4DOQA

Crystal structure of the complex of porcine pancreatic trypsin with 1/2slpi
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
221
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Structure basis 1/2SLPI and porcine pancreas trypsin interaction
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 221
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA02
1HIAB 2NU2E 2AIQA 1GHWH 1ZOMA 3LGTA 1UVSH 3B23B 2OUAA 4UFDH 1GI5A 2J4IA 4AB9A 1YCPH 7ESTE 3LGVA 4CREA 1QQ4A 1D6WA 3ZZ8A 3U9AH 2R0LA 1EZXC 1XXFA 3NUMA 2VGCC 2YNBA 4B75A 3OTJE 2H5CA 1ZHPA 4CR5A 2VVCA 2DUCA 3M3VA 4NZQA 1ELGA 2ANYA 1BBRE 4LZ4B 1HYLA 1THPB 2SNVA 4I33A 1UHBA 1ORFA 3MH4A 2FDAA 3M3SA 1MKWH 3A80A 1C1SA 1LHGH 4DIIH 2FPZA 3V7TA 3SGAE 4U32A 1YLCA 3NPSA 3CENA 1C1WH 1O2YA 1TAWA 1C2DA 2VH6A 1LHCH 3T27A 1K2I1 2J2UA 1MKWK 1QJ7B 1KXFA 1V2WT 3FP7E 5DG6A 5E2OA 4YOJA 3BV9B 1ZPBA 5F6MA 3E3TA 1LVYA 1P12E 2G4TA 2O8WA 5JBBS 4GVUA 1OWIA 3QDZB 2KAIB 4E7NA 3A84A 1TPOA 3SQHE 4BOHA 1DANH 5HXFA 3IITA 1DE7H 2GCTB 3Q3XA 4X1PU 1TA2A 1KY9A 1OYQA 4NA8A 2H9TH 4FUJA 1UVUH 1YBWA 5FCRA 3A89A 1GMCG 2HRVA 9LPRA 1UTQA 1JBUH 1GDQA 1ANDA 3U98H 1SQTA 1KXAA 2FI4E 5C1UA 4GSOA 1E36B 2OC0A 1AZZA 1O2MA 1O39A 3SU0A 4MNXA 2Q6GA 3UFAA 2UWOA 1XX9A 1GJ8B 1P2OA 1GJ5H 1Z6JH 1C5SA 1NU9A 1SOTA 5DKMA 1YPKH 1MKXK 7KMEH 4AFSA 4O3TA 2BMGB 5A2MH 2P93A 3ZVCA 3K65B 1MBQA 2P59A 1GBMA 3NCLA 2BDCA 1LPGB 1S82A 2STAE 1SB1H 5I46H 1GJ7B 5A8YA 1C1RA 2CF8H 2JETB 1CHGA 1DLKB 1Y3YA 4GPGA 3SO3A 1SGFG 4LK4A 1JXPA 2WYJA 1GVKB 1TMTH 1TMBH 2XBWA 4D8NA 1Z71A 4X8VH 1L4ZA 2C8YB 2GGVB 1OWHA 1C2JA 1UVPA 4X8SH 5E0HA 3MI4A 4A92A 2O9QA 2Z3EA 5IYTA 3LU9B 1C5OH 1QHRB 2DE8A 1ELAA 1ESAA 3CS7A 4Y11E 1BJUA 3VFEA 2BD3A 3H7TA 1K28D 2OLGA 3KNXA 4WH8A 3SU5A 4Q7YA 1W0YH 1TYNA 4GUXA 1EKBB 4ZKOU 1JOUB 1HAIH 4CRCA 1QBNA 1O3FA 1QR3E 4Y7AA 1O2QA 3RU4E 1BTPA 2BY5X 1UMAH 4CBNA 2ZFPH 4B71A 3MU0A 3HGPA 3SN8A 2VIQA 4WF8A 3EQ0H 1SVPA 3MNXA 4I8GA 4R8TB 3ZVAA 3BTME 1DS2E 4Q2KA 3LT3A 2PFEA 3H5CB 2ZCHP 4DGJA 1OYTH 3LGIA 1A46H 3D49H 4LOYH 1PPCE 1BTXA 2PGBB 4Y79A 4RSPA 2ZHWH 3RLYH 2AGEX 2O8TA 1CQQA 3K2UA 3UWIA 4LZ1H 2HPPH 2SGEE 2VH0A 3M61U 1GDUA 1MQ5A 3BTWE 3P8NA 3TH3H 4ISIH 1BMMH 1OKXA 2R3UA 1O30A 1FNIA 1TA6A 1DY8A 2PTNA 1EAIA 3EYDA 1H8DH 2ANWA 1TRNA 2ZHEH 2P94A 4GCHF 1QB9A 2ZDNA 4K5ZA 5GIBA 1C4Y2 2SGDE 1T8OA 1LKAA 3O8BA 4X2VA 3RXRA 6CHAC 1WUNH 3MO3A 3LH1A 3AW0A 3NXPA 2XXLA 1MQ6A 3ZZCA 2R2WU 1ZMNA 3A82A 1L0ZA 3RM2H 2QGRA 1ETSH 2G5NA 4BXSA 5L30H 1W3CA 1AUJA 2FLBH 4XOJA 3OY6U 3N7OA 2FOAA 2AMDA 3DT0H 2I6QA 3LPRA 3RDZA 2PR3A 3U8TH 1VCWA 5EQSA 1SMFE 4KGAA 2Y81A 1T4UH 3OY5U 5F8ZA 1GCTB 2PLXA 1HXEH 2WPIS 1EAUA 1YPMH 3ATLA 4O97A 4H6SB 1T8NA 2QXJA 1IQEA 1O2VA 3QUMP 1W11U 4D7FA 4Y0YE 1W7XH 1FY8E 5GCHF 3T2NA 1L1NA 2XC0A 2ZDVH 3MH7A 1ELFA 2ALVA 3SU4A 2TBSA 2ZFSA 3H7OA 4AN7A 4X0WU 2YNAA 2ZEBA 2Y5GA 5DP9A 2BZ6H 3KCGH 1QY6A 1Y3XA 1MMJN 1KTTB 1O3OA 1WU1A 4BTIB 4INHA 1OSSA 4CRGA 4WMFA 1GHAG 1XUJA 1O0DH 3BEUA 1AKSB 2A45B 3O8CA 2XCNA 4JZIA 5GDSH 2BX3A 2Z3CA 1IQMA 1HJAB 1F0TA 3JZ2B 3SNEA 4D76A 4X1NU 2ZCLP 5E0JA 4ABJA 3EAJA 2B5TB 3TGIE 1ZJDA 1C5XB 1SGFA 1HUTH 1UTMA 1GG6B 2GVFA 1TGCA 3TGJE 2R0KA 1GHVH 2H9EH 4AGJA 2V3HH 2ZFTA 5JDUB 1T8LA 1NRRH 4BAQB 1PPHE 3M35A 4BAOB 1EZUC 3Q00A 1IQNA 4AG1A 2FP7B 4NCYA 1RTKA 1F2SE 2WINI 2M5TA 1H9IE 4Y8XA 1KTSB 2AMQA 1MTWA 1UK3A 3VB6A 3AASA 3AW1A 1NROH 1NRSH 1AO5A 8ESTE 1BUIA 4K1TA 1BA8B 4UFEH 1QQUA 2GCHG 6GCHG 2I6SA 3RU4T 1VGCB 1Y3WA 2FI5E 2BOHB 5EW2H 2OINA 1QA0A 1TPSA 1DSUA 3SGBE 2FX6A 3RXEA 1AFEH 2BD5A 1EB2A 1THRH 3F6UH 4X2YA 3AAUA 1SGIB 3DUXH 2VIVA 4HTCH 5TCCA 2Z94A 2VWOA 1BMNH 2WV4A 2BM2A 1ZGVA 1W12U 2CGAA 1UTPA 3ZZ4A 1RS0A 1XXDA 1DUEA 4O3UA 2SGPE 5TJXA 1K9OE 1ZSJA 4JYUH 2ZHFH 2ZDKA 5EPNA 1O3IA 4A7IB 1A5IA 4FUIA 4A1TA 1C1QA 2SGFE 2Y6TA 4I8JA 2ZPQA 1AN1E 5AHGH 2QXIA 4FU8A 1K21H 2BVSH 1XKAC 2OCVB 3SUFA 1EPTC 5T6GA 1O37A 1Z6EA 1DLEA 2P8OC 5CHAC 3GDUA 3SV2H 2XYAA 1FZZA 2ODQA 4R0IA 4D9RA 2XCFA 1P10A 1BJVA 1CT0E 3ATIA 1MD8A 2B7DH 4ABGA 1TGBA 3RXAA 3Q3YA 2PGQB 1E34B 4UE7H 3ZZ7A 1N8OB 1HNEE 1P11E 1CO7E 1KIGH 4DJZB 1LHFH 1B5GH 3FFGA 2RG3A 3ENSB 5DK1A 1PPZA 1CA8B 5EU8A 4YLQH 2OTVA 4YESB 2D26C 3TPIZ 1FN6A 3MTYA 3HK6B 1BTZA 5A0CA 3MYWA 1EZSC 3KF2A 5AFZH 1TE0A 2GKVE 4D9QA 1YF4A 1W14U 1DWEH 3QGNB 4Q7ZA 1TNLA 2FI3E 1O3MA 2ZTZA 1ZSKA 1GHYH 2J9NA 4X8TH 2EI8A 1C2HA 1GBKA 1TALA 3E91A 1V2TT 2OBQA 4GAWA 1S85A 4X1QU 3RXJA 2QF0A 2A5KA 2A7HA 3PO1C 1GVLA 5BRRE 1QNJA 1FV9A 1HGTH 1TPPA 1UHBB 1GHBF 5JB8S 1TOMH 1TNGA 1C5YB 1O2WA 5T6FA 1F0UA 4BNRA 1XUHA 4ISNA 3BTQE 2QCYA 5EGMA 3SV6A 1HPGA 4JZ1A 5FXLA 1LPKB 2R3YA 1QB1A 5BPEA 3QTVH 5TCAA 1F5KU 1VJ9U 2EA3A 1O5AB 5F8TA 1GJCB 1QA7A 1CGIE 3KHVA 3RXKA 1ESBA 1PFXC 1ZTLA 2XWAA 4Q80A 1M9UA 2F9OA 2ODPA 5FBEA 4AFZA 2O8MA 4WMDA 1NZQH 2QXGA 1MUEB 2Y7XA 4K1SA 1SGRE 1WV7H 4HZHA 3P92A 2BDGA 4PROA 4U2WA 2PTCE 1P06A 2YOLA 4UDWH 5FPSA 5B6OA 3RXPA 1OPHB 4CH2B 1JIRA 5DP8A 3BTKE 1Q2WA 5EOKA 3MNCA 2BLWA 3A81A 1JMOH 1P02A 2FESH 4ZKSU 1EJNA 2BY8X 4B76A 1P09A 4FVBA 1EXFA 4IC5A 1O36A 5GXPA 2ZPSA 3SU3A 4WXIA 2Y5FA 3ZZBA 2Y5HA 1P2KA 4KP0A 