4DOQA

Crystal structure of the complex of porcine pancreatic trypsin with 1/2slpi
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
221
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin
publication title Structure basis 1/2SLPI and porcine pancreas trypsin interaction
pubmed doi rcsb
total genus 52
structure length 221
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4doqA02
1MTWA 3M5NA 1GGDB 1G2MA 2XC4A 2ZFSA 2J92A 4IMZA 1SGDE 3BIVH 1ZJDA 2FOAA 2HPPH 3S9BA 3FP8E 2DE8A 2Z6BD 1C2DA 3E0PB 3RLYH 1DM4B 2AMQA 1UVOA 1ZHMA 1GJAB 3RXCA 2WV5A 3ZYEA 1FY1A 3PB1E 1QHRB 4NFFA 1MUEB 3AW1A 2B9LA 1MMJN 4BANB 1TBZH 4J2YB 1KLTA 3QGNB 1YM0A 4K8YA 1V6DA 1UTNA 2VIOA 2TIOA 1PPCE 1C2EA 1ABIH 2G52A 3ZVEA 1OP2A 2F3CE 1KIGH 4M7GA 3D65E 2BVXH 4ABJA 1EJMA 1EZUC 3T28A 3A89A 1Y5UT 1BTHH 1THRH 1J14A 4X8UH 4XE4A 1EX3A 2C4FH 1P0SH 2VU8E 1P10A 3STJA 1Z8GA 3OU0A 2Y82A 3MOCA 3URCA 1RFNA 1SI5H 4U30A 1CSOE 2OP9A 1GHAG 1CT0E 2ZF0H 3PWCA 5EU8A 1TRMA 1C5MD 2Z3DA 3UOUA 4XBBA 4DG4A 1AZ8A 1TA6A 5BRRE 2BY7X 2Z9IA 1GGDC 1HGTH 3TGIE 2QIQA 2GCTB 1RIWC 4X2XA 3UR6A 1KYNA 1PPBH 1V2JT 4CRCA 1BBRH 1EJNA 3TK5A 2A4RA 5HGGA 4MVNA 3E1XB 1GI9B 1O2HA 3UQOA 1LHEH 2JH5D 3ELAH 1HAYB 1H1BA 2P3TB 4FUEA 1NS3A 2WUCA 1SOZA 2F91A 1ARBA 2BDHA 4Y10E 3GDUA 3FP6E 4ABHA 3PMJA 4JZ1A 1J15A 1C2JA 2TGDA 1ETSH 1W0YH 1AO5A 2ZHQH 3PM3A 5ABWA 5E8EH 2G51A 4MG3A 3PMAB 2STAE 4AG1A 2FOMB 1XUKA 1HV7A 2XW9A 2D1JA 4UDWH 3K9XB 1C2MA 3U98H 1JIMA 1QB1A 1AGJA 1UJ1A 3P92A 2C93B 1C2GA 3FANA 1BMLA 3KEEA 4D76A 2ALPA 1J17T 4BOHA 2ZC9H 1TNGA 1W2KH 5EOKA 1QRXA 4E06H 4RSPA 5FPSA 3E90B 5F03A 4NSYA 3U69H 1XVMA 2VB0A 4I32A 4BXSA 1HB0B 1WQSA 3S7KB 2ZTXA 1C4V2 1AY6H 4ABDA 1E37B 4GLYA 2CJIA 2QC2A 5A8YA 3O8RA 3SGAE 4CH2B 2VJ1A 3ATWA 1O5BB 1O2IA 3RU4T 3M7UA 3RM2H 2BD5A 4OS6A 4AZ2B 3RXBA 4NGAH 3MO9A 2R3YA 3TNSA 3EAJA 4Y0ZE 1O2NA 1GDUA 1K22H 1VCQA 1KXAA 2HRVA 2H6MA 3GCHB 2VVCA 4X1QU 4DIHH 4NWKA 2NU4E 3TGKE 3HPTB 1NFYA 1AWHB 3SQHE 3U8RH 2EI7A 1HJ9A 1C1SA 1DXPA 1SVPA 2A5KA 4NA7A 2EC9H 2BY8X 3M3SA 3P8OA 3GY2A 2ZECA 4NFEA 1Z1IA 1GDQA 1QJ6B 1WYKA 1A5IA 4AB9A 2Y6TA 2KAIB 3OSYA 4MPXA 1JOUB 3C27B 1TX7A 4BNRA 5SGAE 1LQEA 2ZHWH 1EXFA 1DWEH 3H7OA 5EW2H 1O2JA 4YZUA 1O2YA 3BN9A 2UWOA 2ZU3A 2XCFA 1N6YA 2P16A 3L33A 3NCLA 3T5FH 5GDSH 3A7YA 3VXFH 1YC0A 2BDIA 5AHGH 4ZHLU 4O3UA 2C90B 2FIRH 5IYTA 2F83A 4LK4A 4DY7B 4ZHAA 1V2QT 3ZZ8A 4Y0YE 1CO7E 3E0NB 1BRAA 4NIVA 4DJZB 1O0DH 3BSQA 3DHKH 1ESBA 1XXDA 2Y5GA 5A0CA 3LJOA 1BHXB 1QJ1B 1GBMA 6CHAB 3GICB 4K3JA 3SV2H 1P05A 4ISIH 1UO6A 1HAIH 5DO4H 3TJNA 1HXFH 1ID5H 1L1GA 3W95A 1FIWA 1Y3UA 2NU0E 3T62A 1TGBA 3A83A 1E35B 2OLGA 4NG9H 5JYIA 2ZHDA 4Q7ZA 3ESTA 1OWKA 1S81A 1SQOA 2AMPA 4LZ4B 1BTWA 2H9TH 1T8MA 1RTFB 3ITIA 3MNSA 3QWCH 5FBIA 2GMTC 5JBCS 1XUGA 4WH8A 1O35A 5DK1A 1AFEH 4UONA 4IC6A 4FUBA 4JK6A 1A4WH 4WH6A 1P3EA 1BTZA 4YOGA 1AU8A 1HYLA 2W26A 1AZZA 2A5IA 4TPYA 2SGFE 2A1DB 2OD3B 1ELEE 2P8OB 4WMFA 4ZROA 3GY3A 3SU5A 4ZKRU 3KQEA 2RA0A 1IQFA 3L3TA 2XNIA 4BAMB 4IN1A 2PGBB 3SU6A 3LGWA 2Z3CA 1Y3WA 2G00A 2D2DA 4ABGA 1TALA 1FN6A 2CN0H 1CHGA 2PGQB 1GHYH 6CHAC 3ZZ9A 2W5EA 3FVFB 1HLTH 2ZEBA 2ZGBH 5B6OA 2IPHA 1CA0C 9LPRA 1MAYA 1ELGA 1V2PT 1UCYH 1PQ7A 3RXIA 2FWWA 2IJOB 3DFLA 1YPJH 1ZPCA 1Y8TA 2GGVB 5HYOA 1EUFA 2O9QA 1C1NA 1SGFG 1CE5A 2ZDVH 2WPHS 3ZZ7A 1O2GH 3F9GA 2HWLB 3LJJA 1P01A 1VJAU 1Z1JA 2GCHG 3GDVA 2ZU5A 3OYPA 1W12U 2ZCLP 1CQQA 1LCYA 2R2MB 1YP9A 4OS2A 4CHAC 2O8WA 1ELFA 1BOQA 5PTPA 3SUEA 3PTBA 3V13A 2PSYA 2BX4A 3F9HA 4X6MA 5J4QA 1GMCF 4FUFA 2PR3A 3S69A 3U1JB 1OS8A 1GI1A 1AFQB 2P8OC 2VIQA 5C5OA 3L6PA 2QYIA 4I8GA 1O2KA 2A7CA 4K1EA 2AEIH 1WQVH 4YLUA 2FTLE 1ZZZA 5C5NA 3GY8A 2OC0A 1QB9A 2C8XB 2QA9E 3BTME 1ZSLA 1ORFA 4BTIB 1IHTH 2XC5A 2Y5FA 1ELVA 4TWYA 3SUDA 4CBNA 2UWLA 2BY9X 4X1SU 4BAQB 2GV6A 1NFXA 3GCOA 2TGTA 1Y5BT 3CS7A 3EYDA 2A7HA 3M37A 4OGYA 1PPEE 1M9UA 3NPSA 3E3TA 5HXFA 4D7GA 1C5SA 3LGUA 4B2BA 3KQBA 3K65B 2PTCE 1GI4A 4AOQA 1FMGA 1QBVH 1ZGIA 1GBEA 4FUIA 3HK6B 4DURA 1C5ZB 4XSKU 3O8BA 1PYTC 1ESAA 1P2MA 3ZZDA 5AVDA 2K1QA 1CU1A 4YO9A 1T32A 5DJ7A 2FESH 1TMUH 3ZZ5A 3BEFB 3AVZA 3QO6A 1A0LA 1ZYOA 1JRTA 3SUFA 2EI8A 3SJKA 4X2YA 1G32B 1GMCG 2Z9JA 3RMNH 3NKKA 2RA3A 1SGIB 4Y8ZA 2EI6A 1MZAA 3LGYA 4KTUA 3RXOA 4WY3A 1QA0A 2JETB 1THSH 2BLWA 3VB6A 2ANKH 3A86A 3RDZA 3ZZBA 3RXKA 4ABIA 1QFKH 2HNTF 2RCEA 4CRAA 1OP8A 2QV1A 1MU8B 1ANCA 1DUEA 4GAWA 1S0QA 1TFXA 2DE9A 1BTXA 1UMAH 2XXLA 1C1VH 1SPJA 1HRTH 5TJXA 1EATA 2ZPSA 1YPLH 2A45B 1KXBA 1F5KU 2CF9H 3E91A 1QQUA 1W3CA 3EA9A 3MI4A 1Y3XA 3DT0H 3LC5A 3QX5H 2CGAA 3MTYA 1BTPA 1A46H 1UTPA 2M5TA 4LZ1H 3RC6A 1TNLA 3SV7A 3MNXA 1GL0E 2P93A 1GMHF 3AAVA 4Y7AA 4H6TA 1EAXA 2OC1A 3M5LA 1P57B 1K21H 5C67A 2FI3E 4ZHMU 3IITA 3A7TA 2OUAA 1G3BA 1SGFA 4AGJA 4MPVA 3A7VA 4BTTB 4UE7H 1JXPA 1TGNA 5FX5A 4AORA 8GCHF 1UCYK 2ZFRH 4XDEA 1IQGA 2W7UA 1TNIA 4WXIA 2JETC 3RXQA 1OYTH 4Y11E 4INLA 2H9EH 1SSXA 2AGIX 1RRKA 1P9SA 2HNTC 1XKBC 4INHA 2P3UB 4JYUH 1MH0A 4X2WA 3GOVB 5E0HA 1HCGA 1K1NA 5LGOA 5C2ZA 3RXUA 3TH4H 1A61H 3RXAA 2ZZUH 6ESTA 1P3CA 4DCDA 1ZTJA 2AS9A 3O8CA 3UREA 2AGGX 5CMXH 4NWLA 1O30A 3F1SB 3NZIA 2VIWA 