D9QA 5FPYA 1ZOMA 1K0HA 1T8MA 3QWCH 3RM2H 1O3CA 1OS8A 3A8AA 3SU1A 4XBCA 4J2YB 2XBYA 4KTSA 1N8OC 1J15A 4AGKA 3F1SB 1O2IA 5L2ZH 3O8RA 3MU5A 1FY4A 3RMMH 1O2MA 2TGAA 2BDGA 1C2IA 2O8UA 2ANYA 1NRRH 1ZGIA 1C1QA 1C5LH 3TH3H 1XMNB 1O3FA 2FPZA 2W3IA 4K1SA 1G36A 3BEFB 1WOFA 3GDSA 5T1VA 2CV3A 2XC5A 1QJ6B 1NC6A 1OX1A 4UFDH 4AB9A 2QGRA 1QJ1B 2BZ6H 1FIWA 3DHKH 2VIDA 1TPSA 4ACBA 3L3TA 2ILNA 2PKSB 5EJ1A 5A8YA 3M61U 2STBE 1XUJA 2GKVE 4JMYA 1SPJA 1ELFA 2AGIX 4Y11E 4A1TA 2B5TB 1RTLA 2HPQH 4WMDA 3IITA 5J4QA 3SU4A 3D23A 1IQIA 1QL8A 1TX7A 3BTGE 2O8LA 3MTYA 3LONA 3WWBA 1MTSA 1UW7A 2J9NA 4ZKSU 2GT8A 3M5MA 2QN5T 1UTNA 2ZDNA 1DXWA 1QFKH 5BRRE 3AASA 1HFDA 1C1MA 1DM4B 1EPTA 1NY22 1VR1H 1BITA 3UNSA 3ZZCA 2F9UA 6CHAC 3WY8A 5A2MH 1E36B 1QB1A 1FQ3A 1EUFA 1KLTA 3U69H 5JBAS 1F0UA 5DGJA 1YLDA 2SNVA 2FI4E 5ESBA 1GG6C 1ZPCA 1TMTH 2BX4A 4DW2U 5DO4H 2P3FH 1D3DB 1VCQA 1XX9A 1ETTH 3FFGA 1MAYA 2GDDA 3SHAH 2HNTE 3QX5H 1DX5M 1XUFA 2A2QH 2VU8E 4X2XA 2XC4A 4X6MA 2G51A 1Y5AT 1B0EA 1OWIA 3UWIA 5LGOA 1TRYA 1SR5C 2FLRH 6CHAB 4TT3D 1O37A 1ZHPA 2B9LA 2XCNA 1NBMD 1C5YB 2C8ZB 3ZZBA 5K0HA 2PUXB 3S7HB 1CU1A 4ZXXH 4RT0A 1C1TA 1LHEH 4AC9A 2ANKH 5SGAE 2A2XH 4O97A 1GG6B 1NRNH 5EXNA 4AN7A 2L74A 3LGYA 4I8GA 1O5FH 1Z6JH 1WTHD 1NESE 1K1NA 2W7UA 1D6WA 2XWBI 4IN2A 1K2I1 2DE9A 2ANWA 2BQ6B 1IQFA 3DA9B 1PYTD 4FU8A 2A0QB 1LTOA 3SO3A 2ZDMA 2I6SA 4CRDA 1PJPA 3GY7A 2ZGJA 2FO9A 1H4WA 1O34A 1V2ST 4B75A 1OWDA 4SGAE 3RXAA 2Q6FA 3GCNA 1PQ8A 2BD9A 1KDQA 3MU1A 1ZMLA 1LMWB 3SU6A 2K1QA 1CHOF 4D7FA 3NXPA 1NT1A 4H6SB 5I46H 1QR3E 3RXMA 2NU4E 3Q3KA 1P10A 1P2OA 4AFZA 2OC1A 2A45B 1J8AA 2BMGB 1FUJA 1SKYE 5CHAC 1FONA 1UCYE 3S0NA 2HPPH 4B1TA 1O3GA 1C2GA 3EA7A 4X8VH 4BAHB 5E8EH 1ELTA 4BAMB 1O2OA 5DP5A 1AKSB 1K28D 2JETC 4GAWA 4OGXA 3M5LA 3SU0A 1LO6A 3GS9A 1PQAA 1V3XA 1DWCH 2D8WA 1TOCB 1Y59T 2V35A 2A31A 1P0SH 3SV7A 1AUTC 4U32A 3LDXH 3SNDA 5CHAB 4X0WU 4JZEH 2F4LA 2VWNA 1B0FA 3ZZAA 3TJOA 6GCHF 1NROH 1MCVA 1FX0B 4AORA 5C3NA 4NG9H 3VXEH 5T3HA 2JETB 1C9PA 1O35A 1V2PT 3RXFA 5HGGA 1FI8A 4I8JA 3BTME 2G00A 2ULLA 2XC0A 2ZU4A 4A6LA 2K8IA 2A32A 5A0CA 3CS0A 3O8BA 3SU2A 3T29A 1QNJA 1GMDF 4B6EA 1P12E 2BX3A 3FZZA 1L4ZA 2PFEA 2ALVA 4BXSA 2EI7A 1FY5A 1DE7H 1KYNA 5GDSH 5JBCS 1C4Y2 2TPIZ 