1ZYOA

Crystal structure of the serine protease domain of sesbania mosaic virus polyprotein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
184
Chain Sequence
SFYSPVKAGDEPASLVAIKSGPTTIGFGCRTKIEDCLLTAHHVWCNSMRPTGLAKAGKQVSVEDWEISMSSSDKMLDFAIVRVPTHVWSKLGVKSTPLVCPSSKDVITCYGGSSSDCLMSGVGSSSTSEFTWKLTHTCPTAAGWSGTPLYSSRGVVGMHVGFEEIGKLNRGVNMFYVANYLLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords serine protease
publication title Crystal structure of the serine protease domain of Sesbania mosaic virus polyprotein and mutational analysis of residues forming the S1-binding pocket
pubmed doi rcsb
source organism Sesbania mosaic virus
total genus 40
structure length 184
sequence length 186
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02122 Peptidase_S39 Peptidase S39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA02
1BTHH 1ELGA 3IWMA 1RJXB 1KXBA 4AX9H 1O30A 3RC4A 2FOAA 3MNXA 3Q3KA 2RA3A 1BCUH 4AYYB 4GSOA 1X7AC 5A8YA 3ZZ9A 2WUBA 3M61U 1HAVB 1XVOA 1CE5A 3AASA 2CHAC 5GWZA 1QRZA 3NKKA 1MD8A 4AOQA 1UCYK 2HPPH 3JZ1B 3URDA 3A7XA 3LC3A 5DP5A 1WTHD 2W7UA 3MO9A 1ABJH 2BTCE 1ZGVA 1BTXA 1ORFA 4NA7A 3LONA 2TIOA 1NU7B 2FS8A 1QJ6B 1YPKH 1P05A 1RD3B 2BXTH 1QCPA 3E8LA 1ID5H 3DUXH 3MNCA 1FY1A 4O97A 3LDXH 5DGJA 3S9BA 3SI4H 3BG8A 4DGJA 1F92A 1WQVH 4Y8XA 2CHAB 1QGFA 2FOEA 2VWOA 1JOUB 2A4RA 3E0PB 3EA8A 2BDIA 2FOHA 1FUJA 1D4PB 4A6LA 1L1GA 4GHQA 4BAHB 4JMYA 3F9HA 1O37A 1UVTH 1P04A 5GCHF 4X1RU 4ZXYH 2FIRH 1QA0A 2GCHG 1EJMA 3K9XB 4NWKA 1C5MD 2G4UA 1YPJH 3GDVA 1TYNA 3UY9A 2DUCA 4MNYA 1O3FA 1MKWK 3M35A 4A1VA 1GI4A 4WMDA 1HAYB 2D2DA 4NCYA 4AG2A 3L3TA 3OYPA 1AB9C 5C3NA 1HB0B 2FOGA 1BTYA 2SGAA 3PM3A 3UTUH 4NA8A 1FPHH 2D26C 1SLWB 2NWNA 2B9LA 5EG4A 1BTUA 4NIWA 1YP9A 1ETRH 1P03A 3ODDA 1QURH 2FTLE 4IGDA 1VCWA 3EA7A 4WMFA 4CBNA 1BOQA 1SLUB 1V3XA 2GP9B 3MFJA 1TA6A 4U01A 2RCEA 4FUCA 3ZZDA 1C5YB 4ZROA 2V0BA 2AEIH 2XBXA 1AB9B 1SGCA 3GICB 1CT2E 3I77A 4J2YB 2XW9A 2Y5FA 4BAOB 1HPGA 2RA0A 2FOCA 1GJBB 4UFGH 1QB1A 2ZU3A 8ESTE 1QB9A 1TALA 3UNSA 3SGQE 5PTPA 3SU4A 1DWDH 4B2CA 1TGCA 2BDHA 3BTKE 3A82A 5JBAS 4YT7H 3STIA 3SZNA 2STBE 2R3YA 4JK6A 2R9PA 4O3UA 4H42U 1AVXA 1E0FD 1Y3XA 1ELBA 1SGFA 4X1PU 1O2OA 1OYTH 2Q6GA 2SGFE 2VB0A 4BXWA 4XBCA 4JZ1A 2BQWB 2TGPZ 3F1SB 3ELAH 2BHGA 1QY6A 1NZQH 5C1YA 3T25A 4ZHMU 1BDAA 2GD4B 2ZHDA 1SSXA 1C2JA 2V3HH 3RXKA 3QO6A 4ABHA 1F0SA 4KTCA 2H5DA 4UE7H 2O8WA 1ZMJA 1GCTB 4QT8C 1KXFA 3PWBA 3EA9A 1V2PT 1DICA 2ZGHA 1WAYB 2VWNA 1CT0E 4Y6DA 3SU1A 2SNVA 3TK9A 2BZAA 3MH6A 3SGAE 1CA0C 4X8SH 1C4V2 2LNCA 4LK4A 2OC0A 3MU0A 1UTLM 1QBNA 1CSOE 3V7TA 2ZTZA 5A0AE 3PYHA 3P6ZB 2BD4A 3RU4T 4NIVA 1G32B 2Q1JA 2J38A 3MO3A 2B8OH 4Y8YA 2A7JA 3BTGE 1UMAH 2P95A 4FXGH 4AB8A 3OSYA 3Q00A 3RXUA 3RU4E 1GHWH 3SJKA 1CO7E 3FP6E 1BBRK 5ETXA 3A7ZA 4Y10E 1IQLA 1Z1JA 2PGBB 1HYLA 2JH5D 4YZUA 1CHOG 4FUGA 5EXLA 1LHGH 3SV8A 1CA0B 1TX7A 2BD9A 1YPLH 1EOLA 1A5GH 2ZFFH 1ANEA 1PYTD 3OY6U 5FCRA 2BY7X 5HYOA 2FX6A 5A2MH 1JIMA 4MNVA 3P8GA 1MD7A 5J4SA 4FU8A 4CRDA 1SR5C 3SU0A 1NRSH 4Q2KA 1T8NA 1THRH 2F83A 1MAYA 1V6DA 4WVPE 1T8MA 2Z3CA 3S9AA 3I29A 3F68H 5E0JA 4CREA 3QWCH 2ZTYA 4A7IB 2SGQE 1XUHA 3A86A 3SW2B 3BEFB 2Q6DA 1QBOA 1H1BA 1GGDC 1NY22 2VIOA 3V12A 1RIWC 4HFPB 5T3HA 1QFKH 2Z9JA 1AWFH 1GHXH 5IYTA 3O8RA 1GJ7B 3UQVA 3QX5H 3T28A 2PWXA 1SOZA 3RXBA 7LPRA 1RTFB 3RXLA 3K6ZA 3RC6A 3STJA 1S83A 2OBQA 1UTOA 1TBRH 1C2IA 3UREA 1IQHA 1YYY1 2F9OA 2XTTB 2BY6X 1EJNA 4CH8B 1GBFA 1O2JA 2JH6D 1TE0A 2VU8E 1FY8E 2WPKS 3ATWA 4K60A 4B1TA 1C1MA 2BY9X 4MVNA 2HPQH 1ZTKA 3UFAA 3SNEA 3P70B 4B75A 1PYTC 1RIWB 3A85A 1SHHB 2Y7ZA 1HAZB 1G30B 1C2EA 5GXPA 1UK3A 5DKMA 2FXRA 2FOFA 4D9RA 5GPIB 2W7SA 4Y11E 1ZZZA 2H1UA 1TB6H 3PMAB 1ZJKA 4X6PA 2H9EH 1EAIA 