3C1KA 3M3TA 1HAZB 3VEQB 1D3TB 3P6ZB 5C1YA 1XUIA 4GPGA 5F6MA 1NM6A 2FOBA 5IDKA 3TK6A 1AN1E 5G4BA 2VWMA 1HUTH 2SGDE 3SV9A 4B73A 1O31A 4B1TA 2BQ7B 1Z6JH 1K1MA 1GMHG 2QXIA 1FI8A 2HGTH 2FS9A 1D3PB 1EJAA 3F68H 3CP7A 5FX6A 1OWEA 1MAXA 4FUCA 2AIPA 2BDBA 4JYVH 2ZPQA 3MHWU 3SO3A 1CHOF 1SGRE 3NXPA 1EKBB 1O2ZA 5L2ZH 2J95A 1TIOA 1GJ6A 3LPRA 2WPMS 4ABFA 1K1IA 1S0RA 2FDAA 2AMDA 3SHAH 4DOQA 8GCHG 3PV4A 5J4SA 1EAIA 1L4DA 1G36A 5GWZA 3GCTG 2TBSA 3MNCA 1BMMH 2VVVA 1B7XB 1GHWH 2FMJA 5T6FA 4X8SH 1T4UH 4WF8A 5H4IB 1HJAC 1RIWB 1ZJKA 1FZZA 2Y81A 3LGIA 4X1PU 3LIWA 4ZH8A 4HFPB 2G55A 1YCPH 4MPWA 1H9IE 4OS5A 1V3XA 2ODYB 2PKAB 1X7AC 1O2VA 1F0SA 2ZTZA 4INKA 3TH2H 1C1WH 3ATMA 1L4ZA 3KL6A 1N8OB 6LPRA 1J9CH 1S83A 3BTTE 3T25A 3RXGA 4YLQH 1GHBF 3I77A 2XBXA 4I31A 1G2LA 3PROA 1NZQH 1XUJA 2THFB 3SJIA 3SNDA 3B9FH 1DPOA 2OQ5A 4ZAEA 4ZUHA 1HIAB 2FPZA 3ATLA 3M5MA 4OGXA 1AVWA 2FO9A 4O9VA 1ZOMA 2A31A 4ASHA 3BF6H 1BBRE 3SGQE 2TGAA 4D9QA 2UUKB 3BTFE 3GISB 3U8TH 2OQUA 3M61U 2ZNKH 1ZMLA 1SOTA 1CHOG 3SBKA 5E0GA 4K1TA 1INCA 1GI0A 1DT2A 1YLCA 3URDA 3TVJB 4CREA 1TX6A 1AI8H 4ZXYH 5FCRA 1UTMA 2BQ6B 2ZDKA 3RXTA 8KME2 1C1RA 1GJ7B 2V35A 4CBOA 2ANYA 3VB7A 2BLQA 3D23A 4IN2A 1YPHC 1TABE 2C3SA 1MBMA 3FAOA 1JRSA 2NU3E 1AWFH 3Q3XA 1HAOH 1FAKH 1C5RA 1GJCB 2RDLA 3F9EA 1FV9A 3SNAA 1W10U 1F5RA 3Q00A 4UD9H 2ZCKP 3UWIA 1DOJA 1YPEH 2NU2E 1MTUA 3RXSA 1NY22 4YT7H 3SV6A 4FU8A 4YM9A 2V6NA 3EA8A 1GMDF 1FN8A 3UPEA 1C9TA 1N8OC 1AUJA 5T6GA 1MTNB 1HBTH 2A2XH 3OY5U 2DUCA 3TH3H 1KXFA 1H9LB 4H42U 1GHBG 4WMDA 2B0FA 2ZI2H 1S84A 2ZFTA 3AAUA 4IBLH 2OCVB 4A5TS 3V12A 1DLKB 2BZ6H 3UNSA 1O5DH 1TPPA 4MNVA 1GHVH 3SHCH 3TJOA 2VNTA 3DUXH 5ESTE 1AHTH 2EA3A 2XTTB 1FIZA 5E0JA 4HZHA 4FXGH 4ISOA 2G81E 2W3KA 1EB2A 2J38A 4SGBE 2D8WA 1EP5A 4Q7YA 5CHAC 3RUOA 1TPAE 1IQJA 2O8MA 2AGEX 5F8TA 4Y79A 5E2OA 3BEUA 2W7SA 2CF8H 4X8VH 3A85A 1O3NA 1UVPA 1PJPA 4AGKA 3SV8A 5A0AE 2ZG0H 2ILNA 3Q77A 4FUJA 4UFFH 3ATIA 2HNTE 3U9AH 2PV9B 2VWNA 3GCNA 2ZDAH 1D4PB 4AYYB 2LPRA 1CA8B 4K5ZA 1PPZA 1C1QA 1TQ0B 1NRNH 1FY5A 2Y7ZA 5JDUB 4FVBA 1GMDG 2AIQA 3IG6B 1MTNC 1AUTC 2SNVA 3BTEE 4AG2A 2BD8A 4JZFH 4MPUA 1A3EH 3SI4H 4MNWA 1THPB 2GP9B 2ZFQH 1W8BH 1FPCH 1ZTLA 2CMYA 1C1UH 3VGCC 4GCHF 3TNTA 1KSNA 1WTGH 3BEIB 5DGJA 3BV9B 3SOSA 4ZMAH 3R0FA 1YKTA 1D3QB 1VJ9U 1IQEA 2BD3A 2O8LA 3PLKA 1LPGB 4KKDA 4UFEH 1FJSA 1GI8B 2OINA 2XCNA 1BZXE 2SGPE 1RTKA 1Y5AT 3LH3A 2GMTB 1LO6A 1T31A 2QXGA 5L2YH 7KMEH 2YNAA 5L6NH 1WBGB 3MU8A 4F4OC 3ZZAA 1OXGA 2BD2A 1NO9H 4FU9A 1SGPE 1LQDB 3I78A 3LT3A 1GBAA 3K6YA 3SNCA 5HM2A 1LKBA 1Y59T 3HGNA 2ULLA 3M5OA 2VH6A 1Z8JB 4NIYA 4R8TB 1ELCA 1OWIA 3MU5A 1LVOA 3EQ0H 1EP6A 2BOKA 4ABBA 5EODA 1O3GA 2OC8A 1E38B 1EPTC 3MMGA 4BXWA 2VH0A 1LPKB 2XBVA 3KGPA 1B0EA 4XOJA 2ZTYA 3GY6A 1DICA 2PKAA 1CA0B 4GCHG 2G5NA 1BBRK 4ABAA 4BAOB 3A7WA 5A0BA 3SU3A 1K2I1 1SB1H 2UUYA 1O2XA 3ODFA 4UEHH 3A81A 1C4Y2 1HAHH 3P17H 3MNBA 1J8AA 1NPMA 1LHGH 2GCHF 4B2AA 1HIAA 1FY3A 1LVBA 4HGCA 1UTLM 1B5GH 1LPZB 3CENA 3QDZB 4K69A 4CHAB 2OXSA 5JBAS 8LPRA 3RU4D 2GTBA 1GBBA 1ZRKA 1ETTH 1O2UA 4PROA 2BXUH 1O3DA 3TJUA 2R0KA 2W3IA 3RXMA 1YPHE 4BAHB 1O2PA 2GD4B 3RM0H 1V2MT 1UCYE 2R3UA 5A8XA 2FLRH 4ZKNU 1PPHE 3UQVA 4IS5A 1SGNE 1V2ST 4WXVA 4X6OA 1SC8U 1V2KT 4LXBH 4HTCH 1BITA 4AB8A 3M7TA 2ZQ2A 1W11U 1O34A 3U1IB 2R0LA 3IWMA 3LONA 4CR9A 4CRBA 3E8LA 1SG8B 3QUMP 7GCHF 3MH7A 3F6UH 1O3IA 1DWDH 1JMOH 3SI3H 1MCVA 3RMMH 3P95A 5FCKA 1O3FA 5I25A 2O8UA 1XKAC 1FY4A 1F5LA 1P2IA 1TNJA 4YESB 1TAWA 4I8LA 1GBHA 2XWAA 1SGEE 1P03A 2NWNA 5EPYA 2J2UA 2Z3EA 3MH4A 2FOCA 1GBJA 1HNEE 3D62A 2OBOA 1BB0B 1YYY1 1QJ7B 3AASA 1Y3YA 1FUJA 1ZTKA 1CGJE 1Q2WA 3PWBA 1ANDA 1QBOA 1UK4A 1GJBB 6GCHF 1CT2E 4CR5A 4Z0KA 3I29A 4Z6AH 1HXEH 2ZGXH 1C5XB 4DT7B 1CBWB 3EA7A 3ZVCA 2P94A 1K1PA 3MU0A 4CRFA 1BRBE 1GVZA 1RXPA 2NU1E 1NFWA 2Z9GA 4Y8YA 1P02A 3HKIB 3RXRA 2LNCA 1C5TA 2QCYA 2GT7A 1BRUP 4NIWA 1ZGVA 2BTCE 1KLIH 1O5AB 7GCHG 2BD7A 5DP6A 3KNXA 1XXFA 1AD8H 4A1TA 3M3VA 1TQ7B 1O2MA 5F8ZA 2R9PA 1LHFH 1IQLA 1EOJA 1V2WT 5EQRA 3FFGA 3SZNA 1F0UA 1QRWA 1TWXB 1EPTA 1P9UA 2G8TA 2A4OA 1UVTH 1SL3A 3SNEA 4AFSA 4FUGA 4K1SA 2A4QA 2EEKA 4YT6H 1C5PA 1DWBH 1D6RA 2TGPZ 2PHBA 1P2NA 1IQKA 1ZHRA 4MQAA 1GI3A 3LU9B 1RS0A 4ESTE 1O2QA 5C1XA 3SU2A 1O3MA 4AX9H 4MTBA 3HKJB 3KIDU 3V3MA 3GY4A 4RKOB 4B71A 1SQAA 1AVGH 1DS2E 1W7XH 4NZLA 1G9IE 6GCHG 1DE7H 2BYAX 3V0XA 5F8XA 1TPSA 1CBWC 4A1XA 2WPIS 1BTUA 2VWLA 5EQQA 1DDJA 3DA9B 1C1TA 2FODA 1FXYA 1G3CA 4Y8XA 4JZEH 1GBKA 1GJ5H 2VIVA 2BDAA 1KXCA 2QGRA 3OY6U 3UNQA 4K60A 2O8TA 3MFJA 3ZZCA 4MLFB 5LPFA 1MBQA 1AQ7A 1GWAA 3MH6A 3SJ8A 5K7RA 5T3HA 1QGFA 4RN6A 1HPGA 1JIRA 2A32A 2OBQA 3RMOH 2A2QH 2HPQH 1TGSZ 1ZMJA 1ZR0A 1O2LA 4TY7A 1MKXH 4H6SB 4WVPE 5GIBA 1TB6H 4AYVB 1CT4E 4KGAA 1EAWA 5FPYA 4U32A 1V2TT 1GJ9B 2HOBA 2B5TB 3B8JA 2FOHA 3Q3KA 1C5QA 4YTAA 3MU4A 3A8CA 1SMFE 3ZZ6A 1XUFA 1EZXC 2VGCC 3RMLH 1TRYA 3S9CA 2J34A 1W14U 1ELAA 2ASUB 1MD8A 2BZAA 4ISNA 5FAHA 5FXLA 1NU7B 1TYNA 1K1LA 1VR1H 3GCTF 1SHYA 3OTJE 1BQYA 5GCHG 1AVXA 1RTLA 5EQSA 1ZPZA 5HM9A 4NA9H 2ZHEH 1SGTA 2XBWA 4X1RU 5DP9A 3PYHA 1HJAB 1DUAA 1P11E 5I46H 1ESTA 2C8WB 2PLXA 4GSOA 1QRZA 