2SGAA

Electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title Electron density calculations as an extension of protein structure refinement. Streptomyces griseus protease A at 1.5 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1983-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA01
3RMMH 1ETTH 1O2XA 1Q2WA 4U32A 3K2UA 3TGIE 1EAUA 1ID5H 2DE8A 1PPHE 4Y8YA 1HAVB 4YZUA 1WOFA 3GY3A 1C2KA 1TNIA 3S7HB 1BOQA 4UFFH 3STJA 1TA6A 1O30A 4NCYA 1O2ZA 1GMDG 1GJ8B 1HV7A 1QCPA 1E0FD 1P2KA 1K22H 1WSSH 5J4QA 1CU1A 3VB5A 1ARBA 3EGKH 2G81E 1C2FA 4A6LA 2ZP0H 4NFEA 1DUEA 1IQJA 3H7OA 1TX6A 3L3TA 3TH2H 2KAIB 1SGYE 5EW2H 2TGDA 1GBBA 5EPYA 3JZ1B 4ABFA 1IQHA 4JCNA 2CV3A 2SGDE 2ZDAH 4I8HA 3VGCC 1EXFA 1XM1A 1ZPZA 1P12E 3FAOA 1A46H 1VGCC 3GY8A 2CF9H 3LOXA 4X1PU 2O8MA 2XCNA 1V2VT 5E2PA 2TGAA 3SGBE 2PUQH 3SUGA 1NPMA 1VZQH 3ZZDA 3SV2H 1VCQA 1JBUH 2XC5A 1SQAA 4K2YA 5E2OA 3S0NA 2VB0A 1YCPH 5H4IB 1FN6A 1C5NH 2TGPZ 1EP6A 1OWIA 1SI5H 3RXFA 3MOCA 1HAYB 2H9EH 1GVLA 3BTKE 2CGAA 1G37A 5EPNA 1DWDH 1UTMA 2GT7A 3T25A 1WQSA 2Y5GA 1ELVA 1B7XB 2V35A 1TNKA 3K6YA 1BBRE 4FUGA 4Y8XA 2XXLA 3RU4T 2A5AA 3BEUA 2PLXA 2BDYA 1ZZZA 2J95A 1BZXE 4YOGA 2J2UA 1O2KA 4X2XA 5C67A 3Q76A 1SFQB 3IG6B 2BD8A 2JH0D 2ZFPH 3TJOA 1XXDA 2EC9H 2ZA5A 5ETXA 3ZYEA 4JYUH 4WXVA 2IPHA 1DSTA 3ATIA 4Y7BA 2ZFFH 2FWWA 2WYGA 1T8LA 1DX5M 2ESTE 5AFYH 4ZXXH 1O2WA 1V2LT 1T8MA 5DP9A 1PQ7A 2Y7XA 2RCEA 4BAKB 1TE0A 2FTLE 1TGNA 1EASA 1YC0A 3P8FA 1N8OC 2GV7A 5F8XA 3ZVFA 1GI9B 3T2NA 3ZZ5A 4D8NA 5E0JA 1HAZB 4QT8C 1TB6H 3P8NA 4X6MA 1QB9A 4DVAU 1Z8JB 1P8VC 3GCTG 4ASHA 4MNYA 1XKAC 4DURA 3A81A 2RA0A 3NCLA 2C8XB 1TBZH 5CHAB 2BD9A 1D3QB 1PQ8A 4Q7YA 1YPMH 1BTHH 3ZZAA 2ZFSA 1BMNH 3SN8A 1DVAH 2PSXA 3M35A 4X2WA 1WUNH 1MTSA 3RMOH 2C8YB 4JZEH 3RXUA 4CBOA 2P8OB 1ZSKA 1AFEH 5FAHA 3D62A 2QXHA 1N6XA 3ZV8A 4Y71A 2ZDVH 1F5RA 3RXKA 2A45B 1GCTB 1C2HA 2F9PA 2XBYA 1SOTA 4HGCA 1C2IA 1O3CA 1TX7A 3BG4B 3SORA 2R9PA 4GHQA 2FOEA 1OYTH 1SGTA 3SNCA 1TALA 1JIRA 1EZSC 1BBRK 1JRTA 1IAUA 1RTKA 1QA0A 1C1QA 1W8BH 5PTPA 3MO3A 1SGQE 1CSOE 1CQQA 1MTVA 2O8TA 3RXRA 1V2KT 3PO1C 4X1NU 3DFLA 5DP4A 1W0YH 1LDTT 1THPB 1A1RA 1YPKH 2PKSC 1EAIA 1AB9B 3SUFA 4AG1A 1HAPH 1Y5BT 1C5UA 1P0SH 3H5CB 2SNVA 3URDA 1Y5AT 1A7SA 2GD4B 1S6HA 2STAE 4ISOA 1P03A 5HGGA 4NFFA 1ZTLA 5J4SA 4NIWA 2BY7X 3MU8A 1QJ1B 1K28D 1O5AB 3FP8E 1ZGIA 3RXQA 3BIVH 4F49A 1C5YB 2C8ZB 1N1LA 1ZPBA 1O3KA 2OC8A 2ZU1A 6CHAB 4OGYA 1EB2A 4FXGH 1AZZA 1P2JA 1QBOA 2FPZA 1IOEA 1CA0B 5EXLA 1K1NA 3EQ0H 1PPCE 4NZQA 1L2EA 1HFDA 3HKIB 1NFYA 1O2YA 4Y11E 1OSSA 1Z8GA 3MH5A 1KLIH 1BBRH 1JXPA 1UVOA 5K7RA 2QYIA 1C5QA 2ZQ2A 3T27A 2F9VA 4B73A 2ODQA 3Q3KA 4TY7A 1YGCH 3G01A 2AYWA 4K60A 3VB6A 3QK1A 1VCWA 1QFKH 1MQ5A 4AFQA 1E37B 2WYJA 1O3BA 5DP5A 3TGJE 2ZGJA 3ATLA 1C5ZB 3NUMA 3P92A 2BD2A 1AZ8A 2A2QH 3LU9B 2ZHQH 3SGAE 3QGNB 4K8YA 5GIBA 2QN5T 2ANMH 5K0HA 8ESTE 4NWKA 1ZTJA 4MPUA 3RXDA 4J1YA 3SU2A 1TGCA 2ZCLP 3A7TA 1UTLM 1E36B 1P2IA 3SU5A 1HCGA 1CGJE 1GG6B 5JBTA 1GI5A 2H5CA 1AVWA 2FYRA 4NA8A 3TK9A 2ZPQA 1EJAA 1NFWA 2VWLA 3KNXA 5SGAE 1NRNH 3UNSA 2G4TA 2HVXA 2R2MB 4Q7ZA 2GP9B 2R0LA 3LGYA 1QNJA 4GPGA 3FANA 1TBRH 4K1TA 1GHBF 2YOLA 4NIXA 1P10A 1TIOA 3T29A 4NA7A 2HWLB 2VVUA 5LH8A 5L30H 1F7ZA 1J8AA 1GBCA 8KME2 3E16B 3EA7A 2OINA 1BTPA 1WQVH 1D4PB 2I6QA 2OP9A 1UTQA 3ZZ8A 1G32B 1SBWA 1DY8A 2AERH 1RTFB 1P2MA 1NN6A 1G9IE 3SU1A 1KXDA 4DW2U 1P04A 1XUGA 1GBAA 4HTCH 2HPQH 1DE7H 2ZPRA 1GJ4H 4ZMAH 2A5IA 3M5LA 3A7ZA 1A3BH 2HALA 3TJNA 3TLOA 3W95A 2V6NA 1H8IH 2SNWA 1EPTC 3SV6A 2P59A 3HGPA 5EXMA 3AVZA 1PPBH 3WY8A 6GCHF 4MVNA 2BLQA 1FI8A 2AIPA 3RXIA 2Z3CA 2EI8A 3ESTA 4GSOA 5TCAA 2WINI 3SJ9A 1QL7A 2WPLS 3PMJA 4UFDH 3RXJA 1MKWH 4JYVH 2H1UA 3ATWA 1D6RA 9ESTA 4GUXA 3QTOH 2XC4A 4AGKA 3LDXH 5A0CA 2W7SA 3F1SB 2QCYA 4ISHH 5JDUB 1W10U 4YO9A 2FX6A 4D9RA 2SGQE 1AUTC 1W2KH 2BDHA 4XE4A 5FPSA 1THRH 1O34A 3GYLB 4X6OA 3HKJB 4B1TA 4WH8A 1LPZB 4HFPB 3RC6A 2FM2A 1ELAA 3F9GA 4YM9A 2BD7A 2LNCA 4UE7H 3TIUA 4X8SH 1TONA 4ISIH 1LCYA 2Q6DA 5I46H 2JETC 5IDKA 4D7GA 3MNSA 1VCPA 1ZJKA 4SGAE 1ELFA 2P93A 1O2HA 2FDAA 1O2LA 2ZDKA 1YM0A 2UUJB 1BJUA 1ZMLA 3EA9A 5DP7A 3S7KB 3TK6A 1ETRH 1VR1H 1L1GA 5AHGH 1GI0A 2BY9X 2FODA 1C5PA 4RN6A 4CHAB 2HOBA 3M37A 1UTJA 1HXFH 1TWXB 2F9UA 1HPGA 2PGBB 3I77A 3P8GA 1PPZA 1Y8TA 1E38B 3ITIA 1DWEH 4VGCC 2Z7FE 2ZI2H 3PLBA 1SSXA 1GBIA 2BLOA 3C1KA 1Y3WA 2DUCA 3M7TA 4DJZB 1GHBG 3HPTB 2QC2A 4MNXA 1YPLH 4OS5A 4A1XA 4BTIB 3M7UA 3PV4A 1HBTH 1NO9H 2BVXH 2QXJA 1SHHB 2H2ZA 2GMTC 1O2MA 2OBQA 4Y79A 2J94A 3HK6B 3UR6A 1FAXA 1SLXB 1ELEE 1HLTH 1HJAC 3SNBA 3VEQB 3FFGA 3M3VA 1ZOMA 3A85A 4FVBA 1UVPA 1S81A 2BMGB 1UTPA 1BCUH 1XUFA 1EOLA 2FXRA 3BTGE 5FX6A 2GCHF 3HGNA 3UQOA 2H9HA 4H6SB 1Z6JH 1SG8B 1AVXA 2YNAA 3TU7H 2C4FH 1PFXC 2FLBH 2G55A 6GCHG 2BDGA 4X8VH 5F8TA 1SGFA 4FUEA 1TNHA 1LHCH 2J4IA 2JH5D 4MPWA 4ZUHA 2EA3A 3LPRA 2BYAX 1LHGH 3KQCA 4MG3A 1P09A 4MPXA 1T31A 2NU1E 3UWIA 2P95A 1GBKA 2HRVA 1NC6A 1C5XB 2FMJA 2ZO3H 1BDAA 1HB0B 2ZFRH 4LZ4B 1L1NA 2M5TA 2A32A 1V2TT 2BDCA 2GDDA 1A2CH 4LOYH 1UHBB 3TGKE 5EU8A 1OWEA 3VGCB 2VIVA 1O2OA 2WUCA 4ABBA 1NRRH 1CE5A 1O3FA 