3ATKA 4ABFA 4MLFB 1QB6A 1HJ8A 2KAIA 3M36A 1HLTH 1T32A 2F9NA 3EQ0H 5JBBS 3ZZDA 2QYIA 1GDUA 2BY6X 1AHTH 1ELEE 1HAXB 3U8OH 1SC8U 1SGRE 2ZGXH 2ODPA 2UWLA 2HALA 2QIQA 1HIAA 1DS2E 3PV2A 2G81E 4X1RU 9LPRA 2H2ZA 1MUEB 3A80A 1AZZA 2PWXA 1NU7B 4E7NA 1O0DH 3KNXA 3UNRA 4X6NA 4JZDH 1JXPA 1SI5H 5DKMA 1O2LA 2BLOA 4TSFD 4WXVA 3STJA 4DOQA 1T8NA 2A5IA 2IPHA 1TGNA 2OBOA 3SBKA 3TK5A 2UUFB 3R0FA 3PRDA 1SLXB 1UTPA 4DIIH 3OX7U 3F2HA 2ZQ2A 2ZZUH 3P95A 3TGJE 4P00A 1W10U 2BY9X 3RUOA 4FUBA 4HZHA 1P9SA 4FU7A 2GJGA 2Z94A 1P01A 1TA6A 2VIQA 3FVFB 2BD8A 2ODQA 1CGIE 1NFWA 5EU8A 2IPQX 4HFPB 2ZPRA 5CMXH 2Z3DA 3MH4A 1UTLM 3M3VA 5A0AE 3EGKH 1ACBE 1K9OE 2ZFTA 1T31A 1HAOH 1TMBH 1ZJDA 1Y3XA 3PB1E 1O2QA 3RC5A 1FN6A 4X1QU 3U8RH 3MU8A 2WPMS 4THNH 2C8YB 1O2VA 1WYKA 3U9AH 3SZNA 1ZTKA 2AS9A 1T8LA 1NO9H 3ZZ4A 3VB4A 1AFQC 4BANB 3TIUA 1LHFH 2EY4C 5F03A 3T62A 1O2YA 1A61H 1O30A 1DWDH 1FNIA 2ZI2H 1TQ0B 2JJ2D 4TYDA 1EKBB 4CHAC 3A7XA 4GCHG 1YC0A 5ABWA 3ITIA 1W3CA 3MFJA 1OSSA 4NCYA 1NM6A 2G52A 2K0QA 3A7YA 4FVBA 2STAE 3NZIA 4NA7A 1PYTC 3MO6A 1FLEE 4Y8YA 1O3DA 2F83A 3O8CA 1GVZA 1W11U 4WF8A 4I33A 1NTPA 1SFQB 1Z71A 3KYFA 1AFQB 4IMQA 3N7EA 2BLQA 2VVVA 3DT0H 1ANCA 1ZPZA 1C5MD 3AVZA 3FZDA 1Y3YA 2FZZA 1H9IE 1QIXB 4WMEA 1JIMA 4FUFA 1SGQE 5LPFA 3UUZA 2C90B 4CHAB 1HXFH 2AIPA 3KQEA 5KEDA 3G01A 1BQYA 5E0GA 1MQ6A 3B9FH 2FOCA 1LVYA 5BPEA 4DJZB 3LU9B 5DG6A 2FX4A 4AG1A 4Y79A 4INHA 4F48B 1GVLA 3BTHE 1ZMNA 1A2CH 1GVKB 2SGQE 5ESTE 3TK9A 3ZYDA 1E0FD 5HXFA 1GHBF 1QCPA 4WH8A 3A88A 4M7GA 3KN2A 1DSTA 1O2NA 3QLPH 1ELBA 1TNIA 2C3SA 2JKHA 1EOJA 3PMBB 3OEHD 4FETA 1P2MA 3F0OA 2ZO3H 2A4GA 4UE7H 3SV9A 3SV6A 4UFGH 2D1JA 4RKOB 1GBEA 2ZHEH 3PWBA 1JRTA 1SGTA 4ZROA 3UB0A 4YTAA 3URDA 5FCKA 4K1TA 2FODA 1ZYOA 4U30A 4B73A 3URCA 4NWLA 3RXQA 2TBSA 3RC4A 5L2YH 1W0YH 2HNTF 3VB3A 3E91A 3NKKA 1PPZA 3U98H 1O3PB 2Q1JA 1IOEA 2JIZD 2ZTYA 5HM2A 1FV9A 1KXDA 1TBZH 1PFXC 1WAYB 5B6OA 2OC7A 3LGVA 1LQDB 4FUCA 2Q6GA 1WQSA 1E1RD 3Q77A 1EAWA 3ZZ9A 1GI7B 5IYTA 3KGPA 2FOAA 3P70B 1QA0A 3UFAA 1HJ9A 4CRGA 2HVXA 1BTXA 4PROA 1RIWB 1FPCH 1GBHA 1EJNA 1ZHRA 4OS5A 1FXYA 3VFEA 2VWOA 4MNYA 3F9HA 4CBOA 4Y6DA 4OS1A 1BBRK 3LC3A 1MU6B 3GICB 3PO1C 1DXPA 1VITF 3A81A 3QGJA 1MKXK 1C5UA 3KQBA 1RRKA 4MPUA 2AGEX 