4DOQA

Crystal structure of the complex of porcine pancreatic trypsin with 1/2slpi
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
221
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Structure basis 1/2SLPI and porcine pancreas trypsin interaction
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 221
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA02
3C1KA 5JBAS 1ELVA 3Q3KA 5BRRE 1GJ7B 1HNEE 1O2VA 4O3UA 2Z9LA 1ELFA 1P2JA 5C2ZA 1YPKH 1KLIH 1DITH 2Y6TA 1C1QA 3MH5A 1FN8A 1T8OA 2ANYA 1HPGA 5T6DA 2UWLA 5AHGH 1HV7A 1Y8TA 1Q31A 1GVZA 1TOMH 1O3IA 2W3KA 3RXTA 3FANA 1H8DH 1UVUH 3AAUA 2GV6A 2AGEX 2BVXH 1OOKB 3MU0A 2ESTE 1TRNA 3PMAB 2AFQB 4TY6A 3R3GB 3RXUA 1CT0E 3TNSA 3RXVA 3VPKA 3LC3A 4MPWA 1LVMA 3ZV8A 4NIWA 2BQWB 3LONA 2VU8E 1VZQH 1Y5UT 1C2DA 2Y5HA 2F9UA 1GI9B 2UUYA 1AMHA 1OSSA 1KLTA 1O2YA 4E05H 1C2GA 4NWLA 3LH3A 1LDTT 2BVSH 5JYIA 1D4PB 2GP9B 1TBRH 4A1TA 1K9OE 1BT7A 3GYMA 3BG4C 1MZDA 2CF8H 2PKSB 1XUIA 3C27B 4FU7A 1GI4A 3GCHC 1PPBH 1TGCA 1CBWB 3RXQA 3VGCB 3ZZ6A 3RXFA 1FNIA 1P11E 2ZECA 3OY6U 4K5ZA 1O37A 3P95A 5EPYA 2BLWA 2HRVA 1ELEE 4ABGA 1NC6A 3QZQA 4J2YB 8GCHF 1EX3A 2J9NA 1DUAA 1S82A 3HGNA 6CHAC 2AMQA 4FUIA 2A45B 3UFAA 3P8OA 3S9CA 1K1NA 1C5TA 4LOYH 2Q6FA 1AUJA 2C8ZB 3V12A 2CXVA 2I6QA 3A8CA 1NU7B 3BTFE 1ANDA 5FBIA 1MKWK 1N1LA 1O2QA 4VGCB 5BPEA 5EQQA 3TLOA 1JXPA 3CS7A 1C4U2 1SQAA 5EW1H 3ATWA 4CRAA 1O33A 1ZRKA 1O3JA 3ZZ3A 2CHAC 3EGKH 2BDBA 1KDQB 4FUEA 1C1SA 3TU7H 1AFQC 3SU4A 2XNIA 1C5QA 3RXJA 3Q77A 1GHXH 3D49H 3U8RH 1O5FH 3F9EA 3GISB 1ZZZA 1Y3UA 2ZGBH 1GBDA 2BQ6B 2ZCLP 5L6NH 2IPHA 3TGKE 1NFYA 3B23B 5A8YA 3S0NA 4GLYA 3FP6E 2GD4B 1NO9H 2WPLS 2QGRA 3VB3A 3EA9A 3SV8A 4BAHB 1FAKH 1ZHMA 4ESTE 2ZTZA 1FONA 1GHBF 2VIDA 4CRFA 1JWTA 5TJXA 3SQEE 3MWIU 4B74A 2HPPH 1TX8A 3R0FA 9ESTA 3GCTF 4NCYA 4YOIA 3ZZ4A 1TNHA 5LPEA 1MD7A 5JB9S 4JCNA 4UEHH 3A8AA 3MYWA 3MOCA 2WUCA 2ZF0H 2ZG0H 1HDTH 4FVDA 3QO6A 1SGCA 1UVOA 2UWPA 4ZMAH 4WXIA 3SV2H 3IITA 3Q3YA 3VB6A 1PYTD 2GDEH 1GHWH 2BDAA 2A5IA 3PM3A 1C2LA 3V0XA 1KXFA 1HBTH 1SVPA 5I46H 4CRBA 1GBKA 4A1XA 4CH8B 1O2LA 2B5TB 1HB0B 3QGNB 1O5GH 5HGGA 1THRH 4SGAE 4Y6DA 1MD8A 2BY5X 4GSOA 1IQMA 1YPJH 4OS7A 3F9HA 1BDAA 1GBJA 1F5KU 1NRNH 1OWIA 2QAAA 3P8NA 2FLRH 3UOUA 1QRWA 4JYUH 1TPOA 4GAWA 2ZHDA 8ESTE 4KTCA 4DURA 1F0RA 3DD2H 1INCA 1C5RA 4DG4A 1O2HA 2ZHQH 4MNXA 4O97A 1CA0B 3PROA 4BAQB 1TMUH 2R9PA 2FEQH 1O3HA 2BYAX 4NIXA 4X6PA 1K21H 1WBGB 2ANMH 1HAPH 2VVUA 3UNSA 1NRSH 1PYTC 5A8XA 1HAVB 2VWMA 1IHSH 3SHAH 4NA7A 3SQHE 3SU2A 2PWXA 1Q3XA 1AIXH 2WYGA 3U1JB 1CGHA 2A32A 2R0LA 3P17H 1AZ8A 1PPHE 2NWNA 1UCYE 1AB9B 5TCAA 2FOGA 5HMAA 4NIVA 5C3NA 1FY5A 1UHBB 5EQRA 1MTSA 2WPJS 2FS9A 1Z7KA 4DJZB 2SGDE 2WPHS 1GJDB 4FUFA 3TIUA 1NRPH 1YM0A 5EU8A 1HAGE 1P06A 1DX5M 2P8OC 4HZHA 1L2EA 4MQAA 1SLXB 4NFFA 4KP0A 1O3BA 1QJ6B 4IC5A 3LH1A 1ZHRA 1V2LT 2SGEE 1BOQA 1ZLRA 3MI4A 4D7FA 5ESTE 3AW1A 2XBVA 1WOFA 4WF8A 3M36A 2V3HH 1S85A 1OWJA 1C2EA 4DOQA 1K1MA 3LC5A 1KTSB 3UWJH 1MTUA 1D3QB 2OC1A 3SV6A 1RIWC 1O2MA 1GHAG 2P3FH 3RXHA 2M5TA 4Y0YE 3SU1A 1DXPA 1EPTB 2V35A 4CHAC 1P04A 5HXFA 1GI0A 4BXWA 1GDQA 1MBMA 2OQ5A 5EG4A 2A7CA 1AKSB 3BV9B 3MU5A 1GG6C 1O2RA 3M35A 1HAOH 3TJUA 5LPFA 1C1PA 2OLGA 4RKOB 2A31A 2BLOA 2XBWA 1MBQA 2V6NA 3M5LA 1E36B 3BTDE 2ZDNA 1QCPA 2HNTC 1TABE 3U1IB 3BTKE 2BD7A 3E8LA 2NU3E 3SBKA 2ZP0H 2Y82A 3T25A 5K7RA 4JZEH 1SQOA 3SUDA 2ZTXA 2CJIA 1GI2A 1FZZA 1GL1A 1G3DA 5T3HA 4KGAA 2FZZA 2FLBH 3LJOA 1C1TA 1DY8A 1G37A 1LCYA 2GDDA 1O3PB 2QXHA 3PLBA 3UR9A 1W0YH 3MNSA 1W0ZU 1Z8JB 1BHXF 5DP5A 5ESBA 4X1RU 1UVTH 1A1RA 4H6SB 1O39A 3AAVA 3SV7A 5DP8A 3ELAH 1P2QA 4AG1A 1W2KH 1Y5BT 2ZEBA 1QHRB 4TPIZ 5JBTA 2BLVA 1MU8B 1PQAA 3RXPA 1K1IA 4MNVA 1FLEE 1KDQA 2ZNKH 2BXUH 1HJAB 3W95A 1SFQB 1WQVH 2Z9GA 2BHGA 2ZC9H 1O3EA 3MFJA 5CHAC 3SJIA 2D1JA 1SMFE 4RKJB 1XKBC 1GBBA 2BLQA 1WSSH 4XFQA 3TK6A 2FIRH 1A7SA 2XWAA 1V2RT 3U69H 2ZZUH 5EXNA 2FOHA 4OGXA 2ZA5A 3RMMH 5E8EH 2J34A 2JH0D 3M7UA 2CMYA 4ZAEA 4NWKA 1GBEA 3UPEA 2XBXA 2XRCA 2OTVA 1CT4E 1E35B 1C9TA 1F5LA 2PKAA 4ZUHA 3MO9A 1FXYA 4OS5A 4XBCA 4YZUA 4WMEA 3LGIA 2XWBI 1NU9A 1W13U 1ZMLA 3O8BA 3T28A 3E16B 1MKXK 3M61U 1FY1A 2FDAA 1N8OC 1ARBA 3QDZB 5EXLA 2EEKA 2H9HA 1O2UA 1FN6A 1EUFA 3HK3B 4ZKOU 3EAJA 4UFFH 2ZWLH 3GCHB 1NY22 1GVKB 3URDA 4MNYA 2A5AA 1TGSZ 4B2CA 1IQLA 1JRSA 5CMXH 4GVUA 1G3BA 1OXGA 5C5NA 1PQ5A 2ZU2A 1QL9A 3KL6A 4D9RA 5EODA 1A3EH 1YBWA 1RS0A 1G9IE 5HYOA 1O35A 1SI5H 2F9OA 2PTCE 1SOZA 1UTQA 3GDSA 3PMHB 3JZ1B 1DT2A 1F5RA 1C2MA 3S69A 4ZXYH 1UCYH 3UNRA 1SGQE 5L2YH 3BTWE 2PSYA 1GHAF 1M9UA 1OX1A 2QV1A 2Z7FE 2D26C 3ZZAA 2VWNA 3FZDA 2C8YB 1O2IA 3U9AH 4ABIA 2G00A 3BEFB 2A0QB 1QIXB 1HIAB 8GCHG 3MO3A 1JBUH 1IQJA 1W12U 1HRTH 1V2JT 3MU4A 8KME2 1KSNA 4RN6A 3A7WA 1HUTH 1P2MA 1HFDA 4NSYA 1D3TB 2BB4A 4MPVA 1BTYA 1TE0A 1EAIA 1ESBA 1O38A 2UUFB 1ELBA 2EC9H 3UUZA 4XDEA 1A0HB 4BNRA 1THPB 4D9QA 3BN9A 1GJ4H 4IC6A 3U8TH 4B73A 1C2JA 1TGNA 2GV7A 2C90B 2W7SA 4K3JA 2O8LA 3ENSB 4WJG2 1CSOE 1AGJA 1HAVA 4U32A 3P8FA 5F8TA 4B2BA 5E2PA 3K9XB 3QN7A 4XOJA 3QK1A 1VGCB 1EP5A 1ZSKA 1TPPA 3BIUH 2VIQA 4FUCA 3N7OA 3OX7U 4WWYA 1UHBA 3B9FH 5E0GA 