4INLA 1O5FH 4IC6A 2Y80A 4BAKB 3RXCA 1Y5BT 2K1QA 2FOGA 1MH0A 4TPIZ 2FEQH 1YPJH 2WV5A 1FAXA 4H4FA 5ABWA 1IOEA 5LPRA 3ZZDA 3SI3H 3K6ZA 1XUIA 3ZZ6A 4MQAA 1XVMA 3TH2H 1PPEE 2ZTYA 1AVXA 4CRAA 1FIWA 1P0SH 3S9AA 3A85A 1O2RA 2BQ7B 4D7GA 3QWCH 1GGDB 3P17H 2V3OH 3GY8A 2Q6FA 3MNSA 2QIQA 1A1RA 2HNTE 4WH6A 3GDSA 1A0HB 1PJPA 1SC8U 1S84A 2V35A 1XUGA 4BAMB 5DP6A 1AB9B 1B0EA 1Y8TA 5DJ7A 1RTFB 3QLPH 1GBDA 4NIWA 1Y3VA 2ZHQH 4GCHG 3S9BA 3S69A 4HFPB 2AH4X 1DUAA 3STIA 4X1RU 5JPMH 1CGJE 1F5RA 1C4U2 1GG6C 1GBAA 2TIOA 3E90B 4ZUHA 5L2ZH 2NWNA 1NS3A 4QT8C 3LJOA 1TX8A 1O5DH 3P8OA 1TBRH 1J15A 3U1JB 2CF9H 1YPHC 1XVOA 3RMMH 1SG8B 8GCHF 4IW4E 4NFFA 1NC6A 3LGUA 1GMHF 1YM0A 1Y59T 4JK5A 2RA0A 4OS5A 5C1YA 1YCPK 3A7YA 2XWBI 2ZZUH 1VGCC 1W0ZU 3BSQA 1CE5A 1D3TB 3O8DA 4O9VA 3VPKA 5GCHG 2O8UA 4WY3A 2ZDLA 2ZQ1A 2RCEA 1Q31A 1ARCA 1CHOG 2BLQA 1Q3XA 1CSOE 3TU7H 4B74A 1EJAA 1B7XB 1EAXA 1WQVH 4OS7A 5A8ZA 4JK6A 3T62A 1MTNB 2G00A 4M7GA 3SJKA 1P9SA 1ELTA 5HM9A 3E0NB 1GI0A 1ZZZA 1C9TA 3M7TA 3AVZA 3UQVA 2F9NA 3A86A 3V0XA 4Q7XA 1BQYA 3S7KB 1JRTA 3MH5A 2BY7X 1TWXB 2WPMS 5JYIA 2H5DA 7LPRA 3DA9B 3SJ8A 1QL7A 2J94A 5HGGA 3TK9A 1Z8IB 4ZXYH 1WAYB 2PKSC 4NA9H 2CV3A 3FP6E 4AG2A 3LC5A 2RDLA 3BTFE 3G01A 1TNKA 1Z1IA 1HAHH 2PKAB 2A5AA 4NIVA 3BTEE 1ABIH 1H9LB 1JWTA 3F9FA 2BOKA 3RP2A 2PUXB 2D1JA 1DSTA 3SJ9A 1P01A 3S7HB 1S6FA 3MU4A 3BIUH 2ZFQH 3BTTE 1LVBA 1GI3A 3EDXB 1HAVA 1IQLA 4O03A 3HGNA 3W94A 4DOQA 4YM9A 3RXOA 1A0JA 1GHXH 1TGTA 1GJDB 2DE9A 4BTTB 4IGDA 4CRFA 4ISOA 1EOLA 4Z6AH 2IJOB 1E38B 5FX5A 1AE5A 8LPRA 2FOCA 2A5IA 2BDAA 3RXFA 3TGKE 1W2KH 3FAOA 2NU4E 1N6YA 3MO6A 2XW9A 1X7AC 5G4BA 2ZGJA 2ZGHA 1O3LA 2VVVA 5GPIB 1A3BH 2BVRH 4TYDA 4B2BA 2C8ZB 1BOQA 1ZMLA 4FUCA 1BHXB 1GBBA 3PV4A 2IOTA 3RXVA 1NO9H 1O2KA 1H1BA 5ESTE 2ZO3H 1GJ6A 1HFDA 3RMOH 1GI1A 3SUDA 2BD4A 1ZMJA 1GI4A 1PQ5A 3ATKA 2BDHA 4JZDH 3GY4A 4YZUA 1AU8A 3MMGA 1C5TA 2VIWA 1BTHH 2SNWA 4FU7A 4UFGH 1OOKB 4OGYA 1T8MA 2AEIH 4DG4A 3I78A 1DICA 4FUHA 5FBIA 1NT1A 4AB8A 1SFIA 1ZR0A 3GY7A 3F68H 2OBOA 4CR9A 1UVOA 1NFXA 3BG4C 2OQUA 1UO6A 1V3XA 1SSXA 3M7UA 3SV8A 1HBTH 2FMJA 1QBOA 3GYMA 4A5TS 1GBEA 5K7RA 1XUFA 1K1LA 1V2NT 5PTPA 3RXIA 1CA0C 1A5HA 1HIAA 1TFXA 3VB4A 1AWHB 4WJG2 3QZRA 3TIUA 1TX7A 5IDKA 1ZTJA 1O2TA 1ANEA 1FY4A 4Y6DA 1FY3A 5C3NA 1O2LA 1C9PA 4JMYA 3M36A 1WYKA 4UEHH 1TIOA 3ELAH 3SHCH 4LXBH 4NWLA 3UNQA 1GI8B 1J14A 1P03A 1THSH 1O2GH 1O3AA 2TPIZ 4K60A 2P95A 3F9EA 2SFAA 2ZU5A 2OC7A 4Y7BA 3ATMA 2ILNA 1P3CA 1CU1A 2XBYA 1PQAA 3T26A 4J1YA 4K3JA 1GGDC 4WMEA 3GCHB 2R2MB 1JIMA 3B9FH 1KXEA 1GHBG 4Y76A 4VGCB 3Q77A 1L2EA 1K1PA 2QA9E 1P2MA 5ETXA 1KXCA 2EC9H 1Z1JA 1V2JT 5LPFA 4AFUA 3V12A 3UPEA 5SGAE 1TRMA 1ELEE 2G81E 1DXWA 2ZQ2A 4E7RG 5DPAA 1QCPA 2GT8A 1DWDH 1GI6A 2G55A 1D6RA 2KAIA 1TRYA 2GT7A 3SU1A 1BCUH 1YPEH 3P70B 1KXDA 2VVUA 4UFFH 1UTOA 2A31A 1F5LA 1BB0B 1ZHRA 2C93B 1YPLH 2B8OH 1KLJH 2C90B 3SNDA 1FJSA 9ESTA 2ZA5A 1O3PB 2H2ZA 2UUFB 3ODDA 1G37A 4IBLH 1NFUA 1ZRKA 3RC5A 2AMPA 3NZIA 3SHAH 1AUTC 1O3KA 1BRCE 2Y82A 1GBTA 4ZAEA 3NKKA 1O2NA 1HJ9A 4MNWA 1QL8A 1QJ1B 3GY2A 5F03A 1QIXB 4DURA 1IHTH 1ZRBA 1CBWB 2F3CE 4KKDA 1QGFA 3T25A 3OU0A 4XFQA 1LPZB 2BD8A 3STJA 3A87A 2BY9X 1KSNA 3KQBA 1EAWA 4OS4A 2ESTE 1T4VH 1YCPM 2EI6A 3ESTA 1BTWA 5HMAA 5C20A 1C5WB 2WUCA 2D8WA 1HAXB 1VJAU 1DXPA 2GD4B 2BD7A 2WPLS 4XBDA 4MPWA 1NFYA 2AFQB 3UWJH 1NRNH 1E0FD 1OWKA 4MG3A 1EJMA 1EPTA 1Z8RA 1GMCF 2GCTC 1GHZA 2FOMB 1SPJA 2NU3E 1AFQB 1XUKA 2VWNA 5AVDA 1S0RA 1V2PT 2FZZA 1KYNA 4MVNA 1TMUH 2A1DB 1GL1A 3AAVA 1MTVA 1AMHA 1O5EH 4U30A 1GI2A 1H4WA 2ANKH 2FOFA 1LCYA 3KIDU 1G3CA 4F4OC 1A7SA 1ID5H 1P04A 2GZ8A 1FPCH 5AFYH 1RRKA 1AY6H 1BMLA 4BXWA 1BHXF 1FAKH 1V2RT 8GCHG 1SQOA 2V0BA 3UUZA 5DP7A 1GMHG 1C5NH 3LH3A 2Z9IA 5T6DA 1GBJA 1P05A 1WBGB 1XMNB 2J92A 1ELCA 2JETC 1F92A 1G32B 4THNH 3P8FA 3D62A 4JYVH 1CGHA 1C2EA 1V2MT 2FOHA 1OX1A 2TGDA 5E0GA 1JRSA 1AWFH 1RFNA 2PSYA 3PM3A 4BTUB 1P2JA 5FX6A 1GI9B 4AYVB 3RXSA 2ZU3A 1ACBE 1FN8A 3MNBA 4ASHA 2C3SA 1XM1A 3A8CA 4KELA 2EI7A 3C1KA 2GZ9A 1AQ7A 4ZKNU 1C5VA 3M5LA 2VB0A 3NK8A 3S9CA 3NWUA 4DVAU 1C1TA 1SGEE 3SQEE 3PWCA 1WQSA 1AVWA 4A1XA 3T28A 5A0BA 1OP2A 2FYQA 3RXLA 1GJAB 4ABAA 4YT7H 4FXGH 3VXFH 2QF3A 6LPRA 5L2YH 2FM2A 1LTOA 3GISB 1ZPCA 4YTAA 4AZ2B 2A0QB 3M5NA 3SI4H 5FHTA 3SV9A 4ISLA 1VCPA 3KQCA 2FOEA 4AOQA 6ESTA 5EW1H 1SOZA 2ZGBH 2FIRH 1F0SA 4HGCA 1PQ8A 1TQ0B 1H9HE 1QRZA 2P3TB 5DO4H 2THFB 2C4FH 3PWBA 1UTKA 3PYHA 3ATWA 3ZVDA 1MZAA 4GHQA 1UTLM 1YPGH 5FCKA 1C2FA 1HCGA 1BRUP 1FIZA 2IN2A 4AGKA 3OSYA 2BDYA 1HAZB 3VB5A 4NA7A 1WCZA 1SLVB 1ZYOA 1TLDA 1DPOA 3RXDA 3BG8A 3KEEA 2OP9A 2W7UA 4H42U 2G52A 1MTSA 2OXSA 1Z8GA 1VR1H 3QTOH 4AYYB 1TNIA 1GPZA 4ZHMU 3ZVEA 4ISHH 3W95A 3U1IB 1SI5H 3OX7U 1RJXB 4SGBE 3QX5H 1MBMA 3A7XA 2G8TA 4BANB 2FS8A 2BD9A 3ZV8A 1FPHH 3MU8A 1C2IA 7GCHF 4ZKRU 5HYOA 1HB0B 2F9UA 5T3HA 3A8DA 2AERH 1O2ZA 3A7ZA 1GCTC 3MOCA 4ABHA 3LOXA 3SOSA 1V2ST 2UUJB 1ELVA 1OP8A 3SORA 1SGCA 4DT7B 1V2QT 1NRQH 3BTHE 2Z9LA 1ELDE 2PUQH 1W13U 5K0HA 5EXMA 2A4RA 5EQRA 4I8KA 1ESTA 1L1GA 3U8OH 2BY6X 1HV7A 1EOJA 1YLDA 2ALPA 4I7YH 1GHAF 1LDTT 4AORA 2BTCE 1K1OA 4TY6A 1IQJA 1LO6A 2ZKSA 