1ELDE 1GBCA 4BTUB 3BV9B 1XXFA 2H5DA 1YGCH 3TJVA 1H8HD 1V2QT 1MTVA 1KMHB 3SQHE 4QT8C 2ZA5A 1GMHF 1CO7E 1PQ5A 2PGQB 1ABIH 1HAHH 1WCZA 1GJ9B 3ZV8A 2J98A 2R3YA 1IAUA 1ABJH 2JDID 3SU3A 1GBAA 2GTBA 3PO1B 1RS0A 1TABE 1W14U 1IHTH 1O3EA 4WMFA 3B8JA 1W0JD 1MTNC 4WVPE 3TU7H 1TAWA 4YT7H 3A86A 2BYAX 2ZDKA 3UPEA 4B2CA 2XNDD 2BD2A 5EJZA 4DVAU 2OUAA 5K7RA 1YWUA 3N7OA 1CSOE 2WV4A 2ZFRH 2OC0A 1AY6H 3BN9A 3BG8A 3TNTA 3VGCC 1V2TT 2H9HA 2IOTA 3T28A 4BTTB 1T4VH 1Y3VA 3WWFA 1HDTH 1EXFA 2SGAA 1UVTH 1PPFE 1UTOA 1ZSKA 1MTNB 1QURH 2BXUH 5T6GA 2G5VA 3OYPA 3A83A 4O9VA 5HIYA 1IHSH 3LGUA 2J97A 4Y7BA 1O32A 1MH0A 2PP6A 4MNVA 1THRH 5DP9A 3TGKE 4ZHMU 1SGFG 4ESTE 1F7ZA 3RXRA 2QF4A 3M5NA 5EW1H 4I32A 1GMHG 4GPGA 3VGCB 2V3MA 3DFLA 4MQAA 1YPEH 1O3AA 3I77A 1P57B 3K6YA 3RLYH 1AUJA 1O3MA 4U01A 1EQ9A 1FAKH 1C4U2 4CR9A 2CXVA 5CE1A 5DP6A 4ABGA 2WUBA 2ZP0H 3RLWH 3OTJE 2XYAA 1NZQH 3DSGA 3RXVA 1COWD 4RN6A 1BDAA 1K1MA 1H8ED 1YPJH 3VG8A 3DSPA 3V13A 3RXJA 3ATIA 4TWWA 1E35B 3OY5U 2AERH 4IS5A 2XBWA 5GJ4B 2BM2A 1MZDA 1KIGH 4O03A 5DP7A 2B8OH 1E34B 1LHDH 1ZRKA 2GZ9A 4D8NA 2ZFFH 5DPAA 1QL7A 1LVMA 2GD4B 1W7GH 4FUDA 4ABEA 1TBQH 1TPPA 3A8CA 3H7TA 1TYNA 1JOUB 2RFKC 1UJ1A 1BHXB 1LVOA 5E2OA 2VH0A 1W0KD 3GCTG 1OWEA 2BD3A 1GBBA 1EP5A 1GCDA 1N8OB 1GI3A 5JBTA 1WTGH 5C5OA 3RXIA 5FL7D 2XTTB 2VBCA 3SGAE 2O8TA 5F8XA 2BLWA 3FKSD 4WH6A 1C5XB 1A0JA 1ANEA 1G32B 3RXDA 3LKWA 4JK6A 2P93A 3DSOA 2J5UA 4RSPA 2WUCA 1E1QD 3NCLA 4ZH8A 3CP7A 4X8TH 4XDEA 1BTUA 5GCHG 3SJ8A 1ELGA 1EZSC 3V3MA 3UOPA 5AFYH 1G9IE 1DUAA 2Y82A 1KXAA 1GJCB 4UDWH 4YLQH 1BCUH 5FXLA 2P3TB 2RDLA 4X6PA 1B7XB 2FOMB 3UAIC 2Z9IA 4JYUH 3TJUA 1DITH 2VINA 1V2JT 2AFQB 1AD8H 1QBOA 5EGMA 2AMQA 1VJ9U 1WV7H 2ZEBA 1EASA 1EB2A 1TRMA 2W5EA 5C2ZA 3RXTA 1QGFA 4O3UA 2TGDA 2PV9B 1XUGA 3MH5A 3MNCA 4MDSA 4OS4A 3BTTE 1S84A 1YPLH 3WW7A 1INCA 1ZTLA 2YNAA 4WWYA 1M9UA 2Y5GA 2G4UA 3IG6B 1L1GA 1YCPM 2J4IA 2FM2A 4ZHAA 1VZQH 3A8BA 1EPTC 1GI0A 5L30H 3FO8D 1A4WH 3ZZ6A 4XBBA 2RG3A 3GDUA 4BNRA 1D6RA 1KLIH 1G3BA 1ESTA 2PKAA 4KELA 3RXHA 1P3EA 1TGTA 4YLUA 1S81A 2ZTXA 3O8DA 2BY7X 1Q3XA 3LIWA 1F0SA 1GHZA 1O38A 1LHCH 1G3CA 1ANDA 3M7UA 1CHGA 1AFEH 2ZHQH 1C1SA 1JRSA 2FS8A 4ASHA 1CT4E 1NFYA 3BTKE 1EPTB 1UK3A 1WQVH 3S9AA 1YLCA 1AMHA 