2SGAA

Electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
b'IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title Electron density calculations as an extension of protein structure refinement. Streptomyces griseus protease A at 1.5 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1983-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgaA01
2ODYB 1TNLA 2WPJS 5T6GA 2BX3A 1K21H 4BTIB 1OKXA 1AGJA 5K7RA 4K1TA 3A8CA 2NU4E 1W12U 1AUJA 1G32B 2ASUB 5DP7A 3AAUA 3SUEA 3UQVA 2TGTA 1D3QB 3HATH 1K28D 5AF9H 1NFWA 1GHAG 1OSSA 2VB0A 5T3HA 4B2CA 1G9IE 4A92A 3SNBA 4CRCA 1C1TA 3SU3A 2FTLE 3T5FH 2ZCHP 1QJ7B 2F9VA 3A81A 1D6RA 2FOFA 1ABJH 2HWLB 1O2RA 1P12E 2ALVA 1SQOA 4A7IB 3RMNH 1X7AC 2HALA 1AE8H 3LGWA 2V3HH 1P57B 3U69H 3ZZ3A 1T8LA 1A5IA 1TX6A 3GDUA 1DE7H 2OBOA 1TGSZ 4Q2KA 3SUGA 2P93A 1AU8A 1EAUA 3M36A 2H9EH 1KLTA 3PMAB 1GJ6A 1CBWB 1HDTH 1LVYA 1P03A 5F8XA 5TCCA 1PQAA 1ELTA 4NIVA 2W7SA 4IS5A 3I29A 3SU5A 2PFEA 1FI8A 3SV2H 1K1LA 3Q3XA 1TPPA 5EXLA 2B8OH 4YOIA 4O03A 4RKOB 1QBNA 3RXQA 4CREA 3LH3A 1TABE 3ZZ4A 1W7GH 1TRMA 2RG3A 2J9NA 3TJUA 5EG4A 1KLIH 3H7OA 3L3TA 2ZU5A 1MAYA 2O8TA 1P2OA 1O2NA 2PKSC 2ZFTA 1G36A 4HFPB 3DFLA 1JXPA 4DG4A 1AVXA 1FY1A 4ISIH 4IW4E 1UTPA 1LHGH 1MTUA 1TRNA 2FS8A 3D49H 3WY8A 3F9FA 3CS0A 1ANCA 1EAXA 1GI8B 3NUMA 3ITIA 1UK2A 5DJ7A 1AO5A 1D6WA 1MCVA 4TWWA 2Z3EA 3UTUH 3ZYDA 1HAVA 4DGJA 4NGAH 1CQQA 1QFKH 1MBQA 2BTCE 3QTOH 3M5NA 1A5GH 5LPFA 3ZZCA 2FI5E 2ZTXA 2O8LA 4R8TB 2R3UA 1NRSH 4D9RA 1ETTH 1YPMH 3B23B 4BXWA 1VGCB 1A1RA 3BIVH 2C4FH 3KHVA 1ABIH 1GCTB 1DWEH 1O2MA 1TNIA 3OYPA 5DP3A 3RU4T 5DP9A 2C3SA 1Y59T 2H5CA 3NCLA 4NZQA 1BTUA 1BTXA 1SQAA 4WY3A 2JH5D 1DXWA 1O2SA 3P8GA 1CHOF 3CS7A 1HXFH 1N1LA 2QGRA 2GV6A 2PSYA 1OPHB 2ZDMA 2ILNA 2AGGX 3N7OA 1A0JA 4Y8ZA 2PKSB 2PKAA 3RP2A 1QCPA 1UK3A 1GMCF 5E2PA 3PLBA 4YLQH 3LH1A 2VGCC 1K1PA 3E90B 8LPRA 4Y0YE 1OP0A 3F9EA 1YPHE 3BG4B 2W3IA 1W10U 3VB4A 4FXGH 3TLOA 1C2KA 3MNXA 1ZPBA 1O2HA 3LKWA 5T6DA 2Y7ZA 2D8WA 3ATWA 2GCHF 4MPVA 2WPIS 4KTUA 1V2WT 1BCUH 2BVSH 2PR3A 1BBRE 3ZVFA 4NWKA 5FHTA 3I77A 1CHOG 2EI7A 4X1RU 1XX9A 1ZZZA 1CU1A 3LT3A 1QRZA 1TYNA 1PPBH 1FXYA 2UWPA 4HTCH 4A1VA 5DPAA 4U01A 2HNTF 4A6LA 3RXIA 3E16B 2PHBA 1UVPA 1GJAB 2FI4E 4D7FA 2WV5A 3P6ZB 4K69A 2UUKB 1C1OA 1G3BA 4DOQA 2ZDVH 1Q2WA 4JZFH 5DKMA 1G2LA 1GMCG 1WBGB 2Z9KA 3A8BA 3LPRA 2W7UA 4UFGH 1J14A 1FUJA 4E7NA 4YT7H 1C1SA 1Y3YA 5B6OA 2ZCLP 2VWLA 3BTFE 2NWNA 1ELEE 1O3EA 2FP7B 3MU1A 4CH2B 1RIWC 4A5TS 1C9PA 2CV3A 1SHYA 2GCHG 1MD8A 4H4FA 1HB0B 2GDEH 1FN8A 1P2IA 3RXCA 1LPKB 1H9IE 1W2KH 1FONA 1SGFG 2HNTC 4ZKOU 1CSOE 1TWXB 2Y80A 1S84A 2DE8A 3HGPA 3MI4A 1P2KA 4B73A 3K6ZA 1ZGIA 1C5XB 2QIQA 2J34A 3SUFA 1QHRB 1XM1A 4I8LA 1P2JA 1O34A 5C20A 2D1JA 3W95A 1CVWH 2DE9A 1BTHH 3M5LA 3KN2A 1O2WA 2OBQA 3SGAE 1CA8B 4JCNA 1EPTA 1WV7H 4ZUHA 2TGPZ 1GJ4H 3RXVA 1HFDA 1Z8IB 3SNDA 1Y8TA 3MNBA 1C5PA 3A80A 4AYVB 1YPJH 3TPIZ 4U32A 3OU0A 2TGAA 3M7QA 2FLBH 1DWDH 1GHVH 5BPEA 1E37B 1P3EA 3P8FA 1GL0E 1O3BA 1H8IH 1KLJH 1ZSKA 2XRCA 4I8JA 1THSH 1CT0E 2M5TA 4IMQA 4B71A 3SJOA 1LHEH 1J8AA 3M3SA 5F8TA 2CHAB 2Y81A 1RIWB 4GLYA 1SB1H 1SHHB 2FO9A 1GBFA 2Z9LA 1P8VC 3BF6H 2BDCA 1DFPA 1GBAA 1GVKB 1V2JT 1P04A 1A0HB 4O9VA 5JB9S 4D7GA 2BLQA 1AQ7A 3BTKE 4NG9H 1L4DA 4WMFA 1AVWA 2BLOA 1GBHA 1TNHA 4U30A 2ODPA 4SGBE 1K1OA 1QRWA 3ZZ7A 3S9BA 1BRCE 4NFEA 4BAQB 1HAPH 1HAZB 1S85A 3L6PA 1C9TA 1G3EA 3A7YA 2J92A 2ZTYA 4HGCA 4Y11E 2B5TB 1QL9A 3GCOA 2FMJA 1ZMNA 6GCHF 3QK1A 1DANH 2OC8A 2BY5X 4WVPE 4ZHAA 3VXFH 4FUEA 2FOMB 3V0XA 4J1YA 3MU4A 1SOZA 3PLKA 4CRGA 3F68H 1F5LA 4IGDA 1FMGA 3KQBA 2TBSA 4UFEH 2HLCA 1T7CA 1CGIE 1NO9H 2SGEE 3K6YA 2B0FA 2BD8A 3ZVGA 1MKXK 2Z7FE 1O31A 2ANKH 1VZQH 2F9PA 1P10A 2VIWA 2ZGHA 1TFXA 1GJ7B 1OWKA 1ESAA 1V2OT 1KXBA 5DG6A 3ZVAA 1FAKH 5FAHA 5GPIB 1CT4E 1WSSH 1QA7A 1DM4B 4GCHF 1NRPH 5T6FA 1IQHA 1UTQA 1BMMH 5DP4A 1C5QA 4LZ4B 3V3MA 1O32A 2BOKA 3BG8A 2ZA5A 1KTTB 2GDDA 2GCTC 2VWOA 3UWJH 2THFB 3RXDA 2V35A 2FOBA 3VPKA 1HAHH 2UUYA 1KDQB 3MO3A 4VGCC 3U8TH 4FUBA 4OGXA 1OYQA 2FODA 1EB2A 2R9PA 5EQQA 4NFFA 2ZI2H 1UMAH 1VR1H 1HAVB 4BAKB 1DVAH 2ZP0H 4OS5A 2QAAA 1CE5A 4RN6A 3SW2B 2I6QA 3MTYA 1SLWB 2QXIA 4DVAU 1FIWA 1NY22 1U6QA 4MDSA 4AFUA 1XKAC 3PM3A 4H6TA 2G52A 1GBTA 2ZG0H 1E34B 1YPKH 4AG1A 1WYKA 3PMBB 1O3LA 5CHAC 1BB0B 1HAXB 1CHGA 1UJ1A 1MTWA 3KF2A 1O3CA 1QURH 2CF8H 1ANBA 1TGNA 3A84A 1LPGB 1NRRH 2GD4B 2KAIB 3GCTF 2JH6D 1V2KT 5FPYA 3ZZDA 1AIXH 3M37A 4ISHH 4NSYA 1LCYA 3MH4A 1XUFA 1CA0C 1DY9A 1SGNE 1PQ5A 1V6DA 4ABFA 1V2LT 1W13U 2FOHA 4MPUA 4AG2A 5C1XA 1YM0A 2GCTB 2C8XB 3BIUH 3UY9A 2ZC9H 3P95A 1TB6H 1P11E 4AX9H 1QB1A 3RXHA 4A1XA 1HBTH 4J2YB 1MU6B 3IWMA 1P01A 4MNYA 1C5LH 1UCYE 1K1NA 1O5DH 3FP6E 4ESTE 1ZMJA 3NWUA 1EJMA 4IC5A 3ZZ6A 1LDTT 2OINA 3K9XB 1O2JA 4I7YH 1EJAA 3H5CB 3SNEA 1VJ9U 2RA3A 3P70B 1D3DB 1K1MA 1QIXB 2GT7A 1DSTA 3MWIU 2GP9B 4IN1A 1BTWA 1W14U 4TPIZ 1J15A 2AS9A 1TAWA 1KXCA 1TMUH 1UCYH 2LPRA 1GMHF 4BTUB 1UTJA 2Y5HA 1TNJA 1V2UT 3NZIA 1ELBA 5A09A 1HIAA 5EPYA 5EW2H 5C67A 2Y5FA 1NRNH 1O39A 1O3DA 3M7TA 3MH6A 4CHAC 4ZKNU 1GHBF 4NA9H 2GMTB 3UIRA 1UVOA 2VVVA 2UUFB 3BTWE 2DUCA 