2SGAA

Electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron density calculations as an extension of protein structure refinement. Streptomyces griseus protease A at 1.5 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
molecule keywords PROTEINASE A
total genus 52
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1983-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA01
1W11U 3PV4A 3RXAA 2UUKB 4ZXYH 3AW1A 1O2UA 1V2MT 2CGAA 2GDDA 3N7OA 1LPGB 2BDBA 4X8TH 3RM2H 2G5NA 2R2WU 1Q31A 2ZECA 3ZZ5A 1GI3A 2ZU3A 3SJ8A 2XCFA 1G2MA 1PPCE 2ZTXA 2GT8A 1IQEA 4JZIA 1DY8A 1VJAU 3SJ9A 2VIVA 1AO5A 3ODDA 4YOGA 1UCYE 2ZHFH 2ZA5A 3T27A 1FAXA 2V3OH 3RXEA 2UWLA 1BBRH 1TRYA 3SUGA 1SFIA 2ZHQH 9LPRA 1FXYA 4UDWH 1W7GH 1CE5A 1Q3XA 2W26A 5DO4H 2AMPA 2FM2A 1C5XB 3ATKA 3SGQE 1GJDB 1BMMH 5EGMA 1KXCA 3DFLA 4TPYA 3T28A 3FP8E 1MU8B 5E2OA 4UFDH 1XXDA 3VB4A 1W13U 3BTKE 1GMDG 2ILNA 4Y7AA 1MTSA 1CHOG 2BMGB 3IITA 1RFNA 1MKWH 3D62A 3UIRA 5FPTA 1EP5A 3S9BA 3A8AA 1G3DA 3VB3A 5IYTA 5EXNA 3GDUA 2PTCE 1AB9B 1G36A 2RA3A 4NWKA 2YNAA 3RXUA 1PPHE 1F0RA 1DXWA 2ZHDA 2BZ6H 1JXPA 2GVFA 2JETB 4Y11E 6CHAC 5GIBA 3B8JA 2FOGA 2FI3E 2PGBB 3F68H 1T8MA 2G8TA 3F9GA 4MDSA 4ABHA 1OWHA 1P2QA 5C1XA 1O2GH 3KN2A 3T26A 1DM4B 2BHGA 1BBRE 1HJAB 5GCHF 4LZ4B 2D26C 5FAHA 3P8OA 4DOQA 1O0DH 2VH6A 1KXBA 3WY8A 2FO9A 1BTWA 2QXGA 5E2PA 5FX6A 1OXGA 2HPPH 3IWMA 3SU6A 4U2WA 3OY5U 4X2WA 3RXIA 1QJ7B 7KMEH 4AGJA 1GI1A 1SGRE 3GCHC 1GHBG 1LMWB 2J9NA 1LHDH 1H1BA 4MPUA 1W14U 1EATA 5DG6A 1Z6EA 3U69H 1O2PA 2C8ZB 2O8WA 2AGIX 5F6MA 1YYY1 1F7ZA 3A8DA 1F2SE 1KSNA 1Z1JA 2J94A 5DP5A 1BHXB 1P03A 2ZPQA 2VJ1A 1DWCH 1GJAB 3K65B 3KGPA 4MTBA 1RTFB 4AFUA 2Q1JA 3RXJA 5JB9S 4O3UA 4D7FA 4RKJB 1HLTH 2VWNA 5FBIA 1BTUA 1FNIA 1GI4A 3BTME 2AMDA 4XBCA 3O8DA 1GJ8B 2A2QH 1NRSH 3MH4A 2JH6D 4LOYH 1E37B 5HYOA 2B5TB 1ZHPA 2W3KA 5JBBS 4ASHA 1CA8B 1V2OT 1A0LA 3TIUA 3SHCH 1GPZA 1RS0A 1ACBE 1TGCA 5JYIA 4X6PA 2ZGHA 2XRCA 1IQIA 1Z1IA 4GLYA 2G52A 2G55A 1AI8H 3I29A 4Y76A 1OX1A 2WYJA 1TNGA 1ANBA 2GP9B 4O9VA 5A09A 1AWFH 3A81A 2ZCKP 2YOLA 3EYDA 3MI4A 2OINA 1T31A 4KP0A 2XBYA 2VWOA 1AHTH 2ZZUH 3SO3A 1NT1A 2HALA 4JK5A 1CBWB 1TIOA 5I25A 1P06A 5EPNA 3MNBA 4Y0ZE 1DICA 2A4GA 2PKSC 3GYMA 4FUEA 5EQSA 2CHAC 3M61U 5AF9H 3SU3A 4UFGH 1CGJE 1RTKA 2OQ5A 4WY3A 1NTPA 5HM2A 3O8RA 2FOAA 1HFDA 1TMUH 3A8CA 1SOZA 2ZWLH 3SJIA 3RXFA 4LZ1H 2OC7A 2DUCA 1GCTB 4AFQA 1QTFA 1IQGA 1ELTA 1QRXA 2FS8A 1C4U2 1HCGA 4KTUA 1O3KA 4YOIA 2QCYA 1EOLA 1PYTD 3SUFA 1ARBA 2ZEBA 1ANCA 2WUBA 1OSSA 1P2IA 1AVWA 1BUIA 1V2VT 1O2NA 1BITA 3SN8A 1HAOH 2VVVA 4B75A 1TONA 5G4BA 4AFSA 3K2UA 4MVNA 1GBTA 1EJAA 2ZFRH 3GY3A 1LHFH 4WF8A 1P57B 1GCDA 1SLXB 1HV7A 4UFFH 3U8OH 1QRZA 8KME2 2W7SA 2UUJB 1WUNH 3P8FA 3GY4A 1ZTKA 2P3FH 2WPJS 2P8OC 5BRRE 1XUKA 1PQ5A 1YCPK 3FFGA 2W5EA 1RXPA 2A5KA 1MCVA 1V2TT 1YPGH 4B2BA 2FMJA 4YLUA 3FVFB 3RXDA 1O5BB 2O8MA 4I8LA 1OP8A 3Q3XA 1SGDE 3ATMA 1T4VH 2JETC 2GV7A 3RC6A 2O8LA 1EB2A 2EI8A 3LU9B 1UTMA 3P6ZB 3V13A 1UTNA 1UTLM 3F6UH 1HAPH 5L30H 4Q7YA 1V2LT 4X6MA 1UCYK 1GBLA 2ZIQH 3GY6A 1BTHH 3KEEA 1CO7E 4NFEA 2BD2A 3H7TA 2A31A 3VB5A 2ZU5A 4X0WU 3MFJA 2QXIA 3BIUH 2PGQB 1W8BH 3S7KB 2KAIA 2VIOA 3MNXA 3S69A 3CS0A 4B2AA 1O3OA 2ZTYA 5FPSA 3I78A 3FP7E 2TRMA 1QR3E 1NN6A 3SNAA 1UTOA 1UVUH 2W7UA 2ZFQH 1C2HA 1ZTJA 5AVDA 4AOQA 2DE9A 6GCHF 2FWWA 1GHYH 2ZU1A 1O37A 2BM2A 3UOUA 3SW2B 1YGCH 1N8OC 1FY4A 2ZU4A 1TPAE 4ZAEA 4ZKNU 1DFPA 1C5RA 2AGEX 2BQWB 4KELA 4IW4E 4U32A 1DSTA 2FOFA 1W10U 1D3DB 1TRMA 3M5LA 2HVXA 4WMEA 4ZKRU 2PV9B 3SOSA 3F9HA 3TH2H 1P01A 4KKDA 3FP6E 2H5CA 1INCA 1LVMA 3P8NA 1JIMA 1O5DH 1T8OA 4NSYA 3U9AH 4I8KA 3SNEA 4HFPB 2ZU2A 2SGAA 1GMCF 1UK2A 1Z8IB 1JBUH 1NESE 3EA7A 3SU1A 1QRWA 1HAGE 4YTAA 2Z6BD 3GCNA 1SHYA 2J34A 1GI0A 1QNJA 4I32A 2XC0A 1ELGA 3B9FH 4Q7ZA 5JBTA 1P3CA 1GVLA 1MCTA 1W7XH 3S9AA 1FY5A 1WYKA 5FCRA 5HXFA 2BLOA 3O8CA 3VFEA 3EAJA 2BDHA 3PROA 3W95A 4ISHH 2BVXH 4DT7B 1V2PT 3UFAA 3LJJA 1OPHB 2WYGA 2P59A 4JZEH 5ETXA 1CBWC 5TJXA 1C5SA 4ZHAA 4LXBH 1HYLA 2Z9KA 4I8JA 1JRTA 1WQVH 2FX4A 2F9UA 1MKXK 1GBBA 1QCPA 4K3JA 1WAYB 2B8OH 1THPB 1PJPA 1C2LA 1AZZA 3HK3B 2XCNA 4BTTB 1DLKB 2OBOA 2Q6GA 1O5AB 1PPGE 3P17H 4FUJA 3T62A 2ZQ1A 4OS6A 1O3HA 1YBWA 3BTFE 3LC5A 2QC2A 3VB7A 1HBTH 3ZZDA 5CMXH 3GCTG 2FLBH 1O2XA 1TBQH 5EPYA 1H9LB 2Y7XA 4XBDA 2XWAA 3SU5A 1ELAA 4CRDA 4IN1A 2XC4A 4OS2A 3Q3KA 4FUHA 1J15A 4JCNA 2GMTC 1SSXA 1TFXA 1FIWA 2Y7ZA 5AFYH 2BD8A 1GBJA 1UTPA 1VCPA 1NROH 2BD5A 1H4WA 2ZHEH 1P2MA 3K6ZA 3M36A 1SQOA 4JMYA 1G2LA 3BG8A 3GOVB 5L2YH 1XVOA 1ZLRA 2ZFSA 3LGIA 4CRCA 5I46H 5DP8A 4A5TS 1GBFA 6LPRA 4DY7B 3KHVA 1W0ZU 2F91A 2BDAA 1Y5AT 2F9PA 3LGYA 1K1OA 4WMFA 1HB0B 3MYWA 1TOCB 2FI4E 1ELBA 3A80A 3F9EA 1WBGB 2V0BA 5F8XA 1S6FA 2F9VA 1GCTC 4D7GA 3FZDA 4NZLA 4NA7A 2UWPA 4BXSA 1FY1A 2I6QA 5TCCA 1N1LA 1P9SA 2QAAA 4TWWA 1OWKA 1UHBB 1GJ9B 3FZZA 1C5YB 5CHAC 3VXFH 2F3CE 2ZF0H 4AFZA 3NCLA 3FANA 2ZGBH 1U6QA 1O2TA 3SGAE 1O30A 4TPIZ 3VPKA 4BAMB 1TX7A 1O33A 2EEKA 5LH8A 5JB8S 2WV5A 1H8DH 1PPZA 1Y3YA 2QN5T 1C5UA 1GL1A 4R8TB 2H5DA 1BMAA 1D6RA 1TLDA 1Z8JB 3UQOA 2FESH 1TNHA 3S7HB 4RN6A 1UO6A 4GSOA 4OS5A 4FU7A 