2P8OC 2Z9LA 1Y3YA 1EB2A 4NIXA 1TQ0B 1K1OA 1W7GH 2OQUA 1S6HA 1EZUC 1CHGA 3GDSA 3TJUA 4F49A 2ZCHP 1PPGE 2VJ1A 3KN2A 3T5FH 1P09A 2GGVB 5HMAA 4ZMAH 8GCHF 3RP2A 1C5QA 3DHKH 4X2WA 7ESTE 3U8RH 3MH7A 2VIVA 3MU8A 1S82A 2B5TB 4ABAA 1AE5A 3KHVA 3HKIB 1O3PB 3V0XA 2SNWA 6CHAC 1LVBA 4JZEH 2FYQA 2AMDA 2P8OB 1V2JT 1GMDG 1VITF 2XC5A 3ZVFA 1QB6A 2W3IA 3GCTF 3SV6A 5EGMA 1XKBC 3UWIA 2W26A 4DG4A 3SV2H 1XXFA 2FOBA 5L30H 1UVUH 5LGOA 1NM6A 2WPLS 1IQNA 1D6WA 4K2YA 1SGIB 1TPPA 5E0GA 4OS4A 3UIRA 6CHAB 2F9PA 1A7SA 3RC5A 2Z9KA 3A7TA 7KMEH 1ZRKA 3C27B 4HZHA 2CGAA 1Y59T 3W94A 1SB1H 2OINA 4UDWH 4BNRA 2HRVA 3RM0H 1SGFG 1KTSB 3SBKA 1OXGA 1UHBA 1HAXB 1K28D 3S9CA 1OSSA 1QA7A 1C4U2 2ZQ2A 1EAXA 2P16A 3MMGA 4YLUA 1TNIA 2VWMA 1GHAG 5A0CA 3BTTE 1A46H 1HJ8A 3D62A 1T8OA 3T26A 4JZFH 3U9AH 5FBEA 1GHYH 1C5PA 2BD7A 1OX1A 1K1MA 4DVAU 2B7DH 1GI1A 2AMPA 3SNAA 5E8EH 4DCDA 2BD5A 1GBHA 3P17H 2WV5A 1P2OA 3M36A 3PLKA 4FU9A 6LPRA 1ETTH 1G3BA 2AS9A 1MTVA 3A7YA 3M3VA 1NRQH 1FXYA 3RLYH 3T2NA 1GMHF 2FYRA 2AFQB 1O2HA 5ABWA 3RMNH 1ETSH 1O2NA 1FNIA 4UFEH 2VNTA 1C5ZB 1BA8B 4WXVA 1ZMLA 1BT7A 6ESTA 3SHCH 1KLJH 1AFEH 2GKVE 4ISHH 1GJ6A 1O3GA 1AKSA 4LXBH 4XSKU 5T6GA 2WYJA 2ZF0H 1GI2A 2A5IA 1VR1H 5AFYH 2BDBA 2SGEE 1J17T 1IQJA 2ZIQH 3UR9A 1C5UA 1AUTC 1MTUA 5H4IB 4DIIH 1LHCH 3RMLH 1O5FH 1DVAH 4I8GA 2FP7B 1TX8A 4ZAEA 1YPMH 1VZQH 5LPRA 2XC4A 1NN6A 1EXFA 1P2QA 3Q77A 4WWYA 3PLBA 1SGRE 1Z8JB 3ZVAA 2JH0D 2GMTC 2UWOA 2QC2A 1UTKA 5BRRE 5L2YH 1S0RA 1EZSC 1MZDA 1P12E 3P95A 1C5WB 1Y5AT 2ZP0H 1VGCB 1UTPA 1A3EH 3KQDA 3MYWA 1C1PA 4OS2A 1O2RA 1GI7B 4KKDA 4UFFH 1GI5A 2VVUA 1OYQA 1HCGA 1O3EA 1DT2A 1GMCF 4TWYA 4E05H 6GCHF 5FX5A 2PLXA 1YPHE 3BEIB 2GMTB 3H5CB 1GVLA 4MPWA 4TYDA 2ZGJA 3R0FA 2BVSH 4JZIA 1SGQE 4ISNA 1AFQB 1QIXB 3DD2H 1O2XA 1LVOA 4K69A 1THPB 1VCQA 1DXPA 1KLTA 3L33A 4INKA 3PTNA 1PPZA 5JDUB 3QZRA 1C2GA 1DY9A 1BTWA 3TH3H 1Z8RA 2ZKSA 1G3CA 3MNBA 2KAIA 2ZFRH 1UHBB 2AERH 3MH4A 3B23B 2HVXA 1EJAA 4CR9A 2O8MA 1L4ZA 1XUFA 1NC6A 1J15A 5AHGH 3RXPA 3ZVDA 5JBCS 1IQFA 1Q2WA 1B0FA 1KYNA 4RN6A 5A09A 1FY5A 1O34A 1N6XA 1W0YH 2HGTH 2PGQB 2FPZA 1O2IA 1A5HA 1C5RA 1V2RT 1P2JA 3GCOA 1DE7H 1Z6JH 3M7UA 5FCKA 1GJ8B 4HTCH 2ZFPH 1MKWH 3VGCC 1Y3WA 3SO3A 1TMBH 2WUCA 1E36B 1C1SA 1O2TA 1ESTA 2ILNA 4FU7A 2BLOA 3SNDA 2OLGA 1O35A 4NG9H 1GG6B 2NU3E 1C1WH 1KTTB 1JBUH 1MH0A 4NSVA 4NZLA 2ZFSA 3LU9B 3BV9B 1BRAA 3ATKA 3P8NA 1KY9A 1XVMA 2QY0B 3SHAH 2STAE 4BXSA 2Z94A 4X8TH 1C1TA 1C1UH 1DSUA 5IDKA 2ZU2A 2NU4E 1TQ7B 4X2YA 2XBYA 2OQ5A 1AKSB 3VGCB 2BQ6B 2PR3A 1THSH 1P2MA 2XC0A 4B2BA 4JYTA 2A2QH 3EGKH 3E16B 2QV1A 2QXJA 2BOKA 4X8VH 1DY8A 3TJVA 2A4OA 4D76A 5BPEA 1ANBA 3QLPH 3GY2A 4CRGA 2GDEH 1V2MT 1MU6B 1FIZA 2Z3DA 1BHXF 4FVDA 2QXIA 1O2VA 2WPHS 1QL7A 5JYIA 1XUKA 1MTNB 4X2VA 4OGYA 2QGRA 3A7WA 4MTBA 4ABIA 1DUEA 2ZHQH 3LGWA 5A8XA 3PROA 1ZGIA 3LKWA 5GDSH 1RGQA 1SGPE 3MU4A 4K3JA 3PWCA 1GJCB 2D8WA 1OWEA 1LVMA 3GCHC 3GOVB 5C5OA 1C2FA 3EAJA 2GT7A 1ARBA 2HNTF 1A0HB 3TH2H 1IOEA 1GBMA 1V2KT 2AIPA 5K7RA 1F0TA 2A2XH 3KEEA 3LH1A 1ZSKA 2GVFA 1O5AB 3ATLA 3EE0B 4XDEA 5F8ZA 1XUJA 2ANKH 3ZZCA 1UTMA 1HAIH 2ZECA 1C5SA 1W0ZU 4I33A 2ZG0H 2IN2A 1ELFA 2CXVA 2PTNA 2VIPA 3D65E 3SU3A 1W8BH 1NRRH 1DWBH 2GCTC 8KME2 2UWLA 1E38B 4B2AA 2FS9A 1JRSA 4CRAA 1BMNH 2H9HA 3GCHB 2CN0H 4MNWA 3SU2A 1YBWA 4BOHA 1V2UT 4GUXA 2GT8A 1ZHRA 1T8LA 2TGTA 3EDXB 1QL8A 2Y5HA 1WSSH 1BBRH 2QA9E 3UQOA 1GVZA 2P93A 4VGCB 4NFEA 1TNJA 1ZSJA 1P9UA 1Z8GA 3L6PA 2J34A 4MG3A 2ZGXH 1SHYA 4YOIA 3AW1A 4B73A 5JBTA 3GY7A 2KAIB 3RXOA 3ATMA 3LGIA 1C2KA 3PO1B 1HXEH 2GCTB 2GZ9A 4B74A 5FBIA 2ZCLP 1HAOH 2THFB 3H7TA 3RXGA 3FANA 1GCTC 2C8YB 2PHBA 4Q7YA 2ANYA 4MPVA 3HGPA 1K1LA 4JK5A 2A31A 1BB0B 4X6NA 2ZPQA 4X6OA 4I7YH 4OGXA 1PPBH 2FI3E 2LPRA 2HNTE 1HIAA 3QZQA 1GJAB 