2VWMA 1BJVA 1SSXA 2BD4A 2WZQA 1CQQA 3Q3YA 2FYRA 3MO9A 1SLVB 1BJUA 2BDHA 2BDBA 2V7QD 4Q4LA 1C5NH 2NU3E 5F53A 2KFWA 4VGCC 2ZWLH 3A7ZA 1U6QA 1O2SA 4UFFH 5EIYA 2WPDD 3QGNB 1RTKA 3GCOA 4A1XA 3QTOH 2WYGA 3M7QA 1GHXH 1UHBB 4CRBA 4CRAA 1SLUB 4ACAA 2TIOA 1GJDB 1SQAA 3KQDA 4KGAA 2Z9JA 3SUFA 1O5EH 1K1OA 5CDFE 3SJOA 3F2GA 1A5HA 1TNGA 4JYVH 2OQ5A 2WPIS 1TNJA 1JWTA 1V2KT 2UWPA 4VGCB 4Q7YA 3KYGA 4X2WA 5EPNA 2GCTC 1C5RA 4R0IA 1DLEA 1A0HB 4OM9A 1VGCC 5EG4A 1G3DA 1OP2A 3JZ2B 1CA8B 4K1EA 5TCAA 3A84A 1A7SA 1GWAA 3FANA 1V2WT 1EP6A 4Y10E 2QF3A 1EJMA 3A82A 3W94A 1ELCA 1SFIA 1S6FA 1T7CA 2FTMA 1L2EA 2QF5A 3F6UH 2GCTB 1C2EA 1QRXA 1GGDC 3GISB 1TGCA 1G2LA 2HWLB 4FU9A 1K21H 1A1RA 3E0PB 3TNSA 5A09A 3BTFE 2B7DH 2TGPZ 3UNQA 4MG3A 1VGCB 4IGDA 3M3SA 1CT0E 5EODA 5C67A 4Z0KA 2G5NA 1AE5A 1KTTB 1BRCE 3A7TA 1IQLA 3ZVFA 1Y5UT 1A5IA 4Y76A 2AHME 1QRZA 4F49A 3UOUA 5F8ZA 2FI3E 2QE7D 2YOLA 5PTPA 2AIQA 4H42U 4XSKU 1P05A 4I8LA 4F4OC 1D9IA 3SI3H 4B2BA 3Q00A 4CBNA 1SOTA 1A3EH 1BMMH 1XUKA 2W26A 1QZ8A 4YZUA 1ANBA 1ARBA 5KGOA 3RM0H 3UR6A 1WU1A 3T2NA 1TNLA 3M5OA 4GCHF 1YCPK 4XRNA 1TB6H 3FP7E 1HPGA 2BOHB 1C2DA 5LPRA 1V2VT 5JB8S 1ORFA 2ASUB 4GSOA 3QK1A 2XXLA 4D9RA 1NPMA 1J17T 1THPB 4LZ1H 3RDZA 3ODFA 4Y71A 1OP8A 3MWIU 3H7OA 1YPKH 1D3PB 1OOKB 1D3QB 2QXGA 4K5ZA 4NIYA 1ZSLA 3GOVB 2CJIA 7KMEH 5H4IB 1KXCA 1QTFA 2EEKA 1BTHH 2KM0A 3A7VA 1GJ4H 1QB9A 2HRVA 2PW8H 3RXKA 1UTMA 1ZLRA 3W1EA 2KAIB 4ISHH 4ABBA 4YT6H 1QBVH 3HATH 3ATWA 1EZQA 4GHQA 1KXEA 3C1KA 1AQ7A 1OPHB 1SG8B 2UUKB 3MH7A 3GYMA 1IQHA 7LPRA 1GI1A 1GJ5H 4B76A 1C5QA 1BRBE 1Z6EA 1EOLA 1RTFB 4I8KA 1AI8H 3N99A 1C5ZB 2LP6A 2SGFE 3UR9A 4XD7D 4A5TS 1DOJA 1HB0B 2GCHF 2V6NA 1DFPA 1O2UA 3RP2A 1OWHA 5J4SA 1P2KA 4U2WA 2OCVB 3UTUH 2VB0A 1GJ7B 3V0XA 2EC9H 1EAIA 2EA3A 3SHCH 2THFB 4H4FA 2P59A 5C1XA 3LH1A 2VVCA 1CT2E 4CH2B 1RFNA 3ZVCA 2XBVA 1ZMJA 4TWYA 3NWUA 2P16A 1O2XA 3KL6A 1F2SE 3DD2H 5A8ZA 4UFEH 3HKIB 1V6DA 4Q80A 3W95A 2QAAA 2ZHWH 1GJBB 4AG2A 3E8LA 4ZAEA 1MTUA 3ZVAA 1PPEE 4O3TA 2ZPSA 3MNSA 2ZFQH 3GY2A 2BVRH 1EZXC 2VNTA 5EQRA 3UREA 3S7KB 5C20A 2WYJA 4AX9H 2WINI 9ESTA 5L6NH 5F8TA 1YPHC 3P8GA 2ZDLA 4NIWA 2ZTZA 4K60A 1F0TA 4X8SH 3ATMA 5CHBA 2NU2E 2XRCA 3MI4A 2FP7B 5FHTA 4GHTA 4ABDA 2PHBA 4INLA 2P95A 