1A3BH 1UK3A 1WTGH 1WV7H 3HKIB 1K1PA 3MU1A 5C1XA 1DANH 1ANCA 3FZZA 4ABDA 3S7HB 2O8TA 1MCTA 1C4Y2 5CE1A 2IJOB 3EA8A 3LGVA 5HM9A 3A88A 2WPKS 4Y11E 1YC0A 1DOJA 1GHBG 2AH4X 3SHCH 4INHA 1TWXB 4BOHA 1P9UA 2ANKH 3LGWA 1GCTB 4Y10E 1NZQH 5DGJA 2BDIA 4WMFA 1FMGA 3GY3A 1V2TT 2OBOA 2ZHWH 1ELAA 1XUKA 2G8TA 2PR3A 1O3LA 2BY9X 3NPSA 2ZQ2A 4Q80A 3RUOA 4AGJA 3KQBA 4Y8XA 1GMHF 1EAXA 1C5VA 2A2QH 1SGFG 2VVCA 2GVFA 2OCVB 4FXGH 1EPTA 2NU4E 1GDUA 4FU8A 1F92A 1Z1JA 2IN2A 1MMJN 2TGDA 1W14U 2A2XH 1YPGH 4TY7A 1AKSA 1BITA 4BAMB 7KMEH 4LZ4B 1XUGA 2GZ7A 1TA2A 1J17T 1TGTA 3I29A 2HOBA 2RDLA 3ZVAA 3ZZ8A 3MNCA 1QTFA 1ZHPA 1Q2WA 5B6OA 3LDXH 2GCTB 2G51A 3RLYH 3I78A 3KGPA 1WYKA 3K6YA 3RXDA 4A6LA 2OBQA 9LPRA 4DY7B 4I8JA 4XE4A 2RCEA 1UTOA 2FS8A 3UWIA 4Y8YA 1MU6B 3RXRA 2BDCA 4Y8ZA 4CH2B 3SU0A 1NESE 1X7AC 1QL7A 4ZHMU 3RLWH 1EB2A 1QBOA 3OY5U 3PMJA 2OUAA 2ZO3H 1V2QT 2F9VA 3V7TA 1T8MA 1C1MA 1ETRH 1Z6JH 1J16A 1V2PT 1O34A 1LHCH 1PPGE 1GI8B 2GZ9A 1DS2E 1QBNA 5EGMA 2BOHB 5FXLA 1GGDB 4KTSA 3KF2A 5EQSA 1CO7E 1SB1H 4Z6AH 2Z9IA 2ZKSA 3RMNH 2Y80A 2WV4A 1SG8B 3ATIA 2P16A 1MKWH 2XC0A 1GBAA 5E0HA 1EZUC 1DE7H 1BMAA 4R0IA 4AFQA 2ZDLA 3W94A 3S7KB 1XUJA 2FO9A 2Y5GA 1E34B 2H2ZA 1C5YB 3GY2A 3ATMA 2P3TB 3BTTE 2BZAA 2G55A 5ETXA 4AFZA 3BEIB 2R3UA 3FVFB 2QA9E 1L1NA 2UWOA 1GBCA 4IGDA 2JETB 2AMDA 1N6XA 1QB9A 1TALA 5AF9H 1QY6A 2BD4A 5T6GA 2W3IA 1H9HE 1AO5A 1IQIA 3SNDA 3HGPA 4GPGA 1YKTA 3A8DA 1C2KA 1TBQH 1PPCE 4F4OC 5LPRA 1O2NA 2D8WA 1TIOA 1P3EA 1UK2A 2R3YA 1T31A 2FOMB 1W11U 1G30B 1NN6A 1VCPA 1Z6EA 2SFAA 2VVVA 2EI8A 2YNBA 1NT1A 1TPSA 4Q7ZA 3UNQA 4U30A 1BZXE 3DHKH 1RTFB 4AFSA 3M3SA 4YT7H 3H5CB 2OC8A 1BBRK 1ZYOA 1O2XA 2FOAA 1WCZA 1QRZA 1SPJA 4CRDA 4FU9A 3UQVA 1AY6H 1MQ5A 1CHGA 1E38B 4AG2A 2SNVA 3SN8A 4AYYB 1ABJH 4B1TA 4ZKNU 2EI7A 3T27A 2Z3CA 2ZFRH 1UMAH 1Z1IA 2RA3A 1Y59T 2DUCA 2P94A 2PKAB 4X2WA 1BMLA 3A7ZA 1CGJE 4INLA 3VB5A 4KTUA 1C1WH 2STBE 4BTTB 2O8UA 4X1QU 2D2DA 3A7YA 2ZDAH 2Z3EA 1O2SA 1BCUH 1G36A 1MTVA 1D9IA 1A4WH 4RSPA 1HIAA 2HNTE 1J15A 2P59A 3PB1E 2QC2A 3SJKA 4R8TB 1SGDE 3QGJA 3LT3A 2GMTB 5C5OA 1A61H 3PLKA 1DUEA 1HJ9A 1K22H 1ACBE 4NZQA 3PYHA 5DO4H 2ZI2H 4YLQH 5DP3A 2BMGB 1IAUA 3HPTB 2R2MB 5AVDA 1PPEE 3NUMA 2BQ7B 1BIOA 2FOBA 3MHWU 7ESTE 1C5LH 1XKAC 1LKAA 1F2SE 3QUMP 1XVMA 1P02A 4SGBE 1CA8B 4ISNA 4ZHAA 3SJ9A 2V3OH 1BJVA 6ESTA 4D7GA 2XTTB 3E90B 4GCHF 4TWYA 1XUHA 1GMDG 3A7VA 2HGTH 2J38A 3F9FA 1AFEH 3LGUA 2XXLA 3GOVB 1DY9A 2FOEA 1EZQA 4IMQA 1A5GH 3T29A 3M5OA 4AX9H 4I7YH 3PLPA 1ELTA 5FX6A 1A46H 4DIIH 3KQDA 1MTNB 4UFGH 4ABAA 1A0LA 1TNGA 1GI5A 2FPZA 2ZDKA 5FPTA 4AORA 2VGCB 2FMJA 1UTKA 4MTBA 1KXAA 1TGBA 1BRUP 2Q6DA 2F9BH 2Y7XA 1SLWB 1DM4B 1S81A 1LPGB 2VH6A 2ANWA 2OP9A 1LVBA 4FUJA 2BTCE 2PUQH 3EDXB 3TJVA 4AB9A 1BTUA 3PMBB 1OP2A 1T32A 2ZGCA 2JH6D 4M7GA 1NPMA 1UVPA 1HCGA 2VIVA 1HLTH 1ZSLA 1HXEH 2QYIA 2Y5FA 4IMZA 2PKSC 2FX4A 1BTZA 3KCGH 4MPXA 2A4GA 3BF6H 1QJ7B 3RC5A 1CBWC 4AN7A 3VGCC 1RTKA 3UQOA 2FX6A 4I8KA 1K1JA 3CP7A 2G4UA 2BX4A 1RJXB 4LZ1H 2C4FH 4Q2KA 3LGYA 2ZDMA 1ZGVA 2ODPA 4K1SA 1O2WA 4IS5A 1IQEA 1WTHD 1QA0A 4MDSA 3GDUA 4Y79A 5K0HA 1TA6A 1DDJA 3UOPA 4YO9A 1MH0A 4YM9A 1SLUB 3GCNA 1ZSJA 2A4OA 3M5MA 2GTBA 3BIVH 1GJ9B 4VGCC 4CREA 4LXBH 2NU2E 2FESH 3SU5A 3SNBA 1XX9A 1XM1A 2QXIA 1AVGH 1DWEH 1HYLA 3ZYDA 1AD8H 1ETTH 1UTLM 4A92A 4OS4A 3OSYA 4WVPE 2ZHEH 1TPAE 4MPUA 1AE5A 1SBWA 1T8LA 1W7GH 3RM2H 1UVSH 3HK6B 3ZZ7A 1ABIH 2FI4E 1F0TA 2AEIH 5A0AE 5GPIB 1LQDB 2TIOA 3SGQE 3SO3A 2F3CE 1C5MD 1CVWH 1LHGH 1KXEA 1UO6A 2FODA 3K6ZA 1AVWA 1Z8IB 1ZJKA 3D23A 4X8TH 4LK4A 1EJAA 2HWLB 4I31A 3VFEA 2EA3A 2B0FA 2K1QA 4X0WU 3HATH 1UTPA 1A5IA 2ILNA 2Q1JA 2EI6A 3ZZ9A 3ZZ5A 1CHOF 3RC4A 1TFXA 1P57B 2STAE 1IHTH 3RU4T 4O3TA 1ZRBA 5SGAE 1OKXA 1AWHB 3NXPA 2W5EA 1PJPA 2FYQA 2WPIS 4I33A 4I8GA 1O2JA 1P12E 4KKDA 5J4SA 2Y81A 2ALPA 1MUEB 3RXIA 1EP6A 1GBIA 2BXTH 4JYVH 1AUTC 1GMHG 4DW2U 1KXDA 1T4UH 6LPRA 1GMDF 2H5DA 4YESB 3MTYA 1FY8E 1FQ3A 1SGPE 4GHTA 1AE8H 4THNH 2H1UA 1AU8A 3A8BA 1MKXH 4H4FA 2CF9H 1JIRA 4ISIH 2I6SA 3GCOA 3TK9A 3ATKA 4ABFA 2ZFFH 1EAWA 1YPLH 3RDZA 1ZMJA 1KTTB 1EXFA 1O3FA 1GJCB 4FUGA 4UE7H 1KLJH 1HAIH 1QL8A 4IW4E 4X1PU 1P2KA 1TX6A 3ZZDA 2KAIB 4B76A 4X8SH 2H9TH 2XCNA 5FPSA 4A5TS 4WH6A 5DK1A 2O8WA 3QX5H 1RD3B 2RG3A 8LPRA 1NRQH 2ZPRA 2J4IA 1GCDA 2A7HA 1THSH 2C8WB 3LU9B 1C5OH 4AOQA 4YOJA 3SI4H 3PWBA 3BG4B 2G4TA 4DT7B 3GY8A 1V6DA 2FYRA 1ZPCA 4JZ1A 5DPAA 1BHXB 1FPCH 1ORFA 2BM2A 3ESTA 1CA0C 3KNXA 3DFJA 4BTIB 1IQKA 1XXFA 4X1SU 3WY8A 3ZVDA 3P70B 4BXSA 4DIHH 1LPKB 1BBRE 2OC7A 1DWBH 2J95A 5DP7A 3UR6A 1UTNA 1LPZB 3Q76A 3NWUA 2FXRA 3RXGA 1SGNE 4UD9H 1O5BB 1O3OA 6CHAB 1PQ7A 3O8DA 1TX7A 3E0PB 5C1UA 3SOSA 5TCCA 1AB9C 3ODFA 3A7XA 1GJAB 1W8BH 2A1DB 1V2MT 1GBMA 1DXWA 3JZ2B 2PGQB 2G5VA 3MNXA 2BD2A 3VEQB 1TB6H 5FHTA 2CHAB 1GVLA 2VJ1A 2GT7A 7GCHG 1RFNA 4QT8C 4NFEA 2BZ6H 1AFQB 3MH4A 2BY7X 2G5NA 4CRGA 2ULLA 1LQEA 1S83A 5C20A 1YLCA 1ANBA 3UREA 1GHYH 2QXJA 1EJNA 1TNJA 1OWHA 5LGOA 4NGAH 3PO1C 4BAOB 2BY8X 3L6PA 3E0NB 3BTQE 1EPTC 1SGFA 1H8IH 1YCPM 2C8XB 3F1SB 2Z9KA 1VJAU 5F03A 3P6ZB 4K69A 1GMCF 1BRAA 4MLFB 3RMOH 1VITH 2W7UA 3E91A 3VXFH 4X6OA 3SNCA 