2CJIA 3F9HA 2A5IA 3OY5U 4ZHMU 2SGPE 3STJA 1C2DA 1DDJA 1CA0B 1QR3E 3TK6A 3GY4A 4B74A 1NN6A 2ZDAH 2AGIX 1HJ9A 4FUIA 1SPJA 2ZTZA 2QA9E 2FIRH 1C5SA 1AZ8A 4UE7H 1S0RA 1GJCB 3KQCA 2BM2A 3LU9B 1ESBA 1LHCH 4AGKA 2ZWLH 1IQFA 1DPOA 2EI6A 1QA0A 3BTDE 3PO1B 1IQNA 4O3UA 1F5KU 2ZHDA 1GMHG 1XXFA 2XWBI 4K2YA 6CHAC 1BTPA 4U2WA 3RXGA 1G30B 1PPHE 1F5RA 4I32A 1SGFA 2XBWA 4I31A 2R3YA 4AFZA 1C5ZB 4HI3A 3G01A 1EPTB 2AIPA 6LPRA 2B7DH 2SGAA 3LGIA 2W26A 3LGTA 3PV4A 2VIVA 1QL7A 3PTNA 1SQTA 4TPYA 1T8OA 3F9GA 1O2GH 4MQAA 4CHAB 5LGOA 4ABBA 2OUAA 4R0IA 3KEEA 5A8XA 1BJVA 1YKTA 1VCWA 1GCDA 1GWAA 1RTLA 4IC6A 1E0FD 1O2PA 1O5EH 2BYAX 3E6PH 1VGCC 1QGFA 2BD7A 3M3TA 1ZSJA 4TY7A 3PLPA 3BTGE 1AKSB 3U98H 1O3IA 1GCTC 2PLXA 1UVUH 3AAVA 2AFQB 1HXEH 2FX4A 1C1WH 5FBIA 5EODA 3ESTA 4ZXYH 3UQOA 2H9TH 2VIDA 2BVRH 2ZPSA 1C1PA 4GUXA 3KL6A 1ZJKA 2GV7A 1C5NH 3SU0A 1NS3A 5ETXA 2OP9A 3Q3KA 2BDGA 1ACBE 3R0FA 4A1TA 2STAE 4K1SA 3T62A 1O2KA 1T31A 2BDIA 2BLWA 4Q7YA 4X2XA 3ATIA 2VNTA 1OX1A 6CHAB 1NFXA 1G37A 4ZAEA 1Z8JB 1AVGH 1BBRK 3QZQA 1EKBB 2WPMS 3GYLB 3EQ0H 1AZZA 1M9UA 1OS8A 3U8RH 3PYHA 1D3TB 5JBBS 1GMDF 4Q80A 3VEQB 3FVFB 1EXFA 3BG4C 1HJAC 3MH5A 5F6MA 3SV9A 5JYIA 1CGJE 2IJOB 1IAUA 1SI5H 1UO6A 4Y8YA 1D3PB 5J4SA 5F03A 1DWBH 5JDUB 2BD3A 3S0NA 3TU7H 2VIOA 1V2NT 2P3UB 5IYTA 1O2IA 4ABJA 3A83A 1O3GA 2QF0A 3MNCA 1DS2E 3QLPH 1ZPZA 3TNTA 2Z94A 5C1UA 2GGVB 5C5OA 3U8OH 3SQHE 2F9UA 3A82A 1PPCE 4K60A 8KME2 1AY6H 4FUFA 1ZPCA 1O38A 2OCVB 2QY0B 3V13A 1AMHA 4NA7A 5FCRA 1BRUP 1Z8RA 2ZHEH 1DICA 1KXDA 2A7HA 4FU9A 1LKBA 1Z1JA 1LQEA 3RC4A 2UWOA 2ZQ2A 5ESBA 1IQLA 1O2LA 5L6NH 1TX7A 4IN2A 3FAOA 5PTPA 3A7WA 1Y5BT 1AI8H 4AB8A 1AFQC 4MVNA 3SU4A 1AWFH 4BAOB 4UONA 2ZKSA 1EASA 2CN0H 2FM2A 2ZO3H 2AMDA 1BQYA 1QB6A 4CRAA 1V2MT 3SNAA 1GI6A 1Y3WA 2FI3E 3MU0A 3ZZ9A 2J38A 2QV1A 1NZQH 1MH0A 3OSYA 1XVOA 1FLEE 1C2EA 4DCDA 7LPRA 1YC0A 4X1QU 1W3CA 1IHSH 3GISB 3RXFA 5GIBA 1BOQA 2CF9H 1EZUC 1BZXE 1P3CA 4DW2U 2NU2E 1HJAB 2WPKS 1O3KA 1VJAU 1TE0A 4YOGA 2ANYA 3ZZ8A 3B9FH 1C2LA 1ZR0A 3BTQE 4MNWA 1YGCH 1SGEE 2W5EA 1GI3A 1IQEA 1FQ3A 3Q3YA 2HOBA 1EZQA 3VB6A 4X2WA 1B7XB 1UHBA 1BMNH 3MO6A 4AZ2B 1BRAA 1TNGA 4FUGA 1FPCH 4FUHA 1O2TA 4E05H 2BZAA 1LKAA 1PPEE 1TA6A 3HKJB 2CXVA 1S6HA 1V2VT 4LOYH 2BDHA 1GBCA 1WTGH 3EA8A 3ELAH 5E0GA 1SGTA 3P17H 3TGIE 2ZHWH 4AGJA 1DWCH 4KGAA 4DY7B 4FU8A 5EW1H 1XUJA 3T26A 3A7VA 1EATA 1ZOMA 5GWZA 3QO6A 4X1PU 4NIXA 1V2PT 2ZDNA 2BY6X 3A8DA 1OOKB 2JKHA 1FDPA 1AFQB 1ZMLA 5FPSA 1IQJA 2GZ7A 2P8OC 3STIA 2QF3A 4K3JA 2CHAC 2ZU1A 3SV8A 2ANWA 8ESTE 2EA3A 3ENSB 2BDYA 2C93B 1Z7KA 5ABWA 1SG8B 3RXAA 4ABAA 3K65B 2PTCE 4NWLA 1FNIA 3SOSA 1ARCA 2GZ8A 2ZU3A 4CH8B 3SORA 1Y3UA 5A8ZA 1ZLRA 4YM9A 2ZHFH 4YESB 3AASA 1ETRH 2R0KA 3TNSA 4F4OC 1UTNA 1MKWK 4INHA 3MMGA 2G4TA 4Y0ZE 1O2ZA 2AMQA 2EC9H 2HPPH 1MCTA 3HGNA 2AH4X 2A4GA 1W7XH 1O3PB 1EP6A 1EUFA 1YCPK 4X0WU 3W94A 1GL1A 4YTAA 4TYDA 4CBOA 1O3OA 3RDZA 2G8TA 1GJDB 1THPB 3E8LA 4BAMB 4O3TA 9LPRA 3Q77A 5DP5A 3NXPA 1XUKA 1C1NA 3ZV8A 1D9IA 1C5MD 3F6UH 2FLRH 3LJJA 2PUXB 3SV6A 5F8ZA 1BA8B 3RXUA 4WJG2 4NSVA 4QT8C 3A89A 2TRMA 3U1JB 2FYQA 2XWAA 1SGCA 4JMYA 1NU7B 1C5VA 1T4UH 1K1JA 1AWHB 4YZUA 2VINA 4I8KA 4KTSA 3RXSA 1FJSA 1GDUA 1CT2E 4X2VA 1ID5H 3BTTE 2P8OB 3QN7A 2FPZA 1J9CH 4OS7A 3TJNA 1GI0A 4I8GA 3M5OA 4NZLA 1GI7B 3RC6A 1K2I1 1RRKA 2FESH 2ZGJA 2ZU4A 3ZVDA 5HYOA 1SGPE 3RXRA 1OYTH 3JZ2B 4MNXA 2A0QB 3IITA 1MBMA 4Y7AA 1H9HE 1HAGE 1P2NA 1BIOA 1DUEA 5EQRA 1JIMA 5EXNA 3SJ9A 1C4Y2 3SZNA 3S7HB 2H6MA 5DK1A 5LH8A 2Y7XA 2PW8H 4KELA 4LK4A 1UTMA 1LVMA 4X2YA 2A2XH 3BTHE 5A2MH 4I8HA 1GHWH 2OXSA 2ZGCA 3GYMA 4MPWA 1EOJA 4KTCA 2WINI 3UUZA 2FYRA 4UD9H 3PROA 2B9LA 1GI5A 4WWYA 1PPGE 1TGCA 3URDA 1ELGA 2WYGA 2HGTH 1QJ1B 4NIWA 1O0DH 1PYTC 1P05A 4OS1A 2J2UA 1W11U 1ZHPA 1O2UA 3LIWA 2ZPQA 4XE4A 2XBVA 1RJXB 6ESTA 2OC7A 1ELVA 1YBWA 2RDLA 2ZNKH 3TITA 2FOCA 1OWIA 2HRVA 2XNIA 5G4BA 1G2MA 1AD8H 1WAYB 1ARBA 2H5DA 2XCFA 4INKA 1TLDA 2ZQ1A 3UNQA 1YPHC 1F7ZA 1UCYK 3GY2A 3LC3A 1S0QA 1FIZA 5L2ZH 1GVZA 1QQ4A 5FCKA 3RC5A 1WCZA 3ODFA 3UNRA 3A85A 1LVBA 6GCHG 4MG3A 4BTTB 1NROH 1SGIB 1WUNH 1P9SA 1LHDH 5SGAE 5EU8A 1HRTH 1UTOA 2FTMA 3ZV9A 1O3AA 1YP9A 3UWIA 3BEIB 4BOHA 1AB9B 3TH4H 3PMHB 5JPMH 3SN8A 1GDQA 2AMPA 1N6XA 3EGKH 3PTBA 3UOUA 4OS2A 2HPQH 1SGRE 4AOQA 3QX5H 1DUAA 3B8JA 3TGJE 3HKIB 3TIUA 3GDSA 2CGAA 3QDZB 2ZFSA 3O8CA 4MTBA 1F92A 3P8OA 2O9QA 1F2SE 5L2YH 1A2CH 3ZVCA 3GY8A 4GCHG 1GJ9B 2V6NA 1AUTC 1ELFA 4UFFH 1C5UA 4WMDA 2IOTA 1XKBC 1AN1E 4WH6A 1HCGA 4INLA 5K0HA 3E0PB 3E0NB 3RMLH 2J95A 2QN5T 4DIHH 1O2OA 1KY9A 2GMTC 4JZEH 3NK8A 2FX6A 1V2RT 4B2AA 1W0ZU 1EQ9A 1EZSC 1ESTA 4TWYA 4CR9A 4UDWH 1DLKB 2ZFQH 2ZGXH 1SGQE 1DLEA 1HAIH 4CRFA 1L1NA 1T32A 1LQDB 2ZHQH 3T29A 2A7JA 2G5NA 3S9CA 4JZDH 4YLUA 2PKAB 3T25A 3QWCH 1MZDA 2RA0A 1ZRBA 2WUCA 3MU5A 3MOCA 2JETC 2R2WU 3PO1C 3T27A 1BITA 5H4IB 1GBBA 1E38B 1UVTH 4XFQA 3RXLA 3CENA 3SU2A 4H6SB 4RSPA 2OTVA 3P8NA 3MHWU 2TGDA 1ELCA 3SV7A 1GBLA 1V2QT 4Q7ZA 3TH2H 2J94A 1P2MA 2G55A 2G00A 3GOVB 1GDNA 2VVCA 2XC4A 3GCTG 1EPTC 1FY8E 2EEKA 2A31A 4H42U 1QJ6B 2WV4A 3RXEA 4CBNA 1UK4A 3QGNB 4ZKRU 1C2FA 2P95A 1A3EH 4YOJA 1RS0A 