1SGQE 1H4WA 5A8ZA 2FI4E 3B23B 2F9BH 3QTVH 2F9VA 1ZLRA 1GI6A 4IGDA 1OSSA 1L0ZA 1AB9C 2CV3A 2SGEE 2JH0D 1O3EA 3ENSB 4X6PA 3TK9A 2Z9KA 2C8YB 2BQWB 3AW0A 3BTDE 3ZVBA 1B0FA 2ZGJA 1LHCH 2PKSB 2ZU2A 4Q7XA 3MO6A 4Y76A 3UY9A 2H9HA 5LPEA 3S7HB 2BDGA 1JBUH 1FLEE 1BJUA 2BY6X 2CHAB 3MO3A 2FOEA 1BIOA 1WSSH 4RKJB 3BTQE 1NU9A 2FOFA 3OX7U 1QB6A 1QL9A 3PO1C 1NT1A 7ESTE 1H8IH 1K9OE 2P3FH 2WPKS 1GI5A 1W7GH 1GBDA 1C5YB 2GDEH 5EXNA 2A5AA 1DVAH 4ZXXH 1O38A 1MCTA 4NCYA 3A8DA 3UNRA 1LKAA 1UTKA 2XC0A 4XBCA 4TPIZ 1TONA 1TMBH 2ZKSA 1NRRH 2I6SA 5LPRA 1Q3XA 2SFAA 3R3GB 1OX1A 1NESE 4KP0A 1BJVA 2AYWA 2ZU1A 4JMYA 1TNHA 1YLDA 3A8BA 3ZVDA 1TBQH 2QXJA 4I33A 1KXEA 1GJDB 1DANH 5FHTA 2H2ZA 1FONA 3LOXA 2FLBH 1P8VC 1C2HA 1WUNH 2AERH 3KQDA 1DWCH 2FTMA 1FY8E 2QAAA 4WJG2 3SJOA 1QL7A 1IOEA 1BMNH 1TA2A 2PKSC 3FZDA 1AMHA 2BDCA 2BB4A 1U6QA 1RGQA 2CHAC 1V2RT 2ZFPH 4D7FA 2ODQA 2ZGCA 3LC3A 3MH5A 1F2SE 3BG4B 3MYWA 7LPRA 4Q80A 3T27A 1SLXB 2BD4A 2F9NA 1S85A 3BTHE 3K6ZA 3SN8A 1WAYB 4CH8B 2ODPA 1LTOA 3SGBE 1LMWB 5CHAB 3D49H 4SGAE 1DY8A 1GI7B 2GZ7A 2FP7B 1P04A 3KCGH 1ELBA 1MKXK 2Z94A 5A2MH 5L30H 1QIXB 1EOLA 1AE5A 3KHVA 2A0QB 2XWBI 5TCAA 2VIDA 2ZHFH 1ZSKA 2PW8H 2Q1JA 2A4GA 1HAVB 2ZIQH 2ZA5A 5C3NA 5K0HA 3P70B 1TX8A 3QZRA 1O3PB 4THNH 5DP8A 2YNBA 2QN5T 4J1YA 4DW2U 4E7NA 3ZZ4A 4YOJA 1G37A 4GHTA 4ISHH 5JBTA 1NC6A 1T8OA 1HAGE 1O5EH 2PFEA 4MNXA 3RXLA 4B75A 1L1JA 3HATH 1MQ6A 1NRQH 1O2WA 1VCPA 4X1NU 1NN6A 1D9IA 1UTQA 2GKVE 4DVAU 1AE8H 3SJ9A 4ABEA 3VGCB 1MTSA 3EE0B 1GBLA 1UHBB 3ZVGA 5GXPA 1KDQB 4KTSA 4NIXA 3RLWH 1GDNA 3BG4C 5EXLA 3A87A 1BUIA 1NRPH 1QL8A 1QY6A 2ZO3H 1PQAA 1O37A 5ETXA 3PMHB 1QURH 3M36A 1A2CH 2OTVA 1IQIA 1LDTT 1O2OA 2GZ8A 2ZDLA 1VCWA 1TOCB 1KTSB 3KF2A 1WCZA 1HFDA 3V7TA 1E34B 2V0BA 4U01A 2P59A 1TGCA 1C2KA 2GX4A 2BM2A 3RXFA 4E05H 1IQMA 1GCTB 2GV7A 5JB8S 1QTFA 4X2VA 4OS1A 5EW1H 2BVSH 3RU4E 3RXEA 3QK1A 2ZWLH 3FZZA 3T26A 3LGTA 1EZQA 1OP0A 3DD2H 1G3EA 4QT8C 1ABJH 2VWOA 2GCTC 1EPTB 1H9HE 3HK3B 3SW2B 1QNJA 5ESBA 2WPJS 3TJVA 1MU6B 1KXDA 3QN7A 5DP5A 3ZV8A 1GCDA 2BX3A 4B2CA 3U8OH 2FXRA 1PYTD 4NA8A 1ANEA 1K28D 1IAUA 3A8AA 3SORA 1OKXA 1BA8B 1YCPK 4AFZA 2JH6D 3BTKE 4MNYA 2AFQB 1RD3B 4FU7A 3NWUA 1BCUH 4A1VA 1VITH 2FS8A 1MKWH 2ANMH 1WOFA 1O32A 2H5CA 2HVXA 1SLWB 1YF4A 3GYMA 3M7QA 1MD7A 4OS7A 1L1NA 3DFJA 1T7CA 2GDDA 4OS4A 1YCPM 1A5HA 1UK3A 1XMNB 2VVUA 1C2FA 1E36B 4DIIH 1C1MA 5C20A 1XX9A 2BXTH 3PTNA 2CXVA 3RXVA 1XM1A 1SLVB 1CGHA 2Z9LA 4AFQA 4D9RA 2WV4A 2ZGHA 4DGJA 4K2YA 1GCTC 1O36A 2BMGB 3VFEA 1ZMNA 3P8NA 1TNKA 5HMAA 3VB5A 1O2RA 2TRMA 1GJ4H 1DX5M 1P2JA 3ZVFA 3NUMA 3GDSA 4TYDA 1BRCE 1P2OA 2PTNA 5DKMA 2FYQA 1AKSB 3EDXB 1S82A 2WYGA 1QBNA 1Q31A 2FOGA 4GVUA 4Y6DA 1V2OT 1C1OA 4JZDH 1CGIE 1C2LA 3H7TA 1QA7A 1DFPA 2F9UA 1TLDA 1LHDH 2FZZA 3RXJA 3ZV9A 1AIXH 3W94A 1NFUA 4E7RG 3A80A 2QF3A 2PUQH 2WINI 2J94A 1DXWA 1C5NH 4UFDH 4B74A 3F9FA 1A0HB 4VGCB 1A0JA 1BHXF 3VB4A 1S6HA 3SU1A 3FP7E 3S0NA 2UWPA 5AFYH 1O3AA 3GCHC 3QTOH 1UVUH 2WYJA 1HJ8A 2ZDMA 2SNWA 1P06A 4Y7BA 2FX6A 4HI3A 3RXHA 2J9NA 2F9PA 2Y5HA 1O2SA 1GHXH 2Q6DA 5FPTA 1C2IA 2BVRH 4NZQA 3UWJH 3VB3A 1H8DH 1ELDE 3TGJE 3P8FA 1T8LA 4I8HA 3ZYDA 3PLPA 1ETRH 4YOIA 3BG8A 3T2NA 2GZ9A 1EB1H 2VIPA 4JK5A 2FEQH 1NTPA 2G4UA 1FNIA 4IW4E 1IQHA 1HAVA 1K1OA 2OC7A 2FI5E 4I8JA 1C5WB 2H5DA 4X0WU 9ESTA 1GVLA 3UIRA 3LKWA 1BTYA 3TLOA 1A1RA 1FQ3A 2IOTA 3TITA 4R0IA 1VZQH 1QQ4A 4F49A 3A82A 2P95A 2YOLA 2BDYA 1V2VT 1YBWA 4X6NA 4A7IB 1TPOA 2ZDNA 1GBFA 5GJ4B 3SU0A 2JKHA 1GVKB 4VGCC 3Q76A 2UUJB 2ANWA 5GPIB 1UK2A 4BAKB 1O3LA 1C5OH 2F9OA 1TBRH 1W13U 2B7DH 1UHBA 2XRCA 5AF9H 3E16B 1OOKB 2XBYA 1KDQA 1YPGH 4A6LA 1FDPA 4XBDA 1NRSH 3UR9A 3RC4A 1A3BH 2G4TA 1YPKH 1Z71A 5EGMA 2J4IA 3BIUH 4FVDA 1EZSC 1UVSH 1ARCA 4K8BA 1FAXA 2AH4X 1SQTA 3ATKA 4NSVA 5JB9S 5BPEA 2H1UA 3S9AA 3T29A 1GBCA 1KLJH 4I8KA 1V2UT 3KQCA 1BDAA 1GHZA 3SNBA 2D26C 3SQEE 1MKWK 3CS0A 3UOPA 1OYQA 3VXEH 1J16A 1V2NT 5JBBS 3QZQA 1KY9A 1DLEA 4D8NA 1V2LT 1SHHB 1P2KA 3MWIU 1SFIA 5EXMA 1XVOA 3E6PH 4JZIA 4CRDA 1UTJA 1TRNA 1K1JA 1DSUA 4JYTA 1TMTH 3RP2A 3GY7A 5EG4A 1P09A 2Y80A 1NROH 3VPKA 1O3JA 1GL1A 4O97A 2WUBA 5T6DA 1O5GH 5FBEA 1PPGE 1O2TA 5EPNA 1O3CA 2VGCB 1O3OA 2GVFA 1ZRBA 2R2WU 2Y7XA 2A7JA 4TWWA 1S5SA 1SR5C 1O39A 3ZZ3A 1MZDA 3HGPA 2FX4A 3LH1A 4AFUA 5GCHF 2ZCHP 1YGCH 1MTVA 3TIUA 2BLVA 2QXHA 1D6WA 1BT7A 5DP4A 1S6FA 3WY8A 1Z7KA 3ZVAA 1ZSJA 2V3OH 2ZP0H 1MQ5A 2TPIZ 4FUHA 1AFQC 1L2EA 2BHGA 2WPLS 4B76A 1XUHA 4ZKOU 1DY9A 1O3HA 2FM2A 3K2UA 4A92A 1GJ8B 1OWHA 1P2QA 5DP3A 2BY5X 3G01A 1AB9B 1SLUB 2PUXB 1VITF 1C9PA 1WV7H 3M35A 1Z8IB 2KAIA 2IN2A 8ESTE 4O3TA 2HALA 1G30B 1AKSA 1O3BA 1O33A 4I7YH 1D3DB 1SGYE 1WTHD 3STIA 1C5LH 3RXPA 3NK8A 1OWDA 2ZU4A 1GPZA 4LOYH 5DG6A 1EQ9A 3H5CB 2G5VA 2C8ZB 1GG6B 5CE1A 1DITH 1SGCA 1TGTA 4FUDA 3QLPH 4WWYA 1HDTH 1DSTA 1GBIA 3JZ1B 4H4FA 4IMQA 1N6XA 4X8TH 3SU4A 5A09A 1ACBE 2Z7FE 3PO1B 1LVMA 2UUFB 5DP7A 2B8OH 3UFAA 1PQ8A 1C5UA 1EAUA 3QGJA 5JPMH 1C4U2 2RG3A 4U2WA 3P8GA 1RJXB 1Z6EA 4O03A 3O8DA 1FPHH 1P12E 1OWJA 4Q2KA 1QCPA 1F0RA 2STBE 3BTGE 5C1UA 1VGCB 4JCNA 3BTWE 1CVWH 2BD9A 4XFQA 1Y3VA 2HLCA 2ZPRA 4MDSA 3RXDA 1KTTB 1ANBA 1YPMH 4KELA 3LGVA 2QY0B 4UFGH 2BLOA 1PFXC 3N7OA 1TE0A 1WU1A 1VITG 4TY6A 1JWTA 1E0FD 3GYLB 2PWXA 1Z8RA 1ZPBA 4IC5A 3UUZA 1GBTA 1GI2A 3Q3YA 4ZKSU 1N1LA 1IQNA 1A7SA 1GG6C 3A84A 5LH8A 4WMEA 1QR3E 3ODDA 3SUGA 2GT8A 1HAPH 3A7ZA 3A88A 1A5GH 1T8NA 3TU7H 2FYRA 5AFZH 1PPFE 3GY5A 2QF0A 1UTOA 1F0TA 1PQ5A 1SFQB 2ALVA 2ZQ1A 4ISLA 2SGQE 1O5FH 2ZFFH 3PMBB 2Q6GA 1TOMH 3LDXH 1F92A 2BOHB 1ZHPA 2PSXA 1G3DA 5TCCA 1VGCC 3A7XA 1O3KA 1T4VH 3JZ2B 4GHQA 2SGAA 4GUXA 1C1PA 4KTCA 1OPHB 3KN2A 5E2PA 1W0ZU 1F7ZA 3PLBA 1HAXB 1EASA 2Q6FA 1LVYA 2V3HH 3EGKH 1BMAA 1SBWA 1O5CB 3MU1A 1GHAF 4CRGA 1C5VA 2VINA 2I6QA 2ESTE 1ELTA 3RC5A 3UTUH 1IHSH 4Y71A 5DPAA 2XYAA 4AN7A 4BTUB 3TPIZ