5FAHA 5A0BA 3GY3A 3PM3A 2GCHG 2RA3A 3PTBA 4D7GA 2CK3D 1ZZZA 1BTYA 2VVUA 2W3KA 1O3KA 2W6ID 2W6JD 3PRBA 5DP4A 1O3IA 2OD3B 1P04A 1GHVH 3I78A 1AWFH 1SHHB 2C8WB 4BAOB 2H6MA 2LPRA 3EA9A 1SHYA 1FY1A 4X8UH 4I7YH 5T6FA 5JYIA 1KY9A 4NIXA 1C2FA 4P02A 1SOZA 3H5CB 5I25A 1YPGH 1DVAH 2KZ4A 4TPIZ 1CE5A 2GGVB 4K8YA 1FZZA 2EQNA 1E37B 1Q2WA 2BD5A 2ZPQA 2AEIH 4AB8A 1D4PB 1YCPH 3GY5A 4B71A 4ZMAH 5AVDA 2YNBA 1HRTH 1MKWK 4UD9H 1O36A 3BF6H 2VJ1A 4A7IB 4YOJA 4Y0YE 2D26C 3SGBE 2QF0A 4I86A 3UWJH 2ZFPH 3RXPA 4I31A 5GPIB 2BDCA 1Y5BT 4ABJA 2A7CA 2SNWA 3ZVGA 5LPEA 2CN0H 5DJ7A 1P09A 3OFND 2W7SA 3PV5A 2I6QA 1V2NT 2VIWA 1SGIB 1W7XH 2Q6DA 1H8DH 1O2HA 1QHRB 1QJ7B 3EDXB 3LGWA 1GL1A 1QL9A 3PMHB 1BRUP 1SB1H 2ZIQH 2BHGA 1SGCA 2R2WU 3RXOA 1YBWA 1HBTH 3ZVEA 4CREA 1P2IA 2VIVA 3QUMP 2KCAA 1Y8TA 3E90B 1EZUC 1S82A 1LDTT 2G4TA 3K9XB 4NFEA 2BQ7B 1SBWA 1BRAA 5TJXA 2GZ8A 4K3JA 2V0BA 4GVUA 2J34A 8ESTE 2Y5HA 2HNTC 3K65B 2WV9A 1O2JA 2QA9E 3UIRA 1HYLA 1C1RA 5FPSA 3D62A 3FP8E 1AVWA 2OK5A 1QY6A 3ZZ7A 1WXRA 1CGHA 3RU4E 2Z6BD 1FMGA 2D2DA 2J95A 3CS7A 2QC2A 3VB6A 2ZU2A 2FOEA 2PTCE 5JB9S 4NIVA 3E0NB 3TITA 4JK5A
chains in the Genus database with same CATH topology
1C9TA 1X7AC 3T27A 1AIXH 1NFXA 4F55A 3GY4A 1LVBA 3QZRA 2Y6TA 2A4RA 2H9TH 3F2FA 1PQ7A 1F0RA 4H6TA 4ZXYH 1JBUH 2OC8A 3M3TA 2BY8X 2OTVA 3PV4A 4ABAA 2UUYA 1UTJA 2O9QA 1O3LA 1S5SA 4DG4A 1ZTJA 1E38B 2SGPE 4ZUHA 2ALPA 3GCTF 3TJNA 1DWEH 3IWMA 1HNEE 1Y3WA 2A7JA 2QY0B 4R8TB 3BTQE 1BTPA 3LGTA 2KCPA 3VB5A 1DDJA 1TQ7B 1O5GH 2ZF0H 2FOHA 3U1JB 1RJXB 1OKXA 3OSYA 1HAVB 1TBRH 1C1WH 1TNHA 2ZNKH 1GI4A 4LOYH 3P6ZB 4B6FA 3HGPA 3RXLA 4NZQA 1GJ8B 2AMPA 3F0PA 1Z8RA 1Z8JB 1VJAU 1MMJN 3MNBA 1AWHB 4OS2A 4FVDA 1MABB 4YXWD 1C5OH 4FUEA 2ZDVH 4JYTA 3PLPA 5GCHF 1SGEE 2ZDAH 4AZ2B 1BIOA 4X6OA 2GMTC 3SGQE 3ENSB 5EQSA 3ZIAD 3HK3B 3RMOH 5DN6D 3AAVA 2DUCA 2FOGA 4UONA 1N1LA 1DY8A 3MOCA 1HAPH 4GLYA 1KTSB 1SL3A 3Q3XA 1GL0E 4K2YA 2ZC9H 4HI3A 4XBDA 2FEQH 1KLJH 2ZGCA 4KTUA 1YP9A 1MKWH 2A1DB 2F91A 5T6DA 4M9FA 3A87A 3M7TA 2FDAA 2FTLE 2P8OC 3VPKA 1GJ6A 4YOIA 4FUJA 5C17A 2PKSC 1FIZA 2GMTB 2ZECA 2V3HH 1ARCA 3P17H 1ELVA 5ETXA 1J14A 2VIPA 1MD8A 1MBMA 3HGNA 3QTVH 2WPLS 2FI5E 3SN8A 1P9UA 2BDIA 3V12A 3BTDE 3RXUA 1DANH 3KIDU 1GI6A 1DSUA 