2SGAA

Electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title Electron density calculations as an extension of protein structure refinement. Streptomyces griseus protease A at 1.5 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1983-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA01
2BDIA 5CHAC 4NIXA 1PJPA 1ELVA 1C2KA 2ZHWH 1PPEE 1EAXA 1P05A 4K2YA 3SJ9A 1J8AA 1RRKA 1L1GA 2BY6X 3LGUA 2WINI 1G9IE 1BTHH 5GWZA 3BEUA 2UWPA 1O2WA 1G2MA 1SR5C 2H6MA 1P9UA 1GHVH 3ZVAA 1BHXF 1O3CA 4JYTA 1RD3B 4H6SB 5DKMA 4ZKNU 1A7SA 1XUHA 4DURA 2BY8X 1AGJA 3A8AA 3KCGH 3P95A 5L6NH 1TGTA 1ZTJA 1FY8E 4ZROA 1AFQC 2C8ZB 1EJMA 3SUFA 2TGDA 2Z6BD 1XKAC 4DGJA 3ZV8A 2ZTYA 3O8DA 1C2MA 1OWDA 4B75A 8ESTE 1GVLA 1HXEH 1NESE 1WCZA 2ZHEH 2XC4A 1C1VH 1NRNH 1THPB 2BD3A 1C9PA 1GJ9B 1U6QA 3EQ0H 3V0XA 1VJ9U 4DY7B 1EPTA 3M5NA 2BD9A 1THRH 5EXMA 4ZKOU 3SGAE 1ID5H 1O2JA 2TPIZ 1O30A 4KP0A 2CN0H 5L30H 3K6YA 2WV4A 3GY8A 3E1XB 3LOXA 3UR9A 3OY5U 3E8LA 4IMQA 3SZNA 2ZQ1A 1ABIH 4I7YH 2OQUA 1A0HB 2G51A 4ZXYH 3BTEE 2Z3DA 1GMDF 3KIDU 2QYIA 5E0HA 3RXIA 3ZZ7A 2XC0A 3SQHE 4JZIA 1ETRH 2QIQA 3BTWE 4Y76A 1LHGH 1H1BA 4NFEA 1GHWH 1C2IA 3GYLB 3KQEA 3GY3A 4UFGH 1DSTA 5F8XA 4KGAA 5ABWA 3T28A 1FN6A 2EA3A 2A2QH 2XC5A 4GCHF 2WUBA 4AG2A 3UOPA 2ZKSA 3C1KA 2VVVA 1PQ8A 3R0FA 1YCPK 5JB8S 1NFYA 5GCHF 2ASUB 1AB9B 1E34B 1T32A 1TQ0B 5FPTA 2GZ9A 1V2MT 1K1JA 2PV9B 1UVPA 3A81A 3NXPA 5C5NA 1JRTA 4K5ZA 3TK5A 1B0EA 1P06A 1O5DH 1SGNE 1HLTH 4OS2A 3RDZA 2JETB 3AW0A 1QIXB 1GHAG 1GBCA 1BRUP 2A7HA 3RC4A 1HAOH 4MPVA 3SNAA 1A3BH 2Y6TA 1K9OE 2GV7A 2BYAX 5CHAB 5EW2H 4AX9H 3ELAH 3BTKE 2A5AA 1C5ZB 4GCHG 2Z9JA 3SJKA 2BD8A 5H4IB 4JK6A 3P8GA 4X6PA 4H4FA 1PPHE 2XRCA 1Z7KA 1BRAA 2P3UB 2WYGA 4CREA 1SFQB 2F9BH 2ZHQH 3VB4A 2ZU2A 3PLKA 2BHGA 1Q2WA 2ZTXA 4O3UA 3RXKA 4YESB 2AGEX 4I8GA 1AFQB 4ZHLU 4X1NU 2UUYA 3QLPH 2BDGA 3HATH 5FBEA 3EDXB 2AMQA 5J4QA 4NZLA 1W10U 2VH6A 3MO9A 2FO9A 3QWCH 1HAIH 1UO6A 1C5NH 1Q3XA 1T4UH 1SGDE 1V2JT 1NC6A 3ODDA 1A0LA 3RXPA 1Z6EA 2VH0A 5C1YA 1C4U2 2G52A 3SNCA 1BMNH 2QXGA 5EU8A 3V13A 1SVPA 3B8JA 1GMHG 1PPGE 3P17H 1FXYA 4AZ2B 2D8WA 1W14U 1LQEA 2PW8H 1SI5H 2O8UA 1MAXA 1GVKB 4Y0YE 3ZZ6A 2LNCA 3MNBA 3SU5A 4YTAA 1GGDB 3OU0A 1K28D 3U1JB 6CHAB 1GCTC 2ANMH 1FLEE 3BIVH 1LHEH 1KY9A 3ZZAA 2QC2A 1D6WA 3SI3H 5HM9A 1O2LA 3S9BA 3A7TA 1BTUA 1G36A 1KTTB 4VGCB 2OUAA 4Q7XA 1QL9A 1C1UH 1UTKA 2D26C 3KGPA 1IQGA 2BM2A 1NPMA 2NU4E 1LPKB 3A8CA 1EOLA 1D3DB 1N6YA 1HYLA 1PYTD 5GXPA 4Y10E 3RC6A 1F5LA 2AERH 1L4DA 1RTLA 2OCVB 3SU6A 1C5OH 4FU8A 1GHBG 4IGDA 1ZPBA 1AKSA 2A2XH 2IOTA 1GBKA 1MTWA 4ISIH 5JDUB 2OC1A 3RXQA 1O3PB 4ZKSU 4A6LA 2M5TA 1GJ6A 2F9VA 1EUFA 8GCHF 3MNCA 1AI8H 1BJUA 1O34A 2ZEBA 5FBIA 1BOQA 4X1RU 1FY1A 4CRFA 1C5MD 5DGJA 3H7TA 1Z8GA 3MFJA 3SV6A 3ITIA 1AVGH 1GWAA 5DJ7A 4J2YB 1O2ZA 3A7XA 1UVOA 3HK6B 2TRMA 1AWHB 3JZ1B 4UEHH 4KTUA 4D7FA 1ESAA 2BMGB 2WV5A 1DY9A 1PPZA 2BLOA 4CR5A 2XNIA 1BB0B 1VITF 4X2YA 1YPEH 1C5LH 1AO5A 5E2OA 1QJ1B 2A1DB 3LT3A 2PKSC 1GHZA 4E7RG 5EGMA 1RIWC 4BOHA 1UTOA 5A8ZA 1DWEH 1L2EA 1HXFH 1GBBA 1SGYE 1EZSC 3SUGA 3TLOA 3QGNB 3W94A 1KXDA 4I33A 1NM6A 1A46H 1O3DA 1CT2E 1ABJH 1DUAA 1GJDB 2CXVA 4MTBA 4X6MA 1XMNB 4ZH8A 2FLRH 3EE0B 4MG3A 3VXEH 3FP7E 4XBBA 3SO3A 1SGQE 3TGIE 3VFEA 5SGAE 4IN1A 3U1IB 1GG6C 5AHGH 1F0RA 1VITG 1SGFA 3MU5A 1QL8A 5GJ4B 4YLUA 4OS4A 2ZGBH 2ZU5A 3SNBA 4IW4E 4AN7A 2ZECA 3QTVH 1TGCA 4FXGH 1CA8B 3D23A 3DT0H 1QQ4A 1CHOF 1K1PA 1O2VA 2VGCB 3LGWA 3M7TA 3DHKH 3U8RH 2O8MA 1TNKA 1GDNA 1BTPA 1GCTB 3SHAH 1XVMA 2WPJS 3MU8A 1AY6H 2THFB 4R0IA 2FS9A 4ABEA 3ZV9A 4ASHA 1ANCA 2Z94A 2C93B 3NWUA 3QDZB 1FY3A 2P94A 2QXJA 5EOKA 1O37A 1HDTH 1FUJA 1L1JA 2PTCE 1K21H 1GDQA 1X7AC 3B23B 1OWJA 4DIHH 2FM2A 1GJ4H 3BTQE 1FV9A 1V6DA 1MKXH 2ANYA 3ATWA 1O2XA 1ELGA 3PO1C 2BXTH 3RXFA 4MNYA 3MTYA 6GCHG 4UDWH 2ZNKH 5JB9S 1ZHRA 1K22H 3LKWA 4LZ1H 2SFAA 3MNSA 5C3NA 5LPFA 4XE4A 1W11U 2FTLE 5FHTA 1O38A 3A7WA 5JBBS 5EPYA 4BXWA 1V2LT 4ISOA 1YF4A 2QCYA 1GL0E 1HFDA 2OTVA 3FP8E 3SJOA 1QGFA 1G37A 2J92A 3TVJB 2VIVA 1YGCH 2WPMS 4X2WA 2QXIA 3M7QA 1T4VH 3GISB 5DK1A 1G3BA 1UVSH 4JZFH 5LPEA 2ZPSA 3PWBA 1HAVB 5JPMH 1GI2A 2AMPA 3LGVA 1CE5A 1Y8TA 1C9TA 1EAIA 2AGIX 1YLCA 1AZZA 3ZYEA 1RIWB 2PKAB 1O2YA 1JBUH 1UK4A 2GX4A 4INLA 3BV9B 5CMXH 3L3TA 1CBWC 5A09A 1QB6A 4ZAEA 2V3OH 3SNDA 1SLVB 2AGGX 2OC0A 2ZF0H 1XKBC 2PUXB 4INHA 1GMCF 1NRSH 1QY6A 1S6FA 1Z8RA 1G3EA 1WTHD 3NCLA 3U8TH 1UHBA 3SJIA 3A7VA 2HNTF 1HCGA 3PV4A 4BTTB 1ZLRA 3LC3A 1ANDA 2UUFB 2QAAA 2GKVE 1BMLA 3OTJE 2J95A 4JZ1A 1G30B 2G4TA 3EA7A 1TNJA 4Y7BA 3TITA 3UUZA 4J1YA 2QF3A 3OSYA 2SGFE 4OS6A 2ZU1A 2CMYA 3AW1A 2ZQ2A 1C1RA 1GL1A 1CT0E 4RN6A 1GMCG 5K0HA 3UFAA 4ABFA 1S82A 1FDPA 4YT7H 3F68H 3P8FA 4ABDA 3UIRA 3SHCH 1C5XB 4WXVA 2R3UA 1T31A 1ZMLA 1C5RA 1ZTKA 1PPCE 4NIWA 2Z7FE 1DFPA 1OPHB 4F4OC 5EW1H 1P2QA 2ANKH 4BNRA 1SOZA 1RTKA 3N7OA 2H9TH 1SB1H 4O3TA 3HGNA 1K2I1 1TGBA 5JBAS 2PSYA 5EQQA 4KTSA 5FCRA 1G3CA 1BIOA 1KXFA 4FUHA 2FI5E 3QZQA 3SN8A 4X8TH 1P0SH 3VEQB 4ESTE 2HPPH 3HKJB 2XTTB 1G32B 4TWYA 4X8UH 2ZC9H 2HRVA 3T26A 1IQLA 4ABBA 2XCFA 1XUIA 1H9HE 1BTZA 3GCHB 1S81A 4FUEA 1BA8B 4FU9A 