5ESTE 1CHOF 1FN8A 4X2XA 1UMAH 3T2NA 2H2ZA 3ZZAA 2A7HA 2O8TA 3JZ2B 2A5IA 1OKXA 4ISIH 3UR6A 1O3LA 2BDCA 3M7QA 3M7TA 2GTBA 1T8NA 1X7AC 1L1GA 3Q00A 1ETRH 2ZGJA 5JDUB 3VGCC 1C5QA 1XUJA 2Z9JA 1AGJA 3Q3YA 3L6PA 4FU9A 4YO9A 4MNXA 3SORA 2XW9A 1BB0B 3CENA 1BTXA 1QFKH 2OTVA 3PO1C 3SBKA 4QT8C 4FUFA 1LPKB 3EQ0H 2V6NA 1XMNB 5T6GA 2BDGA 2ULLA 4X1NU 1YPHE 1KY9A 1FI8A 1GBIA 1EXFA 2FXRA 2VB0A 2WV4A 4GCHG 1D3PB 4Q7XA 3R0FA 4YLQH 1IAUA 1AWHB 1DUAA 1TABE 1O2MA 1UCYH 1V2NT 4BAQB 3P8GA 5EG4A 7GCHF 4FUGA 5GCHG 4DIHH 1HPGA 8GCHG 1A5IA 1S83A 4J2YB 3M7UA 4ZXXH 1MTUA 4THNH 3ZZ9A 4BTUB 3E90B 2VGCB 1TGNA 1XVMA 1C1UH 3AVZA 1TNJA 3DA9B 1S81A 4NZQA 2GGVB 4DIIH 1O3BA 1K22H 1GI7B 2FOCA 3A7YA 1TMTH 3ZV8A 3W94A 2XBVA 5IDKA 3TK5A 1GBHA 3IG6B 3DFJA 3TJNA 1DLEA 1G9IE 4BANB 4MG3A 1DWBH 1G37A 1QGFA 2XTTB 3QUMP 5E8EH 1QA0A 3KCGH 2RA0A 2NU2E 2ZHWH 1SGQE 3I77A 1BJVA 4MNWA 2FTMA 1L0ZA 1CQQA 3URDA 1VGCB 2ALVA 3MH6A 1NRRH 2Z9GA 1FIZA 5EXMA 4AG1A 5FXLA 1TE0A 5GJ4B 2W3IA 1SB1H 2CF9H 2C8YB 3SV6A 1HAXB 4Y71A 1C5TA 1TYNA 1BCUH 2F83A 1K9OE 1H9HE 3PWCA 4ISNA 1B0EA 1O2ZA 1UVTH 2GZ9A 2ZP0H 1GJBB 2AEIH 3M37A 2ZCLP 1ZRBA 2FLRH 1C1SA 1F5KU 3MNCA 4Q80A 1S5SA 4BTIB 7ESTE 5K0HA 1EQ9A 4U01A 1GHAG 1Z71A 2ODQA 1ZSJA 1GI2A 3T25A 2M5TA 2BVRH 1L2EA 2AYWA 2P8OB 4B1TA 4D9RA 2C90B 1VJ9U 3G01A 3PMBB 1J9CH 3SV2H 3UTUH 4AZ2B 5DGJA 1SGEE 4CH8B 4ZKOU 3V0XA 1SL3A 1NZQH 2BOHB 1O5CB 1SGTA 1HJAC 2G81E 1HNEE 2BX3A 2FS9A 1O3NA 1GDUA 3BEFB 2ANYA 2GCHF 3KL6A 1P10A 1ELEE 2PSXA 9ESTA 2G4UA 4OGYA 3ZZ7A 2PKAA 4NA8A 3E6PH 1SHHB 1GG6C 2DE8A 1MTVA 3OTJE 2HNTF 3PMHB 3QX5H 3PTNA 4FUDA 1SMFE 3BSQA 1SGFG 1TA6A 4WH6A 3RXTA 3RXOA 2XC5A 1OOKB 3RMOH 2B7DH 3LGVA 5LPFA 2Y81A 4CR5A 1K1IA 1UTQA 1EJMA 5FCKA 1MBMA 3EE0B 1O2YA 1C1OA 1KLJH 2QF0A 3RXVA 1GL0E 2Q6DA 2OUAA 1FONA 1DY9A 2ZC9H 1RIWC 1TX6A 2FPZA 3RC5A 1F92A 2SGPE 3MU4A 1B7XB 2R3YA 3UNSA 1C2IA 5A0CA 1C1NA 2WPMS 2BXTH 3CS7A 4XSKU 3RM0H 3RXRA 1K1MA 2ZCHP 4MPXA 1QB6A 1K1JA 5GXPA 1Z6JH 4GPGA 1EUFA 3SV7A 1SFQB 1J8AA 3NPSA 4DGJA 1D9IA 3SNDA 3AAVA 1UVSH 3A88A 3UQVA 2SNVA 1ZMJA 2H9TH 1GDQA 1P05A 5LGOA 1Y8TA 2Z3EA 4XOJA 1N8OB 4FU8A 1GJ6A 1KDQA 2GD4B 4F4OC 4OS7A 5DK1A 3SI3H 1P11E 1GBMA 2Y5FA 4NG9H 3AASA 5SGAE 4CRAA 1RJXB 2PW8H 4PROA 3PM3A 4AB8A 2A1DB 2VINA 1AU8A 3Q77A 4ZKSU 4IS5A 2ODPA 1DSUA 2A0QB 1TNLA 2Q6FA 3SQEE 4I31A 3SUEA 1GHXH 1YKTA 2BDYA 2HLCA 1MMJN 2NU3E 1ETSH 4Y8XA 1GBDA 1K1LA 1WOFA 1TWXB 4AORA 1D6WA 1MTWA 1UTJA 1O34A 1PPBH 3U1JB 1QBOA 3E0PB 1ZJKA 1O3FA 3PWBA 1EAIA 1GGDC 3LOXA 4D76A 2FDAA 3E8LA 1K1PA 4D8NA 1IHSH 1ESTA 2AGGX 1F0TA 2BY5X 1IOEA 2Y6TA 5DP7A 2R3UA 2XWBI 3BEUA 2H1UA 2YNBA 3TLOA 3H5CB 1XUFA 4UE7H 3SU4A 3SUDA 3RU4T 2EC9H 4DJZB 1A46H 1D4PB 1ORFA 1MQ6A 1RIWB 2G5VA 3KNXA 1QB9A 2AIQA 4VGCB 3QGNB 4A6LA 1NRNH 1GBAA 5A0AE 1E38B 1C2JA 4WWYA 3U98H 3NKKA 5L2ZH 1S0RA 3A86A 1BIOA 2AFQB 5C5OA 3SHAH 1Z8GA 2R0LA 3MH7A 4O03A 4CBNA 3ATLA 2WINI 2UUFB 2ZGXH 2HWLB 5DPAA 1P9UA 2P93A 2BLVA 2J2UA 3RP2A 3SV8A 4CR9A 3DHKH 1BJUA 1DPOA 3BTWE 3K6YA 1YPHC 2XBXA 1AUTC 1LVOA 1QBVH 4FUCA 1TAWA 4TY6A 4MNVA 5JBCS 3GY5A 1EX3A 3ENSB 1XM1A 1C1VH 1DWDH 1HGTH 2WPIS 1GDNA 1S84A 1AFQC 1NRPH 2ZDLA 3RXKA 1EPTA 1KXFA 1GI9B 5DKMA 4ABFA 1AD8H 3M5OA 4A1TA 3OYPA 1O35A 2GCHG 1ZGVA 2STAE 3F1SB 1OYQA 1BRAA 4FUIA 1H8IH 1LKAA 3ZV9A 1O5EH 2C8WB 4FVDA 1V2QT 3ZYDA 4GVUA 2CHAB 1O2VA 3V3MA 1O32A 1V6DA 2CF8H 3M35A 1MH0A 1O31A 1FMGA 4SGAE 4I8HA 4KGAA 2ZG0H 2TGTA 2UWOA 5DP6A 4F49A 1LKBA 1VCWA 4JYVH 3D65E 1UVOA 2GX4A 1ZYOA 1HIAA 1W2KH 3S9CA 3MOCA 2AIPA 4WH8A 3SNCA 1VITH 1TPOA 5ESBA 3U8TH 1C1PA 1P12E 1EZUC 1NM6A 1GHVH 3QTOH 3HGPA 1GJ5H 1SBWA 3LGWA 4A92A 1SGCA 1QL9A 4NIVA 2TIOA 1CGIE 1C5PA 1SGYE 3M3TA 1O5GH 1SR5C 4BXWA 1XKBC 1KLIH 1SGNE 2C3SA 1P0SH 6CHAB 3DD2H 1S85A 1BBRK 1GVKB 1CA0C 4ZHLU 3STIA 2ZQ2A 1O2OA 3E3TA 3VGCB 1NU7B 3NZIA 3RXCA 1AKSA 3BTDE 3PLPA 4AX9H 5FHTA 5DP9A 1O2SA 1MUEB 3TK6A 2P16A 1QL8A 2PKSB 1NFXA 3LJOA 3A89A 3MHWU 2BQ7B 1DE7H 5EOKA 1GJ7B 5C67A 1QB1A 3MNSA 2Z7FE 3RUOA 1DXPA 2PKAB 1FZZA 2FYQA 1ZMLA 3F9FA 4JYTA 1YP9A 3GCOA 3ZZ8A 1YF4A 4H6TA 3SJOA 2H6MA 5CE1A 3SV9A 5AHGH 4K5ZA 1NFUA 2OCVB 3ITIA 1A3EH 1C9PA 1GHAF 4Z6AH 1F0SA 1AVXA 4I8GA 2STBE 3KIDU 2EA3A 3DUXH 1XX9A 3GICB 3ZVDA 3QGJA 1IQMA 3PLBA 2IJOB 2ZGCA 2J38A 1WTGH 1V2ST 3RMMH 3E16B 3HKIB 3BTEE 1IQFA 4ABGA 4MLFB 1ELCA 2SGDE 1C1RA 4MPVA 2VVCA 3DT0H 2TBSA 2VIPA 1ZJDA 1IQLA 1KTSB 3UNQA 1O3PB 2OBQA 2OP9A 1C4Y2 4YOJA 1AE5A 1TPSA 1NC6A 4IC6A 2ZDMA 1BTZA 3RMNH 1L4ZA 1SVPA 1UHBA 1C5LH 2OC1A 3RXGA 4E7NA 3KQCA 2Y82A 4HTCH 2FYRA 2WPLS 4NIYA 3T29A 1AUJA 1P2JA 1YLCA 3A8BA 1VITG 2WPKS 4BAKB 5JBAS 2Z3CA 4ABJA 1V2JT 1ZTLA 4A1XA 1AIXH 1YPMH 4TWYA 1THRH 5BPEA 2PHBA 5LPRA 2ZFTA 2RDLA 2XNIA 3KQDA 1YCPH 3BF6H 1C2KA 5C1YA 2VU8E 5C1UA 3QLPH 3TJOA 4X1SU 4I7YH 2VVUA 1HDTH 3M3VA 2ANWA 5FBEA 3MU1A 1EOJA 1ABJH 1NO9H 1SLWB 2ZPSA 7GCHG 2FX6A 1C4V2 3QTVH 2BD7A 1FV9A 1HJ9A 2BD4A 1O39A 1NY22 5F8ZA 4ABAA 3QWCH 4WJG2 3D23A 3BIVH 1HXFH 1ZHRA 3E1XB 1BTYA 1FLEE 1GHBF 2O8UA 1FJSA 2ESTE 1V2KT 1LVYA 2A45B 5A8XA 2V35A 2VWMA 1CVWH 2PUXB 1DWEH 1ELFA 1O3GA 3U8RH 2OC0A 3PYHA 1TA2A 2HPQH 1P02A 