3UIRA 1Y3UA 2GV7A 2R9PA 2CN0H 5CE1A 1G30B 2A32A 3SBKA 1O3GA 2JH6D 1RIWB 1AHTH 2GP9B 3RMLH 3EA9A 2F9BH 5J4SA 1HAPH 1BITA 1QFKH 2J38A 1YC0A 3CP7A 3JZ1B 1HJAC 1O31A 2VINA 2FYRA 6CHAB 4X6NA 2H9HA 1TQ7B 3E8LA 3VB7A 1C5QA 1G3EA 1TNJA 4A6LA 1BRAA 1TPAE 2XBXA 2OD3B 2B0FA 3TJVA 3RUOA 2ZHDA 2GX4A 2W7SA 3PMBB 1GMDF 2W5EA 3LC3A 1C1NA 1AZ8A 2HVXA 2ZWLH 1O5BB 2FO9A 3PLPA 3KGPA 1UJ1A 4K1EA 1FLEE 1BRBE 1C1OA 3TJNA 1UTJA 2ZPRA 4ZHAA 3LONA 4MPVA 2FS9A 4ZH8A 2NU1E 2WYGA 2C8WB 1O35A 3GCTF 1ARBA 3RXQA 3SGQE 1P2NA 1O3JA 1EP5A 2P3FH 1ABJH 1C2KA 1NTPA 1SGNE 1D3DB 1O2SA 2HALA 6GCHF 3K9XB 3EA7A 1GJ4H 1P8VC 1DM4B 1QRXA 4Y8ZA 4XBBA 1GI7B 3RC6A 1GJ9B 3T5FH 1TONA 1GBCA 4MNYA 1GBFA 3P6ZB 1O3DA 1HDTH 2QN5T 1C1VH 2Z3DA 1LHEH 1K1MA 2FTLE 3MU1A 2P16A 1VCQA 3RXUA 3TH4H 3TJUA 1MAYA 1LVOA 4OS6A 2RA3A 1V2VT 2ZFFH 3MH6A 3PMJA 1PPGE 1UVTH 2HPQH 3UR6A 3R3GB 3RXMA 1O5GH 2O8LA 2QYIA 3MWIU 3QZQA 3BTGE 1N6XA 2ZG0H 3SU2A 3A83A 2VWMA 3A7TA 3ITIA 2PW8H 1TABE 2GV6A 2QY0B 2JH5D 2P3UB 3CS0A 1EX3A 4Z0KA 3LKWA 1EATA 1P2QA 1RD3B 3I77A 4JCNA 5DP4A 2W3KA 2G51A 4K8YA 1BZXE 1SGQE 4FUGA 3E16B 5LPEA 3V13A 1RTLA 1TBQH 4FUDA 1O3NA 3ZZ3A 3F1SB 1DVAH 1D4PB 4XBCA 1V2UT 3ZYEA 3PLKA 4CHAB 2GMTB 4MNVA 1O34A 1C5ZB 1DT2A 1YYY1 3TVJB 3FANA 1N8OC 4OS1A 3SZNA 2SGAA 5DGJA 1LQEA 8KME2 3LDXH 1RXPA 3VEQB 2Z6BD 1B0FA 1HLTH 4NSVA 1C5PA 2BD2A 4ESTE 1SGPE 2HNTF 1WTHD 2ANMH 2A7JA 1MKXH 2BQ6B 3BF6H 4OS2A 1QRWA 4NIYA 4KTSA 4I8HA 2F9VA 5C5OA 1TNHA 4NZLA 5F8XA 5EXLA 4X2XA 3HATH 1HAYB 1SHYA 3FZZA 3C27B 1O2XA 3EE0B 1J9CH 2Z9GA 1A5GH 1O5CB 3ZZ5A 1IQFA 3UOPA 1T31A 2AGIX 3F9GA 2ZU2A 2HGTH 4SGAE 2FWWA 2V6NA 3A7WA 3PMAB 3RU4D 2TGTA 2W3IA 2HNTC 2A2XH 4X6MA 4UD9H 1V2LT 3ZVFA 4RN6A 5FAHA 2A4QA 5C1XA 3MU5A 1TBZH 2LPRA 3RXGA 3P95A 3SUGA 1EPTB 1P57B 1G2LA 3TJOA 1PYTD 1S5SA 2P8OB 1MCTA 1ZJKA 2XRCA 5CHAB 3ZVGA 1BTYA 1D3QB 2UWPA 1K22H 2HWLB 4K8BA 2STBE 4X2WA 2GDDA 2CHAB 1V2KT 3E0PB 3M5MA 3FZDA 3RXBA 3BIVH 3RC4A 3HKIB 4YOIA 3TK5A 3M5OA 3TK6A 4FU9A 2PWXA 4RKJB 1KDQA 1AD8H 3RLWH 2F83A 2GDEH 4K69A 1NN6A 1LHDH 2BZAA 1O2PA 1L1JA 4MTBA 2VNTA 1AVGH 2BVXH 3GICB 3GCNA 2Q1JA 3IWMA 4UONA 1C2MA 1EB1H 1C5MD 1A2CH 3A8AA 3L33A 3SNBA 4NGAH 3BEIB 2BHGA 4B2CA 1OWDA 4BAHB 1YKTA 1S0QA 2Z9JA 3PO1B 2H6MA 1UK2A 1TGNA 5LGOA 2NU0E 3SNCA 1P2IA 1FDPA 2PHBA 1WTGH 5CMXH 1A61H 5LH8A 1VITF 4Y71A 3IG6B 4WWYA 1DITH 1MD7A 1RIWC 3M3TA 4IN2A 1IQGA 1GCDA 3SV7A 4HI3A 2AYWA 3URDA 2BLOA 1O3BA 4AFQA 3ZZ9A 3L3TA 2ZF0H 1W8BH 1AB9C 3R0FA 3HKJB 5A8XA 3VGCB 2OC1A 3LIWA 3ZYDA 3DD2H 4ZMAH 3DFLA 1C2LA 4XE4A 3UNSA 4B1TA 1ZHMA 1G2MA 1G3BA 1FI8A 5DP3A 3DFJA 3PTNA 2JH0D 4IN1A 5ESBA 2GZ7A 5JBTA 2BLVA 4E05H 1EZQA 3QK1A 1N1LA 3BEFB 3HK3B 2BXUH 2J95A 3S0NA 2PV9B 1NPMA 2F9PA 2PKAA 1P9UA 1HAOH 2Z7FE 1DX5M 3E6PH 3GDVA 5EXNA 1EQ9A 1O2HA 4ABDA 1HJ8A 4MPUA 7GCHG 1MZDA 1V2OT 1WSSH 3SJOA 1TB6H 1O38A 2J34A 3SW2B 2ZC9H 2A4OA 1AIXH 1RGQA 1MCVA 2F91A 2H1UA 1NFWA 1SLWB 4X6OA 1CHOF 5C2ZA 1S83A 5C5NA 5I25A 2AS9A 1W7GH 4KTCA 2Q6DA 1TOCB 4JYTA 1AGJA 2WUBA 1FONA 2CMYA 3TNTA 3D23A 1IQIA 2B9LA 2BDIA 1SQAA 1SGDE 2CJIA 4RKOB 5AF9H 3DHKH 1A3EH 2FX4A 2VIDA 3UQOA 1UTNA 2A7CA 1K1JA 2ZFRH 4OGXA 1MTNC 4IMZA 4X8UH 1C5UA 3PB1E 1LKBA 4ABFA 1S81A 4J2YB 1O3HA 1J8AA 4FUEA 1ZSLA 1E37B 4I31A 2FLRH 1SHHB 1BTUA 3HPTB 2BXTH 1XKBC 1E35B 2EEKA 5JBAS 3KQDA 1FMGA 1O3CA 1FUJA 4FVDA 3QO6A 4E06H 1OS8A 1SFQB 2BYAX 1DDJA 4YT6H 1QJ6B 1FXYA 3GY3A 2UUYA 2QC2A 1IQKA 4DW2U 1O2JA 2FODA 1GMDG 2ZTXA 3BN9A 1O3EA 1TGSZ 3EA8A 4CHAC 1O2UA 2C8XB 4YLUA 2GMTC 1PYTC 2ZU1A 1TX6A 4YO9A 5E2PA 1GJBB 2ZCKP 4U01A 3URCA 1KXBA 3GCOA 3PROA 4GLYA 4X1SU 2XC4A 3Q76A 3GCTG 4ABEA 2VIOA 2WPHS 2VGCB 1OXGA 4X6PA 4F49A 1L4DA 2WPJS 1CT2E 3TITA 5FPYA 1VZQH 1MU6B 2QAAA 1EUFA 5EG4A 1GDNA 1C4V2 5GJ4B 3UTUH 1IAUA 2OQ5A 3GOVB 1DWCH 1PQ7A 1BIOA 1G9IE 2UUKB 3K6YA 4CBOA 1FY1A 2XTTB 1SLXB 3SU6A 3O8RA 1H8IH 1K1IA 3BTDE 4WXVA 4KTUA 2A4GA 1PPBH 4MLFB 3RXHA 4FUBA 2XC5A 5C67A 1U6QA 1ETTH 2PKSB 3LJJA 3ODFA 2TRMA 4Y10E 3LGWA 4NSYA 4DCDA 2PSXA 1GBHA 3A88A 2Z9KA 1WOFA 2QV1A 1Y5UT 3U8RH 2OC8A 4TWWA 1A0LA 1OWJA 3GYLB 2ZP0H 2ZGCA 1C5RA 2BB4A 4YOGA 3PMHB 1HAGE 2ZNKH 1DOJA 4CRDA 1QB6A 2CHAC 2VWLA 3PTBA 4A1VA 1GVZA 2ZGXH 1KLTA 3ZVBA 1FY5A 1V6DA 4IMQA 3RMNH 1YPHE 5J4QA 2LNCA 1K1NA 1O33A 1AE8H 1CT4E 4MPXA 3M7QA 3EGKH 2ZU4A 1ELBA 1MAXA 3GY6A 3VXEH 2BDBA 3V3MA 1GBIA 4AX9H 1LVMA 1IQHA 5FPTA 4JZEH 3Q3KA 1T7CA 2FOBA 1D3PB 5JBCS 2ASUB 4XSKU 2UWLA 3SJIA 3FVFB 1DY9A 2D2DA 3QN7A 2W26A 5EQQA 1C1UH 2ZDMA 3UY9A 1INCA 3RXTA 4I32A 2ZDAH 2IPHA 3TLOA 4DY7B 2VU8E 2XBVA 2ZIQH 1ZTKA 4ZXXH 1C1MA 2ZI2H 3T29A 1BDAA 1AKSA 1ANCA 1NRPH 1G3DA 4IS5A 1EASA 1C5LH 3QGJA 2ULLA 1J16A 4CH8B 1SR5C 3GCHC 5JB9S 2BX4A 2CXVA 4GHTA 2ODYB 2TGAA 4VGCC 1DWBH 1PPFE 1UCYH 1SGTA 3ZZAA 1YGCH 3UNRA 1UK4A 1SGYE 4MDSA 2FXRA 4ZHLU 3VGCC 4XDEA 1QL9A 4INKA 1IHSH 1LQDB 2HOBA 3E1XB 1ANBA 4JZFH 1UCYK 1HAVB 3UREA 3KQEA 1HXFH 2WPKS 1J17T 3B8JA 1GWAA 1Z7KA 3UR9A 4TPYA 3A8BA 1MTUA 1QTFA 3MO9A 4I8LA 3A7VA 2Y7ZA 3PLBA 3OYPA 4ZROA 3BG4B 1NESE 1OP0A 1T32A 5A09A 1W10U 1DFPA 4NWKA 4H6TA 1D9IA 4B73A 3MHWU 4Y8YA 1MU8B 1BBRH 2FTMA 4ABBA 2VJ1A 1KLIH 5DP5A 1CA0B 3TNSA 3RM0H 2XNIA 1Y5AT 4TWYA 1O2IA 1C1PA 1GBLA 2BQWB 2A2QH 1BT7A 4DIHH 2ZECA 2HLCA 3F9HA 3U69H 1BBRK 1SBWA 2AIPA 1QURH 3P8GA 3ZV9A 1EP6A 1NY22 1O2OA 2TGPZ 1NM6A 1YP9A 3FP8E 3MFJA 1NU7B 2JKHA 1CBWC 5E8EH 1HRTH 5GWZA 2GTBA 4TY7A 1A4WH 1P3EA 3I29A 3WY8A 1C2GA 3GY5A 4NFEA 2AGGX 2VIPA 5HM2A 4Y0ZE 4ABIA 4K2YA 2SGQE 2QXHA 3LGYA 5EPYA 3KL6A 1SL3A 2G5VA 1F7ZA 4NG9H 1ETRH 1VITG 4NIXA 4WVPE 1LMWB 1FQ3A 4FUFA 3SNAA 1VITH 3UOUA 1Z8JB 1QBVH 5H4IB 2G4UA 3M37A 1BMAA 1ZPZA 3SUEA 1O32A 1S6HA 1AFQC 1F0RA 1SLUB 2GCHF 1G36A 1AI8H 5EODA 3L6PA 1ZGIA 1KDQB 5A0AE 4B2AA 5L6NH 1UCYE 1ZLRA 1CVWH 3D65E 3KN2A 3VB3A 1OWEA 4CRBA 1GL0E