1BMNH 2ZTYA 1OPHB 1VCWA 3MMGA 4YOGA 4J1YA 1ZMNA 1N6YA 3TPIZ 4CR5A 1UJ1A 1BTPA 4I32A 1P2OA 1TNKA 3F6UH 4UONA 1NRRH 1FUJA 3RM0H 1IQGA 1GI1A 4X6NA 5PTPA 2BDYA 3M3TA 5I25A 2QXGA 1C9PA 3ZYEA 3EE0B 3TJNA 3VXEH 2HLCA 3F68H 1G32B 2CV3A 5A0BA 2QF3A 4ABJA 2FOFA 1F7ZA 2FP7B 1MTWA 1O2OA 2WYJA 1L1JA 2XW9A 3MH6A 1ZR0A 3SGBE 3FP7E 2SNWA 3VB7A 1JRTA 1FV9A 1VITG 3K2UA 5L30H 1KYNA 2ZHFH 1SL3A 3SJ8A 2OXSA 1ELGA 1OWEA 1MCVA 2RA0A 1P3CA 1MQ6A 1C1OA 1MAXA 1ESAA 4OS1A 1LHFH 1DWCH 2TBSA 5E2OA 4XSKU 1S5SA 1P8VC 3GY4A 1Z8GA 2GCHF 4DVAU 1LHEH 1HJAC 5FCRA 1W3CA 1NFWA 2AGGX 2BDGA 3BG8A 3G01A 5DP4A 1AHTH 1KXBA 1OWKA 1W10U 1SGIB 4GCHG 1PPZA 1YCPK 1TNLA 2PGBB 1P09A 1CU1A 1V2KT 4X2VA 3GICB 1Z71A 2AS9A 5C67A 1S0QA 2HNTF 2Z9JA 1G2MA 3RXSA 1V2ST 2PHBA 1LMWB 2YNAA 2NU1E 4FUDA 4DCDA 3ZV9A 4BANB 3BTME 1C2FA 3RU4E 5JBBS 1GHZA 1S6HA 1KY9A 3P92A 3T2NA 2ALVA 3QLPH 1SHYA 5IDKA 2SGAA 1A0JA 2P8OB 2ZGJA 1ZOMA 2QCYA 1DICA 2G81E 3BTGE 3EQ0H 3FAOA 2ZCHP 6GCHG 2G52A 5DKMA 3A89A 3ATLA 1J14A 2Q6GA 1YLDA 4GHQA 2VIWA 3PV4A 1BRBE 7GCHF 1HGTH 2FTLE 3EYDA 1NS3A 4WXVA 3SUEA 1EATA 1SGYE 1F0UA 1QQUA 1V2WT 4K1TA 1EAUA 1BBRH 4MG3A 3LIWA 1P2NA 1RIWB 2BOKA 1V2UT 1GDNA 1EJMA 4CHAB 1QB1A 2ZDVH 5DG6A 1EKBB 2AMPA 1L4DA 3KQEA 2TPIZ 3LOXA 1GG6B 1TAWA 1O3GA 5A8ZA 3TGIE 3TGJE 1FI8A 2KAIA 5LH8A 1WU1A 2B9LA 3S9BA 3A84A 3AW0A 2R2WU 2XC5A 5J4QA 1YPHE 1GJ6A 4B2AA 1J9CH 2ZU5A 4F49A 1XUFA 3V3MA 2ZGHA 4ZKSU 3HKJB 4HTCH 3NCLA 3Q3XA 1GBLA 1WQSA 2BDHA 4D76A 1GI3A 3SW2B 4CBNA 1JIMA 1AI8H 3LGTA 4O9VA 1O2GH 3H7TA 1O31A 1D3PB 1U6QA 1G3EA 1O5CB 4OGYA 4H6TA 2ZFPH 1WUNH 4E7NA 1B0FA 1OS8A 1FDPA 4BAKB 2F91A 1P9SA 4ABBA 1V2NT 2A4QA 5GCHF 1BRCE 2O8MA 4NA8A 1NFXA 2JH5D 3DA9B 1GI7B 3RU4D 4CBOA 1L1GA 1D6RA 3PTBA 2ZU4A 3TK5A 5F8XA 5FCKA 3QTVH 1E0FD 2VB0A 2UUJB 1PFXC 2YOLA 3SNAA 2BX3A 2J2UA 1P0SH 2P3UB 1RGQA 4Y0ZE 2GKVE 1VGCC 1IOEA 1O0DH 1HAHH 3MNBA 3O8RA 1SSXA 1S0RA 4K1EA 1ZJDA 3O8CA 3SNEA 2VIOA 2QF0A 3M5NA 3NK8A 3P8GA 4HI3A 1DSTA 1L4ZA 3D65E 4O03A 3PWCA 4K8BA 3SI3H 1K1LA 1XXDA 1VITF 2J94A 2OC0A 3OU0A 4AFUA 1TLDA 1CHOG 1GCTC 5E0JA 2WV5A 4NSVA 1L0ZA 3QTOH 3TVJB 5CHAB 3DT0H 3NZIA 4E06H 1TMBH 4YT6H 1O5AB 1QJ1B 3FP8E 2VIPA 4I8HA 5GDSH 4IN1A 1O36A 1H9LB 1DLKB 2PTNA 4JK5A 1EOLA 2HVXA 3MH7A 1BTHH 1GJ5H 1K28D 2WINI 1LVYA 3MO6A 1VJ9U 1O3AA 3TH2H 4JZFH 2ZFSA 2BD8A 1G2LA 2F9NA 3A86A 4E7RG 1D3DB 5FBEA 2Y7ZA 4HFPB 3NKKA 4KELA 4B71A 2PW8H 3VB4A 5EW2H 1BUIA 3UY9A 1UK4A 1O3NA 3D62A 1BA8B 4ABHA 4X6MA 3ZVGA 1VCQA 1OYTH 3QZRA 3K65B 2GCTC 1N8OB 2AIQA 2FM2A 1OP8A 1FIZA 4X2YA 3SU3A 2ZIQH 4AB8A 1LTOA 4WH8A 1C5WB 1C5SA 1SGTA 1OYQA 1KIGH 1QB6A 4MNWA 1YPMH 3A7TA 4X2XA 4Y7AA 2QY0B 3BTEE 2A5KA 1DWDH 6GCHF 3A87A 5A0CA 3SV9A 1ETSH 1ELDE 1UTJA 3KHVA 5EOKA 3EA7A 1T7CA 1C5NH 1P10A 2BD5A 3RXLA 1AWFH 1SQTA 1C1NA 1Y3VA 1TNIA 4ZXXH 1LVOA 2UUKB 4K8YA 2H5CA 4AYVB 1ID5H 3M7QA 1YPHC 1SHHB 3ITIA 1GGDC 1RRKA 2OQUA 1DFPA 1TBZH 2GGVB 2THFB 7LPRA 3ZZCA 2ASUB 1GPZA 3TNTA 1TMTH 5F6MA 3U98H 2AYWA 2ODYB 5A2MH 5GJ4B 1IQNA 3GYLB 4JZIA 1ZTJA 4ISOA 1B7XB 1BTXA 1QFKH 1DVAH 1QBVH 2ZPSA 2ZU1A 3GY6A 1TONA 1FJSA 4HGCA 1C1UH 1GBTA 4OS6A 2FI5E 3A85A 3M7TA 3TH3H 3L33A 4OS2A 5F8ZA 5T6FA 2V0BA 5JPMH 3GDVA 2IOTA 5AFZH 1NFUA 1MZAA 2JETC 2VWLA 4A1VA 3M3VA 1DSUA 3PTNA 4IN2A 2TGPZ 4A7IB 4ISLA 3PO1B 3RXOA 2P93A 5JBCS 2J92A 1MAYA 3RC6A 4WY3A 1PQ8A 1LKBA 4UFDH 1FPHH 1YGCH 3ZZBA 2AGIX 2GZ8A 3BEUA 1QA7A 5GWZA 1JMOH 1GBHA 4K60A 2TRMA 3ZVBA 1YP9A 4AGKA 1CE5A 3OYPA 4Q7XA 3KEEA 1EQ9A 1ZPZA 3ZVCA 2C93B 2Z6BD 4AZ2B 1RTLA 3GY7A 5GXPA 1K1OA 2GX4A 1BMMH 1QGFA 2FWWA 2A7JA 1AQ7A 1H9IE 1H4WA 2PLXA 1GMCG 1O30A 4YLUA 4MVNA 2VINA 1LO6A 1O32A 1CQQA 2Z94A 4TWWA 2ZFQH 5C1YA 3T26A 3Q00A 1T8NA 1HAXB 1P05A 5HM2A 3RXMA 2CN0H 4FVBA 1IQFA 4K2YA 3LPRA 4NG9H 3RXAA 1C4V2 2XBYA 1JOUB 3KQCA 3RMLH 4ISHH 1C1RA 1O3KA 1TQ7B 1SOTA 2ZFTA 1Y3YA 1P01A 2F83A 1O5EH 5FPYA 1VR1H 1AVXA 5G4BA 1YF4A 5DP9A 1O2ZA 4NIYA 1SGEE 4Y7BA 5AFYH 2FI3E 1TRMA 3SUFA 2BD3A 3SZNA 3RXEA 3KN2A 1O2TA 2ZCKP 4Q7YA 1FY4A 3A80A 3SORA 3BTHE 3ZVFA 1QRXA 5FX5A 1SR5C 2AIPA 4Y76A 2XC4A 4D8NA 1A5HA 2JKHA 2ODQA 2VNTA 3AASA 2GMTC 1W7XH 5DP6A 1GI6A 1XMNB 2DE9A 1WAYB 4WMDA 3RXKA 1UTMA 1P03A 1GHVH 1H1BA 2PSXA 3H7OA 3ZVEA 1ESTA 1V2VT 4UFEH 1GWAA 4FUHA 5EPNA 4U2WA 1SC8U 2H6MA 2XYAA 1S6FA 1EZSC 1ELCA 3T62A 1O5DH 2BVRH 3STIA 5JB8S 1Y3XA 2ZGXH 4UDWH 2PUXB 2GCHG 2PV9B 3F9GA 2XCFA 2DE8A 4Z0KA 2R0KA 3IG6B 2A4RA 1NTPA 4INKA 1DPOA 4ASHA 2LNCA 4XBDA 1F0SA 1AZZA 3DUXH 3RP2A 1FIWA 1CGIE 1D6WA 3IWMA 4NA9H 1ZGIA 2B7DH 2FOCA 5A09A 4U01A 3SJOA 1ZTKA 1O2KA 3STJA 1FY3A 1HAYB 2TGAA 3CS0A 2WPMS 2C3SA 2QIQA 1XVOA 1NROH 1TYNA 1TRYA 3V13A 2SGQE 1MTNC 3LKWA 1B0EA 4H42U 2W26A 1SLVB 5H4IB 5GIBA 2VGCC 4NZLA 1YYY1 3I77A 4ZKRU 3TJOA 1BTWA 3UTUH 3SU6A 1QURH 4GUXA 3SGAE 1B5GH 2ZQ1A 1HJ8A 4YTAA 1TQ0B 2HPQH 2NU0E 1DLEA 4PROA 2OINA 1J8AA 3A81A 1A2CH 3U8OH 4ZHLU 1C2HA 2F9PA 1GL0E 1C5XB 1O2PA 1BJUA 3E3TA 3SUGA 1C5PA 3A82A 2FTMA 4ZH8A 3L3TA 2BD9A 1C1VH 3TH4H 2ZPQA 1AN1E 3RXCA 1NM6A 1SGRE 1E37B 1EASA 1Y3WA 4B75A 4CR9A 1ARCA 1YPEH 4JMYA 1QQ4A 3GY5A 1BB0B 3A83A 1P2IA 3UIRA 3E6PH 1S84A 4I8LA 4ABEA 3TITA 1V3XA 3KIDU 4TYDA 1KXCA 3LJJA 5FAHA 1TOCB 1Y5AT 2OD3B 1RXPA 3B8JA 1EB1H 4X8VH 1GJBB 3RXBA 1UCYK 3QWCH 2SGFE 2HALA 1O3CA 3BSQA 3ODDA 3OTJE 2ZU3A 3MU8A 1GJ8B 5EXMA 1C5UA 1C5ZB 1O3DA 4CRCA 5DJ7A 1FAXA 2B8OH 2H9EH 1ZPBA 2TGTA 4IBLH 1O3MA 1PPFE 2LPRA 1CT2E 3E1XB 4JZDH 5GCHG 3T5FH 1GBFA 4X8UH 3URCA 1QNJA 1ZTLA 4Y71A 1EOJA 4XBBA 3FFGA 5ABWA 2GT8A 1G3CA 4ZROA 3S9AA 1OWDA 1BQYA 2O9QA 1LHDH 3M37A 1HXFH 1C2IA 2PFEA 2BY6X 2AERH 3GCTG 1Z8RA 2SGPE 2P95A 3CENA 1QR3E 1IQHA 4JYTA 1HAZB 2VH0A 2VWOA 2QN5T 3DFLA 4JK6A 1ANEA 1T4VH 2Z3DA 1K2I1 1OP0A 1SFIA 4DGJA 1YCPH 4BTUB 1V2OT 1EZXC 4FUBA 4X1NU 4TPYA 2CGAA 5JDUB 5L2ZH 3AVZA 5IYTA 2WUBA