4H6SB 3RXLA 1GJ4H 4XDEA 1WCZA 4TY7A 1QURH 1P2NA 2FOMB 2R0KA 4LK4A 1NRQH 4M7GA 3GY8A 4ABBA 1JMOH 2CXVA 1GG6B 2C4FH 3TH4H 3HKJB 3EA9A 1KDQB 4RKOB 1XUHA 3C1KA 3TGJE 1A61H 1D3TB 3MU0A 1GHZA 1SC8U 2OD3B 1KIGH 1BMLA 3LT3A 4YESB 5HM9A 5JPMH 2ANKH 1FN6A 1XXFA 4JZFH 1A0JA 2IN2A 5J4SA 3LH3A 3LDXH 4IN2A 1QJ1B 1K2I1 2A2XH 2BDIA 3HGNA 1A3BH 2IOTA 1ETTH 3QZRA 1C9TA 2G00A 1GI6A 1O2KA 4D9QA 2A4QA 1LQDB 4X1PU 4ABDA 4NFFA 1S0QA 4MNYA 4X6NA 1NPMA 2BLQA 1YPEH 1GMHG 2B0FA 1EAXA 1CU1A 1ELVA 3UUZA 4GAWA 6ESTA 1C5MD 1GI8B 1QL7A 2HOBA 2QXJA 3K9XB 1TBRH 3MTYA 1T4UH 1TX8A 2PR3A 2RG3A 4DURA 1A7SA 2FOBA 3ODFA 2WUCA 2ODYB 1V2UT 8LPRA 3GCHB 4ZROA 1M9UA 1G3CA 1Y5BT 1ZPCA 2Z9IA 3MU8A 3GCTF 1Y3WA 1MAXA 4K8YA 1ESAA 1A4WH 1C2GA 1MU6B 1OYTH 3GY2A 2HRVA 1GMCG 1ESBA 1L4DA 3STJA 2PSYA 2GCTB 3QN7A 1PQAA 1WV7H 4WVPE 3TU7H 1SG8B 1N6YA 2PTNA 2Z9LA 4B71A 4K69A 1Y5UT 1F5LA 5GDSH 1A1RA 1LTOA 1OWIA 1QJ6B 1TOMH 1F0UA 2GV6A 2ASUB 2A32A 2OQUA 1G3BA 5LPEA 3RU4D 1MQ5A 1BRCE 1V2WT 1FPCH 3KQBA 1K21H 3TITA 3BV9B 4H42U 3UWIA 1KXEA 3UWJH 2ZFFH 2ZI2H 4JZDH 1C2DA 1LHEH 2EI6A 4AYVB 3ELAH 1C2MA 3ZVAA 3ZVBA 3QK1A 5C20A 1P04A 1FY3A 1TGBA 3UOPA 1HAIH 4GHTA 3ZZ6A 2ZFPH 4IBLH 3M5MA 1O3MA 2V3HH 3RC4A 1B5GH 1KLTA 4ISOA 3ZVEA 2H9EH 1ARCA 1TNKA 1EZQA 5E0HA 3HPTB 2F9NA 2D2DA 1UK4A 3A7TA 3L33A 1A5HA 1DS2E 1K1NA 1A0HB 4X8UH 1ID5H 5T6FA 1LDTT 2WPHS 2BD9A 2FI5E 2BTCE 3LGTA 1SLUB 4JYUH 1RGQA 2PUQH 2PLXA 2R2MB 2ZDAH 3RLWH 5EQQA 2GT7A 3E91A 2J4IA 2FIRH 1Y3UA 5A0BA 2ALPA 3MO9A 3QDZB 1L1NA 2J92A 2P3TB 3A85A 1J16A 1MZDA 1THSH 4HZHA 3URCA 4XFQA 1ZPBA 2QY0B 1DDJA 4Y7BA 4B2CA 3KF2A 4MQAA 1HUTH 2Y5GA 1HRTH 4AB9A 1PFXC 2HNTE 2A7JA 3SGBE 2P94A 3RDZA 1SQAA 4DG4A 1IQNA 1O5FH 2CV3A 1FAKH 3UPEA 1QQUA 1Y3VA 4ZMAH 3BTQE 1TB6H 3MH5A 3NXPA 3MMGA 3D49H 4E7RG 1W3CA 2TPIZ 2VNTA 3QZQA 1ZRKA 1MTNB 3U1IB 1SOTA 1BZXE 1O2HA 2BY9X 5EU8A 3L3TA 2VIWA 2QIQA 2GDEH 3OY6U 1O2JA 3OX7U 1BMNH 4X8VH 4CRBA 1BA8B 1FDPA 5HMAA 1MD7A 4NGAH 4WXIA 4KTCA 1AFEH 2EI7A 4ESTE 1WSSH 1SGPE 2TGAA 1B0FA 1TBZH 3A7ZA 3A7VA 2ZO3H 3A83A 3PB1E 1LCYA 4DCDA 3SI4H 3TK9A 1EAUA 2BB4A 3PO1B 5DP4A 1EPTC 3GDVA 1C5VA 1T7CA 1O2QA 4K2YA 4TYDA 1QIXB 4NWLA 1KTTB 1SLVB 4H4FA 1IQKA 1C1QA 3TGKE 4X8SH 3AW0A 1BTPA 4X1RU 4ZHMU 5L6NH 2A5AA 2C8XB 2FOHA 3RXQA 1LPZB 3TVJB 1KYNA 1DT2A 1P8VC 5EQRA 1O3IA 3HATH 4KTSA 6GCHG 4XE4A 2VWLA 5T6DA 4CRFA 2BX4A 4CH2B 1VR1H 2A7CA 5A8ZA 1MKXH 2FEQH 4INHA 5FX5A 2XBWA 4CREA 5EODA 1FQ3A 3ZYEA 2FP7B 3Q76A 3TPIZ 3RU4E 1Z8RA 2JKHA 5DJ7A 4ABIA 4FXGH 1ZR0A 2GKVE 2J95A 1FPHH 1E34B 3TJUA 3ZVFA 1AE8H 4K1TA 1TALA 2F9BH 2HNTC 4INKA 5EW1H 1CT2E 1V3XA 1E35B 3C27B 1A5GH 3M3SA 1E36B 3E0NB 3UR9A 1GBKA 2BY8X 2QV1A 1D3QB 1YPLH 2Z94A 4IMQA 1H9IE 3ATWA 2OLGA 1T8LA 1NFWA 1JWTA 1XUIA 3OU0A 1KXAA 2JH5D 3GDSA 1C1TA 1UTKA 1P3EA 5A2MH 4O97A 2SNWA 1IQHA 5C2ZA 3BTTE 4I33A 2CJIA 1LVBA 1C1MA 1QY6A 1CT0E 3AAUA 1TNIA 3LPRA 3SQHE 3ZVCA 1LO6A 1LHCH 3A82A 3LKWA 5EW2H 1SPJA 3BTGE 1TQ0B 4K60A 3KQEA 1ZGIA 1AN1E 2OXSA 2GCTC 2QYIA 3MU5A 1BT7A 1MKWK 2Z3DA 1O3EA 1P2OA 2QGRA 1C2EA 2BY7X 4BAOB 4MPWA 3A7WA 4X2YA 1ELDE 4U30A 2C93B 2SFAA 3CP7A 5FPYA 5GWZA 2BOKA 5A8YA 3TH3H 1Q2WA 3GY7A 2HGTH 5B6OA 4NA9H 4R0IA 1V2RT 2P95A 1O36A 1WTHD 3ZZBA 2XXLA 1DOJA 2KAIB 1W12U 4JK6A 2THFB 3SJKA 3UREA 4CHAB 2VIDA 1NFYA 4CRGA 4J1YA 1LQEA 1BDAA 2PFEA 2I6SA 3LH1A 1XKAC 3RMLH 1CHGA 2BD3A 1GMDF 2A4OA 4O3TA 5J4QA 3R3GB 4ISLA 1TQ7B 1SQTA 2CN0H 3TGIE 4Y6DA 3ZZCA 2D8WA 4YT6H 3UY9A 1HAZB 1GI5A 3HK6B 2CMYA 1VGCC 1OWJA 4OGXA 2RCEA 4GUXA 1K28D 1O2IA 2F9OA 1XUGA 2Y5HA 1QQ4A 4AG2A 2BQ6B 2QF3A 3PMJA 3BEIB 1JIRA 3EGKH 3MWIU 1RRKA 4AN7A 1CGHA 1GVZA 5PTPA 1G30B 1QHRB 2FOEA 3SZNA 1Z7KA 3QO6A 1C5ZB 4NIXA 4ABEA 1PYTC 1ZPZA 4BOHA 2NU1E 2PWXA 1O2WA 3P92A 1VZQH 4GCHF 4Y0YE 4A1VA 2ZDVH 4Y8YA 4NCYA 4Y79A 3S0NA 3RLYH 4B76A 2B9LA 1S6HA 1ZSKA 5AFZH 2O9QA 8GCHF 1MBQA 2SGEE 1JOUB 1WU1A 4CHAC 3UNRA 1VCQA 3ZZ3A 2FZZA 1YPKH 2P3UB 1CA0B 1O3CA 2BLWA 2G4TA 4Z0KA 4K8BA 1BRBE 2ZTZA 1EKBB 1QBNA 4UFEH 1YM0A 4VGCC 2D1JA 4AYYB 3PMAB 3BTHE 1N6XA 4SGBE 4WMDA 1S82A 2AERH 1HAYB 3B23B 3RXHA 3TNTA 1O3DA 2ZDKA 1NU9A 1BOQA 2R9PA 1BQYA 1O2RA 1OWDA 2BVSH 2ZKSA 5F8TA 3BN9A 3V7TA 1IQJA 1AKSB 2ZNKH 1AVGH 2FTLE 1EASA 1ANEA 4XBBA 1SGIB 1HAHH 1BRUP 2BZAA 2VIQA 1EP6A 1OP0A 1J14A 1P09A 2XYAA 2Y80A 1UVPA 1ZSLA 4X2VA 1OP2A 4IGDA 3ZVGA 1PQ8A 1HJ8A 4K1SA 1YLDA 2SGQE 1RD3B 1GBEA 4JZ1A 1AQ7A 1YPJH 3GYLB 1FUJA 4HGCA 4Y10E 1TRNA 1GMHF 1DX5M 4BAHB 2AMQA 4B73A 1BHXF 3OSYA 2GMTB 2NU0E 3RXSA 3ZZ4A 3A7XA 1DVAH 5HGGA 1WQSA 1E0FD 1L1JA 1T32A 5EXLA 4IMZA 4Y8ZA 1EB1H 1EAWA 1F5RA 1FY8E 1G3EA 5F03A 1UJ1A 4YM9A 5C5NA 3PTBA 1O3JA 2G51A 2UUYA 4ZH8A 3V12A 1KXDA 2FODA 1HIAB 7LPRA 1AMHA 5C3NA 4B74A 4FVBA 4BNRA 2GZ7A 1PPFE 3PLKA 4Q2KA 1ZOMA 1TMBH 2OC8A 5DP3A 3SNBA 1C5OH 2TGPZ 1RTLA 5T3HA 1ABIH 1A2CH 2NWNA 3RXPA 2BYAX 1TGSZ 4X1QU 3BG4C 1PQ7A 1MZAA 4NIWA 1HAVA 2GZ8A 1LHGH 1EJNA 1W0YH 2ZDNA 5E0JA 5CHAB 3NUMA 2JH0D 3MO6A 2BY6X 1YCPM 1ANDA 1ZMNA 3T5FH 3LIWA 3SU2A 1C2FA 8ESTE 1O38A 1AY6H 1MTNC 3SU0A 4FUBA 3VB6A 1GGDB 1C5NH 3A84A 1GWAA 4INLA 2K1QA 1C1WH 4UONA 5ABWA 4X6OA 1SI5H 5TCAA 4YZUA 2IPHA 3EA8A 1EZSC 2QA9E 1QA7A 3JZ1B 2VGCC 3LC3A 1P2KA 1GHWH 3FAOA 3O8BA 2ANMH 4OS4A 3ATIA 3GISB 1Y3XA 4UEHH 4DVAU 3MO3A 4CBOA 1CT4E 2AH4X 1EPTB 3LGUA 3ESTA 2H9HA 1VITF 1UK3A 4DW2U 3LONA 2LPRA 3TJVA 5E0GA 1HXEH 5K7RA 4HI3A 3H7OA 1IHTH 4YT7H 1AZ8A 1OWEA 1NS3A 4UD9H 5GPIB 1MAYA 1OS8A 1Y59T 3BG4B 2BXUH 4WXVA 1HAVB 1ZZZA 1PPEE 3RXBA 1J17T 1O2LA 4RSPA 3M5NA 2A4RA 4IC5A 3NWUA 1G32B 4OS1A 1GBCA 1DITH 3P70B 3EDXB 1AB9C 3VEQB 1DUEA 1MD8A 1ZHMA 1DANH 1GJCB 3NK8A 4K1EA 1TGTA 4ZUHA 1SGFA 4AGKA 1AFQB 4E05H 4A7IB 1TPPA 1EZXC 1YC0A 1O3AA 4NSVA 3VXEH 2AS9A 3P95A 1CSOE 2LNCA 3RXMA 1C5WB 3TNSA 2ZPRA 4E06H 2VH0A 2QXHA 4GHQA 5H4IB 2SGFE 1JRSA 2TGDA 2NU4E 3A87A