1VGCB 3KQDA 1TYNA 3M3TA 4PROA 1SR5C 4BOHA 2R0KA 5GDSH 1TQ7B 3F68H 1RRKA 5LPFA 1TA2A 1AI8H 1Y3XA 3GY6A 4NWLA 1XUHA 1SLUB 1SVPA 4DIHH 3A8AA 1O3HA 3VB3A 4NZLA 3SOSA 1Z71A 2Z9JA 1UK2A 3A89A 1QL9A 3E6PH 2PKAB 3LIWA 4R0IA 1BA8B 2BXUH 4U2WA 4ZAEA 2ZF0H 3GCTF 4IMQA 4FUDA 5TCCA 4FU8A 1H9LB 3DT0H 2RG3A 4U01A 1P2OA 3EAJA 2ZHDA 3U8RH 1SGRE 2VIPA 3ZZCA 3RU4E 1GJCB 4ABAA 2A31A 3SV8A 1HAOH 3PB1E 1HUTH 1WTGH 4K1EA 4DOQA 1EATA 2AH4X 2XWAA 5AFZH 1P9SA 4BANB 1AMHA 3ZZBA 3KEEA 2XW9A 1C2JA 2BLVA 1G3DA 4FUFA 1A5GH 3RM2H 5A0AE 1GBLA 2ZHEH 3RM0H 1XUJA 3KIDU 4AFZA 5EXNA 1YF4A 4WH6A 1AKSB 1LKAA 2Y5HA 2A0QB 1N8OB 3OY5U 4TYDA 4ZHMU 1YPJH 1BJVA 1T32A 2ZDMA 4IN2A 1PQ5A 3V0XA 3LC3A 3E0PB 5DGJA 1FIWA 1GBDA 3RP2A 3BTHE 1QQ4A 1PJPA 1P9UA 5DP3A 1CT2E 1GHAF 2Z3DA 4MLFB 1P2QA 2F91A 3MU4A 4JK6A 4DGJA 2VIQA 2G00A 1P2NA 1LO6A 1DFPA 4DY7B 4NSYA 1MTUA 3MYWA 1GHXH 4KTUA 1EZUC 3JZ2B 2ZGHA 3A82A 4LK4A 2QXIA 2GCHG 5B6OA 1GI1A 2BX3A 3M5OA 2WV4A 1GI4A 1C2MA 2D26C 1BT7A 1V2UT 2ZGXH 1EB1H 5EODA 2ZFTA 1AQ7A 1D3TB 1O5FH 1V2WT 5ESTE 1GI7B 3L6PA 1P11E 1GJ5H 3O8CA 3UPEA 3BTTE 1L0ZA 1DOJA 1HDTH 1O3NA 4WMEA 1C1TA 4ZHLU 2THFB 3UOPA 1C9PA 3ZVDA 3B8JA 4KKDA 1ACBE 1E35B 3Q00A 4XBCA 1KTSB 4NGAH 3RXHA 1FY8E 1K1MA 1W14U 2W3IA 4K5ZA 3T5FH 3NXPA 2B8OH 1O2TA 1ZPCA 1HAVA 1GGDC 4GCHF 1J16A 1MTWA 1CT4E 3F9HA 1B0EA 3PO1B 4X6NA 3D23A 1NRPH 1V3XA 1J15A 1UTKA 4H4FA 3E90B 3STIA 2TBSA 4NIVA 2PKSB 1YPHC 2QIQA 1C4U2 1DDJA 2ZIQH 4AYVB 3I78A 1GI3A 2HGTH 1Q3XA 4UONA 2Y81A 1NM6A 2FESH 2KAIA 1DT2A 3CP7A 2ZKSA 4CREA 1V2QT 1ZGVA 3PYHA 1BIOA 1DANH 1S6FA 3RXMA 3GISB 1HAHH 1BRAA 3M3SA 3OYPA 2DE9A 1UTNA 1G2MA 1TOMH 2WPIS 3M36A 4AYYB 1TQ0B 3TNSA 1F0RA 1GPZA 1ZRBA 3PMAB 3A83A 2UWLA 3C27B 3A7YA 1A61H 1Y3YA 3LGUA 3A84A 1O33A 5JYIA 1J17T 4YLQH 4AORA 4I8JA 1FY1A 1HJ8A 2OLGA 1EJNA 1AU8A 4CR9A 4NG9H 1DXWA 2B5TB 5IYTA 3SQHE 2O8UA 1JRSA 2NWNA 1HXEH 2UUYA 3MU5A 4DCDA 4R8TB 1GHAG 1UK3A 1MBQA 4H6TA 1PPEE 1DY9A 1O3JA 1PQAA 1W7XH 4MPVA 2F3CE 5HM9A 3U1IB 2FI5E 3L33A 1AD8H 4YOJA 1C2LA 2JKHA 2VIWA 4Y76A 4NIYA 3SV9A 1GVKB 1CO7E 1ZTKA 5T6DA 4XBBA 1D9IA 1J9CH 3MNCA 2QF3A 2D2DA 3BTFE 4UDWH 2BY6X 2AS9A 2PR3A 1TRMA 1V2RT 1KY9A 1QRZA 1GHWH 2GKVE 1IHTH 5A8XA 5JPMH 5HMAA 1SQTA 4INHA 1QRWA 4WMFA 4XDEA 3GCHC 2AFQB 3GY5A 2H9TH 1TNGA 2H6MA 3MWIU 4Q2KA 1GHVH 1LVMA 3T28A 1C1OA 1GCDA 1T8NA 1Q31A 2ILNA 1O3EA 3U98H 2PTNA 1OPHB 2W26A 1RXPA 3BEFB 3KQBA 2ANWA 1HRTH 1ANBA 4A7IB 2TIOA 2CF8H 1BTYA 2ZG0H 1TNJA 4GCHG 4A1VA 5C2ZA 1H8DH 1C5OH 2ODPA 3FZZA 5FBEA 5DO4H 4CRGA 5DKMA 2VGCC 1EPTB 3V3MA 1KSNA 2CHAC 2ZTYA 2GT8A 2STBE 2A4OA 3AAVA 2XBWA 1F92A 2FLRH 1D6WA 3HATH 3NKKA 3A8CA 3LJJA 3A86A 5AVDA 1AE5A 1GBJA 2P94A 1NFUA 2HLCA 1AUJA 3BTME 1NU9A 1ZJDA 2VWOA 3DUXH 3RXAA 2GVFA 1CGHA 1Z8RA 1C2DA 5LPRA 5F03A 1XVMA 5HYOA 3RLWH 3ATMA 3P6ZB 3Q3XA 1GBFA 2CMYA 4X2VA 2GTBA 3SQEE 1C5LH 2ZHFH 2BZAA 5JBAS 3BTEE 3BV9B 1C1WH 4KGAA 3MO9A 3A80A 1KLTA 4MDSA 3SU6A 7GCHF 2Z9KA 3EDXB 2O9QA 1AWFH 4XOJA 3MU0A 1F5LA 4NSVA 3ZZ4A 2BHGA 1MKWK 2Y6TA 2BTCE 1OX1A 1S84A 2ASUB 2UUKB 1G3CA 2ZU2A 1A0HB 4YESB 2JETB 3UOUA 1C1NA 1RTLA 3MH6A 2FS9A 3QTVH 1OWHA 1SL3A 1MBMA 1MTNC 1XXFA 1TFXA 3MMGA 3VB7A 1AY6H 1RGQA 4DG4A 3S9BA 1BMLA 4THNH 4B2BA 4B76A 1L1JA 4BTTB 3KGPA 2ZCHP 1O2JA 3ELAH 4BNRA 3GDSA 4A1TA 1NTPA 2B9LA 3BF6H 4INLA 4VGCB 1O2NA 2UUFB 3SNEA 1P3EA 1EZQA 1BMMH 2A7CA 2FI3E 3E1XB 3RMNH 4Y10E 3R0FA 3SV7A 3UIRA 5DPAA 3Q3YA 4Z6AH 2QY0B 5GCHF 2RA3A 1OWKA 1NESE 2C3SA 1DLEA 1MZDA 3A88A 1EX3A 2OUAA 3SJIA 3MH4A 1YKTA 1SQOA 1AIXH 1IQIA 3BTQE 2ZPSA 3TJUA 3A7WA 2BB4A 2ZWLH 4U30A 2ZQ1A 3PLKA 2GMTB 4WVPE 1EJMA 2C90B 3KCGH 4TPIZ 1O36A 3B9FH 1K1LA 2G5VA 5T6GA 1O2PA 1C5RA 2O8LA 1HJAB 4YLUA 1TGBA 4B71A 2HNTE 4CRCA 1T4VH 1AVGH 1YPEH 3GOVB 4IBLH 1O37A 2BQWB 2FOMB 4X0WU 1X7AC 2Z3EA 1SGIB 4H42U 1GHZA 1F0SA 1DPOA 1SGDE 1TPPA 3RXCA 4CBNA 5C5OA 4SGBE 5FPYA 5A09A 3NZIA 4OS1A 2Z9LA 3UR9A 3VPKA 3A7XA 4Y7AA 1O3PB 1RIWC 3GY7A 1YCPM 1TRNA 3SUEA 1MUEB 5DK1A 1SMFE 3BTWE 1ELTA 2BX4A 3TITA 3ZVBA 1GMCF 2BD4A 2AMQA 2RDLA 1P01A 4B2CA 1AGJA 3LH3A 4YOIA 2XBVA 1O2RA 2F83A 1CHOG 4AGJA 3KN2A 3A7VA 2GV6A 1IQKA 2FZZA 2G51A 3LH1A 1OWDA 5DP8A 1FMGA 1WAYB 4LXBH 4ESTE 4E06H 2Z6BD 3OY6U 1O3IA 4CH2B 1W7GH 4O3TA 3A87A 3LONA 1ZR0A 2BY5X 4DT7B 1H9HE 2P3TB 1UO6A 4I32A 7GCHG 1LVYA 3RXPA 1BRCE 2AIQA 1BHXB 1ZRKA 4ABHA 1SOZA 1C9TA 1GDNA 1BITA 4GHTA 1W11U 3M7QA 1O35A 2BZ6H 4TY6A 2I6SA 4AB8A 1PPGE 4INKA 2GX4A 1GI6A 2NU0E 4WWYA 4AZ2B 1O5GH 1F2SE 2FYQA 4CRFA 1TABE 2Q6FA 3PMHB 1A0JA 1C2EA 1GWAA 3A8DA 4ZH8A 1C2GA 4ZXYH 4AB9A 3QO6A 1HIAB 1HYLA 3GY2A 4B75A 3LGIA 1GJ6A 1FPCH 1GJ9B 1QR3E 1EP5A 5GXPA 1T8OA 5FBIA 4KP0A 1ANEA 5EQRA 1HNEE 3E3TA 1IQFA 3UQVA 2F9NA 1WBGB 1O32A 2ULLA 4IMZA 1Y5UT 1OS8A 1O2GH 4KTSA 3I29A 5CE1A 2OC0A 1IQLA 4XFQA 1QURH 2VNTA 3BIUH 3ODDA 1OWJA 2Y80A 3GCNA 1KDQB 3V12A 1NRQH 1C5VA 1TPAE 3EE0B 2P3FH 1ARCA 2R3UA 1C1SA 1OXGA 3UY9A 3W94A 4KTCA 5GCHG 1DICA 1FN8A 4WJG2 3SI4H 5C20A 2AEIH 2BVSH 1G3EA 2QXGA 1Y3VA 1TLDA 1B0FA 1ZHMA 3QUMP 1EOJA 1WCZA 5F6MA 3SZNA 1MD8A 1V2NT 1DUAA 2B7DH 1FUJA 3PLPA 3GDVA 4X1QU 3ODFA 4ABDA 4K69A 