chains in the Genus database with same CATH superfamily
3C1KA 5JBAS 1ELVA 3Q3KA 5BRRE 1GJ7B 1HNEE 1O2VA 4O3UA 2Z9LA 1ELFA 1P2JA 5C2ZA 1YPKH 1KLIH 1DITH 2Y6TA 1C1QA 3MH5A 1FN8A 1T8OA 2ANYA 1HPGA 5T6DA 2UWLA 5AHGH 1HV7A 3N99A 1Y8TA 1Q31A 1GVZA 1TOMH 1O3IA 2VBCA 2W3KA 3RXTA 3FANA 1H8DH 1UVUH 3AAUA 2GV6A 2AGEX 2BVXH 1OOKB 3MU0A 2ESTE 1TRNA 3PMAB 2AFQB 4TY6A 3R3GB 3RXUA 1CT0E 3TNSA 3RXVA 3VPKA 3LC3A 4MPWA 1LVMA 2M2AA 3ZV8A 4NIWA 2BQWB 3LONA 2VU8E 1VZQH 1Y5UT 1C2DA 2Y5HA 2F9UA 1GI9B 2J97A 2UUYA 1AMHA 1OSSA 1KLTA 1O2YA 4E05H 1C2GA 4NWLA 3LH3A 1LDTT 2BVSH 5JYIA 1D4PB 2GP9B 1TBRH 4P00A 4A1TA 1K9OE 1BT7A 3GYMA 3BG4C 1MZDA 2CF8H 2PKSB 1XUIA 3C27B 4FU7A 1GI4A 3GCHC 1PPBH 1TGCA 1CBWB 3RXQA 3VGCB 3ZZ6A 3RXFA 1FNIA 1P11E 2ZECA 3DSOA 3OY6U 4K5ZA 1O37A 3P95A 5EPYA 2BLWA 2HRVA 1ELEE 4ABGA 1NC6A 3QZQA 4J2YB 8GCHF 1EX3A 2J9NA 1DUAA 1S82A 3HGNA 2PP6A 6CHAC 2AMQA 4FUIA 2A45B 3UFAA 3P8OA 3S9CA 1K1NA 1C5TA 4LOYH 2Q6FA 5HIZA 1AUJA 2C8ZB 3V12A 2CXVA 2I6QA 5GNDA 3A8CA 1NU7B 3BTFE 1ANDA 5FBIA 1MKWK 1N1LA 1O2QA 4VGCB 5BPEA 5EQQA 3TLOA 1JXPA 3CS7A 1C4U2 1SQAA 5EW1H 3ATWA 3KQ5A 1O33A 1ZRKA 4XD7D 4CRAA 1O3JA 3ZZ3A 2CHAC 3EGKH 2BDBA 1KDQB 4FUEA 1C1SA 3TU7H 1AFQC 3SU4A 2XNIA 1C5QA 1YLNA 3RXJA 3Q77A 1GHXH 3D49H 3U8RH 1O5FH 3F9EA 3GISB 1ZZZA 1Y3UA 2ZGBH 1GBDA 5HKKD 2BQ6B 2ZCLP 5L6NH 2IPHA 3TGKE 1NFYA 1VKYA 3B23B 5A8YA 3S0NA 4GLYA 3FP6E 2GD4B 1NO9H 2WPLS 2KCOA 2QGRA 3VB3A 3EA9A 4P02A 3SV8A 4BAHB 1FAKH 1ZHMA 4ESTE 2ZTZA 1FONA 1GHBF 2VIDA 4CRFA 1JWTA 5TJXA 3SQEE 3MWIU 4B74A 2HPPH 1TX8A 3R0FA 9ESTA 3GCTF 4NCYA 4YOIA 3ZZ4A 1TNHA 5LPEA 1MD7A 5JB9S 4JCNA 2W6ID 4UEHH 3A8AA 3MYWA 3MOCA 2WUCA 2ZF0H 3FO8D 2ZG0H 1HDTH 4FVDA 3QO6A 1SGCA 1UVOA 2UWPA 4ZMAH 4WXIA 3SV2H 3IITA 3Q3YA 3VB6A 1PYTD 2GDEH 1GHWH 2BDAA 2A5IA 3FOAA 3PM3A 1C2LA 3V0XA 1KXFA 1HBTH 1SVPA 5I46H 4CRBA 1GBKA 4A1XA 4CH8B 1O2LA 2B5TB 1HB0B 3QGNB 1O5GH 5HGGA 1THRH 4SGAE 4Y6DA 1MD8A 2BY5X 4GSOA 1IQMA 1YPJH 4OS7A 3F9HA 1BDAA 1GBJA 3FKSD 1W0JD 1F5KU 1NRNH 1OWIA 2QAAA 3P8NA 2FLRH 3UOUA 1QRWA 4JYUH 1TPOA 4GAWA 2ZHDA 8ESTE 4KTCA 4DURA 1F0RA 4F55A 3DD2H 1INCA 1C5RA 4DG4A 1O2HA 2ZHQH 4MNXA 4O97A 1CA0B 3PROA 4BAQB 1TMUH 2R9PA 4XRNA 2FEQH 1O3HA 2BYAX 4NIXA 4X6PA 1K21H 1WBGB 2ANMH 1HAPH 2VVUA 3UNSA 1NRSH 1PYTC 5A8XA 1HAVB 2VWMA 1IHSH 3SHAH 4NA7A 3SQHE 3SU2A 2PWXA 1Q3XA 1AIXH 2WYGA 3U1JB 1CGHA 2A32A 2R0LA 3P17H 1AZ8A 1PPHE 2NWNA 1UCYE 1AB9B 5TCAA 2FOGA 2LP6A 4NIVA 5HMAA 1W0KD 5C3NA 1FY5A 1UHBB 5EQRA 1MTSA 2WPJS 3F2HA 2FS9A 1Z7KA 4DJZB 2SGDE 2WPHS 1EFRD 1GJDB 4FUFA 3TIUA 1NRPH 1YM0A 5EU8A 1HAGE 1P06A 1DX5M 2P8OC 4HZHA 1L2EA 4MQAA 1SLXB 4NFFA 4KP0A 1O3BA 1QJ6B 4IC5A 3LH1A 1ZHRA 1V2LT 2SGEE 1BOQA 1ZLRA 3MI4A 4D7FA 5ESTE 3AW1A 2XBVA 1WOFA 4WF8A 3M36A 1NBME 2V3HH 2QF4A 1S85A 1OWJA 1C2EA 4DOQA 1K1MA 3LC5A 1KTSB 3UWJH 1MTUA 1D3QB 2OC1A 3SV6A 1RIWC 1O2MA 1GHAG 2P3FH 3RXHA 2M5TA 4Y0YE 3SU1A 1DXPA 1EPTB 2V35A 4CHAC 1P04A 5HXFA 1GI0A 4BXWA 1GDQA 1MBMA 2OQ5A 5EG4A 2A7CA 1AKSB 3BV9B 3MU5A 1GG6C 1O2RA 2J5UA 3M35A 1HAOH 3TJUA 5LPFA 1C1PA 2OLGA 4RKOB 2A31A 2BLOA 2XBWA 1MBQA 2V6NA 3M5LA 1E36B 3BTDE 2ZDNA 1QCPA 2HNTC 1TABE 3U1IB 3BTKE 2BD7A 3E8LA 2NU3E 3SBKA 2ZP0H 2WSSD 2Y82A 3T25A 5K7RA 4JZEH 1SQOA 3WWFA 3SUDA 2ZTXA 2CJIA 1GI2A 1FZZA 1GL1A 1G3DA 5T3HA 4KGAA 2FZZA 2FLBH 3LJOA 1C1TA 1DY8A 1G37A 1LCYA 2GDDA 1O3PB 2QXHA 3PLBA 3UR9A 1W0YH 3MNSA 1W0ZU 1Z8JB 3KYFA 1BHXF 5DP5A 5ESBA 4X1RU 3ZIAD 1UVTH 1A1RA 4H6SB 1O39A 3AAVA 3SV7A 5DP8A 5CDFE 3ELAH 1P2QA 4AG1A 1W2KH 1Y5BT 2ZEBA 1QHRB 4TPIZ 3U28C 5JBTA 2BLVA 1MU8B 1NBMD 1PQAA 3RXPA 1K1IA 4MNVA 1FLEE 1KDQA 2ZNKH 2BXUH 1HJAB 3W95A 1SFQB 1WQVH 2Z9GA 2BHGA 2ZC9H 1O3EA 3MFJA 5CHAC 3SJIA 2D1JA 1SMFE 4RKJB 1XKBC 1GBBA 2BLQA 1WSSH 4XFQA 3TK6A 2FIRH 1A7SA 2XWAA 1KMHB 1V2RT 3U69H 2ZZUH 5EXNA 2FOHA 4OGXA 2ZA5A 3RMMH 5E8EH 2J34A 2JH0D 3M7UA 2CMYA 4ZAEA 4NWKA 1GBEA 3UPEA 2XBXA 2XRCA 2OTVA 1CT4E 1E35B 1C9TA 1F5LA 2PKAA 4TT3D 4ZUHA 3MO9A 1FXYA 5EJLA 2GJGA 2KZ4A 4OS5A 4XBCA 4YZUA 4WMEA 3LGIA 2XWBI 1NU9A 1W13U 1ZMLA 3O8BA 3T28A 3E16B 1MKXK 3M61U 1FY1A 2FDAA 1N8OC 1ARBA 3QDZB 5EXLA 2EEKA 2H9HA 1O2UA 1FN6A 1EUFA 3HK3B 4ZKOU 3EAJA 4UFFH 2ZWLH 3PV2A 2KCPA 3GCHB 1NY22 1GVKB 3URDA 4MNYA 2A5AA 1TGSZ 4B2CA 1IQLA 1JRSA 5CMXH 4GVUA 1G3BA 1OXGA 5C5NA 1PQ5A 2ZU2A 1QL9A 3KL6A 4D9RA 5EODA 1A3EH 1YBWA 1RS0A 1G9IE 5HYOA 1O35A 1SI5H 2F9OA 2PTCE 1SOZA 1UTQA 3GDSA 3PMHB 3JZ1B 1DT2A 1F5RA 1C2MA 3S69A 