chains in the Genus database with same CATH superfamily
1W11U 5EJLA 3PV4A 3RXAA 2UUKB 4ZXYH 3AW1A 1O2UA 1V2MT 2CGAA 2GDDA 2YMSC 3N7OA 1LPGB 2BDBA 4X8TH 2PP6A 3RM2H 2G5NA 2R2WU 1Q31A 2ZECA 3ZZ5A 1GI3A 2ZU3A 3SJ8A 2XCFA 1G2MA 1PPCE 2ZTXA 2GT8A 1IQEA 4JZIA 1DY8A 1VJAU 3SJ9A 2VIVA 4XD7D 1AO5A 2AHME 3ODDA 4YOGA 1UCYE 2ZHFH 2ZA5A 3T27A 1FAXA 2V3OH 3RXEA 2UWLA 1BBRH 1TRYA 3SUGA 1SFIA 2ZHQH 9LPRA 2J5UA 3WW7A 1FXYA 4UDWH 3KYGA 1W7GH 1CE5A 1Q3XA 2W26A 5DO4H 2AMPA 2FM2A 1C5XB 3ATKA 3WWFA 3SGQE 1GJDB 4Z1MD 1BMMH 5EGMA 1KXCA 3DFLA 4TPYA 3T28A 3FP8E 1MU8B 5E2OA 4UFDH 1XXDA 3VB4A 1W13U 3BTKE 1GMDG 2ILNA 4Y7AA 1MTSA 1CHOG 2BMGB 3IITA 1RFNA 1MKWH 3D62A 3UIRA 5FPTA 2V7QD 1EP5A 3S9BA 3A8AA 1G3DA 3VB3A 5IYTA 5EXNA 3GDUA 2PTCE 1AB9B 1G36A 2RA3A 4NWKA 2YNAA 3RXUA 2J97A 1PPHE 1F0RA 1DXWA 2ZHDA 2BZ6H 1JXPA 2GVFA 2JETB 4Y11E 6CHAC 5GIBA 3B8JA 2FOGA 2FI3E 2PGBB 3F68H 1T8MA 2G8TA 3F9GA 4MDSA 4XRNA 1OWHA 4ABHA 1P2QA 5C1XA 1O2GH 2JDID 3KN2A 3T26A 1DM4B 2BHGA 1BBRE 1HJAB 5GCHF 4LZ4B 2D26C 5FAHA 3P8OA 4DOQA 1O0DH 2VH6A 1KXBA 3WY8A 2FO9A 1BTWA 2QXGA 5E2PA 5FX6A 1OXGA 2HPPH 3IWMA 3SU6A 5C0TA 4U2WA 3OY5U 4X2WA 3RXIA 1QJ7B 7KMEH 4AGJA 5C17A 1GI1A 1SGRE 3GCHC 1GHBG 1LMWB 2J9NA 1LHDH 1H1BA 4MPUA 1W14U 1EATA 5DG6A 1Z6EA 3U69H 1O2PA 2C8ZB 2KCAA 2O8WA 2AGIX 5F6MA 1YYY1 1F7ZA 3A8DA 1F2SE 2F43B 5FL7D 1KSNA 1Z1JA 2J94A 5DP5A 1BHXB 1P03A 2ZPQA 2VJ1A 1DWCH 1GJAB 3K65B 3KGPA 4MTBA 1RTFB 4AFUA 2Q1JA 3RXJA 5JB9S 4O3UA 4D7FA 4RKJB 1HLTH 2VBCA 2VWNA 5FBIA 1BTUA 1FNIA 1GI4A 3BTME 2AMDA 4XBCA 3O8DA 1GJ8B 2A2QH 1NRSH 3MH4A 2JH6D 4LOYH 1E37B 5HYOA 2B5TB 1ZHPA 2W3KA 5JBBS 4ASHA 1CA8B 1V2OT 2QF5A 1A0LA 3TIUA 3SHCH 1GPZA 1RS0A 1ACBE 1TGCA 5JYIA 4X6PA 2ZGHA 2XRCA 1IQIA 1Z1IA 4GLYA 2G52A 2G55A 5EJ1A 1AI8H 3I29A 4Y76A 1OX1A 2WYJA 1TNGA 1ANBA 2GP9B 4O9VA 5A09A 1AWFH 3A81A 2ZCKP 2YOLA 3EYDA 3MI4A 2OINA 1T31A 4KP0A 2XBYA 2VWOA 1AHTH 2ZZUH 3SO3A 1NT1A 2HALA 1K0HA 4JK5A 1CBWB 1TIOA 4F48B 5I25A 1P06A 5EPNA 3MNBA 4Y0ZE 1DICA 2A4GA 2PKSC 3GYMA 4FUEA 5EQSA 2CHAC 3M61U 5AF9H 3SU3A 4UFGH 5EIYA 3UAIC 1CGJE 1RTKA 2OQ5A 3DSOA 4WY3A 1NTPA 5HM2A 3O8RA 2FOAA 1HFDA 3F3BA 1TMUH 3A8CA 1SOZA 2ZWLH 3SJIA 3RXFA 4LZ1H 2OC7A 2DUCA 1GCTB 4AFQA 1QTFA 1IQGA 1ELTA 1QRXA 2FS8A 1C4U2 1HCGA 2V3MA 4KTUA 1O3KA 4YOIA 2QCYA 1EOLA 1PYTD 3N99A 3SUFA 1ARBA 2ZEBA 1ANCA 2WUBA 1OSSA 1P2IA 1AVWA 1BUIA 1V2VT 1O2NA 4YXWD 1BITA 3SN8A 1HAOH 2VVVA 4B75A 1TONA 5G4BA 4AFSA 3K2UA 4MVNA 1GBTA 1EJAA 2ZFRH 3GY3A 1LHFH 4WF8A 1P57B 1GCDA 1SLXB 1HV7A 4UFFH 2CK3D 3U8OH 1QRZA 8KME2 2W7SA 2UUJB 1WUNH 3P8FA 3GY4A 1ZTKA 2P3FH 2WPJS 2P8OC 5BRRE 1XUKA 3PRBA 1PQ5A 1YCPK 3FFGA 1RXPA 2A5KA 2W5EA 1MCVA 1V2TT 1YPGH 4B2BA 2FMJA 4YLUA 3FVFB 3RXDA 1O5BB 2O8MA 4I8LA 3FN8A 1OP8A 3Q3XA 1SGDE 3ATMA 1T4VH 2JETC 2GV7A 3RC6A 2O8LA 1EB2A 2EI8A 3LU9B 3CNRA 1UTMA 3P6ZB 3V13A 1UTNA 1UTLM 3F6UH 1W0KD 1HAPH 5L30H 4Q7YA 1V2LT 4X6MA 1UCYK 1GBLA 2ZIQH 4B6EA 3GY6A 1BTHH 3KEEA 1CO7E 4NFEA 2BD2A 3H7TA 2A31A 3VB5A 2ZU5A 5B6LA 4X0WU 3MFJA 4ACAA 2QXIA 3BIUH 2PGQB 1W8BH 3S7KB 2KAIA 2VIOA 3MNXA 3S69A 3CS0A 4B2AA 1O3OA 2ZTYA 5FPSA 3I78A 3FP7E 2TRMA 1QR3E 1NN6A 3SNAA 1UTOA 1UVUH 2W7UA 2ZFQH 1C2HA 1ZTJA 5AVDA 1WDIA 4AOQA 2DE9A 6GCHF 2FWWA 1GHYH 2ZU1A 1O37A 2BM2A 3DCLA 3W1EA 3UOUA 3SW2B 1YGCH 1N8OC 1FY4A 2ZU4A 1TPAE 4ZAEA 4ZKNU 1E1QD 1DFPA 1C5RA 2AGEX 2BQWB 4KELA 4IW4E 4U32A 1DSTA 2FOFA 1W10U 1D3DB 1TRMA 3M5LA 2HVXA 4WMEA 4ZKRU 2PV9B 3SOSA 3F9HA 3TH2H 1P01A 4KKDA 3FP6E 2H5CA 1INCA 1LVMA 3P8NA 1JIMA 1O5DH 1T8OA 4NSYA 3U9AH 4I8KA 3SNEA 4HFPB 2ZU2A 2SGAA 1GMCF 1UK2A 1Z8IB 1JBUH 1NESE 3EA7A 3SU1A 1QRWA 1HAGE 4YTAA 2Z6BD 4RI0A 3GCNA 5KECA 1SHYA 2J34A 1GI0A 1QNJA 1YWUA 4I32A 2J98A 2XC0A 1ELGA 3B9FH 4Q7ZA 5JBTA 1P3CA 5C0UA 1GVLA 1MCTA 1W7XH 3S9AA 1FY5A 1WYKA 5FCRA 5HXFA 2BLOA 3O8CA 3VFEA 3EAJA 2BDHA 3PROA 3W95A 4ISHH 2BVXH 4DT7B 1V2PT 3UFAA 2EQNA 3LJJA 1OPHB 2WYGA 2P59A 4JZEH 5ETXA 1CBWC 5TJXA 1C5SA 4ZHAA 4LXBH 1HYLA 2Z9KA 4I8JA 1JRTA 1WQVH 2FX4A 2F9UA 1MKXK 3DSGA 1GBBA 1QCPA 4K3JA 1WAYB 2B8OH 1THPB 1PJPA 1C2LA 1AZZA 3HK3B 2XCNA 4BTTB 1DLKB 2OBOA 2Q6GA 1O5AB 1PPGE 3P17H 4FUJA 3T62A 2ZQ1A 4OS6A 1O3HA 1YBWA 3BTFE 3LC5A 2QC2A 3VB7A 1HBTH 3ZZDA 5CMXH 3GCTG 3F0OA 2FLBH 1O2XA 1TBQH 5EPYA 1H9LB 2Y7XA 4XBDA 2XWAA 3SU5A 1ELAA 4CRDA 4IN1A 2XC4A 4OS2A 3Q3KA 4FUHA 1J15A 4JCNA 2GMTC 1SSXA 1TFXA 1FIWA 2Y7ZA 5AFYH 2BD8A 1GBJA 1UTPA 1VCPA 1NROH 2BD5A 1H4WA 2KCOA 