3PLPA 2P3TB 3RXMA 2STBE 1QNJA 1O3OA 3QX5H 3SU3A 1IQKA 5A0BA 1VGCC 2GDDA 2ZDLA 1NU7B 3U9AH 5FCKA 3ZZBA 3F1SB 1DICA 2F91A 3A82A 5EXNA 4MVNA 1AWFH 3SV9A 2AMDA 4K1SA 2ILNA 1NRPH 5ESBA 1ELAA 1P01A 1N8OB 5JYIA 1GJBB 4U2WA 3MMGA 4O97A 3S69A 5DP3A 3DFJA 1BQYA 1MZDA 4K8YA 4BAQB 5FAHA 1OSSA 3TJOA 5DG6A 2OC7A 1O31A 4I8JA 4UONA 4AFUA 2SGDE 1CGHA 3E16B 1GI1A 1KXCA 1P02A 3OYPA 4YOIA 1E0FD 1OP8A 3F6UH 1YCPM 1XVOA 1VR1H 2A4OA 2GD4B 6LPRA 3E0PB 3O8BA 3GDVA 1C5WB 4NG9H 4X0WU 3RMNH 3SU0A 1BRCE 4KKDA 1C5TA 2R0LA 2F3CE 2J34A 2AIPA 2ZTZA 3CENA 3ZVEA 3ZVGA 2W3IA 4FUDA 5F8ZA 5DP6A 1IQHA 1T7CA 3TGJE 1DDJA 3ATKA 1P10A 2CHAC 1SLUB 5F03A 1MQ6A 2C8YB 3KQBA 2A45B 2RG3A 1Z8JB 2A4RA 1EKBB 1TBQH 2W7UA 4K3JA 2OBQA 1RS0A 1DX5M 1C1PA 2TIOA 3LGYA 3ATIA 1DE7H 4GHTA 5E0GA 3E91A 2DE8A 2Z3EA 5DP9A 1SG8B 2VU8E 2NU3E 4AB8A 3TK6A 1PPFE 4BAOB 2PFEA 1QURH 3MI4A 2BY5X 1EP6A 1ZR0A 1XUJA 1OYQA 2CF9H 3HPTB 2A31A 3RLWH 3ZVFA 1O2OA 2ZO3H 1GPZA 1ANEA 3U69H 2UUKB 5CE1A 1IQIA 4MPXA 3IG6B 1O2NA 2V3HH 1GBIA 1BTWA 1KLTA 1GJ8B 4RKOB 1Q31A 3A83A 3WY8A 2RA0A 5AFZH 2ZDKA 1TBRH 3EA8A 2FOMB 2ZDVH 3VGCC 1T8LA 3FZZA 1C1QA 5C67A 1GHAF 1WSSH 5J4SA 1O2MA 1KDQB 1V2ST 3S7HB 2XWAA 1AE8H 1BCUH 1SGTA 1PQ7A 2FDAA 1P3EA 1AD8H 1W12U 1ZJDA 2KAIA 3L33A 4HTCH 1CHGA 4K1TA 2NWNA 1V2UT 1KXEA 3UTUH 4TPYA 2P8OB 1GHYH 2QY0B 1QL7A 3BG4B 1ZOMA 1UCYH 2TGAA 2ZI2H 4QT8C 2A5KA 1EZUC 2IN2A 1ANBA 1MUEB 1AZ8A 1ZRBA 1CQQA 2FOAA 3HKIB 1QJ6B 5DP7A 4B74A 1TA6A 1H8IH 3S0NA 1TA2A 1L4ZA 3URCA 3UNRA 1QHRB 4GLYA 4Q7ZA 2QXHA 1DXWA 1EX3A 1WAYB 1EAUA 1YLDA 2STAE 3TJUA 3GCNA 3IITA 1FIWA 2H1UA 3M7UA 2ZA5A 1INCA 2A0QB 1FAKH 3ATLA 5E8EH 3SOSA 5C1XA 4BAHB 3SV8A 1J15A 1EPTC 4HZHA 2LPRA 1FI8A 1J16A 2PGQB 1GMHF 3M3TA 2ZGHA 5GDSH 1QJ7B 4RKJB 1WQVH 1O3BA 3AAUA 4FVDA 1YPLH 4UFDH 3M5OA 4Y7AA 2NU0E 2Z9LA 1SQOA 2I6QA 4B73A 2GGVB 1FQ3A 1ELFA 2HNTE 1GI5A 1TMBH 2R9PA 2A7JA 2A7CA 3RXUA 3A8BA 4ZXXH 4AGJA 3RMMH 3UNSA 5TJXA 4I8LA 3SU2A 1UTLM 1KIGH 4E05H 1J14A 3URDA 1EQ9A 2OQ5A 1V2OT 4Q80A 4AOQA 1DUEA 1UK2A 3M61U 4X2XA 1JXPA 1H4WA 1QCPA 2VIWA 2ZFSA 1GHBF 1YPHE 3TGKE 2FWWA 1S0RA 1Y3XA 1MKWH 4FUBA 4Y8XA 1OWKA 1ELTA 1HAZB 1THSH 3I78A 1AQ7A 4B2CA 2GTBA 3RXLA 2XBWA 3SGQE 1TLDA 3UREA 2BX3A 4H42U 1NTPA 1SHYA 1CA0C 1HBTH 4UFFH 2ZPQA 5LH8A 1NFXA 3LC5A 1H9LB 1BBRH 2Y7ZA 4HI3A 1NFWA 1YP9A 3RXSA 1DM4B 1GBAA 1MD7A 3GOVB 3TIUA 2PSXA 2B0FA 4AB9A 2VIDA 2NU2E 1UK3A 1UVTH 2G4UA 1Y5UT 5PTPA 2GMTC 5E0JA 3VB6A 1J9CH 5GPIB 4Y0ZE 1XM1A 1ZGVA 1TPPA 4DOQA 3EAJA 3QGJA 4K1EA 1GI0A 1HJ9A 2PWXA 3NPSA 1NU9A 2OC8A 1D9IA 3GY4A 3UWJH 1PFXC 1NROH 3RXTA 2O8WA 1TABE 1QRZA 4BANB 1FAXA 1ETTH 1WOFA 2FYRA 1VJAU 3MYWA 2BD2A 3KQDA 1MBQA 1EZXC 1NY22 1OS8A 4IBLH 2GCTC 2BVRH 4B2AA 1G3DA 2GT7A 3A84A 1C4V2 3O8RA 5E2PA 1NS3A 3TJNA 2F9UA 3SU1A 2BZ6H 1HPGA 1GCDA 1C1MA 1QB9A 4TY7A 2V35A 4X1PU 1A1RA 1MD8A 3A80A 4LXBH 3E90B 4M7GA 1O3LA 1P12E 2CGAA 1IOEA 2FOHA 2JH5D 2BDYA 3PB1E 5AFYH 1O5EH 2FOBA 2ODPA 2HLCA 2ZU3A 1UCYE 1EB1H 1V2QT 3D62A 1TRNA 3UQOA 1HAHH 2ZFTA 4NWKA 4DG4A 1LVOA 1MKXK 4WJG2 4ISLA 2VVCA 2DE9A 2BOHB 1AUTC 1P57B 2WPHS 5L2ZH 1T8NA 1PPBH 2DUCA 1HRTH 4YOGA 1BJVA 1EATA 3M35A 2AYWA 4O03A 3RXHA 1GBDA 1OWIA 1C1WH 3QZRA 2G55A 1Y3WA 1HAYB 1QQUA 2GCHG 2HALA 1GBHA 1A4WH 1Y3VA 3TNSA 1OP2A 3B9FH 3M36A 1MTNC 1HJAC 2ULLA 1F5KU 6GCHF 1C2JA 4WF8A 3SGBE 4WMDA 5LPRA 3EGKH 3M3SA 2P16A 4JK5A 1MH0A 1JMOH 3QUMP 2GZ8A 3HGPA 3PWCA 4YZUA 4I8KA 1M9UA 3JZ2B 4LZ4B 4ZUHA 5A8YA 5HYOA 1JIRA 1AVXA 2VIOA 3FAOA 2G8TA 5FPSA 4ABJA 2EI8A 1CSOE 1P04A 1C2GA 3GICB 1FMGA 1O3AA 5HGGA 5DO4H 1GJ5H 1TNLA 3H7OA 5EODA 2Z9IA 4B2BA 3GCOA 1C5UA 3RXJA 5HMAA 1XUGA 3TH2H 3MO3A 1Y3YA 4FUIA 2FLBH 2HVXA 2I6SA 2ZDAH 1AN1E 2HGTH 2PLXA 2ZFFH 1CO7E 1S85A 2F9OA 1K1OA 1PYTC 1LVYA 1HUTH 2BX4A 1OP0A 1SBWA 2SNWA 9ESTA 1NN6A 1VITH 3VXFH 3KNXA 3K65B 2FTMA 3BTFE 1PQ5A 2ZHDA 1TAWA 4NWLA 4D7GA 2BZAA 5A2MH 1S5SA 2VB0A 1LPGB 1C5SA 2AFQB 1BBRE 2TGPZ 4CH8B 5TCCA 1NFUA 1QB1A 1ETSH 2PKSB 1SMFE 1UTNA 2J4IA 3Q76A 4U32A 2G81E 1FPCH 3GY7A 1C1SA 4IC5A 4WY3A 1P2MA 3M5LA 1SGEE 5GIBA 4IC6A 1YC0A 2HPQH 3BTDE 4GPGA 1A3EH 1DXPA 5T6FA 3MH6A 4JZDH 1TIOA 4AORA 3UOUA 1HNEE 3M3VA 2RA3A 2WPKS 2OP9A 1O2PA 1W0YH 3PMBB 5EQRA 1D3TB 1C5PA 1RTFB 2P95A 3AAVA 8KME2 1GG6B 4A7IB 2J2UA 1W3CA 4YOJA 1KLIH 4KELA 2PHBA 7GCHG 2BQ7B 1KDQA 2G00A 4TY6A 5C20A 2BDAA 3OY6U 1HJAB 1UTJA 4FUJA 4E06H 3SQEE 4K69A 1AKSB 1IQFA 1HB0B 1DS2E 3ZVDA 4CRGA 1ELDE 2BXUH 3RU4D 5I46H 1TRYA 3LH1A 1KXAA 2G5VA 2ZIQH 4YO9A 3LDXH 1MBMA 1B0FA 4UE7H 4Y8YA 2ZFQH 3ZVCA 4DW2U 3NK8A 3NUMA 1SQAA 3F9FA 3QK1A 2AEIH 3SNEA 5HM2A 1FZZA 1HAPH 1MMJN 1V2PT 5BPEA 1E38B 1XXDA 3BF6H 2ZG0H 2ALPA 3RM2H 4ZMAH 5DP4A 3PO1B 3PYHA 4Q2KA 1BZXE 1EB2A 1F2SE 4MDSA 1UMAH 1C2HA 4Y11E 3PTBA 4DIIH 2FP7B 2FOEA 2Z9KA 4KTCA 4Y8ZA 2Z9GA 1UTPA 1SSXA 3O8CA 4INKA 3SUDA 3ZZ5A 2R2MB 1V3XA 1ZGIA 4MNWA 3MU0A 3CS0A 5G4BA 3GY6A 3RU4T 4CHAC 3AASA 3E6PH 4NA7A 2H5CA 1DSUA 1SGIB 2V0BA 1IHTH 1O5CB 2FODA 2H9EH 1FONA 4F49A 3H5CB 1ORFA 3FFGA 4XBCA 3P70B 3PTNA 5FPYA 1P2OA 9LPRA 4I8HA 1OWHA 2VWOA 5JBCS 1AMHA 3BTTE 1V2RT 4YT6H 1QA0A 5T6DA 2QN5T 4XFQA 2AH4X 