4ZXYH 1UCYH 3UNRA 1SGQE 5L2YH 3BTWE 2PSYA 1GHAF 1M9UA 1OX1A 2QV1A 2Z7FE 2D26C 3ZZAA 2VWNA 3FZDA 2C8YB 1O2IA 3U9AH 4ABIA 2G00A 2L74A 3BEFB 2A0QB 1QIXB 1HIAB 8GCHG 3MO3A 1JBUH 1IQJA 1W12U 1HRTH 1V2JT 3MU4A 1MABB 8KME2 1KSNA 4RN6A 3A7WA 3N7DA 1P2MA 1HFDA 4NSYA 1HUTH 1D3TB 2JJ2D 2BB4A 4MPVA 5DN6D 1BTYA 2YMSD 1TE0A 1EAIA 1ESBA 1O38A 2UUFB 1ELBA 2EC9H 3UUZA 4XDEA 1A0HB 4BNRA 1THPB 4D9QA 3BN9A 1GJ4H 4IC6A 3U8TH 4B73A 1C2JA 1TGNA 2GV7A 2C90B 2W7SA 4K3JA 2O8LA 3ENSB 4WJG2 5C17A 1CSOE 1AGJA 1HAVA 4U32A 3FN8A 2WHXA 3P8FA 5F8TA 4B2BA 5E2PA 3K9XB 3QN7A 4XOJA 3QK1A 1VGCB 1EP5A 1ZSKA 1TPPA 3BIUH 2VIQA 4FUCA 3N7OA 3OX7U 4WWYA 1UHBA 3B9FH 5E0GA 1A3BH 1UK3A 1WTGH 1WV7H 3HKIB 1K1PA 3MU1A 5C1XA 1DANH 1ANCA 3FZZA 4ABDA 3S7HB 2O8TA 4Q4LA 1MCTA 1C4Y2 5CE1A 2IJOB 3EA8A 3LGVA 5HM9A 3A88A 2WPKS 4Y11E 1YC0A 1DOJA 1GHBG 2AH4X 3SHCH 4INHA 1TWXB 4BOHA 1P9UA 2ANKH 3LGWA 1GCTB 4Y10E 1NZQH 5DGJA 2BDIA 5EJZA 4WMFA 1FMGA 3GY3A 1V2TT 2OBOA 2ZHWH 1ELAA 1XUKA 2G8TA 2PR3A 1O3LA 2BY9X 3NPSA 2ZQ2A 4Q80A 3RUOA 4AGJA 3KQBA 4Y8XA 1GMHF 1EAXA 1C5VA 2A2QH 1SGFG 2VVCA 2GVFA 2OCVB 4FXGH 1EPTA 5C0UA 2NU4E 1GDUA 4FU8A 1F92A 1Z1JA 2IN2A 1MMJN 2TGDA 1W14U 2A2XH 1YPGH 4TY7A 1AKSA 1BITA 4BAMB 7KMEH 4LZ4B 1XUGA 2GZ7A 1TA2A 1J17T 1TGTA 3I29A 2HOBA 2RDLA 3ZVAA 2EY4C 3ZZ8A 4ASUD 3MNCA 4F48B 1QTFA 1ZHPA 1Q2WA 5B6OA 3LDXH 2GCTB 3WW7A 2G51A 3RLYH 3I78A 3KGPA 5F53A 1WYKA 3K6YA 3RXDA 4A6LA 2OBQA 9LPRA 4DY7B 4I8JA 4XE4A 2RCEA 1UTOA 2FS8A 3UWIA 4Y8YA 1MU6B 3RXRA 2BDCA 4Y8ZA 4CH2B 3SU0A 1NESE 1X7AC 1QL7A 4ZHMU 3RLWH 1QZ8A 1EB2A 1QBOA 3DCLA 3OY5U 3PMJA 2OUAA 2ZO3H 1V2QT 2F9VA 3V7TA 1T8MA 1C1MA 1ETRH 1Z6JH 1J16A 1V2PT 1O34A 1LHCH 1PPGE 1GI8B 2GZ9A 1DS2E 1QBNA 2XOKD 5EGMA 2BOHB 5FXLA 1GGDB 4KTSA 3KF2A 5EQSA 1CO7E 1SB1H 2XNDD 4Z6AH 2Z9IA 2ZKSA 3RMNH 2Y80A 2WV4A 1SG8B 3ATIA 2P16A 1MKWH 2XC0A 1GBAA 5E0HA 1EZUC 1DE7H 1BMAA 4R0IA 4AFQA 2ZDLA 2KFWA 3W94A 3S7KB 1XUJA 2FO9A 2Y5GA 1E34B 2H2ZA 1C5YB 3GY2A 3ATMA 2P3TB 3BTTE 2BZAA 2G55A 5ETXA 4AFZA 3BEIB 2R3UA 3FVFB 2QA9E 1L1NA 2UWOA 1GBCA 4IGDA 2JETB 4FOUC 2AMDA 1N6XA 1QB9A 1TALA 5AF9H 1QY6A 3SZEA 2BD4A 5T6GA 2W3IA 1H9HE 1AO5A 1IQIA 3SNDA 3HGPA 4GPGA 1YKTA 3A8DA 1C2KA 1TBQH 2J98A 1PPCE 4F4OC 5LPRA 1O2NA 2D8WA 1TIOA 1P3EA 3WWBA 1UK2A 2R3YA 1T31A 2FOMB 1W11U 1G30B 1NN6A 1VCPA 1Z6EA 2SFAA 2VVVA 2EI8A 2YNBA 1NT1A 1TPSA 4Q7ZA 3UNQA 4U30A 1BZXE 3DHKH 1SQRA 1RTFB 4AFSA 3M3SA 4YT7H 3H5CB 2OC8A 1BBRK 1ZYOA 1O2XA 2FOAA 1WCZA 1QRZA 1SPJA 4CRDA 4FU9A 3UQVA 1AY6H 1MQ5A 1CHGA 1E38B 4AG2A 2IJD1 2SNVA 3SN8A 4AYYB 1ABJH 4B1TA 4ZKNU 2EI7A 3T27A 2Z3CA 2ZFRH 1UMAH 1YWUA 1Z1IA 2RA3A 1Y59T 2DUCA 2P94A 2PKAB 4X2WA 1BMLA 3A7ZA 1CGJE 2KCAA 4INLA 3VB5A 4KTUA 1C1WH 2STBE 4BTTB 2O8UA 1E1RD 4X1QU 2D2DA 3A7YA 2ZDAH 2Z3EA 1O2SA 1BCUH 1G36A 1MTVA 1D9IA 1A4WH 4RSPA 1HIAA 2HNTE 1J15A 2P59A 3PB1E 2QC2A 3SJKA 4R8TB 1SGDE 3QGJA 3LT3A 2GMTB 5C5OA 1A61H 3PLKA 1DUEA 1HJ9A 1K22H 1ACBE 4NZQA 3PYHA 5DO4H 4AC9A 2RFKC 2ZI2H 4YLQH 5DP3A 2BMGB 1IAUA 3HPTB 2R2MB 5AVDA 1PPEE 3NUMA 2BQ7B 1BIOA 2FOBA 3MHWU 7ESTE 1C5LH 1XKAC 1LKAA 1F2SE 3QUMP 1XVMA 1P02A 4SGBE 1CA8B 4ISNA 4ZHAA 3SJ9A 2V3OH 1BJVA 6ESTA 4D7GA 2XTTB 3E90B 4GCHF 4TWYA 1XUHA 1GMDG 3A7VA 2HGTH 2J38A 3F9FA 1AFEH 3LGUA 2XXLA 3GOVB 1DY9A 2FOEA 1S6LA 1EZQA 3F0PA 4IMQA 1A5GH 3T29A 3M5OA 4AX9H 4I7YH 3PLPA 1ELTA 5FX6A 1A46H 4DIIH 3KQDA 1MTNB 4UFGH 4ABAA 1A0LA 1TNGA 1GI5A 2FPZA 2ZDKA 5FPTA 4AORA 2VGCB 4RT0A 2FMJA 1UTKA 4MTBA 1KXAA 1TGBA 1BRUP 2Q6DA 2F9BH 2Y7XA 1SLWB 1DM4B 1S81A 1LPGB 2VH6A 2ANWA 2OP9A 1LVBA 4FUJA 2BTCE 2PUQH 3EDXB 3TJVA 4AB9A 2QE7D 1BTUA 3PMBB 1OP2A 1T32A 2ZGCA 2JH6D 4M7GA 1NPMA 1UVPA 1HCGA 2VIVA 1HLTH 1ZSLA 3CNRA 1HXEH 2QYIA 2Y5FA 4IMZA 2PKSC 4M9FA 2FX4A 1BTZA 3KCGH 4MPXA 2A4GA 3BF6H 1QJ7B 3RC5A 4TSFD 1CBWC 2QF5A 3VGCC 1RTKA 3UQOA 4AN7A 2FX6A 4I8KA 1K1JA 3CP7A 2G4UA 2BX4A 1RJXB 4LZ1H 2C4FH 4Q2KA 3LGYA 2ZDMA 1ZGVA 2ODPA 4K1SA 1O2WA 4IS5A 1IQEA 1WTHD 1QA0A 4MDSA 3GDUA 4Y79A 5K0HA 1TA6A 1DDJA 3UOPA 2OK5A 4YO9A 1MH0A 4YM9A 1SLUB 3GCNA 1ZSJA 2A4OA 3M5MA 2GTBA 3BIVH 1GJ9B 3F2GA 4VGCC 4CREA 4LXBH 2NU2E 2FESH 3SU5A 3SNBA 1XX9A 1XM1A 2QXIA 1AVGH 1DWEH 1HYLA 3ZYDA 1AD8H 1ETTH 1UTLM 4A92A 4OS4A 3OSYA 4WVPE 2ZHEH 1TPAE 4MPUA 1AE5A 1SBWA 1T8LA 1W7GH 3RM2H 1OHHD 1UVSH 3HK6B 3ZZ7A 1ABIH 2FI4E 1F0TA 2AEIH 5A0AE 4B6FA 5GPIB 1LQDB 2TIOA 3SGQE 3SO3A 2F3CE 1C5MD 1CVWH 1LHGH 1KXEA 1UO6A 2FODA 3K6ZA 1AVWA 1Z8IB 1ZJKA 3D23A 4X8TH 4LK4A 1EJAA 2HWLB 4I31A 3VFEA 2EA3A 2B0FA 2K1QA 2WPDD 4X0WU 3HATH 1UTPA 1A5IA 2ILNA 2Q1JA 2YMSB 2EI6A 3ZZ9A 3ZZ5A 1CHOF 4RT1A 3RC4A 1TFXA 1P57B 2STAE 1IHTH 3RU4T 4O3TA 1ZRBA 5SGAE 1OKXA 1AWHB 3NXPA 2W5EA 1PJPA 2FYQA 2WPIS 4I33A 4I8GA 1O2JA 1P12E 4KKDA 5J4SA 2Y81A 5KECA 2ALPA 1MUEB 3RXIA 1EP6A 1GBIA 2BXTH 1E1QD 4JYVH 1AUTC 1GMHG 4DW2U 1KXDA 1T4UH 6LPRA 1GMDF 2H5DA 4YESB 3MTYA 1FY8E 1FQ3A 1SGPE 4GHTA 1AE8H 4THNH 2H1UA 1AU8A 3A8BA 1MKXH 4H4FA 2CF9H 1JIRA 4ISIH 2I6SA 4ZCNA 3GCOA 3OTPA 3TK9A 3ATKA 4ABFA 2ZFFH 1EAWA 2J98B 1YPLH 3RDZA 1ZMJA 1KTTB 1EXFA 1O3FA 1GJCB 4FUGA 4UE7H 1KLJH 1HAIH 1QL8A 4IW4E 4X1PU 3F3BA 1P2KA 1TX6A 2L6OA 