1S6LA 2ZHEH 1P2MA 3K6ZA 3M36A 1SQOA 4JMYA 1G2LA 3BG8A 3GOVB 5L2YH 1XVOA 1ZLRA 2ZFSA 3LGIA 4CRCA 5I46H 5DP8A 4A5TS 1GBFA 6LPRA 4DY7B 3KHVA 1W0ZU 2F91A 2BDAA 1Y5AT 2F9PA 3LGYA 1K1OA 4WMFA 1HB0B 3MYWA 1TOCB 2FI4E 1ELBA 3A80A 3F9EA 1WBGB 2V0BA 5F8XA 1S6FA 2F9VA 1GCTC 4D7GA 3FZDA 4NZLA 4NA7A 2UWPA 4BXSA 2K0QA 1FY1A 2I6QA 5TCCA 1N1LA 1P9SA 2QAAA 4TWWA 1OWKA 1UHBB 1GJ9B 3FZZA 1C5YB 5CHAC 3VXFH 2F3CE 2ZF0H 4AFZA 3NCLA 3FANA 2ZGBH 1U6QA 1O2TA 3SGAE 1O30A 3KQ5A 4TPIZ 3VPKA 4BAMB 1TX7A 1O33A 2EEKA 5LH8A 2QF4A 5JB8S 2WV5A 1H8DH 1PPZA 1Y3YA 2QN5T 1C5UA 1GL1A 4R8TB 2H5DA 1BMAA 1D6RA 1TLDA 1Z8JB 3UQOA 2FESH 1TNHA 2HLDD 3S7HB 4RN6A 1UO6A 4GSOA 4OS5A 4FU7A 5ESTE 1CHOF 1FN8A 4X2XA 1UMAH 3T2NA 2H2ZA 3ZZAA 2A7HA 2O8TA 3JZ2B 2A5IA 1OKXA 4ISIH 3UR6A 1O3LA 2BDCA 3M7QA 3M7TA 2GTBA 1T8NA 1X7AC 1L1GA 3Q00A 1ETRH 3PRDA 3SYJA 2ZGJA 5JDUB 3VGCC 3F2GA 1C5QA 1XUJA 2Z9JA 1AGJA 3Q3YA 3L6PA 4FU9A 4YO9A 4MNXA 3SORA 2XW9A 1BB0B 3CENA 1BTXA 1QFKH 2OTVA 3PO1C 3SBKA 4QT8C 4FUFA 1LPKB 3EQ0H 2V6NA 1XMNB 4M9FA 5T6GA 2BDGA 2ULLA 4X1NU 1YPHE 1KY9A 1FI8A 1GBIA 1EXFA 2FXRA 2VB0A 2WV4A 4GCHG 1D3PB 4Q7XA 5CHBA 3R0FA 4YLQH 1IAUA 1AWHB 1DUAA 1TABE 1O2MA 1UCYH 1V2NT 4BAQB 3P8GA 5EG4A 7GCHF 4FUGA 5GCHG 4DIHH 1HPGA 8GCHG 1A5IA 1S83A 4J2YB 3M7UA 4ZXXH 1MTUA 4THNH 2IPQX 3ZZ9A 4BTUB 3E90B 2VGCB 1TGNA 1XVMA 1C1UH 3AVZA 1TNJA 3DA9B 1S81A 4NZQA 2GGVB 4DIIH 1O3BA 1K22H 1GI7B 2FOCA 3A7YA 1TMTH 3ZV8A 3W94A 2XBVA 4F55A 3TK5A 1GBHA 5IDKA 3IG6B 3DFJA 3TJNA 1DLEA 1G9IE 4BANB 4MG3A 1DWBH 1G37A 1QGFA 3OE7D 2XTTB 3QUMP 5E8EH 1QA0A 3KCGH 2RA0A 2NU2E 2ZHWH 1SGQE 3I77A 1BJVA 4MNWA 2FTMA 1L0ZA 1CQQA 3URDA 1VGCB 2ALVA 3MH6A 1NRRH 2Z9GA 1FIZA 5EXMA 4AG1A 5FXLA 1TE0A 5GJ4B 2W3IA 1SB1H 2CF9H 2C8YB 3SV6A 1HAXB 4Y71A 1C5TA 1TYNA 1BCUH 2F83A 1K9OE 1H9HE 3PWCA 4ISNA 1B0EA 1O2ZA 1UVTH 2GZ9A 2ZP0H 1GJBB 2AEIH 2JJ2D 3M37A 2ZCLP 1ZRBA 2FLRH 1C1SA 1F5KU 3MNCA 4Q80A 1S5SA 4BTIB 7ESTE 5K0HA 1EQ9A 4U01A 1GHAG 1Z71A 2ODQA 1ZSJA 1GI2A 3T25A 2M5TA 2BVRH 1L2EA 2AYWA 2P8OB 4B1TA 4D9RA 2C90B 1VJ9U 3G01A 3PMBB 1J9CH 3SV2H 3UTUH 4AZ2B 5DGJA 1SGEE 4CH8B 4OM9A 4ZKOU 3V0XA 1SL3A 5C94A 1NZQH 2BOHB 1O5CB 1SGTA 1HJAC 2G81E 1HNEE 2BX3A 2FS9A 1O3NA 1GDUA 3BEFB 2ANYA 1H8ED 2GCHF 3KL6A 1P10A 2F4LA 2HVYB 1ELEE 2PSXA 9ESTA 2G4UA 4OGYA 3ZZ7A 2PKAA 4NA8A 3E6PH 1SHHB 1GG6C 2DE8A 1MTVA 3OTJE 2HNTF 3PMHB 3QX5H 3PTNA 4FUDA 1SMFE 3BSQA 1SGFG 1TA6A 4WH6A 3RXTA 3RXOA 2XC5A 1OOKB 3RMOH 2B7DH 3LGVA 5LPFA 2Y81A 4CR5A 1K1IA 1UTQA 1EJMA 5FCKA 1MBMA 3EE0B 1O2YA 1C1OA 1KLJH 2QF0A 3RXVA 1GL0E 2Q6DA 2OUAA 1FONA 1DY9A 2ZC9H 1RIWC 1TX6A 2FPZA 3RC5A 1F92A 2SGPE 3MU4A 1B7XB 2R3YA 3UNSA 1C2IA 5A0CA 2GJGA 1C1NA 2WPMS 2BXTH 3CS7A 4XSKU 3RM0H 3RXRA 1K1MA 2ZCHP 4MPXA 1QB6A 1K1JA 5GXPA 1Z6JH 4GPGA 1EUFA 3SV7A 3OEHD 1SFQB 5HIZA 1J8AA 3NPSA 4DGJA 1D9IA 2RDEA 3SNDA 3AAVA 1UVSH 3A88A 3UQVA 2SNVA 1ZMJA 2H9TH 1GDQA 1P05A 5LGOA 1Y8TA 2Z3EA 4XOJA 1N8OB 1NBME 4FU8A 1GJ6A 1KDQA 2GD4B 4F4OC 4OS7A 5DK1A 3SI3H 1P11E 1GBMA 2Y5FA 4NG9H 4TSFD 3AASA 5SGAE 4CRAA 1RJXB 2PW8H 4PROA 3PM3A 4AB8A 2A1DB 2VINA 1AU8A 3Q77A 4ZKSU 4IS5A 2ODPA 1DSUA 2A0QB 1TNLA 2L6OA 2Q6FA 3SQEE 4I31A 3SUEA 1GHXH 1YKTA 2BDYA 2HLCA 1MMJN 2NU3E 1ETSH 4Y8XA 1GBDA 1K1LA 1WOFA 1TWXB 4AORA 1D6WA 1MTWA 1UTJA 1O34A 1PPBH 3U1JB 1QBOA 3E0PB 1ZJKA 1O3FA 3PWBA 1EAIA 1GGDC 3LOXA 4D76A 2FDAA 3E8LA 1K1PA 4D8NA 1IHSH 1ESTA 2AGGX 1F0TA 2LP6A 2BY5X 1IOEA 2Y6TA 5DP7A 2R3UA 1OHHD 1UW7A 2XWBI 3BEUA 2H1UA 2YNBA 3TLOA 3H5CB 1XUFA 4UE7H 3SU4A 3SUDA 3RU4T 2EC9H 4DJZB 1A46H 1D4PB 2KR7A 1ORFA 1MQ6A 1RIWB 2G5VA 3KNXA 1QB9A 2AIQA 4VGCB 3QGNB 4A6LA 1NRNH 1GBAA 5A0AE 1E38B 1C2JA 4WWYA 3U98H 3NKKA 5L2ZH 1S0RA 3A86A 1BIOA 2AFQB 5C5OA 3SHAH 1Z8GA 2R0LA 3ZIAD 3MH7A 4O03A 4CBNA 3ATLA 2WINI 2UUFB 2ZGXH 2HWLB 5DPAA 1P9UA 2P93A 2BLVA 3UB0A 2J2UA 3RP2A 3SV8A 4CR9A 3DHKH 1BJUA 1DPOA 3BTWE 3K6YA 1YPHC 2XBXA 1AUTC 1LVOA 1QBVH 4FUCA 1TAWA 4TY6A 4MNVA 1YY3A 5JBCS 3NRLA 3GY5A 1EX3A 3ENSB 1XM1A 1C1VH 1DWDH 1HGTH 2WPIS 1GDNA 1S84A 1AFQC 1NRPH 2ZDLA 3RXKA 1EPTA 1KXFA 1GI9B 5DKMA 4ABFA 1AD8H 3M5OA 4A1TA 3OYPA 1O35A 2GCHG 1ZGVA 2STAE 3F1SB 1OYQA 1BRAA 4FUIA 1H8IH 2XOKD 1LKAA 3ZV9A 1O5EH 2C8WB 1EFRD 4FVDA 1V2QT 3KYFA 3ZYDA 5DN6D 4GVUA 2CHAB 1O2VA 3V3MA 1O32A 1V6DA 2CF8H 3M35A 1MH0A 1O31A 1FMGA 2K8IA 4SGAE 4I8HA 4KGAA 2ZG0H 2TGTA 2UWOA 5DP6A 4F49A 1LKBA 1VCWA 2WHXA 4JYVH 3FO8D 3D65E 1UVOA 1E1RD 2GX4A 1ZYOA 1HIAA 1W2KH 3S9CA 3MOCA 2AIPA 4WH8A 3SNCA 1VITH 1TPOA 5ESBA 3U8TH 1C1PA 1P12E 2L74A 1EZUC 1NM6A 1GHVH 3QTOH 3HGPA 1GJ5H 1SBWA 3LGWA 4A92A 1SGCA 1QL9A 4NIVA 2TIOA 1CGIE 1C5PA 1SGYE 3M3TA 1O5GH 1SR5C 4BXWA 3OEED 1XKBC 1KLIH 1SGNE 2C3SA 2KX4A 3SZEA 1P0SH 6CHAB 3DD2H 1S85A 1BBRK 1NBMD 1GVKB 1CA0C 4ZHLU 3STIA 2ZQ2A 1O2OA 3E3TA 3VGCB 1NU7B 3NZIA 3RXCA 1AKSA 3BTDE 3PLPA 4AX9H 1WXRA 5FHTA 5DP9A 5DSFA 1O2SA 1MUEB 3TK6A 2IJD1 2P16A 1QL8A 2PKSB 1NFXA 3LJOA 3A89A 3MHWU 2BQ7B 1DE7H 5EOKA 1GJ7B 5C67A 1QB1A 3MNSA 2Z7FE 3RUOA 1DXPA 2PKAB 1FZZA 2FYQA 1ZMLA 3F9FA 4JYTA 1YP9A 3GCOA 3ZZ8A 1YF4A 4H6TA 3SJOA 2J98B 2H6MA 5CE1A 3SV9A 2KCPA 5AHGH 4K5ZA 1NFUA 2OCVB 