1MKXH 3SHCH 1NPMA 3BTEE 4XBDA 5EPNA 3TJVA 3GY7A 5DP8A 2C90B 1IQIA 1YLDA 1TBRH 2BVXH 1RXPA 1VCQA 1RD3B 4ABEA 2XCNA 2ZPRA 4K5ZA 2QXGA 1MU8B 2WPLS 3LDXH 5DGJA 4D9QA 3DT0H 1A4WH 3SU6A 2FOGA 1S5SA 1JRTA 4SGAE 4GHQA 3M7UA 2PV9B 3SI3H 2IN2A 1TBZH 3SQEE 1O36A 1GI1A 1RTKA 1ZGVA 3RXPA 1IOEA 2BD9A 2F91A 4Z6AH 4FUCA 3KQDA 1O3HA 3IG6B 2JETB 2O8UA 3ZYEA 2HVXA 3ZZAA 4AB9A 4Y6DA 5AHGH 1EX3A 5C3NA 1TX8A 3SNCA 1C1VH 1GHAF 3UR9A 1IQMA 4OS6A 3BN9A 4XOJA 1DX5M 2YNBA 3E3TA 3K2UA 1GHBG 4X6PA 2OQ5A 1AFEH 2D2DA 3MNSA 4B75A 1JWTA 2A4RA 2PUQH 2Q1JA 4FVDA 4XBBA 2F9OA 5A0CA 1O5CB 1BT7A 1PPZA 3QTVH 1SSXA 5C5NA 2BXTH 4JYUH 1LO6A 3A87A 4WF8A 1MMJN 4WH8A 1GHYH 4ZKSU 1ZYOA 1QBVH 4X8UH 2R0LA 3Q76A 2O8MA 2A2QH 1BTZA 1C2GA 1XMNB 3LONA 1YLCA 4Y10E 2UWLA 3A88A 1S82A 1ZHMA 1ZHRA 2HNTE 1SOTA 7ESTE 2OQUA 3O8DA 4B1TA 3FP8E 1GI4A 3O8BA 5I46H 3KNXA 5GXPA 1E35B 2BDAA 1MQ5A 1O2QA 2BY9X 4FUJA 4FU7A 1MTNC 2ZECA 1H1BA 2WPHS 2D26C 5GDSH 1HNEE 1C4U2 3C27B 3VGCC 1QB9A 1Y5AT 1L4ZA 1O5BB 1PQ8A 4OGYA 2SGFE 3OY6U 2WUBA 3O8RA 1O5AB 3D62A 3BEUA 3FZZA 2AERH 2BY8X 3NKKA 3RXKA 2G4UA 3M3VA 5IDKA 2A1DB 4X6MA 2A4OA 3FFGA 3GCHB 1S83A 1GGDC 3C1KA 4AORA 1IQGA 1GJBB 4BANB 5AFYH 4ASHA 2PTNA 3VB5A 2SGDE 3GICB 1BTYA 1PYTD 2OC1A 2OD3B 2PSXA 3ZZBA 1TRYA 3TGKE 1TNKA 4BAHB 3RU4D 1P0SH 2TPIZ 4ISOA 2PGQB 2XXLA 1KDQA 3ATMA 1OWEA 3TJOA 1MTVA 4DT7B 4KP0A 3M35A 1W0YH 3HK6B 4MPXA 1F0RA 2F9BH 3E91A 4XSKU 4JYVH 5JBTA 5E2OA 4ZROA 4AFSA 1OWDA 2VH0A 5EXMA 1MTNB 1EB1H 4AN7A 2A5AA 2IPHA 1NTPA 1VITF 3DFJA 3PB1E 2P3FH 1GMDG 4X1SU 3RXMA 5A0BA 1L2EA 4NIYA 3EDXB 2F9NA 3VGCB 1SGDE 1SR5C 2XC5A 4X1NU 3F1SB 1QRXA 1TQ0B 3RXTA 2STBE 2FWWA 2VWNA 4XBCA 3TH3H 2FZZA 2Z3CA 1E36B 2P59A 2QCYA 3A86A 3ATKA 4JYTA 1RGQA 2EI8A 3MH7A 4FVBA 1EZXC 1GG6C 5C1YA 3AVZA 1LMWB 1Q31A 1NU9A 3TK9A 2XC0A 4WXVA 2Y5GA 1OXGA 1PFXC 3JZ1B 1OWJA 1TOMH 1J16A 5DP6A 2KAIA 4X8TH 3SHAH 2P94A 1GGDB 1GBIA 1TPSA 1C1RA 1EAWA 5TJXA 1K1IA 3SJ8A 4M7GA 3ATLA 4IBLH 2ZU2A 2BXUH 3RU4E 5JB8S 4X6NA 1WQVH 3RMOH 1C5OH 1N8OC 1DOJA 1BJUA 1KTSB 3UFAA 2ALPA 1VITG 2XYAA 2ZEBA 2G5VA 4LZ1H 2GX4A 1C2HA 2Q6DA 5AVDA 3R3GB 2ODQA 1DSUA 2FS9A 2SFAA 2W3KA 9ESTA 5C2ZA 1P06A 2Z9IA 1LTOA 2FOAA 2Z3DA 3MYWA 4Z0KA 2BQ7B 4CR5A 3GCNA 4BNRA 5JBCS 4F49A 4Q7XA 2H9HA 1GBJA 4D8NA 3DD2H 3ZVBA 5LPRA 2VVUA 2Q6FA 4PROA 1P2QA 1CGHA 2P16A 2BHGA 1T8NA 2RCEA 3QZRA 3RXOA 3OTJE 1TPOA 4B76A 1NFYA 2PWXA 1UVSH 1BDAA 1SBWA 7KMEH 4RKJB 1K22H 1C5YB 1LVOA 1FPHH 1O3MA 4BXSA 2XBXA 4GAWA 5J4QA 1C5RA 1C2MA 3NPSA 5LPEA 2OLGA 1YPGH 2VIPA 2Z6BD 1QTFA 3HPTB 1OP2A 1GG6B 1SMFE 1BBRH 1PPFE 1A0LA 1DITH 1JOUB 2GVFA 1AE5A 1PJPA 2ZGBH 1GBKA 5A0AE 1QL8A 3DUXH 1F0UA 3GY5A 4ABHA 4HZHA 1T8MA 1ZJDA 1XVMA 2QYIA 2A32A 1O3FA 1LHFH 2BOHB 1SL3A 3LGVA 1F0TA 2H2ZA 4D76A 3M5MA 3BEFB 1BMLA 3EAJA 2XTTB 5A8YA 3OX7U 1N8OB 2PGBB 3E1XB 1HYLA 1KXAA 1TOCB 4I33A 2XBYA 4CRDA 5JBAS 2QXJA 1L0ZA 4CRBA 1TPAE 3RLYH 2VGCB 5E8EH 5FX6A 3A7XA 2ULLA 2ZFRH 1MQ6A 3URCA 1HLTH 1SLVB 2Q6GA 1C2IA 1HIAB 3L33A 2BMGB 3KCGH 1HAOH 1EJNA 1O35A 4JK6A 3LGYA 1ZTKA 5HM9A 5CMXH 1Z6EA 4GVUA 4X6OA 3VXEH 2ZIQH 5EGMA 2XW9A 2ZCKP 1O2YA 1ANDA 1MD7A 2ZFPH 5EOKA 7GCHF 1UTKA 2P3TB 2YNAA 5EQSA 1H9LB 3AW1A 1QBOA 5HGGA 1XUGA 1NT1A 1BHXF 4X8VH 1SC8U 2V0BA 4ZH8A 1ZTLA 3RXJA 1MTSA 3LOXA 2ZFFH 1KXEA 5FPTA 3LC5A 3MO9A 2AYWA 4JK5A 1TBQH 1CO7E 4WXIA 1EAIA 4GSOA 1AHTH 4KKDA 1HUTH 1YF4A 1C2JA 1HAYB 3SBKA 1YPLH 2VH6A 2BLVA 3H7TA 5FX5A 4Y71A 2NU1E 5HXFA 3RUOA 1TMBH 1QQUA 3BTME 4K8BA 4MLFB 3P92A 1TONA 4ZXXH 1KIGH 1P9UA 2VIQA 1AKSA 4E7RG 2VWMA 1C1QA 1ELDE 1GI2A 1TA2A 3I78A 3PMJA 2QC2A 1O3NA 2SGQE 1J17T 1RTFB 1Z8GA 1THRH 7GCHG 1MAXA 1AB9C 4ISLA 4ZMAH 3MFJA 3Q00A 1B0FA 3S9AA 1NC6A 3FZDA 1KSNA 1O30A 2V3OH 8GCHF 2GT8A 1UTLM 1GI9B 5AFZH 2A45B 3FP7E 1SGYE 3SUDA 2R2MB 1FY4A 1HGTH 1SLXB 3BV9B 5HM2A 1DT2A 1SFIA 2BDBA 3AW0A 2C8WB 1BRBE 1V2TT 2ZDLA 1BUIA 2SNVA 1HPGA 1JBUH 5GJ4B 3A7TA 1DXPA 1GBEA 4E06H 1BMAA 4UFDH 1TMTH 4ZHLU 1NESE 3GY3A 1GBDA 3HK3B 2F83A 3LJOA 2TIOA 3A8AA 1EOLA 3UR6A 2SNWA 1FAXA 2ZZUH 1INCA 5ESTE 1KYNA 2GTBA 1OP8A 3S7KB 3SJIA 1WTHD 3TVJB 4ISNA 3A7ZA 1LPZB 1MKWH 1Z71A 1FZZA 3EA7A 3RM2H 8GCHG 4X8SH 1L1JA 1GHXH 4GPGA 4TY6A 3VFEA 3SU1A 3UOPA 2BD2A 1ELAA 4K1EA 2LNCA 3ZVEA 3SGQE 2ESTE 1YCPH 2FEQH 5TCAA 3V7TA 3SO3A 1BHXB 1P02A 3SJKA 4NCYA 2A5KA 3UPEA 3PWBA 1IQKA 1ORFA 3ODDA 2AEIH 4GHTA 4NA8A 2A4QA 3DHKH 1YPEH 3EA9A 1B0EA 1FN6A 2A7CA 3GDVA 1WU1A 3D23A 3V12A 2BB4A 2GZ9A 3UREA 4O97A 1MUEB 1O3JA 2BX4A 1YYY1 4K8YA 3BSQA 1V3XA 1TIOA 2ZDKA 1YCPM 4JZIA 2GKVE 3M61U 4Y76A 1TALA 1NM6A 4WMEA 5GCHF 1GVLA 3U9AH 1A61H 1GJ8B 1G3DA 2ZF0H 1Q3XA 2ANMH 2C8YB 2Y6TA 4Y79A 4AYYB 3U1IB 1O5FH 1GBMA 1GJ5H 1FY3A 1P09A 1C1MA 4LXBH 2WYJA 4JZ1A 1O2VA 3MU8A 1Y3XA 2BY7X 1GPZA 1ZSLA 3DA9B 3EE0B 2YOLA 3FANA 2AGEX 2I6SA 1L1GA 3GY6A 2FDAA 1D4PB 1S6FA 1QY6A 1N6YA 1TQ7B 2K1QA 3T2NA 1WOFA 3QUMP 1O5GH 1C4V2 3EYDA 3TK5A 4XDEA 1C5WB 4ABIA 2O8WA 1A46H 2H1UA 3UNSA 1ZTJA 1XXDA 2C8ZB 1A3BH 5E0JA 1C5TA 5FXLA 1G3CA 3LGUA 1T4VH 2BQ6B 3SI4H 2BQWB 1WQSA 5GCHG 1GHZA 1UHBB 2BD4A 5L30H 1JIRA 1O2XA 1Z6JH 1FY5A 1Y5UT 4DURA 3RM0H 4IMZA 4VGCB 1SLUB 1OWHA 1EP5A 1W8BH 1IHTH 3CP7A 5CE1A 1B5GH 1KXFA 3VB3A 1FV9A 2JH0D 1ZRKA 3KGPA 4YO9A 2BD5A 3RMMH 1JMOH 1PQ7A 1QNJA 2VJ1A 2BZ6H 2F3CE 1A5HA 2Z9GA 3PWCA 1NFUA 2NU3E 1V2ST 3RXBA 1TGBA 5CHAB 4MNVA 5DO4H 2UUJB 4YT6H 1F0SA 2AIQA 3KIDU 4FUDA 2VU8E 1Z1IA 4ABDA 2Y82A 1XUHA 1MZAA 1ANEA 2QXHA 3ZZ5A 2Z9JA 2OC0A 4ABGA 1HJ8A 3D65E 3QGJA 1VCPA 4UEHH 2FOEA 4Y7BA 1CBWC 1O37A 2FXRA 3T28A 2G51A 4THNH 4DIIH 4OS4A 4AFQA 1XUIA 2G81E 3VB7A 1VITH 5I25A 1K9OE 4Y8XA 5HMAA 5E0HA 1C1UH 1NRQH 1ETSH 1A7SA 2CMYA 3GCHC 4B2BA 5BRRE 3S69A 1H8DH 1O33A 3RLWH 1H4WA 2J4IA 1SFQB 1RFNA 5FBEA 4DJZB 1Y3VA 1HV7A 1JRSA 1S81A 1DY8A 3SGBE 1SVPA 1TGTA 2NU0E 3KQEA