3U1JB 2A1DB 2ZECA 1IQNA 1AFQC 4ABIA 3AW0A 4RKOB 4IS5A 2WPJS 4D9QA 5HXFA 3UREA 2HNTF 4IGDA 1FDPA 1ZHRA 4TWWA 1GMHF 7KMEH 5I25A 2LPRA 3ZVGA 2NU2E 1QBNA 2ZNKH 2C8WB 2P16A 3SHAH 1VITH 2ZU4A 1BUIA 5EGMA 1LQDB 3MH7A 1H9IE 2PWXA 1ESTA 5A0BA 2BM2A 3MU1A 1LMWB 4X8UH 1DM4B 1IHSH 4ISNA 1JOUB 3RMLH 2ZFQH 3ATKA 1TMUH 2FOFA 2WUBA 1GMCG 2QF0A 4LZ1H 1HIAA 2BLWA 1UVUH 5AF9H 2PSYA 1NROH 2V3OH 3SW2B 1TX8A 4D7FA 1E34B 3NPSA 2J38A 2FTMA 1PYTD 1ZSLA 1M9UA 3D49H 1ORFA 3P8OA 2OXSA 1ANDA 3LKWA 1C1VH 3BG8A 1C4V2 1BTWA 1GGDB 2G52A 3SI3H 1EUFA 1RS0A 1O2IA 2FO9A 3UNRA 1INCA 5JBCS 1QQUA 1GJ7B 3SJKA 1GJBB 2VH6A 3D65E 4A5TS 1PYTC 1HJ9A 1A0LA 4OGXA 4K8BA 2NU4E 2ZGCA 1DWBH 1B5GH 1MH0A 1MZAA 1A5IA 2ZDNA 1P02A 2AMPA 4ABEA 4OS6A 1DSUA 4Y8ZA 3QN7A 3PTBA 4ZHAA 4FUJA 1NU7B 2GDEH 1CGIE 4JZ1A 2FOHA 3F9FA 1YYY1 4NA9H 1YBWA 1U6QA 1UHBA 1ELGA 1LHFH 2C93B 4JZFH 2SGEE 3URCA 3DD2H 1O5DH 1C4Y2 1GJAB 5FCRA 1NRSH 2BXTH 4TPYA 1SGFG 1YPGH 2SGFE 2QV1A 3NK8A 4YTAA 1LVOA 1LHEH 2XRCA 2ANYA 4AG2A 2GCTC 1BMAA 3SUDA 2ZC9H 1SLWB 2FX4A 2A2XH 1QJ7B 1VJAU 2HPPH 1TPOA 2PKAA 1EQ9A 1A3EH 4AN7A 2V3HH 3MHWU 1HAIH 1T4UH 4Y6DA 1QJ6B 3K6ZA 5ABWA 1G2LA 4X2YA 2ZHWH 1KTTB 5DP6A 1O2SA 1GBTA 1RD3B 5L2YH 1GJDB 3FZDA 2XBXA 2Y5FA 4OS2A 5ESBA 5FXLA 3QWCH 1W12U 1HAGE 2SFAA 4FUBA 6ESTA 1IQEA 1AO5A 2R3YA 3E8LA 3QZRA 1G36A 4AOQA 3RLYH 2ALPA 1UVSH 1VITG 2SGPE 4CRDA 3VXFH 1K1JA 4E7NA 4BAOB 5DG6A 1CBWC 1P05A 1AE8H 5G4BA 2D8WA 3UTUH 1GMHG 1AKSA 2FOCA 4JZIA 3UNQA 1GBHA 1MCVA 4MNWA 1KXAA 2A5KA 5FHTA 1GL1A 1RFNA 1WV7H 3O8RA 1LHDH 3ENSB 4M7GA 5EOKA 2XTTB 1C1RA 1O0DH 4I33A 3OSYA 3GCHB 1QB6A 3AW1A 1GBEA 3O8BA 2WPHS 1V2MT 5TJXA 1V6DA 2FIRH 4X1SU 3U8OH 4BAQB 2Y7ZA 1MAYA 4CH8B 3QGJA 1QRXA 1Z1IA 1FIZA 1LKBA 1T7CA 2Z94A 1SGCA 1O5CB 4BXWA 3PM3A 1DWCH 1P57B 1NZQH 2P3UB 8LPRA 1O3GA 3Q77A 4WMDA 2OBOA 3MNXA 4MNVA 4UD9H 1HAXB 1BRUP 5C1UA 4D76A 3RXVA 4Z0KA 1W3CA 4BAHB 1MU6B 1TMBH 2VGCB 3ZZ6A 3P95A 2CHAB 2FP7B 1O39A 3SO3A 3RC5A 5C3NA 3EA8A 3U9AH 2Q1JA 5A8YA 2UWOA 1V2JT 1ESBA 5GJ4B 3RU4D 1UCYE 3KF2A 3RUOA 4Q80A 3O8DA 3P70B 1W13U 2ZEBA 4YT6H 1KXCA 2Q6GA 2PTCE 4KELA 3K9XB 2PFEA 2ZGBH 1ZYOA 1QBVH 3M61U 4CRAA 1ZMNA 2PGQB 1CT0E 2OQ5A 4J2YB 5E8EH 1L4DA 5A2MH 5JB8S 4AFSA 1K1PA 1SGNE 4ZROA 2J9NA 3TH3H 1FY3A 3FP6E 5FCKA 3MFJA 1A4WH 1NT1A 4O9VA 3LGTA 1FJSA 3UWJH 3RXTA 3TH4H 3ZVCA 4XSKU 1FONA 4TWYA 1S5SA 1XUKA 3RXOA 1VJ9U 3QDZB 2VU8E 5HM2A 2G4UA 3RXGA 4B74A 2GZ9A 2XC0A 3RC4A 4FU9A 2WPKS 1S83A 1EAWA 3IWMA 7LPRA 3IITA 1KXFA 4GVUA 1MTNB 1GBMA 1D3DB 3HK3B 4ZKSU 1C1MA 1FY5A 2BDIA 1ZLRA 3GYMA 1QGFA 2D1JA 2ZTZA 3QZQA 1O2UA 3GY4A 4MQAA 1KLJH 1W0ZU 1GI2A 1OP2A 1TPSA 1UMAH 4OS7A 3BN9A 5L2ZH 1SC8U 1LVBA 1XUIA 2BD5A 3KL6A 3PMBB 1FZZA 5EQSA 1MQ6A 1MCTA 1K9OE 3SGQE 4ABGA 6LPRA 5CHAC 3S69A 3SU4A 1LPKB 1FAKH 4X8TH 1K2I1 1OP0A 1KYNA 1V2OT 3OX7U 3VFEA 4GLYA 1C5SA 1EZXC 2G5NA 5DJ7A 2SGAA 2J92A 1EAXA 4BTUB 2OD3B 3GICB 2P8OC 5FPTA 1BTXA 1GL0E 3UUZA 1ABIH 2ZU3A 3DHKH 1UCYK 1ELDE 2EEKA 1Z6EA 1CHOF 2VVVA 1OYQA 3CENA 1EKBB 5F8ZA 1CVWH 1GCTC 2XYAA 2EI6A 2FOAA 3N7OA 3EYDA 1QA7A 2ZTXA 3BG4C 1ZHPA 4I8LA 4Q7XA 2A4RA 3MNBA 3LC5A 2Z9IA 3T26A 2H5DA 2AGEX 1MAXA 2XWBI 1NS3A 1CA8B 1HGTH 3GDUA 4K1SA 1JIMA 1H1BA 1UJ1A 4O03A 4I31A 1DS2E 3H7TA 3R3GB 1MKXK 4ISLA 1ABJH 1FXYA 1WYKA 2FOGA 2ZZUH 5GPIB 3V13A 1THSH 3RXEA 1RIWB 3K65B 1AWHB 2VIOA 1TOCB 4ZKOU 2BVRH 5CMXH 3M5MA 2FEQH 3SBKA 3ZZ7A 2BDBA 1AB9C 3B23B 3UFAA 4WF8A 3E0NB 4Y0YE 5T6FA 4X6PA 1O5BB 2Y82A 2WV5A 2VIDA 1Z8IB 1IQGA 2OC7A 2BOKA 4JK5A 1UCYH 2TGTA 1QL8A 1O2VA 1BB0B 1Y59T 1EPTA 2FS8A 2YNBA 1SGPE 3RXLA 4Y0ZE 4YT7H 4GAWA 4I8GA 3KQEA 2FI4E 1V2PT 3ZZ3A 5JB9S 1WTHD 1ELCA 2TRMA 2B0FA 6CHAC 1JWTA 4CR5A 4IW4E 2WPMS 4I7YH 5LPEA 1CA0C 4WXIA 8GCHF 1G30B 3T62A 1DLKB 2GGVB 4WY3A 3TJVA 1FV9A 2OC1A 2GZ8A 3AASA 2O8WA 1FY4A 3LJOA 2GZ7A 1C1UH 3U8TH 1C5MD 3OU0A 3SJOA 4FU7A 1MKXH 2J34A 2BOHB 2XCFA 4HI3A 1OKXA 3MTYA 1P3CA 2IJOB 3BSQA 3RXSA 1AHTH 1WU1A 1O3AA 2ALVA 3PWCA 2K1QA 3PROA 3SHCH 1Z1JA 2A4QA 1F5KU 2IOTA 1C1PA 4UFGH 2PW8H 3ZVAA 3GCOA 3FVFB 1S82A 5EQQA 3SU3A 3QX5H 4FVDA 3ZZ9A 1O38A 1XX9A 3ZVEA 3SU0A 2TPIZ 1MD7A 1SFIA 1O3LA 1XMNB 4O3UA 1Y3UA 1BTUA 1G3BA 1GG6C 1K1OA 4UEHH 4JZDH 5C1XA 1FNIA 1S85A 2QGRA 2VH0A 3ZV9A 3LGWA 1C5TA 4OS4A 1UK4A 4A92A 1KIGH 2CXVA 1V2ST 2JH6D 2AGIX 4XBDA 4B2AA 1L4ZA 1BRBE 1F0UA 2W5EA 1YLDA 1BQYA 3TPIZ 1KXBA 4ZKNU 4IN1A 1O3OA 1QHRB 4FUIA 4FUHA 7ESTE 2VJ1A 4UFEH 1LQEA 3TNTA 1DXPA 1MU8B 5BRRE 2FOBA 1AFQB 1XKBC 4AFUA 5LGOA 1MMJN 1RJXB 3VXEH 1FLEE 3S9AA 1OOKB 2W7UA 4MTBA 1H4WA 1PPFE 2QAAA 3U69H 2F9BH 5T3HA 3VB4A 3TK5A 1UTOA 1LPGB 1GDQA 1AN1E 2ODYB 4K3JA 4E7RG 5E0HA 3LGVA 1YLCA 1P06A 2EI7A 1Z7KA 2IN2A 1SB1H 3F9EA 1O31A 2UWPA 1TGTA 3V7TA 2CJIA 3PTNA 1SPJA 1GMDF 3ZYDA 2BD3A 4JMYA 1ZMJA 1QY6A 3MI4A 1TGSZ 4HZHA 2ZCKP 1GHYH 1D3PB 1ETSH 2CN0H 1LTOA 3CS0A 1OP8A 1F0TA 3QLPH 1C5WB 3RDZA 4E05H 1N6YA 1O2QA 2VVCA 3KHVA 4RKJB 1K21H 1O3MA 3BTDE 1ELBA 4IC5A 5C5NA 3BEIB 2A7HA 2PHBA 5E0GA 2V0BA 5L6NH 3TVJB 4DIIH 1S0RA 5A8ZA 1GVZA 1SLVB 1TAWA 8GCHG 9LPRA 4BXSA 2BY8X 2XNIA 1SGEE 3DFJA 2AMDA 2AGGX 2OQUA 2VWNA 1GI8B 2R2WU 1ANCA 1NY22 4F4OC 2Z9GA 1YPHE 1NFXA 3P17H 1TMTH 1FQ3A 1BHXF 1ZSJA 3F6UH 5C1YA 4JYTA 2OCVB 2W3KA 1VITF 3A8BA 5FX5A 3LT3A 1GDUA 2VINA 5GWZA 1BTZA 1DITH 1K1IA 2VWMA 1A5HA 2GCTB 3SJ8A 1KXEA 5EG4A 2ZU5A 4CHAC 1J14A 2NU3E 5JBBS 1TBQH 1XVOA 1QB1A 2BDAA 2OTVA 3CS7A 3OTJE 2BQ7B 3FP7E 3RXBA 1IQMA 1CHGA 2A4GA 3SNDA 2PV9B 2PUXB 2QA9E 3DA9B 3SNAA 2F9OA 4O97A 3PWBA 1O5EH 4FUCA 1UVTH 4ABJA 4IC6A 1ESAA 1S0QA 1SHYA 3E91A 4CRBA 1FPHH 3MO6A 2HNTC 1TNLA 2BQ6B 1O3DA 4X1RU 4I8KA 1QTFA 2ANKH 1JMOH 1CBWB 5EW1H 1KDQA 1YP9A 4BAMB 4AX9H 3S9CA 1TRYA 3NWUA 1QIXB 2ZDLA 2A7JA 4RSPA 5BPEA 4ZKRU 2G8TA 1YCPK 3M5NA 3AAUA
