2SGAA

Electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords PROTEINASE A
publication title Electron density calculations as an extension of protein structure refinement. Streptomyces griseus protease A at 1.5 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 52
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1983-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA01
4X6NA 3U1IB 1EATA 4ABEA 1VJ9U 1DWDH 1BMAA 2ANWA 2K1QA 1UHBB 1UTMA 1XVOA 3DUXH 3JZ2B 1BBRH 2FX4A 3PMJA 3VXEH 4NWLA 2THFB 2FPZA 2SGFE 2A45B 1FQ3A 3F6UH 1QCPA 1IOEA 3RC5A 3BEUA 4ZUHA 1A0HB 2DE9A 3KN2A 1JRTA 3BTHE 2F83A 2FLRH 4BXSA 3GCHB 2LNCA 4ZKOU 2ZTXA 2OINA 1W8BH 2AS9A 1V2TT 2ZHDA 1O3GA 4GLYA 1O2SA 1CQQA 2O8MA 3CP7A 1DY9A 1GHAG 5A0CA 1PPGE 1IQKA 1BRUP 3EA8A 3KL6A 5C5NA 2OP9A 4XBCA 5GDSH 1AE5A 5L2ZH 5EXMA 1IQGA 2OD3B 1DXWA 1NRPH 1O2OA 4KTSA 2H6MA 4IC6A 1DM4B 2FOAA 1OKXA 4NCYA 4WH8A 4MNWA 4XFQA 4CHAC 2WYJA 1O3BA 4FVDA 5F03A 1RTKA 4LOYH 4WMDA 2JKHA 3UPEA 1YGCH 1H4WA 4ASHA 3PV4A 1TFXA 2ZQ2A 2ANMH 1P02A 4K8BA 3ZYDA 1ESAA 1A7SA 3A83A 4AN7A 1O30A 1SMFE 2HALA 2F9OA 5E2PA 4ABBA 4CRFA 3A80A 3AASA 3V13A 2ZNKH 5DP5A 1E34B 2FOGA 3K65B 5EG4A 1J16A 1V2RT 1TE0A 3MI4A 2Z9KA 1NRSH 2CHAB 1O3OA 2GV7A 5DP7A 1T8NA 2GMTB 2Y5GA 1ZTKA 4K3JA 4THNH 2ZPRA 2CF9H 1HUTH 1C2IA 1IHSH 3A87A 3SI4H 1CHOF 3TU7H 1TOCB 1YPGH 1THPB 1FY8E 3LH1A 1S6FA 1P2JA 4PROA 3RXIA 3QDZB 2QXJA 1TPSA 1D3TB 1QJ1B 1QQ4A 1DWBH 4E05H 5DG6A 2Y81A 1YPKH 4K1TA 3S7KB 1UCYK 6GCHF 1QURH 5IYTA 3RLWH 1G3DA 3VFEA 3LONA 4DIIH 3OSYA 2IN2A 1NU7B 1WSSH 1F5RA 2NU1E 2UUJB 3ATIA 1W10U 2SGDE 2AEIH 4NIYA 1GHXH 4BTUB 4B74A 1HV7A 2XRCA 1VGCC 2FESH 1TALA 1O3JA 3DFJA 3TH2H 4X8SH 4CRDA 1DS2E 3HKJB 2ZDVH 4ISOA 1EB1H 2ZDMA 4ZAEA 2I6QA 1FIWA 1W3CA 3IG6B 8KME2 1NM6A 2FWWA 1L0ZA 1LPKB 2Q1JA 3MO3A 3RP2A 2A7JA 1QRZA 4RSPA 1BRBE 1TQ0B 3U98H 5FPYA 2WPLS 8GCHF 3A7TA 1YPEH 5FCKA 3LJJA 2DUCA 4ZXYH 5HMAA 2EC9H 1FXYA 1V6DA 2OC1A 4Y10E 1YPHC 2ZU2A 2FOFA 3PMAB 5IDKA 1GL0E 2OC8A 4XSKU 1MD7A 2UWOA 3U8RH 2VB0A 4IMQA 2Q6DA 2G4TA 2BY9X 1K1PA 1C1OA 2SGQE 1ZPBA 1AB9C 4UEHH 5EPNA 2HGTH 1ARBA 1P04A 5AF9H 1G2MA 4E7RG 2BTCE 1DFPA 4WMFA 1C1TA 4ZHMU 1P9UA 1Y3VA 3M5OA 2BD2A 1GWAA 3RXCA 5SGAE 1ELDE 1NFYA 3A7VA 3GDVA 4K5ZA 3C1KA 1GG6C 3PTBA 2Z9JA 2G4UA 1O3PB 1GJ7B 2ZDAH 1Z7KA 2FLBH 1IQLA 1MBQA 1P2QA 1EPTA 1Y5UT 4ZKNU 1NESE 2Q6GA 1UO6A 3VB4A 3B8JA 3ZVDA 5JBTA 1GCDA 1T31A 1MTUA 1U6QA 3GCHC 1O39A 1HAZB 3BTGE 2R0KA 2VJ1A 1K1OA 1P0SH 2SGAA 3EYDA 2BY6X 3K9XB 1O3AA 1LO6A 1QBNA 3E90B 1MTWA 1SQOA 4X0WU 3BEIB 3QWCH 4DCDA 1CT4E 1GDUA 1S0RA 3MTYA 3OU0A 3IITA 1BJUA 2A7CA 1BTUA 1AUTC 3AW1A 3RDZA 4BANB 1ETRH 2ZHFH 1Y3WA 1KTTB 1C5SA 1ZJKA 2RDLA 3VB7A 2OCVB 1QB6A 4BAMB 1NU9A 1A3EH 1LKAA 2A5KA 2BD7A 3UNRA 2ZKSA 3LGTA 2XCFA 2WUCA 4DURA 1UTLM 3EGKH 2A5IA 3M37A 2OUAA 3SJOA 3T25A 1O3NA 3I29A 2A31A 3SJKA 1D3DB 1ZSJA 2QC2A 2O8TA 1E35B 2C8WB 1VCWA 2XBVA 2PGBB 1KTSB 1PPCE 1YC0A 3SU3A 4Q2KA 1AWHB 1MUEB 2GMTC 2PSXA 4O3TA 4X6OA 1CVWH 1DX5M 2VIPA 2P93A 1BUIA 1SGNE 5HM9A 1OPHB 2BVSH 5FX5A 1QNJA 1C1VH 1EOJA 4YOIA 5DP4A 2PKSB 2P95A 1TGSZ 1HJAB 4WMEA 5A2MH 1LHGH 1DWCH 3RMMH 4NZLA 1K28D 1EASA 1DANH 1Y5AT 2SNWA 1DVAH 2ZHQH 4CRGA 2J94A 3UOUA 1HIAB 4BAQB 1EJMA 2ZHWH 3V7TA 1XVMA 2AGEX 1D4PB 4Y7BA 4YOJA 5A0AE 1JOUB 4WH6A 1S85A 4FU8A 1KDQA 1O5CB 1P11E 1O34A 1P2IA 2V3OH 1DLEA 2A0QB 1MD8A 1F2SE 5GIBA 3SUEA 1GBLA 5CHAC 3SGAE 3LDXH 2WUBA 1ELAA 2BD3A 1DUAA 1BTXA 1C5OH 2NU0E 1GI5A 1UTPA 1C5PA 2HVXA 3MWIU 3RUOA 4NFEA 2Z94A 3S69A 1O2PA 4GHTA 4NSVA 2G8TA 1ZGIA 1MU8B 3RXOA 1GI6A 3MNBA 4TY6A 3RXQA 3LC5A 3GYMA 1SGPE 2J34A 1GJ5H 3S9CA 4LXBH 1C2JA 1ZHPA 5FCRA 2QXIA 1N8OB 3PMBB 3M7QA 1WUNH 2HRVA 3TJUA 5T6FA 4BTTB 3ODDA 1LQEA 1ANBA 3LGWA 1G32B 4X1SU 1GBIA 4MPWA 2FX6A 4IS5A 2A4RA 3P95A 1LQDB 1QRWA 2PUXB 2PKAA 1RGQA 3SW2B 4MNXA 3A86A 3BTWE 5TCAA 2ZZUH 7LPRA 1O3MA 1LHCH 1RFNA 1VITF 2IJOB 2FOCA 1HAHH 1QBOA 3A88A 1LMWB 3P17H 4CHAB 1A46H 1Y59T 1EAIA 1GDNA 1N6XA 3BG8A 2BD8A 1LPGB 1BTPA 1LTOA 1GJAB 1NPMA 3RXDA 2G52A 3GY8A 1V2LT 1BITA 2BMGB 1C4U2 1HYLA 1Y5BT 3D65E 3SV8A 3FVFB 2LPRA 3M7UA 2PTCE 2AIQA 4B2AA 1CU1A 1MKWH 4IN1A 1BHXB 1GMHF 2GZ7A 1OWDA 1O3LA 1GJ9B 2R3YA 3UWIA 1DE7H 1C1UH 1Z1IA 4WF8A 1O31A 1HFDA 5GCHF 1FY1A 3ZZCA 2VWOA 1F5KU 1GBDA 1T8LA 1HLTH 3BTKE 3AVZA 1GBEA 3FAOA 4WJG2 1TMBH 3A7ZA 1LDTT 1D9IA 2KAIA 2FS9A 1HDTH 1O2JA 2V3HH 1C2EA 2UWPA 2ZIQH 4D8NA 1GVKB 3BF6H 1GJ6A 1IHTH 3RU4D 1ZRBA 1BTHH 1CA0C 3D23A 3KQEA 4YZUA 1SVPA 1EZSC 3MU0A 4INKA 2BDHA 3V0XA 2ZCKP 3CS7A 5DJ7A 2FM2A 1A4WH 3DFLA 1UK3A 4GUXA 3O8DA 5I46H 1JMOH 4B76A 3FP6E 5LH8A 2EI6A 3RXGA 1SBWA 4D9QA 1LVOA 4DJZB 2O8UA 5JBCS 2ZU1A 1CHOG 1BA8B 5H4IB 1HAIH 1W7XH 3K2UA 4MPUA 5DKMA 3KQCA 2EA3A 2TIOA 1VGCB 4I7YH 4UE7H 1XUFA 1O2IA 5FX6A 3MHWU 4R0IA 1SGTA 1VCQA 4HTCH 1P2OA 1Q31A 5L6NH 1AUJA 1XKBC 1KDQB 1FUJA 1G2LA 3A8BA 2GCTC 6GCHG 3A8AA 1HXEH 5EXLA 3OTJE 5C5OA 4DW2U 2GT7A 2B8OH 4H42U 4AG1A 3B23B 4BOHA 4D9RA 4QT8C 2JETB 1NRQH 1V2QT 2BD4A 2BOHB 4JK5A 1GBAA 3L6PA 1HJAC 1AZ8A 4X6MA 3ZZ8A 2ZFSA 1V2MT 1H9IE 3RXKA 3A81A 3PTNA 2NWNA 1UCYE 2HOBA 4UFGH 1CO7E 