3ITIA 1A3EH 1C9PA 1GHAF 4Z6AH 1F0SA 1AVXA 4I8GA 2STBE 3KIDU 2EA3A 3DUXH 1XX9A 3GICB 3ZVDA 3QGJA 1IQMA 2OK5A 3PLBA 2IJOB 2ZGCA 2J38A 1WTGH 1V2ST 3RMMH 3E16B 3HKIB 3BTEE 1IQFA 4ABGA 4MLFB 1ELCA 2SGDE 1C1RA 4MPVA 2VVCA 3DT0H 2TBSA 1ZJDA 2VIPA 1IQLA 1KTSB 3UNQA 1O3PB 2OBQA 2OP9A 1C4Y2 4YOJA 1AE5A 1TPSA 1NC6A 3DSPA 4IC6A 2ZDMA 1BTZA 3RMNH 1L4ZA 1SVPA 1UHBA 1C5LH 2OC1A 3RXGA 4E7NA 3KQCA 2Y82A 3H09A 4HTCH 2FYRA 2WPLS 4NIYA 3T29A 3N7EA 1AUJA 1P2JA 1YLCA 4P00A 3A8BA 1VITG 2WPKS 4BAKB 5JBAS 2Z3CA 4ABJA 1V2JT 1ZTLA 4A1XA 1AIXH 1YPMH 1KMHB 4TWYA 1THRH 5BPEA 2PHBA 5LPRA 1SQRA 2ZFTA 2RDLA 2YMSD 2XNIA 3KQDA 1YCPH 3BF6H 1C2KA 5C1YA 3F2FA 2VU8E 5C1UA 3QLPH 1VKYA 3TJOA 4X1SU 4I7YH 2VVUA 1HDTH 3M3VA 2ANWA 5FBEA 3MU1A 1EOJA 1ABJH 1NO9H 1SLWB 2ZPSA 7GCHG 2FX6A 1C4V2 1W0JD 3QTVH 2BD7A 1FV9A 1HJ9A 2BD4A 4ZCNA 1O39A 1NY22 5F8ZA 4ABAA 3QWCH 4WJG2 3D23A 3FOAA 3BIVH 1HXFH 1ZHRA 3E1XB 1BTYA 1FLEE 1GHBF 2O8UA 3EE7A 1FJSA 2ESTE 1V2KT 1LVYA 2A45B 5A8XA 2V35A 2VWMA 1CVWH 4B6FA 2PUXB 1DWEH 1ELFA 1O3GA 3U8RH 2OC0A 3PYHA 1TA2A 2HPQH 1P02A 4H6SB 3RXLA 1GJ4H 4XDEA 1WCZA 4TY7A 1QURH 1P2NA 2FOMB 2R0KA 2EY4C 4LK4A 1NRQH 4M7GA 3GY8A 4ABBA 5GNDA 1JMOH 2CXVA 1GG6B 2C4FH 3TH4H 3HKJB 3EA9A 1KDQB 4RKOB 1XUHA 3C1KA 3TGJE 1A61H 3OFND 1D3TB 3MU0A 1GHZA 1SC8U 2OD3B 1KIGH 1BMLA 3LT3A 4YESB 5HM9A 5JPMH 2ANKH 1FN6A 1XXFA 4JZFH 1A0JA 2IN2A 5J4SA 3LH3A 3LDXH 4IN2A 1QJ1B 1K2I1 2A2XH 2BDIA 3HGNA 1A3BH 2IOTA 1ETTH 3QZRA 1C9TA 2G00A 1GI6A 1O2KA 4D9QA 2A4QA 1LQDB 4X1PU 4ABDA 4NFFA 1S0QA 4MNYA 4X6NA 1NPMA 2BLQA 1YPEH 1GMHG 2B0FA 1EAXA 1CU1A 1ELVA 3UUZA 4GAWA 6ESTA 1C5MD 1GI8B 1QL7A 2HOBA 2QXJA 3K9XB 1TBRH 3MTYA 1T4UH 1TX8A 2PR3A 4AC9A 2RG3A 4DURA 1A7SA 2FOBA 3ODFA 2WUCA 2ODYB 1V2UT 8LPRA 3GCHB 4ZROA 1M9UA 1G3CA 1Y5BT 1ZPCA 3PV5A 2Z9IA 3MU8A 3GCTF 1Y3WA 1MAXA 4K8YA 1ESAA 1A4WH 1C2GA 1MU6B 1OYTH 3GY2A 2HRVA 4HG6A 2W6ID 1GMCG 1ESBA 1L4DA 3STJA 2PSYA 2GCTB 3QN7A 1PQAA 4ACBA 5KEDA 4TT3D 1WV7H 4WVPE 3TU7H 1SG8B 1N6YA 2PTNA 2Z9LA 4B71A 4K69A 1Y5UT 1F5LA 5GDSH 1A1RA 1MABB 1LTOA 1OWIA 1QJ6B 1TOMH 1F0UA 2GV6A 2ASUB 2A32A 2OQUA 1G3BA 5LPEA 3RU4D 1MQ5A 1BRCE 1V2WT 1FPCH 3KQBA 1K21H 3TITA 3BV9B 4H42U 3UWIA 1KXEA 3UWJH 2ZFFH 2ZI2H 4JZDH 1C2DA 1LHEH 2EI6A 4AYVB 3ELAH 1C2MA 3ZVAA 3ZVBA 3QK1A 5C20A 1P04A 1FY3A 1TGBA 3UOPA 1HAIH 4GHTA 3ZZ6A 2ZFPH 4IBLH 3M5MA 1O3MA 2V3HH 3RC4A 1B5GH 1KLTA 4ISOA 3ZVEA 2H9EH 1ARCA 1TNKA 1EZQA 5HKKD 5E0HA 3HPTB 2F9NA 2D2DA 1UK4A 3A7TA 3L33A 1A5HA 1DS2E 1K1NA 1A0HB 4X8UH 1ID5H 5T6FA 1LDTT 2WPHS 2BD9A 2FI5E 2BTCE 3LGTA 1SLUB 4JYUH 1RGQA 2PUQH 2PLXA 2R2MB 2ZDAH 3RLWH 5EQQA 2GT7A 3E91A 2J4IA 2FIRH 1Y3UA 5A0BA 2ALPA 3MO9A 3QDZB 1L1NA 2J92A 2P3TB 3A85A 1J16A 1MZDA 1THSH 4HZHA 3URCA 4XFQA 1ZPBA 2QY0B 1DDJA 4Y7BA 4B2CA 3KF2A 4MQAA 1HUTH 2Y5GA 1HRTH 4AB9A 1PFXC 2HNTE 2A7JA 3SGBE 2P94A 3RDZA 1SQAA 4DG4A 1IQNA 1O5FH 2CV3A 1FAKH 3UPEA 1QQUA 1Y3VA 4ZMAH 3BTQE 1TB6H 3MH5A 3NXPA 3MMGA 3D49H 4E7RG 1W3CA 2TPIZ 2VNTA 3QZQA 1ZRKA 1MTNB 3U1IB 1SOTA 5EJZA 1BZXE 1O2HA 2BY9X 5EU8A 3L3TA 2VIWA 2QIQA 2GDEH 3OY6U 1O2JA 3OX7U 1BMNH 4X8VH 4CRBA 1BA8B 3WWBA 1FDPA 2JIZD 1MD7A 2KFWA 4NGAH 4WXIA 5HMAA 4KTCA 4ASUD 1AFEH 2EI7A 4ESTE 2WPDD 1WSSH 1SGPE 2TGAA 1B0FA 1TBZH 3A7ZA 4Q4LA 3A7VA 2ZO3H 3A83A 3PB1E 1LCYA 4DCDA 3SI4H 3TK9A 1EAUA 2BB4A 3PO1B 5DP4A 1EPTC 3GDVA 1C5VA 1T7CA 1O2QA 4K2YA 4TYDA 1QIXB 4NWLA 1KTTB 1SLVB 4H4FA 1IQKA 1C1QA 3TGKE 4X8SH 3AW0A 1BTPA 4X1RU 4ZHMU 5L6NH 2KM0A 2A5AA 2C8XB 2FOHA 3RXQA 1LPZB 3TVJB 1KYNA 1DT2A 1P8VC 5EQRA 1O3IA 3HATH 4KTSA 4P02A 4XE4A 6GCHG 2VWLA 5T6DA 4CRFA 2BX4A 4CH2B 5CDFE 1VR1H 2A7CA 5A8ZA 1MKXH 2FEQH 4INHA 2YMSB 5FX5A 2XBWA 4CREA 5EODA 1FQ3A 4FETA 3ZYEA 2FP7B 3Q76A 3TPIZ 3RU4E 1Z8RA 2JKHA 5DJ7A 4ABIA 4FXGH 1ZR0A 2GKVE 2J95A 1FPHH 1E34B 3TJUA 3ZVFA 1AE8H 4K1TA 1TALA 2F9BH 2HNTC 4INKA 4DT4A 5EW1H 1CT2E 1V3XA 1E35B 3C27B 1A5GH 3M3SA 1E36B 3E0NB 3UR9A 1GBKA 1BMFD 2BY8X 2QV1A 1D3QB 1YPLH 2Z94A 3FKSD 1H9IE 3OAAD 4IMQA 3ATWA 2OLGA 1T8LA 1NFWA 1JWTA 1XUIA 3OU0A 1KXAA 2JH5D 3GDSA 1C1TA 1UTKA 4Q63A 1P3EA 5A2MH 4O97A 2SNWA 1IQHA 5C2ZA 3BTTE 4I33A 2CJIA 1LVBA 1C1MA 1QY6A 1CT0E 3AAUA 1TNIA 3LPRA 3SQHE 3ZVCA 1LO6A 1LHCH 3A82A 3LKWA 5EW2H 1SPJA 3BTGE 1TQ0B 4K60A 3KQEA 2RFKC 1ZGIA 1AN1E 2OXSA 2GCTC 2QYIA 3MU5A 1BT7A 1MKWK 2Z3DA 1O3EA 1P2OA 2QGRA 1C2EA 3MQKC 2BY7X 4BAOB 4MPWA 3A7WA 4X2YA 1ELDE 4U30A 2C93B 2SFAA 3CP7A 5FPYA 5GWZA 2BOKA 3U28C 5A8YA 3TH3H 1Q2WA 3GY7A 2HGTH 5B6OA 4NA9H 4R0IA 1V2RT 2P95A 1O36A 1WTHD 3ZZBA 2XXLA 1DOJA 2KAIB 1W12U 4JK6A 2THFB 3SJKA 3UREA 4CHAB 2VIDA 1NFYA 4CRGA 4J1YA 5KGOA 1LQEA 1BDAA 2PFEA 2I6SA 3LH1A 1XKAC 3RMLH 1CHGA 2BD3A 1GMDF 2JJ1D 2A4OA 4O3TA 5J4QA 3R3GB 5IK2D 4ISLA 1TQ7B 1SQTA 2CN0H 3TGIE 4RT0A 4Y6DA 3ZZCA 2D8WA 4YT6H 3UY9A 1HAZB 1GI5A 3HK6B 2CMYA 5F53A 1VGCC 1OWJA 4OGXA 2RCEA 4GUXA 1H8HD 1K28D 1O2IA 2F9OA 1XUGA 2Y5HA 1E79D 1QQ4A 4AG2A 2BQ6B 1FX0B 2QF3A 5HIYA 3PMJA 3BEIB 1JIRA 3EGKH 3MWIU 1RRKA 4AN7A 1CGHA 1GVZA 5PTPA 1G30B 1QHRB 2FOEA 3SZNA 1Z7KA 3QO6A 1C5ZB 4NIXA 4ABEA 1PYTC 1ZPZA 4BOHA 3AK5A 2NU1E 2PWXA 1O2WA 2XNDD 3P92A 1VZQH 4GCHF 4Y0YE 