2Y81A 3JZ1B 2XWAA 3LJJA 3QN7A 1UVSH 4Y0ZE 4DGJA 1OHHD 3BTEE 1BBRH 3EAJA 1AGJA 1TONA 3HKJB 3SI4H 5DSFA 2V3OH 1MKXH 2TGTA 2AYWA 1C1UH 2P8OB 2LNCA 1GI2A 4K8BA 1A0LA 1IQJA 3M37A 4IC6A 2DE8A 1ZRBA 1Z8GA 1G30B 1NRSH 1BOQA 2Y80A 2QXHA 3SJ9A 1AN1E 1OWKA 2O8WA 1MD7A 1T4UH 2GT7A 2ZFSA 5C0UA 1PPCE 2CF8H 2LELA 4AFUA 4AYVB 3ZYEA 4J1YA 1WSSH 3P8OA 4CR5A 2Y5FA 3SOSA 1O5CB 1UMAH 2GX4A 4DCDA 4LXBH 1ZHMA 1NRPH 2AGGX 1O31A 4XOJA 1AZ8A 1HGTH 2ZGHA 4OS7A 1BMAA 2F9BH 1ZGVA 3A89A 1MAXA 4CRCA 2KR7A 4ZKNU 1AB9C 4WJG2 1O5DH 1Y3UA 8KME2 1UK4A 5GWZA 1IQNA 2WPKS 4ISLA 4X1PU 4DT4A 3PROA 1IQMA 2FMJA 5EOKA 2CGAA 2ZU5A 1GBIA 2EI6A 1HCGA 2J38A 1O3OA 3VB7A 3TVJB 5C1UA 2A5AA 2ANMH 3L6PA 1UHBA 4BAKB 3K2UA 1O5AB 4MNXA 7GCHF 2PLXA 2BB4A 3ZV9A 3RU4D 3FP6E 1PPBH 2OLGA 5EQQA 4A92A 4JZFH 1W8BH 1AKSA 3SJKA 1C5TA 1GHWH 2ZGBH 4B2AA 1AB9B 1XUIA 2BOKA 4ZKRU 1GDNA 1HJAC 3P8FA 1IQGA 3Q76A 2A5KA 2Z3CA 4JCNA 1W0ZU 1RXPA 1HAIH 1O3NA 1W12U 1BUIA 1JIRA 1TX8A 3SUDA 4FXGH 1XVOA 3S9BA 2FS9A 2ZG0H 4X1NU 5HKKD 1HUTH 1XKBC 2RCEA 4KKDA 1LKBA 2VGCC 4WXIA 2AH4X 2SFAA 3ZVBA 1K1IA 1FJSA 4NZLA 4INKA 5FPTA 4MNWA 3ZZ3A 4Q2KA 3SNCA 5HM9A 4KP0A 1IQEA 4ZHLU 3ZZ5A 3OTPA 1HJAB 1DLKB 1TX6A 3KHVA 1TGSZ 6ESTA 4AFQA 1UK2A 3P8NA 6LPRA 2GV7A 1HV7A 4YOGA 2XNIA 2QV1A 1S85A 3SZEA 2FESH 1O2WA 2IJOB 3TH2H 1ZPBA 1QRWA 3NK8A 2ZU1A 2O8MA 4ZKOU 1L0ZA 2PKAB 1ESAA 3BIVH 1AE8H 3RXBA 3E1XB 4JZIA 1SGDE 2VGCB 1L1JA 1OXGA 1HAYB 3OEED 1H8IH 2C8XB 2BQWB 7GCHG 3TH4H 2NWNA 1AVGH 2CHAC 3GY6A 3FOAA 1CVWH 1GBFA 1SGYE 1SVPA 1O3HA 2WV5A 1ID5H 5E0HA 3PTNA 1MTWA 1NS3A 2G55A 2XW9A 4CH8B 1HAGE 3BEUA 1D3TB 1NU9A 3MH6A 1K1JA 1KDQB 4ZCNA 1GDQA 3HPTB 3SUEA 3GDVA 4NA8A 1ETSH 2F9PA 4Q7ZA 2AMDA 3NPSA 2BDYA 3ELAH 4TY7A 1T8OA 1P06A 3TLOA 4Q63A 1MBQA 3BSQA 1P03A 2CHAB 1Q31A 1XUHA 3LJOA 2ESTE 1NFUA 4E05H 1B5GH 1P3CA 1QQUA 2R2MB 1CHOG 1GCTC 1MQ5A 4MPWA 3KQCA 3LH3A 1EB1H 3MNXA 5DP3A 3OAAD 2KCYA 1AU8A 5EXLA 2FX6A 2B0FA 2M5TA 4XE4A 3RC6A 3SU5A 2Z9KA 8GCHF 3RU4T 1C1NA 1ZSJA 1PPHE 1GGDB 2QCYA 1UVOA 1P11E 3GYLB 3E3TA 2CF9H 1OYQA 1C1VH 2BLVA 2ZCHP 3UQVA 2ZHFH 5EPYA 2FIRH 3A85A 2FLBH 1GBKA 1GCTB 3SNAA 5FX6A 2H9EH 1GI9B 1TMUH 1G3EA 1LHGH 4NWKA 4X2VA 8LPRA 5EXMA 2OXSA 1ETRH 4ABIA 1GJAB 4IW4E 5FBEA 2IJD1 