3UR6A 3UNQA 1DY8A 3EA9A 1ANDA 1C1PA 1IQHA 1TB6H 1B7XB 1SSXA 2A4GA 2PR3A 2ODQA 1Z8GA 1SGCA 2ZCHP 5E0HA 1WU1A 1Y8TA 3UQOA 4IGDA 4JZ1A 1OSSA 1O33A 1C9TA 4U2WA 4B75A 8GCHG 3RXTA 2TGAA 3GOVB 2AERH 2PKAB 3I77A 1O5DH 5JPMH 4AFUA 1P01A 4HI3A 1Z1JA 3ZV8A 1ARCA 3OY6U 1YLDA 4OGXA 4A1XA 3UTUH 1ZMNA 2PHBA 1O2NA 3UQVA 1ETSH 1BQYA 5DO4H 4X6PA 3E0NB 4RN6A 2PTNA 3TGIE 1TBRH 4MTBA 1QFKH 2ZPSA 1O5FH 2O8WA 1DOJA 1IQEA 1HJ8A 1MCVA 1O37A 1PQ8A 3QO6A 1TRMA 3E6PH 1N8OC 1OYTH 3T62A 1EPTC 4JYTA 4KKDA 1EP5A 1AVGH 3STIA 3GY7A 1W12U 2XXLA 1FY4A 1W7GH 1MCTA 5FPTA 1XUIA 2HNTC 3ZZ5A 1EUFA 3Q3YA 4JYVH 1P2MA 1BRCE 4INLA 4NA9H 3TH4H 1Q2WA 1EB2A 2ESTE 2XC4A 4YTAA 4X2YA 1XXDA 4R8TB 1ZOMA 1F92A 4O9VA 4WVPE 1OWEA 1S5SA 3E91A 4AORA 2AMDA 1K22H 1BZXE 1A1RA 1T8MA 5FPSA 1NFWA 1KXCA 1KYNA 3VXFH 3KQDA 1EQ9A 3F9GA 3KQBA 2AGIX 1O2WA 5ETXA 2ZFFH 1OP0A 1TNIA 2G5NA 5HGGA 2QXGA 2ZFRH 1ID5H 2QV1A 2I6SA 1TRYA 5FXLA 1C2DA 2J4IA 1XX9A 1JIMA 2STBE 1XMNB 4DY7B 1BMMH 4JYUH 4CR5A 2W3KA 1AGJA 1EOLA 3CS0A 4ZKRU 1CBWB 4OS6A 3M3TA 3SU0A 1KIGH 4AFQA 5JDUB 1W0ZU 1QQUA 1DICA 2ZI2H 3F9EA 3R3GB 2GTBA 3QK1A 3Q3XA 4DOQA 3F9HA 1ZHRA 4NGAH 1MTNC 2FODA 2W5EA 4Y11E 5C1XA 2XBWA 1PPBH 1AQ7A 2BOKA 3VGCC 3D62A 1KLIH 1FNIA 3EQ0H 1VCPA 4ZKSU 1P2NA 4O3UA 1A0JA 1YCPK 2XBXA 4F49A 5LPFA 2UWLA 1ELBA 3A8DA 5F8ZA 1FY3A 2Y80A 4FUEA 1C5WB 5C1YA 1UTNA 3RMOH 2RCEA 2F9UA 4F4OC 2ZF0H 2BD9A 2ZWLH 5JBBS 3UOPA 3ZZDA 4A6LA 3RXMA 1PQ7A 5EQSA 3NK8A 1GJ8B 1NFUA 4ISHH 3KEEA 4AB8A 3TVJB 1V2UT 5AHGH 1SHYA 2A2QH 3PLBA 2ZQ1A 5CHAB 3GISB 3CENA 1EAWA 1P03A 8ESTE 3HATH 4FUGA 3ITIA 3GDSA 3A7WA 3M3SA 1WCZA 3UR9A 1K1IA 3HKIB 3TGKE 1ZRKA 1V3XA 3QTOH 3L33A 1MH0A 5J4QA 1FONA 4DVAU 1PQAA 5DP3A 1UCYH 2P3UB 1KXAA 3KHVA 1G3EA 4WWYA 1P09A 2FOBA 1QA7A 3SNEA 4YLQH 1RTLA 2JETC 2Z9GA 3NUMA 1G3CA 3MYWA 3T27A 1C5YB 1FN6A 3QGNB 3T5FH 1PYTD 2ZU4A 4Y76A 1BOQA 1ORFA 2G81E 3WY8A 4AG2A 3KNXA 4H4FA 5AVDA 1C1RA 3ZV9A 2BY5X 1A5HA 3PO1B 4DG4A 2PGQB 3FP8E 4BAKB 3EA7A 1NZQH 3VEQB 1TNLA 2D2DA 2B7DH 2ZTYA 3F1SB 2ZC9H 3SNDA 3SHAH 1OP2A 1RS0A 3M5LA 2OLGA 1TGTA 1UVOA 1HRTH 1C1WH 1PYTC 1P06A 2Z3EA 3URDA 1IQIA 1UTQA 2BX3A 3LGUA 4LK4A 5GWZA 1HAVA 1N1LA 1FZZA 4U01A 1HAPH 1SGYE 4LZ4B 2ULLA 3GCOA 1OOKB 1C4V2 2VNTA 1SPJA 1S0QA 2D26C 1FMGA 2P59A 2H2ZA 2ZCLP 1MAXA 3HK6B 1SOTA 3RU4E 1C5XB 4B2BA 1ACBE 2V35A 3BIVH 1IQNA 2PFEA 1F7ZA 2RA3A 2QF0A 1NN6A 2PLXA 1HAXB 4JK6A 4IW4E 3P6ZB 1O2ZA 1RIWB 5ESTE 4FUCA 4SGAE 4OS1A 1ANEA 4Y6DA 4NA7A 2G00A 4Y8YA 1TGCA 4X8VH 1VITG 2FTLE 4DT7B 1KXBA 1PFXC 2W26A 1V2OT 2P94A 2BDYA 1HNEE 1AFEH 1G9IE 2Z7FE 4AZ2B 4CR9A 2FOEA 2OQUA 1MTSA 3QGJA 3S9AA 2ZTZA 3SORA 3MNCA 3ZVCA 3P8GA 2W7SA 1O35A 1CA0B 1C5NH 5C67A 2BDBA 2TGPZ 5T6DA 2IPHA 1TA2A 2PV9B 4ABAA 2ILNA 3U69H 2H5DA 4K69A 1TNJA 1XM1A 1BRAA 1YPMH 1AU8A 1GMHG 5E0GA 1SL3A 2VIDA 2P8OB 1C5MD 3E1XB 3FZZA 3GY5A 3SU4A 5GCHG 3SU6A 3MH4A 2Y5FA 2Z6BD 4Z0KA 2QYIA 3JZ1B 1AMHA 2VVUA 3OYPA 4NSYA 1LVBA 1GMCF 1E36B 2VIQA 2GP9B 1D3PB 3QLPH 2OC0A 5HM2A 3ATKA 2QIQA 1AZZA 3GY3A 3Q76A 3Q3KA 1QJ7B 2BQ7B 1CBWC 2GCTB 2BY8X 4X2VA 7KMEH 3SU2A 1SGRE 1ELGA 2FXRA 1KXDA 2H9HA 4I33A 4GCHF 3I78A 5F8TA 3O8BA 1HJ9A 3SZNA 4Q80A 4K2YA 2CF8H 3TIUA 2WV4A 3UIRA 2Y7ZA 2ANYA 3NPSA 1K2I1 2UUYA 1LHEH 1TAWA 1GBCA 2DE8A 2J2UA 3ELAH 4JZFH 2F91A 2QCYA 1C4Y2 1ESTA 1QIXB 4CH2B 1HAGE 3ZZ7A 1L4DA 1P10A 3BG4C 5T6GA 1TX6A 3U8TH 1HAYB 1Z6EA 2ZGXH 3RXHA 1SGFG 3BSQA 1GVLA 2HNTE 1GI3A 2QF3A 1T8OA 1GHWH 1EZXC 1SC8U 3H7TA 1CT2E 3F9FA 2ZA5A 1GI8B 5A09A 3PLPA 2Y6TA 1SB1H 1TX8A 2FIRH 3BTME 4UD9H 4WY3A 2GT8A 2GV6A 4AYVB 3E8LA 3KF2A 4A92A 4K60A 1ZPCA 3SNCA 1F0RA 1GHYH 1XXFA 2CMYA 1QL9A 2CXVA 4OGYA 3Q77A 1H8DH 1P12E 2TGDA 1LHFH 1TPAE 2AIPA 2VVCA 1YPJH 1TRNA 4I8GA 4DIHH 2XW9A 1O0DH 1O3IA 1YYY1 3TK5A 1BCUH 1JXPA 3U8OH 4DGJA 3G01A 1CGIE 3QUMP 1GJCB 2J9NA 5C3NA 2A5AA 1ZHMA 1IQJA 1QY6A 1V2JT 1UTKA 1EPTB 4IC5A 3PO1C 4BNRA 1THSH 1HGTH 1YLCA 3SN8A 3BEFB 1XUJA 2ZFTA 2YOLA 5A8XA 1H8IH 3LOXA 1FAXA 2FS8A 1RD3B 5TJXA 2ZDNA 1O2VA 3NKKA 1AVXA 3MH6A 4FUBA 4CBOA 1HBTH 5EU8A 2Z9LA 2WINI 3FANA 5DK1A 2ZP0H 4YOGA 2BLWA 3UY9A 4H6SB 1C5TA 4MLFB 4X2XA 1MAYA 3SQHE 5BRRE 1DSTA 4Y71A 1M9UA 1O3KA 2Q6FA 1C2LA 1K1NA 1SQAA 4MPVA 3RM2H 1SLXB 2FI4E 2Z3DA 5JBAS 1ELVA 1CT0E 2FZZA 3BN9A 4O97A 2CV3A 2AGGX 1JIRA 1J8AA 1OWHA 2ZDLA 2UUKB 4RKOB 4FU7A 4GAWA 1JWTA 2GZ8A 4Y0ZE 5K0HA 5FAHA 1UHBA 3PM3A 1RIWC 4K1SA 1X7AC 1O2RA 4ZHLU 1C2GA 1O2QA 3SUFA 1C2MA 1LPZB 4KP0A 4AYYB 1L1GA 1QBVH 1C5LH 2YNAA 4FUJA 3EAJA 2G51A 3TNSA 1S6HA 1W11U 1VR1H 1SLWB 1LVYA 2HNTF 1P9SA 2BVRH 3BTEE 1C2HA 1MTNB 1MKXK 3OX7U 3QZQA 5EOKA 3AW0A 3MU1A 2RA0A 3RXLA 2ZU3A 3VGCB 1YPHE 2BZ6H 1GI0A 4A1TA 2C93B 3ZZ9A 1BMNH 2WYGA 1TLDA 1GDQA 1TNHA 2XYAA 3RM0H 1EZQA 4NIWA 1ZSLA 4MNYA 2QAAA 2R9PA 4CRCA 4Q7YA 1Z8RA 1EAXA 4NIVA 2ALPA 1O2LA 1TYNA 3VB6A 1MQ5A 2P3FH 1V2KT 2P8OC 4ABJA 1CSOE 2ZGHA 3D49H 3W95A 3DD2H 2BDAA 3HK3B 3NXPA 1WOFA 2XWBI 1PJPA 3KGPA 4AGKA 1C5RA 1O2MA 1BHXF 7GCHF 1F0SA 2HPQH 2AMQA 2O9QA 1V2WT 2WPMS 5AFYH 3BTDE 1Z8JB 4ABIA 5J4SA 4M7GA 1E37B 4NG9H 1AWFH 3TNTA 1TGNA 2C3SA 2HLCA 2GCHF 1KY9A 1GBTA 1W2KH 1RJXB 4ZMAH 3TH3H 2OBQA 1HXFH 