4SGAE 1OP0A 1XKAC 3DT0H 3QUMP 3GY6A 2GV7A 2QN5T 1CGHA 1DXWA 2EI6A 5EQSA 1RRKA 1KDQA 2TRMA 1CQQA 1LHFH 5SGAE 4TPYA 1O2KA 3R3GB 4YO9A 3MO6A 5EQRA 2BMGB 4JYVH 1OWJA 1NFWA 4U2WA 1AD8H 1ELCA 1D3QB 1OWDA 4H4FA 3HATH 3UNRA 2D1JA 4ABGA 5EOKA 4E7NA 1GHBG 4Y0YE 3ZZAA 3S0NA 1LKAA 2ANWA 4FUJA 4GPGA 2HALA 4XBBA 3RXSA 2FLRH 3PV4A 1CBWB 2GCHF 2ZDMA 3VXEH 1EATA 1A4WH 3RXDA 1AHTH 1TA2A 1PQ7A 1YCPM 3M3TA 1XX9A 1TMTH 3U1JB 1ZOMA 4YT6H 1G36A 2G55A 4CRFA 3EQ0H 3NUMA 4X2XA 1DWCH 1AGJA 1S0QA 1G3DA 3K6YA 3ODFA 4ISOA 2BD8A 2XXLA 3ZVGA 2ZFQH 2ZTXA 1UK4A 2FX4A 2OP9A 4KELA 1GBJA 5FPYA 1C9TA 4U32A 4BAQB 4NA9H 3BTQE 5E0HA 3A87A 4JZDH 1Z6EA 1W14U 3BG4B 1BZXE 3CP7A 5EU8A 4AORA 1SGNE 3RXHA 3OX7U 2CMYA 2FI5E 3HGNA 1TABE 3BEUA 3M7QA 3ZZ5A 2UUJB 5JBBS 1V2VT 1D3TB 5DPAA 4BTUB 3VB7A 1TNHA 3M5NA 3RMMH 4KTUA 3U8TH 2OC1A 4IN1A 4AGKA 3ZZBA 4Q7ZA 3NK8A 2CV3A 1O33A 1C4Y2 1NFUA 1TMUH 4OS6A 1W7XH 2I6SA 2XNIA 5LPEA 3DFJA 3QK1A 3Q3YA 1ZSLA 5ESTE 2RDLA 3HK3B 1V2TT 4IMZA 1V2NT 3RM2H 3VB5A 4SGBE 1BMMH 1YM0A 2Y82A 4IN2A 3UPEA 1BTZA 1C5OH 3U69H 1H9IE 5G4BA 1G2MA 1O3MA 2BX3A 3MH5A 1HGTH 3MI4A 1GJ4H 1O2GH 1TNGA 5F6MA 1C9PA 1OWIA 5CHAC 1HAHH 1GBIA 1J14A 3E6PH 2ZI2H 1EKBB 2F9BH 1SQAA 1JXPA 1O2PA 1F5KU 1GBDA 4J1YA 1PFXC 1C2DA 1FI8A 1TFXA 1N1LA 4K1EA 1B5GH 5E2PA 1SGYE 1QR3E 4YTAA 1NT1A 1LTOA 2QYIA 2UWPA 3VB6A 1N8OC 4K8BA 1Y8TA 3NPSA 3OTJE 3GYMA 3TPIZ 1TGNA 4ZKOU 2G5VA 3D23A 3M5OA 1D3DB 1FMGA 2AGIX 3HPTB 7GCHG 1HIAB 2NU2E 5CHAB 4XE4A 3TGJE 8LPRA 1EQ9A 1ZLRA 2QXHA 1M9UA 1F5RA 1CVWH 4INLA 1MAXA 1GBLA 1DS2E 1K1PA 1F5LA 2ZGCA 1KDQB 1T32A 5C2ZA 5L6NH 5DP6A 2AYWA 3U98H 3T29A 3KQBA 3SGBE 1KLIH 2K1QA 3D49H 3I78A 1N8OB 1CHOF 2Z9GA 1OKXA 4I8LA 2V35A 2NU1E 1ZTLA 1EUFA 2BYAX 1P3CA 2A45B 2TGAA 1AO5A 4TPIZ 1G2LA 1GHVH 3RXQA 1FQ3A 4A1XA 5AVDA 1S6FA 3MHWU 1TRYA 5T6FA 1SI5H 1ZHPA 3WY8A 2OTVA 3PMJA 4ZHLU 5C1XA 4GLYA 2ZU5A 2A5AA 5TJXA 3LGUA 2JKHA 1BITA 2P3TB 1O2YA 2XRCA 2F9VA 1FLEE 4YOGA 2FLBH 2ZCKP 3AAUA 1FAKH 4M7GA 1AUJA 2YNAA 3CENA 2ZHFH 2R3UA 1FAXA 4Y7BA 3LH3A 2YOLA 1AU8A 1DWEH 2C8XB 1FZZA 4HGCA 1BQYA 1N6YA 1GPZA 3ESTA 1UTJA 2G5NA 2WPMS 1YCPH 3BF6H 4MLFB 1AN1E 1MTSA 3ZYDA 1IQGA 1BJVA 1SL3A 2ZPSA 4HI3A 3LGTA 2FESH 2XYAA 2ZDKA 2HLCA 4K5ZA 3MTYA 4WH8A 2J95A 2V3OH 3RU4D 4GCHF 1ELDE 5I25A 2ESTE 2ZNKH 1KXCA 2SGDE 1DPOA 1KXEA 3RMOH 4E06H 4X0WU 4FUBA 5DP9A 2GV6A 4GHTA 3M3SA 1K2I1 1UVPA 2SGPE 4AG1A 9LPRA 2A5KA 1YKTA 2DE9A 1O5CB 3SQEE 2UUYA 1DLEA 2FO9A 2W3KA 2G51A 3TNSA 4CBOA 2BB4A 2WYGA 3NZIA 1SMFE 2P94A 3BTME 2WINI 4D7GA 3Q3XA 1ZPZA 1QQUA 3SOSA 1AVGH 5EODA 3QTOH 1V2LT 1EPTA 4WJG2 5J4QA 1W3CA 2JETB 3KQCA 1SFIA 1UCYE 3O8DA 1GHZA 1VGCC 4NWLA 4WXIA 2Z9IA 2ZC9H 2HWLB 2QF0A 1WCZA 1SOTA 1NFYA 3GY5A 4FUEA 4B76A 1UK2A 5EPNA 3ZZ7A 1PPFE 1L1JA 5DP8A 4BAMB 1TAWA 3G01A 1ZYOA 2BZ6H 2BX4A 1O3BA 2A4QA 1GL0E 3ENSB 2FWWA 3M5LA 4UFDH 3ZYEA 1LDTT 3AW0A 4K1TA 1GMDF 1O36A 4AFQA 1AWHB 3SJOA 1YCPK 2O8UA 1NROH 2BLVA 3MNSA 1AFQC 2VH0A 1BIOA 4ABJA 3ZV9A 3BTEE 3K65B 3FAOA 1QBVH 5LH8A 2BVXH 3KCGH 1KXAA 1FN6A 1MBMA 2PSXA 1FJSA 4A5TS 1GBAA 2ZU1A 3VXFH 1H8IH 1P2KA 3VFEA 1T31A 1PQ5A 4X1QU 4RKOB 3KQEA 3RXFA 4Z6AH 1JMOH 1MQ5A 3SN8A 4Y76A 3F9GA 1RFNA 3SV9A 3GISB 4THNH 5C5NA 4O9VA 1QJ7B 1ARCA 2J94A 4FUHA 2BD3A 1G9IE 4OS5A 3ZZ8A 1GWAA 3KL6A 1MCVA 1FN8A 2GDDA 5FXLA 3BTFE 1MUEB 2G8TA 1FPCH 1GHAF 3VEQB 5GCHG 4DY7B 1F7ZA 1O32A 3PLPA 3H7OA 1L1NA 2OBOA 4TY7A 1AZZA 3Q76A 4CHAC 4ZKRU 3QDZB 1YLCA 1GG6C 3RXEA 5AF9H 1MMJN 3GY8A 2BY5X 1WBGB 5EPYA 2EI8A 4PROA 5FPTA 2ZQ1A 2ZHWH 1A1RA 1C1NA 4AFZA 4KGAA 4WY3A 1GDQA 1FY3A 3SU5A 3M5MA 1NPMA 4X1SU 3P92A 3T27A 4ISLA 1IHSH 2UUFB 2Y81A 2PKAA 2IOTA 2ZHEH 4O03A 1EPTC 2BQ7B 3IITA 2R2MB 4CHAB 1P9SA 1P2NA 5FX6A 1V2ST 1MU8B 1RTKA 1BRBE 4ASHA 1PPEE 4H6SB 