3ZZDA 2KAIB 4B76A 4X8SH 2H9TH 2XCNA 3OEHD 5FPSA 4A5TS 4WH6A 3SYJA 5DK1A 2O8WA 3QX5H 1RD3B 2RG3A 8LPRA 1NRQH 2ZPRA 2J4IA 1GCDA 2A7HA 1THSH 2C8WB 3LU9B 1C5OH 4I86A 4AOQA 4YOJA 3SI4H 3PWBA 3BG4B 2G4TA 4DT7B 3GY8A 1V6DA 2FYRA 1ZPCA 4JZ1A 5DPAA 1BHXB 1FPCH 1ORFA 2BM2A 3ESTA 1CA0C 3KNXA 3DFJA 4BTIB 1IQKA 1XXFA 4X1SU 3WY8A 3ZVDA 3P70B 4BXSA 4DIHH 1LPKB 1BBRE 2OC7A 1DWBH 2J95A 5DP7A 3UR6A 2F4LA 1UTNA 1LPZB 3Q76A 3NWUA 2FXRA 3RXGA 1SGNE 4UD9H 1O5BB 1O3OA 6CHAB 1PQ7A 3O8DA 1TX7A 3E0PB 5C1UA 3SOSA 5TCCA 1AB9C 2K0QA 3ODFA 3A7XA 1GJAB 1W8BH 2A1DB 1V2MT 1GBMA 1DXWA 3JZ2B 2PGQB 2G5VA 3MNXA 2BD2A 3VEQB 1TB6H 5FHTA 2CHAB 1GVLA 2VJ1A 2GT7A 7GCHG 1RFNA 4QT8C 4NFEA 2BZ6H 1AFQB 3MH4A 2BY7X 2G5NA 4CRGA 2ULLA 1LQEA 1S83A 5C20A 1YLCA 1ANBA 3UREA 1GHYH 2QXJA 1EJNA 1TNJA 1OWHA 5LGOA 5EJ1A 4NGAH 3PO1C 4BAOB 2BY8X 5B6LA 3L6PA 3E0NB 3BTQE 1EPTC 1SGFA 4Q63A 1H8IH 1YCPM 2C8XB 3F1SB 2Z9KA 1VJAU 5F03A 3P6ZB 4K69A 1GMCF 1BRAA 3F2FA 4MLFB 5T1VA 3RMOH 1VITH 2W7UA 3E91A 3VXFH 4X6OA 3SNCA 1BMNH 2ZTYA 1OPHB 1VCWA 3MMGA 4YOGA 4J1YA 1ZMNA 1N6YA 3TPIZ 4CR5A 1UJ1A 1BTPA 4I32A 1P2OA 1TNKA 3F6UH 4UONA 1NRRH 1FUJA 3RM0H 1IQGA 1GI1A 4X6NA 5PTPA 2BDYA 3M3TA 5I25A 2QXGA 1C9PA 3ZYEA 3EE0B 3TJNA 3VXEH 2HLCA 3F68H 1G32B 2CV3A 5A0BA 2QF3A 4ABJA 2FOFA 1F7ZA 2FP7B 1MTWA 1O2OA 2WYJA 3PRDA 1L1JA 2XW9A 3MH6A 1ZR0A 3SGBE 3FP7E 2SNWA 3VB7A 1JRTA 1FV9A 1VITG 3K2UA 5L30H 1KYNA 2ZHFH 1SL3A 3SJ8A 2OXSA 1ELGA 3W1EA 1OWEA 1MCVA 2RA0A 1P3CA 1MQ6A 1C1OA 1MAXA 1ESAA 4OS1A 1LHFH 1DWCH 2TBSA 5E2OA 4XSKU 1S5SA 1P8VC 3GY4A 1Z8GA 2GCHF 4DVAU 1LHEH 1HJAC 5FCRA 1W3CA 1NFWA 2AGGX 2BDGA 3BG8A 3G01A 5DP4A 1AHTH 1KXBA 1OWKA 1W10U 1SGIB 4GCHG 1PPZA 1YCPK 1TNLA 2PGBB 1P09A 1CU1A 1V2KT 4X2VA 3GICB 1Z71A 2AS9A 5C67A 1S0QA 2HNTF 2Z9JA 1G2MA 3RXSA 1V2ST 2PHBA 1LMWB 2YNAA 2NU1E 4FUDA 4DCDA 3ZV9A 4BANB 3BTME 5C94A 1SKYE 1C2FA 3RU4E 2AHME 5IK2D 5JBBS 1GHZA 1S6HA 1KY9A 3P92A 3T2NA 2ALVA 3QLPH 1SHYA 5IDKA 2SGAA 1A0JA 2P8OB 2ZGJA 5KGOA 1ZOMA 2QCYA 1DICA 2G81E 3BTGE 3EQ0H 3FAOA 2ZCHP 6GCHG 2G52A 5DKMA 3A89A 3ATLA 1J14A 2Q6GA 1YLDA 4GHQA 2VIWA 3PV4A 1BRBE 7GCHF 1HGTH 2FTLE 3EYDA 3PRBA 1NS3A 4WXVA 3SUEA 1EATA 1SGYE 1F0UA 1QQUA 1V2WT 4K1TA 1EAUA 1BBRH 4MG3A 3LIWA 1P2NA 1RIWB 2BOKA 1V2UT 1GDNA 1EJMA 4CHAB 1QB1A 2ZDVH 5DG6A 1EKBB 2AMPA 1L4DA 3KQEA 2TPIZ 3DSGA 3LOXA 1GG6B 1TAWA 1O3GA 5A8ZA 3TGIE 3TGJE 1FI8A 2KAIA 5LH8A 1WU1A 2B9LA 3S9BA 3A84A 3AW0A 2R2WU 3AK5A 2HVYB 2XC5A 5J4QA 1YPHE 1GJ6A 4B2AA 1J9CH 2ZU5A 4F49A 1XUFA 3V3MA 2ZGHA 4ZKSU 3HKJB 4HTCH 3VG8A 3NCLA 3Q3XA 1GBLA 1WQSA 2BDHA 4D76A 1GI3A 3SW2B 4CBNA 1JIMA 1AI8H 3LGTA 4O9VA 1O2GH 3H7TA 1O31A 1D3PB 1U6QA 1G3EA 1O5CB 4OGYA 4H6TA 2ZFPH 1WUNH 4E7NA 1B0FA 1COWD 1OS8A 1FDPA 4BAKB 2F91A 1P9SA 4ABBA 1V2NT 2A4QA 5GCHF 1BRCE 2O8MA 4NA8A 1NFXA 2JH5D 3DA9B 1GI7B 3RU4D 4CBOA 1L1GA 1UW7A 1D6RA 3N7EA 3PTBA 2ZU4A 3TK5A 5F8XA 5FCKA 3QTVH 1E0FD 2VB0A 2UUJB 1PFXC 2YOLA 3NRLA 3SNAA 2BX3A 2J2UA 1P0SH 2P3UB 1RGQA 4Y0ZE 2GKVE 1VGCC 1IOEA 1O0DH 1HAHH 3MNBA 3O8RA 1SSXA 2WZQA 1S0RA 3DSPA 2K8IA 1ZJDA 4K1EA 3O8CA 3SNEA 2VIOA 2QF0A 3M5NA 3NK8A 3GS9A 3P8GA 4HI3A 1DSTA 1L4ZA 3D65E 4O03A 3PWCA 4K8BA 3SI3H 1K1LA 1XXDA 1VITF 2J94A 2OC0A 3OU0A 4AFUA 1TLDA 1CHOG 1GCTC 5E0JA 2WV5A 4NSVA 1L0ZA 3QTOH 3TVJB 5CHAB 3DT0H 2JIZD 3NZIA 4E06H 1TMBH 4YT6H 1O5AB 1QJ1B 3FP8E 4RI0A 2VIPA 4I8HA 5GDSH 4IN1A 1O36A 1H9LB 1DLKB 2PTNA 4JK5A 1EOLA 2HVXA 3MH7A 1BTHH 1GJ5H 1K28D 2WINI 1LVYA 3MO6A 1VJ9U 4Z1MD 1O3AA 3TH2H 4JZFH 2ZFSA 2BD8A 1G2LA 2F9NA 3A86A 4E7RG 1D3DB 5FBEA 2Y7ZA 4HFPB 3NKKA 4KELA 2CK3D 4B71A 2PW8H 3VB4A 5EW2H 1BUIA 3UY9A 1UK4A 1O3NA 3D62A 1BA8B 4ABHA 4X6MA 3ZVGA 1VCQA 1OYTH 3QZRA 3K65B 2GCTC 1N8OB 3H09A 4OM9A 2AIQA 2FM2A 1OP8A 1FIZA 4X2YA 3SU3A 2ZIQH 4AB8A 1LTOA 2F43B 4WH8A 1C5WB 1C5SA 1SGTA 1OYQA 1KIGH 1QB6A 4MNWA 1YPMH 3A7TA 4X2XA 4Y7AA 2QY0B 3BTEE 2A5KA 2HLDD 1DWDH 6GCHF 3A87A 5A0CA 3SV9A 1ETSH 1ELDE 1UTJA 3KHVA 5EOKA 3EA7A 1T7CA 1C5NH 1P10A 2BD5A 1WDIA 3RXLA 1AWFH 1SQTA 1YY3A 1C1NA 1Y3VA 1TNIA 4ZXXH 1LVOA 2UUKB 4K8YA 2H5CA 4AYVB 1ID5H 3M7QA 1YPHC 1SHHB 3ITIA 1GGDC 1RRKA 2OQUA 4HG6A 1DFPA 1TBZH 2GGVB 2THFB 7LPRA 3ZZCA 2ASUB 1GPZA 3TNTA 1TMTH 5F6MA 3U98H 2AYWA 2ODYB 5A2MH 5GJ4B 1IQNA 1H8HD 3GYLB 4JZIA 1ZTJA 4ISOA 1B7XB 2V7QD 1BTXA 1QFKH 1DVAH 1QBVH 2ZPSA 2ZU1A 3GY6A 1TONA 1FJSA 4HGCA 1C1UH 1GBTA 2KCYA 4OS6A 2FI5E 3A85A 3M7TA 3TH3H 3L33A 4OS2A 5F8ZA 5T6FA 2V0BA 5JPMH 1FX0B 3GDVA 2V3MA 5KEDA 2IOTA 5AFZH 1NFUA 1MZAA 2JETC 2VWLA 3EE7A 4A1VA 3M3VA 1DSUA 3PTNA 1E79D 4IN2A 2TGPZ 4A7IB 4ISLA 3PO1B 3RXOA 2P93A 5JBCS 2J92A 1MAYA 3RC6A 4WY3A 1PQ8A 1LKBA 4UFDH 1FPHH 1YGCH 3ZZBA 5EIYA 4YXWD 2AGIX 2GZ8A 3BEUA 1QA7A 4B6EA 2JDID 1JMOH 1GBHA 5GWZA 4K60A 2TRMA 3ZVBA 1YP9A 4AGKA 1CE5A 3OYPA 4Q7XA 3KEEA 1EQ9A 1ZPZA 2IPQX 3ZVCA 2C93B 2Z6BD 4AZ2B 1RTLA 3GY7A 2EQNA 5GXPA 1K1OA 2GX4A 2KX4A 1BMMH 1QGFA 2FWWA 2A7JA 1AQ7A 1H9IE 1H4WA 2PLXA 1GMCG 1O30A 4YLUA 4MVNA 2VINA 1LO6A 1O32A 5CHBA 1CQQA 2Z94A 4TWWA 2RDEA 2ZFQH 5C1YA 3Q00A 1T8NA 3T26A 1HAXB 1P05A 5HM2A 3RXMA 2CN0H 4FVBA 1IQFA 4K2YA 3LPRA 4NG9H 3RXAA 1BMFD 1C4V2 