3M3VA 4NFFA 3FZDA 3A82A 3S0NA 1OS8A 1OWIA 1F0TA 3SBKA 2A32A 1CE5A 1G30B 1KLJH 5FBEA 1GBFA 3ZZ6A 5ABWA 3LH3A 4JMYA 4Q7XA 4U32A 1C5VA 2VWLA 2TGTA 4INHA 2ZG0H 1WQSA 2TPIZ 2HWLB 1SI5H 1TBQH 1UVSH 3M5MA 4WXVA 3T2NA 3ZZBA 2BLQA 1LVMA 1HAOH 1MMJN 5L30H 3RMLH 3UREA 1J15A 4ZXXH 4UDWH 2VWMA 4YESB 3NZIA 1YBWA 4TWWA 4MNVA 2WPKS 1C1SA 2HPPH 2SNVA 3UWJH 2CJIA 1UTJA 2ZGBH 1GI4A 3SI3H 2D1JA 3E16B 1G3BA 2R3UA 1BBRK 1O2UA 1BDAA 2XC0A 3GCTF 3GDUA 1GBJA 2Y7XA 3MU4A 1GHBF 3RXPA 1KSNA 1NC6A 1Y3YA 5T3HA 1O2KA 1P57B 3QN7A 1JBUH 1MQ6A 2P3TB 4XOJA 3PLKA 4XE4A 4I8LA 2A1DB 1B0FA 4IBLH 2RG3A 1GI9B 2STAE 4TPYA 1DITH 4X1QU 2FYQA 2F9PA 1CGHA 1V2VT 3H7OA 1EKBB 1PPFE 3LGIA 3NCLA 1THRH 1L1JA 1FDPA 1GHZA 1ZMLA 4I8KA 1EJNA 5DP6A 2XNIA 3PB1E 2GKVE 1WYKA 1UJ1A 4ISNA 5DGJA 3P92A 4GSOA 4K8YA 2BY7X 1IQFA 1GJBB 2FDAA 3VB5A 2GDDA 1AFQB 1TWXB 3ODFA 1EZUC 5E8EH 2VGCB 1CGJE 2B9LA 1AIXH 3N7OA 1WV7H 3BTQE 4YT6H 1MU6B 2KAIB 1Z8IB 2GDEH 4VGCB 3K6YA 3K6ZA 3ZZ4A 4E7NA 1K1JA 1KXEA 1P3EA 2XBYA 2BB4A 3RXFA 2BDGA 2VIOA 1GMDF 1DDJA 1SOZA 1GBKA 1AO5A 2AFQB 3U1JB 2O8LA 1C1QA 3M35A 2AYWA 1GBHA 4AFSA 2FYRA 5TCCA 1SR5C 1BJVA 1TIOA 3PWBA 1TMUH 2VU8E 1QTFA 1AN1E 1J14A 4D7GA 3RXBA 5I25A 1NRNH 1UVUH 1S83A 2BD5A 2XTTB 1QL8A 3SV6A 2WPHS 4ISLA 2BYAX 1SQTA 1EXFA 2NU3E 4A5TS 4HFPB 4IMZA 5FBIA 3P8OA 1TA6A 3PROA 1ZLRA 2EI7A 1CHGA 5G4BA 1K21H 1EP6A 1H9LB 3HGPA 3SGQE 1D6RA 1HCGA 2WPJS 1OXGA 1NT1A 1O32A 1TOMH 2FOHA 3EE0B 3ESTA 3MH5A 1FPHH 4D76A 2SGEE 1W0YH 2F3CE 4X1PU 1GGDB 4FU9A 3SU5A 3SUDA 1DPOA 2ODYB 1UK2A 1TMTH 1GMCG 1C1NA 3M36A 4FUIA 1NFXA 1P05A 3FP7E 3BG4B 1ABIH 1AVWA 4B73A 1O3DA 3MU5A 1T7CA 2B0FA 2ZPQA 4J1YA 1TPPA 2Y82A 1K1LA 3SHCH 3MFJA 3Q00A 2C90B 2PSYA 3LKWA 4AGJA 5EW1H 1O5GH 4GCHG 1C1MA 1C2KA 2JH6D 2D8WA 1ELCA 6LPRA 3IWMA 1Y3UA 5JYIA 1EJAA 3ZZ3A 1ZSKA 4GHQA 4KTCA 2BDCA 1ELFA 1L4ZA 4X1RU 5F8XA 1GCTB 3PMHB 2AH4X 1O5BB 1NRRH 4Y8ZA 3U9AH 3A8CA 2F9BH 1YM0A 5F6MA 1YCPH 2VH6A 4ISIH 3LPRA 4OS5A 4CH8B 1MZDA 2W3IA 3SQEE 3ENSB 3MO6A 1T4UH 1TPOA 2W7UA 1FAKH 2BLOA 2BHGA 1QRXA 2FI3E 3A85A 4BAOB 4O03A 1GJ4H 4MVNA 1A0LA 4HGCA 1Q3XA 1ELEE 1A5GH 3URCA 1Y3XA 3BTTE 1Z71A 2GD4B 3TGJE 1D3QB 1HIAA 1ETTH 4UFEH 1VJAU 2BQWB 1F0UA 5GPIB 1HB0B 2ZGJA 3SV2H 2BXTH 1JRSA 1SG8B 2P16A 1LHDH 4CRBA 3NWUA 4TYDA 1ABJH 4I32A 1C5UA 1MZAA 2UUFB 1HPGA 1ZMJA 2TBSA 3TJNA 3EDXB 4KTUA 3RLYH 4MG3A 3TJVA 5EW2H 4HZHA 1OWJA 1QL7A 2J95A 4AB9A 1FLEE 1B5GH 2A7HA 2XCNA 1SGIB 3RXEA 3T28A 4Y0YE 1V2ST 5JB8S 1BB0B 4AX9H 1O38A 2A4OA 3P70B 1C5QA 1AE8H 1D6WA 1YF4A 2VWNA 5E2OA 1TONA 1QGFA 2FEQH 2G55A 2ZFPH 3ZVBA 2OTVA 1GHAF 1S84A 3PYHA 1GI2A 1PQ5A 5ESBA 2SGPE 5AFZH 2FI5E 2R0LA 1YCPM 2ZHEH 1IAUA 1WTHD 3RC6A 1FI8A 1QJ6B 3RXJA 1ZTLA 1AFQC 3PWCA 2IOTA 2VIVA 1GJDB 1Z6JH 2GVFA 1H9HE 1TGBA 2ASUB 2VGCC 4I8HA 5A8ZA 2H5CA 4XBBA 4VGCC 1C2FA 2FMJA 5FHTA 2XWAA 3HPTB 4OS7A 1NO9H 3ZVEA 2PWXA 3LC3A 1OWKA 1OYQA 5HYOA 3BIUH 1LCYA 2SFAA 3QTVH 1T4VH 3GY4A 3RXRA 3UNSA 2BLVA 4ZROA 2R2WU 3DHKH 2F9VA 1ZPZA 1BMLA 4ESTE 2BXUH 1BTZA 2M5TA 8LPRA 1UVTH 3ATLA 1ZZZA 1S81A 1PPEE 3SJ8A 1F5LA 1AY6H 2C8ZB 1TNGA 1W13U 3ATWA 2Y5HA 3LU9B 4CRAA 4GVUA 5GJ4B 4H6TA 1P2KA 1OX1A 6CHAB 1WBGB 3GY2A 1V2NT 2WPIS 4NWKA 3A89A 6ESTA 3RMNH 1DT2A 4YO9A 4JZIA 5C1UA 1SGFA 4TPIZ 1MBMA 7GCHG 4B1TA 3SV9A 1GGDC 2CHAC 1UK4A 1GBBA 1C5ZB 4AOQA 3W94A 1E38B 1O5AB 4OS2A 1ANCA 1INCA 4UFFH 1ZR0A 5DP8A 3MNXA 1KLTA 2QXHA 2GCHG 2XC5A 2QN5T 3MNSA 4WXIA 3MMGA 2ZO3H 2PUQH 1GBMA 2GX4A 2EEKA 3AAVA 1T32A 1ZTJA 2B5TB 5CE1A 2Z3CA 2OC7A 2QA9E 2VINA 3KIDU 3L3TA 2FP7B 1FJSA 1SGDE 1P3CA 1ELTA 2ZGCA 2V6NA 2JH0D 5LGOA 4B71A 1J17T 2V0BA 2WV5A 4RKJB 1UMAH 5K7RA 3BV9B 4B2CA 4Q7ZA 1O3HA 1O2YA 1PPZA 1XUKA 1GCTC 2C4FH 3GY6A 3GYLB 3MO9A 4XBDA 1HAVB 4I8JA 3RC4A 1YP9A 3P8FA 4Z6AH 1P8VC 1BIOA 1N6YA 3R0FA 1TBZH 3LGYA 2BDIA 3T29A 1A61H 3V3MA 4U30A 4NIXA 1WTGH 2OBOA 3SV7A 3M7TA 4KELA 3M5NA 2OQ5A 1DLKB 1GVZA 1WAYB 1ZGVA 4XDEA 1L2EA 3ZYEA 1NTPA 4ABDA 3UUZA 4A1VA 4CREA 3GCTG 1AD8H 1GHBG 1S82A 3E3TA 1MTVA 1H1BA 4JCNA 1AKSA 1TQ7B 1EX3A 4AFZA 3RXUA 4E06H 5C2ZA 5HXFA 1QA0A 4ABGA 3DT0H 2TRMA 5A0BA 4NA8A 1SFIA 3MH7A 3SOSA 4ZHAA 1O3CA 2C8YB 4X8UH 2BZAA 3HGNA 1O2TA 1O36A 7ESTE 1SGEE 1LKBA 4BAHB 1RRKA 1BBRE 2YNBA 2CN0H 1FIZA 2BX4A 1DXPA 1MKWK 3SO3A 3SJIA 3C27B 3SNBA 2ZU5A 4TWYA 1TNKA 2ANKH 5BPEA 3S7HB 3FFGA 3SJ9A 4UFDH 1K1MA 2FO9A 1GI1A 1O3EA 2C8XB 3UFAA 1O5EH 9ESTA 4GPGA 1IQMA 1B0EA 3V12A 1XUHA 3KCGH 4FUDA 5L2YH 4CBNA 3LIWA 2JH5D 4X8TH 1A3BH 5B6OA 2J38A 1QR3E 2AMPA 2ZDKA 2ZFQH 4FUFA 3TK9A 1SLVB 5A8YA 3E0PB 2ZECA 3RXAA 1ZJDA 1O2GH 4JZEH 3TITA 4UONA 5DP9A 1XUGA 3A7XA 4OS4A 5EXNA 2ODPA 3TLOA 1SGQE 2CGAA 3SUGA 1GMDG 1NS3A 1J9CH 2H9EH 3P8NA 5EQQA 1L1NA 1E0FD 5EPYA 1C9PA 1DUEA 4D7FA 1BT7A 2QGRA 1NY22 3O8CA 4YLUA 4MQAA 1SLUB 1RTFB 2QY0B 1KXFA 1A5IA 3STJA 5DPAA 2BQ6B 2Z9IA 9LPRA 4FXGH 3TJOA 5EODA 3ZVAA 3F68H 4Y7AA 3RXSA 4KGAA 1EAUA 3SU1A 5PTPA 1TABE 4LZ1H 1PPHE 4ABFA 1VZQH 3AAUA 2J92A 1ESBA 3SNAA 4MDSA 3ZVGA 4ABHA 2VIWA 1GHVH 5EQRA 1XKAC 3H5CB 1MKXH 1BTYA 1V2PT 1TX7A 5CMXH 4J2YB 3DA9B 1GL1A 1FY5A 2G5VA 2VH0A 3MOCA 1UVPA 1QB9A 4MPXA 4BXWA 1VITH 2GZ9A 2ZEBA 4TY7A 3M61U 4SGBE 1AI8H 1FPCH 1O2HA 4FUHA 4BTIB 1G37A 6CHAC 3VB3A 2NU2E 2EI8A 1DSUA 4FVBA 3S9BA 4ZH8A 3LJOA 2FTMA 1DWEH 1W14U 1FV9A 4A7IB 2FOMB 3VPKA 1QB1A 4K1EA 3TPIZ 3T26A 4X1NU 1GI7B 1A2CH 1BTWA 1O2XA 1CA8B 3GICB 4X2WA 2A4QA 2OXSA 1GPZA 1ZYOA 2PKSC 4YT7H 1K9OE 5GXPA 4IN2A 2H1UA 3LGVA 1YKTA 2R2MB 3ZVFA 4JZDH 1AKSB 4Y79A 4NZQA 3A7YA 4YM9A 1AB9B 1AHTH 1YPLH 5EGMA 1FN8A 3RU4T 3QZRA 2BVXH 3OY5U 3A84A 3ATMA 5JB9S 3B9FH 1UTOA 5LPEA 3TK6A 5E0JA 1G36A 1SHHB 2NU4E 5LPRA 4Y8XA 1O3FA 2A2XH 2GGVB 3SGBE 1OP8A 2VVVA 3QX5H 2F9NA 3GCNA 2ALVA 3BTFE 4I31A 1QHRB 1NROH 2H9TH 2BM2A 5C20A 3RXVA 2PW8H 1GG6B 1WQVH 1RXPA 3LT3A 3ZZAA 1SFQB 3O8RA 3MU8A