chains in the Genus database with same CATH superfamily
3EE7A 3RMMH 1ETTH 1O2XA 1Q2WA 4U32A 3K2UA 3TGIE 1EAUA 1ID5H 2DE8A 1PPHE 4Y8YA 1HAVB 4YZUA 1WOFA 3GY3A 1C2KA 1TNIA 3S7HB 1BOQA 4UFFH 3STJA 1TA6A 1O30A 4NCYA 1O2ZA 1GMDG 1GJ8B 1HV7A 4RT0A 1QCPA 1E0FD 1P2KA 1K22H 1WSSH 5J4QA 1CU1A 3VB5A 1ARBA 3EGKH 2G81E 1C2FA 4A6LA 2ZP0H 4NFEA 1DUEA 5C17A 1IQJA 3H7OA 1TX6A 3L3TA 3TH2H 2KAIB 1SGYE 5EW2H 2TGDA 3N99A 1GBBA 3AK5A 5EPYA 3JZ1B 4ABFA 1IQHA 4JCNA 2CV3A 2SGDE 2ZDAH 4I8HA 3VGCC 1EXFA 4B6FA 1XM1A 1ZPZA 1P12E 3FAOA 1A46H 1VGCC 3GY8A 2CF9H 3UB0A 3LOXA 4X1PU 2O8MA 2XCNA 1V2VT 5E2PA 2TGAA 3SGBE 2PUQH 3SUGA 1NPMA 1VZQH 3ZZDA 3SV2H 1VCQA 1JBUH 2XC5A 1SQAA 4K2YA 5E2OA 3S0NA 2VB0A 1YCPH 5H4IB 1FN6A 2W6ID 1C5NH 2TGPZ 5EJZA 1EP6A 1OWIA 1SI5H 3RXFA 3MOCA 1HAYB 2H9EH 3FKSD 1GVLA 3BTKE 2CGAA 1G37A 5EPNA 1DWDH 1UTMA 2GT7A 3T25A 1WQSA 2Y5GA 1ELVA 1B7XB 2V35A 1TNKA 3K6YA 1BBRE 4FUGA 4Y8XA 2XXLA 3RU4T 2A5AA 3GS9A 3BEUA 2PLXA 2BDYA 1ZZZA 2J95A 1BZXE 4YOGA 2J2UA 1O2KA 4X2XA 5C67A 2J97A 3Q76A 2XNDD 1SFQB 3IG6B 2BD8A 2JH0D 2ZFPH 3TJOA 3PRDA 1XXDA 2EC9H 2ZA5A 5ETXA 3ZYEA 4JYUH 4WXVA 2IPHA 1DSTA 3ATIA 1COWD 4Y7BA 2ZFFH 2FWWA 2WYGA 1T8LA 1DX5M 2ESTE 5AFYH 4ZXXH 1O2WA 1V2LT 1T8MA 5EJLA 5DP9A 2IPQX 1PQ7A 2Y7XA 2RCEA 4BAKB 4F48B 1TE0A 2FTLE 1TGNA 1EASA 1YC0A 3P8FA 1N8OC 2GV7A 5F8XA 3ZVFA 1GI9B 3T2NA 3ZZ5A 4D8NA 5E0JA 1HAZB 4QT8C 1TB6H 3P8NA 4X6MA 1QB9A 4DVAU 1Z8JB 1P8VC 3GCTG 4ASHA 4MNYA 1XKAC 4DURA 3A81A 2RA0A 3NCLA 2C8XB 1TBZH 5CHAB 2BD9A 1D3QB 1PQ8A 4Q7YA 1YPMH 1BTHH 2JDID 3ZZAA 2ZFSA 1BMNH 3OTPA 3SN8A 1DVAH 2PSXA 3M35A 4X2WA 1WUNH 1MTSA 3RMOH 2C8YB 4JZEH 3RXUA 4CBOA 2P8OB 1ZSKA 1AFEH 5FAHA 3D62A 2QXHA 1N6XA 3ZV8A 4Y71A 2ZDVH 1F5RA 3RXKA 2A45B 1GCTB 1C2HA 2F9PA 2XBYA 1SOTA 4HGCA 1C2IA 1O3CA 1TX7A 3BG4B 3SORA 2R9PA 4GHQA 2FOEA 3DSPA 1OYTH 1SGTA 3SNCA 1TALA 1JIRA 1EZSC 1BBRK 3PV5A 1JRTA 1IAUA 1RTKA 1QA0A 1C1QA 1W8BH 5PTPA 3MO3A 1SGQE 1CSOE 1CQQA 1MTVA 2O8TA 3RXRA 1V2KT 3PO1C 4X1NU 4FOUC 3DFLA 5DP4A 4Q4LA 1W0YH 1LDTT 1THPB 1A1RA 1YPKH 2PKSC 1EAIA 1AB9B 3SUFA 4AG1A 1HAPH 1Y5BT 1C5UA 1P0SH 3H5CB 2SNVA 2W6JD 1Y5AT 3URDA 1A7SA 4TT3D 3OE7D 2GD4B 1S6HA 2STAE 4ISOA 4OM9A 1P03A 5HGGA 4NFFA 1ZTLA 5J4SA 4NIWA 2BY7X 3MU8A 1QJ1B 1K28D 1O5AB 3FP8E 1ZGIA 3RXQA 3BIVH 4F49A 1C5YB 2C8ZB 1N1LA 1ZPBA 1O3KA 2OC8A 2ZU1A 6CHAB 4OGYA 1EB2A 4FXGH 1AZZA 1P2JA 1QBOA 2FPZA 1IOEA 1CA0B 5EXLA 1K1NA 3EQ0H 1PPCE 4NZQA 1L2EA 1HFDA 3HKIB 1NFYA 1O2YA 4Y11E 1OSSA 1Z8GA 3MH5A 1KLIH 1BBRH 1JXPA 1UVOA 5K7RA 2QYIA 1C5QA 2ZQ2A 3T27A 2F9VA 4B73A 2ODQA 3Q3KA 4TY7A 1YGCH 3G01A 2AYWA 4K60A 3VB6A 3QK1A 1VCWA 1QFKH 1MQ5A 4AFQA 1E37B 2WYJA 1O3BA 5DP5A 3TGJE 2ZGJA 3ATLA 1C5ZB 3NUMA 3P92A 2BD2A 1AZ8A 2A2QH 3LU9B 2ZHQH 3SGAE 3QGNB 4K8YA 5GIBA 2QN5T 3OEHD 2JIZD 2ANMH 5K0HA 8ESTE 4NWKA 1ZTJA 4MPUA 4TSFD 3RXDA 4J1YA 3SU2A 1TGCA 2ZCLP 3A7TA 1UTLM 1E36B 1P2IA 5C0UA 3SU5A 1HCGA 1CGJE 1GG6B 5JBTA 1GI5A 2H5CA 1AVWA 2FYRA 4NA8A 3TK9A 2ZPQA 1EJAA 1NFWA 2VWLA 3KNXA 5SGAE 1NRNH 2KCAA 3UNSA 2G4TA 2HVXA 2R2MB 4Q7ZA 2GP9B 2R0LA 3LGYA 1QNJA 4GPGA 3FANA 1TBRH 4K1TA 1GHBF 2YOLA 4NIXA 1P10A 1TIOA 3T29A 4NA7A 2HWLB 2VVUA 5LH8A 5L30H 1F7ZA 1J8AA 1GBCA 8KME2 3E16B 3EA7A 2OINA 1BTPA 1WQVH 1D4PB 2I6QA 2OP9A 1UTQA 3ZZ8A 1G32B 1SBWA 1DY8A 2AERH 1RTFB 1P2MA 1NN6A 1G9IE 3SU1A 5IK2D 5F53A 1KXDA 4DW2U 1P04A 1XUGA 1GBAA 4HTCH 5CDFE 2HPQH 1DE7H 2ZPRA 1GJ4H 3FO8D 4ZMAH 2A5IA 3M5LA 3A7ZA 1A3BH 2HALA 3TJNA 3TLOA 3W95A 2V6NA 2YMSD 1H8IH 3SYJA 2SNWA 1EPTC 3SV6A 2P59A 3HGPA 5EXMA 3AVZA 1PPBH 3WY8A 6GCHF 4MVNA 2BLQA 1FI8A 2AIPA 3RXIA 2Z3CA 2EI8A 3ESTA 4GSOA 5TCAA 2WINI 3SJ9A 1QL7A 2WPLS 3PMJA 2YMSC 4UFDH 3RXJA 1MKWH 4JYVH 2H1UA 3ATWA 1D6RA 9ESTA 4GUXA 3QTOH 2XC4A 4AGKA 3LDXH 4YXWD 2W7SA 5A0CA 3F1SB 2QCYA 4ISHH 5JDUB 1W10U 4YO9A 2FX6A 3DCLA 4D9RA 2SGQE 1NBME 1AUTC 1W2KH 2BDHA 4XE4A 5FPSA 1THRH 1O34A 3GYLB 4X6OA 3HKJB 4B1TA 4WH8A 1LPZB 4HFPB 3RC6A 2FM2A 1ELAA 3F9GA 4YM9A 2BD7A 2LNCA 4UE7H 3TIUA 4X8SH 1TONA 4ISIH 1LCYA 2Q6DA 5I46H 2JETC 3OAAD 5IDKA 4D7GA 3MNSA 1VCPA 1ZJKA 4SGAE 1ELFA 2P93A 1O2HA 2FDAA 1O2LA 2ZDKA 1YM0A 2UUJB 1BJUA 2L74A 1ZMLA 3EA9A 3WWFA 5DP7A 3S7KB 3TK6A 1ETRH 1VR1H 1L1GA 5AHGH 1GI0A 2BY9X 4ACBA 2FODA 1C5PA 4RN6A 4CHAB 2HOBA 3M37A 1UTJA 1HXFH 1TWXB 2F9UA 1HPGA 2PGBB 3I77A 2KCOA 3P8GA 1PPZA 1Y8TA 1E38B 3ITIA 1YY3A 1DWEH 4VGCC 2Z7FE 5C94A 2ZI2H 3PLBA 1SSXA 1GBIA 2BLOA 3C1KA 1Y3WA 1OHHD 2KCPA 3H09A 2DUCA 3M7TA 4DJZB 3DSOA 1GHBG 3HPTB 