2XBYA 1JOUB 3KQCA 3RMLH 4ISHH 1C1RA 1O3KA 2LELA 1TQ7B 1SOTA 2ZFTA 1Y3YA 1P01A 2F83A 1O5EH 5FPYA 1VR1H 1AVXA 5G4BA 1YF4A 5DP9A 1O2ZA 4NIYA 1SGEE 4Y7BA 5AFYH 2FI3E 1TRMA 3SUFA 2BD3A 3SZNA 3RXEA 3KN2A 5HIYA 1O2TA 2ZCKP 4Q7YA 1FY4A 3A80A 3SORA 3BTHE 3ZVFA 1QRXA 5FX5A 1SR5C 2AIPA 4Y76A 5C0TA 2XC4A 4D8NA 1A5HA 2JKHA 2ODQA 2VNTA 3AASA 2GMTC 1W7XH 5DP6A 1GI6A 1XMNB 2DE9A 1WAYB 4WMDA 3RXKA 1UTMA 1P03A 1GHVH 1H1BA 2PSXA 3H7OA 3ZVEA 1ESTA 1V2VT 4UFEH 1GWAA 4FUHA 5EPNA 4U2WA 1SC8U 2H6MA 5FL7D 1WXRA 2XYAA 4ACBA 1S6FA 1EZSC 1ELCA 3T62A 1O5DH 2BVRH 3STIA 5JB8S 1Y3XA 2ZGXH 4UDWH 2PUXB 3MQKC 2GCHG 2PV9B 3F9GA 2XCFA 2DE8A 4Z0KA 2R0KA 3IG6B 2A4RA 1NTPA 4INKA 1DPOA 4ASHA 2LNCA 4XBDA 1F0SA 1AZZA 3DUXH 3RP2A 1FIWA 1CGIE 1D6WA 3IWMA 4NA9H 1ZGIA 2B7DH 2FOCA 5A09A 3OFND 4U01A 3SJOA 1ZTKA 1O2KA 3STJA 1FY3A 1HAYB 2TGAA 3CS0A 2WPMS 2C3SA 2QIQA 1XVOA 1NROH 1TYNA 3PV5A 1TRYA 3V13A 2SGQE 1MTNC 3LKWA 1B0EA 3OE7D 2W26A 1SLVB 4H42U 5H4IB 5GIBA 2VGCC 4NZLA 1YYY1 3OAAD 3I77A 4ZKRU 3TJOA 1BTWA 3UTUH 3SU6A 1QURH 4GUXA 3UB0A 3SGAE 1B5GH 2ZQ1A 1HJ8A 4YTAA 1TQ0B 2HPQH 2NU0E 1DLEA 4PROA 2OINA 1J8AA 3A81A 1A2CH 3U8OH 4ZHLU 1C2HA 2F9PA 3KYGA 1GL0E 1C5XB 1O2PA 1BJUA 3E3TA 3SUGA 1C5PA 3A82A 2FTMA 4ZH8A 3L3TA 2BD9A 1C1VH 3TH4H 2ZPQA 1AN1E 3RXCA 1NM6A 1SGRE 1E37B 1EASA 2W6JD 1Y3WA 4B75A 4CR9A 1ARCA 1YPEH 4JMYA 1QQ4A 3GY5A 4FETA 1BB0B 3A83A 2KM0A 1P2IA 2JJ1D 3UIRA 3E6PH 1S84A 4I8LA 4ABEA 2KR7A 1V3XA 3KIDU 3TITA 4TYDA 1KXCA 3LJJA 5FAHA 1TOCB 1Y5AT 2OD3B 1RXPA 3B8JA 1EB1H 4X8VH 5DSFA 1GJBB 3RXBA 1UCYK 3QWCH 2SGFE 2HALA 1O3CA 3BSQA 3ODDA 3OTJE 2ZU3A 3MU8A 1GJ8B 5EXMA 1C5UA 1C5ZB 1K0HA 4ACAA 1O3DA 4CRCA 5DJ7A 1FAXA 2B8OH 2H9EH 1ZPBA 3OEED 2TGTA 4IBLH 3UAIC 1O3MA 1PPFE 2LPRA 1CT2E 3E1XB 4JZDH 5GCHG 3T5FH 1GBFA 4X8UH 3URCA 1QNJA 1ZTLA 4Y71A 1EOJA 3F0OA 4XBBA 2WV9A 3FFGA 5ABWA 2GT8A 1G3CA 4ZROA 3S9AA 1OWDA 4DT4A 1BQYA 2O9QA 1LHDH 3M37A 1HXFH 1C2IA 2PFEA 2BY6X 2AERH 3GCTG 1Z8RA 2SGPE 2P95A 3CENA 1QR3E 1IQHA 4JYTA 1HAZB 2VH0A 2VWOA 2QN5T 2YMSC 3DFLA 4JK6A 1ANEA 1T4VH 2Z3DA 1K2I1 1OP0A 1SFIA 4DGJA 1YCPH 4BTUB 1V2OT 1EZXC 1H8ED 4FUBA 4X1NU 4TPYA 2CGAA 5JDUB 5L2ZH 3AVZA 5IYTA 2WUBA
chains in the Genus database with same CATH topology
3C1KA 5JBAS 1ELVA 3Q3KA 5BRRE 1GJ7B 1HNEE 1O2VA 4O3UA 2Z9LA 1ELFA 1P2JA 5C2ZA 1YPKH 1KLIH 1DITH 2Y6TA 1C1QA 3MH5A 1FN8A 1T8OA 2ANYA 1HPGA 5T6DA 2UWLA 5AHGH 1HV7A 1Y8TA 1Q31A 1GVZA 1TOMH 1O3IA 2W3KA 3RXTA 3FANA 1H8DH 1UVUH 3AAUA 2GV6A 2AGEX 2BVXH 1OOKB 3MU0A 2ESTE 1TRNA 3PMAB 2AFQB 4TY6A 3R3GB 3RXUA 1CT0E 3TNSA 3RXVA 3VPKA 3LC3A 4MPWA 1LVMA 3ZV8A 4NIWA 2BQWB 3LONA 2VU8E 1VZQH 1Y5UT 1C2DA 2Y5HA 2F9UA 1GI9B 2UUYA 1AMHA 1OSSA 1KLTA 1O2YA 4E05H 1C2GA 4NWLA 3LH3A 1LDTT 2BVSH 5JYIA 1D4PB 2GP9B 1TBRH 4A1TA 1K9OE 1BT7A 3GYMA 3BG4C 1MZDA 2CF8H 2PKSB 1XUIA 3C27B 4FU7A 1GI4A 3GCHC 1PPBH 1TGCA 1CBWB 3RXQA 3VGCB 3ZZ6A 3RXFA 1FNIA 1P11E 2ZECA 3OY6U 4K5ZA 1O37A 3P95A 5EPYA 2BLWA 2HRVA 1ELEE 4ABGA 1NC6A 3QZQA 4J2YB 8GCHF 1EX3A 2J9NA 1DUAA 1S82A 3HGNA 6CHAC 2AMQA 4FUIA 2A45B 3UFAA 3P8OA 3S9CA 1K1NA 1C5TA 4LOYH 2Q6FA 1AUJA 2C8ZB 3V12A 2CXVA 2I6QA 3A8CA 1NU7B 3BTFE 1ANDA 5FBIA 1MKWK 1N1LA 1O2QA 4VGCB 5BPEA 5EQQA 3TLOA 1JXPA 3CS7A 1C4U2 1SQAA 5EW1H 3ATWA 4CRAA 1O33A 1ZRKA 1O3JA 3ZZ3A 2CHAC 3EGKH 2BDBA 1KDQB 4FUEA 1C1SA 3TU7H 1AFQC 3SU4A 2XNIA 1C5QA 3RXJA 3Q77A 1GHXH 3D49H 3U8RH 1O5FH 3F9EA 3GISB 1ZZZA 1Y3UA 2ZGBH 1GBDA 2BQ6B 2ZCLP 5L6NH 2IPHA 3TGKE 1NFYA 3B23B 5A8YA 3S0NA 4GLYA 3FP6E 2GD4B 1NO9H 2WPLS 2QGRA 3VB3A 3EA9A 3SV8A 4BAHB 1FAKH 1ZHMA 4ESTE 2ZTZA 1FONA 1GHBF 2VIDA 4CRFA 1JWTA 5TJXA 3SQEE 3MWIU 4B74A 2HPPH 1TX8A 3R0FA 9ESTA 3GCTF 4NCYA 4YOIA 3ZZ4A 1TNHA 5LPEA 1MD7A 5JB9S 4JCNA 4UEHH 3A8AA 3MYWA 3MOCA 2WUCA 2ZF0H 2ZG0H 1HDTH 4FVDA 3QO6A 1SGCA 1UVOA 2UWPA 4ZMAH 4WXIA 3SV2H 3IITA 3Q3YA 3VB6A 1PYTD 2GDEH 1GHWH 2BDAA 2A5IA 3PM3A 1C2LA 3V0XA 1KXFA 1HBTH 1SVPA 5I46H 4CRBA 1GBKA 4A1XA 4CH8B 1O2LA 2B5TB 1HB0B 3QGNB 1O5GH 5HGGA 1THRH 4SGAE 4Y6DA 1MD8A 2BY5X 4GSOA 1IQMA 1YPJH 4OS7A 3F9HA 1BDAA 1GBJA 1F5KU 1NRNH 1OWIA 2QAAA 3P8NA 2FLRH 3UOUA 1QRWA 4JYUH 1TPOA 4GAWA 2ZHDA 8ESTE 4KTCA 4DURA 1F0RA 3DD2H 1INCA 1C5RA 4DG4A 1O2HA 2ZHQH 4MNXA 4O97A 1CA0B 3PROA 4BAQB 1TMUH 2R9PA 2FEQH 1O3HA 2BYAX 4NIXA 4X6PA 1K21H 1WBGB 2ANMH 1HAPH 2VVUA 3UNSA 1NRSH 1PYTC 5A8XA 1HAVB 2VWMA 1IHSH 3SHAH 4NA7A 3SQHE 3SU2A 2PWXA 1Q3XA 1AIXH 2WYGA 3U1JB 1CGHA 2A32A 2R0LA 3P17H 1AZ8A 1PPHE 2NWNA 1UCYE 1AB9B 5TCAA 2FOGA 5HMAA 4NIVA 5C3NA 1FY5A 1UHBB 5EQRA 1MTSA 2WPJS 2FS9A 1Z7KA 4DJZB 2SGDE 2WPHS 1GJDB 4FUFA 3TIUA 1NRPH 1YM0A 5EU8A 1HAGE 1P06A 1DX5M 2P8OC 4HZHA 1L2EA 4MQAA 1SLXB 4NFFA 4KP0A 1O3BA 1QJ6B 4IC5A 3LH1A 1ZHRA 1V2LT 2SGEE 1BOQA 1ZLRA 3MI4A 4D7FA 5ESTE 3AW1A 2XBVA 1WOFA 4WF8A 3M36A 2V3HH 1S85A 1OWJA 1C2EA 4DOQA 1K1MA 3LC5A 1KTSB 3UWJH 1MTUA 1D3QB 2OC1A 3SV6A 1RIWC 1O2MA 1GHAG 2P3FH 3RXHA 2M5TA 4Y0YE 3SU1A 1DXPA 1EPTB 2V35A 4CHAC 1P04A 5HXFA 1GI0A 4BXWA 1GDQA 1MBMA 2OQ5A 5EG4A 2A7CA 1AKSB 3BV9B 3MU5A 1GG6C 1O2RA 3M35A 1HAOH 3TJUA 5LPFA 1C1PA 2OLGA 4RKOB 2A31A 2BLOA 2XBWA 1MBQA 2V6NA 3M5LA 