3SJ9A 3SJ8A 4UD9H 2G52A 4LZ4B 3C1KA 1YPEH 1TBZH 3RUOA 1QTFA 3MOCA 5HM9A 4NZQA 5JB9S 1EASA 3DFLA 3FZZA 3P8OA 1HLTH 2CF8H 3BN9A 3LIWA 2SFAA 1MTNC 1FDPA 2ZFTA 3FFGA 4Y71A 1BMAA 2G4TA 1O5BB 1CT4E 1OOKB 1GI6A 2QF3A 2GX4A 1WQSA 2BLQA 1B0EA 5A8ZA 4BAKB 1EPTB 2BDYA 1KXDA 1O5EH 3ZVCA 2PV9B 1QHRB 1YF4A 2XBWA 2UUKB 2ZGBH 4WMEA 4AN7A 3SORA 1W2KH 1OWKA 1WTGH 1GJDB 2PUQH 2TGDA 2FEQH 1F2SE 5LPFA 1SFQB 1ELVA 1TGBA 3W95A 1C5TA 4MDSA 1AIXH 1V2QT 1DITH 4ZKNU 1C5NH 4MNXA 1BBRE 4KTSA 4FUIA 3DA9B 2V6NA 1QL9A 1UTQA 1FIWA 3TLOA 2A32A 2OC8A 5ESBA 1TOMH 4JYUH 3V3MA 1MTWA 1W11U 3TIUA 4AZ2B 4YLQH 1NU9A 4CRCA 1GCDA 5C1UA 3UOPA 4YOJA 1KSNA 3RXMA 1EAWA 2BVRH 2R0LA 1ZMNA 1HJ9A 1GVKB 3ZZ6A 2J2UA 2VGCC 3LOXA 5B6OA 1OWHA 4VGCC 1H4WA 1NRPH 1P11E 1BRCE 4IC6A 1NS3A 3TJNA 1TBQH 4XFQA 1BTPA 1XMNB 1SGEE 1JIRA 3M7TA 3LGVA 5DP3A 3RXIA 3PO1C 1EOJA 4ISIH 4FUDA 3E3TA 5CMXH 1A61H 2M5TA 2G00A 1XUGA 1TPSA 4WH6A 1DOJA 4LOYH 2ZEBA 2ZWLH 1Y5BT 3MU1A 1O3KA 5EQQA 1K1NA 4X1NU 3ITIA 2O8TA 1SVPA 4WF8A 2FM2A 3ATIA 1GI3A 2VGCB 4DJZB 3FZDA 3RXRA 1GBKA 2QCYA 4ZUHA 1LHEH 2ALPA 1J9CH 1WYKA 1SLXB 1DLKB 1SLVB 3KGPA 5F8TA 3A81A 1VJ9U 2VWLA 1HUTH 3FP7E 1YLDA 1GDUA 2XCNA 2PW8H 1O31A 5TCAA 3ZVBA 1HFDA 1D6RA 1AI8H 5HGGA 4Z0KA 1J16A 1D3PB 2HOBA 1S85A 1Y3UA 1O5GH 2BD2A 1L0ZA 3CS7A 1Z7KA 3O8BA 1RTLA 3GY4A 1C1QA 4K8YA 2PKAB 1GBBA 3PMBB 1DX5M 1HNEE 3RDZA 2P3UB 1P01A 3UWJH 4CRBA 1OS8A 3FP8E 1C5VA 2Z7FE 1BUIA 3TGIE 1TNLA 4BTTB 2A4GA 4R0IA 4ABFA 1LKBA 2PTCE 2BDAA 1CBWC 4A92A 1S5SA 1ZR0A 1F0RA 3A80A 3BIVH 3P8FA 4OS1A 1Z8IB 1GJ9B 1O2WA 1WUNH 3FVFB 3E1XB 3A8DA 2ZPRA 3U8OH 1IQIA 1O3JA 3UR6A 3S7KB 1Q3XA 5L2ZH 1DUAA 2ZU4A 1Q31A 3GCNA 1C1RA 1P8VC 1P2IA 1Y3VA 4AYVB 4B71A 2O9QA 1INCA 1EX3A 3TH4H 1C1OA 1LCYA 1PPHE 1LQEA 3NCLA 4I31A 2A7HA 1NESE 1TLDA 1NO9H 1LQDB 1O39A 1YPHC 1EZQA 2QAAA 4MPXA 3BG4C 2A1DB 2GZ7A 5DP7A 4D7FA 2FOMB 1TGSZ 1TPAE 1O2MA 2Z3EA 3SUEA 2PKSC 2FI4E 2BY8X 8GCHG 2EC9H 2VIQA 1HAPH 1MZAA 3UUZA 2OC7A 4KP0A 5HXFA 2PUXB 5I46H 1DM4B 4RSPA 1UO6A 2C8WB 4O3TA 3LT3A 1LO6A 3SUDA 2BLWA 2ZDVH 1O3HA 2ODYB 2C8ZB 1SQTA 2RG3A 3RXCA 1VITG 4INHA 4ZHAA 4OS7A 2PKSB 3GCTG 3TU7H 2QIQA 5F8XA 3MU5A 2XCFA 4FUFA 3A84A 3KF2A 1C2MA 1TIOA 3E91A 3QGJA 3ZZ3A 3GY3A 1NFXA 1K1IA 1K9OE 4NSYA 2Y7XA 2P59A 3N7OA 2Y80A 1DSTA 3NWUA 3RXTA 5HM2A 2BM2A 2OCVB 1RXPA 1CU1A 4I32A 3SU6A 1MQ6A 3A7VA 3GDUA 1ANDA 1O3AA 2VIDA 1MKXH 3LGYA 1O3IA 4DOQA 1O3LA 1A0LA 3EYDA 1HV7A 3TK6A 4GCHG 3A83A 2EA3A 1AVWA 2YNBA 4GAWA 1EP6A 3TVJB 3F9EA 4JCNA 1SBWA 1AMHA 1K21H 1VCPA 1ZPCA 5T6DA 1P0SH 2ODQA 2VVVA 2OD3B 1AY6H 1FY4A 1PPCE 3NXPA 3B9FH 3S69A 1GGDB 2FMJA 4U30A 1GMHG 2J4IA 4Y7AA 3SV7A 4D8NA 3LJOA 3SJIA 3BTWE 2XWAA 1GHBF 2W5EA 1A0JA 2G81E 5A0BA 2AGGX 2H9TH 1FV9A 1O2UA 2NU0E 3UNQA 3BSQA 3RXAA 1QRWA 3V13A 4GVUA 1ZPBA 4I8JA 2AGEX 1SPJA 1UTNA 1ZHMA 5DG6A 1B7XB 5EW2H 1W13U 3IG6B 1U6QA 2QXGA 1L2EA 1LPKB 4ABBA 2EEKA 2ULLA 4IMQA 4Q7XA 1TRMA 1PQAA 3KNXA 1C5XB 2H5CA 4BTIB 2BOHB 2OUAA 3A89A 2CF9H 5GIBA 1HBTH 5AFZH 1ESAA 2FTMA 2O8LA 1G37A 2ZDLA 2BXUH 4UEHH 1SC8U 3KIDU 1IQKA 1GL1A 2F91A 1IHTH 2ZA5A 4I8HA 3VB3A 3CS0A 3PMHB 1ELAA 1YC0A 3QGNB 1C1VH 3SUGA 2ALVA 1HRTH 5C67A 1H9HE 3U1IB 1UJ1A 1MKXK 1V2OT 1CGJE 3HKJB 1XXDA 2VH6A 4ZKSU 3RXJA 3ZVEA 4K1SA 1H9LB 1ABIH 1MBQA 1WU1A 3HK6B 1ANCA 5GJ4B 1O38A 1GMCG 6GCHG 2A0QB 4BANB 2Y5GA 2Z6BD 1MCTA 1P3EA 1OP2A 4NFFA 5DK1A 3TK5A 3A8BA 1CA8B 4CR5A 9ESTA 5CE1A 1JRTA 4YESB 1GI9B 1QJ1B 2F9NA 5TCCA 3QTVH 5JPMH 3K2UA 1GDNA 1LPZB 2ANMH 1LHDH 2J9NA 1UVOA 1WOFA 1EB1H 4MQAA 3M37A 1YGCH 3AAVA 2JETC 1W10U 4MPUA 2C93B 1T4UH 2C3SA 1GBEA 1ESBA 5C20A 5DO4H 2ODPA 3F6UH 2B0FA 1TONA 2EI7A 1SG8B 2A7CA 1A2CH 2OXSA 1QNJA 3JZ2B 1AQ7A 4E7RG 4A1TA 5E2OA 1CGIE 2XBVA 1O2SA 2HNTC 2CJIA 3OY5U 3A8AA 