2QC2A 4MNXA 1YPLH 4OS5A 4A1XA 4BTIB 3M7UA 3PV4A 1HBTH 1NO9H 2BVXH 2QXJA 1SHHB 2H2ZA 2GMTC 1O2MA 2OBQA 4Y79A 2J94A 3HK6B 3UR6A 1FAXA 1SLXB 1ELEE 1HLTH 1HJAC 3SNBA 3VEQB 3FFGA 3M3VA 5DN6D 1ZOMA 3A85A 4FVBA 1UVPA 1S81A 2BMGB 1UTPA 1BCUH 1XUFA 1EOLA 2FXRA 3BTGE 5FX6A 2GCHF 3HGNA 3UQOA 2H9HA 4H6SB 1Z6JH 1SG8B 1AVXA 2YNAA 3TU7H 2C4FH 1PFXC 2FLBH 2G55A 6GCHG 2BDGA 4X8VH 5F8TA 1SGFA 4FUEA 1TNHA 1LHCH 2J4IA 2JH5D 4MPWA 4ZUHA 2EA3A 3LPRA 2BYAX 1LHGH 3KQCA 4MG3A 1P09A 4MPXA 1T31A 2NU1E 3UWIA 2P95A 1GBKA 2HRVA 2LP6A 1NC6A 1C5XB 2FMJA 2ZO3H 1BDAA 1HB0B 2ZFRH 4LZ4B 1L1NA 2M5TA 2A32A 1V2TT 2BDCA 2GDDA 1A2CH 4LOYH 5EIYA 1UHBB 3TGKE 5EU8A 1OWEA 3VGCB 2VIVA 1O2OA 2WUCA 4ABBA 1NRRH 1CE5A 1O3FA 1VGCB 3KQDA 1TYNA 3M3TA 4PROA 1SR5C 4BOHA 2R0KA 5GDSH 1TQ7B 3F68H 1RRKA 5LPFA 1TA2A 1AI8H 1Y3XA 3GY6A 4NWLA 1XUHA 1SLUB 5KEDA 1SVPA 4DIHH 3A8AA 1O3HA 3VB3A 4NZLA 3SOSA 1Z71A 2Z9JA 1UK2A 3A89A 1QL9A 3E6PH 2PKAB 3LIWA 4R0IA 1BA8B 2BXUH 4U2WA 4ZAEA 3F0OA 5B6LA 2ZF0H 3GCTF 5HKKD 4IMQA 4FUDA 5TCCA 4FU8A 1H9LB 3DT0H 2RG3A 4U01A 1P2OA 3EAJA 2ZHDA 3U8RH 1SGRE 2VIPA 3ZZCA 3RU4E 1GJCB 2J98B 4ABAA 2A31A 3SV8A 1HAOH 3PB1E 1HUTH 1WTGH 4K1EA 4DOQA 4Z1MD 1EATA 2AH4X 2XWAA 5AFZH 1P9SA 4BANB 1AMHA 3ZZBA 3KEEA 2XW9A 1C2JA 2BLVA 1G3DA 4FUFA 1A5GH 3RM2H 5A0AE 1GBLA 2ZHEH 3RM0H 1XUJA 3KIDU 4AFZA 5EXNA 1YF4A 4WH6A 1AKSB 1LKAA 2Y5HA 2A0QB 1N8OB 3OY5U 4TYDA 4ZHMU 1YPJH 1BJVA 1T32A 2ZDMA 4IN2A 1PQ5A 2QF5A 3V0XA 3LC3A 3E0PB 5DGJA 1FIWA 1GBDA 3RP2A 4RT1A 3BTHE 1QQ4A 1PJPA 1P9UA 5DP3A 1CT2E 1GHAF 2Z3DA 4MLFB 1P2QA 2F91A 3MU4A 4JK6A 4DGJA 2VIQA 2G00A 1P2NA 1LO6A 1DFPA 4DY7B 4NSYA 1MTUA 3MYWA 1GHXH 4KTUA 1EZUC 5C0TA 3JZ2B 2HLDD 2ZGHA 3A82A 4LK4A 2QXIA 2GCHG 5B6OA 4Q63A 1GI1A 2BX3A 3M5OA 2WV4A 1GI4A 1C2MA 2D26C 1BT7A 1V2UT 2ZGXH 1EB1H 5EODA 2ZFTA 1AQ7A 1D3TB 1O5FH 1V2WT 2WV9A 5ESTE 1GI7B 3L6PA 1P11E 1GJ5H 3O8CA 3UPEA 3BTTE 2V7QD 1L0ZA 1DOJA 1HDTH 1O3NA 4WMEA 1C1TA 4ZHLU 2THFB 3UOPA 1C9PA 3ZVDA 3B8JA 4KKDA 1ACBE 1E35B 3Q00A 4XBCA 1KTSB 4NGAH 3RXHA 1FY8E 1K1MA 1W14U 2W3IA 4K5ZA 3T5FH 3NXPA 2B8OH 1O2TA 1ZPCA 1HAVA 1GGDC 4GCHF 1J16A 1E1QD 1MTWA 1CT4E 3F9HA 1B0EA 3PO1B 4X6NA 3D23A 1NRPH 1V3XA 1J15A 1UTKA 4H4FA 3PV2A 3E90B 3STIA 2V3MA 2TBSA 4NIVA 2PKSB 1YPHC 2QIQA 1C4U2 1KMHB 1DDJA 2ZIQH 4AYVB 3I78A 1GI3A 2HGTH 1Q3XA 4UONA 2Y81A 1NM6A 2FESH 2KAIA 1DT2A 3CP7A 2ZKSA 4CREA 2K8IA 1V2QT 1ZGVA 3PYHA 2EQNA 1BIOA 1DANH 1S6FA 3RXMA 3GISB 1HAHH 1BRAA 3M3SA 3OYPA 2DE9A 1UTNA 1G2MA 1TOMH 2WPIS 3M36A 4AYYB 1TQ0B 3TNSA 1WDIA 1F0RA 1GPZA 1ZRBA 3PMAB 1W0KD 3A83A 2UWLA 5KGOA 5GNDA 3C27B 3A7YA 1YLNA 1A61H 1Y3YA 3LGUA 3A84A 1O33A 5JYIA 1J17T 4YLQH 4AORA 4I8JA 1FY1A 1HJ8A 2OLGA 1EJNA 1AU8A 4CR9A 4NG9H 1DXWA 2B5TB 5IYTA 3SQHE 2O8UA 1JRSA 2NWNA 1HXEH 2UUYA 3MU5A 4DCDA 4R8TB 1GHAG 1UK3A 1MBQA 2L6OA 4H6TA 1PPEE 1DY9A 1O3JA 1PQAA 1W7XH 4MPVA 2F3CE 5HM9A 3U1IB 2FI5E 3L33A 1AD8H 4YOJA 1C2LA 2JKHA 2VIWA 4Y76A 4NIYA 3SV9A 1GVKB 1CO7E 1ZTKA 5T6DA 4XBBA 1D9IA 2KR7A 1J9CH 3MNCA 2QF3A 2D2DA 3BTFE 4UDWH 2BY6X 2AS9A 2PR3A 1TRMA 1V2RT 1KY9A 1QRZA 1GHWH 2GKVE 1IHTH 5A8XA 5JPMH 5HMAA 1SQTA 4INHA 1QRWA 4WMFA 4XDEA 3GCHC 2AFQB 3GY5A 2H9TH 1TNGA 2H6MA 3U28C 3MWIU 4Q2KA 1GHVH 1LVMA 3DSGA 1C1OA 1GCDA 3T28A 1T8NA 1Q31A 2ILNA 2RFKC 1O3EA 3U98H 2PTNA 1OPHB 2W26A 1RXPA 3BEFB 3KQBA 2ANWA 1HRTH 1ANBA 4A7IB 2TIOA 2CF8H 1BTYA 2ZG0H 2KM0A 1TNJA 4GCHG 4A1VA 5C2ZA 1H8DH 1C5OH 2ODPA 3FZZA 5FBEA 5DO4H 4CRGA 5DKMA 2VGCC 1EPTB 3V3MA 1KSNA 2CHAC 2ZTYA 2GT8A 2STBE 2A4OA 3AAVA 2XBWA 1F92A 2FLRH 1D6WA 3HATH 2KFWA 3NKKA 3A8CA 3LJJA 3A86A 5AVDA 1AE5A 1GBJA 2P94A 1NFUA 2HLCA 1AUJA 3BTME 1NU9A 1ZJDA 2VWOA 2YMSB 3DUXH 3RXAA 2GVFA 1CGHA 1Z8RA 1C2DA 5LPRA 5F03A 1XVMA 5HYOA 3RLWH 3ATMA 3P6ZB 3Q3XA 1GBFA 2CMYA 4X2VA 2GTBA 2WPDD 3SQEE 1C5LH 2ZHFH 2BZAA 5JBAS 3BTEE 3BV9B 1C1WH 4KGAA 3MO9A 3A80A 1KLTA 4MDSA 3SU6A 7GCHF 4HG6A 2Z9KA 3EDXB 2O9QA 1AWFH 4XOJA 3MU0A 1F5LA 4NSVA 3ZZ4A 2BHGA 1MKWK 2Y6TA 2BTCE 1OX1A 1S84A 2ASUB 4XD7D 2UUKB 1G3CA 2ZU2A 1A0HB 4YESB 2JETB 3UOUA 1C1NA 1RTLA 2F43B 3MH6A 2FS9A 3QTVH 1OWHA 1SL3A 1MBMA 1MTNC 1XXFA 1TFXA 3MMGA 3VB7A 1AY6H 1RGQA 4DG4A 3S9BA 1BMLA 4THNH 4B2BA 4B76A 1L1JA 3OFND 4BTTB 3KGPA 2ZCHP 1O2JA 3ELAH 4BNRA 3GDSA 4A1TA 1NTPA 2B9LA 3BF6H 4INLA 4VGCB 1O2NA 2UUFB 3SNEA 1P3EA 1EZQA 1BMMH 2A7CA 4P00A 2FI3E 3E1XB 3RMNH 4Y10E 2EY4C 3R0FA 3SV7A 3UIRA 5DPAA 3Q3YA 4Z6AH 2QY0B 5GCHF 2RA3A 1OWKA 1NESE 2C3SA 1DLEA 1MZDA 3A88A 1EX3A 2OUAA 3SJIA 3MH4A 1YKTA 1SQOA 1AIXH 1IQIA 3BTQE 2ZPSA 3TJUA 3A7WA 2BB4A 2ZWLH 4U30A 2ZQ1A 3PLKA 2GMTB 4WVPE 1EJMA 2C90B 3KCGH 4TPIZ 1O36A 3B9FH 1K1LA 2G5VA 5T6GA 1O2PA 1C5RA 2O8LA 1HJAB 4YLUA 1TGBA 4B71A 2HNTE 4CRCA 3F2HA 1T4VH 1AVGH 1YPEH 3GOVB 4IBLH 1O37A 2BQWB 2FOMB 4X0WU 4I86A 1X7AC 2Z3EA 1SGIB 4H42U 1GHZA 1F0SA 1DPOA 1SGDE 1TPPA 3RXCA 4CBNA 5C5OA 4SGBE 5FPYA 5A09A 3NZIA 4OS1A 2Z9LA 3UR9A 3VPKA 3A7XA 4Y7AA 1O3PB 1RIWC 3GY7A 1YCPM 1TRNA 3SUEA 1MUEB 5DK1A 1SMFE 3BTWE 1ELTA 2BX4A 3TITA 3ZVBA 1GMCF 2BD4A 2AMQA 2RDLA 1P01A 4B2CA 1AGJA 3LH3A 4YOIA 2XBVA 1O2RA 2F83A 1CHOG 3F2GA 4AGJA 3KN2A 3A7VA 