chains in the Genus database with same CATH superfamily
2ODYB 1TNLA 2WPJS 5T6GA 2BX3A 1K21H 4BTIB 1OKXA 1AGJA 5K7RA 4K1TA 3A8CA 2NU4E 1W12U 1AUJA 1G32B 2ASUB 5DP7A 3AAUA 3SUEA 3UQVA 2TGTA 1D3QB 3HATH 1K28D 5AF9H 1NFWA 1GHAG 1OSSA 2VB0A 5T3HA 4B2CA 1G9IE 4A92A 3SNBA 4CRCA 1C1TA 2KZ4A 3SU3A 2FTLE 3T5FH 2ZCHP 1QJ7B 2F9VA 3A81A 1D6RA 2FOFA 1ABJH 2HWLB 1O2RA 1P12E 2ALVA 1SQOA 4A7IB 2XNDD 1X7AC 2HALA 3RMNH 1AE8H 3LGWA 2V3HH 1P57B 3U69H 3ZZ3A 1T8LA 1A5IA 1TX6A 3GDUA 1DE7H 2OBOA 1TGSZ 4Q2KA 3SUGA 2P93A 1AU8A 1EAUA 3M36A 2H9EH 1KLTA 3PMAB 1GJ6A 1CBWB 1HDTH 1LVYA 1P03A 5F8XA 5TCCA 1PQAA 1ELTA 4NIVA 2W7SA 4IS5A 3I29A 3SU5A 2PFEA 1FI8A 3SV2H 1K1LA 3Q3XA 1TPPA 5EXLA 2B8OH 4YOIA 3CNRA 4O03A 4RKOB 1QBNA 3RXQA 4CREA 3LH3A 1TABE 3ZZ4A 1W7GH 1TRMA 2RG3A 2J9NA 3TJUA 5EG4A 1KLIH 3H7OA 3L3TA 2ZU5A 1MAYA 2O8TA 1P2OA 1O2NA 2PKSC 2ZFTA 1G36A 4HFPB 3DFLA 5CDFE 1JXPA 4DG4A 1AVXA 1FY1A 4ISIH 4IW4E 1UTPA 1LHGH 1MTUA 1TRNA 2FS8A 3D49H 3WY8A 3F9FA 3CS0A 1ANCA 1EAXA 1GI8B 5HIZA 4ZCNA 3NUMA 3ITIA 1UK2A 5DJ7A 1AO5A 1D6WA 1MCVA 4TWWA 2Z3EA 3UTUH 3ZYDA 1HAVA 4DGJA 2VBCA 4NGAH 1CQQA 1QFKH 1MBQA 2BTCE 3QTOH 3M5NA 1A5GH 5LPFA 3ZZCA 2FI5E 2ZTXA 2O8LA 4R8TB 2R3UA 1NRSH 4D9RA 1ETTH 1YPMH 3B23B 4BXWA 1VGCB 1A1RA 3BIVH 2C4FH 3KHVA 1ABIH 1GCTB 1DWEH 1O2MA 1TNIA 3OYPA 5DP3A 3RU4T 5DP9A 2C3SA 1Y59T 2H5CA 2W6ID 3NCLA 4NZQA 2RFKC 1BTUA 1BTXA 1SQAA 2JJ2D 4WY3A 2JH5D 1DXWA 1O2SA 3P8GA 1CHOF 5KECA 1EFRD 2OK5A 2JDID 3CS7A 1HXFH 1N1LA 2QGRA 2GV6A 2PSYA 1OPHB 2ZDMA 2ILNA 2AGGX 1K0HA 3N7OA 1A0JA 4Y8ZA 2PKSB 2PKAA 2LP6A 3RP2A 1QCPA 1UK3A 1GMCF 5E2PA 3PLBA 4YLQH 3LH1A 2VGCC 1K1PA 3E90B 8LPRA 4Y0YE 1OP0A 3F9EA 1YPHE 3BG4B 2W3IA 1W10U 3VB4A 4FXGH 3TLOA 1COWD 1YY3A 1C2KA 3MNXA 1ZPBA 1O2HA 3LKWA 5T6DA 2Y7ZA 2D8WA 2J97A 3ATWA 2GCHF 4MPVA 2WPIS 4KTUA 1V2WT 1BCUH 2BVSH 2PR3A 1BBRE 3ZVFA 4NWKA 5FHTA 3I77A 1CHOG 2EI7A 4X1RU 1XX9A 1ZZZA 1CU1A 3LT3A 1QRZA 1TYNA 1PPBH 1FXYA 2UWPA 4HTCH 4A1VA 5DPAA 4U01A 2HNTF 4A6LA 3RXIA 3E16B 2PHBA 1UVPA 1GJAB 2FI4E 4D7FA 2WV5A 3P6ZB 4K69A 1KMHB 1C1OA 2UUKB 1G3BA 2AHME 4DOQA 2ZDVH 1Q2WA 4JZFH 5DKMA 1G2LA 1GMCG 1WBGB 2Z9KA 3A8BA 2JJ1D 3LPRA 2W7UA 4UFGH 1J14A 1FUJA 4E7NA 4YT7H 1C1SA 1Y3YA 5B6OA 2ZCLP 2VWLA 3BTFE 2NWNA 1ELEE 1O3EA 2FP7B 3MU1A 4CH2B 1RIWC 4A5TS 1C9PA 2CV3A 1SHYA 2GCHG 1MD8A 4H4FA 1HB0B 2V3MA 4M9FA 2GDEH 1FN8A 1P2IA 3RXCA 1LPKB 1H9IE 1W2KH 1FONA 1SGFG 2HNTC 4ZKOU 1CSOE 1TWXB 2Y80A 1S84A 2DE8A 3HGPA 3MI4A 1P2KA 4B73A 3K6ZA 1ZGIA 2RDEA 1C5XB 2QIQA 2J34A 3SUFA 1QHRB 1XM1A 4I8LA 1P2JA 1O34A 5C20A 2D1JA 3W95A 2KX4A 1CVWH 2DE9A 1BTHH 2WSSD 3M5LA 3KN2A 1O2WA 2OBQA 3SGAE 1CA8B 4JCNA 1EPTA 1WV7H 4ZUHA 2TGPZ 1GJ4H 3RXVA 1HFDA 1Z8IB 3SNDA 1Y8TA 3MNBA 1C5PA 3A80A 4AYVB 1YPJH 3TPIZ 4U32A 3OU0A 4TSFD 2TGAA 3M7QA 2FLBH 1DWDH 1GHVH 5BPEA 1E37B 1P3EA 3P8FA 1GL0E 1O3BA 1H8IH 2PP6A 1KLJH 1ZSKA 2XRCA 4I8JA 1THSH 1CT0E 2M5TA 4IMQA 4B71A 3SJOA 4OM9A 1LHEH 1J8AA 3M3SA 5F8TA 2CHAB 2Y81A 1RIWB 4GLYA 1SB1H 2CK3D 1SHHB 2FO9A 1GBFA 2Z9LA 1P8VC 3BF6H 3N7DA 2BDCA 1DFPA 1GBAA 2QF5A 1GVKB 1V2JT 1P04A 1A0HB 4O9VA 5JB9S 4D7GA 2BLQA 1AQ7A 3BTKE 4NG9H 1L4DA 4WMFA 1AVWA 2BLOA 2YMSC 3N99A 1GBHA 1TNHA 4U30A 2ODPA 4SGBE 1K1OA 1QRWA 3ZZ7A 3S9BA 1BRCE 4NFEA 5FL7D 4BAQB 1HAPH 1HAZB 1S85A 3L6PA 1C9TA 1G3EA 3A7YA 2J92A 2ZTYA 4HGCA 4Y11E 2B5TB 1QL9A 4TT3D 3GCOA 2FMJA 1ZMNA 6GCHF 3QK1A 1DANH 2OC8A 2BY5X 4WVPE 4ZHAA 3VXFH 4FUEA 2FOMB 3V0XA 4J1YA 3MU4A 1SOZA 3PLKA 4CRGA 3F68H 1F5LA 4IGDA 1FMGA 3KQBA 2TBSA 4UFEH 2HLCA 1T7CA 1CGIE 1NO9H 2SGEE 3K6YA 2B0FA 2BD8A 3ZVGA 1MKXK 2Z7FE 1O31A 2ANKH 1VZQH 2F9PA 1P10A 2VIWA 2ZGHA 2WV9A 1TFXA 1GJ7B 1OWKA 1ESAA 1V2OT 1KXBA 5DG6A 3ZVAA 1FAKH 5FAHA 5GPIB 1CT4E 1WSSH 1QA7A 2WPDD 1DM4B 4GCHF 1NRPH 5T6FA 1IQHA 1UTQA 1BMMH 5DP4A 1C5QA 4LZ4B 3V3MA 2YMSB 1O32A 2BOKA 3BG8A 2ZA5A 1KTTB 2GDDA 2GCTC 3F2GA 2L74A 2VWOA 3UWJH 2THFB 3RXDA 2V35A 2FOBA 3VPKA 1HAHH 2UUYA 1KDQB 3MO3A 4VGCC 3U8TH 4FUBA 4OGXA 1OYQA 2FODA 1EB2A 2R9PA 5EQQA 4B6FA 4NFFA 2ZI2H 1UMAH 1VR1H 1HAVB 4BAKB 1DVAH 2ZP0H 4OS5A 2QAAA 1CE5A 4RN6A 3SW2B 2I6QA 3MTYA 1SLWB 2QXIA 4DVAU 1FIWA 1NY22 1U6QA 4MDSA 4AFUA 1XKAC 3PM3A 3W1EA 4H6TA 2G52A 1GBTA 2ZG0H 1E34B 1YPKH 3AK5A 4AG1A 3VG8A 1WYKA 3PMBB 1O3LA 5CHAC 1BB0B 1HAXB 1CHGA 1UJ1A 1MTWA 3KF2A 1O3CA 1QURH 2CF8H 1ANBA 1TGNA 3A84A 1LPGB 1NRRH 2GD4B 2KAIB 3GCTF 2JH6D 1V2KT 5FPYA 3ZZDA 5C0UA 1AIXH 3M37A 4ISHH 4NSYA 1LCYA 3MH4A 1XUFA 1CA0C 