chains in the Genus database with same CATH superfamily
1MTWA 3M5NA 3WWFA 1GGDB 1G2MA 2XC4A 2ZFSA 1W0KD 2J92A 4IMZA 1SGDE 3BIVH 1ZJDA 2FOAA 3FO8D 2HPPH 3S9BA 3FP8E 2DE8A 2Z6BD 1C2DA 3E0PB 3RLYH 1DM4B 2AMQA 3N7EA 1UVOA 2OK5A 1ZHMA 1GJAB 3RXCA 2WV5A 3ZYEA 1FY1A 3PB1E 1QHRB 3KYFA 4NFFA 1MUEB 3AW1A 2B9LA 1MMJN 4BANB 1TBZH 4J2YB 1KLTA 3QGNB 1YM0A 4K8YA 1V6DA 1UTNA 2VIOA 2TIOA 1PPCE 1C2EA 1ABIH 2G52A 3ZVEA 1OP2A 2F3CE 5EJZA 1KIGH 4M7GA 3D65E 2BVXH 4ABJA 1EJMA 1EZUC 3T28A 3A89A 1Y5UT 1BTHH 1THRH 1J14A 4X8UH 4XE4A 1EX3A 2C4FH 1P0SH 2VU8E 1P10A 3STJA 1Z8GA 3OU0A 2Y82A 3MOCA 3URCA 1RFNA 1SI5H 4U30A 1CSOE 2OP9A 1GHAG 1CT0E 2ZF0H 3PWCA 5EU8A 1TRMA 1C5MD 2Z3DA 3UOUA 4XBBA 4DG4A 1AZ8A 1TA6A 5BRRE 2BY7X 2Z9IA 1GGDC 1HGTH 2F4LA 3TGIE 2QIQA 2GCTB 1RIWC 4X2XA 3UR6A 1KYNA 1PPBH 1V2JT 4CRCA 1BBRH 1EJNA 3TK5A 2A4RA 5HGGA 1W0JD 4MVNA 3E1XB 1GI9B 1O2HA 3UQOA 1LHEH 2JH5D 3ELAH 1HAYB 1H1BA 2J98B 2P3TB 4FUEA 1NS3A 2WUCA 1SOZA 2F91A 1ARBA 2BDHA 4Y10E 3GDUA 3FP6E 4ABHA 3PMJA 4JZ1A 1J15A 1C2JA 2TGDA 1ETSH 1W0YH 1AO5A 2ZHQH 3PM3A 5ABWA 5E8EH 2G51A 4MG3A 3PMAB 2STAE 4AG1A 2FOMB 1XUKA 1HV7A 1K0HA 2XW9A 2D1JA 4UDWH 3K9XB 1C2MA 3U98H 1SKYE 1JIMA 1QB1A 4FETA 1AGJA 1UJ1A 3P92A 2C93B 1C2GA 3FANA 1BMLA 3KEEA 4D76A 2ALPA 1J17T 4BOHA 2ZC9H 1TNGA 1W2KH 5EOKA 1QRXA 4E06H 4RSPA 5FPSA 3E90B 5F03A 4NSYA 3U69H 1XVMA 1FX0B 2VB0A 4I32A 2K0QA 4BXSA 1HB0B 1WQSA 3S7KB 2ZTXA 1C4V2 1AY6H 4ABDA 1E37B 4GLYA 2CJIA 2QC2A 5A8YA 3O8RA 3SGAE 4CH2B 2VJ1A 3ATWA 1O5BB 3WW7A 1O2IA 3RU4T 3U28C 3M7UA 3RM2H 2BD5A 4OS6A 2KCAA 4AZ2B 3RXBA 4NGAH 3MO9A 2R3YA 3TNSA 3EAJA 4Y0ZE 1O2NA 1GDUA 1K22H 1VCQA 1KXAA 2HRVA 2H6MA 3GCHB 2VVCA 4X1QU 4DIHH 4NWKA 2NU4E 3TGKE 3HPTB 1NFYA 1AWHB 3SQHE 3U8RH 2EI7A 1HJ9A 1C1SA 1DXPA 1SVPA 2A5KA 4NA7A 2EC9H 2BY8X 3M3SA 3P8OA 3GY2A 2ZECA 4NFEA 1Z1IA 1GDQA 1QJ6B 1WYKA 4ASUD 1A5IA 4AB9A 2Y6TA 2KAIB 2KR7A 3OSYA 4MPXA 1JOUB 3C27B 1TX7A 4BNRA 5SGAE 1LQEA 2ZHWH 1EXFA 1DWEH 3H7OA 5EW2H 1O2JA 4YZUA 1O2YA 3BN9A 2UWOA 2ZU3A 2XCFA 1N6YA 2P16A 3L33A 3EE7A 3NCLA 3T5FH 1YY3A 3A7YA 5GDSH 1YC0A 3VXFH 2BDIA 5AHGH 4ZHLU 4O3UA 2C90B 2FIRH 5IYTA 2F83A 4LK4A 4DY7B 4ZHAA 1V2QT 3ZZ8A 4Y0YE 1CO7E 3N99A 3E0NB 1BRAA 4NIVA 4DJZB 1O0DH 3BSQA 3DHKH 1ESBA 1XXDA 2Y5GA 5A0CA 3LJOA 1BHXB 1QJ1B 1GBMA 6CHAB 4YXWD 3GICB 4K3JA 3SV2H 3ZIAD 1P05A 4ISIH 1UO6A 1HAIH 5DO4H 3TJNA 1HXFH 1ID5H 1L1GA 4RT1A 3W95A 1FIWA 1Y3UA 2NU0E 3T62A 1TGBA 3A83A 1E35B 2OLGA 4NG9H 5JYIA 2ZHDA 4Q7ZA 3ESTA 1OWKA 1S81A 1SQOA 2AMPA 4LZ4B 1BTWA 2H9TH 1T8MA 1RTFB 3ITIA 3MNSA 3QWCH 5FBIA 2GMTC 4M9FA 5JBCS 1XUGA 4WH8A 1O35A 5DK1A 1AFEH 4UONA 4IC6A 4FUBA 4JK6A 1A4WH 4WH6A 1P3EA 1BTZA 1E1QD 1AU8A 1HYLA 2W26A 4YOGA 1AZZA 2A5IA 4TPYA 2SGFE 2A1DB 2OD3B 1ELEE 2P8OB 4WMFA 4ZROA 3GY3A 3SU5A 4ZKRU 3KQEA 2RA0A 1IQFA 3L3TA 1E1RD 2XNIA 3WWBA 4BAMB 4IN1A 2PGBB 3SU6A 3LGWA 2Z3CA 1Y3WA 2G00A 2D2DA 4ABGA 1TALA 1FN6A 2CN0H 1CHGA 2PGQB 2WPDD 1GHYH 6CHAC 3PRDA 3ZZ9A 2W5EA 3FVFB 1HLTH 2ZEBA 2ZGBH 5B6OA 2IPHA 1CA0C 9LPRA 1H8HD 1MAYA 1ELGA 1V2PT 2J98A 1UCYH 1PQ7A 3RXIA 2FWWA 2IJOB 3DFLA 1YPJH 1ZPCA 1Y8TA 2GGVB 5HYOA 1EUFA 2O9QA 1C1NA 1SGFG 1CE5A 2ZDVH 2WPHS 3ZZ7A 1O2GH 3F9GA 2HWLB 3LJJA 1P01A 1VJAU 5CHBA 1Z1JA 2GCHG 3GDVA 2ZU5A 3OYPA 1W12U 5DSFA 2ZCLP 1CQQA 1LCYA 2R2MB 1YP9A 4OS2A 4CHAC 2O8WA 1ELFA 1BOQA 5PTPA 5B6LA 3SUEA 3PTBA 3V13A 2PSYA 2BX4A 3F9HA 4X6MA 5J4QA 1GMCF 4FUFA 2PR3A 3S69A 3U1JB 1OS8A 1GI1A 1AFQB 2P8OC 2VIQA 3DSPA 5C5OA 3L6PA 2QYIA 4I8GA 1O2KA 2QE7D 2A7CA 4K1EA 2AEIH 1WQVH 4YLUA 2FTLE 1ZZZA 2HLDD 5C5NA 3GY8A 2OC0A 1QB9A 2C8XB 2QA9E 3BTME 1ZSLA 1ORFA 4BTIB 3OE7D 1IHTH 2XC5A 2Y5FA 1ELVA 4TWYA 3SUDA 4CBNA 2UWLA 2BY9X 4X1SU 3UAIC 2KCYA 4BAQB 2GV6A 1NFXA 3GCOA 2TGTA 1Y5BT 3CS7A 3EYDA 2A7HA 3M37A 4OGYA 1PPEE 5KECA 1M9UA 2KZ4A 3E3TA 3NPSA 5HXFA 4D7GA 1C5SA 3LGUA 4B2BA 3KQBA 3K65B 2PTCE 1GI4A 4AOQA 1FMGA 1QBVH 1ZGIA 1GBEA 4FUIA 3HK6B 3F3BA 1C5ZB 4XSKU 4DURA 3O8BA 1PYTC 1ESAA 1P2MA 5F53A 3ZZDA 5AVDA 2K1QA 1CU1A 4YO9A 1T32A 5DJ7A 2FESH 1TMUH 3ZZ5A 3BEFB 3AVZA 3QO6A 1A0LA 1ZYOA 1JRTA 5KEDA 1YLNA 3SUFA 2EI8A 3SJKA 4X2YA 1G32B 1GMCG 2Z9JA 3RMNH 3NKKA 2RA3A 1SGIB 4Y8ZA 2EI6A 1MZAA 3LGYA 4KTUA 3RXOA 4WY3A 1QA0A 2JETB 1THSH 2BLWA 3VB6A 2ANKH 3A86A 3RDZA 3ZZBA 3RXKA 4ABIA 1QFKH 5C0UA 2HNTF 2RCEA 1H8ED 4CRAA 1OP8A 2QV1A 1MU8B 1ANCA 1DUEA 4GAWA 1S0QA 1TFXA 2DE9A 1BTXA 1UMAH 2XXLA 1C1VH 1SPJA 1HRTH 5TJXA 1EATA 2ZPSA 1YPLH 