1TPOA 3B8JA 5FPSA 4AFUA 2ZDNA 1BJUA 1BHXB 4R8TB 3BIUH 5JB8S 1BRUP 5F03A 2XWBI 3SI3H 3VPKA 1IQEA 1ZRBA 4RKJB 4ABEA 3LC5A 4IBLH 1GI8B 1NRNH 1TGTA 1PJPA 1AZ8A 3LPRA 1VJAU 7GCHF 4Q80A 5K0HA 2C90B 1ACBE 4Y79A 4DURA 1GJ5H 2R0KA 3SNBA 3T62A 1XM1A 2ASUB 1DDJA 1HAVA 3RXVA 1O3CA 1YPGH 1V2WT 1S84A 4AFSA 2FZZA 3URCA 2F3CE 3ZV8A 1HXFH 4Y0ZE 3F9FA 2PSYA 1QQ4A 1P06A 1TOCB 1GI0A 4FVBA 4XOJA 1S81A 5EXMA 3SUFA 1H8DH 3TITA 4IW4E 1TRNA 1P02A 1J8AA 4IC5A 1P57B 2Q6FA 2AH4X 1GBTA 1SQOA 1DFPA 4DT7B 1G3EA 1HDTH 3VB4A 1O3NA 1E37B 2BDCA 2VIWA 1TNKA 4D9QA 1HJAC 1EZXC 2WPIS 1ELTA 4DW2U 1FONA 1T7CA 2R2WU 2IJOB 3BTDE 1GBCA 1OP8A 1JWTA 4F4OC 1ZTJA 4IS5A 3OU0A 2AMQA 5DP4A 1LVYA 2ZDAH 3E90B 3PTBA 3LJJA 2IPHA 2H6MA 1VITH 2P3FH 4CH2B 3ZZ4A 1BMLA 2TBSA 2DE8A 3TNTA 4TWWA 4ZH8A 1TWXB 1A5IA 1KIGH 1P10A 4ESTE 4X8UH 4DIHH 3UOUA 1C5LH 1HJAB 2F9UA 1IAUA 1Y5UT 3TGKE 1UCYH 1O2QA 1T4VH 1RS0A 4X6MA 1Z71A 1O5DH 1C2HA 1EP5A 4H6TA 4TY6A 3AVZA 1UVSH 1O0DH 1DANH 2WV4A 1C2LA 4Y8ZA 1O2LA 2ZZUH 1EAUA 2J92A 5FAHA 1K1JA 5FHTA 3MWIU 4AB9A 2Y6TA 2AIQA 3A88A 1PQ8A 2VVCA 4ZXXH 1IQMA 1NTPA 1SGDE 1L4DA 4UONA 1OPHB 2GTBA 2BDGA 1E34B 2GZ8A 1E35B 1O3DA 2I6QA 4ABDA 5EW1H 1XUIA 1ZJDA 3QN7A 2FDAA 1AE8H 2PFEA 1W12U 1SGTA 3SNCA 4NIYA 5DJ7A 2VINA 3A8CA 1ELEE 3O8CA 1O3OA 3E0NB 3PB1E 3TJOA 5EXNA 1LMWB 4XBDA 4I8KA 1TX6A 1K22H 4LZ1H 1D9IA 1LPGB 2WPJS 2C4FH 1QRXA 1A3BH 3SQHE 4NGAH 1F0UA 1Z1IA 1HAGE 2FODA 2TPIZ 2H2ZA 3RLWH 1O2ZA 4YM9A 2ZO3H 1WV7H 3GYLB 3S7HB 4AGJA 3BTHE
chains in the Genus database with same CATH superfamily
3OTPA 1BTHH 1ELGA 3IWMA 1RJXB 1KXBA 4AX9H 1O30A 3RC4A 3WWBA 2FOAA 3MNXA 3Q3KA 2RA3A 1BCUH 4AYYB 4GSOA 1X7AC 5A8YA 3ZZ9A 2WUBA 3M61U 1HAVB 1XVOA 1CE5A 3AASA 2CHAC 5GWZA 1QRZA 3NKKA 1MD8A 4AOQA 2LELA 1UCYK 2HPPH 3JZ1B 3URDA 3A7XA 3LC3A 5DP5A 2YMSC 1WTHD 2W7UA 3MO9A 1ABJH 2BTCE 1ZGVA 4YXWD 1BTXA 1ORFA 4NA7A 3LONA 2TIOA 1NU7B 2FS8A 1QJ6B 1YPKH 1P05A 1RD3B 2BXTH 1QCPA 2J98A 3E8LA 1ID5H 3DUXH 3MNCA 1FY1A 4O97A 3LDXH 5DGJA 3S9BA 3SI4H 3BG8A 4DGJA 1F92A 1WQVH 4Y8XA 2CHAB 1QGFA 2FOEA 2VWOA 1JOUB 2A4RA 3E0PB 3EA8A 2BDIA 2FOHA 1FUJA 1D4PB 4A6LA 1L1GA 2YMSB 4GHQA 4BAHB 4JMYA 3F9HA 1O37A 1UVTH 1P04A 5GCHF 4X1RU 4ZXYH 2FIRH 1QA0A 2GCHG 1EJMA 3K9XB 4NWKA 1C5MD 2G4UA 1YPJH 3GDVA 1TYNA 3UY9A 2DUCA 4MNYA 1O3FA 1MKWK 3M35A 4A1VA 1GI4A 4WMDA 1HAYB 2D2DA 3DSPA 4NCYA 4AG2A 3L3TA 3OYPA 1AB9C 5C3NA 1HB0B 2FOGA 1BTYA 2SGAA 3PM3A 3UTUH 4NA8A 1FPHH 2D26C 1SLWB 2NWNA 2B9LA 5EG4A 1BTUA 4NIWA 1YP9A 1ETRH 1P03A 3ODDA 1QURH 2FTLE 4IGDA 1VCWA 3EA7A 4WMFA 4CBNA 1BOQA 1SLUB 1V3XA 2GP9B 3MFJA 1TA6A 4U01A 2RCEA 4FUCA 3ZZDA 1C5YB 4ZROA 3H09A 2V0BA 2AEIH 2XBXA 1YLNA 1AB9B 1SGCA 2JJ1D 3GICB 1CT2E 3I77A 4J2YB 2XW9A 2Y5FA 4BAOB 1HPGA 2RA0A 2FOCA 1GJBB 4UFGH 1QB1A 2ZU3A 8ESTE 1QB9A 1TALA 3UNSA 4OM9A 3SGQE 5PTPA 3SU4A 1DWDH 4B2CA 1TGCA 2BDHA 5KGOA 3BTKE 3A82A 5JBAS 4YT7H 3STIA 3SZNA 2STBE 2R3YA 4JK6A 2R9PA 4O3UA 4H42U 1AVXA 1E0FD 1Y3XA 1ELBA 1SGFA 3OEHD 4X1PU 1O2OA 1OYTH 2Q6GA 2SGFE 2VB0A 2OK5A 4BXWA 4XBCA 4JZ1A 2BQWB 2TGPZ 5C17A 3F1SB 3ELAH 2BHGA 1QY6A 1NZQH 5C1YA 3T25A 4ZHMU 1BDAA 2GD4B 2ZHDA 1SSXA 1C2JA 2V3HH 3RXKA 3QO6A 4ABHA 1F0SA 2IJD1 4KTCA 2H5DA 4UE7H 3VG8A 2O8WA 1ZMJA 1GCTB 4QT8C 1KXFA 3PWBA 3EA9A 1V2PT 1DICA 5EJZA 2ZGHA 1WAYB 3OFND 2VWNA 1CT0E 4Y6DA 3SU1A 2SNVA 3TK9A 2BZAA 3MH6A 3SGAE 1CA0C 4X8SH 1C4V2 2LNCA 4LK4A 2OC0A 3MU0A 1UTLM 1QBNA 1CSOE 3V7TA 2ZTZA 5A0AE 3PYHA 3P6ZB 2BD4A 3RU4T 4NIVA 1G32B 2Q1JA 2J38A 4TT3D 3MO3A 2B8OH 4Y8YA 2A7JA 3BTGE 1UMAH 2P95A 4FXGH 4AB8A 2J98B 3OSYA 3Q00A 3RXUA 3RU4E 1GHWH 3SJKA 1CO7E 3FP6E 1BBRK 5ETXA 3A7ZA 4Y10E 1IQLA 1Z1JA 3F2HA 2PGBB 1HYLA 2JH5D 4YZUA 1CHOG 4FUGA 5EXLA 1LHGH 2W6ID 3SV8A 1CA0B 5C0TA 1TX7A 2BD9A 