chains in the Genus database with same CATH superfamily
4X6NA 3U1IB 1EATA 4ABEA 1VJ9U 1DWDH 1BMAA 2ANWA 2K1QA 1UHBB 1UTMA 2EY4C 1XVOA 2RDEA 3DUXH 3JZ2B 1BBRH 2FX4A 3PMJA 3VXEH 4NWLA 2THFB 2FPZA 2SGFE 2A45B 1FQ3A 2WV9A 1QCPA 1IOEA 1SQRA 3F6UH 3BEUA 4ZUHA 3RC5A 1A0HB 2DE9A 3KN2A 1JRTA 3BTHE 2F83A 2FLRH 4BXSA 3GCHB 2LNCA 4ZKOU 2ZTXA 2OINA 1W8BH 2AS9A 1V2TT 3UB0A 2ZHDA 1O3GA 4GLYA 5CHBA 1O2SA 1CQQA 2O8MA 3CP7A 1DY9A 1GHAG 5A0CA 1PPGE 1IQKA 1BRUP 3EA8A 3KL6A 5C5NA 2OP9A 1YLNA 3N7DA 4XBCA 5GDSH 1AE5A 5L2ZH 5EXMA 1IQGA 2OD3B 1DXWA 1NRPH 1O2OA 4KTSA 2H6MA 4IC6A 1DM4B 2FOAA 1OKXA 4NCYA 4P02A 4WH8A 4MNWA 4XFQA 4CHAC 2WYJA 1O3BA 2GJGA 4FVDA 5F03A 1RTKA 2LELA 4LOYH 4WMDA 2JKHA 3UPEA 1YGCH 1H4WA 4ASHA 3PV4A 1TFXA 2ZQ2A 2ANMH 1P02A 4K8BA 3ZYDA 1ESAA 1A7SA 3A83A 4AN7A 1O30A 1SMFE 2HALA 2F9OA 1WXRA 5E2PA 3W1EA 4ABBA 4CRFA 3A80A 3AASA 3V13A 2ZNKH 5DP5A 1K0HA 1E34B 2FOGA 3K65B 5EG4A 1J16A 1V2RT 1TE0A 3MI4A 2Z9KA 1NRSH 2CHAB 1O3OA 2GV7A 5DP7A 1T8NA 2GMTB 2Y5GA 1ZTKA 4K3JA 4THNH 2ZPRA 2CF9H 1HUTH 1C2IA 1IHSH 3A87A 3UAIC 3SI4H 1CHOF 3TU7H 1TOCB 5B6LA 1YPGH 4F48B 1THPB 1FY8E 3LH1A 1S6FA 1P2JA 4PROA 3RXIA 3QDZB 2QXJA 1TPSA 1D3TB 1QJ1B 1QQ4A 2KR7A 1DWBH 4E05H 5DG6A 2Y81A 1YPKH 4K1TA 3S7KB 1UCYK 6GCHF 1QURH 5IYTA 3RLWH 1G3DA 3VFEA 4P00A 3LONA 4DIIH 3OSYA 2IN2A 1NU7B 1WSSH 1F5RA 2NU1E 2UUJB 3ATIA 1W10U 2SGDE 2AEIH 4NIYA 1GHXH 4BTUB 4B74A 1HV7A 2XRCA 1VGCC 2FESH 1TALA 1O3JA 3DFJA 3TH2H 4X8SH 4CRDA 1DS2E 3HKJB 2ZDVH 4ISOA 1EB1H 2ZDMA 4ZAEA 2I6QA 1FIWA 1W3CA 3IG6B 8KME2 1NM6A 2FWWA 1L0ZA 1LPKB 2Q1JA 3MO3A 3RP2A 2A7JA 1QRZA 4RSPA 1BRBE 1TQ0B 3U98H 5FPYA 2WPLS 8GCHF 3A7TA 1YPEH 5FCKA 3LJJA 2DUCA 4ZXYH 5HMAA 2EC9H 1FXYA 1V6DA 2OC1A 4Y10E 1YPHC 2ZU2A 2FOFA 3PMAB 5IDKA 1GL0E 2OC8A 4XSKU 1EFRD 1MD7A 2UWOA 3U8RH 2VB0A 4IMQA 2Q6DA 2G4TA 2BY9X 1K1PA 1W0KD 1C1OA 2K8IA 2SGQE 1ZPBA 1AB9C 4UEHH 5EPNA 2HGTH 1ARBA 1P04A 5AF9H 1G2MA 4E7RG 2BTCE 1DFPA 4WMFA 1C1TA 5F53A 4ZHMU 1P9UA 1Y3VA 3M5OA 2BD2A 1GWAA 3RXCA 5SGAE 1ELDE 1NFYA 3A7VA 3GDVA 4K5ZA 3C1KA 1GG6C 3PTBA 2Z9JA 2G4UA 1O3PB 1GJ7B 2ZDAH 1Z7KA 2FLBH 1IQLA 1MBQA 3DCLA 1P2QA 1EPTA 1Y5UT 4ZKNU 1NESE 2Q6GA 1UO6A 3VB4A 3B8JA 3ZVDA 5JBTA 1GCDA 1T31A 1MTUA 1U6QA 3GCHC 1O39A 1HAZB 3WW7A 3BTGE 2R0KA 2VJ1A 1K1OA 1P0SH 2SGAA 3EYDA 2BY6X 3K9XB 1O3AA 1LO6A 1QBNA 3E90B 4FOUC 1MTWA 1SQOA 4X0WU 3BEIB 3QWCH 4DCDA 1CT4E 1GDUA 1S0RA 3MTYA 3OU0A 4DT4A 3IITA 1BJUA 2KCPA 2JIZD 2A7CA 1BTUA 1AUTC 3AW1A 3RDZA 4BANB 1ETRH 2ZHFH 2M2AA 1Y3WA 1KTTB 1C5SA 1ZJKA 2RDLA 3VB7A 2OCVB 1QB6A 4BAMB 1NU9A 1A3EH 1LKAA 2A5KA 2BD7A 3UNRA 2ZKSA 3LGTA 2XCFA 2WUCA 4DURA 1UTLM 3EGKH 2A5IA 3M37A 2OUAA 3SJOA 3T25A 1O3NA 3I29A 2A31A 3SJKA 1D3DB 1ZSJA 2QC2A 2O8TA 1E35B 2C8WB 1VCWA 2XBVA 2PGBB 1KTSB 1PPCE 1YC0A 3SU3A 4Q2KA 1AWHB 1MUEB 2GMTC 2PSXA 4O3TA 4X6OA 1CVWH 1DX5M 2VIPA 2P93A 1BUIA 1SGNE 5HM9A 1OPHB 2BVSH 5FX5A 1QNJA 1C1VH 1EOJA 4M9FA 4YOIA 4HG6A 5DP4A 2PKSB 2P95A 1TGSZ 1HJAB 4WMEA 5A2MH 4Z1MD 1LHGH 1DWCH 3RMMH 4NZLA 1K28D 1EASA 1DANH 1Y5AT 2SNWA 1DVAH 2ZHQH 4CRGA 2J94A 3UOUA 1HIAB 4BAQB 1EJMA 2ZHWH 3V7TA 1XVMA 2AGEX 1D4PB 4Y7BA 4YOJA 5A0AE 1JOUB 4WH6A 1S85A 4FU8A 1KDQA 1O5CB 1P11E 1O34A 1P2IA 2V3OH 1DLEA 2A0QB 1MD8A 1F2SE 5GIBA 3SUEA 1GBLA 5CHAC 3SGAE 3LDXH 2WUBA 3F2HA 1ELAA 2BD3A 1DUAA 1BTXA 1C5OH 2NU0E 1GI5A 1UTPA 1C5PA 2HVXA 3MWIU 3RUOA 2WHXA 4NFEA 2Z94A 3S69A 1O2PA 4GHTA 4NSVA 2G8TA 1ZGIA 1MU8B 3RXOA 1GI6A 3MNBA 4TY6A 3RXQA 3LC5A 3SYJA 3GYMA 1SGPE 2J34A 2XOKD 1GJ5H 3S9CA 4LXBH 1C2JA 1ZHPA 5FCRA 2QXIA 1N8OB 3PMBB 3M7QA 1WUNH 2HRVA 1OHHD 3TJUA 5T6FA 4BTTB 3ODDA 1LQEA 1ANBA 3LGWA 1G32B 4X1SU 2AHME 1GBIA 4MPWA 3PRBA 2FX6A 4IS5A 2A4RA 3P95A 1LQDB 1QRWA 2PUXB 2PKAA 1RGQA 3FN8A 2JJ1D 3SW2B 4MNXA 3A86A 3BTWE 5TCAA 2ZZUH 7LPRA 1O3MA 1LHCH 1RFNA 1VITF 2IJOB 2FOCA 1HAHH 1QBOA 2F4LA 3A88A 1LMWB 3P17H 4CHAB 1A46H 1Y59T 1EAIA 1GDNA 1N6XA 3BG8A 2BD8A 1LPGB 1BTPA 1LTOA 1GJAB 1NPMA 3RXDA 2G52A 3GY8A 1V2LT 1BITA 2BMGB 1C4U2 1HYLA 1Y5BT 3D65E 3SV8A 3FVFB 2LPRA 3M7UA 2PTCE 2AIQA 4B2AA 1CU1A 1MKWH 4IN1A 1BHXB 1GMHF 2GZ7A 1OWDA 3FKSD 1O3LA 1GJ9B 2R3YA 3UWIA 1DE7H 1C1UH 1Z1IA 4WF8A 1O31A 1HFDA 5GCHF 1FY1A 3ZZCA 2VWOA 5EIYA 1F5KU 1GBDA 1T8LA 1HLTH 3BTKE 3AVZA 1GBEA 3FAOA 4WJG2 1TMBH 3A7ZA 5CDFE 1LDTT 1D9IA 2KAIA 2FS9A 1HDTH 1O2JA 4ACAA 2V3HH 1C2EA 2UWPA 2ZIQH 4D8NA 1GVKB 2KCOA 3BF6H 2W6JD 1GJ6A 1IHTH 3RU4D 1ZRBA 1BTHH 1CA0C 3D23A 3KQEA 