1E36B 3BTDE 2ZDNA 1QCPA 2HNTC 1TABE 3U1IB 3BTKE 2BD7A 3E8LA 2NU3E 3SBKA 2ZP0H 2Y82A 3T25A 5K7RA 4JZEH 1SQOA 3SUDA 2ZTXA 2CJIA 1GI2A 1FZZA 1GL1A 1G3DA 5T3HA 4KGAA 2FZZA 2FLBH 3LJOA 1C1TA 1DY8A 1G37A 1LCYA 2GDDA 1O3PB 2QXHA 3PLBA 3UR9A 1W0YH 3MNSA 1W0ZU 1Z8JB 1BHXF 5DP5A 5ESBA 4X1RU 1UVTH 1A1RA 4H6SB 1O39A 3AAVA 3SV7A 5DP8A 3ELAH 1P2QA 4AG1A 1W2KH 1Y5BT 2ZEBA 1QHRB 4TPIZ 5JBTA 2BLVA 1MU8B 1PQAA 3RXPA 1K1IA 4MNVA 1FLEE 1KDQA 2ZNKH 2BXUH 1HJAB 3W95A 1SFQB 1WQVH 2Z9GA 2BHGA 2ZC9H 1O3EA 3MFJA 5CHAC 3SJIA 2D1JA 1SMFE 4RKJB 1XKBC 1GBBA 2BLQA 1WSSH 4XFQA 3TK6A 2FIRH 1A7SA 2XWAA 1V2RT 3U69H 2ZZUH 5EXNA 2FOHA 4OGXA 2ZA5A 3RMMH 5E8EH 2J34A 2JH0D 3M7UA 2CMYA 4ZAEA 4NWKA 1GBEA 3UPEA 2XBXA 2XRCA 2OTVA 1CT4E 1E35B 1C9TA 1F5LA 2PKAA 4ZUHA 3MO9A 1FXYA 4OS5A 4XBCA 4YZUA 4WMEA 3LGIA 2XWBI 1NU9A 1W13U 1ZMLA 3O8BA 3T28A 3E16B 1MKXK 3M61U 1FY1A 2FDAA 1N8OC 1ARBA 3QDZB 5EXLA 2EEKA 2H9HA 1O2UA 1FN6A 1EUFA 3HK3B 4ZKOU 3EAJA 4UFFH 2ZWLH 3GCHB 1NY22 1GVKB 3URDA 4MNYA 2A5AA 1TGSZ 4B2CA 1IQLA 1JRSA 5CMXH 4GVUA 1G3BA 1OXGA 5C5NA 1PQ5A 2ZU2A 1QL9A 3KL6A 4D9RA 5EODA 1A3EH 1YBWA 1RS0A 1G9IE 5HYOA 1O35A 1SI5H 2F9OA 2PTCE 1SOZA 1UTQA 3GDSA 3PMHB 3JZ1B 1DT2A 1F5RA 1C2MA 3S69A 4ZXYH 1UCYH 3UNRA 1SGQE 5L2YH 3BTWE 2PSYA 1GHAF 1M9UA 1OX1A 2QV1A 2Z7FE 2D26C 3ZZAA 2VWNA 3FZDA 2C8YB 1O2IA 3U9AH 4ABIA 2G00A 3BEFB 2A0QB 1QIXB 1HIAB 8GCHG 3MO3A 1JBUH 1IQJA 1W12U 1HRTH 1V2JT 3MU4A 8KME2 1KSNA 4RN6A 3A7WA 1HUTH 1P2MA 1HFDA 4NSYA 1D3TB 2BB4A 4MPVA 1BTYA 1TE0A 1EAIA 1ESBA 1O38A 2UUFB 1ELBA 2EC9H 3UUZA 4XDEA 1A0HB 4BNRA 1THPB 4D9QA 3BN9A 1GJ4H 4IC6A 3U8TH 4B73A 1C2JA 1TGNA 2GV7A 2C90B 2W7SA 4K3JA 2O8LA 3ENSB 4WJG2 1CSOE 1AGJA 1HAVA 4U32A 3P8FA 5F8TA 4B2BA 5E2PA 3K9XB 3QN7A 4XOJA 3QK1A 1VGCB 1EP5A 1ZSKA 1TPPA 3BIUH 2VIQA 4FUCA 3N7OA 3OX7U 4WWYA 1UHBA 3B9FH 5E0GA 1A3BH 1UK3A 1WTGH 1WV7H 3HKIB 1K1PA 3MU1A 5C1XA 1DANH 1ANCA 3FZZA 4ABDA 3S7HB 2O8TA 1MCTA 1C4Y2 5CE1A 2IJOB 3EA8A 3LGVA 5HM9A 3A88A 2WPKS 4Y11E 1YC0A 1DOJA 1GHBG 2AH4X 3SHCH 4INHA 1TWXB 4BOHA 1P9UA 2ANKH 3LGWA 1GCTB 4Y10E 1NZQH 5DGJA 2BDIA 4WMFA 1FMGA 3GY3A 1V2TT 2OBOA 2ZHWH 1ELAA 1XUKA 2G8TA 2PR3A 1O3LA 2BY9X 3NPSA 2ZQ2A 4Q80A 3RUOA 4AGJA 3KQBA 4Y8XA 1GMHF 1EAXA 1C5VA 2A2QH 1SGFG 2VVCA 2GVFA 2OCVB 4FXGH 1EPTA 2NU4E 1GDUA 4FU8A 1F92A 1Z1JA 2IN2A 1MMJN 2TGDA 1W14U 2A2XH 1YPGH 4TY7A 1AKSA 1BITA 4BAMB 7KMEH 4LZ4B 1XUGA 2GZ7A 1TA2A 1J17T 1TGTA 3I29A 2HOBA 2RDLA 3ZVAA 3ZZ8A 3MNCA 1QTFA 1ZHPA 1Q2WA 5B6OA 3LDXH 2GCTB 2G51A 3RLYH 3I78A 3KGPA 1WYKA 3K6YA 3RXDA 4A6LA 2OBQA 9LPRA 4DY7B 4I8JA 4XE4A 2RCEA 1UTOA 2FS8A 3UWIA 4Y8YA 1MU6B 3RXRA 2BDCA 4Y8ZA 4CH2B 3SU0A 1NESE 1X7AC 1QL7A 4ZHMU 3RLWH 1EB2A 1QBOA 3OY5U 3PMJA 2OUAA 2ZO3H 1V2QT 2F9VA 3V7TA 1T8MA 1C1MA 1ETRH 1Z6JH 1J16A 1V2PT 1O34A 1LHCH 1PPGE 1GI8B 2GZ9A 1DS2E 1QBNA 5EGMA 2BOHB 5FXLA 1GGDB 4KTSA 3KF2A 5EQSA 1CO7E 1SB1H 4Z6AH 2Z9IA 2ZKSA 3RMNH 2Y80A 2WV4A 1SG8B 3ATIA 2P16A 1MKWH 2XC0A 1GBAA 5E0HA 1EZUC 1DE7H 1BMAA 4R0IA 4AFQA 2ZDLA 3W94A 3S7KB 1XUJA 2FO9A 2Y5GA 1E34B 2H2ZA 1C5YB 3GY2A 3ATMA 2P3TB 3BTTE 2BZAA 2G55A 5ETXA 4AFZA 3BEIB 2R3UA 3FVFB 2QA9E 1L1NA 2UWOA 1GBCA 4IGDA 2JETB 2AMDA 1N6XA 1QB9A 1TALA 5AF9H 1QY6A 2BD4A 5T6GA 2W3IA 1H9HE 1AO5A 1IQIA 3SNDA 3HGPA 4GPGA 1YKTA 3A8DA 1C2KA 1TBQH 1PPCE 4F4OC 5LPRA 1O2NA 2D8WA 1TIOA 1P3EA 1UK2A 2R3YA 1T31A 2FOMB 1W11U 1G30B 1NN6A 1VCPA 1Z6EA 2SFAA 2VVVA 2EI8A 2YNBA 1NT1A 1TPSA 4Q7ZA 3UNQA 4U30A 1BZXE 3DHKH 1RTFB 4AFSA 3M3SA 4YT7H 3H5CB 2OC8A 1BBRK 1ZYOA 1O2XA 2FOAA 1WCZA 1QRZA 1SPJA 4CRDA 4FU9A 3UQVA 1AY6H 1MQ5A 1CHGA 1E38B 4AG2A 2SNVA 3SN8A 4AYYB 1ABJH 4B1TA 4ZKNU 2EI7A 3T27A 2Z3CA 2ZFRH 1UMAH 1Z1IA 2RA3A 1Y59T 2DUCA 2P94A 2PKAB 4X2WA 1BMLA 3A7ZA 1CGJE 4INLA 3VB5A 4KTUA 1C1WH 2STBE 4BTTB 2O8UA 4X1QU 2D2DA 3A7YA 2ZDAH 2Z3EA 1O2SA 1BCUH 1G36A 1MTVA 1D9IA 1A4WH 4RSPA 1HIAA 2HNTE 1J15A 2P59A 3PB1E 2QC2A 3SJKA 4R8TB 1SGDE 3QGJA 3LT3A 2GMTB 5C5OA 1A61H 3PLKA 1DUEA 1HJ9A 1K22H 1ACBE 4NZQA 3PYHA 5DO4H 2ZI2H 4YLQH 5DP3A 2BMGB 1IAUA 3HPTB 2R2MB 5AVDA 1PPEE 3NUMA 2BQ7B 1BIOA 2FOBA 3MHWU 7ESTE 1C5LH 1XKAC 1LKAA 1F2SE 3QUMP 1XVMA 1P02A 4SGBE 1CA8B 4ISNA 4ZHAA 3SJ9A 2V3OH 1BJVA 6ESTA 4D7GA 2XTTB 3E90B 4GCHF 4TWYA 1XUHA 1GMDG 3A7VA 2HGTH 2J38A 3F9FA 1AFEH 3LGUA 2XXLA 3GOVB 1DY9A 2FOEA 1EZQA 4IMQA 1A5GH 3T29A 3M5OA 4AX9H 4I7YH 3PLPA 1ELTA 5FX6A 1A46H 4DIIH 3KQDA 1MTNB 4UFGH 4ABAA 1A0LA 1TNGA 1GI5A 2FPZA 2ZDKA 5FPTA 4AORA 2VGCB 2FMJA 1UTKA 4MTBA 1KXAA 1TGBA 1BRUP 2Q6DA 2F9BH 2Y7XA 1SLWB 1DM4B 1S81A 1LPGB 2VH6A 2ANWA 2OP9A 1LVBA 4FUJA 2BTCE 2PUQH 3EDXB 3TJVA 4AB9A 1BTUA 3PMBB 1OP2A 1T32A 2ZGCA 2JH6D 4M7GA 1NPMA 1UVPA 1HCGA 2VIVA 1HLTH 1ZSLA 1HXEH 2QYIA 2Y5FA 4IMZA 2PKSC 2FX4A 1BTZA 3KCGH 4MPXA 2A4GA 3BF6H 1QJ7B 3RC5A 1CBWC 4AN7A 3VGCC 1RTKA 3UQOA 2FX6A 4I8KA 1K1JA 3CP7A 2G4UA 2BX4A 1RJXB 4LZ1H 2C4FH 4Q2KA 3LGYA 2ZDMA 1ZGVA 2ODPA 4K1SA 1O2WA 4IS5A 1IQEA 1WTHD 1QA0A 4MDSA 3GDUA 4Y79A 5K0HA 1TA6A 1DDJA 3UOPA 4YO9A 1MH0A 4YM9A 1SLUB 3GCNA 1ZSJA 2A4OA 3M5MA 2GTBA 3BIVH 1GJ9B 4VGCC 4CREA 4LXBH 2NU2E 2FESH 3SU5A 3SNBA 1XX9A 1XM1A 2QXIA 1AVGH