2GV6A 1IQKA 2FZZA 2G51A 3LH1A 1OWDA 5DP8A 1FMGA 1WAYB 4LXBH 4ESTE 4E06H 2Z6BD 3OY6U 1O3IA 3W1EA 4CH2B 1W7GH 4O3TA 3A87A 3LONA 1ZR0A 2BY5X 4DT7B 2K0QA 1H9HE 2P3TB 1UO6A 4I32A 7GCHG 1LVYA 3RXPA 1BRCE 2AIQA 1BHXB 1ZRKA 4ABHA 2M2AA 1SOZA 1C9TA 1GDNA 1BITA 4GHTA 1W11U 3M7QA 1O35A 2BZ6H 4TY6A 1W0JD 2I6SA 4AB8A 1MABB 1PPGE 4INKA 2GX4A 1GI6A 2NU0E 4WWYA 4AZ2B 3FN8A 1O5GH 1F2SE 2FYQA 4CRFA 1SQRA 1TABE 2Q6FA 3PMHB 1A0JA 1C2EA 1GWAA 3A8DA 4ZH8A 1C2GA 4ZXYH 4AB9A 3QO6A 1HIAB 1HYLA 3GY2A 4B75A 1E1RD 3LGIA 1GJ6A 1FPCH 1GJ9B 3MQKC 1QR3E 1EP5A 5GXPA 1T8OA 5FBIA 4KP0A 1ANEA 5EQRA 1HNEE 3E3TA 1IQFA 3UQVA 2F9NA 1WBGB 1O32A 2ULLA 4IMZA 1Y5UT 1OS8A 1O2GH 4KTSA 3I29A 5CE1A 2OC0A 4XRNA 1IQLA 4XFQA 1QURH 2VNTA 3BIUH 3ODDA 1OWJA 2Y80A 3GCNA 1KDQB 3V12A 1NRQH 1C5VA 1TPAE 2WSSD 3EE0B 2P3FH 1ARCA 2R3UA 1C1SA 1OXGA 3UY9A 3W94A 4KTCA 5GCHG 1DICA 1FN8A 4WJG2 3SI4H 5C20A 3OEED 2AEIH 2BVSH 1G3EA 2QXGA 1Y3VA 1TLDA 1B0FA 1ZHMA 3QUMP 1EOJA 1WCZA 5F6MA 3SZNA 1MD8A 1V2NT 1DUAA 2B7DH 1FUJA 3PLPA 3GDVA 4X1QU 3ODFA 4ABDA 4K69A 3U1JB 2A1DB 2ZECA 1IQNA 1AFQC 4ABIA 3AW0A 4RKOB 4IS5A 2WPJS 4D9QA 5HXFA 2QF4A 3UREA 2HNTF 4IGDA 1FDPA 1ZHRA 4TWWA 1GMHF 7KMEH 5I25A 5HIYA 2LPRA 3ZVGA 2NU2E 1QBNA 2ZNKH 3VG8A 2C8WB 2P16A 3SHAH 1VITH 4ZCNA 2ZU4A 5FL7D 1BUIA 5EGMA 1LQDB 3MH7A 1H9IE 2PWXA 1ESTA 5A0BA 2BM2A 3MU1A 1VKYA 1LMWB 4X8UH 2HVYB 1DM4B 1IHSH 4ISNA 1JOUB 3RMLH 2ZFQH 3ATKA 1TMUH 2OK5A 2FOFA 2WUBA 1GMCG 4AC9A 2QF0A 4LZ1H 1HIAA 2BLWA 1UVUH 5AF9H 2PSYA 1NROH 2V3OH 5EJ1A 3SW2B 1TX8A 4D7FA 1E34B 3NPSA 2J38A 2FTMA 1PYTD 1ZSLA 3F0PA 1M9UA 3D49H 1ORFA 3P8OA 2OXSA 1ANDA 3CNRA 3LKWA 1C1VH 3BG8A 1C4V2 1BTWA 1GGDB 2G52A 3SI3H 1EUFA 1RS0A 1O2IA 2FO9A 3UNRA 1INCA 5JBCS 1QQUA 1GJ7B 3SJKA 3PRBA 1GJBB 1QZ8A 2VH6A 3D65E 4A5TS 1PYTC 1HJ9A 1A0LA 4OGXA 4K8BA 2NU4E 2ZGCA 1DWBH 1B5GH 1MH0A 1MZAA 1A5IA 1UW7A 1P02A 2AMPA 2ZDNA 4ABEA 4OS6A 1DSUA 4Y8ZA 3QN7A 3PTBA 4ZHAA 4FUJA 1NU7B 2GDEH 1CGIE 4JZ1A 2FOHA 3F9FA 1YYY1 4NA9H 1YBWA 1U6QA 1UHBA 1ELGA 1LHFH 2C93B 4JZFH 2SGEE 3URCA 3DD2H 1O5DH 1C4Y2 1GJAB 5FCRA 1NRSH 2BXTH 2QE7D 4TPYA 1SGFG 1YPGH 2SGFE 2QV1A 3NK8A 4YTAA 1LVOA 1LHEH 2XRCA 2ANYA 4AG2A 2GCTC 1BMAA 3WW7A 3SUDA 2WZQA 2ZC9H 1SLWB 2FX4A 2A2XH 1QJ7B 1VJAU 2F4LA 1TPOA 2HPPH 2PKAA 1EQ9A 1A3EH 4AN7A 2V3HH 3MHWU 1HAIH 1T4UH 3NRLA 1QJ6B 3K6ZA 4Y6DA 5ABWA 1G2LA 4X2YA 2ZHWH 1KTTB 5DP6A 1O2SA 1GBTA 1RD3B 5L2YH 1GJDB 1BMFD 3FZDA 2XBXA 2Y5FA 4OS2A 5ESBA 5FXLA 3QWCH 2J98A 1W12U 1HAGE 2SFAA 4FUBA 6ESTA 1IQEA 3F3BA 1AO5A 2R3YA 3E8LA 2VBCA 1G36A 3QZRA 4AOQA 3RLYH 2ALPA 1UVSH 1VITG 2SGPE 4CRDA 3VXFH 1K1JA 4E7NA 4BAOB 5DG6A 1CBWC 1P05A 1AE8H 5G4BA 2D8WA 3UTUH 1GMHG 1AKSA 2FOCA 4JZIA 3UNQA 1GBHA 1MCVA 4MNWA 1KXAA 2A5KA 5FHTA 1GL1A 1RFNA 1WV7H 3O8RA 1LHDH 3ENSB 4M7GA 5EOKA 2XTTB 1C1RA 1O0DH 4ASUD 4I33A 3OSYA 3GCHB 1QB6A 3AW1A 1GBEA 3O8BA 2WPHS 1V2MT 5TJXA 1V6DA 2FIRH 4X1SU 3U8OH 3N7DA 4BAQB 5KECA 2Y7ZA 1MAYA 4CH8B 3QGJA 1QRXA 1Z1IA 1FIZA 1LKBA 1T7CA 2Z94A 1H8HD 1SGCA 1O5CB 4BXWA 3PM3A 1DWCH 1P57B 1NZQH 2P3UB 8LPRA 1O3GA 3Q77A 4WMDA 2OBOA 3MNXA 4MNVA 4UD9H 1HAXB 1BRUP 5C1UA 4D76A 3RXVA 4Z0KA 1W3CA 4BAHB 1MU6B 1K0HA 1TMBH 2VGCB 3ZZ6A 3P95A 2CHAB 2FP7B 1O39A 3SO3A 3RC5A 5C3NA 3EA8A 3U9AH 2Q1JA 3WWBA 5A8YA 2UWOA 1V2JT 1ESBA 5GJ4B 3RU4D 1UCYE 3KF2A 3RUOA 4Q80A 3O8DA 3P70B 1W13U 2ZEBA 4YT6H 1KXCA 2Q6GA 2PTCE 4KELA 3K9XB 2PFEA 2WHXA 2ZGBH 1ZYOA 1QBVH 3M61U 4CRAA 1ZMNA 2PGQB 1CT0E 2OQ5A 4J2YB 5E8EH 1L4DA 5A2MH 5JB8S 4AFSA 1K1PA 1SGNE 4ZROA 2J9NA 3TH3H 1FY3A 3FP6E 5FCKA 3MFJA 1A4WH 1NT1A 4O9VA 3LGTA 1FJSA 3UWJH 3RXTA 3TH4H 3ZVCA 4XSKU 1FONA 4TWYA 1S5SA 1XUKA 3RXOA 1VJ9U 3QDZB 1S6LA 2VU8E 5HM2A 2G4UA 3RXGA 4B74A 2GZ9A 2XC0A 3RC4A 4FU9A 2WPKS 1S83A 1EAWA 3IWMA 7LPRA 3IITA 1KXFA 4GVUA 1MTNB 1GBMA 1D3DB 3HK3B 4ZKSU 1C1MA 1FY5A 2BDIA 2RDEA 1ZLRA 3GYMA 1QGFA 2D1JA 2ZTZA 3QZQA 1O2UA 3GY4A 4MQAA 1KLJH 1W0ZU 1GI2A 1OP2A 1TPSA 1UMAH 4OS7A 3BN9A 5L2ZH 1SC8U 1LVBA 1XUIA 3N7EA 2BD5A 3KL6A 3PMBB 1FZZA 5EQSA 1MQ6A 1MCTA 1K9OE 3SGQE 4ABGA 1WXRA 6LPRA 5CHAC 3S69A 3SU4A 1LPKB 1FAKH 4M9FA 4X8TH 1K2I1 1OP0A 1KYNA 1V2OT 3OX7U 3VFEA 4GLYA 1C5SA 1EZXC 2G5NA 5DJ7A 2SGAA 2J92A 1EAXA 4BTUB 2OD3B 3GICB 2P8OC 5FPTA 1BTXA 3F2FA 1GL0E 3UUZA 1ABIH 2ZU3A 3DHKH 1UCYK 1ELDE 2EEKA 1Z6EA 1CHOF 2VVVA 1OYQA 3CENA 4FETA 1EKBB 5F8ZA 1CVWH 1GCTC 2XYAA 2EI6A 3FOAA 2FOAA 3N7OA 3EYDA 1QA7A 2ZTXA 3BG4C 1ZHPA 4I8LA 4Q7XA 2A4RA 3MNBA 3LC5A 2Z9IA 3T26A 3KYGA 2H5DA 2AGEX 1MAXA 2XWBI 4DT4A 1NS3A 1CA8B 1HGTH 3GDUA 4K1SA 1JIMA 1H1BA 1UJ1A 4O03A 4I31A 1DS2E 3H7TA 3R3GB 1MKXK 2AHME 1ABJH 4ISLA 1EFRD 2GJGA 1FXYA 1WYKA 2FOGA 2ZZUH 5GPIB 3V13A 1THSH 3RXEA 1RIWB 3K65B 1AWHB 2VIOA 1TOCB 4ZKOU 2BVRH 5CMXH 3M5MA 2FEQH 3SBKA 3ZZ7A 2BDBA 1AB9C 3B23B 3UFAA 4WF8A 5T1VA 3E0NB 4Y0YE 4ACAA 5T6FA 4X6PA 1O5BB 2Y82A 2WV5A 2VIDA 1Z8IB 1IQGA 2OC7A 2JJ1D 2BOKA 4JK5A 1UCYH 2LELA 2TGTA 1QL8A 1O2VA 1BB0B 1Y59T 1EPTA 2FS8A 2YNBA 1SGPE 3RXLA 4Y0ZE 4YT7H 4GAWA 4I8GA 3KQEA 2FI4E 1V2PT 3ZZ3A 5JB9S 1WTHD 1ELCA 2TRMA 2B0FA 6CHAC 1JWTA 4CR5A 4IW4E 2WPMS 4I7YH 1YWUA 5LPEA 1CA0C 4WXIA 