chains in the Genus database with same CATH superfamily
1HIAB 2NU2E 2AIQA 1GHWH 1ZOMA 3LGTA 1UVSH 3B23B 2OUAA 4UFDH 1GI5A 2J4IA 4AB9A 1YCPH 7ESTE 3VG8A 3LGVA 4CREA 1QQ4A 1D6WA 3ZZ8A 4TT3D 3U9AH 2R0LA 1EZXC 1XXFA 3NUMA 2VGCC 3OEED 2YNBA 4B75A 3OTJE 2H5CA 5EJ1A 1ZHPA 4CR5A 2VVCA 2DUCA 3M3VA 4NZQA 5B6LA 1ELGA 2ANYA 1BBRE 4LZ4B 2QF5A 1HYLA 1THPB 2SNVA 4I33A 1UHBA 2LELA 1ORFA 3MH4A 2FDAA 2IJD1 1MKWH 3M3SA 3A80A 1C1SA 2VBCA 1LHGH 4DIIH 2FPZA 3V7TA 3SGAE 4U32A 1YLCA 3NPSA 3CENA 1C1WH 1O2YA 1TAWA 1C2DA 2VH6A 1LHCH 3T27A 1K2I1 2J2UA 1MKWK 1QJ7B 1KXFA 1V2WT 3F2HA 3FP7E 5DG6A 5E2OA 3BV9B 1ZPBA 4YOJA 3E3TA 5F6MA 1LVYA 1P12E 2G4TA 2O8WA 5JBBS 4GVUA 1OWIA 3QDZB 4I86A 2KAIB 4E7NA 3A84A 1TPOA 3SQHE 4BOHA 1DANH 5HXFA 3IITA 1DE7H 2GCTB 3Q3XA 4X1PU 1TA2A 1KY9A 1OYQA 4NA8A 2H9TH 4FUJA 1UVUH 1YBWA 5FCRA 3A89A 1GMCG 2HRVA 9LPRA 1UTQA 1JBUH 1GDQA 1ANDA 3U98H 1SQTA 1KXAA 2FI4E 5C1UA 4GSOA 1E36B 2OC0A 2RDEA 1AZZA 1O2MA 1O39A 3SU0A 4MNXA 2Q6GA 3UFAA 2UWOA 1XX9A 1GJ8B 1P2OA 1GJ5H 1Z6JH 1C5SA 1NU9A 1SOTA 5DKMA 1YPKH 1MKXK 7KMEH 4AFSA 3PRDA 4O3TA 2BMGB 5A2MH 2P93A 3ZVCA 3K65B 1MBQA 2P59A 1GBMA 3NCLA 3ZIAD 2BDCA 1LPGB 1S82A 2STAE 1SB1H 5I46H 1GJ7B 5A8YA 3DCLA 1C1RA 2CF8H 2JETB 1CHGA 1DLKB 1Y3YA 4GPGA 3SO3A 1SGFG 4LK4A 1JXPA 2WYJA 1GVKB 1TMTH 3H09A 1TMBH 2XBWA 4D8NA 1Z71A 4X8VH 1L4ZA 5HKKD 2C8YB 2GGVB 1OWHA 1C2JA 1UVPA 4X8SH 5E0HA 3MI4A 4A92A 2O9QA 2Z3EA 5IYTA 3LU9B 1C5OH 1QHRB 2DE8A 1ELAA 1ESAA 1OHHD 3CS7A 4Y11E 1BJUA 4B6FA 3VFEA 2BD3A 3H7TA 1K28D 2OLGA 3KNXA 4WH8A 3SU5A 2JJ2D 4Q7YA 1W0YH 1TYNA 4GUXA 1EKBB 4ZKOU 1JOUB 1HAIH 4CRCA 1QBNA 1O3FA 1QR3E 4Y7AA 1O2QA 3RU4E 1BTPA 2BY5X 1UMAH 3EE7A 4CBNA 2ZFPH 4B71A 3MU0A 3HGPA 3SN8A 2VIQA 4WF8A 3EQ0H 1SVPA 2WZQA 3MNXA 4I8GA 4R8TB 3BTME 3ZVAA 1DS2E 4Q2KA 3LT3A 2PFEA 3H5CB 2ZCHP 4DGJA 1OYTH 3LGIA 1A46H 4M9FA 3D49H 4LOYH 1PPCE 1BTXA 2PGBB 4Y79A 4RSPA 1S6LA 2ZHWH 2J98A 3WWFA 3RLYH 2AGEX 2O8TA 1CQQA 3K2UA 3UWIA 4LZ1H 2HPPH 2SGEE 2VH0A 3M61U 1GDUA 1MQ5A 3BTWE 3P8NA 3TH3H 4ISIH 1BMMH 1OKXA 2R3UA 1O30A 1FNIA 1TA6A 1DY8A 2PTNA 1EAIA 3EYDA 1H8DH 2ANWA 2V3MA 1TRNA 2ZHEH 2P94A 4GCHF 1QB9A 2ZDNA 4K5ZA 3MQKC 5GIBA 1C4Y2 2SGDE 1T8OA 1LKAA 2GJGA 3O8BA 4X2VA 3RXRA 6CHAC 1WUNH 2KCYA 3MO3A 3LH1A 3AW0A 3NXPA 2XXLA 1MQ6A 3ZZCA 2R2WU 1ZMNA 3A82A 1L0ZA 3RM2H 2QGRA 1K0HA 1ETSH 2G5NA 4BXSA 5L30H 1W3CA 1H8ED 1AUJA 2FLBH 4XOJA 3OY6U 3N7OA 2FOAA 2AMDA 3DT0H 2I6QA 3LPRA 3RDZA 2PR3A 3U8TH 1VCWA 4F48B 5EQSA 5F53A 1SMFE 4KGAA 2Y81A 1T4UH 2XOKD 3OY5U 5F8ZA 1GCTB 2PLXA 1HXEH 2WPIS 1EAUA 1YPMH 3ATLA 4O97A 4H6SB 1T8NA 2QXJA 2L74A 1IQEA 1O2VA 3QUMP 1W11U 4D7FA 4Y0YE 1W7XH 1FY8E 5GCHF 1NBME 3T2NA 1L1NA 2XC0A 2ZDVH 3MH7A 1ELFA 2ALVA 3SU4A 2TBSA 4XD7D 2ZFSA 3H7OA 4AN7A 4X0WU 2YNAA 2ZEBA 2Y5GA 5DP9A 2BZ6H 3KCGH 1QY6A 1Y3XA 1MMJN 5EJLA 1KTTB 1O3OA 1WU1A 4BTIB 4INHA 1OSSA 4CRGA 4WMFA 1GHAG 1XUJA 1O0DH 3BEUA 1AKSB 1YWUA 2A45B 3O8CA 2XCNA 4JZIA 5GDSH 2BX3A 2Z3CA 1IQMA 1HJAB 1F0TA 3JZ2B 3SNEA 4D76A 5DN6D 4X1NU 2ZCLP 5E0JA 4ABJA 3EAJA 2B5TB 3TGIE 1ZJDA 4TSFD 1C5XB 1SGFA 1HUTH 1UTMA 1GG6B 2GVFA 1TGCA 3TGJE 2R0KA 1GHVH 2H9EH 2F4LA 4AGJA 2V3HH 2ZFTA 5JDUB 1T8LA 1NRRH 4BAQB 1PPHE 3M35A 4BAOB 1EZUC 3Q00A 1IQNA 4AG1A 2FP7B 4NCYA 1RTKA 1F2SE 2WINI 3FOAA 2M5TA 1H9IE 4Y8XA 1KTSB 2AMQA 1MTWA 1UK3A 3VB6A 3AASA 3AW1A 5IK2D 1NROH 1NRSH 1AO5A 8ESTE 1BUIA 4K1TA 1BA8B 4UFEH 1QQUA 2GCHG 2W6ID 4RT1A 6GCHG 2I6SA 3RU4T 1VGCB 1Y3WA 2FI5E 2BOHB 5EW2H 2PP6A 2OINA 1QA0A 1TPSA 1YLNA 1DSUA 3SGBE 2FX6A 3RXEA 1AFEH 2BD5A 1EB2A 1THRH 3F6UH 4X2YA 3AAUA 1SGIB 3DUXH 4RT0A 2VIVA 4HTCH 5TCCA 2Z94A 2VWOA 1BMNH 2WV4A 2BM2A 3PV2A 1ZGVA 1W12U 2CGAA 3KQ5A 1UTPA 3ZZ4A 1RS0A 1XXDA 5KECA 1DUEA 4O3UA 2KZ4A 2SGPE 5KGOA 5TJXA 1K9OE 1COWD 1ZSJA 4JYUH 2ZHFH 2ZDKA 5EPNA 1O3IA 4A7IB 1A5IA 4FUIA 4A1TA 1C1QA 2SGFE 2Y6TA 4I8JA 2ZPQA 1AN1E 5AHGH 2QXIA 4FU8A 1K21H 2BVSH 1XKAC 2OCVB 3SUFA 1EPTC 5T6GA 1O37A 1Z6EA 1DLEA 2P8OC 5CHAC 3GDUA 3SV2H 2XYAA 1FZZA 2ODQA 3OEHD 4R0IA 4D9RA 2XCFA 1P10A 1BJVA 1CT0E 3ATIA 1MD8A 2B7DH 4ABGA 1TGBA 3RXAA 3Q3YA 2PGQB 1E34B 4UE7H 3U28C 3ZZ7A 1N8OB 1HNEE 1P11E 1CO7E 1KIGH 4DJZB 1LHFH 1B5GH 3FFGA 2RG3A 3ENSB 5DK1A 1PPZA 1CA8B 5EU8A 4YLQH 2OTVA 4YESB 2D26C 3TPIZ 3CNRA 1FN6A 2K0QA 3MTYA 3HK6B 1BTZA 5A0CA 3MYWA 1EZSC 3KF2A 5AFZH 1TE0A 2GKVE 4D9QA 1YF4A 1W14U 1DWEH 3QGNB 4Q7ZA 1TNLA 2FI3E 1O3MA 2ZTZA 1ZSKA 1GHYH 2J9NA 4X8TH 2EI8A 1C2HA 1GBKA 1TALA 3E91A 