3AK5A 3BTWE 1V2OT 1UO6A 3T26A 5C1YA 3ZVDA 3LT3A 2HGTH 1GBJA 1BBRE 1S83A 1SLWB 1GBLA 2XOKD 3ODDA 4RKJB 6GCHG 1K22H 1MZAA 2BZAA 1O2PA 4KTCA 2JJ1D 3D65E 4K69A 5HYOA 1Z7KA 3KEEA 3S69A 1EAXA 1C5SA 1TLDA 1C5WB 1S0QA 1Z8IB 3GCHC 4ISIH 2H1UA 1H9LB 1GMDG 3FN8A 2F3CE 1O2RA 2Y7ZA 3UY9A 1OWJA 1HIAB 4NA9H 3KF2A 3VXFH 5JPMH 1RD3B 3E16B 2PUQH 3D49H 8GCHG 2C93B 2YMSD 2J94A 3U1IB 1AO5A 4HTCH 1EATA 1NN6A 2KCOA 1L4DA 1TA2A 5DP8A 2BVSH 2WSSD 1GHAF 1KSNA 4SGBE 3TPIZ 4Q7XA 1J9CH 1DPOA 1PPGE 3AW0A 3ESTA 4IMZA 3P92A 3GCHB 1LCYA 2Z3EA 1FN8A 4Y7AA 1V2RT 1Z1JA 1J16A 3E6PH 5EW2H 3SJIA 2GVFA 3SNBA 1LPZB 3LOXA 2J92A 1MU8B 1IQKA 1FDPA 1V2UT 1P2QA 5TCCA 2R0LA 4BOHA 3PMAB 2GV6A 1BTWA 3SV8A 3STIA 2XBXA 2XCFA 4E06H 1O2KA 4ISOA 3K6ZA 4MPVA 1BT7A 1RGQA 2C4FH 3A8DA 3B23B 5B6LA 1FY8E 1BB0B 1UCYK 5G4BA 1UTKA 2JH0D 4ASUD 1O2TA 1OYTH 2Y7XA 2PSYA 1YPMH 3MO3A 1TPOA 2NU0E 5IK2D 2CMYA 1JMOH 3EE0B 3HK6B 1KXFA 3UQOA 1OP0A 2ODYB 4IN1A 5HMAA 2EI8A 4BTIB 1BMLA 5C5NA 2ZU3A 1G37A 2ZHDA 1QA7A 3DFJA 3DUXH 3OY6U 2JH6D 1F5LA 2J2UA 3ZZ8A 1GPZA 3RXSA 4DURA 3ATLA 3SUGA 2Z9GA 1LKAA 2OINA 1TPAE 1S6HA 4B74A 1FAXA 1SMFE 1DWBH 1GHAG 4Z1MD 5AHGH 4LZ4B 1WUNH 1GI5A 2BD7A 3PMJA 3LPRA 1KXBA 1W2KH 1O33A 5E2PA 1P2JA 1P02A 2A7HA 3M35A 1SQTA 3AW1A 3RXGA 1GI8B 1DT2A 3CENA 1C2LA 2OQUA 2G8TA 2WPJS 3TGIE 4XFQA 1C4V2 2FXRA 5GIBA 5FX5A 5FBIA 1A46H 1C2KA 1C2JA 3RMLH 2HOBA 2H5CA 1F92A 3L33A 4TPYA 4HGCA 1XM1A 3NRLA 1DICA 4Y8ZA 3KCGH 2BY5X 1YF4A 1AVXA 4OGYA 1ELAA 1DUEA 1VCPA 2OBQA 1H1BA 1UTQA 3F9GA 1C5VA 4MPXA 2HLDD 2BTCE 3SW2B 1YYY1 1O39A 5E0JA 2ZCLP 3OE7D 1TOMH 1LPGB 4GUXA 1GBMA 4BXWA 1SQOA 3RMNH 3A7WA 1TRNA 2PGBB 1A5GH 1CA0C 2Z7FE 2F43B 4TY6A 2FWWA 4LK4A 1O2ZA 3F3BA 5GNDA 3F9EA 1ZJKA 4X2YA 1GMCF 2P3UB 2FOBA 1GBDA 1RIWC 2QXIA 1V2LT 1ESBA 2IN2A 2F9OA 4JZ1A 3V7TA 1Z1IA 4DY7B 5A8XA 3SORA 2BDAA 2M2AA 1C5PA 3SNEA 4BAQB 4IC5A 1ZR0A 3AAUA 3MMGA 1S0RA 1UVUH 2ZCKP 1H9HE 3GY8A 4MTBA 2FOFA 4ABHA 1NRQH 1C2MA 2FYQA 3T5FH 4AOQA 3TK6A 1CA0B 1BMFD 3I29A 1HXEH 1O2GH 5GXPA 3F68H 1BTZA 2P94A 4YO9A 2UWOA 3OU0A 4RI0A 2R3UA 4DIHH 2VWLA 1VITH 3MHWU 3BG4C 3SQEE 1GHBG 1N6XA 5AF9H 1P8VC 5F6MA 4NGAH 3F9FA 2ZQ1A 3R3GB 5JDUB 5C0TA 1TALA 5DK1A 1O3JA 3PLBA 2F9VA 1W13U 1XXDA 3BEIB 1QBNA 