1YPLH 1EOLA 1A5GH 2ZFFH 1ANEA 1PYTD 3GS9A 3OY6U 5FCRA 2BY7X 5HYOA 2FX6A 5A2MH 1JIMA 4MNVA 3P8GA 1MD7A 5J4SA 4FU8A 4CRDA 1SR5C 3SU0A 1NRSH 4Q2KA 1T8NA 1THRH 2F83A 1MAYA 1V6DA 4WVPE 1T8MA 2Z3CA 3S9AA 2QE7D 3I29A 5C0UA 3F68H 5E0JA 4CREA 3QWCH 2ZTYA 3WWFA 4A7IB 1NBME 2SGQE 1XUHA 3A86A 3SW2B 3BEFB 2Q6DA 1QBOA 1H1BA 1GGDC 1NY22 2VIOA 3V12A 1RIWC 4HFPB 5T3HA 1QFKH 2Z9JA 1AWFH 1GHXH 5IYTA 3O8RA 1GJ7B 5CDFE 3UQVA 3QX5H 3T28A 2PWXA 1SOZA 3RXBA 7LPRA 1RTFB 3RXLA 2L6OA 3K6ZA 3RC6A 3STJA 1S83A 2OBQA 1UTOA 3OEED 1TBRH 1C2IA 3UREA 1IQHA 1YYY1 2F9OA 2XTTB 2BY6X 1EJNA 4CH8B 1GBFA 1O2JA 2JH6D 1TE0A 2VU8E 2F43B 1FY8E 2WPKS 3ATWA 4K60A 4B1TA 1C1MA 2BY9X 4MVNA 2HPQH 1ZTKA 3UFAA 3SNEA 3P70B 4B75A 1PYTC 1MABB 1RIWB 3A85A 5IK2D 1SHHB 1W0JD 2Y7ZA 1HAZB 1G30B 1C2EA 3PV2A 5GXPA 1UK3A 5DKMA 2FXRA 2FOFA 4D9RA 5GPIB 2W7SA 4Y11E 1ZZZA 2H1UA 1TB6H 3PMAB 1ZJKA 4X6PA 2H9EH 1EAIA 2P8OC 1EFRD 2Z9LA 1Y3YA 1EB2A 4NIXA 1TQ0B 1K1OA 1W7GH 2OQUA 2QF4A 1S6HA 1EZUC 1CHGA 3GDSA 3TJUA 4F49A 2ZCHP 1PPGE 2VJ1A 3KN2A 3T5FH 1P09A 2GGVB 5HMAA 4ZMAH 8GCHF 3RP2A 1C5QA 3DHKH 4X2WA 7ESTE 3U8RH 3MH7A 2VIVA 3MU8A 1S82A 2B5TB 4ABAA 1AE5A 3KHVA 3HKIB 1O3PB 3V0XA 2SNWA 6CHAC 2WSSD 1LVBA 4JZEH 2FYQA 3UAIC 2AMDA 2P8OB 1V2JT 1GMDG 1VITF 2XC5A 3ZVFA 1QB6A 2W3IA 3GCTF 3SV6A 5EGMA 1XKBC 3UWIA 2W26A 4DG4A 3SV2H 1XXFA 2FOBA 5L30H 1UVUH 2QF5A 5LGOA 1NM6A 2WPLS 1IQNA 1W0KD 1D6WA 4K2YA 1SGIB 1TPPA 2KR7A 5E0GA 4OS4A 3UIRA 6CHAB 2F9PA 1A7SA 3RC5A 2Z9KA 3A7TA 1H8ED 7KMEH 1ZRKA 3C27B 4HZHA 2CGAA 1Y59T 3W94A 1SB1H 2OINA 4UDWH 4F55A 4BNRA 2HRVA 3RM0H 1SGFG 1KTSB 3SBKA 1OXGA 1UHBA 1HAXB 1K28D 3S9CA 5EJ1A 1OSSA 1QA7A 1C4U2 2ZQ2A 1EAXA 2P16A 3MMGA 4YLUA 1TNIA 2VWMA 1GHAG 5A0CA 3BTTE 1A46H 1HJ8A 3D62A 1T8OA 3T26A 4JZFH 3U9AH 1UW7A 5FBEA 1GHYH 1C5PA 2BD7A 1OX1A 1K1MA 4ACAA 4DVAU 2B7DH 1GI1A 2AMPA 3FOAA 3SNAA 5E8EH 4DCDA 2BD5A 2EY4C 1GBHA 3P17H 2WV5A 1P2OA 3M36A 3PLKA 4FU9A 6LPRA 1ETTH 1G3BA 2AS9A 1MTVA 3A7YA 3M3VA 1NRQH 1FXYA 3RLYH 3T2NA 1GMHF 2FYRA 2AFQB 1O2HA 5ABWA 3RMNH 1ETSH 1O2NA 1FNIA 4UFEH 2VNTA 1C5ZB 1BA8B 4WXVA 1ZMLA 1BT7A 6ESTA 3SHCH 1KLJH 1AFEH 2GKVE 4ISHH 1GJ6A 1O3GA 1AKSA 4LXBH 4XSKU 5T6GA 2AHME 2WYJA 2ZF0H 1GI2A 2A5IA 1VR1H 5AFYH 1WXRA 2BDBA 2SGEE 1J17T 1IQJA 2ZIQH 3UR9A 1C5UA 1AUTC 3KYGA 1MTUA 5H4IB 4DIIH 1LHCH 3RMLH 1O5FH 1DVAH 2V7QD 4I8GA 2FP7B 1TX8A 4ZAEA 1YPMH 1VZQH 5LPRA 2XC4A 1NN6A 1EXFA 1P2QA 3Q77A 4WWYA 3PLBA 1SGRE 3KYFA 1Z8JB 3ZVAA 2JH0D 2GMTC 2UWOA 2QC2A 1UTKA 2GJGA 5BRRE 3DSGA 5L2YH 1S0RA 1EZSC 1MZDA 1P12E 3P95A 1C5WB 1Y5AT 2ZP0H 1VGCB 1UTPA 1A3EH 3KQDA 3MYWA 1C1PA 4OS2A 1O2RA 1GI7B 4KKDA 4UFFH 2KM0A 1GI5A 2VVUA 1OYQA 1HCGA 1O3EA 1DT2A 1GMCF 4TWYA 4E05H 6GCHF 5FX5A 2PLXA 1YPHE 3BEIB 2GMTB 2XNDD 3H5CB 1GVLA 4MPWA 1QZ8A 5B6LA 4TYDA 2ZGJA 3R0FA 4FETA 2BVSH 4JZIA 1K0HA 1SGQE 4ISNA 1AFQB 1QIXB 3DD2H 2HLDD 1O2XA 1LVOA 4K69A 1THPB 1VCQA 1DXPA 1KLTA 3L33A 4INKA 3PTNA 1PPZA 5JDUB 3QZRA 1C2GA 1DY9A 1BTWA 3TH3H 1Z8RA 2ZKSA 1G3CA 3MNBA 2KAIA 2ZFRH 1UHBB 2AERH 3MH4A 3B23B 2HVXA 1EJAA 2KCAA 2WHXA 4CR9A 2O8MA 1L4ZA 2KZ4A 1XUFA 1NC6A 1J15A 5AHGH 3RXPA 3ZVDA 5JBCS 1IQFA 1Q2WA 1B0FA 1KYNA 4RN6A 5A09A 1FY5A 1O34A 1N6XA 1W0YH 2HGTH 2PGQB 2FPZA 1O2IA 1A5HA 1C5RA 1V2RT 1P2JA 3GCOA 1DE7H 1Z6JH 3M7UA 5FCKA 1GJ8B 4HTCH 2ZFPH 5HKKD 1MKWH 3VGCC 1Y3WA 2L74A 1TMBH 3SO3A 2WUCA 1E36B 1C1SA 1O2TA 1ESTA 2ILNA 4FU7A 2BLOA 3SNDA 2OLGA 1O35A 4NG9H 1GG6B 1SQRA 2NU3E 1C1WH 1KTTB 1JBUH 1MH0A 4NSVA 4NZLA 2ZFSA 3LU9B 5DN6D 3BV9B 1BRAA 3ATKA 3P8NA 1KY9A 1XVMA 2QY0B 3SHAH 2STAE 4BXSA 2Z94A 4X8TH 1C1TA 1C1UH 1DSUA 5IDKA 2ZU2A 2NU4E 1TQ7B 4X2YA 2XBYA 2OQ5A 1AKSB 3VGCB 2BQ6B 2PR3A 5F53A 1THSH 1P2MA 2XC0A 4B2BA 4JYTA 2A2QH 3EGKH 3E16B 2QV1A 2QXJA 2BOKA 4X8VH 