8GCHF 1G30B 3T62A 2PP6A 1DLKB 2GGVB 4WY3A 3TJVA 1FV9A 2OC1A 2GZ8A 3AASA 2O8WA 1FY4A 2JJ2D 3LJOA 2GZ7A 1C1UH 3U8TH 1C5MD 3OU0A 3SJOA 4FU7A 1MKXH 2J34A 2BOHB 2XCFA 3KYFA 4HI3A 1OKXA 3MTYA 1P3CA 2IJOB 3BSQA 3RXSA 3ZIAD 1AHTH 1WU1A 1O3AA 2ALVA 3PWCA 2K1QA 3PROA 3SHCH 4F55A 1Z1JA 2A4QA 1F5KU 2IOTA 3UAIC 1C1PA 4UFGH 2PW8H 3ZVAA 3GCOA 3FVFB 1S82A 5EQQA 3SU3A 3QX5H 4FVDA 4P02A 3ZZ9A 1O38A 1XX9A 3ZVEA 3SU0A 2TPIZ 1MD7A 1SFIA 1O3LA 1XMNB 4O3UA 1Y3UA 1BTUA 1G3BA 1GG6C 1K1OA 2XOKD 4UEHH 4JZDH 5C1XA 1FNIA 1S85A 2QGRA 2VH0A 3ZV9A 3LGWA 1C5TA 4OS4A 1UK4A 4A92A 1KIGH 2CXVA 1V2ST 2JH6D 2AGIX 4XBDA 4B2AA 1L4ZA 1BRBE 1F0UA 2W5EA 1YLDA 1BQYA 3TPIZ 1KXBA 4ZKNU 4IN1A 1FX0B 1O3OA 1QHRB 4FUIA 4FUHA 7ESTE 2VJ1A 4UFEH 1LQEA 3TNTA 1DXPA 1MU8B 5BRRE 2FOBA 1AFQB 1XKBC 4AFUA 5LGOA 1MMJN 1RJXB 3VXEH 1FLEE 3S9AA 1OOKB 2W7UA 4MTBA 1H4WA 1PPFE 2QAAA 3U69H 2F9BH 5T3HA 3VB4A 3TK5A 1UTOA 1LPGB 1GDQA 1AN1E 2ODYB 4K3JA 4E7RG 5E0HA 3LGVA 1YLCA 1P06A 2EI7A 1Z7KA 2IN2A 1SB1H 3F9EA 1O31A 2UWPA 1TGTA 3V7TA 2CJIA 3PTNA 1SPJA 1GMDF 3ZYDA 2BD3A 2CK3D 4JMYA 1ZMJA 1QY6A 3MI4A 1TGSZ 4HZHA 5CHBA 2ZCKP 1GHYH 1D3PB 4RI0A 1ETSH 2CN0H 1LTOA 3CS0A 1OP8A 1F0TA 3QLPH 1C5WB 3RDZA 4E05H 1N6YA 1O2QA 2VVCA 3KHVA 4RKJB 1K21H 1O3MA 3BTDE 1ELBA 4IC5A 5C5NA 3BEIB 2A7HA 2PHBA 5E0GA 1SKYE 2V0BA 5L6NH 3TVJB 4DIIH 1S0RA 5A8ZA 1GVZA 2KZ4A 1SLVB 1TAWA 8GCHG 9LPRA 4BXSA 2BY8X 2XNIA 1SGEE 3KQ5A 3DFJA 2AMDA 1H8ED 2AGGX 2OQUA 2VWNA 1GI8B 2R2WU 2J5UA 1ANCA 1NY22 4F4OC 2Z9GA 1YPHE 1NFXA 3P17H 1TMTH 1FQ3A 1BHXF 1ZSJA 3F6UH 5DSFA 5C1YA 4JYTA 2OCVB 2W3KA 1VITF 3A8BA 5FX5A 3LT3A 1GDUA 2VINA 5GWZA 1BTZA 1DITH 2KX4A 1K1IA 2VWMA 1A5HA 2GCTB 3SJ8A 1KXEA 5EG4A 2ZU5A 4CHAC 1J14A 2NU3E 5JBBS 1TBQH 1XVOA 1QB1A 2BDAA 2OTVA 3CS7A 3OTJE 2BQ7B 3FP7E 3RXBA 4B6EA 1IQMA 1NBMD 2IJD1 1CHGA 2A4GA 3SNDA 2PV9B 2PUXB 2QA9E 3DA9B 3SNAA 2F9OA 4O97A 3PWBA 1O5EH 4FUCA 1UVTH 4ABJA 4IC6A 1ESAA 1S0QA 1SHYA 3E91A 4CRBA 1FPHH 3MO6A 2HNTC 1TNLA 2BQ6B 1O3DA 4X1RU 2KCYA 4I8KA 1QTFA 2ANKH 1JMOH 1CBWB 5EW1H 1KDQA 1YP9A 4BAMB 4AX9H 3S9CA 1TRYA 3NWUA 1QIXB 1E79D 2ZDLA 2A7JA 4RSPA 5BPEA 4ZKRU 2G8TA 5HIZA 3SZEA 1YCPK 3M5NA 3AAUA
chains in the Genus database with same CATH topology
3RMMH 1ETTH 1O2XA 1Q2WA 4U32A 3K2UA 3TGIE 1EAUA 1ID5H 2DE8A 1PPHE 4Y8YA 1HAVB 4YZUA 1WOFA 3GY3A 1C2KA 1TNIA 3S7HB 1BOQA 4UFFH 3STJA 1TA6A 1O30A 4NCYA 1O2ZA 1GMDG 1GJ8B 1HV7A 1QCPA 1E0FD 1P2KA 1K22H 1WSSH 5J4QA 1CU1A 3VB5A 1ARBA 3EGKH 2G81E 1C2FA 4A6LA 2ZP0H 4NFEA 1DUEA 1IQJA 3H7OA 1TX6A 3L3TA 3TH2H 2KAIB 1SGYE 5EW2H 2TGDA 1GBBA 5EPYA 3JZ1B 4ABFA 1IQHA 4JCNA 2CV3A 2SGDE 2ZDAH 4I8HA 3VGCC 1EXFA 1XM1A 1ZPZA 1P12E 3FAOA 1A46H 1VGCC 3GY8A 2CF9H 3LOXA 4X1PU 2O8MA 2XCNA 1V2VT 5E2PA 2TGAA 3SGBE 2PUQH 3SUGA 1NPMA 1VZQH 3ZZDA 3SV2H 1VCQA 1JBUH 2XC5A 1SQAA 4K2YA 5E2OA 3S0NA 2VB0A 1YCPH 5H4IB 1FN6A 1C5NH 2TGPZ 1EP6A 1OWIA 1SI5H 3RXFA 3MOCA 1HAYB 2H9EH 1GVLA 3BTKE 2CGAA 1G37A 5EPNA 1DWDH 1UTMA 2GT7A 3T25A 1WQSA 2Y5GA 1ELVA 1B7XB 2V35A 1TNKA 3K6YA 1BBRE 4FUGA 4Y8XA 2XXLA 3RU4T 2A5AA 3BEUA 2PLXA 2BDYA 1ZZZA 2J95A 1BZXE 4YOGA 2J2UA 1O2KA 4X2XA 5C67A 3Q76A 1SFQB 3IG6B 2BD8A 2JH0D 2ZFPH 3TJOA 1XXDA 2EC9H 2ZA5A 5ETXA 3ZYEA 4JYUH 4WXVA 2IPHA 1DSTA 3ATIA 4Y7BA 2ZFFH 2FWWA 2WYGA 1T8LA 1DX5M 2ESTE 5AFYH 4ZXXH 1O2WA 1V2LT 1T8MA 5DP9A 1PQ7A 2Y7XA 2RCEA 4BAKB 1TE0A 2FTLE 1TGNA 1EASA 1YC0A 3P8FA 1N8OC 2GV7A 5F8XA 3ZVFA 1GI9B 3T2NA 3ZZ5A 4D8NA 5E0JA 1HAZB 4QT8C 1TB6H 3P8NA 4X6MA 1QB9A 4DVAU 1Z8JB 1P8VC 3GCTG 4ASHA 4MNYA 1XKAC 4DURA 3A81A 2RA0A 3NCLA 2C8XB 1TBZH 5CHAB 2BD9A 1D3QB 1PQ8A 4Q7YA 1YPMH 1BTHH 3ZZAA 2ZFSA 1BMNH 3SN8A 1DVAH 2PSXA 3M35A 4X2WA 1WUNH 1MTSA 3RMOH 2C8YB 4JZEH 3RXUA 4CBOA 2P8OB 1ZSKA 1AFEH 5FAHA 3D62A 2QXHA 1N6XA 3ZV8A 4Y71A 2ZDVH 1F5RA 3RXKA 2A45B 1GCTB 1C2HA 2F9PA 2XBYA 1SOTA 4HGCA 1C2IA 1O3CA 1TX7A 3BG4B 3SORA 2R9PA 4GHQA 2FOEA 1OYTH 1SGTA 3SNCA 1TALA 1JIRA 1EZSC 1BBRK 1JRTA 1IAUA 1RTKA 1QA0A 1C1QA 1W8BH 5PTPA 3MO3A 1SGQE 1CSOE 1CQQA 1MTVA 2O8TA 3RXRA 1V2KT 3PO1C 4X1NU 3DFLA 5DP4A 1W0YH 1LDTT 1THPB 1A1RA 1YPKH 2PKSC 1EAIA 1AB9B 3SUFA 4AG1A 1HAPH 1Y5BT 1C5UA 1P0SH 3H5CB 2SNVA 3URDA 1Y5AT 1A7SA 2GD4B 1S6HA 2STAE 4ISOA 1P03A 5HGGA 4NFFA 1ZTLA 5J4SA 4NIWA 2BY7X 3MU8A 1QJ1B 1K28D 1O5AB 3FP8E 1ZGIA 3RXQA 3BIVH 4F49A 1C5YB 2C8ZB 1N1LA 1ZPBA 1O3KA 2OC8A 2ZU1A 6CHAB 4OGYA 1EB2A 4FXGH 1AZZA 1P2JA 1QBOA 2FPZA 1IOEA 1CA0B 5EXLA 1K1NA 3EQ0H 1PPCE 4NZQA 1L2EA 1HFDA 3HKIB 1NFYA 1O2YA 4Y11E 1OSSA 1Z8GA 3MH5A 1KLIH 1BBRH 1JXPA 1UVOA 5K7RA 2QYIA 1C5QA 2ZQ2A 3T27A 2F9VA 4B73A 2ODQA 3Q3KA 4TY7A 1YGCH 3G01A 2AYWA 4K60A 3VB6A 3QK1A 1VCWA 1QFKH 1MQ5A 4AFQA 1E37B 2WYJA 1O3BA 5DP5A 3TGJE 2ZGJA 3ATLA 1C5ZB 3NUMA 3P92A 2BD2A 1AZ8A 2A2QH 3LU9B 2ZHQH 3SGAE 3QGNB 4K8YA 5GIBA 2QN5T 2ANMH 5K0HA 8ESTE 4NWKA 1ZTJA 4MPUA 3RXDA 4J1YA 3SU2A 1TGCA 2ZCLP 3A7TA 1UTLM 1E36B 1P2IA 3SU5A 1HCGA 1CGJE 1GG6B 5JBTA 1GI5A 2H5CA 1AVWA 2FYRA 4NA8A 3TK9A 2ZPQA 1EJAA 1NFWA 2VWLA 3KNXA 5SGAE 1NRNH 3UNSA 2G4TA 2HVXA 2R2MB 4Q7ZA 2GP9B 2R0LA 3LGYA 1QNJA 4GPGA 3FANA 1TBRH 4K1TA 1GHBF 2YOLA 4NIXA 1P10A 1TIOA 