4A1VA 2ZDVH 4Y8YA 4NCYA 4Y79A 3S0NA 3RLYH 4B76A 2B9LA 1S6HA 1ZSKA 5AFZH 2O9QA 8GCHF 1MBQA 2SGEE 1JOUB 1WU1A 4CHAC 1QZ8A 3UNRA 1VCQA 3ZZ3A 2FZZA 1YPKH 2P3UB 1CA0B 1O3CA 2BLWA 2G4TA 4Z0KA 4K8BA 1BRBE 2ZTZA 1EKBB 1QBNA 3OTPA 4UFEH 1YM0A 4VGCC 2D1JA 4AYYB 3PMAB 3BTHE 2WZQA 1N6XA 4SGBE 4WMDA 1S82A 2AERH 1HAYB 3B23B 3RXHA 3TNTA 1O3DA 2ZDKA 1NU9A 1BOQA 2R9PA 1BQYA 1O2RA 1OWDA 2BVSH 2ZKSA 5F8TA 3BN9A 3V7TA 1IQJA 1AKSB 2LELA 2ZNKH 1AVGH 2FTLE 1EASA 1ANEA 4XBBA 1SGIB 1HAHH 1BRUP 2BZAA 2VIQA 1EP6A 1OP0A 1J14A 1P09A 2XYAA 2Y80A 2KZ4A 1UVPA 1ZSLA 4X2VA 1OP2A 3F0PA 4IGDA 1PQ8A 3ZVGA 1HJ8A 4K1SA 1YLDA 2SGQE 1RD3B 1GBEA 4JZ1A 1AQ7A 1YPJH 3GYLB 1FUJA 4HGCA 4Y10E 1TRNA 1GMHF 2KCYA 1DX5M 4BAHB 2AMQA 4B73A 1BHXF 3GS9A 2GMTB 2NU0E 3OSYA 3RXSA 3ZZ4A 3A7XA 1DVAH 5HGGA 1WQSA 1E0FD 1L1JA 1T32A 5EXLA 4IMZA 4Y8ZA 1EB1H 1EAWA 1F5RA 1FY8E 1G3EA 5F03A 1UJ1A 4YM9A 5C5NA 3PTBA 1O3JA 2G51A 2UUYA 4ZH8A 3V12A 1KXDA 2FODA 1HIAB 3VG8A 7LPRA 1AMHA 5C3NA 4B74A 4FVBA 4BNRA 2GZ7A 1PPFE 3PLKA 4Q2KA 1ZOMA 1TMBH 2OC8A 5DP3A 3SNBA 1C5OH 2TGPZ 1RTLA 5T3HA 1ABIH 1A2CH 2NWNA 3RXPA 2BYAX 1TGSZ 4X1QU 3BG4C 1PQ7A 1MZAA 1YLNA 4NIWA 1HAVA 2GZ8A 1LHGH 1EJNA 1W0YH 2ZDNA 5E0JA 2QE7D 5CHAB 3NUMA 3PV2A 2JH0D 3MO6A 2BY6X 1YCPM 1ANDA 1ZMNA 3T5FH 3LIWA 3SU2A 1C2FA 8ESTE 1O38A 1AY6H 3F2HA 1MTNC 3SU0A 4FUBA 3VB6A 1GGDB 1C5NH 3A84A 1GWAA 4INLA 2K1QA 1C1WH 4UONA 5ABWA 4X6OA 1SI5H 5TCAA 4YZUA 2IPHA 3EA8A 1EZSC 2QA9E 1QA7A 3JZ1B 2VGCC 3LC3A 1P2KA 1GHWH 3FAOA 3N7DA 3O8BA 2ANMH 4OS4A 3ATIA 3GISB 1Y3XA 4UEHH 4DVAU 3MO3A 4CBOA 1CT4E 2AH4X 1EPTB 3LGUA 3ESTA 2H9HA 1VITF 1UK3A 2W6JD 4DW2U 3LONA 2LPRA 3TJVA 5E0GA 1HXEH 5K7RA 4HI3A 4RT1A 3H7OA 1IHTH 4YT7H 1AZ8A 1OWEA 5T1VA 1NS3A 4UD9H 5GPIB 1MAYA 1OS8A 1Y59T 3BG4B 2BXUH 4WXVA 1HAVB 1ZZZA 1PPEE 3RXBA 1J17T 1O2LA 2WV9A 4RSPA 3M5NA 2A4RA 4IC5A 3NWUA 1G32B 4OS1A 1GBCA 1DITH 3P70B 3EDXB 1AB9C 3VEQB 1DUEA 1MD8A 1ZHMA 1DANH 1GJCB 1COWD 3NK8A 4K1EA 1TGTA 4ZUHA 1SGFA 4AGKA 1AFQB 4E05H 4A7IB 1SKYE 1EZXC 1TPPA 1YC0A 2WSSD 1O3AA 4NSVA 3VXEH 2AS9A 4I86A 4FOUC 3P95A 1CSOE 2LNCA 3RXMA 1C5WB 3TNSA 2ZPRA 4E06H 2M2AA 2QXHA 2VH0A 4GHQA 5H4IB 2SGFE 1JRSA 2TGDA 2NU4E 3A87A
chains in the Genus database with same CATH topology
1W11U 3PV4A 3RXAA 2UUKB 4ZXYH 3AW1A 1O2UA 1V2MT 2CGAA 2GDDA 3N7OA 1LPGB 2BDBA 4X8TH 3RM2H 2G5NA 2R2WU 1Q31A 2ZECA 3ZZ5A 1GI3A 2ZU3A 3SJ8A 2XCFA 1G2MA 1PPCE 2ZTXA 2GT8A 1IQEA 4JZIA 1DY8A 1VJAU 3SJ9A 2VIVA 1AO5A 3ODDA 4YOGA 1UCYE 2ZHFH 2ZA5A 3T27A 1FAXA 2V3OH 3RXEA 2UWLA 1BBRH 1TRYA 3SUGA 1SFIA 2ZHQH 9LPRA 1FXYA 4UDWH 1W7GH 1CE5A 1Q3XA 2W26A 5DO4H 2AMPA 2FM2A 1C5XB 3ATKA 3SGQE 1GJDB 1BMMH 5EGMA 1KXCA 3DFLA 4TPYA 3T28A 3FP8E 1MU8B 5E2OA 4UFDH 1XXDA 3VB4A 1W13U 3BTKE 1GMDG 2ILNA 4Y7AA 1MTSA 1CHOG 2BMGB 3IITA 1RFNA 1MKWH 3D62A 3UIRA 5FPTA 1EP5A 3S9BA 3A8AA 1G3DA 3VB3A 5IYTA 5EXNA 3GDUA 2PTCE 1AB9B 1G36A 2RA3A 4NWKA 2YNAA 3RXUA 1PPHE 1F0RA 1DXWA 2ZHDA 2BZ6H 1JXPA 2GVFA 2JETB 4Y11E 6CHAC 5GIBA 3B8JA 2FOGA 2FI3E 2PGBB 3F68H 1T8MA 2G8TA 3F9GA 4MDSA 4ABHA 1OWHA 1P2QA 5C1XA 1O2GH 3KN2A 3T26A 1DM4B 2BHGA 1BBRE 1HJAB 5GCHF 4LZ4B 2D26C 5FAHA 3P8OA 4DOQA 1O0DH 2VH6A 1KXBA 3WY8A 2FO9A 1BTWA 2QXGA 5E2PA 5FX6A 1OXGA 2HPPH 3IWMA 3SU6A 4U2WA 3OY5U 4X2WA 3RXIA 1QJ7B 7KMEH 4AGJA 1GI1A 1SGRE 3GCHC 1GHBG 1LMWB 2J9NA 1LHDH 1H1BA 4MPUA 1W14U 1EATA 5DG6A 1Z6EA 3U69H 1O2PA 2C8ZB 2O8WA 2AGIX 5F6MA 1YYY1 1F7ZA 3A8DA 1F2SE 1KSNA 1Z1JA 2J94A 5DP5A 1BHXB 1P03A 2ZPQA 2VJ1A 1DWCH 1GJAB 3K65B 3KGPA 4MTBA 1RTFB 4AFUA 2Q1JA 3RXJA 5JB9S 4O3UA 4D7FA 4RKJB 1HLTH 2VWNA 5FBIA 1BTUA 1FNIA 1GI4A 3BTME 2AMDA 4XBCA 3O8DA 1GJ8B 2A2QH 1NRSH 3MH4A 2JH6D 4LOYH 1E37B 5HYOA 2B5TB 1ZHPA 2W3KA 5JBBS 4ASHA 1CA8B 1V2OT 1A0LA 3TIUA 3SHCH 1GPZA 1RS0A 1ACBE 1TGCA 5JYIA 4X6PA 2ZGHA 2XRCA 1IQIA 1Z1IA 4GLYA 2G52A 2G55A 1AI8H 3I29A 4Y76A 1OX1A 2WYJA 1TNGA 1ANBA 2GP9B 4O9VA 5A09A 1AWFH 3A81A 2ZCKP 2YOLA 3EYDA 3MI4A 2OINA 1T31A 4KP0A 2XBYA 2VWOA 1AHTH 2ZZUH 3SO3A 1NT1A 2HALA 4JK5A 1CBWB 1TIOA 5I25A 1P06A 5EPNA 3MNBA 4Y0ZE 1DICA 2A4GA 2PKSC 3GYMA 4FUEA 5EQSA 2CHAC 3M61U 5AF9H 3SU3A 4UFGH 1CGJE 1RTKA 2OQ5A 4WY3A 1NTPA 5HM2A 3O8RA 2FOAA 1HFDA 1TMUH 3A8CA 1SOZA 2ZWLH 3SJIA 3RXFA 4LZ1H 2OC7A 2DUCA 1GCTB 4AFQA 1QTFA 1IQGA 1ELTA 1QRXA 2FS8A 1C4U2 1HCGA 4KTUA 1O3KA 4YOIA 2QCYA 1EOLA 1PYTD 3SUFA 1ARBA 2ZEBA 1ANCA 2WUBA 1OSSA 1P2IA 1AVWA 1BUIA 1V2VT 1O2NA 1BITA 3SN8A 1HAOH 2VVVA 4B75A 1TONA 5G4BA 4AFSA 3K2UA 4MVNA 1GBTA 1EJAA 2ZFRH 3GY3A 1LHFH 4WF8A 1P57B 1GCDA 1SLXB 1HV7A 4UFFH 3U8OH 1QRZA 8KME2 2W7SA 2UUJB 1WUNH 3P8FA 3GY4A 1ZTKA 2P3FH 2WPJS 2P8OC 5BRRE 1XUKA 1PQ5A 1YCPK 3FFGA 2W5EA 1RXPA 2A5KA 1MCVA 1V2TT 1YPGH 4B2BA 2FMJA 4YLUA 3FVFB 3RXDA 1O5BB 2O8MA 4I8LA 1OP8A 3Q3XA 1SGDE 3ATMA 1T4VH 2JETC 2GV7A 3RC6A 2O8LA 1EB2A 2EI8A 3LU9B 1UTMA 3P6ZB 3V13A 1UTNA 1UTLM 3F6UH 1HAPH 5L30H 4Q7YA 1V2LT 4X6MA 1UCYK 1GBLA 2ZIQH 3GY6A 1BTHH 3KEEA 1CO7E 4NFEA 2BD2A 3H7TA 2A31A 3VB5A 2ZU5A 4X0WU 3MFJA 2QXIA 3BIUH 2PGQB 1W8BH 3S7KB 2KAIA 2VIOA 3MNXA 3S69A 3CS0A 4B2AA 1O3OA 2ZTYA 5FPSA 3I78A 3FP7E 2TRMA 1QR3E 1NN6A 3SNAA 1UTOA 