2KCOA 1V2TT 2JIZD 4P02A 2OBQA 4GAWA 1S85A 4X1QU 3RXJA 2QF0A 2A5KA 2A7HA 3PO1C 1GVLA 5BRRE 1QNJA 1FV9A 1HGTH 1TPPA 1UHBB 1GHBF 5JB8S 1TOMH 1TNGA 1C5YB 1O2WA 5T6FA 1F0UA 4BNRA 1XUHA 4ISNA 3BTQE 2QCYA 5EGMA 3SV6A 1HPGA 4JZ1A 5FXLA 3OAAD 1LPKB 2R3YA 4Q4LA 1QB1A 5BPEA 3QTVH 5TCAA 1F5KU 1VJ9U 2EA3A 1O5AB 5F8TA 1GJCB 1QA7A 1CGIE 3KHVA 3RXKA 1ESBA 1PFXC 1ZTLA 2XWAA 4Q80A 1M9UA 2F9OA 2ODPA 5FBEA 4AFZA 2O8MA 4WMDA 1NZQH 2QXGA 1MUEB 2Y7XA 4K1SA 1SGRE 5HIYA 1WV7H 4HZHA 3DSOA 3P92A 2BDGA 4PROA 4U2WA 2PTCE 1P06A 2YOLA 4UDWH 5FPSA 5B6OA 3RXPA 1OPHB 4CH2B 1JIRA 5DP8A 3BTKE 1Q2WA 5EOKA 3MNCA 2BLWA 3A81A 1JMOH 1P02A 2FESH 3FKSD 1EJNA 2BY8X 4ZKSU 4B76A 1P09A 4FVBA 1EXFA 4IC5A 1O36A 5GXPA 2ZPSA 3SU3A 4WXIA 3F0OA 2Y5FA 3ZZBA 2Y5HA 1P2KA 4KP0A 4INLA 1O5FH 4IC6A 2Y80A 4ACAA 3RXCA 1Y5BT 2K1QA 4BAKB 2FOGA 1MH0A 4TPIZ 2FEQH 1YPJH 2WV5A 1FAXA 4H4FA 5ABWA 1IOEA 5LPRA 3ZZDA 3SI3H 3K6ZA 1XUIA 3ZZ6A 4MQAA 1XVMA 3TH2H 1PPEE 5C0UA 2ZTYA 1AVXA 4CRAA 1FIWA 1P0SH 3S9AA 3A85A 1O2RA 2BQ7B 4D7GA 3SYJA 3QWCH 1UW7A 1GGDB 3P17H 2V3OH 3GY8A 2Q6FA 3MNSA 2QIQA 1A1RA 2HNTE 4WH6A 3GDSA 1A0HB 1PJPA 1SC8U 1S84A 2V35A 1XUGA 4BAMB 5DP6A 1AB9B 1B0EA 3FO8D 1Y8TA 5DJ7A 1RTFB 3QLPH 2J5UA 1GBDA 4NIWA 1Y3VA 2ZHQH 4GCHG 5DSFA 3S9BA 3S69A 4HFPB 2AH4X 1DUAA 3STIA 4X1RU 5EJZA 5JPMH 1CGJE 1F5RA 1C4U2 1GG6C 1GBAA 2TIOA 3E90B 4ZUHA 5L2ZH 2NWNA 1NS3A 4QT8C 3LJOA 1TX8A 1O5DH 3P8OA 1TBRH 1J15A 3U1JB 2CF9H 1YPHC 1XVOA 3RMMH 1SG8B 8GCHF 4IW4E 4NFFA 1NC6A 3LGUA 1GMHF 1YM0A 1SKYE 2J98B 1Y59T 4JK5A 2RA0A 4OS5A 5C1YA 1YCPK 3A7YA 2XWBI 2ZZUH 1VGCC 1W0ZU 3BSQA 1CE5A 1D3TB 3O8DA 4O9VA 3VPKA 5GCHG 2O8UA 4WY3A 2ZDLA 2ZQ1A 2RCEA 1Q31A 1ARCA 1CHOG 2BLQA 1Q3XA 1CSOE 3TU7H 4B74A 1EJAA 1B7XB 1EAXA 1WQVH 4OS7A 5A8ZA 4JK6A 3T62A 1MTNB 2G00A 4M7GA 3SJKA 1P9SA 1QZ8A 1ELTA 5HM9A 3E0NB 1GI0A 1ZZZA 1C9TA 3M7TA 3AVZA 3UQVA 2F9NA 3A86A 3V0XA 4Q7XA 1BQYA 3S7KB 1JRTA 3MH5A 2BY7X 1TWXB 2WPMS 5JYIA 2H5DA 7LPRA 3DA9B 3SJ8A 1QL7A 2J94A 3WWBA 5HGGA 3TK9A 1Z8IB 2EY4C 4ZXYH 1WAYB 2PKSC 4NA9H 2CV3A 3FP6E 4AG2A 3LC5A 2RDLA 3BTFE 3G01A 1TNKA 1Z1IA 1HAHH 2HLDD 2A5AA 2PKAB 2WPDD 4NIVA 3BTEE 1ABIH 1H9LB 1JWTA 3F9FA 2BOKA 3RP2A 2PUXB 2D1JA 1DSTA 3SJ9A 2KCPA 1P01A 3S7HB 5C0TA 1S6FA 3MU4A 3BIUH 2ZFQH 3BTTE 1LVBA 1GI3A 3EDXB 1HAVA 1IQLA 4O03A 3HGNA 3W94A 4DOQA 4YM9A 3RXOA 1A0JA 1GHXH 1TGTA 1GJDB 2DE9A 4BTTB 4IGDA 4CRFA 4P00A 4ISOA 1EOLA 4Z6AH 2IJOB 1E38B 5FX5A 1AE5A 8LPRA 2FOCA 2A5IA 2BDAA 3RXFA 2J97A 3TGKE 1W2KH 3FAOA 2NU4E 1N6YA 3MO6A 2XW9A 1X7AC 5G4BA 2ZGJA 2ZGHA 1O3LA 2VVVA 5GPIB 1A3BH 2BVRH 4TYDA 4B2BA 2YMSB 2C8ZB 1BOQA 1ZMLA 4FUCA 1BHXB 1GBBA 3PV4A 2IOTA 3KYGA 1NO9H 1O2KA 1H1BA 3RXVA 5ESTE 2ZO3H 1GJ6A 1HFDA 3RMOH 1GI1A 3SUDA 1W0KD 2BD4A 1ZMJA 1GI4A 1PQ5A 3ATKA 2BDHA 4JZDH 3GY4A 4YZUA 1AU8A 3MMGA 1C5TA 2VIWA 1BTHH 2SNWA 4FU7A 4UFGH 1OOKB 4OGYA 1T8MA 2AEIH 4DG4A 3I78A 1EFRD 1DICA 4FUHA 5FBIA 1NT1A 4AB8A 1SFIA 4HG6A 1ZR0A 3GY7A 3F68H 2OBOA 4CR9A 1UVOA 1NFXA 3BG4C 2OQUA 1UO6A 1V3XA 1SSXA 3M7UA 3SV8A 1HBTH 2FMJA 1QBOA 3GYMA 4A5TS 1GBEA 5K7RA 1XUFA 3AK5A 1K1LA 1V2NT 5PTPA 3RXIA 1CA0C 1A5HA 1HIAA 1TFXA 3VB4A 1AWHB 4WJG2 3QZRA 3TIUA 1TX7A 5IDKA 1ZTJA 1O2TA 1ANEA 1FY4A 4Y6DA 1FY3A 5C3NA 1O2LA 1C9PA 4JMYA 3M36A 1WYKA 2L6OA 4UEHH 1TIOA 3ELAH 3SHCH 4LXBH 4NWLA 3UNQA 1GI8B 1J14A 1P03A 1THSH 1O2GH 1O3AA 2TPIZ 1FX0B 4K60A 2P95A 3F9EA 2SFAA 2ZU5A 2OC7A 4Y7BA 3ATMA 2ILNA 1P3CA 1CU1A 2XBYA 1PQAA 3T26A 4J1YA 4K3JA 1GGDC 4WMEA 3GCHB 2R2MB 1JIMA 3B9FH 1KXEA 1GHBG 4Y76A 4VGCB 2KX4A 3Q77A 1L2EA 1K1PA 2QA9E 1P2MA 5ETXA 1KXCA 2EC9H 1Z1JA 1V2JT 5LPFA 1NBMD 5KEDA 4AFUA 3V12A 3UPEA 5SGAE 1TRMA 1ELEE 2G81E 1DXWA 4B6EA 2ZQ2A 4E7RG 5DPAA 1QCPA 2GT8A 1DWDH 2KR7A 1GI6A 2G55A 1D6RA 2KAIA 2KCAA 5FL7D 1TRYA 2GT7A 3SU1A 1BCUH 1YPEH 3P70B 1KXDA 2VVUA 4UFFH 1UTOA 2A31A 1F5LA 1BB0B 1ZHRA 2C93B 1YPLH 2B8OH 1KLJH 2C90B 3SNDA 1FJSA 9ESTA 2ZA5A 1O3PB 2H2ZA 2UUFB 3ODDA 1G37A 1E1QD 4IBLH 1NFUA 1ZRKA 3RC5A 3NRLA 2KM0A 2AMPA 3NZIA 3SHAH 1AUTC 1O3KA 1BRCE 2Y82A 1GBTA 4ASUD 4ZAEA 3NKKA 1O2NA 1HJ9A 4MNWA 1QL8A 1QJ1B 3GY2A 5F03A 1QIXB 4DURA 1IHTH 1ZRBA 1CBWB 2F3CE 4KKDA 1QGFA 3T25A 3OU0A 4DT4A 4XFQA 1LPZB 1VKYA 2BD8A 3STJA 3A87A 2BY9X 1KSNA 3KQBA 1EAWA 4OS4A 2ESTE 1T4VH 1YCPM 2EI6A 3ESTA 3F0PA 1BTWA 5HMAA 5C20A 1C5WB 2WUCA 2D8WA 1HAXB 1VJAU 1DXPA 2GD4B 2BD7A 2WPLS 4XBDA 4MPWA 1NFYA 4XRNA 2AFQB 3UWJH 1NRNH 1E0FD 1OWKA 4MG3A 3DSGA 1EJMA 1EPTA 1Z8RA 1GMCF 2CK3D 3KYFA 2GCTC 1GHZA 2FOMB 1SPJA 2NU3E 1AFQB 1XUKA 2VWNA 5AVDA 1S0RA 1V2PT 2FZZA 5C17A 1KYNA 1W0JD 4MVNA 1TMUH 2A1DB 1GL1A 3AAVA 1MTVA 1AMHA 1O5EH 4U30A 1GI2A 1H4WA 2ANKH 2FOFA 1LCYA 3KIDU 1G3CA 4F4OC 2F43B 1A7SA 1ID5H 1P04A 2GZ8A 1FPCH 5AFYH 1RRKA 1AY6H 1BMLA 4BXWA 1BHXF 1FAKH 1V2RT 8GCHG 1SQOA 2V0BA 3UUZA 5DP7A 1GMHG 1C5NH 3LH3A 2Z9IA 5T6DA 1GBJA 1P05A 1WBGB 1XMNB 2J92A 1ELCA 2JETC 4ACBA 1F92A 1G32B 4THNH 3P8FA 3D62A 4JYVH 1CGHA 1C2EA 1V2MT 2LP6A 2FOHA 1WXRA 1OX1A 2TGDA 5E0GA 1JRSA 1AWFH 1RFNA 2PSYA 3PM3A 4BTUB 1P2JA 5FX6A 1GI9B 4AYVB 3RXSA 2ZU3A 1ACBE 1FN8A 3MNBA 4ASHA 2C3SA 1XM1A 2KFWA 3A8CA 4KELA 2EI7A 3C1KA 2WV9A 