1CBWB 2OINA 1GDUA 1Y5AT 3DFLA 4CH2B 2ZFRH 3FZDA 1PQAA 3CP7A 1TX7A 2CJIA 1QRWA 1XXFA 2ZCKP 2BY9X 1IQMA 1P2NA 4MLFB 3T5FH 1OKXA 3MOCA 4ZKRU 1WTGH 4NSYA 3MH5A 1YKTA 1C4Y2 1AB9C 1KSNA 4TPIZ 2Q6FA 1XUKA 3BTME 3K9XB 2EEKA 3SORA 3RXDA 2OD3B 4XOJA 1O3GA 2R3YA 4JMYA 1FNIA 4CRCA 2JETC 1TNGA 2B9LA 4AYVB 4SGAE 3PMHB 4MPUA 1ZMJA 2GV6A 1TGSZ 2W5EA 2BOKA 3DA9B 4AG1A 1ZYOA 6ESTA 3VPKA 3ATMA 5T3HA 1O3MA 2UWLA 4FU7A 1LKAA 3RLYH 3STIA 1TPAE 2GT8A 2Y5HA 4X1SU 1O2GH 3KN2A 2ZPRA 1TBZH 1LCYA 1MTUA 3W95A 1UCYK 1L0ZA 1E37B 2GVFA 2BDHA 2BLQA 3TU7H 3SBKA 1D3QB 3VB5A 1O3NA 4A92A 3GCTG 1AHTH 3DD2H 3T27A 2CV3A 2F9PA 4UD9H 2PGBB 3RU4E 7ESTE 1LDTT 3PROA 1TOMH 1NZQH 1K1MA 3ZZ4A 5T6GA 4B76A 4Y71A 1TFXA 2Q1JA 3QTOH 3TJVA 1TALA 1W13U 2VJ1A 1O2IA 2AS9A 1HIAB 3SUEA 1GVZA 1DWBH 1MAYA 1V2TT 2JKHA 4CRDA 2VVUA 3LH3A 2HOBA 4CHAB 2SGQE 1UTQA 1P2IA 2A4GA 1TMUH 1EOJA 1GI9B 3ESTA 1UHBB 1QRXA 1FN8A 2XCNA 2D2DA 1P03A 1H8DH 1GBEA 3BTGE 2JH0D 1CGJE 1VGCB 3UNQA 1GGDC 5DP5A 4FUFA 1Y59T 1O39A 1Y5BT 4GAWA 6CHAC 1KXBA 2ODYB 1FJSA 4A5TS 1FIZA 3UY9A 3STJA 1XUFA 3LPRA 1WUNH 2OBOA 1BRBE 4VGCC 5L2YH 2BD5A 1AFEH 1DOJA 4ABAA 2SGAA 4Z6AH 1GI6A 1TB6H 1Z8IB 2RCEA 1F7ZA 3EA9A 4NIVA 1HJ8A 3U98H 2FIRH 3KHVA 1NRRH 1ZSKA 1EZQA 4IMZA 1QBVH 3SJ8A 1GMDG 2ANWA 4CR9A 1AIXH 1LO6A 1O3JA 1F0SA 1MKWK 1S83A 2Y5FA 3MNXA 1S84A 1O3IA 2YNAA 1MU6B 2VIPA 4A1TA 1WBGB 2SGEE 1EASA 1O35A 2ZFPH 4WMEA 3S9CA 2EI7A 1F0UA 1WQSA 4U01A 1GBLA 4WH8A 1IQEA 2CHAB 1BBRK 3TK9A 4WVPE 1SOTA 4Y6DA 1V2KT 1KYNA 1P3CA 1O2HA 1BDAA 3RUOA 1VZQH 4A1VA 3RXGA 3BEFB 3LGIA 3S7KB 1DLEA 2XYAA 2Z3CA 2Y80A 3RXEA 1UTMA 2P59A 5GCHG 2HNTC 1ZSJA 1CGIE 4NFFA 1O5AB 3FANA 1T8OA 5C5OA 2FOGA 2IPHA 1ZPZA 2BY7X 2O8TA 2BB4A 2UUJB 1YPKH 1TYNA 1O2QA 1ELEE 1QA7A 1SGFG 1BTXA 1Z6JH 1FY4A 4GVUA 1GJCB 1D6RA 5F6MA 1W0ZU 3Q77A 1IQNA 1IQJA 4JYVH 4MQAA 1ZZZA 1YCPH 5DPAA 4JZEH 3MH7A 1YPHC 3HK3B 5JBTA 1MTVA 2IJOB 1JWTA 1ESTA 1WYKA 2VWMA 4XDEA 2F83A 1K1NA 1MZAA 1HAVA 1LTOA 2WPLS 3T62A 3G01A 3L6PA 3ODFA 3VGCB 1TRMA 2XWBI 2Y81A 2D1JA 2FZZA 1BMMH 3A86A 2PKAA 1W7XH 1O5BB 1D3PB 1V2VT 3FP6E 2Y82A 4NSVA 2FEQH 3RMLH 1SLWB 4HGCA 1T8MA 3S9AA 3GY2A 1BMAA 3GYMA 4LK4A 3P8NA 1RGQA 1B5GH 1LPZB 4BTIB 4Y79A 2C4FH 3SV7A 1FPHH 3UPEA 5ESTE 1OYTH 3RXCA 2VGCC 4OS5A 1LHFH 4ABGA 2BD4A 4D8NA 7KMEH 1AU8A 4FVBA 3PM3A 4DT7B 3MH4A 2ODQA 3PMJA 1CU1A 3BSQA 3P92A 1LVBA 2WUCA 1V2WT 3UQVA 1F5RA 1ZTLA 3ZZDA 3ZZCA 2ZDMA 1O2TA 4CBNA 4K8BA 1DWCH 2PUQH 1YPJH 4WXIA 1TMTH 2TBSA 2H2ZA 2PTNA 1SPJA 3U8OH 4X2VA 2A32A 2ZP0H 3I29A 2TGTA 2AIQA 3V7TA 1TX8A 2BLWA 1ELBA 2VIQA 1JIMA 1C2EA 4YM9A 2ZHFH 3SV2H 1RJXB 3GY5A 3R3GB 3E3TA 4NGAH 4WH6A 3A85A 4RSPA 1O0DH 1EPTB 1O33A 2ZZUH 3RMOH 3T29A 1C1NA 4SGBE 3A89A 2H9HA 1SGCA 1O32A 4B71A 1S6HA 2BQ6B 1ZPCA 5B6OA 1D4PB 4R8TB 2GCHF 5BRRE 2FX4A 3RXBA 3TNTA 2W3KA 1P2KA 2XW9A 2B8OH 2C90B 2EI6A 1C2LA 1YPGH 1P2JA 1DVAH 3TPIZ 3GDUA 1AUJA 3CS7A 4AFZA 3PLBA 1KLJH 1YYY1 4AFQA 4D76A 3P8OA 1TQ7B 1C5YB 4E7NA 1O2UA 3RXAA 2ZWLH 1O3HA 2BLVA 3E0NB 2BDCA 8GCHG 1OX1A 1SGPE 3PMAB 2QF0A 1OOKB 1ZSLA 2OLGA 4H6TA 4XBDA 1GI3A 3T25A 1GBTA 2KAIB 1GI4A 4CBOA 1C5VA 4NZQA 2C3SA 2JH6D 2J9NA 2QV1A 1EP5A 2Y7XA 3ZYDA 2B5TB 1G2LA 1H9IE 1ARBA 1Z1IA 4NA9H 1MCVA 2ZCHP 3MO6A 2BTCE 2QA9E 3OX7U 1K1LA 1YPMH 3P6ZB 3ZZ8A 4NCYA 3LJOA 1HAGE 1TGNA 7LPRA 2ALVA 1CA0B 1F92A 1QBNA 3F9HA 1CVWH 1FY5A 1P09A 2UWOA 1WV7H 5IYTA 1YM0A 2GDEH 1ZHPA 3BIUH 1GJ7B 3NKKA 5C1UA 1C2DA 4BTUB 2RDLA 1TX6A 3RXRA 1TONA 3D49H 3A88A 3A7YA 1SFIA 1Y3UA 4I32A 2FX6A 8LPRA 1LHDH 1E35B 1GBFA 2GMTB 2VWLA 4U30A 2XBYA 4HFPB 5EPNA 4CRAA 1TPOA 3LJJA 4BXSA 4BAKB 4DCDA 3Q3KA 5A0CA 1NT1A 2XXLA 2VINA 1OXGA 5AVDA 1ZMNA 2F9NA 4TWWA 1LQDB 1Z71A 3RC5A 3BG8A 1F0TA 1IAUA 1QR3E 1BTYA 1ACBE 1P11E 3KF2A 3MWIU 1SQTA 5TCAA 3V12A 4NA8A 4AFSA 3SW2B 2W7SA 2BVSH 1P9SA 1C2FA 4ABHA 3BN9A 5ETXA 1BUIA 3SI4H 2Y5GA 1OWEA 2GCTB 1TNHA 4ISHH 2A5IA 2EC9H 1L1NA 1CHOG 1VCQA 1JOUB 5C2ZA 3NZIA 3M5MA 1S0QA 5IDKA 1EXFA 3Q00A 1LHCH 3RM0H 1O5FH 3MU4A 1DANH 4AYYB 3BTHE 7GCHF 2ZGJA 1SL3A 4D9QA 1O2SA 2C8XB 2OXSA 2SNVA 1W2KH 5I25A 5FX5A 2FXRA 1DITH 4ZHAA 1RXPA 2P3FH 3GCHC 1NO9H 3K6ZA 2ZU4A 4FUGA 1SGRE 2Q6DA 1DLKB 4GSOA 1O2RA 4WWYA 3LONA 1A5IA 1EJAA 1ZHMA 4MNXA 1UVUH 2FOCA 2R2WU 3LU9B 2W26A 3BEIB 5FXLA 1BT7A 1A5GH 1XX9A 5FX6A 1HIAA 4FUCA 1N8OC 1ZRKA 2WPIS 2ESTE 1N6XA 1HGTH 4I31A 1QFKH 1O3FA 2WYJA 1BHXB 2B7DH 2QGRA 2Q6GA 1GHXH 4JCNA 1GBJA 1B7XB 3ZVBA 1IHSH 1HAXB 3KQCA 3UWIA 2O8LA 3VB7A 3LGTA 1QBOA 2FI3E 2GP9B 1MTNB 4JYUH 3A87A 3F9GA 2ZDNA 4MNVA 2XBXA 4X1QU 1QTFA 2GZ7A 3A8DA 1LVMA 1A2CH 3D65E 3ENSB 1SC8U 4ISNA 1ELCA 4ZHMU 4IS5A 3Q3YA 1C5QA 4MPWA 4THNH 4PROA 3Q3XA 3TH3H 1W8BH 2V6NA 1P8VC 5AF9H 2YOLA 2BQWB 1E36B 4DJZB 2A4QA 2FPZA 3RP2A 1BITA 2CF8H 2FS8A 4OGXA 4X8VH 3VB3A 2J38A 4D9RA 1A0JA 4Z0KA 1DT2A 2YNBA 1O2KA 4BAMB 4A1XA 2FMJA 1A61H 2P93A 5F8TA 1MU8B 1JRSA 1K1IA 1TNIA 2O9QA 3KL6A 4O9VA 2K1QA 2R0KA 4WMFA 1LMWB 2BVXH 1RFNA 3TH4H 1O3EA 1YBWA 4GUXA 3ZZ3A 2ZGCA 1ZJKA 5A0AE 3I77A 2VWNA 4OS1A 4XSKU 4NIYA 4X6OA 2PR3A 2BDBA 4GHQA 4X6NA 3MU1A 1O36A 1GI8B 2J94A 3K2UA 1AE5A 1EAWA 4K60A 5LGOA 4Q7YA 4B1TA 1O5GH 1VCWA 1KTSB 1CT4E 2H5DA 1Z1JA 4DVAU 3QO6A 2C8WB 2ZCLP 3T2NA 1C1TA 1W7GH 1NRQH 1UJ1A 4YLQH 5A8XA 4OGYA 3GDSA 2VNTA 1WU1A 4UFEH 3DUXH 1TPSA 3IWMA 2XBVA 3MHWU 3LIWA 2G5NA 3RXVA 2BD7A 3KEEA 4TYDA 1ARCA 2FOFA 3V3MA 1GBMA 1DY8A 1MTSA 2NU1E 3A7ZA 1DWDH 4OS7A 2FI4E 3M37A 3F9EA 5HXFA 2FESH 4X8SH 1AVWA 1MQ5A 1TWXB 2P8OC 4CRBA 3FVFB 1VCPA 3BG4C 3EYDA 3C27B 4AGKA 5K7RA 1TOCB 4IN2A 2ZGXH 5EG4A 1N1LA 3UR6A 1V2NT 3QN7A 1J17T 3AVZA 1MCTA 1HV7A 1TE0A 1GI7B 4LOYH 1A5HA 3GCTF 3SU4A 2SGPE 1SLXB 1DPOA 5EQSA 1EJNA 1O3KA 1ESBA 1LKBA 2FYQA 2HWLB 5DP8A 3RXOA 5EXLA 1GJAB 4ABIA 1C1OA 1SHHB 3ZZ9A