2A45B 1KXBA 1F5KU 2CF9H 3E91A 1QQUA 1W3CA 3EA9A 3MI4A 1Y3XA 4TSFD 3DT0H 3LC5A 3QX5H 2CGAA 3MTYA 1BTPA 1A46H 1UTPA 2M5TA 4LZ1H 3RC6A 1TNLA 3SV7A 3MNXA 1GL0E 2P93A 1GMHF 3AAVA 4Y7AA 4H6TA 3OFND 1EAXA 2OC1A 3M5LA 1P57B 1K21H 5C67A 2FI3E 4ZHMU 3IITA 3A7TA 2OUAA 1G3BA 1SGFA 4AGJA 4MPVA 3A7VA 4BTTB 4UE7H 1JXPA 1TGNA 5FX5A 4AORA 2YMSC 8GCHF 1UCYK 2ZFRH 2RFKC 4XDEA 1IQGA 2W7UA 1TNIA 4WXIA 2JETC 3RXQA 1OYTH 4Y11E 4INLA 2H9EH 1SSXA 2AGIX 1RRKA 1P9SA 2HNTC 1XKBC 4INHA 2P3UB 4JYUH 1MH0A 4X2WA 3GOVB 5E0HA 1HCGA 1K1NA 5LGOA 5C2ZA 3RXUA 3TH4H 1A61H 3RXAA 2ZZUH 6ESTA 1P3CA 4DCDA 1ZTJA 2AS9A 3O8CA 3UREA 2AGGX 5CMXH 4NWLA 1O30A 3F1SB 3NZIA 2VIWA 3C1KA 4XD7D 3M3TA 1HAZB 2JIZD 3VEQB 1D3TB 3P6ZB 5C1YA 1XUIA 4GPGA 5F6MA 1NM6A 1NBME 2FOBA 5IDKA 3TK6A 1AN1E 5G4BA 2VWMA 1HUTH 2SGDE 3SV9A 4B73A 1O31A 4B1TA 2BQ7B 1Z6JH 1K1MA 1GMHG 2QXIA 1FI8A 4TT3D 2HGTH 2FS9A 1D3PB 1EJAA 3F68H 3CP7A 5FX6A 1OWEA 1MAXA 4FUCA 2AIPA 2BDBA 4JYVH 2ZPQA 3MHWU 3SO3A 1CHOF 1SGRE 3NXPA 1EKBB 1O2ZA 5L2ZH 2J95A 2RDEA 1TIOA 1GJ6A 3LPRA 2WPMS 4ABFA 3GS9A 1K1IA 1S0RA 2FDAA 2AMDA 3PV5A 3SHAH 4DOQA 8GCHG 3PV4A 1EFRD 5J4SA 1EAIA 1L4DA 1G36A 5GWZA 3GCTG 5IK2D 2TBSA 3MNCA 1BMMH 2VVVA 1B7XB 1GHWH 2FMJA 5T6FA 3MQKC 4X8SH 1T4UH 4WF8A 5H4IB 1HJAC 1RIWB 1ZJKA 1FZZA 2Y81A 3LGIA 4X1PU 3LIWA 4ZH8A 4HFPB 2G55A 1YCPH 4MPWA 1H9IE 4OS5A 1V3XA 2ODYB 2PKAB 1X7AC 1O2VA 1F0SA 2ZTZA 4INKA 3TH2H 1C1WH 3ATMA 1L4ZA 3KL6A 1N8OB 6LPRA 1J9CH 1S83A 3BTTE 3T25A 3RXGA 4YLQH 1GHBF 3I77A 2XBXA 4I31A 1G2LA 3PROA 3OAAD 1NZQH 1XUJA 2THFB 3SJIA 3SNDA 3B9FH 1DPOA 2OQ5A 4ZAEA 4ZUHA 1HIAB 2FPZA 3ATLA 3M5MA 4OGXA 1AVWA 2FO9A 4O9VA 1ZOMA 2A31A 4ASHA 3BF6H 1BBRE 3SGQE 2TGAA 4D9QA 2UUKB 3BTFE 3GISB 3U8TH 2OQUA 3M61U 2ZNKH 1ZMLA 1SOTA 1CHOG 3SBKA 5E0GA 4K1TA 1INCA 1GI0A 1DT2A 1YLCA 3URDA 3TVJB 4CREA 1TX6A 1AI8H 4ZXYH 5FCRA 1UTMA 2BQ6B 2ZDKA 3RXTA 8KME2 1C1RA 2AHME 1GJ7B 2V35A 2EQNA 2ANYA 4CBOA 3VB7A 2BLQA 3D23A 4IN2A 1YPHC 1TABE 2C3SA 1MBMA 3FAOA 1JRSA 2NU3E 1AWFH 3Q3XA 1HAOH 1FAKH 5C94A 1C5RA 1GJCB 2RDLA 3F9EA 1FV9A 3SNAA 1W10U 1F5RA 3Q00A 4UD9H 2ZCKP 5GNDA 1DOJA 1YPEH 2NU2E 1MTUA 3RXSA 1NY22 4YT7H 3SV6A 4FU8A 4YM9A 2V6NA 4P02A 3EA8A 1GMDF 1FN8A 3UPEA 1C9TA 1N8OC 1AUJA 5T6GA 1MTNB 1HBTH 2A2XH 3OY5U 2DUCA 3TH3H 1KXFA 1H9LB 4H42U 1GHBG 4WMDA 2B0FA 2ZI2H 1S84A 2ZFTA 3AAUA 4IBLH 4ZCNA 2OCVB 4A5TS 3V12A 1DLKB 2BZ6H 3UNSA 1O5DH 1TPPA 1COWD 4MNVA 1GHVH 3SHCH 3TJOA 2VNTA 3DUXH 5ESTE 1AHTH 2EA3A 2XTTB 1FIZA 5E0JA 4HZHA 4FXGH 4ISOA 2G81E 2W3KA 1EB2A 2J38A 4SGBE 2D8WA 1EP5A 4Q7YA 5CHAC 3RUOA 1TPAE 1IQJA 2O8MA 2AGEX 5F8TA 4Y79A 5E2OA 5CDFE 3BEUA 2W7SA 2J5UA 2CF8H 2W6ID 4X8VH 3A85A 1O3NA 1UVPA 1PJPA 4AGKA 3SV8A 4RI0A 5A0AE 2ZG0H 2ILNA 3Q77A 4FUJA 4UFFH 3ATIA 2HNTE 3U9AH 2PV9B 2VWNA 3GCNA 2ZDAH 1D4PB 4AYYB 2LPRA 1CA8B 4K5ZA 1PPZA 1C1QA 1TQ0B 1NRNH 1FY5A 2Y7ZA 5JDUB 4FVBA 1GMDG 2AIQA 2WHXA 3IG6B 1MTNC 1AUTC 2SNVA 3BTEE 4AG2A 4I86A 2BD8A 4JZFH 4MPUA 1A3EH 2XOKD 3SI4H 4MNWA 1THPB 2GP9B 2ZFQH 1W8BH 1FPCH 1ZTLA 2CMYA 1C1UH 3VGCC 4GCHF 3TNTA 1KSNA 1WTGH 3BEIB 5DGJA 3BV9B 3SOSA 4ZMAH 3R0FA 1YKTA 1D3QB 1VJ9U 1IQEA 2BD3A 2O8LA 3PLKA 1LPGB 4KKDA 4UFEH 1FJSA 1GI8B 2OINA 2XCNA 1BZXE 2SGPE 1RTKA 1Y5AT 3LH3A 2GMTB 1LO6A 1T31A 2QXGA 5L2YH 7KMEH 2YNAA 5L6NH 1WBGB 3MU8A 4F4OC 2WSSD 3ZZAA 1OXGA 2BD2A 1NO9H 4FU9A 1SGPE 1LQDB 3I78A 3LT3A 1GBAA 3K6YA 3SNCA 5HM2A 1LKBA 1Y59T 3HGNA 2ULLA 4P00A 3M5OA 2VH6A 1E79D 1Z8JB 4NIYA 4R8TB 1ELCA 1OWIA 3MU5A 1LVOA 3EQ0H 1EP6A 2BOKA 4ABBA 5EODA 1O3GA 2OC8A 1E38B 2M2AA 1EPTC 3MMGA 4BXWA 2VH0A 1LPKB 2QF5A 2XBVA 3KGPA 1B0EA 4XOJA 3UWIA 2ZTYA 1BMFD 5T1VA 3GY6A 1DICA 2PKAA 1CA0B 4GCHG 2G5NA 3F0OA 1BBRK 4ABAA 4BAOB 3A7WA 5A0BA 3SU3A 1K2I1 1SB1H 2UUYA 1O2XA 3ODFA 4UEHH 3F0PA 3A81A 1C4Y2 1HAHH 3P17H 3MNBA 1J8AA 1NPMA 1LHGH 2GCHF 4B2AA 1HIAA 1FY3A 1LVBA 4HGCA 1UTLM 1B5GH 1LPZB 3CENA 3QDZB 4K69A 4CHAB 2OXSA 5JBAS 8LPRA 3RU4D 2GTBA 1GBBA 1ZRKA 1ETTH 1O2UA 4PROA 2BXUH 1O3DA 3TJUA 2R0KA 2W3IA 3RXMA 1YPHE 4BAHB 1O2PA 2GD4B 3RM0H 4ACAA 1V2MT 1UCYE 2R3UA 5A8XA 2FLRH 4ZKNU 1PPHE 3UQVA 4IS5A 1SGNE 1V2ST 4WXVA 4X6OA 1SC8U 1V2KT 4LXBH 4HTCH 1BITA 1YWUA 4AB8A 3M7TA 2ZQ2A 1W11U 1O34A 5EJLA 2R0LA 3U1IB 3IWMA 3LONA 4CR9A 4CRBA 1WXRA 3E8LA 1SG8B 3QUMP 7GCHF 3MH7A 3F6UH 1O3IA 1DWDH 1JMOH 3SI3H 1MCVA 3RMMH 3P95A 5FCKA 1O3FA 5I25A 2O8UA 1XKAC 1FY4A 1F5LA 1P2IA 1TNJA 4YESB 1TAWA 4I8LA 3FN8A 1GBHA 2XWAA 1SGEE 3DCLA 1P03A 2NWNA 5EPYA 2J2UA 2Z3EA 3MH4A 2FOCA 3F2GA 1GBJA 1HNEE 3D62A 2OBOA 1BB0B 1YYY1 1QJ7B 3AASA 1Y3YA 1FUJA 1ZTKA 1CGJE 1Q2WA 3PWBA 1ANDA 1QBOA 1UK4A 1GJBB 6GCHF 1CT2E 4CR5A 4Z0KA 3I29A 4Z6AH 1HXEH 2ZGXH 1C5XB 4DT7B 1CBWB 3EA7A 3ZVCA 2P94A 1K1PA 3MU0A 4CRFA 1BRBE 1GVZA 1RXPA 2NU1E 1NFWA 2Z9GA 4Y8YA 5C17A 1P02A 3HKIB 3RXRA 2LNCA 1C5TA 2QCYA 2GT7A 1BRUP 4NIWA 1ZGVA 2BTCE 4F48B 1KLIH 1O5AB 7GCHG 2BD7A 2KCPA 5DP6A 3KNXA 1XXFA 1AD8H 4A1TA 3M3VA 1TQ7B 1O2MA 5F8ZA 2R9PA 4DT4A 1LHFH 1IQLA 1EOJA 1V2WT 5EQRA 3FFGA 3SZNA 1F0UA 1QRWA 1TWXB 1EPTA 1P9UA 2G8TA 2A4OA 3VG8A 4B6EA 1UVTH 1SL3A 3SNEA 4AFSA 4FUGA 4K1SA 2A4QA 2EEKA 3KYGA 4YT6H 1C5PA 