1DY8A 3TJVA 2A4OA 4D76A 5BPEA 1ANBA 3QLPH 3GY2A 4CRGA 2GDEH 1V2MT 3PV5A 1MU6B 1FIZA 2Z3DA 1BHXF 4FVDA 2QXIA 1O2VA 2WPHS 1QL7A 5JYIA 1XUKA 5KECA 1MTNB 4X2VA 4OGYA 2QGRA 3A7WA 4MTBA 4ABIA 1DUEA 2ZHQH 3LGWA 5A8XA 3PROA 2VBCA 1ZGIA 3LKWA 5GDSH 1RGQA 1SGPE 3MU4A 4K3JA 3PWCA 1GJCB 2D8WA 1OWEA 1LVMA 3GCHC 3GOVB 5C5OA 1C2FA 3EAJA 2GT7A 1ARBA 2HNTF 1A0HB 3TH2H 1IOEA 1GBMA 5HIZA 1V2KT 2AIPA 5K7RA 2WZQA 1F0TA 2A2XH 3KEEA 3LH1A 1ZSKA 2GVFA 1O5AB 3ATLA 3EE0B 4XDEA 5F8ZA 1XUJA 2ANKH 3ZZCA 1UTMA 1HAIH 2ZECA 1C5SA 5HIYA 1W0ZU 4I33A 2ZG0H 2IN2A 1ELFA 2CXVA 2PTNA 2VIPA 3D65E 3SU3A 1W8BH 1NRRH 1DWBH 2GCTC 8KME2 2UWLA 1E38B 4B2AA 2FS9A 1JRSA 4CRAA 1BMNH 2H9HA 3KQ5A 3OE7D 3GCHB 2CN0H 4MNWA 3SU2A 1YBWA 4BOHA 1V2UT 4GUXA 2GT8A 1ZHRA 1T8LA 2TGTA 2W6JD 3EDXB 1QL8A 2Y5HA 1WSSH 1BBRH 2QA9E 3UQOA 1GVZA 2P93A 4VGCB 4NFEA 1TNJA 1ZSJA 1P9UA 1Z8GA 3L6PA 2J34A 4MG3A 2ZGXH 1SHYA 4YOIA 3AW1A 4B73A 5JBTA 3F2FA 3GY7A 2KAIB 3RXOA 3ATMA 1S6LA 3LGIA 1C2KA 3PO1B 1HXEH 2GCTB 2GZ9A 4B74A 5FBIA 2ZCLP 1HAOH 2THFB 3H7TA 3RXGA 3FANA 1GCTC 2C8YB 2PHBA 4Q7YA 2ANYA 4MPVA 3HGPA 1K1LA 4JK5A 2A31A 1BB0B 4X6NA 2ZPQA 4X6OA 4I7YH 4OGXA 1PPBH 2FI3E 2LPRA 2HNTE 1HIAA 3QZQA 3PRDA 1GJAB 4SGAE 1OP0A 1XKAC 3DT0H 3QUMP 3GY6A 2GV7A 2QN5T 1CGHA 1DXWA 2EI6A 5EQSA 1RRKA 1KDQA 2TRMA 1CQQA 1LHFH 4Z1MD 5SGAE 4TPYA 1O2KA 3R3GB 4YO9A 3MO6A 5EQRA 2BMGB 3F0PA 4JYVH 1OWJA 1NFWA 4U2WA 1AD8H 1ELCA 1D3QB 1OWDA 4H4FA 3HATH 3UNRA 2D1JA 4ABGA 5EOKA 4E7NA 1GHBG 4Y0YE 3ZZAA 3S0NA 1LKAA 2ANWA 3N99A 4FUJA 4GPGA 2HALA 4XBBA 3RXSA 2FLRH 3PV4A 1CBWB 2GCHF 2ZDMA 3VXEH 1EATA 1A4WH 3RXDA 1AHTH 1TA2A 3FN8A 2KX4A 1PQ7A 1YCPM 3M3TA 1XX9A 1TMTH 3U1JB 1ZOMA 2V3MA 4YT6H 1G36A 2G55A 4CRFA 3EQ0H 3NUMA 4X2XA 1DWCH 1AGJA 1S0QA 1G3DA 3K6YA 3ODFA 4ISOA 2BD8A 2XXLA 3ZVGA 2ZFQH 2ZTXA 1UK4A 2FX4A 2OP9A 3EE7A 1GBJA 4KELA 1C9TA 4U32A 5FPYA 4BAQB 4NA9H 3BTQE 5E0HA 3A87A 4JZDH 1Z6EA 1W14U 3BG4B 1BZXE 3UB0A 3CP7A 5EU8A 4AORA 1SGNE 3RXHA 3OX7U 2CMYA 2FI5E 3PRBA 3HGNA 1TABE 3BEUA 3M7QA 3ZZ5A 2UUJB 5JBBS 1V2VT 1D3TB 5DPAA 4BTUB 3VB7A 1TNHA 3M5NA 3RMMH 4KTUA 3U8TH 2OC1A 4IN1A 1VKYA 4AGKA 3ZZBA 4Q7ZA 3NK8A 2CV3A 1O33A 1C4Y2 1NFUA 1TMUH 4OS6A 1W7XH 2I6SA 2XNIA 5LPEA 3DFJA 3QK1A 3Q3YA 1ZSLA 5ESTE 2RDLA 3HK3B 1V2TT 4AC9A 4IMZA 1V2NT 3RM2H 3VB5A 4SGBE 1BMMH 1YM0A 2Y82A 4IN2A 3UPEA 1BTZA 1C5OH 3U69H 1H9IE 5G4BA 1G2MA 1O3MA 5DSFA 2BX3A 3MH5A 1HGTH 3MI4A 1GJ4H 1O2GH 1TNGA 5F6MA 1C9PA 1OWIA 5CHAC 1HAHH 1GBIA 1J14A 3E6PH 2ZI2H 1EKBB 2F9BH 1SQAA 1JXPA 1O2PA 1F5KU 1GBDA 4J1YA 1PFXC 1C2DA 1FI8A 1TFXA 1N1LA 4K1EA 1B5GH 4Q63A 5E2PA 1SGYE 1QR3E 4YTAA 2KCOA 1NT1A 1LTOA 2QYIA 2UWPA 3VB6A 1N8OC 4K8BA 1Y8TA 3NPSA 4HG6A 3OTJE 3GYMA 3TPIZ 1TGNA 4ZKOU 2G5VA 3D23A 3M5OA 1D3DB 1FMGA 2AGIX 3HPTB 7GCHG 1HIAB 2NU2E 2KFWA 5CHAB 4XE4A 3TGJE 2M2AA 8LPRA 1EQ9A 1ZLRA 2QXHA 1M9UA 1F5RA 1CVWH 4INLA 1MAXA 1GBLA 1DS2E 1K1PA 1F5LA 2ZGCA 1KDQB 1T32A 5C2ZA 5L6NH 5DP6A 2AYWA 3U98H 3T29A 3KQBA 3SGBE 1KLIH 2K1QA 3D49H 3I78A 1N8OB 1CHOF 2Z9GA 1OKXA 4I8LA 2V35A 2NU1E 1ZTLA 1EUFA 2BYAX 1P3CA 2A45B 2TGAA 1AO5A 4TPIZ 1G2LA 1GHVH 1OHHD 3RXQA 1FQ3A 4A1XA 5AVDA 1S6FA 3MHWU 1TRYA 5T6FA 1SI5H 1ZHPA 3WY8A 2OTVA 3PMJA 4ZHLU 5C1XA 4GLYA 2ZU5A 2A5AA 5TJXA 3LGUA 2JKHA 1BITA 2P3TB 1O2YA 2XRCA 2F9VA 1FLEE 4YOGA 2FLBH 2ZCKP 3AAUA 1FAKH 4M7GA 5FL7D 1AUJA 2YNAA 3CENA 2ZHFH 2JIZD 2R3UA 1FAXA 4Y7BA 3LH3A 2YOLA 1AU8A 1DWEH 1FX0B 2C8XB 1FZZA 4HGCA 1BQYA 1N6YA 1GPZA 3ESTA 1UTJA 2G5NA 2WPMS 1YCPH 2EQNA 3BF6H 4MLFB 1AN1E 4B6EA 1MTSA 3ZYDA 1IQGA 1BJVA 1SL3A 2ZPSA 4HI3A 3LGTA 2FESH 2XYAA 2ZDKA 2HLCA 3DSOA 4K5ZA 3MTYA 4WH8A 2J95A 2V3OH 3RU4D 4GCHF 1ELDE 5I25A 2ESTE 2ZNKH 1KXCA 2SGDE 1DPOA 1KXEA 3RMOH 4E06H 2CK3D 4X0WU 4FUBA 5DP9A 2GV6A 4GHTA 