2R0KA 1V2MT 2BXTH 1K1PA 3NUMA 1SGNE 2NU1E 5LH8A 3RXEA 4DT7B 2Z9LA 1YM0A 3H09A 4IBLH 1N6YA 1L1NA 2A4OA 4FUIA 4E7RG 1O5BB 3MU4A 1LPKB 1HAVA 2TRMA 1YKTA 4OS6A 4X1SU 1GMCG 1MCTA 1NBME 1P2NA 3BG4B 1C2HA 2VIOA 1K1LA 2ZKSA 4UEHH 4FUHA 1HAZB 4D76A 1C1OA 4AYYB 4Y8XA 1UCYH 1THSH 2PR3A 4YM9A 2OP9A 3QO6A 3N7DA 1DY9A 3LGIA 3VEQB 1SGFA 3LC5A 1FPHH 2RA0A 3EA8A 1BHXF 4A1VA 2VH6A 2SGDE 2PSXA 1TWXB 1GBTA 2YMSC 1TFXA 5AFZH 2JH5D 1F5KU 1G2MA 3PWCA 3FAOA 1A3BH 1GHYH 1UVPA 4NSYA 2GDEH 7ESTE 5IDKA 4NFFA 1BZXE 1XKAC 1O3BA 4MVNA 1EJAA 2GZ7A 1BMNH 2HLCA 3PLKA 1CBWC 3BIUH 3PYHA 2WHXA 1QQ4A 4YESB 3T25A 4NSVA 3RXCA 4AFSA 4AGJA 1VITG 2L6OA 4Z6AH 2SGEE 1TIOA 3QDZB 3EYDA 1VCWA 4ISNA 1WBGB 2UUJB 5FCRA 1FY3A 2GP9B 4I8HA 1YPHE 3S9CA 1S6LA 3C27B 1SGPE 3MU0A 1EFRD 1C1PA 1EX3A 1TE0A 2YMSB 4WY3A 3MYWA 1EAUA 3SYJA 1F5RA 4FUGA 3DCLA 1TNKA 1CGJE 2QXJA 3SV2H 1LQEA 1XVMA 2A4QA 2R9PA 1CBWB 2BVXH 2WPHS 3U8TH 1TGBA 2PTNA 4CRFA 1E79D 1BA8B 3QZQA 4D9QA 5FPYA 1ZOMA 1T8MA 3QWCH 3RM2H 1O3CA 1OS8A 3A8AA 3SU1A 4XBCA 4J2YB 2XBYA 4KTSA 1N8OC 1J15A 4AGKA 3F1SB 1O2IA 5L2ZH 3O8RA 3MU5A 1FY4A 3RMMH 1O2MA 2TGAA 2BDGA 1C2IA 2O8UA 2ANYA 1NRRH 1ZGIA 1C1QA 1C5LH 3TH3H 1XMNB 1O3FA 2FPZA 2W3IA 4K1SA 1G36A 3BEFB 1WOFA 3GDSA 5T1VA 2CV3A 2XC5A 1QJ6B 1NC6A 1OX1A 4UFDH 4AB9A 2QGRA 1QJ1B 2BZ6H 1FIWA 3DHKH 2VIDA 1TPSA 3L3TA 2ILNA 2PKSB 5A8YA 3M61U 2STBE 1XUJA 2GKVE 4JMYA 1SPJA 1ELFA 2AGIX 4Y11E 4A1TA 2B5TB 1RTLA 2HPQH 4WMDA 3IITA 5J4QA 3SU4A 3D23A 1IQIA 1QL8A 1TX7A 3BTGE 2O8LA 3MTYA 3LONA 3WWBA 1MTSA 2J9NA 4ZKSU 2GT8A 3M5MA 2QN5T 1UTNA 2ZDNA 1DXWA 1QFKH 5BRRE 3AASA 1HFDA 1C1MA 1DM4B 1EPTA 1NY22 1VR1H 1BITA 3UNSA 3ZZCA 2F9UA 6CHAC 3WY8A 5A2MH 1E36B 1QB1A 1FQ3A 1EUFA 1KLTA 3U69H 5JBAS 1F0UA 5DGJA 1YLDA 2SNVA 2FI4E 5ESBA 1GG6C 1ZPCA 1TMTH 2BX4A 4DW2U 5DO4H 2P3FH 1D3DB 1VCQA 1XX9A 1ETTH 3FFGA 1MAYA 2GDDA 3SHAH 2HNTE 3QX5H 1DX5M 1XUFA 2A2QH 2VU8E 4X2XA 2XC4A 4X6MA 2G51A 1Y5AT 1B0EA 1OWIA 3UWIA 5LGOA 1TRYA 1SR5C 2FLRH 6CHAB 4TT3D 1O37A 1ZHPA 2B9LA 2XCNA 1NBMD 1C5YB 2C8ZB 3ZZBA 5K0HA 2PUXB 3S7HB 1CU1A 4ZXXH 1C1TA 1LHEH 2ANKH 5SGAE 2A2XH 4O97A 1GG6B 1NRNH 5EXNA 4AN7A 3LGYA 4I8GA 1O5FH 1Z6JH 1WTHD 1NESE 1K1NA 2W7UA 1D6WA 2XWBI 4IN2A 1K2I1 2DE9A 2ANWA 2BQ6B