chains in the Genus database with same CATH superfamily
2BDIA 5CHAC 4NIXA 1PJPA 1ELVA 1C2KA 2ZHWH 1PPEE 1EAXA 1P05A 4XD7D 4K2YA 3SJ9A 1J8AA 1RRKA 1L1GA 2BY6X 3LGUA 2WINI 1G9IE 1W0KD 1BTHH 5GWZA 3BEUA 2UWPA 1O2WA 1G2MA 1SR5C 2H6MA 1P9UA 1GHVH 3ZVAA 1BHXF 1O3CA 4JYTA 1RD3B 4H6SB 5DKMA 4ZKNU 1A7SA 1XUHA 4DURA 2BY8X 1AGJA 3A8AA 3KCGH 3P95A 5L6NH 1TGTA 1ZTJA 1FY8E 4ZROA 1AFQC 2C8ZB 1EJMA 3SUFA 2TGDA 2Z6BD 3F2GA 1XKAC 4TSFD 4F55A 4DGJA 3ZV8A 2ZTYA 3O8DA 1C2MA 1OWDA 4B75A 8ESTE 1GVLA 1HXEH 1NESE 1WCZA 2ZHEH 2XC4A 1C1VH 1NRNH 1THPB 2BD3A 1C9PA 1GJ9B 1U6QA 3EQ0H 3V0XA 1VJ9U 4DY7B 1EPTA 3M5NA 2BD9A 1THRH 5EXMA 4ZKOU 3SGAE 5EJZA 1ID5H 1O2JA 2TPIZ 1O30A 4KP0A 2CN0H 5L30H 3K6YA 2WV4A 3GY8A 3E1XB 3LOXA 3UR9A 3OY5U 2IJD1 3E8LA 4IMQA 3SZNA 2ZQ1A 1ABIH 4I7YH 2OQUA 1A0HB 2G51A 4ZXYH 3BTEE 2Z3DA 1GMDF 3KIDU 3UAIC 2QYIA 5E0HA 3RXIA 3ZZ7A 2XC0A 3FO8D 3SQHE 4JZIA 1ETRH 2QIQA 3BTWE 4Y76A 1LHGH 1H1BA 4NFEA 1GHWH 1C2IA 3GYLB 3KQEA 3GY3A 4UFGH 1DSTA 5F8XA 4KGAA 5ABWA 3T28A 1FN6A 2EA3A 2M2AA 2A2QH 2XC5A 4GCHF 2WUBA 4AG2A 3UOPA 2ZKSA 3C1KA 2VVVA 1PQ8A 3R0FA 1YCPK 3PV2A 5JB8S 1NFYA 5GCHF 2ASUB 1AB9B 1E34B 1T32A 1TQ0B 5FPTA 2GZ9A 1V2MT 1K1JA 2PV9B 1UVPA 3A81A 3NXPA 5C5NA 1JRTA 4K5ZA 3TK5A 1B0EA 1P06A 1O5DH 1SGNE 1HLTH 4OS2A 3RDZA 2JETB 3AW0A 1QIXB 1GHAG 1GBCA 1BRUP 2A7HA 3RC4A 1HAOH 4MPVA 3SNAA 1A3BH 2Y6TA 1K9OE 2GV7A 2BYAX 3NRLA 5CHAB 5EW2H 4AX9H 3ELAH 3BTKE 2A5AA 1E1RD 3FKSD 1C5ZB 3GS9A 4GCHG 2Z9JA 3SJKA 2BD8A 5H4IB 4JK6A 3P8GA 4X6PA 4H4FA 1PPHE 2XRCA 1Z7KA 1BRAA 2P3UB 2WYGA 4CREA 1SFQB 2F9BH 2ZHQH 3VB4A 2ZU2A 3PLKA 2BHGA 1Q2WA 2ZTXA 4O3UA 3RXKA 4YESB 2AGEX 4OM9A 4I8GA 1AFQB 4ZHLU 4X1NU 2UUYA 3QLPH 2BDGA 3HATH 5FBEA 3EDXB 2AMQA 5J4QA 4NZLA 1W10U 2VH6A 3MO9A 2FO9A 3QWCH 1HAIH 1YY3A 1UO6A 1C5NH 1Q3XA 1T4UH 1SGDE 1V2JT 1NC6A 2KM0A 3ODDA 1A0LA 3RXPA 1Z6EA 2VH0A 5C1YA 1C4U2 2G52A 3SNCA 1BMNH 2EQNA 2QXGA 5EU8A 3V13A 1SVPA 3B8JA 1GMHG 1PPGE 3P17H 3UB0A 5HIYA 1FXYA 4AZ2B 2D8WA 1W14U 1LQEA 2PW8H 1SI5H 2O8UA 1MAXA 1GVKB 4Y0YE 2L6OA 3ZZ6A 2LNCA 2WHXA 3MNBA 3SU5A 4YTAA 1GGDB 3OU0A 1K28D 3U1JB 6CHAB 1GCTC 5C94A 2ANMH 1FLEE 3BIVH 1LHEH 1KY9A 3ZZAA 2QC2A 1D6WA 3SI3H 5HM9A 1O2LA 3S9BA 3A7TA 1BTUA 1G36A 5C17A 1KTTB 4VGCB 2OUAA 4Q7XA 1QL9A 1C1UH 1UTKA 2D26C 3KGPA 1IQGA 2BM2A 1NPMA 2NU4E 1LPKB 3A8CA 1EOLA 1D3DB 1N6YA 1HYLA 1PYTD 5GXPA 4Y10E 3RC6A 1F5LA 2AERH 1L4DA 1RTLA 2OCVB 3SU6A 1C5OH 4FU8A 1GHBG 4IGDA 1ZPBA 1AKSA 2A2XH 2IOTA 1GBKA 1MTWA 4ISIH 5JDUB 2OC1A 3RXQA 1O3PB 2WZQA 4ZKSU 4A6LA 2M5TA 1GJ6A 2F9VA 2LP6A 1EUFA 8GCHF 3MNCA 1AI8H 1BJUA 1O34A 2ZEBA 5FBIA 1BOQA 4X1RU 1FY1A 3FN8A 2V3MA 4CRFA 1C5MD 5DGJA 3H7TA 1Z8GA 3MFJA 3SV6A 3ITIA 1AVGH 1GWAA 5DJ7A 4J2YB 1O2ZA 3A7XA 1UVOA 3HK6B 2TRMA 1AWHB 3JZ1B 1YLNA 4UEHH 4KTUA 4D7FA 1ESAA 2BMGB 2WV5A 1DY9A 1PPZA 2BLOA 4CR5A 2XNIA 1BB0B 1VITF 4X2YA 1YPEH 1C5LH 1AO5A 5E2OA 1QJ1B 2A1DB 3LT3A 2PKSC 1GHZA 4E7RG 5EGMA 1RIWC 4BOHA 1UTOA 5A8ZA 1DWEH 1L2EA 1HXFH 1GBBA 1SGYE 1EZSC 3SUGA 2GJGA 3TLOA 3QGNB 3W94A 1KXDA 4I33A 1NM6A 1A46H 2VBCA 1O3DA 1CT2E 1ABJH 1DUAA 1GJDB 2CXVA 4MTBA 4X6MA 1XMNB 4ZH8A 2FLRH 3EE0B 4MG3A 3VXEH 3FP7E 4XBBA 3SO3A 1SGQE 3TGIE 3VFEA 5SGAE 4IN1A 3U1IB 1GG6C 5AHGH 1F0RA 1VITG 1SGFA 3MU5A 1QL8A 5GJ4B 4YLUA 4OS4A 2ZGBH 2ZU5A 3SNBA 4IW4E 4AN7A 2ZECA 3QTVH 1TGCA 4FXGH 1CA8B 3D23A 3DT0H 1QQ4A 1CHOF 5EIYA 1K1PA 1O2VA 2VGCB 3LGWA 3M7TA 3DHKH 3U8RH 2O8MA 1TNKA 1GDNA 1BTPA 1GCTB 3SHAH 1XVMA 2WPJS 3MU8A 1AY6H 2THFB 4R0IA 2FS9A 4ABEA 3ZV9A 4ASHA 1ANCA 2Z94A 2C93B 3NWUA 3QDZB 1FY3A 2P94A 2QXJA 5EOKA 1O37A 1HDTH 1FUJA 1L1JA 2LELA 2PTCE 1K21H 1GDQA 1X7AC 3B23B 1OWJA 4DIHH 2FM2A 1GJ4H 3BTQE 1FV9A 1V6DA 1MKXH 2ANYA 3ATWA 1O2XA 1ELGA 3PO1C 4B6EA 2BXTH 3RXFA 4MNYA 3MTYA 6GCHG 4UDWH 3OAAD 2ZNKH 5JB9S 1ZHRA 1K22H 3LKWA 4LZ1H 2SFAA 4XRNA 3MNSA 5C3NA 5LPFA 4XE4A 1W11U 2FTLE 5FHTA 1O38A 3A7WA 5JBBS 5EPYA 4BXWA 1V2LT 4ISOA 1YF4A 2QCYA 1GL0E 4FOUC 1HFDA 2OTVA 3FP8E 3SJOA 1QGFA 1G37A 2J92A 3TVJB 2VIVA 1YGCH 2WPMS 4X2WA 2QXIA 3M7QA 1T4VH 3GISB 5DK1A 1G3BA 1UVSH 4JZFH 5LPEA 2ZPSA 3PWBA 1HAVB 5JPMH 1GI2A 2AMPA 3LGVA 2EY4C 1CE5A 1Y8TA 3PV5A 1C9TA 1EAIA 2AGIX 1YLCA 1AZZA 3ZYEA 1RIWB 2PKAB 1O2YA 1JBUH 1UK4A 5CHBA 2GX4A 4INLA 3BV9B 5CMXH 3L3TA 1CBWC 5A09A 1QB6A 4ZAEA 2V3OH 3SNDA 1SLVB 2AGGX 2OC0A 4ACBA 2ZF0H 1XKBC 2PUXB 4INHA 1GMCF 1NRSH 1QY6A 1S6FA 1Z8RA 1G3EA 1WTHD 3NCLA 3U8TH 1UHBA 2W6ID 3SJIA 3A7VA 2HNTF 1HCGA 3PV4A 4BTTB 1ZLRA 3LC3A 1ANDA 2UUFB 