4YZUA 1SVPA 1EZSC 3MU0A 4INKA 2BDHA 3V0XA 2ZCKP 3CS7A 5DJ7A 2FM2A 1A4WH 3DFLA 1UK3A 4GUXA 3H09A 3O8DA 5I46H 2RFKC 2CK3D 1JMOH 4B76A 3FP6E 5LH8A 2EI6A 3RXGA 1SBWA 4D9QA 1LVOA 4DJZB 2O8UA 5JBCS 2ZU1A 1CHOG 1BA8B 5H4IB 1HAIH 1W7XH 3K2UA 4MPUA 5DKMA 3KQCA 2EA3A 2TIOA 1VGCB 4I7YH 4UE7H 1XUFA 1O2IA 5FX6A 3MHWU 4R0IA 1SGTA 1VCQA 4HTCH 1P2OA 1Q31A 5L6NH 1AUJA 1UW7A 1XKBC 1KDQB 1FUJA 1G2LA 3A8BA 2GCTC 6GCHG 3A8AA 1HXEH 5EXLA 3GS9A 3OTJE 5C5OA 4DW2U 2GT7A 2B8OH 4H42U 4AG1A 3B23B 4BOHA 4D9RA 4QT8C 2JETB 1NRQH 1V2QT 2BD4A 2BOHB 4JK5A 1GBAA 3L6PA 4RI0A 1HJAC 1AZ8A 4X6MA 3ZZ8A 2ZFSA 1V2MT 1H9IE 3RXKA 3A81A 3PTNA 2NWNA 1UCYE 2HOBA 4UFGH 4ZCNA 1CO7E 3UR6A 3UNQA 1DY8A 3EA9A 1ANDA 1C1PA 1IQHA 1TB6H 1B7XB 1SSXA 2A4GA 2PR3A 2ODQA 1Z8GA 1SGCA 2ZCHP 5E0HA 1WU1A 1Y8TA 3UQOA 4IGDA 4JZ1A 1OSSA 1O33A 1C9TA 4U2WA 4B75A 8GCHG 3RXTA 2TGAA 3GOVB 2AERH 2PKAB 3I77A 2IJD1 1O5DH 4I86A 5JPMH 4AFUA 1P01A 4HI3A 1Z1JA 5KGOA 1ARCA 3ZV8A 1MABB 3OY6U 1YLDA 4OGXA 4A1XA 3UTUH 1ZMNA 2PHBA 1O2NA 3UQVA 1ETSH 1BQYA 5DO4H 4X6PA 3E0NB 4RN6A 2PTNA 3TGIE 1TBRH 4MTBA 1QFKH 2ZPSA 1O5FH 2O8WA 1DOJA 1IQEA 1HJ8A 1MCVA 1O37A 1PQ8A 3QO6A 5HKKD 4TSFD 1TRMA 2QF4A 3E6PH 1N8OC 1OYTH 3T62A 1EPTC 4JYTA 4KKDA 1EP5A 1AVGH 3STIA 3GY7A 1W12U 2XXLA 1FY4A 1W7GH 1E79D 1MCTA 5FPTA 1XUIA 2HNTC 3ZZ5A 1EUFA 3Q3YA 4JYVH 1P2MA 1BRCE 1NBMD 4INLA 4NA9H 3TH4H 1Q2WA 1EB2A 2ESTE 2XC4A 4YTAA 4X2YA 1XXDA 4R8TB 1ZOMA 1F92A 4O9VA 4WVPE 1OWEA 1S5SA 3E91A 4AORA 2AMDA 1K22H 1BZXE 2F43B 1A1RA 1T8MA 5FPSA 1NFWA 1KXCA 5EJLA 1KYNA 3VXFH 3KQDA 1EQ9A 3F9GA 3KQBA 2AGIX 1O2WA 5ETXA 2ZFFH 1OP0A 1TNIA 2G5NA 2K0QA 5HGGA 2QXGA 2ZFRH 1ID5H 2QV1A 2I6SA 1TRYA 5FXLA 1C2DA 2J4IA 4F55A 1XX9A 1JIMA 2STBE 1XMNB 4DY7B 1BMMH 4JYUH 4CR5A 3PV2A 2W3KA 1AGJA 1EOLA 3CS0A 4ZKRU 1CBWB 4OS6A 3M3TA 3SU0A 1KIGH 4AFQA 5JDUB 1W0ZU 1QQUA 1DICA 2ZI2H 3F9EA 3R3GB 2GTBA 3QK1A 3Q3XA 4DOQA 3F9HA 1ZHRA 4NGAH 1MTNC 2FODA 2W5EA 4Y11E 5C1XA 1BMFD 2XBWA 1PPBH 1AQ7A 2BOKA 3VGCC 3D62A 1KLIH 1FNIA 3EQ0H 1VCPA 4ZKSU 1P2NA 4O3UA 1A0JA 1YCPK 2XBXA 4F49A 5LPFA 2UWLA 1ELBA 3A8DA 5F8ZA 1FY3A 2Y80A 4FUEA 1C5WB 5C1YA 1UTNA 3RMOH 2RCEA 2F9UA 4F4OC 2ZF0H 2BD9A 2ZWLH 5JBBS 3UOPA 3ZZDA 4A6LA 3RXMA 1PQ7A 5EQSA 3NK8A 2WZQA 1GJ8B 1NFUA 4ISHH 3KEEA 4AB8A 3TVJB 1V2UT 5AHGH 1SHYA 2A2QH 3PLBA 2ZQ1A 5CHAB 3GISB 3CENA 1EAWA 1P03A 8ESTE 3HATH 4FUGA 3ITIA 3GDSA 3A7WA 3M3SA 1WCZA 3UR9A 1K1IA 3HKIB 3TGKE 1ZRKA 1V3XA 3QTOH 3L33A 1MH0A 5J4QA 1FONA 4DVAU 1PQAA 5DP3A 1UCYH 2P3UB 1KXAA 3KHVA 1G3EA 4WWYA 1P09A 2FOBA 1QA7A 5HIYA 3SNEA 1E1QD 4YLQH 3U28C 4Q4LA 1RTLA 2JETC 2Z9GA 3NUMA 1KMHB 1G3CA 3MYWA 3T27A 1C5YB 1FN6A 3QGNB 3T5FH 1PYTD 2ZU4A 4Y76A 1BOQA 1ORFA 2G81E 3WY8A 4AG2A 3KNXA 4H4FA 5AVDA 1C1RA 3ZV9A 2BY5X 1A5HA 3PO1B 4DG4A 2PGQB 3FP8E 4BAKB 3EA7A 1NZQH 3VEQB 1TNLA 2D2DA 2B7DH 2ZTYA 3F1SB 2ZC9H 3SNDA 3SHAH 1OP2A 1RS0A 3M5LA 2OLGA 1TGTA 1UVOA 1HRTH 1C1WH 1PYTC 1P06A 2Z3EA 3URDA 1IQIA 1UTQA 2BX3A 3LGUA 4LK4A 5GWZA 1HAVA 1N1LA 1W0JD 1FZZA 4U01A 1HAPH 1SGYE 4LZ4B 2ULLA 3GCOA 1OOKB 1C4V2 2VNTA 1SPJA 1S0QA 2D26C 1FMGA 2P59A 2H2ZA 2ZCLP 1MAXA 3HK6B 1SOTA 3RU4E 1C5XB 4B2BA 1ACBE 2V35A 3BIVH 1IQNA 2PFEA 1F7ZA 2QF5A 2RA3A 2QF0A 1NN6A 2PLXA 1HAXB 4JK6A 4IW4E 3P6ZB 1O2ZA 1RIWB 5ESTE 4FUCA 4SGAE 4OS1A 1ANEA 4Y6DA 4NA7A 2G00A 4Y8YA 1TGCA 4X8VH 5DSFA 1VITG 2FTLE 4DT7B 1KXBA 1PFXC 2W26A 4TT3D 1V2OT 2P94A 2BDYA 2V3MA 1HNEE 1AFEH 3KQ5A 1G9IE 2Z7FE 1E1RD 4AZ2B 4CR9A 2FOEA 1QZ8A 1MTSA 2OQUA 3QGJA 3S9AA 2ZTZA 3SORA 3OEED 3MNCA 3ZVCA 3P8GA 2W7SA 1O35A 1CA0B 1C5NH 5C67A 2BDBA 2TGPZ 5T6DA 4B6FA 2IPHA 1TA2A 2PV9B 4ABAA 2ILNA 3U69H 2H5DA 4RT0A 4K69A 1TNJA 2J98A 1XM1A 1BRAA 1YPMH 1AU8A 1GMHG 5E0GA 5C0UA 1SL3A 2VIDA 2P8OB 1C5MD 3E1XB 3FZZA 3GY5A 3SU4A 5GCHG 3SU6A 3MH4A 2Y5FA 2Z6BD 4Z0KA 2QYIA 3JZ1B 1AMHA 2VVUA 3OYPA 4NSYA 1LVBA 1GMCF 1E36B 2VIQA 2GP9B 1D3PB 3QLPH 2OC0A 5HM2A 3ATKA 2QIQA 1AZZA 3GY3A 3Q76A 3FO8D 3Q3KA 1QJ7B 2BQ7B 1CBWC 2GCTB 2BY8X 4X2VA 7KMEH 3SU2A 1SGRE 1ELGA 2V7QD 2FXRA 1KXDA 2H9HA 4I33A 4GCHF 3I78A 2J97A 2PP6A 5F8TA 3O8BA 1HJ9A 3SZNA 4Q80A 4K2YA 2CF8H 3TIUA 2WV4A 3UIRA 2Y7ZA 2ANYA 3NPSA 1K2I1 2UUYA 1LHEH 1TAWA 1GBCA 2DE8A 2J2UA 3ELAH 4JZFH 2F91A 2QCYA 1C4Y2 1ESTA 1QIXB 4CH2B 1HAGE 3ZZ7A 1L4DA 1P10A 3BG4C 5T6GA 1TX6A 3U8TH 1HAYB 1Z6EA 2ZGXH 1SKYE 3RXHA 1SGFG 3BSQA 1GVLA 2HNTE 1GI3A 2QF3A 5KEDA 1T8OA 1GHWH 1EZXC 1SC8U 3H7TA 1CT2E 3F9FA 2ZA5A 1GI8B 5A09A 3PLPA 2Y6TA 1SB1H 1TX8A 2FIRH 3BTME 4UD9H 4WY3A 2GT8A 2GV6A 4AYVB 3E8LA 3KF2A 4A92A 3N99A 4K60A 1ZPCA 3SNCA 1F0RA 1GHYH 1XXFA 2CMYA 1QL9A 1H8HD 2CXVA 4OGYA 3Q77A 1H8DH 1P12E 2TGDA 1LHFH 1TPAE 2AIPA 2VVCA 1YPJH 1TRNA 3OEHD 1NBME 4I8GA 4DIHH 2XW9A 1O0DH 1O3IA 1YYY1 3TK5A 1BCUH 1JXPA 3U8OH 4DGJA 3G01A 1CGIE 3QUMP 1GJCB 2J9NA 5C3NA 2A5AA 1ZHMA 1IQJA 1QY6A 1V2JT 1UTKA 1EPTB 4IC5A 3PO1C 4BNRA 1THSH 1HGTH 1YLCA 3F0PA 3SN8A 3BEFB 1XUJA 2ZFTA 2YOLA 5A8XA 1H8IH 3LOXA 2HLDD 1FAXA 2FS8A 1RD3B 5TJXA 2ZDNA 1O2VA 3NKKA 1AVXA 3MH6A 4FUBA 4CBOA 1HBTH 5EU8A 2Z9LA 2WINI 3FANA 5DK1A 2ZP0H 4YOGA 2BLWA 3UY9A 4H6SB 1C5TA 4MLFB 4X2XA 1MAYA 3SQHE 5BRRE 3OTPA 