1DWBH 2CK3D 1D6RA 2TGPZ 2PHBA 1P2NA 1IQKA 1MABB 1ZHRA 4MQAA 1GI3A 3SYJA 3LU9B 1RS0A 4ESTE 1O2QA 5C1XA 3SU2A 1O3MA 2YMSB 4AX9H 4MTBA 3HKJB 3KIDU 3V3MA 3GY4A 4RKOB 4B71A 1SQAA 1AVGH 1DS2E 1W7XH 4NZLA 1G9IE 5HIYA 6GCHG 1DE7H 2BYAX 3V0XA 5F8XA 1TPSA 1CBWC 1UW7A 4HG6A 4A1XA 2WPIS 1BTUA 2VWLA 5EQQA 1DDJA 3DA9B 1C1TA 2FODA 1FXYA 1G3CA 2VBCA 3OEED 4Y8XA 4JZEH 1GBKA 1GJ5H 2VIVA 2BDAA 1KXCA 2QGRA 3OY6U 3UNQA 4K60A 2O8TA 3MFJA 3ZZCA 4MLFB 5LPFA 1MBQA 1AQ7A 1GWAA 3MH6A 3SJ8A 5K7RA 5T3HA 1QGFA 4RN6A 3DSOA 1HPGA 1JIRA 2A32A 2OBQA 3RMOH 2A2QH 2HPQH 1TGSZ 1ZMJA 1ZR0A 1O2LA 4TY7A 1MKXH 4H6SB 4WVPE 5GIBA 1TB6H 4AYVB 1CT4E 4KGAA 1EAWA 5FPYA 4U32A 1V2TT 1GJ9B 2HOBA 2B5TB 3B8JA 2FOHA 3Q3KA 1C5QA 4YTAA 3MU4A 3A8CA 1SMFE 3ZZ6A 1XUFA 1EZXC 2VGCC 3RMLH 1TRYA 3S9CA 2J34A 4RT0A 1W14U 1ELAA 2ASUB 1MD8A 2BZAA 2IJD1 4ISNA 5FAHA 5FXLA 1NU7B 1TYNA 1K1LA 1VR1H 3GCTF 1SHYA 3OTJE 1BQYA 5GCHG 1AVXA 1RTLA 5EQSA 1ZPZA 4Z1MD 4NA9H 5HM9A 2ZHEH 1SGTA 2XBWA 4X1RU 5DP9A 3PYHA 1HJAB 1DUAA 1P11E 5I46H 1ESTA 2C8WB 2PLXA 4GSOA 1QRZA 1SGQE 1H4WA 3PV2A 5A8ZA 2FI4E 3B23B 2F9BH 3QTVH 2F9VA 1ZLRA 1GI6A 4IGDA 1OSSA 2WV9A 1L0ZA 1AB9C 2CV3A 2SGEE 2JH0D 1O3EA 3ENSB 3KQ5A 4X6PA 3CNRA 3TK9A 2Z9KA 2C8YB 2BQWB 3AW0A 3BTDE 3ZVBA 1B0FA 2ZGJA 1LHCH 2PKSB 2ZU2A 4Q7XA 3MO6A 4Y76A 3UY9A 2H9HA 5LPEA 3S7HB 2BDGA 1JBUH 1FLEE 1BJUA 2BY6X 2CHAB 3MO3A 2FOEA 1BIOA 1WSSH 4RKJB 3BTQE 1NU9A 2FOFA 3OX7U 1QB6A 1QL9A 3PO1C 1NT1A 7ESTE 1H8IH 1K9OE 1OHHD 2P3FH 2J97A 2WPKS 1GI5A 1W7GH 2LP6A 1GBDA 1C5YB 2GDEH 5EXNA 2A5AA 4XRNA 1DVAH 1QZ8A 3FKSD 4ZXXH 1O38A 1MCTA 4NCYA 3A8DA 3UNRA 1LKAA 1UTKA 2XC0A 4XBCA 4TPIZ 1TONA 5KGOA 1TMBH 2ZKSA 1NRRH 3N7DA 2I6SA 5LPRA 1Q3XA 2SFAA 3R3GB 1OX1A 1NESE 3H09A 4KP0A 1BJVA 2AYWA 2ZU1A 4JMYA 1TNHA 1YLDA 3A8BA 3ZVDA 1TBQH 2QXJA 4I33A 1KXEA 1GJDB 1DANH 5FHTA 2H2ZA 1FONA 3LOXA 2FLBH 1P8VC 2LELA 1C2HA 1WUNH 2AERH 3KQDA 1DWCH 2KX4A 2FTMA 1FY8E 2QAAA 4WJG2 3SJOA 1QL7A 1IOEA 1BMNH 1TA2A 2PKSC 3FZDA 1AMHA 2BDCA 2BB4A 1U6QA 1RGQA 2CHAC 1V2RT 2ZFPH 4D7FA 2ODQA 2ZGCA 3LC3A 3MH5A 1F2SE 3BG4B 3MYWA 7LPRA 4Q80A 3T27A 1SLXB 2BD4A 2F9NA 4B6FA 1S85A 3BTHE 3K6ZA 3SN8A 1WAYB 4CH8B 2ODPA 1LTOA 3SGBE 1LMWB 5CHAB 3D49H 4SGAE 1DY8A 1GI7B 2GZ7A 2FP7B 1P04A 3KCGH 1ELBA 1MKXK 2Z94A 5A2MH 5L30H 1QIXB 1EOLA 1AE5A 3KHVA 2A0QB 2XWBI 5TCAA 2VIDA 2ZHFH 2EY4C 1ZSKA 2PW8H 2Q1JA 2A4GA 1HAVB 2ZIQH 2ZA5A 5C3NA 5K0HA 3P70B 1TX8A 3QZRA 2IPQX 1O3PB 4THNH 5DP8A 2YNBA 2HVYB 2QN5T 4J1YA 4DW2U 4E7NA 3ZZ4A 4YOJA 1G37A 4GHTA 4ISHH 5JBTA 3F2HA 1NC6A 1T8OA 1HAGE 1O5EH 2PFEA 4MNXA 3RXLA 4B75A 1L1JA 3HATH 1MQ6A 1NRQH 1O2WA 1VCPA 4X1NU 1NN6A 1D9IA 1NBMD 1UTQA 2GKVE 4DVAU 1AE8H 5EIYA 3SJ9A 4ABEA 3VGCB 1MTSA 3EE0B 3UB0A 1GBLA 3OTPA 5EJ1A 4FOUC 1UHBB 3ZVGA 5GXPA 1KDQB 4KTSA 4NIXA 3RLWH 1GDNA 3BG4C 5EXLA 3A87A 1BUIA 1NRPH 2F43B 1QL8A 1QY6A 2ZO3H 2WZQA 1PQAA 1O37A 2JJ2D 5ETXA 3PMHB 1QURH 3M36A 1A2CH 2OTVA 1IQIA 1LDTT 1O2OA 2GZ8A 2ZDLA 1VCWA 1WDIA 1TOCB 1KTSB 3KF2A 1WCZA 1HFDA 3V7TA 1E34B 2V0BA 4U01A 2P59A 1TGCA 1C2KA 2GX4A 2BM2A 3RXFA 4E05H 1IQMA 1GCTB 2GV7A 5JB8S 1QTFA 4X2VA 2JDID 4OS1A 5EW1H 2BVSH 3RU4E 3RXEA 3QK1A 2ZWLH 3FZZA 3T26A 3LGTA 1EZQA 1OP0A 3DD2H 1G3EA 4QT8C 1ABJH 2VWOA 5HIZA 2GCTC 1EPTB 1H9HE 3HK3B 3SW2B 1QNJA 5ESBA 2WPJS 3TJVA 1MU6B 1KXDA 3QN7A 2JJ1D 5DP5A 3SZEA 3ZV8A 1GCDA 2BX3A 4B2CA 3U8OH 2FXRA 1PYTD 4NA8A 1ANEA 1K28D 1IAUA 3A8AA 3SORA 1OKXA 1BA8B 1YCPK 4AFZA 2JH6D 3BTKE 4MNYA 2AFQB 1RD3B 4FU7A 3NWUA 1BCUH 4A1VA 5C0TA 1VITH 1KMHB 2FS8A 1MKWH 2ANMH 1WOFA 1O32A 2H5CA 2HVXA 1SLWB 1YF4A 3GYMA 3M7QA 1MD7A 4OS7A 1L1NA 3DFJA 1T7CA 2GDDA 4OS4A 1YCPM 1A5HA 1UK3A 1XMNB 2VVUA 1C2FA 1E36B 4DIIH 1C1MA 5C20A 1XX9A 2BXTH 3PTNA 2CXVA 3RXVA 1XM1A 1SLVB 1CGHA 2Z9LA 4AFQA 4D9RA 2WV4A 2ZGHA 2L6OA 4DGJA 4K2YA 1GCTC 1O36A 2BMGB 3VFEA 1ZMNA 3P8NA 1TNKA 5HMAA 3VB5A 1O2RA 2TRMA 1GJ4H 1DX5M 1P2JA 3ZVFA 3NUMA 3GDSA 4TYDA 1BRCE 1P2OA 2PTNA 5DKMA 2FYQA 1AKSB 5FL7D 3EDXB 1S82A 2WYGA 1QBNA 1Q31A 2FOGA 4GVUA 4Y6DA 1V2OT 1C1OA 4JZDH 1CGIE 1C2LA 3H7TA 1QA7A 2GJGA 1DFPA 2F9UA 1TLDA 1LHDH 2FZZA 3RXJA 3ZV9A 1AIXH 3W94A 1NFUA 4E7RG 4AC9A 3A80A 2QF3A 2PUQH 2WINI 2J94A 1DXWA 1C5NH 4UFDH 4B74A 3F9FA 1A0HB 4VGCB 1A0JA 1BHXF 3VB4A 1S6HA 2KFWA 3SU1A 3FP7E 3S0NA 2UWPA 5AFYH 1O3AA 3GCHC 3QTOH 1UVUH 2WYJA 1HJ8A 2ZDMA 2YMSD 2SNWA 1P06A 4Y7BA 2FX6A 4HI3A 3RXHA 2J9NA 2F9PA 2Y5HA 1O2SA 1GHXH 2Q6DA 5FPTA 1C2IA 2BVRH 4NZQA 3UWJH 3VB3A 1H8DH 1ELDE 3TGJE 3P8FA 1T8LA 4I8HA 1SQRA 3PLPA 1ETRH 4YOIA 3BG8A 3T2NA 3ZYDA 2GZ9A 1EB1H 2VIPA 4JK5A 2FEQH 1NTPA 2G4UA 1FNIA 4IW4E 1IQHA 1HAVA 1K1OA 2FI5E 2OC7A 4I8JA 1C5WB 2H5DA 2QF4A 4X0WU 9ESTA 1GVLA 3UIRA 3LKWA 1BTYA 2K8IA 3TLOA 1A1RA 2KM0A 1FQ3A 2IOTA 3TITA 4R0IA 1VZQH 1QQ4A 4F49A 3A82A 2P95A 2YOLA 2BDYA 1V2VT 1YBWA 4X6NA 4A7IB 1TPOA 2ZDNA 1GBFA 3FOAA 2W6JD 2L74A 5GJ4B 3SU0A 2JKHA 1GVKB 4VGCC 3Q76A 2UUJB 2ANWA 5GPIB 1UK2A 4BAKB 1O3LA 1C5OH 2F9OA 1TBRH 1W13U 3AK5A 2B7DH 1UHBA 2XRCA 5AF9H 3E16B 1OOKB 2XBYA 1KDQA 1YPGH 4A6LA 1FDPA 4XBDA 1NRSH 3UR9A 3RC4A 1A3BH 2KCOA 2G4TA 1YPKH 1Z71A 5EGMA 2J4IA 3BIUH 4FVDA 1EZSC 3NRLA 1UVSH 