3T29A 4NA7A 2HWLB 2VVUA 5LH8A 5L30H 1F7ZA 1J8AA 1GBCA 8KME2 3E16B 3EA7A 2OINA 1BTPA 1WQVH 1D4PB 2I6QA 2OP9A 1UTQA 3ZZ8A 1G32B 1SBWA 1DY8A 2AERH 1RTFB 1P2MA 1NN6A 1G9IE 3SU1A 1KXDA 4DW2U 1P04A 1XUGA 1GBAA 4HTCH 2HPQH 1DE7H 2ZPRA 1GJ4H 4ZMAH 2A5IA 3M5LA 3A7ZA 1A3BH 2HALA 3TJNA 3TLOA 3W95A 2V6NA 1H8IH 2SNWA 1EPTC 3SV6A 2P59A 3HGPA 5EXMA 3AVZA 1PPBH 3WY8A 6GCHF 4MVNA 2BLQA 1FI8A 2AIPA 3RXIA 2Z3CA 2EI8A 3ESTA 4GSOA 5TCAA 2WINI 3SJ9A 1QL7A 2WPLS 3PMJA 4UFDH 3RXJA 1MKWH 4JYVH 2H1UA 3ATWA 1D6RA 9ESTA 4GUXA 3QTOH 2XC4A 4AGKA 3LDXH 5A0CA 2W7SA 3F1SB 2QCYA 4ISHH 5JDUB 1W10U 4YO9A 2FX6A 4D9RA 2SGQE 1AUTC 1W2KH 2BDHA 4XE4A 5FPSA 1THRH 1O34A 3GYLB 4X6OA 3HKJB 4B1TA 4WH8A 1LPZB 4HFPB 3RC6A 2FM2A 1ELAA 3F9GA 4YM9A 2BD7A 2LNCA 4UE7H 3TIUA 4X8SH 1TONA 4ISIH 1LCYA 2Q6DA 5I46H 2JETC 5IDKA 4D7GA 3MNSA 1VCPA 1ZJKA 4SGAE 1ELFA 2P93A 1O2HA 2FDAA 1O2LA 2ZDKA 1YM0A 2UUJB 1BJUA 1ZMLA 3EA9A 5DP7A 3S7KB 3TK6A 1ETRH 1VR1H 1L1GA 5AHGH 1GI0A 2BY9X 2FODA 1C5PA 4RN6A 4CHAB 2HOBA 3M37A 1UTJA 1HXFH 1TWXB 2F9UA 1HPGA 2PGBB 3I77A 3P8GA 1PPZA 1Y8TA 1E38B 3ITIA 1DWEH 4VGCC 2Z7FE 2ZI2H 3PLBA 1SSXA 1GBIA 2BLOA 3C1KA 1Y3WA 2DUCA 3M7TA 4DJZB 1GHBG 3HPTB 2QC2A 4MNXA 1YPLH 4OS5A 4A1XA 4BTIB 3M7UA 3PV4A 1HBTH 1NO9H 2BVXH 2QXJA 1SHHB 2H2ZA 2GMTC 1O2MA 2OBQA 4Y79A 2J94A 3HK6B 3UR6A 1FAXA 1SLXB 1ELEE 1HLTH 1HJAC 3SNBA 3VEQB 3FFGA 3M3VA 1ZOMA 3A85A 4FVBA 1UVPA 1S81A 2BMGB 1UTPA 1BCUH 1XUFA 1EOLA 2FXRA 3BTGE 5FX6A 2GCHF 3HGNA 3UQOA 2H9HA 4H6SB 1Z6JH 1SG8B 1AVXA 2YNAA 3TU7H 2C4FH 1PFXC 2FLBH 2G55A 6GCHG 2BDGA 4X8VH 5F8TA 1SGFA 4FUEA 1TNHA 1LHCH 2J4IA 2JH5D 4MPWA 4ZUHA 2EA3A 3LPRA 2BYAX 1LHGH 3KQCA 4MG3A 1P09A 4MPXA 1T31A 2NU1E 3UWIA 2P95A 1GBKA 2HRVA 1NC6A 1C5XB 2FMJA 2ZO3H 1BDAA 1HB0B 2ZFRH 4LZ4B 1L1NA 2M5TA 2A32A 1V2TT 2BDCA 2GDDA 1A2CH 4LOYH 1UHBB 3TGKE 5EU8A 1OWEA 3VGCB 2VIVA 1O2OA 2WUCA 4ABBA 1NRRH 1CE5A 1O3FA 1VGCB 3KQDA 1TYNA 3M3TA 4PROA 1SR5C 4BOHA 2R0KA 5GDSH 1TQ7B 3F68H 1RRKA 5LPFA 1TA2A 1AI8H 1Y3XA 3GY6A 4NWLA 1XUHA 1SLUB 1SVPA 4DIHH 3A8AA 1O3HA 3VB3A 4NZLA 3SOSA 1Z71A 2Z9JA 1UK2A 3A89A 1QL9A 3E6PH 2PKAB 3LIWA 4R0IA 1BA8B 2BXUH 4U2WA 4ZAEA 2ZF0H 3GCTF 4IMQA 4FUDA 5TCCA 4FU8A 1H9LB 3DT0H 2RG3A 4U01A 1P2OA 3EAJA 2ZHDA 3U8RH 1SGRE 2VIPA 3ZZCA 3RU4E 1GJCB 4ABAA 2A31A 3SV8A 1HAOH 3PB1E 1HUTH 1WTGH 4K1EA 4DOQA 1EATA 2AH4X 2XWAA 5AFZH 1P9SA 4BANB 1AMHA 3ZZBA 3KEEA 2XW9A 1C2JA 2BLVA 1G3DA 4FUFA 1A5GH 3RM2H 5A0AE 1GBLA 2ZHEH 3RM0H 1XUJA 3KIDU 4AFZA 5EXNA 1YF4A 4WH6A 1AKSB 1LKAA 2Y5HA 2A0QB 1N8OB 3OY5U 4TYDA 4ZHMU 1YPJH 1BJVA 1T32A 2ZDMA 4IN2A 1PQ5A 3V0XA 3LC3A 3E0PB 5DGJA 1FIWA 1GBDA 3RP2A 3BTHE 1QQ4A 1PJPA 1P9UA 5DP3A 1CT2E 1GHAF 2Z3DA 4MLFB 1P2QA 2F91A 3MU4A 4JK6A 4DGJA 2VIQA 2G00A 1P2NA 1LO6A 1DFPA 4DY7B 4NSYA 1MTUA 3MYWA 1GHXH 4KTUA 1EZUC 3JZ2B 2ZGHA 3A82A 4LK4A 2QXIA 2GCHG 5B6OA 1GI1A 2BX3A 3M5OA 2WV4A 1GI4A 1C2MA 2D26C 1BT7A 1V2UT 2ZGXH 1EB1H 5EODA 2ZFTA 1AQ7A 1D3TB 1O5FH 1V2WT 5ESTE 1GI7B 3L6PA 1P11E 1GJ5H 3O8CA 3UPEA 3BTTE 1L0ZA 1DOJA 1HDTH 1O3NA 4WMEA 1C1TA 4ZHLU 2THFB 3UOPA 1C9PA 3ZVDA 3B8JA 4KKDA 1ACBE 1E35B 3Q00A 4XBCA 1KTSB 4NGAH 3RXHA 1FY8E 1K1MA 1W14U 2W3IA 4K5ZA 3T5FH 3NXPA 2B8OH 1O2TA 1ZPCA 1HAVA 1GGDC 4GCHF 1J16A 1MTWA 1CT4E 3F9HA 1B0EA 3PO1B 4X6NA 3D23A 1NRPH 1V3XA 1J15A 1UTKA 4H4FA 3E90B 3STIA 2TBSA 4NIVA 2PKSB 1YPHC 2QIQA 1C4U2 1DDJA 2ZIQH 4AYVB 3I78A 1GI3A 2HGTH 1Q3XA 4UONA 2Y81A 1NM6A 2FESH 2KAIA 1DT2A 3CP7A 2ZKSA 4CREA 1V2QT 1ZGVA 3PYHA 1BIOA 1DANH 1S6FA 3RXMA 3GISB 1HAHH 1BRAA 3M3SA 3OYPA 2DE9A 1UTNA 1G2MA 1TOMH 2WPIS 3M36A 4AYYB 1TQ0B 3TNSA 1F0RA 1GPZA 1ZRBA 3PMAB 3A83A 2UWLA 3C27B 3A7YA 1A61H 1Y3YA 3LGUA 3A84A 1O33A 5JYIA 1J17T 4YLQH 4AORA 4I8JA 1FY1A 1HJ8A 2OLGA 1EJNA 1AU8A 4CR9A 4NG9H 1DXWA 2B5TB 5IYTA 3SQHE 2O8UA 1JRSA 2NWNA 1HXEH 2UUYA 3MU5A 4DCDA 4R8TB 1GHAG 1UK3A 1MBQA 4H6TA 1PPEE 1DY9A 1O3JA 1PQAA 1W7XH 4MPVA 2F3CE 5HM9A 3U1IB 2FI5E 3L33A 1AD8H 4YOJA 1C2LA 2JKHA 2VIWA 4Y76A 4NIYA 3SV9A 1GVKB 1CO7E 1ZTKA 5T6DA 4XBBA 1D9IA 1J9CH 3MNCA 2QF3A 2D2DA 3BTFE 4UDWH 2BY6X 2AS9A 2PR3A 1TRMA 1V2RT 1KY9A 1QRZA 1GHWH 2GKVE 1IHTH 5A8XA 5JPMH 5HMAA 1SQTA 4INHA 1QRWA 4WMFA 4XDEA 3GCHC 2AFQB 3GY5A 2H9TH 1TNGA 2H6MA 3MWIU 4Q2KA 1GHVH 1LVMA 3T28A 1C1OA 1GCDA 1T8NA 1Q31A 2ILNA 1O3EA 3U98H 2PTNA 1OPHB 2W26A 1RXPA 3BEFB 3KQBA 2ANWA 1HRTH 1ANBA 4A7IB 2TIOA 2CF8H 1BTYA 2ZG0H 1TNJA 4GCHG 4A1VA 5C2ZA 1H8DH 1C5OH 2ODPA 3FZZA 5FBEA 5DO4H 4CRGA 5DKMA 2VGCC 1EPTB 3V3MA 1KSNA 2CHAC 2ZTYA 2GT8A 2STBE 2A4OA 3AAVA 2XBWA 1F92A 2FLRH 1D6WA 3HATH 3NKKA 3A8CA 3LJJA 3A86A 5AVDA 1AE5A 1GBJA 2P94A 1NFUA 2HLCA 1AUJA 3BTME 1NU9A 1ZJDA 2VWOA 3DUXH 3RXAA 2GVFA 1CGHA 1Z8RA 1C2DA 5LPRA 5F03A 1XVMA 5HYOA 3RLWH 3ATMA 3P6ZB 3Q3XA 1GBFA 2CMYA 4X2VA 2GTBA 3SQEE 1C5LH 2ZHFH 2BZAA 5JBAS 3BTEE 3BV9B 1C1WH 4KGAA 3MO9A 3A80A 1KLTA 4MDSA 3SU6A 7GCHF 2Z9KA 3EDXB 2O9QA 1AWFH 4XOJA 3MU0A 1F5LA 4NSVA 3ZZ4A 2BHGA 1MKWK 2Y6TA 2BTCE 1OX1A 1S84A 2ASUB 2UUKB 1G3CA 2ZU2A 1A0HB 4YESB 2JETB 3UOUA 1C1NA 1RTLA 3MH6A 2FS9A 3QTVH 1OWHA 1SL3A 1MBMA 1MTNC 1XXFA 1TFXA 3MMGA 3VB7A 1AY6H 1RGQA 4DG4A