2GZ9A 1AQ7A 4ZKNU 1C5VA 3M5LA 2VB0A 3NK8A 3S9CA 3NWUA 4DVAU 1C1TA 1SGEE 3SQEE 3PWCA 1WQSA 1AVWA 4A1XA 3T28A 5A0BA 1OP2A 3FN8A 2FYQA 3RXLA 1GJAB 4ABAA 4YT7H 4FXGH 3VXFH 2QF3A 6LPRA 5L2YH 2FM2A 1LTOA 2QF4A 3GISB 1ZPCA 4YTAA 4AZ2B 2A0QB 3M5NA 3SI4H 5FHTA 3SV9A 4ISLA 1VCPA 3KQCA 2FOEA 4AOQA 6ESTA 5EW1H 1SOZA 2ZGBH 2FIRH 1F0SA 4HGCA 1PQ8A 1TQ0B 1H9HE 1QRZA 2P3TB 5DO4H 2THFB 2C4FH 3PWBA 1UTKA 3PYHA 3ATWA 3ZVDA 1MZAA 4GHQA 1UTLM 1YPGH 5FCKA 1C2FA 1HCGA 1BRUP 1FIZA 2IN2A 4AGKA 3OSYA 2BDYA 1HAZB 3VB5A 4NA7A 1WCZA 1SLVB 1ZYOA 1TLDA 1DPOA 3RXDA 3BG8A 3KEEA 2OP9A 2W7UA 4H42U 2G52A 1MTSA 2OXSA 1Z8GA 1VR1H 3QTOH 4AYYB 1TNIA 1SQRA 1GPZA 4ZHMU 3ZVEA 4ISHH 3W95A 3U1IB 1SI5H 3OX7U 1RJXB 4SGBE 3QX5H 1MBMA 3PV5A 3A7XA 2G8TA 4BANB 2FS8A 2BD9A 3ZV8A 1FPHH 3MU8A 1C2IA 7GCHF 4ZKRU 5HYOA 1HB0B 3UAIC 2F9UA 5T3HA 3A8DA 2AERH 1O2ZA 5T1VA 3A7ZA 1GCTC 3MOCA 4ABHA 3LOXA 3SOSA 1V2ST 2UUJB 1ELVA 1OP8A 3SORA 1SGCA 4DT7B 1V2QT 1NRQH 2W6JD 3BTHE 2Z9LA 2OK5A 1ELDE 2PUQH 1W13U 5CHBA 5K0HA 1MABB 5EXMA 2A4RA 5EQRA 4I8KA 1ESTA 1L1GA 3U8OH 2BY6X 1HV7A 1EOJA 1YLDA 2ALPA 4I7YH 1GHAF 1LDTT 4AORA 2BTCE 4F55A 1K1OA 4TY6A 1IQJA 1LO6A 2ZKSA 3UIRA 1Y3UA 2GV7A 2R9PA 2CN0H 5CE1A 1G30B 2A32A 3SBKA 1O3GA 2JH6D 1RIWB 1AHTH 2GP9B 3RMLH 3OFND 3EA9A 2F9BH 5J4SA 3N7DA 1HAPH 1BITA 1QFKH 2J38A 1YC0A 3CP7A 3JZ1B 1HJAC 1O31A 2XNDD 2VINA 2FYRA 6CHAB 4X6NA 2H9HA 3N99A 1TQ7B 3E8LA 3VB7A 1C5QA 1G3EA 1TNJA 4A6LA 1BRAA 1TPAE 2XBXA 2OD3B 2B0FA 3TJVA 3RUOA 4FOUC 2ZHDA 2GX4A 2W7SA 3PMBB 1GMDF 2W5EA 3LC3A 1C1NA 1AZ8A 2HVXA 2ZWLH 1O5BB 2FO9A 3PLPA 3KGPA 1UJ1A 4K1EA 1FLEE 1BRBE 1C1OA 3TJNA 1UTJA 2ZPRA 4ZHAA 3LONA 4MPVA 2FS9A 4ZH8A 2NU1E 2WYGA 2C8WB 1O35A 3GCTF 1ARBA 3RXQA 3SGQE 1P2NA 1O3JA 1EP5A 1ABJH 1C2KA 1NTPA 1SGNE 2P3FH 1D3DB 1O2SA 2HALA 6GCHF 3K9XB 3EA7A 1GJ4H 1P8VC 1DM4B 1QRXA 4Y8ZA 4XBBA 1GI7B 3RC6A 1GJ9B 3T5FH 1TONA 1GBCA 4MNYA 1GBFA 3P6ZB 1O3DA 1HDTH 2QN5T 1C1VH 4AC9A 2Z3DA 1LHEH 1K1MA 2FTLE 1E79D 3MU1A 2P16A 1VCQA 3RXUA 3TH4H 3TJUA 1MAYA 1LVOA 4OS6A 2RA3A 1V2VT 2WHXA 2ZFFH 4RI0A 3MH6A 3PMJA 1PPGE 1UVTH 2HPQH 3UR6A 3R3GB 3RXMA 1O5GH 2O8LA 2QYIA 3MWIU 3QZQA 3BTGE 1N6XA 2ZG0H 3SU2A 3A83A 2VWMA 3A7TA 3ITIA 2PW8H 5GNDA 1TABE 2GV6A 2QY0B 2JH5D 2P3UB 3CS0A 1EX3A 4Z0KA 3LKWA 1EATA 3WW7A 1P2QA 1RD3B 3I77A 4JCNA 5DP4A 2W3KA 2G51A 4K8YA 1BZXE 1SGQE 4FUGA 3E16B 5LPEA 3V13A 1RTLA 1TBQH 4FUDA 1O3NA 3ZZ3A 3F1SB 1DVAH 1D4PB 4XBCA 1V2UT 3ZYEA 3PLKA 4CHAB 2GMTB 3OE7D 4MNVA 1O34A 1C5ZB 1DT2A 1YYY1 3TVJB 3FANA 1N8OC 4OS1A 3SZNA 2SGAA 5DGJA 1LQEA 2K8IA 8KME2 3LDXH 1RXPA 3VEQB 2Z6BD 1B0FA 1HLTH 4NSVA 1C5PA 2BD2A 4ESTE 1SGPE 2HNTF 1WTHD 2ANMH 2A7JA 1MKXH 2BQ6B 3BF6H 4OS2A 1QRWA 4NIYA 4KTSA 4I8HA 2F9VA 3W1EA 1KMHB 4FETA 5C5OA 1TNHA 4NZLA 5F8XA 5EXLA 4X2XA 3HATH 1HAYB 4OM9A 1SHYA 3FZZA 3C27B 1O2XA 3EE0B 1J9CH 2Z9GA 1A5GH 1O5CB 3DSPA 3ZZ5A 1IQFA 3UOPA 1T31A 2AGIX 3F9GA 2ZU2A 2HGTH 4SGAE 2FWWA 2V6NA 3A7WA 3PMAB 3RU4D 2TGTA 2W3IA 2HNTC 2A2XH 4X6MA 4UD9H 2HVYB 1V2LT 3ZVFA 4RN6A 5FAHA 2A4QA 5C1XA 3MU5A 1TBZH 2LPRA 3RXGA 3P95A 3SUGA 2WSSD 1EPTB 1P57B 1G2LA 3TJOA 1PYTD 1S5SA 2P8OB 1MCTA 1ZJKA 2XRCA 5CHAB 3ZVGA 1BTYA 1D3QB 2UWPA 1K22H 2HWLB 4K8BA 2STBE 4X2WA 2GDDA 2CHAB 1H8HD 1V2KT 3E0PB 3M5MA 3FZDA 3RXBA 3BIVH 3RC4A 1WDIA 3HKIB 4YOIA 3OTPA 3TK5A 3M5OA 3TK6A 4FU9A 2PWXA 4RKJB 1KDQA 1AD8H 3RLWH 2F83A 2GDEH 4K69A 1NN6A 1LHDH 2BZAA 1O2PA 1L1JA 4MTBA 3PRBA 2VNTA 1AVGH 2BVXH 3GICB 3GCNA 2Q1JA 3IWMA 4UONA 1C2MA 2YMSD 1EB1H 1C5MD 1A2CH 3A8AA 3L33A 3SNBA 4NGAH 3BEIB 2BHGA 4B2CA 1OWDA 4BAHB 1YKTA 1S0QA 2Z9JA 3PO1B 2H6MA 1UK2A 1TGNA 5LGOA 4ZCNA 2NU0E 3SNCA 1P2IA 1FDPA 2PHBA 1WTGH 5CMXH 1A61H 5LH8A 1VITF 4Y71A 3IG6B 4WWYA 1DITH 4Q63A 1MD7A 1RIWC 3M3TA 4IN2A 1IQGA 1GCDA 3SV7A 4HI3A 2AYWA 3URDA 2BLOA 1O3BA 4AFQA 3ZZ9A 3L3TA 2ZF0H 1W8BH 1AB9C 3R0FA 3HKJB 5A8XA 3VGCB 2OC1A 3LIWA 3ZYDA 3DD2H 4ZMAH 3DFLA 1C2LA 4XE4A 3UNSA 4B1TA 1ZHMA 1G2MA 1G3BA 1FI8A 5DP3A 3DFJA 3PTNA 2JH0D 4IN1A 5ESBA 2GZ7A 5JBTA 2BLVA 4E05H 1EZQA 3QK1A 1N1LA 3BEFB 3HK3B 2BXUH 2J95A 3S0NA 2PV9B 1NPMA 2F9PA 2PKAA 1P9UA 1HAOH 2Z7FE 1DX5M 3E6PH 3GDVA 5EXNA 1EQ9A 1O2HA 4ABDA 1HJ8A 4MPUA 7GCHG 1MZDA 1V2OT 1WSSH 3SJOA 1TB6H 1O38A 2J34A 3N7EA 3SW2B 2ZC9H 2A4OA 2H1UA 1AIXH 1RGQA 1MCVA 2F91A 1NFWA 1SLWB 4X6OA 1CHOF 5C2ZA 1S83A 5C5NA 5I25A 2AS9A 1W7GH 4KTCA 2Q6DA 1TOCB 4JYTA 1AGJA 2WUBA 1FONA 2CMYA 3TNTA 3D23A 1IQIA 2B9LA 2BDIA 1SQAA 1SGDE 2CJIA 4RKOB 5AF9H 3DHKH 1A3EH 2FX4A 2VIDA 3UQOA 1UTNA 2A7CA 1K1JA 2ZFRH 4OGXA 1MTNC 4IMZA 4X8UH 1C5UA 3PB1E 1LKBA 4ABFA 1S81A 4J2YB 1O3HA 1J8AA 2V7QD 1ZSLA 1E37B 4FUEA 4I31A 2FLRH 1SHHB 1BTUA 3HPTB 2BXTH 1XKBC 1E35B 2EEKA 5JBAS 3KQDA 1FMGA 1O3CA 2JJ1D 1FUJA 4FVDA 3QO6A 4E06H 1OS8A 1SFQB 2BYAX 1DDJA 4YT6H 1QJ6B 1FXYA 3GY3A 2UUYA 2QC2A 1IQKA 4DW2U 1O2JA 2FODA 1GMDG 2ZTXA 3BN9A 1O3EA 1TGSZ 3EA8A 4CHAC 1O2UA 2C8XB 4YLUA 2GMTC 1PYTC 2ZU1A 1TX6A 4YO9A 5E2PA 1GJBB 2ZCKP 4U01A 3URCA 1KXBA 3GCOA 3PROA 4GLYA 4X1SU 2XC4A 3Q76A 3GCTG 4ABEA 5CDFE 2VIOA 2WPHS 2VGCB 1OXGA 4X6PA 4F49A 1L4DA 2WPJS 1CT2E 3TITA 5FPYA 1VZQH 1MU6B 2QAAA 1EUFA 5EG4A 