2QAAA 2GKVE 3OE7D 5HIZA 2IPQX 1BMLA 3OTJE 2J95A 4JZ1A 4YXWD 1G30B 5GNDA 2G4TA 3EA7A 1TNJA 4Y7BA 3TITA 3UUZA 4J1YA 2QF3A 3OSYA 2SGFE 4OS6A 2ZU1A 2CMYA 2W6JD 3AW1A 2ZQ2A 3OEHD 1C1RA 1GL1A 1CT0E 4RN6A 1GMCG 5K0HA 3UFAA 4ABFA 1S82A 1FDPA 4YT7H 3F68H 3P8FA 4ABDA 3UIRA 3SHCH 1C5XB 4WXVA 2R3UA 1T31A 1ZMLA 1C5RA 1ZTKA 1PPCE 4NIWA 2Z7FE 1DFPA 1OPHB 4F4OC 5EW1H 1P2QA 2ANKH 4BNRA 1SOZA 1RTKA 3N7OA 2H9TH 1SB1H 4O3TA 3HGNA 3EE7A 1K2I1 1TGBA 5JBAS 2PSYA 5EQQA 4KTSA 5FCRA 1G3CA 1BIOA 1KXFA 4FUHA 2FI5E 3QZQA 3SN8A 4X8TH 1P0SH 3VEQB 4ESTE 4P02A 2HPPH 3HKJB 2XTTB 2KR7A 1G32B 4TWYA 4X8UH 2ZC9H 2HRVA 3T26A 1IQLA 4ABBA 2XCFA 1XUIA 1H9HE 1BTZA 3GCHB 1S81A 4FUEA 1BA8B 4FU9A 3PLPA 2P3TB 3RXMA 2HLDD 2STBE 1QNJA 1O3OA 1UW7A 3QX5H 3SU3A 1IQKA 5A0BA 1VGCC 2GDDA 2ZDLA 1NU7B 3U9AH 5FCKA 3ZZBA 3F1SB 1DICA 2F91A 3A82A 5EXNA 4MVNA 1AWFH 3SV9A 2AMDA 4K1SA 2ILNA 1NRPH 5ESBA 1ELAA 1P01A 1N8OB 5JYIA 1GJBB 4U2WA 3MMGA 4O97A 3S69A 5DP3A 3DFJA 1BQYA 1MZDA 4K8YA 4BAQB 2KCAA 3W1EA 5FAHA 1OSSA 1COWD 3TJOA 5DG6A 2OC7A 1O31A 4I8JA 4UONA 4AFUA 2SGDE 1CGHA 3E16B 1GI1A 1KXCA 1P02A 3OYPA 4YOIA 2HVYB 1E0FD 1OP8A 3F6UH 1YCPM 1XVOA 1VR1H 2A4OA 2GD4B 6LPRA 5B6LA 3E0PB 2JDID 3O8BA 3GDVA 1C5WB 4NG9H 4X0WU 3RMNH 3SU0A 1BRCE 4KKDA 1C5TA 2R0LA 2F3CE 2J34A 2AIPA 2ZTZA 3CENA 3ZVEA 3ZVGA 2W3IA 4FUDA 5F8ZA 5DP6A 1IQHA 1T7CA 3TGJE 3KYGA 1DDJA 3ATKA 1P10A 2CHAC 1SLUB 5F03A 1MQ6A 2C8YB 3KQBA 2A45B 2RG3A 1Z8JB 2A4RA 1EKBB 1TBQH 2W7UA 4K3JA 2OBQA 1RS0A 1DX5M 1C1PA 2TIOA 3LGYA 3ATIA 1DE7H 4GHTA 5E0GA 3E91A 2DE8A 2Z3EA 5DP9A 1SG8B 2VU8E 2NU3E 2YMSD 4ASUD 4AB8A 3TK6A 1PPFE 4BAOB 2PFEA 1QURH 3MI4A 2BY5X 1EP6A 1ZR0A 1XUJA 1OYQA 2CF9H 3HPTB 2A31A 3RLWH 3ZVFA 1O2OA 2ZO3H 1GPZA 1ANEA 3U69H 2UUKB 5CE1A 1IQIA 4MPXA 3IG6B 1O2NA 2V3HH 1GBIA 1BTWA 1KLTA 1GJ8B 4RKOB 1Q31A 3A83A 3N99A 3WY8A 2RA0A 5AFZH 2ZDKA 1TBRH 3EA8A 2FOMB 2ZDVH 3VGCC 1T8LA 3FZZA 1C1QA 5C67A 1GHAF 1H8ED 1WSSH 5J4SA 1O2MA 1KDQB 1V2ST 3S7HB 2XWAA 1AE8H 1BCUH 1SGTA 1PQ7A 2FDAA 1P3EA 1AD8H 1W12U 1ZJDA 2KAIA 3L33A 4HTCH 1CHGA 4K1TA 2NWNA 1V2UT 1KXEA 3UTUH 4TPYA 2P8OB 1GHYH 2QY0B 1QL7A 3BG4B 1ZOMA 1UCYH 2TGAA 2ZI2H 4QT8C 3DSGA 2A5KA 1EZUC 2IN2A 1ANBA 1MUEB 1AZ8A 1ZRBA 1CQQA 2FOAA 3HKIB 1QJ6B 5DP7A 4B74A 1TA6A 1H8IH 3S0NA 1TA2A 1L4ZA 3URCA 3UNRA 1QHRB 4GLYA 4Q7ZA 2QXHA 1DXWA 1EX3A 1WAYB 1EAUA 1YLDA 2STAE 3TJUA 3GCNA 3IITA 1FIWA 2H1UA 3M7UA 2ZA5A 5IK2D 1INCA 2A0QB 1FAKH 3ATLA 3DSOA 4Q63A 5E8EH 3SOSA 5C1XA 4BAHB 3SV8A 1J15A 1EPTC 2JIZD 4HZHA 2LPRA 2L74A 1FI8A 3F2HA 1J16A 2PGQB 1GMHF 3M3TA 2ZGHA 5GDSH 1QJ7B 4RKJB 1WQVH 1O3BA 3AAUA 4FVDA 1YPLH 4UFDH 3M5OA 5C0UA 4Y7AA 2NU0E 2Z9LA 1SQOA 2I6QA 4B73A 2GGVB 1FQ3A 3DCLA 1ELFA 2KX4A 2HNTE 1GI5A 1TMBH 2R9PA 2A7JA 2A7CA 3RXUA 3A8BA 4ZXXH 4AGJA 3RMMH 3UNSA 5TJXA 4I8LA 3SU2A 1UTLM 1KIGH 4E05H 1J14A 3URDA 1EQ9A 2OQ5A 1V2OT 4Q80A 4AOQA 1DUEA 1UK2A 3M61U 4X2XA 5KGOA 1JXPA 1H4WA 1QCPA 2VIWA 2ZFSA 1GHBF 1YPHE 3TGKE 2FWWA 1S0RA 1Y3XA 1MKWH 4FUBA 4Y8XA 1OWKA 1ELTA 1HAZB 1THSH 3I78A 1AQ7A 3F2FA 4B2CA 2GTBA 3RXLA 2XBWA 3SGQE 1TLDA 3UREA 2BX3A 4H42U 1NTPA 1SHYA 1CA0C 1HBTH 4UFFH 2ZPQA 5LH8A 1NFXA 3LC5A 1H9LB 1BBRH 2Y7ZA 3KYFA 4HI3A 1NFWA 1YP9A 3RXSA 1DM4B 1GBAA 1MD7A 2KCYA 3GOVB 3TIUA 2PSXA 2B0FA 4AB9A 2VIDA 2NU2E 1UK3A 1UVTH 2G4UA 1Y5UT 5PTPA 2GMTC 5E0JA 3VB6A 1J9CH 5GPIB 4Y0ZE 1XM1A 1ZGVA 1TPPA 4DOQA 3EAJA 3QGJA 2RFKC 4K1EA 1WDIA 1GI0A 1HJ9A 2PWXA 3NPSA 4Z1MD 1NU9A 2OC8A 1D9IA 3GY4A 3UWJH 1PFXC 1NROH 3RXTA 2O8WA 1TABE 1QRZA 4BANB 1FAXA 2JJ2D 1ETTH 1WOFA 2FYRA 1VJAU 3MYWA 2BD2A 3KQDA 1MBQA 1EZXC 1NY22 1OS8A 2J97A 4IBLH 2GCTC 2BVRH 4B2AA 1G3DA 2GT7A 3A84A 1C4V2 3O8RA 5E2PA 1NS3A 3TJNA 2F9UA 3SU1A 3SYJA 2BZ6H 1HPGA 1GCDA 1C1MA 1QB9A 4TY7A 2V35A 4X1PU 4P00A 1A1RA 1MD8A 3A80A 4LXBH 3E90B 4M7GA 1O3LA 1P12E 2CGAA 1IOEA 2FOHA 2JH5D 2BDYA 3PB1E 5AFYH 1O5EH 2FOBA 2ODPA 2HLCA 2ZU3A 1UCYE 1EB1H 1V2QT 3D62A 1TRNA 3UQOA 1HAHH 2ZFTA 4NWKA 4DG4A 5DN6D 1LVOA 1MKXK 4WJG2 4ISLA 2VVCA 2DE9A 2BOHB 1AUTC 1P57B 2WPHS 5L2ZH 1T8NA 1QZ8A 1PPBH 2DUCA 1HRTH 4YOGA 1BJVA 3OEED 1EATA 3M35A 2AYWA 4O03A 3RXHA 1GBDA 1OWIA 1C1WH 3QZRA 2KZ4A 2G55A 1Y3WA 1HAYB 1QQUA 2GCHG 2HALA 1GBHA 1A4WH 1Y3VA 3TNSA 1OP2A 3B9FH 3M36A 1MTNC 2KCOA 1HJAC 2ULLA 1F5KU 6GCHF 1C2JA 4WF8A 3SGBE 4WMDA 5LPRA 3EGKH 3M3SA 2P16A 4JK5A 1MH0A 1K0HA 1JMOH 3QUMP 2GZ8A 3HGPA 3PWCA 4YZUA 4I8KA 1M9UA 3JZ2B 4LZ4B 4ZUHA 5A8YA 5HYOA 1JIRA 1AVXA 2VIOA 3FAOA 2G8TA 5FPSA 4ABJA 2EI8A 1CSOE 1P04A 5KEDA 1C2GA 3GICB 5FL7D 1FMGA 1O3AA 5HGGA 5DO4H 1GJ5H 1TNLA 3H7OA 5EODA 2XNDD 2Z9IA 4B2BA 3GCOA 1C5UA 3RXJA 5HMAA 1XUGA 3TH2H 3MO3A 1Y3YA 4FUIA 2FLBH 2J5UA 2HVXA 2I6SA 2ZDAH 1AN1E 2HGTH 2PLXA 2ZFFH 3ZIAD 1CO7E 1S85A 2F9OA 1K1OA 1PYTC 1LVYA 1HUTH 2BX4A 1OP0A 1SBWA 2SNWA 9ESTA 1NN6A 1VITH 3VXFH 3KNXA 3K65B 2FTMA 3BTFE 1PQ5A 2ZHDA 1TAWA 4NWLA 4D7GA 2BZAA 5A2MH 1S5SA 2VB0A 1LPGB 1C5SA 2AFQB 1BBRE 2TGPZ 4CH8B 5TCCA 1NFUA 1QB1A 2QF5A 1ETSH 2PKSB 1SMFE 1UTNA 2J4IA 3Q76A 2J98B 4U32A 2G81E 4M9FA 1FPCH 3GY7A 1C1SA 4IC5A 4WY3A 1P2MA 3M5LA 1SGEE 5GIBA 4IC6A 1YC0A 2HPQH 3BTDE 4GPGA 1A3EH 1DXPA 