1DY9A 1SGNE 1PQ5A 1V6DA 4ABFA 1V2LT 1W13U 2FOHA 4MPUA 4AG2A 5C1XA 1YM0A 2GCTB 2C8XB 3BIUH 3UY9A 2ZC9H 3P95A 1TB6H 1P11E 4AX9H 1QB1A 3RXHA 4A1XA 1HBTH 4J2YB 1MU6B 3IWMA 1P01A 4MNYA 1C5LH 1UCYE 1K1NA 1O5DH 3FP6E 4ESTE 1ZMJA 3NWUA 1EJMA 4IC5A 3ZZ6A 1LDTT 2OINA 3K9XB 1O2JA 4I7YH 1EJAA 3H5CB 3SNEA 3H09A 5EIYA 1VJ9U 2RA3A 3P70B 1D3DB 1K1MA 1QIXB 2GT7A 1DSTA 3MWIU 2GP9B 4IN1A 1BTWA 1W14U 4TPIZ 1J15A 2AS9A 1TAWA 1KXCA 1TMUH 1UCYH 2LPRA 1GMHF 4BTUB 1UTJA 2Y5HA 1TNJA 1V2UT 3NZIA 1ELBA 5A09A 1HIAA 5EPYA 5EW2H 5C67A 1OHHD 2Y5FA 1NRNH 1O39A 1O3DA 3M7TA 3MH6A 4CHAC 4ZKNU 1GHBF 4NA9H 2GMTB 3UIRA 2GJGA 1UVOA 2VVVA 2UUFB 3BTWE 2DUCA 2CJIA 3F9HA 2A5IA 3OY5U 4ZHMU 2SGPE 3STJA 1C2DA 1DDJA 1CA0B 1QR3E 3TK6A 3GY4A 4B74A 1NN6A 2ZDAH 2AGIX 1HJ9A 4FUIA 1SPJA 2ZTZA 2QA9E 2FIRH 1C5SA 1AZ8A 4UE7H 1S0RA 1GJCB 3KQCA 2BM2A 3LU9B 3UB0A 1ESBA 1LHCH 4AGKA 2ZWLH 1IQFA 1DPOA 2EI6A 1QA0A 3BTDE 3PO1B 1IQNA 4O3UA 1F5KU 2ZHDA 1GMHG 1XXFA 5GNDA 4Z1MD 1QZ8A 2XWBI 4K2YA 6CHAC 1BTPA 4U2WA 3RXGA 1G30B 1PPHE 1F5RA 3SYJA 4I32A 1SGFA 2XBWA 4I31A 2R3YA 4AFZA 1C5ZB 5HKKD 4HI3A 3G01A 1EPTB 2AIPA 6LPRA 2B7DH 2SGAA 3LGIA 2W26A 3N7EA 3LGTA 3PV4A 2VIVA 1QL7A 3PTNA 1SQTA 4TPYA 1T8OA 3F9GA 1O2GH 4MQAA 4CHAB 1H8ED 4FETA 5LGOA 4ABBA 2OUAA 4R0IA 3KEEA 5A8XA 1BJVA 1YKTA 1VCWA 1GCDA 1GWAA 1RTLA 4IC6A 1E0FD 1O2PA 1O5EH 2BYAX 3E6PH 1VGCC 1QGFA 2BD7A 3M3TA 1ZSJA 4TY7A 3PLPA 3BTGE 2IJD1 1AKSB 3U98H 1O3IA 1GCTC 2PLXA 1UVUH 3AAVA 2AFQB 1HXEH 2FX4A 1C1WH 5FBIA 5KEDA 5EODA 3ESTA 4ZXYH 3UQOA 2H9TH 2VIDA 2BVRH 2ZPSA 1C1PA 4GUXA 3KL6A 1ZJKA 2GV7A 1C5NH 3SU0A 1NS3A 5ETXA 2OP9A 3Q3KA 2BDGA 1ACBE 3PRBA 3R0FA 4A1TA 2STAE 4K1SA 3T62A 1O2KA 1T31A 2BDIA 2BLWA 4Q7YA 4X2XA 3ATIA 2VNTA 1OX1A 2QF4A 3FN8A 6CHAB 1NFXA 1G37A 2XOKD 4ZAEA 1Z8JB 1AVGH 1BBRK 3QZQA 1EKBB 2WPMS 3GYLB 3EQ0H 1AZZA 1M9UA 1OS8A 3U8RH 3PYHA 1D3TB 5JBBS 1GMDF 4Q80A 3VEQB 3FVFB 1EXFA 3BG4C 1HJAC 3MH5A 3F2FA 5F6MA 3SV9A 5JYIA 1CGJE 2IJOB 1IAUA 1SI5H 1UO6A 4Y8YA 4RI0A 1D3PB 5J4SA 5F03A 1DWBH 5JDUB 2BD3A 3S0NA 3TU7H 2VIOA 1V2NT 2P3UB 5IYTA 1O2IA 4ABJA 3A83A 1O3GA 2QF0A 3MNCA 1DS2E 3QLPH 1ZPZA 3TNTA 2Z94A 5C1UA 2GGVB 5C5OA 3U8OH 3SQHE 2F9UA 3A82A 1PPCE 4K60A 8KME2 3OEED 1W0JD 1AY6H 4FUFA 1ZPCA 1O38A 2OCVB 2QY0B 3V13A 1AMHA 4NA7A 2J98B 5FCRA 1BRUP 1Z8RA 2ZHEH 1DICA 1KXDA 2A7HA 4FU9A 1LKBA 1Z1JA 1LQEA 3RC4A 2UWOA 2ZQ2A 5ESBA 1IQLA 1O2LA 5L6NH 1TX7A 4IN2A 3FAOA 5PTPA 3A7WA 1Y5BT 1AI8H 4AB8A 1AFQC 4MVNA 3SU4A 5EJ1A 1AWFH 4BAOB 4UONA 2ZKSA 1EASA 2CN0H 2FM2A 2ZO3H 2AMDA 1BQYA 1QB6A 4CRAA 1V2MT 3FOAA 1GI6A 1Y3WA 3SNAA 2FI3E 3MU0A 3ZZ9A 2J38A 2QV1A 1NZQH 1MH0A 3OSYA 1XVOA 1FLEE 1C2EA 4DCDA 7LPRA 1YC0A 4X1QU 1W3CA 1IHSH 3GISB 5HIYA 5GIBA 3RXFA 1BOQA 2CF9H 1EZUC 1BZXE 1P3CA 4DW2U 2NU2E 2KCPA 1HJAB 2WPKS 1O3KA 1VJAU 1TE0A 4YOGA 2ANYA 3ZZ8A 3B9FH 1C2LA 1ZR0A 3BTQE 4MNWA 1YGCH 1SGEE 2W5EA 1GI3A 3MQKC 1IQEA 1FQ3A 5T1VA 3Q3YA 2HOBA 1EZQA 3VB6A 4X2WA 1B7XB 1UHBA 1BMNH 3MO6A 4AZ2B 1BRAA 1TNGA 4FUGA 1FPCH 4FUHA 1O2TA 4E05H 2BZAA 1YWUA 4B6EA 1LKAA 1PPEE 1TA6A 3HKJB 2CXVA 1S6HA 1V2VT 4LOYH 2BDHA 1GBCA 1WTGH 3EA8A 3ELAH 5E0GA 1E79D 1SGTA 3P17H 3TGIE 2ZHWH 4AGJA 1DWCH 4KGAA 4DY7B 4FU8A 5EW1H 1XUJA 3T26A 3A7VA 1EATA 1ZOMA 5GWZA 3QO6A 4X1PU 4NIXA 1V2PT 2ZDNA 2BY6X 3A8DA 1OOKB 2JKHA 1FDPA 3ZIAD 1AFQB 1ZMLA 3EE7A 5FPSA 1IQJA 2GZ7A 2P8OC 3STIA 2QF3A 4DT4A 4K3JA 2CHAC 2ZU1A 3SV8A 2ANWA 3WW7A 8ESTE 2EA3A 3ENSB 2BDYA 2C93B 1Z7KA 5ABWA 1SG8B 3RXAA 4ABAA 3K65B 2PTCE 4NWLA 1FNIA 3SOSA 1ARCA 2GZ8A 2ZU3A 4CH8B 3SORA 1Y3UA 5A8ZA 1ZLRA 4YM9A 2ZHFH 4YESB 3AASA 1ETRH 2R0KA 3TNSA 4F4OC 1UTNA 1MKWK 4INHA 3MMGA 2G4TA 4Y0ZE 1O2ZA 2AMQA 2EC9H 2HPPH 1MCTA 3U28C 3HGNA 2AH4X 2A4GA 1W7XH 1O3PB 1EP6A 1EUFA 1YCPK 4X0WU 3W94A 1GL1A 4YTAA 4TYDA 4CBOA 1O3OA 3RDZA 2G8TA 1GJDB 1WDIA 1THPB 3E8LA 4BAMB 4O3TA 9LPRA 3Q77A 5DP5A 3NXPA 1XUKA 1C1NA 3ZV8A 1D9IA 1C5MD 4RT1A 3F6UH 2FLRH 3LJJA 4P00A 2PUXB 3SV6A 5F8ZA 1BA8B 3PV5A 4WJG2 3RXUA 4NSVA 4QT8C 3A89A 2TRMA 3U1JB 2FYQA 2XWAA 1SGCA 4JMYA 1NU7B 1C5VA 1T4UH 1K1JA 1AWHB 4YZUA 2VINA 4I8KA 4KTSA 3RXSA 1FJSA 1GDUA 1CT2E 2J5UA 4X2VA 1ID5H 3BTTE 2P8OB 3QN7A 2FPZA 1J9CH 3FO8D 4OS7A 3TJNA 1GI0A 4I8GA 3M5OA 4NZLA 1GI7B 3RC6A 1K2I1 1RRKA 2FESH 2ZGJA 2ZU4A 3ZVDA 5HYOA 1SGPE 4P02A 1OYTH 3JZ2B 4MNXA 3RXRA 2A0QB 3IITA 1MBMA 4Y7AA 1H9HE 1HAGE 1P2NA 1BIOA 1DUEA 5EQRA 1JIMA 5EXNA 3NRLA 3SJ9A 1C4Y2 3SZNA 3S7HB 2H6MA 5DK1A 5LH8A 2Y7XA 3PRDA 2PW8H 4KELA 4LK4A 1UTMA 2JIZD 1LVMA 4X2YA 2A2XH 3BTHE 5A2MH 4I8HA 1GHWH 2OXSA 2ZGCA 3GYMA 4MPWA 1EOJA 4KTCA 2WINI 3UUZA 2FYRA 4UD9H 3PROA 2B9LA 1GI5A 4WWYA 1PPGE 1TGCA 3URDA 1ELGA 2WYGA 2HGTH 1QJ1B 4NIWA 1O0DH 1W0KD 1PYTC 2KM0A 4RT0A 1P05A 4OS1A 2J2UA 1W11U 1ZHPA 2W6JD 1O2UA 3LIWA 2ZPQA 4XE4A 2XBVA 1RJXB 6ESTA 2OC7A 1ELVA 1YBWA 2RDLA 2ZNKH 3TITA 2FOCA 1OWIA 2HRVA 5B6LA 2XNIA 5G4BA 1G2MA 1AD8H 1WAYB 1ARBA 2H5DA 2XCFA 4INKA 1TLDA 2ZQ1A 3UNQA 4YXWD 1S6LA 1YPHC 1F7ZA 1UCYK 3GY2A 3LC3A 1NBMD 1S0QA 1FIZA 5L2ZH 1GVZA 1QQ4A 5FCKA 4ACAA 3RC5A 1WCZA 3ODFA 3UNRA 3A85A 1LVBA 6GCHG 4MG3A 4BTTB 1NROH 1SGIB 1WUNH 1P9SA 1LHDH 5SGAE 5EU8A 