1DSTA 4Y71A 1M9UA 1O3KA 2Q6FA 1C2LA 1K1NA 2HVYB 1SQAA 4MPVA 3RM2H 1SLXB 2FI4E 2Z3DA 5JBAS 4Q63A 1ELVA 1CT0E 2FZZA 3BN9A 4O97A 2CV3A 2AGGX 1JIRA 1J8AA 1OWHA 2ZDLA 2KZ4A 2UUKB 4RKOB 4FU7A 4GAWA 1JWTA 2GZ8A 4Y0ZE 3N7EA 5K0HA 5FAHA 1UHBA 3PM3A 1RIWC 4K1SA 1X7AC 1O2RA 4ZHLU 1C2GA 1O2QA 3SUFA 1C2MA 1LPZB 4KP0A 4AYYB 1L1GA 1QBVH 1C5LH 2YNAA 4FUJA 3EAJA 2G51A 3TNSA 1S6HA 1W11U 3VG8A 1VR1H 1SLWB 1LVYA 2HNTF 1P9SA 2BVRH 3BTEE 1C2HA 1MTNB 1MKXK 3OX7U 3QZQA 5EOKA 3AW0A 3MU1A 2RA0A 3RXLA 3MQKC 2ZU3A 3VGCB 1YPHE 2BZ6H 1GI0A 4A1TA 2C93B 3ZZ9A 1BMNH 2WYGA 1TLDA 1GDQA 1TNHA 2XYAA 3RM0H 1EZQA 4NIWA 1ZSLA 4MNYA 2QAAA 2R9PA 4CRCA 4Q7YA 1Z8RA 1EAXA 4NIVA 2ALPA 1O2LA 1TYNA 3VB6A 1MQ5A 2P3FH 1V2KT 2P8OC 4ABJA 1CSOE 2ZGHA 3D49H 3W95A 3DD2H 2BDAA 3HK3B 3NXPA 1WOFA 2XWBI 1PJPA 3KGPA 4AGKA 1C5RA 1O2MA 1BHXF 7GCHF 1F0SA 2HPQH 2AMQA 2O9QA 5C94A 1V2WT 2WPMS 5AFYH 3BTDE 1Z8JB 4ABIA 5J4SA 2W6ID 4M7GA 1E37B 4NG9H 1AWFH 3TNTA 1TGNA 2C3SA 2HLCA 2GCHF 1KY9A 1GBTA 1W2KH 1RJXB 4ZMAH 3TH3H 1HXFH 2OBQA 3M3VA 4NFFA 3FZDA 3A82A 3S0NA 1OS8A 2L74A 1OWIA 2JDID 1F0TA 3SBKA 2A32A 1CE5A 1G30B 1KLJH 5FBEA 1GBFA 3ZZ6A 5ABWA 3LH3A 4JMYA 4Q7XA 4U32A 1C5VA 2VWLA 2TGTA 4INHA 2ZG0H 1WQSA 2TPIZ 2HWLB 1SI5H 1TBQH 1UVSH 3M5MA 4WXVA 3T2NA 3ZZBA 2BLQA 1LVMA 1HAOH 1MMJN 3F2FA 5L30H 3RMLH 3UREA 1J15A 4ZXXH 4UDWH 2VWMA 4YESB 3NZIA 4B6EA 1YBWA 4TWWA 4MNVA 2WPKS 1C1SA 2HPPH 2SNVA 3UWJH 2CJIA 1UTJA 2ZGBH 1GI4A 3SI3H 2D1JA 3E16B 1G3BA 2R3UA 1BBRK 1O2UA 1BDAA 2XC0A 3GCTF 3GDUA 5C17A 1GBJA 2Y7XA 3MU4A 1GHBF 3RXPA 1KSNA 1NC6A 1Y3YA 5T3HA 1O2KA 1P57B 3QN7A 3DSGA 1JBUH 1MQ6A 2P3TB 4XOJA 3PLKA 5EJ1A 4XE4A 4I8LA 2A1DB 1B0FA 4IBLH 2RG3A 1GI9B 2STAE 4TPYA 1DITH 4X1QU 2FYQA 2F9PA 3KYGA 1CGHA 5EJZA 1V2VT 3H7OA 1EKBB 1PPFE 3LGIA 3NCLA 1THRH 1L1JA 1FDPA 1GHZA 1ZMLA 4I8KA 1EJNA 5DP6A 1S6LA 2XNIA 3PB1E 2GKVE 1WYKA 1UJ1A 4ISNA 5DGJA 3P92A 4GSOA 4K8YA 2BY7X 1IQFA 1GJBB 2FDAA 3VB5A 2GDDA 1AFQB 1TWXB 3ODFA 1EZUC 5E8EH 2VGCB 1CGJE 3SZEA 1VKYA 2B9LA 3CNRA 1AIXH 3N7OA 1WV7H 3BTQE 4YT6H 1MU6B 2KAIB 1Z8IB 2GDEH 4VGCB 3K6YA 3K6ZA 3ZZ4A 4E7NA 1K1JA 1KXEA 1P3EA 2XBYA 2BB4A 3RXFA 2BDGA 2VIOA 1GMDF 1DDJA 1SOZA 1GBKA 1AO5A 2AFQB 2IPQX 5T1VA 2O8LA 3U1JB 1C1QA 3M35A 4ASUD 2AYWA 1GBHA 4AFSA 2FYRA 5TCCA 1SR5C 1BJVA 1TIOA 3PWBA 1TMUH 2VU8E 1QTFA 1AN1E 1J14A 4D7GA 3RXBA 5DN6D 5I25A 1NRNH 1UVUH 1S83A 2BD5A 2L6OA 1QL8A 2XTTB 3SV6A 2WPHS 4ISLA 2BYAX 1SQTA 1EXFA 2NU3E 4A5TS 4HFPB 4ACBA 4IMZA 5FBIA 1YY3A 3P8OA 1TA6A 3PROA 1ZLRA 2EI7A 1CHGA 5G4BA 1K21H 1EP6A 2QE7D 1H9LB 3HGPA 3SGQE 1D6RA 2YMSB 1HCGA 2WPJS 1OXGA 1NT1A 1O32A 1TOMH 2FOHA 3EE0B 3ESTA 3MH5A 1FPHH 4D76A 2SGEE 1W0YH 2F3CE 4X1PU 3F0OA 1GGDB 4FU9A 3SU5A 3SUDA 1DPOA 2ODYB 1UK2A 1TMTH 1GMCG 1C1NA 3M36A 4FUIA 1NFXA 1P05A 3FP7E 3OAAD 3BG4B 1ABIH 1AVWA 4B73A 5IK2D 1O3DA 3MU5A 1T7CA 2B0FA 3WWBA 1YWUA 2ZPQA 4J1YA 1TPPA 2Y82A 1K1LA 3SHCH 3MFJA 3Q00A 2C90B 2PSYA 4YXWD 3LKWA 4AGJA 5EW1H 1O5GH 4GCHG 1C1MA 1C2KA 2JH6D 2D8WA 1ELCA 6LPRA 4RT1A 3IWMA 1Y3UA 5JYIA 1EJAA 3ZZ3A 1ZSKA 4GHQA 4KTCA 2BDCA 1ELFA 1L4ZA 4X1RU 5F8XA 1GCTB 3PMHB 2AH4X 1O5BB 1NRRH 4Y8ZA 3U9AH 3A8CA 2F9BH 1YM0A 5F6MA 1YCPH 2VH6A 4ISIH 3LPRA 4OS5A 4CH8B 1MZDA 5C0TA 2W3IA 3SQEE 3ENSB 3MO6A 1T4UH 1TPOA 2W7UA 1FAKH 2BLOA 2BHGA 1QRXA 2JJ2D 2FI3E 2KCYA 3A85A 4BAOB 4O03A 1GJ4H 4MVNA 1A0LA 4HGCA 3ZIAD 1Q3XA 1ELEE 1A5GH 3URCA 1Y3XA 3BTTE 1Z71A 2GD4B 3TGJE 1D3QB 1HIAA 2VBCA 1ETTH 4UFEH 3DSOA 1VJAU 2BQWB 1F0UA 5GPIB 1HB0B 2ZGJA 3SV2H 2BXTH 1JRSA 1SG8B 2P16A 1LHDH 4CRBA 3NWUA 4TYDA 1ABJH 2WSSD 4I32A 1C5UA 1MZAA 2UUFB 1HPGA 1ZMJA 2KM0A 2TBSA 3TJNA 3F3BA 3EDXB 4KTUA 3RLYH 4MG3A 3TJVA 5EW2H 4HZHA 1OWJA 1QL7A 2J95A 4AB9A 1FLEE 1B5GH 2A7HA 2XCNA 1SGIB 3RXEA 3T28A 4Y0YE 1V2ST 5JB8S 1BB0B 4AX9H 1O38A 2A4OA 1FX0B 3P70B 1C5QA 1AE8H 1D6WA 1YF4A 2VWNA 5E2OA 1TONA 1QGFA 2FEQH 2G55A 2ZFPH 3NRLA 2OTVA 3ZVBA 1GHAF 1S84A 3PYHA 1GI2A 1PQ5A 5ESBA 2SGPE 5AFZH 2FI5E 2R0LA 1YCPM 2XNDD 2ZHEH 1IAUA 1WTHD 3RC6A 1FI8A 1QJ6B 3RXJA 1ZTLA 1AFQC 3PWCA 3PRDA 2IOTA 2VIVA 1GJDB 1Z6JH 2GVFA 1H9HE 1TGBA 2ASUB 2VGCC 4I8HA 5A8ZA 2H5CA 4XBBA 4VGCC 1C2FA 2FMJA 5FHTA 2XWAA 3HPTB 4OS7A 1NO9H 3ZVEA 2PWXA 3LC3A 1OWKA 1OYQA 5HYOA 3BIUH 1LCYA 2WPDD 2SFAA 3QTVH 1T4VH 3GY4A 3RXRA 3UNSA 2BLVA 4ZROA 2R2WU 3DHKH 2F9VA 1ZPZA 1BMLA 2YMSD 4ESTE 2BXUH 1BTZA 2M5TA 8LPRA 1UVTH 3ATLA 1ZZZA 1S81A 1PPEE 3SJ8A 1F5LA 1AY6H 2C8ZB 1TNGA 1W13U 3ATWA 2Y5HA 3LU9B 4CRAA 4GVUA 5GJ4B 4H6TA 1P2KA 1OX1A 6CHAB 1WBGB 3GY2A 1V2NT 2YMSC 2WPIS 4NWKA 3A89A 6ESTA 3RMNH 1DT2A 4YO9A 4JZIA 5C1UA 1SGFA 4TPIZ 1MBMA 7GCHG 4B1TA 3SV9A 1GGDC 2CHAC 1UK4A 1GBBA 1C5ZB 5GNDA 4AOQA 2KFWA 1E38B 3W94A 1O5AB 4OS2A 1ANCA 1INCA 4UFFH 1ZR0A 5DP8A 3MNXA 1KLTA 2QXHA 2GCHG 2XC5A 2QN5T 3MNSA 4WXIA 3MMGA 2OK5A 2ZO3H 2PUQH 1GBMA 2GX4A 2EEKA 3AAVA 2B5TB 1T32A 1COWD 1ZTJA 5CE1A 2EQNA 2Z3CA 2OC7A 2QA9E 2VINA 3KIDU 3L3TA 2FP7B 1FJSA 1SGDE 1P3CA 1ELTA 2ZGCA 2V6NA 2JH0D 5LGOA 4B71A 1J17T 2V0BA 2WV5A 4RKJB 1UMAH 3OFND 5K7RA 3BV9B 4B2CA 4Q7ZA 1O3HA 1O2YA 1PPZA 1XUKA 1GCTC 2C4FH 3GY6A 3GYLB 3MO9A 4XBDA 1HAVB 4I8JA 3RC4A 1YP9A 3P8FA 