1ARCA 4K8BA 1FAXA 2AH4X 1SQTA 3ATKA 4NSVA 5JB9S 5BPEA 1S6LA 2H1UA 3S9AA 1GBCA 1KLJH 4I8KA 3T29A 1V2UT 3KQCA 1BDAA 1GHZA 3SNBA 2D26C 3SQEE 1MKWK 3CS0A 3UOPA 1OYQA 3VXEH 1J16A 1V2NT 5JBBS 3QZQA 1KY9A 1DLEA 4D8NA 1V2LT 1SHHB 3DSGA 1P2KA 3MWIU 1SFIA 5EXMA 1XVOA 2XNDD 3E6PH 4JZIA 4CRDA 1UTJA 1TRNA 1K1JA 1DSUA 4JYTA 1TMTH 3RP2A 3GY7A 5EG4A 1P09A 2Y80A 1NROH 4F55A 3VPKA 1O3JA 1GL1A 4O97A 2WUBA 5T6DA 1O5GH 5FBEA 1PPGE 1O2TA 5EPNA 1O3CA 2VGCB 4Q63A 5HKKD 2V3MA 1O3OA 2GVFA 1ZRBA 2R2WU 2Y7XA 2A7JA 4TWWA 1S5SA 1SR5C 1O39A 3ZZ3A 1MZDA 1VKYA 3HGPA 2FX4A 3LH1A 4AFUA 5GCHF 2ZCHP 1YGCH 1MTVA 3TIUA 2BLVA 2QXHA 1D6WA 1BT7A 5DN6D 5DP4A 1S6FA 3WY8A 1Z7KA 3ZVAA 1ZSJA 2V3OH 2ZP0H 1MQ5A 2TPIZ 4FUHA 1AFQC 1L2EA 2BHGA 2WPLS 4B76A 1XUHA 4ZKOU 1DY9A 1O3HA 2PP6A 2FM2A 3K2UA 4A92A 1GJ8B 1OWHA 1P2QA 5DP3A 2BY5X 3G01A 1AB9B 1SLUB 2PUXB 1VITF 1C9PA 1WV7H 3M35A 1Z8IB 2KAIA 2IN2A 8ESTE 4O3TA 2HALA 1G30B 1AKSA 1O3BA 1O33A 4I7YH 1D3DB 1SGYE 1WTHD 3STIA 1C5LH 3RXPA 3NK8A 1OWDA 2ZU4A 1GPZA 4LOYH 5DG6A 1EQ9A 3H5CB 2G5VA 2C8ZB 1GG6B 5CE1A 1DITH 1SGCA 1TGTA 4FUDA 3QLPH 4WWYA 1HDTH 1DSTA 1GBIA 3JZ1B 4H4FA 4IMQA 1N6XA 4X8TH 3SU4A 5A09A 1ACBE 2Z7FE 3PO1B 1LVMA 2UUFB 5DP7A 2B8OH 3UFAA 1PQ8A 1C5UA 1EAUA 3QGJA 5JPMH 1C4U2 2RG3A 4U2WA 3P8GA 1RJXB 1Z6EA 4OM9A 4O03A 3O8DA 1FPHH 3F2FA 1P12E 1OWJA 4Q2KA 1QCPA 1F0RA 2STBE 3BTGE 5C1UA 1VGCB 4JCNA 3BTWE 1CVWH 2BD9A 4XFQA 1Y3VA 3OEHD 2HLCA 2ZPRA 4MDSA 3RXDA 1KTTB 1ANBA 1YPMH 4KELA 3LGVA 2QY0B 2V7QD 4UFGH 2BLOA 1PFXC 3N7OA 1TE0A 1WU1A 1VITG 4TY6A 1JWTA 1E0FD 3GYLB 2PWXA 1Z8RA 1ZPBA 4IC5A 3UUZA 1GBTA 1GI2A 3Q3YA 4ZKSU 1N1LA 1IQNA 1A7SA 1GG6C 3A84A 5LH8A 4WMEA 1QR3E 3ODDA 3SUGA 2GT8A 1HAPH 3A7ZA 3A88A 1A5GH 1T8NA 4Q4LA 3TU7H 2FYRA 5AFZH 1PPFE 3PRBA 3GY5A 2QF0A 1UTOA 1F0TA 1PQ5A 1SFQB 2ALVA 2ZQ1A 4ISLA 2SGQE 1O5FH 2ZFFH 3PMBB 2Q6GA 1TOMH 3LDXH 1F92A 2BOHB 1ZHPA 2PSXA 1G3DA 5TCCA 1VGCC 3A7XA 1O3KA 1T4VH 3JZ2B 4GHQA 2SGAA 4GUXA 1C1PA 4KTCA 1OPHB 3KN2A 5E2PA 1W0ZU 1F7ZA 3PLBA 1HAXB 1EASA 2Q6FA 1LVYA 2V3HH 3EGKH 3W1EA 1BMAA 4ACBA 1SBWA 1O5CB 3MU1A 1GHAF 4CRGA 1C5VA 2VINA 2I6QA 2ESTE 1ELTA 3RC5A 3UTUH 1IHSH 4Y71A 5DPAA 2XYAA 4AN7A 4BTUB 3TPIZ
chains in the Genus database with same CATH topology
1MTWA 3M5NA 1GGDB 1G2MA 2XC4A 2ZFSA 2J92A 4IMZA 1SGDE 3BIVH 1ZJDA 2FOAA 2HPPH 3S9BA 3FP8E 2DE8A 2Z6BD 1C2DA 3E0PB 3RLYH 1DM4B 2AMQA 1UVOA 1ZHMA 1GJAB 3RXCA 2WV5A 3ZYEA 1FY1A 3PB1E 1QHRB 4NFFA 1MUEB 3AW1A 2B9LA 1MMJN 4BANB 1TBZH 4J2YB 1KLTA 3QGNB 1YM0A 4K8YA 1V6DA 1UTNA 2VIOA 2TIOA 1PPCE 1C2EA 1ABIH 2G52A 3ZVEA 1OP2A 2F3CE 1KIGH 4M7GA 3D65E 2BVXH 4ABJA 1EJMA 1EZUC 3T28A 3A89A 1Y5UT 1BTHH 1THRH 1J14A 4X8UH 4XE4A 1EX3A 2C4FH 1P0SH 2VU8E 1P10A 3STJA 1Z8GA 3OU0A 2Y82A 3MOCA 3URCA 1RFNA 1SI5H 4U30A 1CSOE 2OP9A 1GHAG 1CT0E 2ZF0H 3PWCA 5EU8A 1TRMA 1C5MD 2Z3DA 3UOUA 4XBBA 4DG4A 1AZ8A 1TA6A 5BRRE 2BY7X 2Z9IA 1GGDC 1HGTH 3TGIE 2QIQA 2GCTB 1RIWC 4X2XA 3UR6A 1KYNA 1PPBH 1V2JT 4CRCA 1BBRH 1EJNA 3TK5A 2A4RA 5HGGA 4MVNA 3E1XB 1GI9B 1O2HA 3UQOA 1LHEH 2JH5D 3ELAH 1HAYB 1H1BA 2P3TB 4FUEA 1NS3A 2WUCA 1SOZA 2F91A 1ARBA 2BDHA 4Y10E 3GDUA 3FP6E 4ABHA 3PMJA 4JZ1A 1J15A 1C2JA 2TGDA 1ETSH 1W0YH 1AO5A 2ZHQH 3PM3A 5ABWA 5E8EH 2G51A 4MG3A 3PMAB 2STAE 4AG1A 2FOMB 1XUKA 1HV7A 2XW9A 2D1JA 4UDWH 3K9XB 1C2MA 3U98H 1JIMA 1QB1A 1AGJA 1UJ1A 3P92A 2C93B 1C2GA 3FANA 1BMLA 3KEEA 4D76A 2ALPA 1J17T 4BOHA 2ZC9H 1TNGA 1W2KH 5EOKA 1QRXA 4E06H 4RSPA 5FPSA 3E90B 5F03A 4NSYA 3U69H 1XVMA 2VB0A 4I32A 4BXSA 1HB0B 1WQSA 3S7KB 2ZTXA 1C4V2 1AY6H 4ABDA 1E37B 4GLYA 2CJIA 2QC2A 5A8YA 3O8RA 3SGAE 4CH2B 2VJ1A 3ATWA 1O5BB 1O2IA 3RU4T 3M7UA 3RM2H 2BD5A 4OS6A 4AZ2B 3RXBA 4NGAH 3MO9A 2R3YA 3TNSA 3EAJA 4Y0ZE 1O2NA 1GDUA 1K22H 1VCQA 1KXAA 2HRVA 2H6MA 3GCHB 2VVCA 4X1QU 4DIHH 4NWKA 2NU4E 3TGKE 3HPTB 1NFYA 1AWHB 3SQHE 3U8RH 2EI7A 1HJ9A 1C1SA 1DXPA 1SVPA 2A5KA 4NA7A 2EC9H 2BY8X 3M3SA 3P8OA 3GY2A 2ZECA 4NFEA 1Z1IA 1GDQA 1QJ6B 1WYKA 1A5IA 4AB9A 2Y6TA 2KAIB 3OSYA 4MPXA 1JOUB 3C27B 1TX7A 4BNRA 5SGAE 1LQEA 2ZHWH 1EXFA 1DWEH 3H7OA 5EW2H 1O2JA 4YZUA 1O2YA 3BN9A 2UWOA 2ZU3A 2XCFA 1N6YA 2P16A 3L33A 3NCLA 3T5FH 5GDSH 3A7YA 3VXFH 1YC0A 2BDIA 5AHGH 4ZHLU 4O3UA 2C90B 2FIRH 5IYTA 2F83A 4LK4A 4DY7B 4ZHAA 1V2QT 3ZZ8A 4Y0YE 1CO7E 3E0NB 1BRAA 4NIVA 4DJZB 1O0DH 3BSQA 3DHKH 1ESBA 1XXDA 2Y5GA 5A0CA 3LJOA 1BHXB 1QJ1B 1GBMA 6CHAB 3GICB 4K3JA 3SV2H 1P05A 4ISIH 1UO6A 1HAIH 5DO4H 3TJNA 1HXFH 1ID5H 1L1GA 3W95A 1FIWA 1Y3UA 2NU0E 3T62A 1TGBA 3A83A 1E35B 2OLGA 4NG9H 5JYIA 2ZHDA 4Q7ZA 3ESTA 1OWKA 1S81A 1SQOA 2AMPA 4LZ4B 1BTWA 2H9TH 1T8MA 1RTFB 3ITIA 3MNSA 3QWCH 5FBIA 2GMTC 5JBCS 1XUGA 4WH8A 1O35A 5DK1A 1AFEH 4UONA 4IC6A 4FUBA 4JK6A 1A4WH 4WH6A 1P3EA 1BTZA 4YOGA 1AU8A 1HYLA 2W26A 1AZZA 2A5IA 4TPYA 2SGFE 2A1DB 2OD3B 1ELEE 2P8OB 4WMFA 4ZROA 3GY3A 3SU5A 4ZKRU 3KQEA 2RA0A 1IQFA 3L3TA 2XNIA 4BAMB 4IN1A 2PGBB 3SU6A 3LGWA 2Z3CA 1Y3WA 2G00A 2D2DA 4ABGA 1TALA 1FN6A 2CN0H 1CHGA 2PGQB 1GHYH 6CHAC 3ZZ9A 2W5EA 3FVFB 1HLTH 2ZEBA 2ZGBH 5B6OA 2IPHA 1CA0C 9LPRA 1MAYA 1ELGA 1V2PT 1UCYH 1PQ7A 3RXIA 2FWWA 2IJOB 3DFLA 1YPJH 1ZPCA 1Y8TA 2GGVB 5HYOA 1EUFA 