1HRTH 5C94A 1UTOA 4HG6A 2FTMA 3ZV9A 1O3AA 1YP9A 3UWIA 3BEIB 4BOHA 1AB9B 3TH4H 3PMHB 5JPMH 3SN8A 3OEHD 1SKYE 1GDQA 2AMPA 1N6XA 3EGKH 3PTBA 3UOUA 4OS2A 2HPQH 1SGRE 4AOQA 2KFWA 3QX5H 1DUAA 3B8JA 3TGJE 3HKIB 3TIUA 5EJLA 3GDSA 2CGAA 3QDZB 2ZFSA 3O8CA 4MTBA 1F92A 3P8OA 2O9QA 1F2SE 5L2YH 1A2CH 3KYFA 3ZVCA 3GY8A 4GCHG 5DN6D 1GJ9B 2V6NA 1AUTC 1ELFA 4UFFH 1C5UA 4WMDA 2IOTA 1XKBC 1AN1E 4WH6A 1HCGA 4INLA 5K0HA 3E0PB 3E0NB 3RMLH 2J95A 2QN5T 3WWBA 4DIHH 1O2OA 1NBME 1KY9A 2GMTC 4JZEH 3NK8A 2FX6A 1V2RT 4B2AA 1W0ZU 1EQ9A 1EZSC 3F0PA 1ESTA 4TWYA 4CR9A 4UDWH 1DLKB 2ZFQH 2ZGXH 1SGQE 1DLEA 1HAIH 4CRFA 1L1NA 1T32A 1LQDB 2ZHQH 3T29A 2A7JA 2G5NA 3S9CA 4JZDH 4YLUA 2PKAB 3T25A 3QWCH 1MZDA 2RA0A 1ZRBA 2WUCA 3MU5A 3MOCA 2JETC 2R2WU 3PO1C 3T27A 1BITA 5H4IB 1GBBA 1E38B 1UVTH 4XFQA 3RXLA 3CENA 3SU2A 4H6SB 4RSPA 2OTVA 3P8NA 3MHWU 2TGDA 1ELCA 3SV7A 1GBLA 1V2QT 4Q7ZA 3TH2H 2J94A 1P2MA 2G55A 2G00A 3GOVB 1GDNA 2VVCA 2XC4A 3GCTG 1EPTC 1FY8E 2EEKA 2A31A 4H42U 1QJ6B 2WV4A 3RXEA 4CBNA 1UK4A 3QGNB 4ZKRU 1C2FA 2P95A 1A3EH 4YOJA 1RS0A 1MKXH 3SHCH 1NPMA 3BTEE 4XBDA 5EPNA 3TJVA 3GY7A 5DP8A 2C90B 1IQIA 1YLDA 1TBRH 2BVXH 1RXPA 1VCQA 1RD3B 4ABEA 2XCNA 2ZPRA 4K5ZA 2QXGA 1MU8B 2WPLS 3LDXH 5DGJA 4D9QA 3DT0H 1A4WH 3SU6A 2FOGA 1S5SA 1YLNA 1JRTA 4SGAE 4GHQA 3M7UA 2PV9B 3SI3H 2IN2A 1TBZH 3SQEE 1O36A 1GI1A 1RTKA 1ZGVA 3RXPA 1IOEA 2BD9A 2F91A 4Z6AH 3F2HA 4FUCA 3KQDA 1O3HA 3IG6B 2JETB 2O8UA 3ZYEA 2HVXA 3ZZAA 4AB9A 4Y6DA 5AHGH 1EX3A 3DSGA 5C3NA 1TX8A 3SNCA 1C1VH 1GHAF 3UR9A 1IQMA 4OS6A 3BN9A 3KQ5A 4XOJA 1DX5M 2YNBA 3E3TA 3K2UA 1GHBG 4X6PA 2OQ5A 1AFEH 2D2DA 3MNSA 4B75A 1JWTA 2A4RA 2PUQH 2Q1JA 2EY4C 4FVDA 4XBBA 2F9OA 5A0CA 1O5CB 1BT7A 1PPZA 3QTVH 5F53A 1SSXA 5C5NA 2BXTH 4JYUH 1LO6A 3A87A 4WF8A 1MMJN 4WH8A 1GHYH 4ZKSU 1ZYOA 1QBVH 4X8UH 2R0LA 3Q76A 2O8MA 2A2QH 1BTZA 1C2GA 1XMNB 3LONA 1YLCA 4Y10E 2UWLA 3A88A 4F48B 1S82A 1VKYA 1ZHMA 1ZHRA 2HNTE 1SOTA 7ESTE 2OQUA 3O8DA 4B1TA 3FP8E 1GI4A 3O8BA 5I46H 3KNXA 5GXPA 1E35B 2BDAA 1MQ5A 1O2QA 2BY9X 4FUJA 4FU7A 1MTNC 2ZECA 1H1BA 2WPHS 2D26C 2KCAA 5GDSH 2YMSD 1HNEE 1C4U2 3C27B 3VGCC 1QB9A 1Y5AT 1L4ZA 1O5BB 3FKSD 1PQ8A 4OGYA 2SGFE 3OY6U 2WUBA 3F3BA 3O8RA 1O5AB 3D62A 3BEUA 3FZZA 2AERH 3OAAD 2BY8X 3NKKA 3DSPA 3RXKA 2G4UA 3M3VA 5IDKA 1FX0B 2A1DB 4X6MA 2A4OA 3FFGA 3GCHB 1S83A 1GGDC 3C1KA 4AORA 1IQGA 1E1QD 1GJBB 4BANB 5AFYH 4ASHA 2PTNA 5DSFA 3VB5A 2F4LA 2SGDE 3GICB 1BTYA 1PYTD 2OC1A 5KGOA 2OD3B 2PSXA 3ZZBA 1TRYA 3TGKE 1TNKA 4BAHB 3RU4D 1P0SH 2TPIZ 4ISOA 2WZQA 2PGQB 2XXLA 1KDQA 3ATMA 4I86A 1OWEA 3TJOA 1MTVA 4XRNA 4AC9A 4DT7B 4KP0A 3M35A 1W0YH 3HK6B 4MPXA 1F0RA 2F9BH 2KR7A 3E91A 4XSKU 4JYVH 5JBTA 5E2OA 4ZROA 4AFSA 1OWDA 2VH0A 5EXMA 1MTNB 1EB1H 4AN7A 2A5AA 2IPHA 3GS9A 1NTPA 1VITF 3DFJA 3PB1E 2P3FH 3OFND 1GMDG 4X1SU 3RXMA 5A0BA 1L2EA 4NIYA 3EDXB 2F9NA 3VGCB 1SGDE 1SR5C 2XC5A 4X1NU 3F1SB 1QRXA 1TQ0B 1UW7A 3RXTA 2STBE 2FWWA 2VWNA 4XBCA 3TH3H 2FZZA 2Z3CA 1E36B 2P59A 2QCYA 3A86A 3ATKA 4JYTA 1RGQA 2EI8A 3MH7A 2KCOA 4FVBA 1EZXC 1GG6C 5C1YA 3AVZA 1LMWB 1Q31A 1NU9A 3TK9A 2XC0A 4WXVA 2Y5GA 1OXGA 1PFXC 3JZ1B 1OWJA 1TOMH 1J16A 5DP6A 2KAIA 4X8TH 3SHAH 2P94A 1GGDB 1GBIA 1TPSA 1C1RA 1EAWA 5TJXA 1K1IA 3SJ8A 4M7GA 3ATLA 4IBLH 2ZU2A 2BXUH 4Q63A 3RU4E 5JB8S 4X6NA 1WQVH 3RMOH 1C5OH 1N8OC 1DOJA 1BJUA 1KTSB 3UFAA 2ALPA 1VITG 2XYAA 2ZEBA 2G5VA 4LZ1H 2GX4A 1C2HA 2Q6DA 5AVDA 3R3GB 2ODQA 1DSUA 2FS9A 2SFAA 2W3KA 9ESTA 5C2ZA 1P06A 2Z9IA 1LTOA 2FOAA 2Z3DA 3MYWA 4Z0KA 2BQ7B 4CR5A 3GCNA 4BNRA 5JBCS 4F49A 4Q7XA 2H9HA 1GBJA 4D8NA 3DD2H 3ZVBA 1H8HD 2VVUA 5LPRA 2Q6FA 4PROA 1P2QA 1CGHA 2P16A 2BHGA 1T8NA 2RCEA 3QZRA 3RXOA 3OTJE 1TPOA 4B76A 1NFYA 2PWXA 1UVSH 1BDAA 1SBWA 7KMEH 4RKJB 1K22H 1C5YB 1LVOA 1FPHH 1O3MA 4BXSA 2XBXA 4GAWA 4F55A 5J4QA 1C5RA 1C2MA 3NPSA 5LPEA 2OLGA 1YPGH 2VIPA 2Z6BD 1QTFA 3HPTB 1OP2A 1GG6B 1SMFE 2HVYB 1BBRH 1PPFE 1A0LA 1E1RD 1DITH 1JOUB 2GVFA 1AE5A 1PJPA 2ZGBH 1GBKA 5A0AE 1QL8A 3DUXH 1F0UA 3GY5A 4ABHA 4HZHA 1T8MA 1ZJDA 1XVMA 2QYIA 2A32A 1O3FA 1LHFH 2BOHB 1SL3A 3LGVA 1F0TA 2H2ZA 2WHXA 4D76A 3M5MA 3BEFB 3WWFA 1BMLA 3EAJA 2XTTB 5A8YA 3OX7U 1N8OB 2PGBB 3E1XB 1HYLA 1KXAA 1TOCB 4I33A 2XBYA 4CRDA 5JBAS 2QXJA 1L0ZA 4CRBA 1TPAE 3RLYH 2VGCB 5E8EH 5FX6A 3A7XA 2ULLA 2ZFRH 1MQ6A 3URCA 1HLTH 1SLVB 2Q6GA 1C2IA 1HIAB 3L33A 2BMGB 3KCGH 1HAOH 1EJNA 1O35A 4JK6A 3LGYA 3OTPA 1ZTKA 5HM9A 5CMXH 1Z6EA 4GVUA 4X6OA 3VXEH 2ZIQH 5EGMA 2XW9A 2ZCKP 4Q4LA 1O2YA 5CHBA 5EJZA 1ANDA 1MD7A 2ZFPH 5EOKA 4ACBA 2QE7D 3PV2A 7GCHF 1UTKA 2P3TB 2YNAA 5EQSA 1H9LB 3AW1A 1QBOA 5HGGA 1XUGA 1NT1A 1BHXF 4X8VH 1SC8U 2V0BA 4ZH8A 1ZTLA 3RXJA 1MTSA 3LOXA 2ZFFH 1KXEA 5FPTA 1WXRA 3LC5A 3MO9A 2AYWA 4JK5A 1TBQH 1CO7E 4WXIA 1EAIA 4GSOA 3DSOA 1AHTH 4KKDA 1HUTH 1YF4A 1C2JA 1HAYB 3SBKA 4FOUC 1YPLH 2VH6A 2BLVA 3H7TA 5FX5A 4Y71A 2NU1E 5HXFA 3RUOA 1TMBH 1QQUA 3BTME 4K8BA 4MLFB 3P92A 1TONA 4ZXXH 1KIGH 1P9UA 2VIQA 1AKSA 4E7RG 2VWMA 1C1QA 1ELDE 1GI2A 1TA2A 3I78A 3PMJA 2QC2A 1O3NA 2SGQE 3KYGA 1J17T 1RTFB 1Z8GA 1THRH 5C17A 1MAXA 7GCHG 1AB9C 4ISLA 4ZMAH 3MFJA 3Q00A 1B0FA 3S9AA 1NC6A 3FZDA 1KSNA 1O30A 2V3OH 1MABB 8GCHF 2GT8A 1UTLM 