5T6FA 3MH6A 4JZDH 1TIOA 2WPDD 4AORA 3UOUA 1HNEE 3M3VA 2RA3A 2WPKS 2OP9A 1O2PA 1W0YH 3PMBB 5EQRA 1D3TB 1C5PA 1RTFB 2P95A 3AAVA 8KME2 1GG6B 4A7IB 2J2UA 1W3CA 4YOJA 1KLIH 4KELA 2PHBA 7GCHG 2BQ7B 1KDQA 2G00A 4TY6A 5C20A 2BDAA 3OY6U 5CDFE 1HJAB 1UTJA 4FUJA 4E06H 3SQEE 4K69A 1AKSB 1IQFA 1HB0B 1SKYE 1DS2E 3ZVDA 4CRGA 1ELDE 2BXUH 3RU4D 4RT0A 5I46H 1TRYA 3LH1A 1KXAA 2G5VA 2ZIQH 4YO9A 3LDXH 1MBMA 1B0FA 4UE7H 4Y8YA 2ZFQH 2QF4A 3ZVCA 4DW2U 3NK8A 3NUMA 1SQAA 3F9FA 3QK1A 2AEIH 3SNEA 5HM2A 1FZZA 1HAPH 1MMJN 1V2PT 5BPEA 1E38B 1XXDA 4ACAA 3BF6H 2ZG0H 2ALPA 4F48B 3RM2H 1BMFD 4ZMAH 5DP4A 3PO1B 3PYHA 4Q2KA 1BZXE 1EB2A 1F2SE 4MDSA 1UMAH 1C2HA 4Y11E 3PTBA 1OHHD 4DIIH 2FP7B 2FOEA 2Z9KA 4KTCA 2QE7D 4Y8ZA 2Z9GA 1UTPA 1SSXA 3O8CA 4INKA 3SUDA 3ZZ5A 2R2MB 1V3XA 1ZGIA 3DSPA 4MNWA 3MU0A 3CS0A 5G4BA 3GY6A 3RU4T 4CHAC 3AASA 3E6PH 4NA7A 2H5CA 1DSUA 1SGIB 2V0BA 1IHTH 1O5CB 2FODA 2H9EH 1FONA 4F49A 3H5CB 1ORFA 3FFGA 5KECA 1E79D 4XBCA 5F53A 3P70B 3PTNA 5FPYA 1P2OA 9LPRA 4I8HA 1OWHA 2VWOA 5JBCS 1AMHA 3BTTE 1V2RT 4YT6H 1QA0A 5T6DA 2QN5T 4XFQA 2AH4X 1CBWB 2OINA 1GDUA 1Y5AT 3DFLA 4CH2B 2ZFRH 3FZDA 1PQAA 3CP7A 1TX7A 2CJIA 1QRWA 1XXFA 2ZCKP 2BY9X 1IQMA 1P2NA 4MLFB 3T5FH 1OKXA 3MOCA 4ZKRU 1WTGH 4NSYA 3MH5A 1YKTA 1C4Y2 1AB9C 1KSNA 4TPIZ 2Q6FA 1XUKA 3BTME 3WWFA 3K9XB 2EEKA 3SORA 3RXDA 2OD3B 4XOJA 1O3GA 2R3YA 4JMYA 1FNIA 4CRCA 2JJ1D 2JETC 1TNGA 2B9LA 4AYVB 4SGAE 3PMHB 4MPUA 1W0JD 1ZMJA 2GV6A 1TGSZ 2W5EA 2BOKA 3DA9B 4AG1A 1ZYOA 6ESTA 3VPKA 3ATMA 5T3HA 1O3MA 2UWLA 4FU7A 1LKAA 3RLYH 3STIA 1TPAE 2GT8A 2Y5HA 4X1SU 1O2GH 4RI0A 3KN2A 2ZPRA 1KMHB 1TBZH 1LCYA 1MTUA 3W95A 1UCYK 1L0ZA 1E37B 2GVFA 2BDHA 2BLQA 3TU7H 3SBKA 1D3QB 5C0TA 3VB5A 1O3NA 3KQ5A 4A92A 3GCTG 1AHTH 2F43B 3DD2H 3T27A 2CV3A 1H8HD 2F9PA 4UD9H 2PGBB 3RU4E 7ESTE 1LDTT 3PROA 1TOMH 1NZQH 1K1MA 3ZZ4A 5T6GA 4B76A 4Y71A 1TFXA 2Q1JA 3QTOH 5T1VA 3TJVA 1TALA 1W13U 4FETA 2VJ1A 1O2IA 2AS9A 1HIAB 3OTPA 3SUEA 1GVZA 1DWBH 1MAYA 1YWUA 1V2TT 2JKHA 4CRDA 2VVUA 3LH3A 2HOBA 4CHAB 2SGQE 1UTQA 1P2IA 1FX0B 2A4GA 1TMUH 2KCPA 1EOJA 1GI9B 3ESTA 1UHBB 1QRXA 1FN8A 2XCNA 2D2DA 1P03A 1H8DH 1GBEA 3BTGE 2JH0D 1CGJE 1VGCB 3UNQA 5EJ1A 1GGDC 5DP5A 4FUFA 1Y59T 1O39A 1Y5BT 4GAWA 6CHAC 1KXBA 2ODYB 1FJSA 4A5TS 1FIZA 3UY9A 3STJA 1XUFA 3LPRA 1WUNH 2OBOA 1BRBE 4VGCC 5L2YH 2BD5A 1AFEH 1DOJA 4ABAA 2SGAA 4Z6AH 1GI6A 1TB6H 1Z8IB 2RCEA 1F7ZA 3EA9A 4NIVA 1HJ8A 3U98H 2FIRH 3KHVA 1NRRH 1ZSKA 1EZQA 4IMZA 1QBVH 3SJ8A 1GMDG 2ANWA 4CR9A 1AIXH 1LO6A 1O3JA 1F0SA 1MKWK 2XOKD 1S83A 2Y5FA 3MNXA 1S84A 1O3IA 2YNAA 1MU6B 2VIPA 4A1TA 1WBGB 2SGEE 1EASA 1O35A 2ZFPH 4WMEA 4DT4A 2EI7A 3S9CA 1F0UA 1WQSA 4U01A 1GBLA 4WH8A 1IQEA 5HKKD 2CHAB 1BBRK 3TK9A 4WVPE 4AC9A 1SOTA 4Y6DA 1V2KT 1KYNA 1P3CA 1O2HA 1BDAA 3RUOA 1VZQH 4A1VA 3RXGA 3BEFB 3LGIA 3S7KB 1DLEA 2XYAA 2Z3CA 2K0QA 2Y80A 3RXEA 1UTMA 2P59A 5GCHG 2HNTC 1ZSJA 1CGIE 4NFFA 1O5AB 3FANA 1T8OA 2V7QD 5C5OA 2FOGA 2IPHA 1ZPZA 2BY7X 2O8TA 2BB4A 2UUJB 1YPKH 1TYNA 1O2QA 3OFND 1ELEE 1QA7A 1SGFG 1BTXA 1Z6JH 1FY4A 4GVUA 1GJCB 1D6RA 3SZEA 1W0ZU 3Q77A 5F6MA 1IQNA 1IQJA 4JYVH 4MQAA 1ZZZA 1YCPH 5DPAA 3VG8A 4JZEH 3MH7A 1YPHC 3HK3B 5JBTA 1MTVA 2IJOB 1JWTA 1ESTA 1WYKA 2VWMA 2YMSC 4XDEA 2F83A 1K1NA 1MZAA 1HAVA 1LTOA 2WPLS 1E1QD 3T62A 3G01A 3L6PA 3ODFA 3VGCB 1TRMA 2XWBI 2Y81A 2D1JA 2FZZA 1BMMH 3A86A 2PKAA 1W7XH 2J98A 1O5BB 1D3PB 1V2VT 3FP6E 2Y82A 4NSVA 2FEQH 4TT3D 3RMLH 1SLWB 4HGCA 1T8MA 3S9AA 3GY2A 1BMAA 3GYMA 4LK4A 3P8NA 1RGQA 1B5GH 1SQRA 1LPZB 4BTIB 4Y79A 2C4FH 3SV7A 1FPHH 3UPEA 5ESTE 1OYTH 3RXCA 2VGCC 4OS5A 1LHFH 3PRDA 2BD4A 4ABGA 4D8NA 1AU8A 4FVBA 7KMEH 3PM3A 4I86A 4DT7B 3MH4A 2ODQA 3PMJA 1CU1A 3BSQA 3P92A 5DSFA 1LVBA 2WUCA 1V2WT 3UQVA 1F5RA 1ZTLA 3ZZDA 3ZZCA 2ZDMA 1O2TA 4CBNA 2KFWA 4K8BA 3F0PA 1DWCH 2PUQH 1YPJH 4WXIA 1TMTH 2TBSA 4B6FA 2H2ZA 2PTNA 1SPJA 3U8OH 4X2VA 2A32A 2ZP0H 3I29A 2TGTA 2AIQA 3V7TA 1TX8A 2BLWA 1ELBA 2VIQA 4Q4LA 1JIMA 1C2EA 4YM9A 2ZHFH 1S6LA 3SV2H 1RJXB 3GY5A 3R3GB 3E3TA 4NGAH 4WH6A 3A85A 4RSPA 1O0DH 2PP6A 1EPTB 1O33A 2ZZUH 3RMOH 3T29A 1C1NA 4SGBE 3A89A 2H9HA 1SGCA 1O32A 4B71A 1S6HA 2BQ6B 1ZPCA 5B6OA 1D4PB 4R8TB 2GCHF 5BRRE 2FX4A 3RXBA 3TNTA 2W3KA 1P2KA 2XW9A 2B8OH 2C90B 2EI6A 1C2LA 1YPGH 1P2JA 1DVAH 3TPIZ 3GDUA 1AUJA 3CS7A 4AFZA 3PLBA 1KLJH 1YYY1 4AFQA 4D76A 3P8OA 1TQ7B 1C5YB 4E7NA 1O2UA 3RXAA 2ZWLH 1O3HA 2BLVA 3E0NB 2BDCA 8GCHG 1OX1A 1SGPE 3PMAB 2QF0A 1OOKB 1ZSLA 2OLGA 4H6TA 4XBDA 1GI3A 3T25A 1GBTA 2KAIB 1GI4A 4CBOA 1C5VA 4NZQA 2C3SA 2JH6D 2J9NA 1EFRD 2QV1A 1EP5A 2Y7XA 3ZYDA 2B5TB 1G2LA 1H9IE 2YMSB 1ARBA 1Z1IA 4NA9H 1MCVA 2ZCHP 3MO6A 2BTCE 2QA9E 3OX7U 1K1LA 1YPMH 3P6ZB 3ZZ8A 4NCYA 3LJOA 1HAGE 1TGNA 7LPRA 2ALVA 1CA0B 1F92A 1QBNA 3F9HA 1CVWH 1FY5A 1P09A 2UWOA 1WV7H 5IYTA 1YM0A 2GDEH 1ZHPA 3BIUH 1GJ7B 3NKKA 5C1UA 1C2DA 4BTUB 2RDLA 1TX6A 3RXRA 1TONA 3D49H 3A88A 3A7YA 1SFIA 1Y3UA 4I32A 2FX6A 3WW7A 8LPRA 1LHDH 1E35B 1GBFA 2GMTB 2VWLA 4U30A 2XBYA 4HFPB 5EPNA 4CRAA 1TPOA 3LJJA 4BXSA 4BAKB 4DCDA 3Q3KA 5A0CA 1NT1A 2XXLA 2VINA 1OXGA 1NBMD 5AVDA 1ZMNA 2F9NA 4TWWA 1LQDB 1Z71A 3RC5A 1VKYA 3BG8A 1F0TA 1IAUA 1QR3E 1BTYA 