4Z6AH 1P8VC 1BIOA 1N6YA 3R0FA 1TBZH 3LGYA 2BDIA 3T29A 1A61H 3V3MA 4U30A 4NIXA 1WTGH 2OBOA 3SV7A 3M7TA 4KELA 3M5NA 2OQ5A 1DLKB 1GVZA 1WAYB 1ZGVA 4XDEA 1L2EA 3ZYEA 1NTPA 4ABDA 3UUZA 4A1VA 2J5UA 4CREA 3GCTG 1AD8H 1GHBG 1S82A 3E3TA 1MTVA 1H1BA 4JCNA 1AKSA 5KECA 5FL7D 1TQ7B 1EX3A 4AFZA 3RXUA 4E06H 5C2ZA 5HXFA 1QA0A 4ABGA 3DT0H 2TRMA 5A0BA 4NA8A 1SFIA 2KCAA 3MH7A 3SOSA 4ZHAA 1O3CA 2C8YB 4X8UH 2BZAA 3HGNA 1O2TA 1O36A 7ESTE 1SGEE 1LKBA 4BAHB 1RRKA 1BBRE 2YNBA 2CN0H 1FIZA 2BX4A 1DXPA 4XRNA 1MKWK 3SO3A 3SJIA 3C27B 3SNBA 2ZU5A 4TWYA 1TNKA 2ANKH 5BPEA 3S7HB 3FFGA 3SJ9A 4UFDH 1K1MA 2FO9A 1GI1A 1O3EA 2C8XB 3UFAA 1O5EH 9ESTA 4GPGA 1IQMA 1B0EA 3V12A 1XUHA 3KCGH 4FUDA 5L2YH 4CBNA 2J98B 3LIWA 2JH5D 4X8TH 1A3BH 5B6OA 2J38A 1QR3E 2AMPA 2ZDKA 2ZFQH 4FUFA 3TK9A 1SLVB 5A8YA 3E0PB 2ZECA 3RXAA 1ZJDA 1O2GH 4JZEH 3TITA 4UONA 5DP9A 1XUGA 3A7XA 4OS4A 5EXNA 2ODPA 3TLOA 1SGQE 2CGAA 3SUGA 1GMDG 1NS3A 1J9CH 2H9EH 3P8NA 5EQQA 1L1NA 1E0FD 5EPYA 1C9PA 2KX4A 1DUEA 4D7FA 1BT7A 2QGRA 1NY22 3O8CA 4YLUA 4MQAA 1SLUB 1RTFB 2QY0B 1KXFA 1A5IA 3STJA 5DPAA 2BQ6B 2Z9IA 9LPRA 4FXGH 3TJOA 5EODA 3ZVAA 3F68H 4Y7AA 3RXSA 4KGAA 5HIZA 1EAUA 3SU1A 5PTPA 1TABE 4LZ1H 1PPHE 4ABFA 1VZQH 3AAUA 2J92A 3DSPA 3KYFA 1ESBA 3SNAA 4MDSA 3ZVGA 4ABHA 2VIWA 1GHVH 5EQRA 3WWFA 1XKAC 3H5CB 1MKXH 1BTYA 1V2PT 1TX7A 5CMXH 4J2YB 3DA9B 3PV5A 1GL1A 1FY5A 1WDIA 2G5VA 2VH0A 3AK5A 3MOCA 1H8ED 1QB9A 1UVPA 4MPXA 4BXWA 1VITH 2GZ9A 2ZEBA 4TY7A 3M61U 4SGBE 1AI8H 1FPCH 1O2HA 4FUHA 4BTIB 1G37A 6CHAC 4FETA 2NU2E 3VB3A 2EI8A 1DSUA 4FVBA 3S9BA 4ZH8A 3LJOA 2FTMA 3F2GA 2LP6A 1DWEH 1W14U 1FV9A 4A7IB 2FOMB 3VPKA 3FOAA 1QB1A 4K1EA 3TPIZ 3T26A 4X1NU 1GI7B 1A2CH 1BTWA 1O2XA 1CA8B 3OE7D 3GICB 4X2WA 2A4QA 2OXSA 1GPZA 1ZYOA 2PKSC 4YT7H 1K9OE 5GXPA 4IN2A 2H1UA 3LGVA 1YKTA 2R2MB 3ZVFA 4JZDH 4XD7D 1AKSB 4Y79A 4NZQA 3A7YA 4YM9A 1AB9B 1AHTH 1YPLH 3EE7A 5EGMA 1FN8A 3RU4T 4AC9A 3QZRA 2BVXH 3OY5U 3A84A 3ATMA 5JB9S 3B9FH 1UTOA 5LPEA 3TK6A 5E0JA 1G36A 1SHHB 2NU4E 5LPRA 4OM9A 4Y8XA 1O3FA 2A2XH 2GGVB 3SGBE 1OP8A 2VVVA 3QX5H 2F9NA 3GCNA 2ALVA 3BTFE 4I31A 1QHRB 1NROH 2H9TH 2BM2A 5C20A 3RXVA 2PW8H 1GG6B 1WQVH 1RXPA 3LT3A 3ZZAA 1SFQB 3O8RA 3MU8A
chains in the Genus database with same CATH topology
4X6NA 3U1IB 1EATA 4ABEA 1VJ9U 1DWDH 1BMAA 2ANWA 2K1QA 1UHBB 1UTMA 1XVOA 3DUXH 3JZ2B 1BBRH 2FX4A 3PMJA 3VXEH 4NWLA 2THFB 2FPZA 2SGFE 2A45B 1FQ3A 3F6UH 1QCPA 1IOEA 3RC5A 3BEUA 4ZUHA 1A0HB 2DE9A 3KN2A 1JRTA 3BTHE 2F83A 2FLRH 4BXSA 3GCHB 2LNCA 4ZKOU 2ZTXA 2OINA 1W8BH 2AS9A 1V2TT 2ZHDA 1O3GA 4GLYA 1O2SA 1CQQA 2O8MA 3CP7A 1DY9A 1GHAG 5A0CA 1PPGE 1IQKA 1BRUP 3EA8A 3KL6A 5C5NA 2OP9A 4XBCA 5GDSH 1AE5A 5L2ZH 5EXMA 1IQGA 2OD3B 1DXWA 1NRPH 1O2OA 4KTSA 2H6MA 4IC6A 1DM4B 2FOAA 1OKXA 4NCYA 4WH8A 4MNWA 4XFQA 4CHAC 2WYJA 1O3BA 4FVDA 5F03A 1RTKA 4LOYH 4WMDA 2JKHA 3UPEA 1YGCH 1H4WA 4ASHA 3PV4A 1TFXA 2ZQ2A 2ANMH 1P02A 4K8BA 3ZYDA 1ESAA 1A7SA 3A83A 4AN7A 1O30A 1SMFE 2HALA 2F9OA 5E2PA 4ABBA 4CRFA 3A80A 3AASA 3V13A 2ZNKH 5DP5A 1E34B 2FOGA 3K65B 5EG4A 1J16A 1V2RT 1TE0A 3MI4A 2Z9KA 1NRSH 2CHAB 1O3OA 2GV7A 5DP7A 1T8NA 2GMTB 2Y5GA 1ZTKA 4K3JA 4THNH 2ZPRA 2CF9H 1HUTH 1C2IA 1IHSH 3A87A 3SI4H 1CHOF 3TU7H 1TOCB 1YPGH 1THPB 1FY8E 3LH1A 1S6FA 1P2JA 4PROA 3RXIA 3QDZB 2QXJA 1TPSA 1D3TB 1QJ1B 1QQ4A 1DWBH 4E05H 5DG6A 2Y81A 1YPKH 4K1TA 3S7KB 1UCYK 6GCHF 1QURH 5IYTA 3RLWH 1G3DA 3VFEA 3LONA 4DIIH 3OSYA 2IN2A 1NU7B 1WSSH 1F5RA 2NU1E 2UUJB 3ATIA 1W10U 2SGDE 2AEIH 4NIYA 1GHXH 4BTUB 4B74A 1HV7A 2XRCA 1VGCC 2FESH 1TALA 1O3JA 3DFJA 3TH2H 4X8SH 4CRDA 1DS2E 3HKJB 2ZDVH 4ISOA 1EB1H 2ZDMA 4ZAEA 2I6QA 1FIWA 1W3CA 3IG6B 8KME2 1NM6A 2FWWA 1L0ZA 1LPKB 2Q1JA 3MO3A 3RP2A 2A7JA 1QRZA 4RSPA 1BRBE 1TQ0B 3U98H 5FPYA 2WPLS 8GCHF 3A7TA 1YPEH 5FCKA 3LJJA 2DUCA 4ZXYH 5HMAA 2EC9H 1FXYA 1V6DA 2OC1A 4Y10E 1YPHC 2ZU2A 2FOFA 3PMAB 5IDKA 1GL0E 2OC8A 4XSKU 1MD7A 2UWOA 3U8RH 2VB0A 4IMQA 2Q6DA 2G4TA 2BY9X 1K1PA 1C1OA 2SGQE 1ZPBA 1AB9C 4UEHH 5EPNA 2HGTH 1ARBA 1P04A 5AF9H 1G2MA 4E7RG 2BTCE 1DFPA 4WMFA 1C1TA 4ZHMU 1P9UA 1Y3VA 3M5OA 2BD2A 1GWAA 3RXCA 5SGAE 1ELDE 1NFYA 3A7VA 3GDVA 4K5ZA 3C1KA 1GG6C 3PTBA 2Z9JA 2G4UA 1O3PB 1GJ7B 2ZDAH 1Z7KA 2FLBH 1IQLA 1MBQA 1P2QA 1EPTA 1Y5UT 4ZKNU 1NESE 2Q6GA 1UO6A 3VB4A 3B8JA 3ZVDA 5JBTA 1GCDA 1T31A 1MTUA 1U6QA 3GCHC 1O39A 1HAZB 3BTGE 2R0KA 2VJ1A 1K1OA 1P0SH 2SGAA 3EYDA 2BY6X 3K9XB 1O3AA 1LO6A 1QBNA 3E90B 1MTWA 1SQOA 4X0WU 3BEIB 3QWCH 4DCDA 1CT4E 1GDUA 1S0RA 3MTYA 3OU0A 3IITA 1BJUA 2A7CA 1BTUA 1AUTC 3AW1A 3RDZA 4BANB 1ETRH 2ZHFH 1Y3WA 1KTTB 1C5SA 1ZJKA 2RDLA 3VB7A 2OCVB 1QB6A 4BAMB 1NU9A 1A3EH 1LKAA 2A5KA 2BD7A 3UNRA 2ZKSA 3LGTA 2XCFA 2WUCA 4DURA 1UTLM 3EGKH 2A5IA 3M37A 2OUAA 3SJOA 3T25A 1O3NA 3I29A 2A31A 3SJKA 1D3DB 1ZSJA 2QC2A 2O8TA 1E35B 2C8WB 1VCWA 2XBVA 2PGBB 1KTSB 1PPCE 1YC0A 3SU3A 4Q2KA 1AWHB 1MUEB 2GMTC 2PSXA 4O3TA 4X6OA 1CVWH 1DX5M 2VIPA 2P93A 1BUIA 1SGNE 5HM9A 1OPHB 2BVSH 5FX5A 1QNJA 1C1VH 1EOJA 4YOIA 5DP4A 2PKSB 2P95A 1TGSZ 1HJAB 4WMEA 5A2MH 1LHGH 1DWCH 3RMMH 4NZLA 1K28D 1EASA 1DANH 1Y5AT 2SNWA 1DVAH 2ZHQH 4CRGA 2J94A 3UOUA 1HIAB 4BAQB 1EJMA 2ZHWH 3V7TA 1XVMA 2AGEX 