1UVUH 2W7UA 2ZFQH 1C2HA 1ZTJA 5AVDA 4AOQA 2DE9A 6GCHF 2FWWA 1GHYH 2ZU1A 1O37A 2BM2A 3UOUA 3SW2B 1YGCH 1N8OC 1FY4A 2ZU4A 1TPAE 4ZAEA 4ZKNU 1DFPA 1C5RA 2AGEX 2BQWB 4KELA 4IW4E 4U32A 1DSTA 2FOFA 1W10U 1D3DB 1TRMA 3M5LA 2HVXA 4WMEA 4ZKRU 2PV9B 3SOSA 3F9HA 3TH2H 1P01A 4KKDA 3FP6E 2H5CA 1INCA 1LVMA 3P8NA 1JIMA 1O5DH 1T8OA 4NSYA 3U9AH 4I8KA 3SNEA 4HFPB 2ZU2A 2SGAA 1GMCF 1UK2A 1Z8IB 1JBUH 1NESE 3EA7A 3SU1A 1QRWA 1HAGE 4YTAA 2Z6BD 3GCNA 1SHYA 2J34A 1GI0A 1QNJA 4I32A 2XC0A 1ELGA 3B9FH 4Q7ZA 5JBTA 1P3CA 1GVLA 1MCTA 1W7XH 3S9AA 1FY5A 1WYKA 5FCRA 5HXFA 2BLOA 3O8CA 3VFEA 3EAJA 2BDHA 3PROA 3W95A 4ISHH 2BVXH 4DT7B 1V2PT 3UFAA 3LJJA 1OPHB 2WYGA 2P59A 4JZEH 5ETXA 1CBWC 5TJXA 1C5SA 4ZHAA 4LXBH 1HYLA 2Z9KA 4I8JA 1JRTA 1WQVH 2FX4A 2F9UA 1MKXK 1GBBA 1QCPA 4K3JA 1WAYB 2B8OH 1THPB 1PJPA 1C2LA 1AZZA 3HK3B 2XCNA 4BTTB 1DLKB 2OBOA 2Q6GA 1O5AB 1PPGE 3P17H 4FUJA 3T62A 2ZQ1A 4OS6A 1O3HA 1YBWA 3BTFE 3LC5A 2QC2A 3VB7A 1HBTH 3ZZDA 5CMXH 3GCTG 2FLBH 1O2XA 1TBQH 5EPYA 1H9LB 2Y7XA 4XBDA 2XWAA 3SU5A 1ELAA 4CRDA 4IN1A 2XC4A 4OS2A 3Q3KA 4FUHA 1J15A 4JCNA 2GMTC 1SSXA 1TFXA 1FIWA 2Y7ZA 5AFYH 2BD8A 1GBJA 1UTPA 1VCPA 1NROH 2BD5A 1H4WA 2ZHEH 1P2MA 3K6ZA 3M36A 1SQOA 4JMYA 1G2LA 3BG8A 3GOVB 5L2YH 1XVOA 1ZLRA 2ZFSA 3LGIA 4CRCA 5I46H 5DP8A 4A5TS 1GBFA 6LPRA 4DY7B 3KHVA 1W0ZU 2F91A 2BDAA 1Y5AT 2F9PA 3LGYA 1K1OA 4WMFA 1HB0B 3MYWA 1TOCB 2FI4E 1ELBA 3A80A 3F9EA 1WBGB 2V0BA 5F8XA 1S6FA 2F9VA 1GCTC 4D7GA 3FZDA 4NZLA 4NA7A 2UWPA 4BXSA 1FY1A 2I6QA 5TCCA 1N1LA 1P9SA 2QAAA 4TWWA 1OWKA 1UHBB 1GJ9B 3FZZA 1C5YB 5CHAC 3VXFH 2F3CE 2ZF0H 4AFZA 3NCLA 3FANA 2ZGBH 1U6QA 1O2TA 3SGAE 1O30A 4TPIZ 3VPKA 4BAMB 1TX7A 1O33A 2EEKA 5LH8A 5JB8S 2WV5A 1H8DH 1PPZA 1Y3YA 2QN5T 1C5UA 1GL1A 4R8TB 2H5DA 1BMAA 1D6RA 1TLDA 1Z8JB 3UQOA 2FESH 1TNHA 3S7HB 4RN6A 1UO6A 4GSOA 4OS5A 4FU7A 5ESTE 1CHOF 1FN8A 4X2XA 1UMAH 3T2NA 2H2ZA 3ZZAA 2A7HA 2O8TA 3JZ2B 2A5IA 1OKXA 4ISIH 3UR6A 1O3LA 2BDCA 3M7QA 3M7TA 2GTBA 1T8NA 1X7AC 1L1GA 3Q00A 1ETRH 2ZGJA 5JDUB 3VGCC 1C5QA 1XUJA 2Z9JA 1AGJA 3Q3YA 3L6PA 4FU9A 4YO9A 4MNXA 3SORA 2XW9A 1BB0B 3CENA 1BTXA 1QFKH 2OTVA 3PO1C 3SBKA 4QT8C 4FUFA 1LPKB 3EQ0H 2V6NA 1XMNB 5T6GA 2BDGA 2ULLA 4X1NU 1YPHE 1KY9A 1FI8A 1GBIA 1EXFA 2FXRA 2VB0A 2WV4A 4GCHG 1D3PB 4Q7XA 3R0FA 4YLQH 1IAUA 1AWHB 1DUAA 1TABE 1O2MA 1UCYH 1V2NT 4BAQB 3P8GA 5EG4A 7GCHF 4FUGA 5GCHG 4DIHH 1HPGA 8GCHG 1A5IA 1S83A 4J2YB 3M7UA 4ZXXH 1MTUA 4THNH 3ZZ9A 4BTUB 3E90B 2VGCB 1TGNA 1XVMA 1C1UH 3AVZA 1TNJA 3DA9B 1S81A 4NZQA 2GGVB 4DIIH 1O3BA 1K22H 1GI7B 2FOCA 3A7YA 1TMTH 3ZV8A 3W94A 2XBVA 5IDKA 3TK5A 1GBHA 3IG6B 3DFJA 3TJNA 1DLEA 1G9IE 4BANB 4MG3A 1DWBH 1G37A 1QGFA 2XTTB 3QUMP 5E8EH 1QA0A 3KCGH 2RA0A 2NU2E 2ZHWH 1SGQE 3I77A 1BJVA 4MNWA 2FTMA 1L0ZA 1CQQA 3URDA 1VGCB 2ALVA 3MH6A 1NRRH 2Z9GA 1FIZA 5EXMA 4AG1A 5FXLA 1TE0A 5GJ4B 2W3IA 1SB1H 2CF9H 2C8YB 3SV6A 1HAXB 4Y71A 1C5TA 1TYNA 1BCUH 2F83A 1K9OE 1H9HE 3PWCA 4ISNA 1B0EA 1O2ZA 1UVTH 2GZ9A 2ZP0H 1GJBB 2AEIH 3M37A 2ZCLP 1ZRBA 2FLRH 1C1SA 1F5KU 3MNCA 4Q80A 1S5SA 4BTIB 7ESTE 5K0HA 1EQ9A 4U01A 1GHAG 1Z71A 2ODQA 1ZSJA 1GI2A 3T25A 2M5TA 2BVRH 1L2EA 2AYWA 2P8OB 4B1TA 4D9RA 2C90B 1VJ9U 3G01A 3PMBB 1J9CH 3SV2H 3UTUH 4AZ2B 5DGJA 1SGEE 4CH8B 4ZKOU 3V0XA 1SL3A 1NZQH 2BOHB 1O5CB 1SGTA 1HJAC 2G81E 1HNEE 2BX3A 2FS9A 1O3NA 1GDUA 3BEFB 2ANYA 2GCHF 3KL6A 1P10A 1ELEE 2PSXA 9ESTA 2G4UA 4OGYA 3ZZ7A 2PKAA 4NA8A 3E6PH 1SHHB 1GG6C 2DE8A 1MTVA 3OTJE 2HNTF 3PMHB 3QX5H 3PTNA 4FUDA 1SMFE 3BSQA 1SGFG 1TA6A 4WH6A 3RXTA 3RXOA 2XC5A 1OOKB 3RMOH 2B7DH 3LGVA 5LPFA 2Y81A 4CR5A 1K1IA 1UTQA 1EJMA 5FCKA 1MBMA 3EE0B 1O2YA 1C1OA 1KLJH 2QF0A 3RXVA 1GL0E 2Q6DA 2OUAA 1FONA 1DY9A 2ZC9H 1RIWC 1TX6A 2FPZA 3RC5A 1F92A 2SGPE 3MU4A 1B7XB 2R3YA 3UNSA 1C2IA 5A0CA 1C1NA 2WPMS 2BXTH 3CS7A 4XSKU 3RM0H 3RXRA 1K1MA 2ZCHP 4MPXA 1QB6A 1K1JA 5GXPA 1Z6JH 4GPGA 1EUFA 3SV7A 1SFQB 1J8AA 3NPSA 4DGJA 1D9IA 3SNDA 3AAVA 1UVSH 3A88A 3UQVA 2SNVA 1ZMJA 2H9TH 1GDQA 1P05A 5LGOA 1Y8TA 2Z3EA 4XOJA 1N8OB 4FU8A 1GJ6A 1KDQA 2GD4B 4F4OC 4OS7A 5DK1A 3SI3H 1P11E 1GBMA 2Y5FA 4NG9H 3AASA 5SGAE 4CRAA 1RJXB 2PW8H 4PROA 3PM3A 4AB8A 2A1DB 2VINA 1AU8A 3Q77A 4ZKSU 4IS5A 2ODPA 1DSUA 2A0QB 1TNLA 2Q6FA 3SQEE 4I31A 3SUEA 1GHXH 1YKTA 2BDYA 2HLCA 1MMJN 2NU3E 1ETSH 4Y8XA 1GBDA 1K1LA 1WOFA 1TWXB 4AORA 1D6WA 1MTWA 1UTJA 1O34A 1PPBH 3U1JB 1QBOA 3E0PB 1ZJKA 1O3FA 3PWBA 1EAIA 1GGDC 3LOXA 4D76A 2FDAA 3E8LA 1K1PA 4D8NA 1IHSH 1ESTA 2AGGX 1F0TA 2BY5X 1IOEA 2Y6TA 5DP7A 2R3UA 2XWBI 3BEUA 2H1UA 2YNBA 3TLOA 3H5CB 1XUFA 4UE7H 3SU4A 3SUDA 3RU4T 2EC9H 4DJZB 1A46H 1D4PB 1ORFA 1MQ6A 1RIWB 2G5VA 3KNXA 1QB9A 2AIQA 4VGCB 3QGNB 4A6LA 1NRNH 1GBAA 5A0AE 1E38B 1C2JA 4WWYA 3U98H 3NKKA 5L2ZH 1S0RA 3A86A 1BIOA 2AFQB 5C5OA 3SHAH 1Z8GA 2R0LA 3MH7A 4O03A 4CBNA 3ATLA 2WINI 2UUFB 2ZGXH 2HWLB 5DPAA 1P9UA 2P93A 2BLVA 2J2UA 3RP2A 3SV8A 4CR9A 3DHKH 1BJUA 1DPOA 3BTWE 3K6YA 1YPHC 2XBXA 1AUTC 1LVOA 1QBVH 4FUCA 1TAWA 4TY6A 4MNVA 5JBCS 3GY5A 1EX3A 3ENSB 1XM1A 1C1VH 1DWDH 1HGTH 2WPIS 1GDNA 1S84A 1AFQC 1NRPH 2ZDLA 3RXKA 1EPTA 1KXFA 1GI9B 5DKMA 4ABFA 1AD8H 3M5OA 4A1TA 3OYPA 1O35A 2GCHG 1ZGVA 2STAE 3F1SB 1OYQA 1BRAA 4FUIA