1GDNA 4YXWD 1C4V2 5GJ4B 3UTUH 1IAUA 3F3BA 2OQ5A 3GOVB 1DWCH 2YMSC 1PQ7A 1BIOA 2JDID 1G9IE 2UUKB 3K6YA 4CBOA 1E1RD 1FY1A 2XTTB 1SLXB 3SU6A 3O8RA 1H8IH 3F2GA 1K1IA 3UB0A 3BTDE 4WXVA 4KTUA 2A4GA 1PPBH 4MLFB 3RXHA 4FUBA 2XC5A 5C67A 1U6QA 1ETTH 2PKSB 3LJJA 3ODFA 2TRMA 4Y10E 3LGWA 4NSYA 4DCDA 2PSXA 1GBHA 3A88A 2Z9KA 1WOFA 2QV1A 1Y5UT 3U8RH 2OC8A 4TWWA 1A0LA 1OWJA 3GYLB 2ZP0H 2ZGCA 1C5RA 2BB4A 4YOGA 3PMHB 1HAGE 2ZNKH 1DOJA 4CRDA 1QB6A 2CHAC 2VWLA 3PTBA 4A1VA 1GVZA 2ZGXH 1KLTA 3ZVBA 1FY5A 1V6DA 4IMQA 3RMNH 1YPHE 5J4QA 2LNCA 1K1NA 1O33A 5HIZA 1AE8H 1CT4E 4MPXA 3M7QA 3EGKH 2ZU4A 1ELBA 1MAXA 3GY6A 3VXEH 2BDBA 3F2FA 3V3MA 1GBIA 4AX9H 1LVMA 1IQHA 2EQNA 5FPTA 4JZEH 3Q3KA 1T7CA 4Z1MD 2FOBA 1D3PB 5JBCS 2ASUB 4XSKU 2UWLA 3SJIA 3FVFB 1DY9A 2D2DA 3QN7A 2W26A 5EQQA 1C1UH 2ZDMA 3UY9A 1INCA 3RXTA 4I32A 2ZDAH 2IPHA 3TLOA 4DY7B 2VU8E 2XBVA 2ZIQH 2RFKC 1ZTKA 4ZXXH 1C1MA 2ZI2H 3T29A 1BMFD 1BDAA 2IPQX 1AKSA 1ANCA 1NRPH 1G3DA 4IS5A 3GS9A 1EASA 1C5LH 3QGJA 2ULLA 1J16A 4CH8B 1SR5C 3GCHC 5JB9S 2BX4A 2CXVA 4GHTA 2ODYB 2TGAA 4VGCC 1DWBH 1PPFE 1UCYH 1SGTA 3ZZAA 1YGCH 3UNRA 1UK4A 1SGYE 4MDSA 2FXRA 4ZHLU 3VGCC 4XDEA 1QL9A 4INKA 1IHSH 2AHME 1LQDB 2HOBA 3E1XB 1ANBA 4JZFH 1UCYK 1HAVB 3UREA 3KQEA 1HXFH 2WPKS 1J17T 3B8JA 1GWAA 1Z7KA 3UR9A 4TPYA 3A8BA 1MTUA 1QTFA 3MO9A 4I8LA 3A7VA 2Y7ZA 3PLBA 3OYPA 4ZROA 3BG4B 1NESE 1OP0A 1T32A 5A09A 1W10U 1DFPA 4NWKA 4H6TA 1D9IA 4B73A 3MHWU 4Y8YA 1MU8B 1BBRH 2FTMA 4ABBA 1YY3A 2VJ1A 1KLIH 5DP5A 1CA0B 3TNSA 3SZEA 3RM0H 2XNIA 1Y5AT 4TWYA 1O2IA 1C1PA 1GBLA 2BQWB 2A2QH 1BT7A 4DIHH 2ZECA 2HLCA 3F9HA 3U69H 1BBRK 1SBWA 2AIPA 1QURH 3P8GA 3ZV9A 1EP6A 1NY22 1O2OA 2TGPZ 1NM6A 1YP9A 2QE7D 3FP8E 3MFJA 1NU7B 2JKHA 1CBWC 5E8EH 1HRTH 5GWZA 2GTBA 4TY7A 1A4WH 1P3EA 3I29A 3WY8A 1C2GA 3GY5A 4NFEA 2AGGX 2VIPA 5HM2A 4Y0ZE 4ABIA 4K2YA 2SGQE 2QXHA 3LGYA 5EPYA 3KL6A 1SL3A 2G5VA 1F7ZA 4NG9H 1ETRH 1VITG 4NIXA 4WVPE 1LMWB 1FQ3A 4FUFA 3SNAA 1VITH 3UOUA 1Z8JB 1QBVH 5EIYA 5H4IB 2G4UA 3M37A 1BMAA 5C94A 1ZPZA 3SUEA 1O32A 1S6HA 1AFQC 1F0RA 1SLUB 2GCHF 1G36A 1AI8H 5EODA 3L6PA 1ZGIA 1KDQB 5A0AE 4B2AA 5L6NH 1UCYE 1ZLRA 1CVWH 3D65E 3KN2A 2M2AA 3VB3A 1OWEA 4CRBA 1GL0E
chains in the Genus database with same CATH topology
1HIAB 2NU2E 2AIQA 1GHWH 1ZOMA 3LGTA 1UVSH 3B23B 2OUAA 4UFDH 1GI5A 2J4IA 4AB9A 1YCPH 7ESTE 3LGVA 4CREA 1QQ4A 1D6WA 3ZZ8A 3U9AH 2R0LA 1EZXC 1XXFA 3NUMA 2VGCC 2YNBA 4B75A 3OTJE 2H5CA 1ZHPA 4CR5A 2VVCA 2DUCA 3M3VA 4NZQA 1ELGA 2ANYA 1BBRE 4LZ4B 1HYLA 1THPB 2SNVA 4I33A 1UHBA 1ORFA 3MH4A 2FDAA 3M3SA 1MKWH 3A80A 1C1SA 1LHGH 4DIIH 2FPZA 3V7TA 3SGAE 4U32A 1YLCA 3NPSA 3CENA 1C1WH 1O2YA 1TAWA 1C2DA 2VH6A 1LHCH 3T27A 1K2I1 2J2UA 1MKWK 1QJ7B 1KXFA 1V2WT 3FP7E 5DG6A 5E2OA 4YOJA 3BV9B 1ZPBA 5F6MA 3E3TA 1LVYA 1P12E 2G4TA 2O8WA 5JBBS 4GVUA 1OWIA 3QDZB 2KAIB 4E7NA 3A84A 1TPOA 3SQHE 4BOHA 1DANH 5HXFA 3IITA 1DE7H 2GCTB 3Q3XA 4X1PU 1TA2A 1KY9A 1OYQA 4NA8A 2H9TH 4FUJA 1UVUH 1YBWA 5FCRA 3A89A 1GMCG 2HRVA 9LPRA 1UTQA 1JBUH 1GDQA 1ANDA 3U98H 1SQTA 1KXAA 2FI4E 5C1UA 4GSOA 1E36B 2OC0A 1AZZA 1O2MA 1O39A 3SU0A 4MNXA 2Q6GA 3UFAA 2UWOA 1XX9A 1GJ8B 1P2OA 1GJ5H 1Z6JH 1C5SA 1NU9A 1SOTA 5DKMA 1YPKH 1MKXK 7KMEH 4AFSA 4O3TA 2BMGB 5A2MH 2P93A 3ZVCA 3K65B 1MBQA 2P59A 1GBMA 3NCLA 2BDCA 1LPGB 1S82A 2STAE 1SB1H 5I46H 1GJ7B 5A8YA 1C1RA 2CF8H 2JETB 1CHGA 1DLKB 1Y3YA 4GPGA 3SO3A 1SGFG 4LK4A 1JXPA 2WYJA 1GVKB 1TMTH 1TMBH 2XBWA 4D8NA 1Z71A 4X8VH 1L4ZA 2C8YB 2GGVB 1OWHA 1C2JA 1UVPA 4X8SH 5E0HA 3MI4A 4A92A 2O9QA 2Z3EA 5IYTA 3LU9B 1C5OH 1QHRB 2DE8A 1ELAA 1ESAA 3CS7A 4Y11E 1BJUA 3VFEA 2BD3A 3H7TA 1K28D 2OLGA 3KNXA 4WH8A 3SU5A 4Q7YA 1W0YH 1TYNA 4GUXA 1EKBB 4ZKOU 1JOUB 1HAIH 4CRCA 1QBNA 1O3FA 1QR3E 4Y7AA 1O2QA 3RU4E 1BTPA 2BY5X 1UMAH 4CBNA 2ZFPH 4B71A 3MU0A 3HGPA 3SN8A 2VIQA 4WF8A 3EQ0H 1SVPA 3MNXA 4I8GA 4R8TB 3ZVAA 3BTME 1DS2E 4Q2KA 3LT3A 2PFEA 3H5CB 2ZCHP 4DGJA 1OYTH 3LGIA 1A46H 3D49H 4LOYH 1PPCE 1BTXA 2PGBB 4Y79A 4RSPA 2ZHWH 3RLYH 2AGEX 2O8TA 1CQQA 3K2UA 3UWIA 4LZ1H 2HPPH 2SGEE 2VH0A 3M61U 1GDUA 1MQ5A 3BTWE 3P8NA 3TH3H 4ISIH 1BMMH 1OKXA 2R3UA 1O30A 1FNIA 1TA6A 1DY8A 2PTNA 1EAIA 3EYDA 1H8DH 2ANWA 1TRNA 2ZHEH 2P94A 4GCHF 1QB9A 2ZDNA 4K5ZA 5GIBA 1C4Y2 2SGDE 1T8OA 1LKAA 3O8BA 4X2VA 3RXRA 6CHAC 1WUNH 3MO3A 3LH1A 3AW0A 3NXPA 2XXLA 1MQ6A 3ZZCA 2R2WU 1ZMNA 3A82A 1L0ZA 3RM2H 2QGRA 1ETSH 2G5NA 4BXSA 5L30H 1W3CA 1AUJA 2FLBH 4XOJA 3OY6U 3N7OA 2FOAA 2AMDA 3DT0H 2I6QA 3LPRA 3RDZA 2PR3A 3U8TH 1VCWA 5EQSA 1SMFE 4KGAA 2Y81A 1T4UH 3OY5U 5F8ZA 1GCTB 2PLXA 1HXEH 2WPIS 1EAUA 1YPMH 3ATLA 4O97A 4H6SB 1T8NA 2QXJA 1IQEA 1O2VA 3QUMP 1W11U 4D7FA 4Y0YE 1W7XH 1FY8E 5GCHF 3T2NA 1L1NA 2XC0A 2ZDVH 3MH7A 1ELFA 2ALVA 3SU4A 2TBSA 2ZFSA 3H7OA 4AN7A 4X0WU 2YNAA 2ZEBA 2Y5GA 5DP9A 2BZ6H 3KCGH 1QY6A 1Y3XA 1MMJN 1KTTB 1O3OA 1WU1A 4BTIB 4INHA 1OSSA 4CRGA 4WMFA 1GHAG 1XUJA 1O0DH 3BEUA 1AKSB 2A45B 3O8CA 2XCNA 4JZIA 5GDSH 2BX3A 2Z3CA 1IQMA 1HJAB 1F0TA 3JZ2B 3SNEA 4D76A 4X1NU 2ZCLP 5E0JA 4ABJA 3EAJA 2B5TB 3TGIE 1ZJDA 1C5XB 1SGFA 1HUTH 1UTMA 1GG6B 2GVFA 1TGCA 3TGJE 2R0KA 1GHVH 2H9EH 4AGJA 2V3HH 2ZFTA 5JDUB 1T8LA 1NRRH 4BAQB 1PPHE 3M35A 