1ACBE 1P11E 3KF2A 3MWIU 1SQTA 5TCAA 3V12A 4NA8A 4AFSA 3SW2B 2W7SA 2BVSH 1P9SA 1C2FA 4ABHA 3BN9A 5ETXA 1BUIA 3SI4H 2Y5GA 1OWEA 2GCTB 1TNHA 2CK3D 2A5IA 4ISHH 2EC9H 1L1NA 1CHOG 1VCQA 1JOUB 5C2ZA 3NZIA 3M5MA 2AHME 1S0QA 5IDKA 1EXFA 3Q00A 1LHCH 3RM0H 1O5FH 3MU4A 1DANH 4AYYB 3BTHE 7GCHF 2K8IA 2ZGJA 1SL3A 4D9QA 1O2SA 2C8XB 2OXSA 2SNVA 1W2KH 5I25A 5FX5A 2FXRA 1DITH 4ZHAA 3U28C 1RXPA 2P3FH 3GCHC 1NO9H 3K6ZA 2ZU4A 4FUGA 1SGRE 2Q6DA 1DLKB 3MQKC 4GSOA 1O2RA 4WWYA 3LONA 1A5IA 1EJAA 1ZHMA 4MNXA 1UVUH 2FOCA 2OK5A 2R2WU 3LU9B 2RDEA 2W26A 3BEIB 5FXLA 1BT7A 1A5GH 1XX9A 5FX6A 1HIAA 4FUCA 1N8OC 1ZRKA 2WPIS 3WWBA 2WSSD 2ESTE 1N6XA 1HGTH 4I31A 1QFKH 1O3FA 2WYJA 1BHXB 2B7DH 2QGRA 2Q6GA 1GHXH 4JCNA 1GBJA 1B7XB 4HG6A 1WXRA 3ZVBA 1IHSH 1HAXB 3KQCA 3UWIA 2O8LA 3VB7A 3LGTA 1QBOA 2FI3E 2GP9B 1MTNB 4JYUH 3A87A 3F9GA 3N7EA 2ZDNA 4MNVA 2XBXA 2WV9A 4X1QU 1QTFA 2GZ7A 3A8DA 1LVMA 1A2CH 3D65E 3ENSB 1SC8U 4ISNA 1ELCA 4ZHMU 4IS5A 3Q3YA 1C5QA 4MPWA 4THNH 4PROA 3Q3XA 3TH3H 1W8BH 2V6NA 1P8VC 5EJLA 5AF9H 2YOLA 2BQWB 1E36B 4DJZB 2A4QA 2FPZA 3RP2A 1BITA 3F0OA 2CF8H 2FS8A 4OGXA 4X8VH 3VB3A 2J38A 4D9RA 1A0JA 4Z0KA 1DT2A 2YNBA 1O2KA 4BAMB 4A1XA 2F4LA 2FMJA 1A61H 2P93A 5F8TA 1MABB 1MU8B 1JRSA 1K1IA 1TNIA 2O9QA 3KL6A 4O9VA 2K1QA 2R0KA 4WMFA 1LMWB 2BVXH 1RFNA 3TH4H 1O3EA 1YBWA 4GUXA 3ZZ3A 2ZGCA 1ZJKA 5A0AE 3I77A 2VWNA 4OS1A 4XSKU 4NIYA 4X6OA 2PR3A 3CNRA 2BDBA 4GHQA 4X6NA 3MU1A 1O36A 1GI8B 2J94A 3K2UA 1AE5A 4RT1A 1EAWA 4K60A 1NBME 5LGOA 3H09A 4Q7YA 4B1TA 1O5GH 1VCWA 3FOAA 1KTSB 1CT4E 2H5DA 1Z1JA 4DVAU 3N7DA 3QO6A 2C8WB 2ZCLP 3T2NA 1C1TA 3AK5A 1W7GH 1NRQH 1UJ1A 4YLQH 5A8XA 4OGYA 3GDSA 2VNTA 1WU1A 4UFEH 3DUXH 1TPSA 3IWMA 3F3BA 2XBVA 3MHWU 3LIWA 2G5NA 3RXVA 2BD7A 3KEEA 4TYDA 1ARCA 2FOFA 3V3MA 1GBMA 1DY8A 1MTSA 3PRBA 2NU1E 3A7ZA 1DWDH 4OS7A 2FI4E 3M37A 3F9EA 5HXFA 2FESH 4X8SH 1AVWA 1MQ5A 1TWXB 2P8OC 4CRBA 3FVFB 1VCPA 3BG4C 3EYDA 3C27B 4AGKA 5K7RA 1TOCB 4IN2A 2ZGXH 5EG4A 1N1LA 3UR6A 1V2NT 3QN7A 1J17T 3AVZA 1MCTA 4ZCNA 1HV7A 1TE0A 1GI7B 4LOYH 1A5HA 3GCTF 3SU4A 2SGPE 1SLXB 1DPOA 5EQSA 1EJNA 1O3KA 1ESBA 1LKBA 2FYQA 2HWLB 5DP8A 3RXOA 5EXLA 1GJAB 4ABIA 1C1OA 1SHHB 3ZZ9A
chains in the Genus database with same CATH topology
2BDIA 5CHAC 4NIXA 1PJPA 1ELVA 1C2KA 2ZHWH 1PPEE 1EAXA 1P05A 4K2YA 3SJ9A 1J8AA 1RRKA 1L1GA 2BY6X 3LGUA 2WINI 1G9IE 1BTHH 5GWZA 3BEUA 2UWPA 1O2WA 1G2MA 1SR5C 2H6MA 1P9UA 1GHVH 3ZVAA 1BHXF 1O3CA 4JYTA 1RD3B 4H6SB 5DKMA 4ZKNU 1A7SA 1XUHA 4DURA 2BY8X 1AGJA 3A8AA 3KCGH 3P95A 5L6NH 1TGTA 1ZTJA 1FY8E 4ZROA 1AFQC 2C8ZB 1EJMA 3SUFA 2TGDA 2Z6BD 1XKAC 4DGJA 3ZV8A 2ZTYA 3O8DA 1C2MA 1OWDA 4B75A 8ESTE 1GVLA 1HXEH 1NESE 1WCZA 2ZHEH 2XC4A 1C1VH 1NRNH 1THPB 2BD3A 1C9PA 1GJ9B 1U6QA 3EQ0H 3V0XA 1VJ9U 4DY7B 1EPTA 3M5NA 2BD9A 1THRH 5EXMA 4ZKOU 3SGAE 1ID5H 1O2JA 2TPIZ 1O30A 4KP0A 2CN0H 5L30H 3K6YA 2WV4A 3GY8A 3E1XB 3LOXA 3UR9A 3OY5U 3E8LA 4IMQA 3SZNA 2ZQ1A 1ABIH 4I7YH 2OQUA 1A0HB 2G51A 4ZXYH 3BTEE 2Z3DA 1GMDF 3KIDU 2QYIA 5E0HA 3RXIA 3ZZ7A 2XC0A 3SQHE 4JZIA 1ETRH 2QIQA 3BTWE 4Y76A 1LHGH 1H1BA 4NFEA 1GHWH 1C2IA 3GYLB 3KQEA 3GY3A 4UFGH 1DSTA 5F8XA 4KGAA 5ABWA 3T28A 1FN6A 2EA3A 2A2QH 2XC5A 4GCHF 2WUBA 4AG2A 3UOPA 2ZKSA 3C1KA 2VVVA 1PQ8A 3R0FA 1YCPK 5JB8S 1NFYA 5GCHF 2ASUB 1AB9B 1E34B 1T32A 1TQ0B 5FPTA 2GZ9A 1V2MT 1K1JA 2PV9B 1UVPA 3A81A 3NXPA 5C5NA 1JRTA 4K5ZA 3TK5A 1B0EA 1P06A 1O5DH 1SGNE 1HLTH 4OS2A 3RDZA 2JETB 3AW0A 1QIXB 1GHAG 1GBCA 1BRUP 2A7HA 3RC4A 1HAOH 4MPVA 3SNAA 1A3BH 2Y6TA 1K9OE 2GV7A 2BYAX 5CHAB 5EW2H 4AX9H 3ELAH 3BTKE 2A5AA 1C5ZB 4GCHG 2Z9JA 3SJKA 2BD8A 5H4IB 4JK6A 3P8GA 4X6PA 4H4FA 1PPHE 2XRCA 1Z7KA 1BRAA 2P3UB 2WYGA 4CREA 1SFQB 2F9BH 2ZHQH 3VB4A 2ZU2A 3PLKA 2BHGA 1Q2WA 2ZTXA 4O3UA 3RXKA 4YESB 2AGEX 4I8GA 1AFQB 4ZHLU 4X1NU 2UUYA 3QLPH 2BDGA 3HATH 5FBEA 3EDXB 2AMQA 5J4QA 4NZLA 1W10U 2VH6A 3MO9A 2FO9A 3QWCH 1HAIH 1UO6A 1C5NH 1Q3XA 1T4UH 1SGDE 1V2JT 1NC6A 3ODDA 1A0LA 3RXPA 1Z6EA 2VH0A 5C1YA 1C4U2 2G52A 3SNCA 1BMNH 2QXGA 5EU8A 3V13A 1SVPA 3B8JA 1GMHG 1PPGE 3P17H 1FXYA 4AZ2B 2D8WA 1W14U 1LQEA 2PW8H 1SI5H 2O8UA 1MAXA 1GVKB 4Y0YE 3ZZ6A 2LNCA 3MNBA 3SU5A 4YTAA 1GGDB 3OU0A 1K28D 3U1JB 6CHAB 1GCTC 2ANMH 1FLEE 3BIVH 1LHEH 1KY9A 3ZZAA 2QC2A 1D6WA 3SI3H 5HM9A 1O2LA 3S9BA 3A7TA 1BTUA 1G36A 1KTTB 4VGCB 2OUAA 4Q7XA 1QL9A 1C1UH 1UTKA 2D26C 3KGPA 1IQGA 2BM2A 1NPMA 2NU4E 1LPKB 3A8CA 1EOLA 1D3DB 1N6YA 1HYLA 1PYTD 5GXPA 4Y10E 3RC6A 1F5LA 2AERH 1L4DA 1RTLA 2OCVB 3SU6A 1C5OH 4FU8A 1GHBG 4IGDA 1ZPBA 1AKSA 2A2XH 2IOTA 1GBKA 1MTWA 4ISIH 5JDUB 2OC1A 3RXQA 1O3PB 4ZKSU 4A6LA 2M5TA 1GJ6A 2F9VA 1EUFA 8GCHF 3MNCA 1AI8H 1BJUA 1O34A 2ZEBA 5FBIA 1BOQA 4X1RU 1FY1A 4CRFA 1C5MD 5DGJA 3H7TA 1Z8GA 3MFJA 3SV6A 3ITIA 1AVGH 1GWAA 5DJ7A 4J2YB 1O2ZA 3A7XA 1UVOA 3HK6B 2TRMA 1AWHB 3JZ1B 4UEHH 4KTUA 4D7FA 1ESAA 2BMGB 2WV5A 1DY9A 1PPZA 2BLOA 4CR5A 2XNIA 1BB0B 1VITF 4X2YA 1YPEH 1C5LH 1AO5A 5E2OA 1QJ1B 2A1DB 3LT3A 2PKSC 1GHZA 4E7RG 5EGMA 1RIWC 4BOHA 1UTOA 5A8ZA 1DWEH 1L2EA 1HXFH 1GBBA 1SGYE 1EZSC 3SUGA 3TLOA 3QGNB 3W94A 1KXDA 4I33A 1NM6A 1A46H 1O3DA 1CT2E 1ABJH 1DUAA 1GJDB 2CXVA 4MTBA 4X6MA 1XMNB 4ZH8A 2FLRH 