1D4PB 4Y7BA 4YOJA 5A0AE 1JOUB 4WH6A 1S85A 4FU8A 1KDQA 1O5CB 1P11E 1O34A 1P2IA 2V3OH 1DLEA 2A0QB 1MD8A 1F2SE 5GIBA 3SUEA 1GBLA 5CHAC 3SGAE 3LDXH 2WUBA 1ELAA 2BD3A 1DUAA 1BTXA 1C5OH 2NU0E 1GI5A 1UTPA 1C5PA 2HVXA 3MWIU 3RUOA 4NFEA 2Z94A 3S69A 1O2PA 4GHTA 4NSVA 2G8TA 1ZGIA 1MU8B 3RXOA 1GI6A 3MNBA 4TY6A 3RXQA 3LC5A 3GYMA 1SGPE 2J34A 1GJ5H 3S9CA 4LXBH 1C2JA 1ZHPA 5FCRA 2QXIA 1N8OB 3PMBB 3M7QA 1WUNH 2HRVA 3TJUA 5T6FA 4BTTB 3ODDA 1LQEA 1ANBA 3LGWA 1G32B 4X1SU 1GBIA 4MPWA 2FX6A 4IS5A 2A4RA 3P95A 1LQDB 1QRWA 2PUXB 2PKAA 1RGQA 3SW2B 4MNXA 3A86A 3BTWE 5TCAA 2ZZUH 7LPRA 1O3MA 1LHCH 1RFNA 1VITF 2IJOB 2FOCA 1HAHH 1QBOA 3A88A 1LMWB 3P17H 4CHAB 1A46H 1Y59T 1EAIA 1GDNA 1N6XA 3BG8A 2BD8A 1LPGB 1BTPA 1LTOA 1GJAB 1NPMA 3RXDA 2G52A 3GY8A 1V2LT 1BITA 2BMGB 1C4U2 1HYLA 1Y5BT 3D65E 3SV8A 3FVFB 2LPRA 3M7UA 2PTCE 2AIQA 4B2AA 1CU1A 1MKWH 4IN1A 1BHXB 1GMHF 2GZ7A 1OWDA 1O3LA 1GJ9B 2R3YA 3UWIA 1DE7H 1C1UH 1Z1IA 4WF8A 1O31A 1HFDA 5GCHF 1FY1A 3ZZCA 2VWOA 1F5KU 1GBDA 1T8LA 1HLTH 3BTKE 3AVZA 1GBEA 3FAOA 4WJG2 1TMBH 3A7ZA 1LDTT 1D9IA 2KAIA 2FS9A 1HDTH 1O2JA 2V3HH 1C2EA 2UWPA 2ZIQH 4D8NA 1GVKB 3BF6H 1GJ6A 1IHTH 3RU4D 1ZRBA 1BTHH 1CA0C 3D23A 3KQEA 4YZUA 1SVPA 1EZSC 3MU0A 4INKA 2BDHA 3V0XA 2ZCKP 3CS7A 5DJ7A 2FM2A 1A4WH 3DFLA 1UK3A 4GUXA 3O8DA 5I46H 1JMOH 4B76A 3FP6E 5LH8A 2EI6A 3RXGA 1SBWA 4D9QA 1LVOA 4DJZB 2O8UA 5JBCS 2ZU1A 1CHOG 1BA8B 5H4IB 1HAIH 1W7XH 3K2UA 4MPUA 5DKMA 3KQCA 2EA3A 2TIOA 1VGCB 4I7YH 4UE7H 1XUFA 1O2IA 5FX6A 3MHWU 4R0IA 1SGTA 1VCQA 4HTCH 1P2OA 1Q31A 5L6NH 1AUJA 1XKBC 1KDQB 1FUJA 1G2LA 3A8BA 2GCTC 6GCHG 3A8AA 1HXEH 5EXLA 3OTJE 5C5OA 4DW2U 2GT7A 2B8OH 4H42U 4AG1A 3B23B 4BOHA 4D9RA 4QT8C 2JETB 1NRQH 1V2QT 2BD4A 2BOHB 4JK5A 1GBAA 3L6PA 1HJAC 1AZ8A 4X6MA 3ZZ8A 2ZFSA 1V2MT 1H9IE 3RXKA 3A81A 3PTNA 2NWNA 1UCYE 2HOBA 4UFGH 1CO7E 3UR6A 3UNQA 1DY8A 3EA9A 1ANDA 1C1PA 1IQHA 1TB6H 1B7XB 1SSXA 2A4GA 2PR3A 2ODQA 1Z8GA 1SGCA 2ZCHP 5E0HA 1WU1A 1Y8TA 3UQOA 4IGDA 4JZ1A 1OSSA 1O33A 1C9TA 4U2WA 4B75A 8GCHG 3RXTA 2TGAA 3GOVB 2AERH 2PKAB 3I77A 1O5DH 5JPMH 4AFUA 1P01A 4HI3A 1Z1JA 3ZV8A 1ARCA 3OY6U 1YLDA 4OGXA 4A1XA 3UTUH 1ZMNA 2PHBA 1O2NA 3UQVA 1ETSH 1BQYA 5DO4H 4X6PA 3E0NB 4RN6A 2PTNA 3TGIE 1TBRH 4MTBA 1QFKH 2ZPSA 1O5FH 2O8WA 1DOJA 1IQEA 1HJ8A 1MCVA 1O37A 1PQ8A 3QO6A 1TRMA 3E6PH 1N8OC 1OYTH 3T62A 1EPTC 4JYTA 4KKDA 1EP5A 1AVGH 3STIA 3GY7A 1W12U 2XXLA 1FY4A 1W7GH 1MCTA 5FPTA 1XUIA 2HNTC 3ZZ5A 1EUFA 3Q3YA 4JYVH 1P2MA 1BRCE 4INLA 4NA9H 3TH4H 1Q2WA 1EB2A 2ESTE 2XC4A 4YTAA 4X2YA 1XXDA 4R8TB 1ZOMA 1F92A 4O9VA 4WVPE 1OWEA 1S5SA 3E91A 4AORA 2AMDA 1K22H 1BZXE 1A1RA 1T8MA 5FPSA 1NFWA 1KXCA 1KYNA 3VXFH 3KQDA 1EQ9A 3F9GA 3KQBA 2AGIX 1O2WA 5ETXA 2ZFFH 1OP0A 1TNIA 2G5NA 5HGGA 2QXGA 2ZFRH 1ID5H 2QV1A 2I6SA 1TRYA 5FXLA 1C2DA 2J4IA 1XX9A 1JIMA 2STBE 1XMNB 4DY7B 1BMMH 4JYUH 4CR5A 2W3KA 1AGJA 1EOLA 3CS0A 4ZKRU 1CBWB 4OS6A 3M3TA 3SU0A 1KIGH 4AFQA 5JDUB 1W0ZU 1QQUA 1DICA 2ZI2H 3F9EA 3R3GB 2GTBA 3QK1A 3Q3XA 4DOQA 3F9HA 1ZHRA 4NGAH 1MTNC 2FODA 2W5EA 4Y11E 5C1XA 2XBWA 1PPBH 1AQ7A 2BOKA 3VGCC 3D62A 1KLIH 1FNIA 3EQ0H 1VCPA 4ZKSU 1P2NA 4O3UA 1A0JA 1YCPK 2XBXA 4F49A 5LPFA 2UWLA 1ELBA 3A8DA 5F8ZA 1FY3A 2Y80A 4FUEA 1C5WB 5C1YA 1UTNA 3RMOH 2RCEA 2F9UA 4F4OC 2ZF0H 2BD9A 2ZWLH 5JBBS 3UOPA 3ZZDA 4A6LA 3RXMA 1PQ7A 5EQSA 3NK8A 1GJ8B 1NFUA 4ISHH 3KEEA 4AB8A 3TVJB 1V2UT 5AHGH 1SHYA 2A2QH 3PLBA 2ZQ1A 5CHAB 3GISB 3CENA 1EAWA 1P03A 8ESTE 3HATH 4FUGA 3ITIA 3GDSA 3A7WA 3M3SA 1WCZA 3UR9A 1K1IA 3HKIB 3TGKE 1ZRKA 1V3XA 3QTOH 3L33A 1MH0A 5J4QA 1FONA 4DVAU 1PQAA 5DP3A 1UCYH 2P3UB 1KXAA 3KHVA 1G3EA 4WWYA 1P09A 2FOBA 1QA7A 3SNEA 4YLQH 1RTLA 2JETC 2Z9GA 3NUMA 1G3CA 3MYWA 3T27A 1C5YB 1FN6A 3QGNB 3T5FH 1PYTD 2ZU4A 4Y76A 1BOQA 1ORFA 2G81E 3WY8A 4AG2A 3KNXA 4H4FA 5AVDA 1C1RA 3ZV9A 2BY5X 1A5HA 3PO1B 4DG4A 2PGQB 3FP8E 4BAKB 3EA7A 1NZQH 3VEQB 1TNLA 2D2DA 2B7DH 2ZTYA 3F1SB 2ZC9H 3SNDA 3SHAH 1OP2A 1RS0A 3M5LA 2OLGA 1TGTA 1UVOA 1HRTH 1C1WH 1PYTC 1P06A 2Z3EA 3URDA 1IQIA 1UTQA 2BX3A 3LGUA 4LK4A 5GWZA 1HAVA 1N1LA 1FZZA 4U01A 1HAPH 1SGYE 4LZ4B 2ULLA 3GCOA 1OOKB 1C4V2 2VNTA 1SPJA 1S0QA 2D26C 1FMGA 2P59A 2H2ZA 2ZCLP 1MAXA 3HK6B 1SOTA 3RU4E 1C5XB 4B2BA 1ACBE 2V35A 3BIVH 1IQNA 2PFEA 1F7ZA 2RA3A 2QF0A 1NN6A 2PLXA 1HAXB 4JK6A 4IW4E 3P6ZB 1O2ZA 1RIWB 5ESTE 4FUCA 4SGAE 4OS1A 1ANEA 4Y6DA 4NA7A 2G00A 4Y8YA 1TGCA 4X8VH 1VITG 2FTLE 4DT7B 1KXBA 1PFXC 2W26A 1V2OT 2P94A 2BDYA 1HNEE 1AFEH 1G9IE 2Z7FE 4AZ2B 4CR9A 2FOEA 2OQUA 1MTSA 3QGJA 3S9AA 2ZTZA 3SORA 3MNCA 3ZVCA 3P8GA 2W7SA 1O35A 1CA0B 1C5NH 5C67A 2BDBA 2TGPZ 5T6DA 2IPHA 1TA2A 2PV9B 4ABAA 2ILNA 3U69H 2H5DA 4K69A 1TNJA 1XM1A 1BRAA 1YPMH 1AU8A 1GMHG 5E0GA 1SL3A 2VIDA 2P8OB 1C5MD 3E1XB 3FZZA 3GY5A 3SU4A 5GCHG 3SU6A 3MH4A 2Y5FA 2Z6BD 4Z0KA 2QYIA 3JZ1B 1AMHA 2VVUA 3OYPA 4NSYA 1LVBA 1GMCF 1E36B 2VIQA 2GP9B 1D3PB 3QLPH 2OC0A 5HM2A 3ATKA 2QIQA 1AZZA 3GY3A 3Q76A 3Q3KA 1QJ7B 2BQ7B 1CBWC 2GCTB 2BY8X 4X2VA 7KMEH 3SU2A 1SGRE 1ELGA 2FXRA 1KXDA 2H9HA 4I33A 4GCHF 3I78A 5F8TA 3O8BA 1HJ9A 3SZNA 4Q80A 4K2YA 2CF8H 3TIUA 2WV4A 3UIRA 2Y7ZA 2ANYA 3NPSA 1K2I1 2UUYA 1LHEH 1TAWA 1GBCA 2DE8A 2J2UA 3ELAH 4JZFH 2F91A