4BAOB 1EZUC 3Q00A 1IQNA 4AG1A 2FP7B 4NCYA 1RTKA 1F2SE 2WINI 2M5TA 1H9IE 4Y8XA 1KTSB 2AMQA 1MTWA 1UK3A 3VB6A 3AASA 3AW1A 1NROH 1NRSH 1AO5A 8ESTE 1BUIA 4K1TA 1BA8B 4UFEH 1QQUA 2GCHG 6GCHG 2I6SA 3RU4T 1VGCB 1Y3WA 2FI5E 2BOHB 5EW2H 2OINA 1QA0A 1TPSA 1DSUA 3SGBE 2FX6A 3RXEA 1AFEH 2BD5A 1EB2A 1THRH 3F6UH 4X2YA 3AAUA 1SGIB 3DUXH 2VIVA 4HTCH 5TCCA 2Z94A 2VWOA 1BMNH 2WV4A 2BM2A 1ZGVA 1W12U 2CGAA 1UTPA 3ZZ4A 1RS0A 1XXDA 1DUEA 4O3UA 2SGPE 5TJXA 1K9OE 1ZSJA 4JYUH 2ZHFH 2ZDKA 5EPNA 1O3IA 4A7IB 1A5IA 4FUIA 4A1TA 1C1QA 2SGFE 2Y6TA 4I8JA 2ZPQA 1AN1E 5AHGH 2QXIA 4FU8A 1K21H 2BVSH 1XKAC 2OCVB 3SUFA 1EPTC 5T6GA 1O37A 1Z6EA 1DLEA 2P8OC 5CHAC 3GDUA 3SV2H 2XYAA 1FZZA 2ODQA 4R0IA 4D9RA 2XCFA 1P10A 1BJVA 1CT0E 3ATIA 1MD8A 2B7DH 4ABGA 1TGBA 3RXAA 3Q3YA 2PGQB 1E34B 4UE7H 3ZZ7A 1N8OB 1HNEE 1P11E 1CO7E 1KIGH 4DJZB 1LHFH 1B5GH 3FFGA 2RG3A 3ENSB 5DK1A 1PPZA 1CA8B 5EU8A 4YLQH 2OTVA 4YESB 2D26C 3TPIZ 1FN6A 3MTYA 3HK6B 1BTZA 5A0CA 3MYWA 1EZSC 3KF2A 5AFZH 1TE0A 2GKVE 4D9QA 1YF4A 1W14U 1DWEH 3QGNB 4Q7ZA 1TNLA 2FI3E 1O3MA 2ZTZA 1ZSKA 1GHYH 2J9NA 4X8TH 2EI8A 1C2HA 1GBKA 1TALA 3E91A 1V2TT 2OBQA 4GAWA 1S85A 4X1QU 3RXJA 2QF0A 2A5KA 2A7HA 3PO1C 1GVLA 5BRRE 1QNJA 1FV9A 1HGTH 1TPPA 1UHBB 1GHBF 5JB8S 1TOMH 1TNGA 1C5YB 1O2WA 5T6FA 1F0UA 4BNRA 1XUHA 4ISNA 3BTQE 2QCYA 5EGMA 3SV6A 1HPGA 4JZ1A 5FXLA 1LPKB 2R3YA 1QB1A 5BPEA 3QTVH 5TCAA 1F5KU 1VJ9U 2EA3A 1O5AB 5F8TA 1GJCB 1QA7A 1CGIE 3KHVA 3RXKA 1ESBA 1PFXC 1ZTLA 2XWAA 4Q80A 1M9UA 2F9OA 2ODPA 5FBEA 4AFZA 2O8MA 4WMDA 1NZQH 2QXGA 1MUEB 2Y7XA 4K1SA 1SGRE 1WV7H 4HZHA 3P92A 2BDGA 4PROA 4U2WA 2PTCE 1P06A 2YOLA 4UDWH 5FPSA 5B6OA 3RXPA 1OPHB 4CH2B 1JIRA 5DP8A 3BTKE 1Q2WA 5EOKA 3MNCA 2BLWA 3A81A 1JMOH 1P02A 2FESH 4ZKSU 1EJNA 2BY8X 4B76A 1P09A 4FVBA 1EXFA 4IC5A 1O36A 5GXPA 2ZPSA 3SU3A 4WXIA 2Y5FA 3ZZBA 2Y5HA 1P2KA 4KP0A 4INLA 1O5FH 4IC6A 2Y80A 4BAKB 3RXCA 1Y5BT 2K1QA 2FOGA 1MH0A 4TPIZ 2FEQH 1YPJH 2WV5A 1FAXA 4H4FA 5ABWA 1IOEA 5LPRA 3ZZDA 3SI3H 3K6ZA 1XUIA 3ZZ6A 4MQAA 1XVMA 3TH2H 1PPEE 2ZTYA 1AVXA 4CRAA 1FIWA 1P0SH 3S9AA 3A85A 1O2RA 2BQ7B 4D7GA 3QWCH 1GGDB 3P17H 2V3OH 3GY8A 2Q6FA 3MNSA 2QIQA 1A1RA 2HNTE 4WH6A 3GDSA 1A0HB 1PJPA 1SC8U 1S84A 2V35A 1XUGA 4BAMB 5DP6A 1AB9B 1B0EA 1Y8TA 5DJ7A 1RTFB 3QLPH 1GBDA 4NIWA 1Y3VA 2ZHQH 4GCHG 3S9BA 3S69A 4HFPB 2AH4X 1DUAA 3STIA 4X1RU 5JPMH 1CGJE 1F5RA 1C4U2 1GG6C 1GBAA 2TIOA 3E90B 4ZUHA 5L2ZH 2NWNA 1NS3A 4QT8C 3LJOA 1TX8A 1O5DH 3P8OA 1TBRH 1J15A 3U1JB 2CF9H 1YPHC 1XVOA 3RMMH 1SG8B 8GCHF 4IW4E 4NFFA 1NC6A 3LGUA 1GMHF 1YM0A 1Y59T 4JK5A 2RA0A 4OS5A 5C1YA 1YCPK 3A7YA 2XWBI 2ZZUH 1VGCC 1W0ZU 3BSQA 1CE5A 1D3TB 3O8DA 4O9VA 3VPKA 5GCHG 2O8UA 4WY3A 2ZDLA 2ZQ1A 2RCEA 1Q31A 1ARCA 1CHOG 2BLQA 1Q3XA 1CSOE 3TU7H 4B74A 1EJAA 1B7XB 1EAXA 1WQVH 4OS7A 5A8ZA 4JK6A 3T62A 1MTNB 2G00A 4M7GA 3SJKA 1P9SA 1ELTA 5HM9A 3E0NB 1GI0A 1ZZZA 1C9TA 3M7TA 3AVZA 3UQVA 2F9NA 3A86A 3V0XA 4Q7XA 1BQYA 3S7KB 1JRTA 3MH5A 2BY7X 1TWXB 2WPMS 5JYIA 2H5DA 7LPRA 3DA9B 3SJ8A 1QL7A 2J94A 5HGGA 3TK9A 1Z8IB 4ZXYH 1WAYB 2PKSC 4NA9H 2CV3A 3FP6E 4AG2A 3LC5A 2RDLA 3BTFE 3G01A 1TNKA 1Z1IA 1HAHH 2PKAB 2A5AA 4NIVA 3BTEE 1ABIH 1H9LB 1JWTA 3F9FA 2BOKA 3RP2A 2PUXB 2D1JA 1DSTA 3SJ9A 1P01A 3S7HB 1S6FA 3MU4A 3BIUH 2ZFQH 3BTTE 1LVBA 1GI3A 3EDXB 1HAVA 1IQLA 4O03A 3HGNA 3W94A 4DOQA 4YM9A 3RXOA 1A0JA 1GHXH 1TGTA 1GJDB 2DE9A 4BTTB 4IGDA 4CRFA 4ISOA 1EOLA 4Z6AH 2IJOB 1E38B 5FX5A 1AE5A 8LPRA 2FOCA 2A5IA 2BDAA 3RXFA 3TGKE 1W2KH 3FAOA 2NU4E 1N6YA 3MO6A 2XW9A 1X7AC 5G4BA 2ZGJA 2ZGHA 1O3LA 2VVVA 5GPIB 1A3BH 2BVRH 4TYDA 4B2BA 2C8ZB 1BOQA 1ZMLA 4FUCA 1BHXB 1GBBA 3PV4A 2IOTA 3RXVA 1NO9H 1O2KA 1H1BA 5ESTE 2ZO3H 1GJ6A 1HFDA 3RMOH 1GI1A 3SUDA 2BD4A 1ZMJA 1GI4A 1PQ5A 3ATKA 2BDHA 4JZDH 3GY4A 4YZUA 1AU8A 3MMGA 1C5TA 2VIWA 1BTHH 2SNWA 4FU7A 4UFGH 1OOKB 4OGYA 1T8MA 2AEIH 4DG4A 3I78A 1DICA 4FUHA 5FBIA 1NT1A 4AB8A 1SFIA 1ZR0A 3GY7A 3F68H 2OBOA 4CR9A 1UVOA 1NFXA 3BG4C 2OQUA 1UO6A 1V3XA 1SSXA 3M7UA 3SV8A 1HBTH 2FMJA 1QBOA 3GYMA 4A5TS 1GBEA 5K7RA 1XUFA 1K1LA 1V2NT 5PTPA 3RXIA 1CA0C 1A5HA 1HIAA 1TFXA 3VB4A 1AWHB 4WJG2 3QZRA 3TIUA 1TX7A 5IDKA 1ZTJA 1O2TA 1ANEA 1FY4A 4Y6DA 1FY3A 5C3NA 1O2LA 1C9PA 4JMYA 3M36A 1WYKA 4UEHH 1TIOA 3ELAH 3SHCH 4LXBH 4NWLA 3UNQA 1GI8B 1J14A 1P03A 1THSH 1O2GH 1O3AA 2TPIZ 4K60A 2P95A 3F9EA 2SFAA 2ZU5A 2OC7A 4Y7BA 3ATMA 2ILNA 1P3CA 1CU1A 2XBYA 1PQAA 3T26A 4J1YA 4K3JA 1GGDC 4WMEA 3GCHB 2R2MB 1JIMA 3B9FH 1KXEA 1GHBG 4Y76A 4VGCB 3Q77A 1L2EA 1K1PA 2QA9E 1P2MA 5ETXA 1KXCA 2EC9H 1Z1JA 1V2JT 5LPFA 4AFUA 3V12A 3UPEA 5SGAE 1TRMA 1ELEE 2G81E 1DXWA 2ZQ2A 4E7RG 5DPAA 1QCPA 2GT8A 1DWDH 1GI6A 2G55A 1D6RA 2KAIA 1TRYA 2GT7A 3SU1A 1BCUH 1YPEH 3P70B 1KXDA 2VVUA 4UFFH 1UTOA 2A31A 1F5LA 1BB0B 1ZHRA 2C93B 1YPLH 2B8OH 1KLJH 2C90B 3SNDA 1FJSA 9ESTA 2ZA5A 1O3PB 2H2ZA 2UUFB 3ODDA 1G37A 4IBLH 1NFUA 1ZRKA 3RC5A 2AMPA 3NZIA 3SHAH 1AUTC 1O3KA 1BRCE 2Y82A 1GBTA 4ZAEA 3NKKA 1O2NA 1HJ9A 4MNWA 1QL8A 1QJ1B 3GY2A 5F03A 1QIXB 4DURA 1IHTH 1ZRBA 1CBWB 2F3CE 4KKDA 1QGFA 3T25A 3OU0A 4XFQA 1LPZB 2BD8A 3STJA 3A87A 2BY9X 1KSNA 3KQBA 1EAWA 4OS4A 2ESTE 1T4VH 1YCPM 2EI6A 3ESTA 1BTWA 5HMAA 5C20A 1C5WB