3EE0B 4MG3A 3VXEH 3FP7E 4XBBA 3SO3A 1SGQE 3TGIE 3VFEA 5SGAE 4IN1A 3U1IB 1GG6C 5AHGH 1F0RA 1VITG 1SGFA 3MU5A 1QL8A 5GJ4B 4YLUA 4OS4A 2ZGBH 2ZU5A 3SNBA 4IW4E 4AN7A 2ZECA 3QTVH 1TGCA 4FXGH 1CA8B 3D23A 3DT0H 1QQ4A 1CHOF 1K1PA 1O2VA 2VGCB 3LGWA 3M7TA 3DHKH 3U8RH 2O8MA 1TNKA 1GDNA 1BTPA 1GCTB 3SHAH 1XVMA 2WPJS 3MU8A 1AY6H 2THFB 4R0IA 2FS9A 4ABEA 3ZV9A 4ASHA 1ANCA 2Z94A 2C93B 3NWUA 3QDZB 1FY3A 2P94A 2QXJA 5EOKA 1O37A 1HDTH 1FUJA 1L1JA 2PTCE 1K21H 1GDQA 1X7AC 3B23B 1OWJA 4DIHH 2FM2A 1GJ4H 3BTQE 1FV9A 1V6DA 1MKXH 2ANYA 3ATWA 1O2XA 1ELGA 3PO1C 2BXTH 3RXFA 4MNYA 3MTYA 6GCHG 4UDWH 2ZNKH 5JB9S 1ZHRA 1K22H 3LKWA 4LZ1H 2SFAA 3MNSA 5C3NA 5LPFA 4XE4A 1W11U 2FTLE 5FHTA 1O38A 3A7WA 5JBBS 5EPYA 4BXWA 1V2LT 4ISOA 1YF4A 2QCYA 1GL0E 1HFDA 2OTVA 3FP8E 3SJOA 1QGFA 1G37A 2J92A 3TVJB 2VIVA 1YGCH 2WPMS 4X2WA 2QXIA 3M7QA 1T4VH 3GISB 5DK1A 1G3BA 1UVSH 4JZFH 5LPEA 2ZPSA 3PWBA 1HAVB 5JPMH 1GI2A 2AMPA 3LGVA 1CE5A 1Y8TA 1C9TA 1EAIA 2AGIX 1YLCA 1AZZA 3ZYEA 1RIWB 2PKAB 1O2YA 1JBUH 1UK4A 2GX4A 4INLA 3BV9B 5CMXH 3L3TA 1CBWC 5A09A 1QB6A 4ZAEA 2V3OH 3SNDA 1SLVB 2AGGX 2OC0A 2ZF0H 1XKBC 2PUXB 4INHA 1GMCF 1NRSH 1QY6A 1S6FA 1Z8RA 1G3EA 1WTHD 3NCLA 3U8TH 1UHBA 3SJIA 3A7VA 2HNTF 1HCGA 3PV4A 4BTTB 1ZLRA 3LC3A 1ANDA 2UUFB 2QAAA 2GKVE 1BMLA 3OTJE 2J95A 4JZ1A 1G30B 2G4TA 3EA7A 1TNJA 4Y7BA 3TITA 3UUZA 4J1YA 2QF3A 3OSYA 2SGFE 4OS6A 2ZU1A 2CMYA 3AW1A 2ZQ2A 1C1RA 1GL1A 1CT0E 4RN6A 1GMCG 5K0HA 3UFAA 4ABFA 1S82A 1FDPA 4YT7H 3F68H 3P8FA 4ABDA 3UIRA 3SHCH 1C5XB 4WXVA 2R3UA 1T31A 1ZMLA 1C5RA 1ZTKA 1PPCE 4NIWA 2Z7FE 1DFPA 1OPHB 4F4OC 5EW1H 1P2QA 2ANKH 4BNRA 1SOZA 1RTKA 3N7OA 2H9TH 1SB1H 4O3TA 3HGNA 1K2I1 1TGBA 5JBAS 2PSYA 5EQQA 4KTSA 5FCRA 1G3CA 1BIOA 1KXFA 4FUHA 2FI5E 3QZQA 3SN8A 4X8TH 1P0SH 3VEQB 4ESTE 2HPPH 3HKJB 2XTTB 1G32B 4TWYA 4X8UH 2ZC9H 2HRVA 3T26A 1IQLA 4ABBA 2XCFA 1XUIA 1H9HE 1BTZA 3GCHB 1S81A 4FUEA 1BA8B 4FU9A 3PLPA 2P3TB 3RXMA 2STBE 1QNJA 1O3OA 3QX5H 3SU3A 1IQKA 5A0BA 1VGCC 2GDDA 2ZDLA 1NU7B 3U9AH 5FCKA 3ZZBA 3F1SB 1DICA 2F91A 3A82A 5EXNA 4MVNA 1AWFH 3SV9A 2AMDA 4K1SA 2ILNA 1NRPH 5ESBA 1ELAA 1P01A 1N8OB 5JYIA 1GJBB 4U2WA 3MMGA 4O97A 3S69A 5DP3A 3DFJA 1BQYA 1MZDA 4K8YA 4BAQB 5FAHA 1OSSA 3TJOA 5DG6A 2OC7A 1O31A 4I8JA 4UONA 4AFUA 2SGDE 1CGHA 3E16B 1GI1A 1KXCA 1P02A 3OYPA 4YOIA 1E0FD 1OP8A 3F6UH 1YCPM 1XVOA 1VR1H 2A4OA 2GD4B 6LPRA 3E0PB 3O8BA 3GDVA 1C5WB 4NG9H 4X0WU 3RMNH 3SU0A 1BRCE 4KKDA 1C5TA 2R0LA 2F3CE 2J34A 2AIPA 2ZTZA 3CENA 3ZVEA 3ZVGA 2W3IA 4FUDA 5F8ZA 5DP6A 1IQHA 1T7CA 3TGJE 1DDJA 3ATKA 1P10A 2CHAC 1SLUB 5F03A 1MQ6A 2C8YB 3KQBA 2A45B 2RG3A 1Z8JB 2A4RA 1EKBB 1TBQH 2W7UA 4K3JA 2OBQA 1RS0A 1DX5M 1C1PA 2TIOA 3LGYA 3ATIA 1DE7H 4GHTA 5E0GA 3E91A 2DE8A 2Z3EA 5DP9A 1SG8B 2VU8E 2NU3E 4AB8A 3TK6A 1PPFE 4BAOB 2PFEA 1QURH 3MI4A 2BY5X 1EP6A 1ZR0A 1XUJA 1OYQA 2CF9H 3HPTB 2A31A 3RLWH 3ZVFA 1O2OA 2ZO3H 1GPZA 1ANEA 3U69H 2UUKB 5CE1A 1IQIA 4MPXA 3IG6B 1O2NA 2V3HH 1GBIA 1BTWA 1KLTA 1GJ8B 4RKOB 1Q31A 3A83A 3WY8A 2RA0A 5AFZH 2ZDKA 1TBRH 3EA8A 2FOMB 2ZDVH 3VGCC 1T8LA 3FZZA 1C1QA 5C67A 1GHAF 1WSSH 5J4SA 1O2MA 1KDQB 1V2ST 3S7HB 2XWAA 1AE8H 1BCUH 1SGTA 1PQ7A 2FDAA 1P3EA 1AD8H 1W12U 1ZJDA 2KAIA 3L33A 4HTCH 1CHGA 4K1TA 2NWNA 1V2UT 1KXEA 3UTUH 4TPYA 2P8OB 1GHYH 2QY0B 1QL7A 3BG4B 1ZOMA 1UCYH 2TGAA 2ZI2H 4QT8C 2A5KA 1EZUC 2IN2A 1ANBA 1MUEB 1AZ8A 1ZRBA 1CQQA 2FOAA 3HKIB 1QJ6B 5DP7A 4B74A 1TA6A 1H8IH 3S0NA 1TA2A 1L4ZA 3URCA 3UNRA 1QHRB 4GLYA 4Q7ZA 2QXHA 1DXWA 1EX3A 1WAYB 1EAUA 1YLDA 2STAE 3TJUA 3GCNA 3IITA 1FIWA 2H1UA 3M7UA 2ZA5A 1INCA 2A0QB 1FAKH 3ATLA 5E8EH 3SOSA 5C1XA 4BAHB 3SV8A 1J15A 1EPTC 4HZHA 2LPRA 1FI8A 1J16A 2PGQB 1GMHF 3M3TA 2ZGHA 5GDSH 1QJ7B 4RKJB 1WQVH 1O3BA 3AAUA 4FVDA 1YPLH 4UFDH 3M5OA 4Y7AA 2NU0E 2Z9LA 1SQOA 2I6QA 4B73A 2GGVB 1FQ3A 1ELFA 2HNTE 1GI5A 1TMBH 2R9PA 2A7JA 2A7CA 3RXUA 3A8BA 4ZXXH 4AGJA 3RMMH 3UNSA 5TJXA 4I8LA 3SU2A 1UTLM 1KIGH 4E05H 1J14A 3URDA 1EQ9A 2OQ5A 1V2OT 4Q80A 4AOQA 1DUEA 1UK2A 3M61U 4X2XA 1JXPA 1H4WA 1QCPA 2VIWA 2ZFSA 1GHBF 1YPHE 3TGKE 2FWWA 1S0RA 1Y3XA 1MKWH 4FUBA 4Y8XA 1OWKA 1ELTA 1HAZB 1THSH 3I78A 1AQ7A 4B2CA 2GTBA 3RXLA 2XBWA 3SGQE 1TLDA 3UREA 2BX3A 4H42U 1NTPA 1SHYA 1CA0C 1HBTH 4UFFH 2ZPQA 5LH8A 1NFXA 3LC5A 1H9LB 1BBRH 2Y7ZA 4HI3A 1NFWA 1YP9A 3RXSA 1DM4B 1GBAA 1MD7A 3GOVB 3TIUA 2PSXA 2B0FA 4AB9A 2VIDA 2NU2E 1UK3A 1UVTH 2G4UA 1Y5UT 5PTPA 2GMTC 5E0JA 3VB6A 1J9CH 5GPIB 4Y0ZE 1XM1A 1ZGVA 1TPPA 4DOQA 3EAJA 3QGJA 4K1EA 1GI0A 1HJ9A 2PWXA 3NPSA 1NU9A 2OC8A 1D9IA 3GY4A 3UWJH 1PFXC 1NROH 3RXTA 2O8WA 1TABE 1QRZA 4BANB 1FAXA 1ETTH 1WOFA 2FYRA 1VJAU 3MYWA 2BD2A 3KQDA 1MBQA 1EZXC 1NY22 1OS8A 4IBLH 2GCTC 2BVRH 4B2AA 1G3DA 2GT7A 3A84A 1C4V2 3O8RA 5E2PA 1NS3A 3TJNA 2F9UA 3SU1A 2BZ6H 1HPGA 1GCDA 1C1MA 1QB9A 4TY7A 2V35A 4X1PU 1A1RA 1MD8A 3A80A 4LXBH 3E90B 4M7GA 1O3LA 1P12E 2CGAA 1IOEA 2FOHA 2JH5D 2BDYA 3PB1E 5AFYH 1O5EH 2FOBA 2ODPA 2HLCA 2ZU3A 1UCYE 1EB1H 1V2QT 3D62A 1TRNA 3UQOA 1HAHH 2ZFTA 4NWKA 4DG4A 1LVOA 1MKXK 4WJG2 4ISLA 2VVCA 2DE9A 2BOHB 1AUTC 1P57B 2WPHS 5L2ZH 1T8NA 1PPBH 2DUCA 1HRTH 4YOGA 1BJVA 1EATA 3M35A 2AYWA 4O03A 3RXHA 1GBDA 1OWIA 1C1WH 3QZRA