1GI9B 5AFZH 2A45B 3FP7E 1SGYE 5C0TA 3SUDA 2R2MB 1FY4A 1HGTH 1SLXB 3BV9B 5HM2A 1DT2A 1SFIA 2BDBA 3AW0A 2C8WB 1BRBE 1V2TT 2ZDLA 1BUIA 2SNVA 1HPGA 1SQRA 1JBUH 5GJ4B 3A7TA 1DXPA 1GBEA 4E06H 1BMAA 4UFDH 1TMTH 4ZHLU 1NESE 3GY3A 1GBDA 3HK3B 2F83A 3LJOA 2TIOA 3A8AA 1EOLA 1BMFD 3UR6A 2SNWA 1FAXA 2ZZUH 1INCA 5ESTE 1KYNA 2GTBA 5IK2D 1OP8A 3S7KB 3SJIA 1WTHD 2V7QD 2J98A 3TVJB 4ISNA 3A7ZA 1LPZB 1MKWH 1Z71A 1FZZA 3EA7A 3RM2H 8GCHG 4X8SH 1L1JA 1GHXH 4GPGA 4TY6A 3VFEA 3SU1A 3UOPA 2BD2A 2M2AA 1ELAA 4K1EA 2LNCA 3ZVEA 3SGQE 2ESTE 1YCPH 2FEQH 5TCAA 3V7TA 3SO3A 1BHXB 1P02A 3SJKA 4NCYA 2A5KA 3UPEA 3PWBA 1IQKA 1ORFA 2F43B 3ODDA 2AEIH 4GHTA 4NA8A 2A4QA 3DHKH 3OE7D 1YPEH 3EA9A 1B0EA 4XD7D 1FN6A 2A7CA 3GDVA 1WU1A 3D23A 3V12A 2BB4A 2GZ9A 3UREA 4O97A 1MUEB 1O3JA 2BX4A 1YYY1 4K8YA 3BSQA 1V3XA 1TIOA 2ZDKA 1YCPM 4JZIA 2GKVE 3M61U 4Y76A 1TALA 1NM6A 4WMEA 3UAIC 4ASUD 5GCHF 1GVLA 3U9AH 1A61H 1GJ8B 1G3DA 2ZF0H 1Q3XA 2ANMH 2C8YB 2Y6TA 4Y79A 4AYYB 3U1IB 2EQNA 1O5FH 1GBMA 1GJ5H 1FY3A 1P09A 1C1MA 4LXBH 2WYJA 4JZ1A 1O2VA 3MU8A 1Y3XA 2BY7X 1GPZA 1ZSLA 3DA9B 3EE0B 2YOLA 3FANA 2AGEX 2I6SA 1L1GA 3GY6A 2FDAA 1D4PB 1S6FA 1QY6A 1N6YA 1TQ7B 2K1QA 3T2NA 1WOFA 3QUMP 1O5GH 1C4V2 3EYDA 3TK5A 4XDEA 1C5WB 4ABIA 2O8WA 1A46H 2H1UA 2IPQX 2LELA 3UNSA 1ZTJA 1XXDA 2C8ZB 1A3BH 5E0JA 1C5TA 5FXLA 1G3CA 3LGUA 1T4VH 2BQ6B 3SI4H 2BQWB 1WQSA 5GCHG 3F0OA 1GHZA 1UHBB 2BD4A 5L30H 1JIRA 1O2XA 1Z6JH 1FY5A 1Y5UT 4DURA 3RM0H 4IMZA 4VGCB 1SLUB 1OWHA 1EP5A 1W8BH 1IHTH 3CP7A 2K0QA 5CE1A 1B5GH 1KXFA 3VB3A 1FV9A 2JH0D 1ZRKA 3KGPA 4YO9A 2BD5A 3RMMH 1JMOH 1PQ7A 1QNJA 2VJ1A 3SZEA 2BZ6H 2F3CE 1A5HA 2K8IA 2Z9GA 3PWCA 1NFUA 2NU3E 1V2ST 3RXBA 1TGBA 3DCLA 5CHAB 2KCYA 4MNVA 5DO4H 2UUJB 4YT6H 1F0SA 2AIQA 2HLDD 3KIDU 4FUDA 2VU8E 1Z1IA 4ABDA 2Y82A 1XUHA 1MZAA 1ANEA 2QXHA 3ZZ5A 2Z9JA 2OC0A 4ABGA 1HJ8A 3D65E 3QGJA 1VCPA 4UEHH 2FOEA 4Y7BA 1CBWC 1O37A 2FXRA 3T28A 2G51A 4THNH 4DIIH 4OS4A 4AFQA 1XUIA 2G81E 3VB7A 1VITH 5I25A 1K9OE 4Y8XA 5HMAA 5E0HA 1C1UH 1NRQH 1ETSH 1A7SA 2CMYA 3GCHC 4B2BA 5BRRE 2L6OA 3S69A 1H8DH 1O33A 3RLWH 1H4WA 2J4IA 1SFQB 1RFNA 5FBEA 4DJZB 1Y3VA 1HV7A 1JRSA 1S81A 1DY8A 3SGBE 1SVPA 1TGTA 2NU0E 3KQEA
chains in the Genus database with same CATH topology
2ODYB 1TNLA 2WPJS 5T6GA 2BX3A 1K21H 4BTIB 1OKXA 1AGJA 5K7RA 4K1TA 3A8CA 2NU4E 1W12U 1AUJA 1G32B 2ASUB 5DP7A 3AAUA 3SUEA 3UQVA 2TGTA 1D3QB 3HATH 1K28D 5AF9H 1NFWA 1GHAG 1OSSA 2VB0A 5T3HA 4B2CA 1G9IE 4A92A 3SNBA 4CRCA 1C1TA 3SU3A 2FTLE 3T5FH 2ZCHP 1QJ7B 2F9VA 3A81A 1D6RA 2FOFA 1ABJH 2HWLB 1O2RA 1P12E 2ALVA 1SQOA 4A7IB 3RMNH 1X7AC 2HALA 1AE8H 3LGWA 2V3HH 1P57B 3U69H 3ZZ3A 1T8LA 1A5IA 1TX6A 3GDUA 1DE7H 2OBOA 1TGSZ 4Q2KA 3SUGA 2P93A 1AU8A 1EAUA 3M36A 2H9EH 1KLTA 3PMAB 1GJ6A 1CBWB 1HDTH 1LVYA 1P03A 5F8XA 5TCCA 1PQAA 1ELTA 4NIVA 2W7SA 4IS5A 3I29A 3SU5A 2PFEA 1FI8A 3SV2H 1K1LA 3Q3XA 1TPPA 5EXLA 2B8OH 4YOIA 4O03A 4RKOB 1QBNA 3RXQA 4CREA 3LH3A 1TABE 3ZZ4A 1W7GH 1TRMA 2RG3A 2J9NA 3TJUA 5EG4A 1KLIH 3H7OA 3L3TA 2ZU5A 1MAYA 2O8TA 1P2OA 1O2NA 2PKSC 2ZFTA 1G36A 4HFPB 3DFLA 1JXPA 4DG4A 1AVXA 1FY1A 4ISIH 4IW4E 1UTPA 1LHGH 1MTUA 1TRNA 2FS8A 3D49H 3WY8A 3F9FA 3CS0A 1ANCA 1EAXA 1GI8B 3NUMA 3ITIA 1UK2A 5DJ7A 1AO5A 1D6WA 1MCVA 4TWWA 2Z3EA 3UTUH 3ZYDA 1HAVA 4DGJA 4NGAH 1CQQA 1QFKH 1MBQA 2BTCE 3QTOH 3M5NA 1A5GH 5LPFA 3ZZCA 2FI5E 2ZTXA 2O8LA 4R8TB 2R3UA 1NRSH 4D9RA 1ETTH 1YPMH 3B23B 4BXWA 1VGCB 1A1RA 3BIVH 2C4FH 3KHVA 1ABIH 1GCTB 1DWEH 1O2MA 1TNIA 3OYPA 5DP3A 3RU4T 5DP9A 2C3SA 1Y59T 2H5CA 3NCLA 4NZQA 1BTUA 1BTXA 1SQAA 4WY3A 2JH5D 1DXWA 1O2SA 3P8GA 1CHOF 3CS7A 1HXFH 1N1LA 2QGRA 2GV6A 2PSYA 1OPHB 2ZDMA 2ILNA 2AGGX 3N7OA 1A0JA 4Y8ZA 2PKSB 2PKAA 3RP2A 1QCPA 1UK3A 1GMCF 5E2PA 3PLBA 4YLQH 3LH1A 2VGCC 1K1PA 3E90B 8LPRA 4Y0YE 1OP0A 3F9EA 1YPHE 3BG4B 2W3IA 1W10U 3VB4A 4FXGH 3TLOA 1C2KA 3MNXA 1ZPBA 1O2HA 3LKWA 5T6DA 2Y7ZA 2D8WA 3ATWA 2GCHF 4MPVA 2WPIS 4KTUA 1V2WT 1BCUH 2BVSH 2PR3A 1BBRE 3ZVFA 4NWKA 5FHTA 3I77A 1CHOG 2EI7A 4X1RU 1XX9A 1ZZZA 1CU1A 3LT3A 1QRZA 1TYNA 1PPBH 1FXYA 2UWPA 4HTCH 4A1VA 5DPAA 4U01A 2HNTF 4A6LA 3RXIA 3E16B 2PHBA 1UVPA 1GJAB 2FI4E 4D7FA 2WV5A 3P6ZB 4K69A 2UUKB 1C1OA 1G3BA 4DOQA 2ZDVH 1Q2WA 4JZFH 5DKMA 1G2LA 1GMCG 1WBGB 2Z9KA 3A8BA 3LPRA 2W7UA 4UFGH 1J14A 1FUJA 4E7NA 4YT7H 1C1SA 1Y3YA 5B6OA 2ZCLP 2VWLA 3BTFE 2NWNA 1ELEE 1O3EA 2FP7B 3MU1A 4CH2B 1RIWC 4A5TS 1C9PA 2CV3A 1SHYA 2GCHG 1MD8A 4H4FA 1HB0B 2GDEH 1FN8A 1P2IA 3RXCA 1LPKB 1H9IE 1W2KH 1FONA 1SGFG 2HNTC 4ZKOU 1CSOE 1TWXB 2Y80A 1S84A 2DE8A 3HGPA 3MI4A 1P2KA 4B73A 3K6ZA 1ZGIA 1C5XB 2QIQA 2J34A 3SUFA 1QHRB 1XM1A 4I8LA 1P2JA 1O34A 5C20A 2D1JA 3W95A 1CVWH 2DE9A 1BTHH 3M5LA 3KN2A 1O2WA 2OBQA 3SGAE 1CA8B 4JCNA 1EPTA 1WV7H 4ZUHA 2TGPZ 1GJ4H 3RXVA 1HFDA 1Z8IB 3SNDA 1Y8TA 3MNBA 1C5PA 3A80A 4AYVB 1YPJH 3TPIZ 4U32A 3OU0A 2TGAA 3M7QA 2FLBH 1DWDH 1GHVH 5BPEA 1E37B 1P3EA 3P8FA 1GL0E 1O3BA 1H8IH 1KLJH 1ZSKA 2XRCA 4I8JA 1THSH 1CT0E 2M5TA 4IMQA 4B71A 3SJOA 1LHEH 1J8AA 3M3SA 5F8TA 2CHAB 2Y81A 1RIWB 4GLYA 1SB1H 1SHHB 2FO9A 1GBFA 2Z9LA 1P8VC 3BF6H 2BDCA 1DFPA 1GBAA 1GVKB 1V2JT 1P04A 1A0HB 4O9VA 5JB9S 4D7GA 2BLQA 1AQ7A 3BTKE 