2O9QA 1C1NA 1SGFG 1CE5A 2ZDVH 2WPHS 3ZZ7A 1O2GH 3F9GA 2HWLB 3LJJA 1P01A 1VJAU 1Z1JA 2GCHG 3GDVA 2ZU5A 3OYPA 1W12U 2ZCLP 1CQQA 1LCYA 2R2MB 1YP9A 4OS2A 4CHAC 2O8WA 1ELFA 1BOQA 5PTPA 3SUEA 3PTBA 3V13A 2PSYA 2BX4A 3F9HA 4X6MA 5J4QA 1GMCF 4FUFA 2PR3A 3S69A 3U1JB 1OS8A 1GI1A 1AFQB 2P8OC 2VIQA 5C5OA 3L6PA 2QYIA 4I8GA 1O2KA 2A7CA 4K1EA 2AEIH 1WQVH 4YLUA 2FTLE 1ZZZA 5C5NA 3GY8A 2OC0A 1QB9A 2C8XB 2QA9E 3BTME 1ZSLA 1ORFA 4BTIB 1IHTH 2XC5A 2Y5FA 1ELVA 4TWYA 3SUDA 4CBNA 2UWLA 2BY9X 4X1SU 4BAQB 2GV6A 1NFXA 3GCOA 2TGTA 1Y5BT 3CS7A 3EYDA 2A7HA 3M37A 4OGYA 1PPEE 1M9UA 3NPSA 3E3TA 5HXFA 4D7GA 1C5SA 3LGUA 4B2BA 3KQBA 3K65B 2PTCE 1GI4A 4AOQA 1FMGA 1QBVH 1ZGIA 1GBEA 4FUIA 3HK6B 4DURA 1C5ZB 4XSKU 3O8BA 1PYTC 1ESAA 1P2MA 3ZZDA 5AVDA 2K1QA 1CU1A 4YO9A 1T32A 5DJ7A 2FESH 1TMUH 3ZZ5A 3BEFB 3AVZA 3QO6A 1A0LA 1ZYOA 1JRTA 3SUFA 2EI8A 3SJKA 4X2YA 1G32B 1GMCG 2Z9JA 3RMNH 3NKKA 2RA3A 1SGIB 4Y8ZA 2EI6A 1MZAA 3LGYA 4KTUA 3RXOA 4WY3A 1QA0A 2JETB 1THSH 2BLWA 3VB6A 2ANKH 3A86A 3RDZA 3ZZBA 3RXKA 4ABIA 1QFKH 2HNTF 2RCEA 4CRAA 1OP8A 2QV1A 1MU8B 1ANCA 1DUEA 4GAWA 1S0QA 1TFXA 2DE9A 1BTXA 1UMAH 2XXLA 1C1VH 1SPJA 1HRTH 5TJXA 1EATA 2ZPSA 1YPLH 2A45B 1KXBA 1F5KU 2CF9H 3E91A 1QQUA 1W3CA 3EA9A 3MI4A 1Y3XA 3DT0H 3LC5A 3QX5H 2CGAA 3MTYA 1BTPA 1A46H 1UTPA 2M5TA 4LZ1H 3RC6A 1TNLA 3SV7A 3MNXA 1GL0E 2P93A 1GMHF 3AAVA 4Y7AA 4H6TA 1EAXA 2OC1A 3M5LA 1P57B 1K21H 5C67A 2FI3E 4ZHMU 3IITA 3A7TA 2OUAA 1G3BA 1SGFA 4AGJA 4MPVA 3A7VA 4BTTB 4UE7H 1JXPA 1TGNA 5FX5A 4AORA 8GCHF 1UCYK 2ZFRH 4XDEA 1IQGA 2W7UA 1TNIA 4WXIA 2JETC 3RXQA 1OYTH 4Y11E 4INLA 2H9EH 1SSXA 2AGIX 1RRKA 1P9SA 2HNTC 1XKBC 4INHA 2P3UB 4JYUH 1MH0A 4X2WA 3GOVB 5E0HA 1HCGA 1K1NA 5LGOA 5C2ZA 3RXUA 3TH4H 1A61H 3RXAA 2ZZUH 6ESTA 1P3CA 4DCDA 1ZTJA 2AS9A 3O8CA 3UREA 2AGGX 5CMXH 4NWLA 1O30A 3F1SB 3NZIA 2VIWA 3C1KA 3M3TA 1HAZB 3VEQB 1D3TB 3P6ZB 5C1YA 1XUIA 4GPGA 5F6MA 1NM6A 2FOBA 5IDKA 3TK6A 1AN1E 5G4BA 2VWMA 1HUTH 2SGDE 3SV9A 4B73A 1O31A 4B1TA 2BQ7B 1Z6JH 1K1MA 1GMHG 2QXIA 1FI8A 2HGTH 2FS9A 1D3PB 1EJAA 3F68H 3CP7A 5FX6A 1OWEA 1MAXA 4FUCA 2AIPA 2BDBA 4JYVH 2ZPQA 3MHWU 3SO3A 1CHOF 1SGRE 3NXPA 1EKBB 1O2ZA 5L2ZH 2J95A 1TIOA 1GJ6A 3LPRA 2WPMS 4ABFA 1K1IA 1S0RA 2FDAA 2AMDA 3SHAH 4DOQA 8GCHG 3PV4A 5J4SA 1EAIA 1L4DA 1G36A 5GWZA 3GCTG 2TBSA 3MNCA 1BMMH 2VVVA 1B7XB 1GHWH 2FMJA 5T6FA 4X8SH 1T4UH 4WF8A 5H4IB 1HJAC 1RIWB 1ZJKA 1FZZA 2Y81A 3LGIA 4X1PU 3LIWA 4ZH8A 4HFPB 2G55A 1YCPH 4MPWA 1H9IE 4OS5A 1V3XA 2ODYB 2PKAB 1X7AC 1O2VA 1F0SA 2ZTZA 4INKA 3TH2H 1C1WH 3ATMA 1L4ZA 3KL6A 1N8OB 6LPRA 1J9CH 1S83A 3BTTE 3T25A 3RXGA 4YLQH 1GHBF 3I77A 2XBXA 4I31A 1G2LA 3PROA 1NZQH 1XUJA 2THFB 3SJIA 3SNDA 3B9FH 1DPOA 2OQ5A 4ZAEA 4ZUHA 1HIAB 2FPZA 3ATLA 3M5MA 4OGXA 1AVWA 2FO9A 4O9VA 1ZOMA 2A31A 4ASHA 3BF6H 1BBRE 3SGQE 2TGAA 4D9QA 2UUKB 3BTFE 3GISB 3U8TH 2OQUA 3M61U 2ZNKH 1ZMLA 1SOTA 1CHOG 3SBKA 5E0GA 4K1TA 1INCA 1GI0A 1DT2A 1YLCA 3URDA 3TVJB 4CREA 1TX6A 1AI8H 4ZXYH 5FCRA 1UTMA 2BQ6B 2ZDKA 3RXTA 8KME2 1C1RA 1GJ7B 2V35A 4CBOA 2ANYA 3VB7A 2BLQA 3D23A 4IN2A 1YPHC 1TABE 2C3SA 1MBMA 3FAOA 1JRSA 2NU3E 1AWFH 3Q3XA 1HAOH 1FAKH 1C5RA 1GJCB 2RDLA 3F9EA 1FV9A 3SNAA 1W10U 1F5RA 3Q00A 4UD9H 2ZCKP 3UWIA 1DOJA 1YPEH 2NU2E 1MTUA 3RXSA 1NY22 4YT7H 3SV6A 4FU8A 4YM9A 2V6NA 3EA8A 1GMDF 1FN8A 3UPEA 1C9TA 1N8OC 1AUJA 5T6GA 1MTNB 1HBTH 2A2XH 3OY5U 2DUCA 3TH3H 1KXFA 1H9LB 4H42U 1GHBG 4WMDA 2B0FA 2ZI2H 1S84A 2ZFTA 3AAUA 4IBLH 2OCVB 4A5TS 3V12A 1DLKB 2BZ6H 3UNSA 1O5DH 1TPPA 4MNVA 1GHVH 3SHCH 3TJOA 2VNTA 3DUXH 5ESTE 1AHTH 2EA3A 2XTTB 1FIZA 5E0JA 4HZHA 4FXGH 4ISOA 2G81E 2W3KA 1EB2A 2J38A 4SGBE 2D8WA 1EP5A 4Q7YA 5CHAC 3RUOA 1TPAE 1IQJA 2O8MA 2AGEX 5F8TA 4Y79A 5E2OA 3BEUA 2W7SA 2CF8H 4X8VH 3A85A 1O3NA 1UVPA 1PJPA 4AGKA 3SV8A 5A0AE 2ZG0H 2ILNA 3Q77A 4FUJA 4UFFH 3ATIA 2HNTE 3U9AH 2PV9B 2VWNA 3GCNA 2ZDAH 1D4PB 4AYYB 2LPRA 1CA8B 4K5ZA 1PPZA 1C1QA 1TQ0B 1NRNH 1FY5A 2Y7ZA 5JDUB 4FVBA 1GMDG 2AIQA 3IG6B 1MTNC 1AUTC 2SNVA 3BTEE 4AG2A 2BD8A 4JZFH 4MPUA 1A3EH 3SI4H 4MNWA 1THPB 2GP9B 2ZFQH 1W8BH 1FPCH 1ZTLA 2CMYA 1C1UH 3VGCC 4GCHF 3TNTA 1KSNA 1WTGH 3BEIB 5DGJA 3BV9B 3SOSA 4ZMAH 3R0FA 1YKTA 1D3QB 1VJ9U 1IQEA 2BD3A 2O8LA 3PLKA 1LPGB 4KKDA 4UFEH 1FJSA 1GI8B 2OINA 2XCNA 1BZXE 2SGPE 1RTKA 1Y5AT 3LH3A 2GMTB 1LO6A 1T31A 2QXGA 5L2YH 7KMEH 2YNAA 5L6NH 1WBGB 3MU8A 4F4OC 3ZZAA 1OXGA 2BD2A 1NO9H 4FU9A 1SGPE 1LQDB 3I78A 3LT3A 1GBAA 3K6YA 3SNCA 5HM2A 1LKBA 1Y59T 3HGNA 2ULLA 3M5OA 2VH6A 1Z8JB 4NIYA 4R8TB 1ELCA 1OWIA 3MU5A 1LVOA 3EQ0H 1EP6A 2BOKA 4ABBA 5EODA 1O3GA 2OC8A 1E38B 1EPTC 3MMGA 4BXWA 2VH0A 1LPKB 2XBVA 3KGPA 1B0EA 4XOJA 2ZTYA 3GY6A 1DICA 2PKAA 1CA0B 4GCHG 2G5NA 1BBRK 4ABAA 4BAOB 3A7WA 5A0BA 3SU3A 1K2I1 1SB1H 2UUYA 1O2XA 3ODFA 4UEHH 3A81A 1C4Y2 1HAHH 3P17H 3MNBA 1J8AA 1NPMA 1LHGH 2GCHF 4B2AA 1HIAA 1FY3A 1LVBA 4HGCA 1UTLM 1B5GH 1LPZB 3CENA 3QDZB 4K69A 4CHAB 2OXSA 5JBAS 8LPRA 3RU4D 2GTBA 1GBBA 1ZRKA 1ETTH 1O2UA 4PROA 2BXUH 1O3DA 3TJUA 2R0KA 2W3IA 3RXMA 1YPHE 4BAHB 1O2PA 2GD4B 3RM0H 1V2MT 1UCYE 2R3UA 5A8XA 2FLRH 4ZKNU 1PPHE 3UQVA 4IS5A 1SGNE 1V2ST 4WXVA 4X6OA 1SC8U 1V2KT 4LXBH 4HTCH 1BITA 4AB8A 3M7TA 2ZQ2A 1W11U