4NG9H 1L4DA 4WMFA 1AVWA 2BLOA 1GBHA 1TNHA 4U30A 2ODPA 4SGBE 1K1OA 1QRWA 3ZZ7A 3S9BA 1BRCE 4NFEA 4BAQB 1HAPH 1HAZB 1S85A 3L6PA 1C9TA 1G3EA 3A7YA 2J92A 2ZTYA 4HGCA 4Y11E 2B5TB 1QL9A 3GCOA 2FMJA 1ZMNA 6GCHF 3QK1A 1DANH 2OC8A 2BY5X 4WVPE 4ZHAA 3VXFH 4FUEA 2FOMB 3V0XA 4J1YA 3MU4A 1SOZA 3PLKA 4CRGA 3F68H 1F5LA 4IGDA 1FMGA 3KQBA 2TBSA 4UFEH 2HLCA 1T7CA 1CGIE 1NO9H 2SGEE 3K6YA 2B0FA 2BD8A 3ZVGA 1MKXK 2Z7FE 1O31A 2ANKH 1VZQH 2F9PA 1P10A 2VIWA 2ZGHA 1TFXA 1GJ7B 1OWKA 1ESAA 1V2OT 1KXBA 5DG6A 3ZVAA 1FAKH 5FAHA 5GPIB 1CT4E 1WSSH 1QA7A 1DM4B 4GCHF 1NRPH 5T6FA 1IQHA 1UTQA 1BMMH 5DP4A 1C5QA 4LZ4B 3V3MA 1O32A 2BOKA 3BG8A 2ZA5A 1KTTB 2GDDA 2GCTC 2VWOA 3UWJH 2THFB 3RXDA 2V35A 2FOBA 3VPKA 1HAHH 2UUYA 1KDQB 3MO3A 4VGCC 3U8TH 4FUBA 4OGXA 1OYQA 2FODA 1EB2A 2R9PA 5EQQA 4NFFA 2ZI2H 1UMAH 1VR1H 1HAVB 4BAKB 1DVAH 2ZP0H 4OS5A 2QAAA 1CE5A 4RN6A 3SW2B 2I6QA 3MTYA 1SLWB 2QXIA 4DVAU 1FIWA 1NY22 1U6QA 4MDSA 4AFUA 1XKAC 3PM3A 4H6TA 2G52A 1GBTA 2ZG0H 1E34B 1YPKH 4AG1A 1WYKA 3PMBB 1O3LA 5CHAC 1BB0B 1HAXB 1CHGA 1UJ1A 1MTWA 3KF2A 1O3CA 1QURH 2CF8H 1ANBA 1TGNA 3A84A 1LPGB 1NRRH 2GD4B 2KAIB 3GCTF 2JH6D 1V2KT 5FPYA 3ZZDA 1AIXH 3M37A 4ISHH 4NSYA 1LCYA 3MH4A 1XUFA 1CA0C 1DY9A 1SGNE 1PQ5A 1V6DA 4ABFA 1V2LT 1W13U 2FOHA 4MPUA 4AG2A 5C1XA 1YM0A 2GCTB 2C8XB 3BIUH 3UY9A 2ZC9H 3P95A 1TB6H 1P11E 4AX9H 1QB1A 3RXHA 4A1XA 1HBTH 4J2YB 1MU6B 3IWMA 1P01A 4MNYA 1C5LH 1UCYE 1K1NA 1O5DH 3FP6E 4ESTE 1ZMJA 3NWUA 1EJMA 4IC5A 3ZZ6A 1LDTT 2OINA 3K9XB 1O2JA 4I7YH 1EJAA 3H5CB 3SNEA 1VJ9U 2RA3A 3P70B 1D3DB 1K1MA 1QIXB 2GT7A 1DSTA 3MWIU 2GP9B 4IN1A 1BTWA 1W14U 4TPIZ 1J15A 2AS9A 1TAWA 1KXCA 1TMUH 1UCYH 2LPRA 1GMHF 4BTUB 1UTJA 2Y5HA 1TNJA 1V2UT 3NZIA 1ELBA 5A09A 1HIAA 5EPYA 5EW2H 5C67A 2Y5FA 1NRNH 1O39A 1O3DA 3M7TA 3MH6A 4CHAC 4ZKNU 1GHBF 4NA9H 2GMTB 3UIRA 1UVOA 2VVVA 2UUFB 3BTWE 2DUCA 2CJIA 3F9HA 2A5IA 3OY5U 4ZHMU 2SGPE 3STJA 1C2DA 1DDJA 1CA0B 1QR3E 3TK6A 3GY4A 4B74A 1NN6A 2ZDAH 2AGIX 1HJ9A 4FUIA 1SPJA 2ZTZA 2QA9E 2FIRH 1C5SA 1AZ8A 4UE7H 1S0RA 1GJCB 3KQCA 2BM2A 3LU9B 1ESBA 1LHCH 4AGKA 2ZWLH 1IQFA 1DPOA 2EI6A 1QA0A 3BTDE 3PO1B 1IQNA 4O3UA 1F5KU 2ZHDA 1GMHG 1XXFA 2XWBI 4K2YA 6CHAC 1BTPA 4U2WA 3RXGA 1G30B 1PPHE 1F5RA 4I32A 1SGFA 2XBWA 4I31A 2R3YA 4AFZA 1C5ZB 4HI3A 3G01A 1EPTB 2AIPA 6LPRA 2B7DH 2SGAA 3LGIA 2W26A 3LGTA 3PV4A 2VIVA 1QL7A 3PTNA 1SQTA 4TPYA 1T8OA 3F9GA 1O2GH 4MQAA 4CHAB 5LGOA 4ABBA 2OUAA 4R0IA 3KEEA 5A8XA 1BJVA 1YKTA 1VCWA 1GCDA 1GWAA 1RTLA 4IC6A 1E0FD 1O2PA 1O5EH 2BYAX 3E6PH 1VGCC 1QGFA 2BD7A 3M3TA 1ZSJA 4TY7A 3PLPA 3BTGE 1AKSB 3U98H 1O3IA 1GCTC 2PLXA 1UVUH 3AAVA 2AFQB 1HXEH 2FX4A 1C1WH 5FBIA 5EODA 3ESTA 4ZXYH 3UQOA 2H9TH 2VIDA 2BVRH 2ZPSA 1C1PA 4GUXA 3KL6A 1ZJKA 2GV7A 1C5NH 3SU0A 1NS3A 5ETXA 2OP9A 3Q3KA 2BDGA 1ACBE 3R0FA 4A1TA 2STAE 4K1SA 3T62A 1O2KA 1T31A 2BDIA 2BLWA 4Q7YA 4X2XA 3ATIA 2VNTA 1OX1A 6CHAB 1NFXA 1G37A 4ZAEA 1Z8JB 1AVGH 1BBRK 3QZQA 1EKBB 2WPMS 3GYLB 3EQ0H 1AZZA 1M9UA 1OS8A 3U8RH 3PYHA 1D3TB 5JBBS 1GMDF 4Q80A 3VEQB 3FVFB 1EXFA 3BG4C 1HJAC 3MH5A 5F6MA 3SV9A 5JYIA 1CGJE 2IJOB 1IAUA 1SI5H 1UO6A 4Y8YA 1D3PB 5J4SA 5F03A 1DWBH 5JDUB 2BD3A 3S0NA 3TU7H 2VIOA 1V2NT 2P3UB 5IYTA 1O2IA 4ABJA 3A83A 1O3GA 2QF0A 3MNCA 1DS2E 3QLPH 1ZPZA 3TNTA 2Z94A 5C1UA 2GGVB 5C5OA 3U8OH 3SQHE 2F9UA 3A82A 1PPCE 4K60A 8KME2 1AY6H 4FUFA 1ZPCA 1O38A 2OCVB 2QY0B 3V13A 1AMHA 4NA7A 5FCRA 1BRUP 1Z8RA 2ZHEH 1DICA 1KXDA 2A7HA 4FU9A 1LKBA 1Z1JA 1LQEA 3RC4A 2UWOA 2ZQ2A 5ESBA 1IQLA 1O2LA 5L6NH 1TX7A 4IN2A 3FAOA 5PTPA 3A7WA 1Y5BT 1AI8H 4AB8A 1AFQC 4MVNA 3SU4A 1AWFH 4BAOB 4UONA 2ZKSA 1EASA 2CN0H 2FM2A 2ZO3H 2AMDA 1BQYA 1QB6A 4CRAA 1V2MT 3SNAA 1GI6A 1Y3WA 2FI3E 3MU0A 3ZZ9A 2J38A 2QV1A 1NZQH 1MH0A 3OSYA 1XVOA 1FLEE 1C2EA 4DCDA 7LPRA 1YC0A 4X1QU 1W3CA 1IHSH 3GISB 3RXFA 5GIBA 1BOQA 2CF9H 1EZUC 1BZXE 1P3CA 4DW2U 2NU2E 1HJAB 2WPKS 1O3KA 1VJAU 1TE0A 4YOGA 2ANYA 3ZZ8A 3B9FH 1C2LA 1ZR0A 3BTQE 4MNWA 1YGCH 1SGEE 2W5EA 1GI3A 1IQEA 1FQ3A 3Q3YA 2HOBA 1EZQA 3VB6A 4X2WA 1B7XB 1UHBA 1BMNH 3MO6A 4AZ2B 1BRAA 1TNGA 4FUGA 1FPCH 4FUHA 1O2TA 4E05H 2BZAA 1LKAA 1PPEE 1TA6A 3HKJB 2CXVA 1S6HA 1V2VT 4LOYH 2BDHA 1GBCA 1WTGH 3EA8A 3ELAH 5E0GA 1SGTA 3P17H 3TGIE 2ZHWH 4AGJA 1DWCH 4KGAA 4DY7B 4FU8A 5EW1H 1XUJA 3T26A 3A7VA 1EATA 1ZOMA 5GWZA 3QO6A 4X1PU 4NIXA 1V2PT 2ZDNA 2BY6X 3A8DA 1OOKB 2JKHA 1FDPA 1AFQB 1ZMLA 5FPSA 1IQJA 2GZ7A 2P8OC 3STIA 2QF3A 4K3JA 2CHAC 2ZU1A 3SV8A 2ANWA 8ESTE 2EA3A 3ENSB 2BDYA 2C93B 1Z7KA 5ABWA 1SG8B 3RXAA 4ABAA 3K65B 2PTCE 4NWLA 1FNIA 3SOSA 1ARCA 2GZ8A 2ZU3A 4CH8B 3SORA 1Y3UA 5A8ZA 1ZLRA 4YM9A 2ZHFH 4YESB 3AASA 1ETRH 2R0KA 3TNSA 4F4OC 1UTNA 1MKWK 4INHA 3MMGA 2G4TA 4Y0ZE 1O2ZA 2AMQA 2EC9H 2HPPH 1MCTA 3HGNA 2AH4X 2A4GA 1W7XH 1O3PB 1EP6A 1EUFA 1YCPK 4X0WU 3W94A 1GL1A 4YTAA 4TYDA 4CBOA 1O3OA 3RDZA 2G8TA 1GJDB 1THPB 3E8LA 4BAMB 4O3TA 9LPRA 3Q77A 5DP5A 3NXPA 1XUKA 1C1NA 3ZV8A 1D9IA 1C5MD 3F6UH 2FLRH 3LJJA 2PUXB 3SV6A 5F8ZA 1BA8B 3RXUA 4WJG2 4NSVA 4QT8C 3A89A 2TRMA 3U1JB 2FYQA 2XWAA 1SGCA 4JMYA 1NU7B 1C5VA 1T4UH 1K1JA 1AWHB 4YZUA 2VINA 4I8KA 4KTSA 3RXSA 1FJSA 1GDUA 1CT2E 4X2VA 1ID5H 3BTTE 2P8OB 3QN7A 2FPZA 1J9CH 4OS7A