3M3SA 1K2I1 1UVPA 2SGPE 4AG1A 9LPRA 2A5KA 1YKTA 2DE9A 1O5CB 3SQEE 2UUYA 4M9FA 1DLEA 1YWUA 2FO9A 2W3KA 2IPQX 2G51A 3TNSA 4CBOA 2BB4A 2WYGA 3NZIA 1SMFE 2P94A 3BTME 2WINI 4D7GA 3Q3XA 1ZPZA 1QQUA 3SOSA 1AVGH 5EODA 3QTOH 1V2LT 1EPTA 4I86A 4RT0A 4WJG2 5J4QA 1W3CA 2JETB 3KQCA 1SFIA 1UCYE 3O8DA 1GHZA 1NBMD 1VGCC 4NWLA 4WXIA 2Z9IA 2ZC9H 2HWLB 2QF0A 1WCZA 1SOTA 1NFYA 3GY5A 3DCLA 4FUEA 4B76A 3N7EA 1UK2A 4XRNA 4FOUC 5EPNA 3ZZ7A 1PPFE 1L1JA 5DP8A 4BAMB 1TAWA 5CHBA 3G01A 1ZYOA 2BZ6H 2BX4A 1O3BA 2A4QA 1GL0E 3ENSB 2FWWA 3M5LA 4UFDH 3ZYEA 1LDTT 3AW0A 4K1TA 1GMDF 1O36A 4AFQA 1AWHB 4Q4LA 3SJOA 1YCPK 2O8UA 1NROH 4P02A 2BLVA 3MNSA 1AFQC 2VH0A 1BIOA 4ABJA 3ZV9A 3BTEE 3K65B 3FAOA 1QBVH 5LH8A 2BVXH 5EIYA 3KCGH 1KXAA 1FN6A 1MBMA 2PSXA 1FJSA 4A5TS 1GBAA 2ZU1A 3VXFH 1H8IH 1P2KA 3VFEA 1T31A 1PQ5A 4X1QU 4RKOB 3KQEA 3RXFA 4Z6AH 1JMOH 1MQ5A 3SN8A 4Y76A 3F9GA 1RFNA 3SV9A 3GISB 4THNH 5C5NA 4O9VA 2LP6A 1QJ7B 1ARCA 2J94A 4FUHA 2BD3A 1G9IE 3F2GA 4OS5A 3ZZ8A 1GWAA 3KL6A 1MCVA 1FN8A 2GDDA 5FXLA 3BTFE 1MUEB 2G8TA 1FPCH 1GHAF 2WPDD 3VEQB 5GCHG 4DY7B 1F7ZA 1O32A 3PLPA 3H7OA 1L1NA 2OBOA 4TY7A 5KEDA 1AZZA 3Q76A 4CHAC 1E1RD 4ZKRU 3QDZB 1YLCA 1GG6C 3RXEA 5AF9H 1MMJN 3GY8A 2BY5X 1WBGB 5EPYA 2EI8A 4PROA 5FPTA 2ZQ1A 2ZHWH 1A1RA 1C1NA 4AFZA 2J97A 4KGAA 1H8HD 4WY3A 1GDQA 1FY3A 3SU5A 3M5MA 1NPMA 4X1SU 3P92A 3T27A 4ISLA 1IHSH 2UUFB 2Y81A 2PKAA 2IOTA 2ZHEH 4O03A 1EPTC 2K8IA 2BQ7B 3IITA 2R2MB 4CHAB 1P9SA 1P2NA 5FX6A 1V2ST 1MU8B 3FO8D 1RTKA 1BRBE 4ASHA 1PPEE 4H6SB 3SJ9A 3SJ8A 4UD9H 2G52A 4LZ4B 3C1KA 1YPEH 1TBZH 3RUOA 1QTFA 3MOCA 5HM9A 4NZQA 5JB9S 1EASA 3DFLA 3FZZA 3P8OA 1HLTH 2CF8H 3BN9A 3LIWA 2SFAA 1MTNC 1FDPA 2ZFTA 3FFGA 4Y71A 1BMAA 2G4TA 1O5BB 1CT4E 1OOKB 1GI6A 2QF3A 2GX4A 1WQSA 2BLQA 3AK5A 1B0EA 5A8ZA 4BAKB 1EPTB 2BDYA 1KXDA 1O5EH 3ZVCA 2PV9B 1QHRB 1YF4A 1E1QD 2XBWA 2UUKB 2ZGBH 4WMEA 2RFKC 4AN7A 3SORA 1W2KH 1OWKA 1WTGH 1GJDB 2PUQH 2TGDA 2FEQH 1F2SE 5LPFA 1SFQB 1ELVA 3F3BA 1TGBA 3W95A 1C5TA 4MDSA 1AIXH 1V2QT 1DITH 3N7DA 4ZKNU 1C5NH 4MNXA 1BBRE 4KTSA 4FUIA 3DA9B 2V6NA 1QL9A 1UTQA 1FIWA 3TLOA 2A32A 2OC8A 5ESBA 1TOMH 4JYUH 3V3MA 1MTWA 1W11U 3TIUA 4AZ2B 4YLQH 1NU9A 4CRCA 1GCDA 5C1UA 3UOPA 4YOJA 1KSNA 3RXMA 4DT4A 1EAWA 2BVRH 2R0LA 1ZMNA 1HJ9A 1GVKB 3ZZ6A 2J2UA 2VGCC 3LOXA 5B6OA 1OWHA 4VGCC 1H4WA 1NRPH 1P11E 1BRCE 2XOKD 4IC6A 1NS3A 3TJNA 1TBQH 4XFQA 1BTPA 1XMNB 1SGEE 1JIRA 3M7TA 3LGVA 5DP3A 3RXIA 3PO1C 1EOJA 4ISIH 4FUDA 3E3TA 5CMXH 1A61H 2M5TA 2G00A 1XUGA 1TPSA 4WH6A 1DOJA 4LOYH 2ZEBA 2ZWLH 1Y5BT 3MU1A 1O3KA 5EQQA 1K1NA 4X1NU 3ITIA 2O8TA 1SVPA 4WF8A 2FM2A 3ATIA 1GI3A 2VGCB 4DJZB 3FZDA 3RXRA 1GBKA 2QCYA 4ZUHA 1LHEH 2ALPA 1J9CH 1WYKA 1SLXB 1DLKB 1SLVB 3KGPA 5F8TA 3A81A 1VJ9U 2VWLA 1HUTH 3FP7E 1YLDA 1GDUA 2XCNA 2PW8H 1O31A 5TCAA 3ZVBA 1HFDA 1D6RA 1AI8H 5HGGA 4Z0KA 1J16A 1D3PB 2HOBA 1S85A 1Y3UA 1O5GH 2BD2A 1L0ZA 4F48B 3CS7A 1Z7KA 4B6FA 3O8BA 1RTLA 3GY4A 1C1QA 4K8YA 2PKAB 1GBBA 3PMBB 1DX5M 1HNEE 3RDZA 2P3UB 1P01A 3UWJH 4CRBA 1OS8A 3FP8E 1C5VA 2Z7FE 1BUIA 3TGIE 1TNLA 4BTTB 2A4GA 4R0IA 4ABFA 1LKBA 2PTCE 2BDAA 1CBWC 4A92A 1S5SA 1ZR0A 1F0RA 3A80A 3BIVH 3P8FA 4OS1A 3FKSD 1Z8IB 1GJ9B 1O2WA 3U28C 1WUNH 3FVFB 3E1XB 3A8DA 2ZPRA 3U8OH 1E79D 1IQIA 1O3JA 3UR6A 3S7KB 1Q3XA 5L2ZH 1DUAA 2ZU4A 1Q31A 3ZIAD 3GCNA 1C1RA 1P8VC 1P2IA 1Y3VA 4AYVB 4B71A 2O9QA 1INCA 1EX3A 3TH4H 1C1OA 1LCYA 1PPHE 1LQEA 3NCLA 4I31A 2A7HA 1NESE 1TLDA 1NO9H 1LQDB 1O39A 1YPHC 1EZQA 2QAAA 4MPXA 3BG4C 2A1DB 2GZ7A 5DP7A 4D7FA 2FOMB 1TGSZ 1TPAE 1O2MA 2Z3EA 3SUEA 2PKSC 2FI4E 2BY8X 2KCPA 8GCHG 2EC9H 2VIQA 1HAPH 1MZAA 3UUZA 2OC7A 4KP0A 5HXFA 2PUXB 5I46H 1DM4B 4RSPA 1UO6A 2C8WB 4O3TA 2JDID 3LT3A 1LO6A 3SUDA 2BLWA 2ZDVH 1O3HA 2ODYB 2C8ZB 1SQTA 2RG3A 3RXCA 1VITG 4INHA 4ZHAA 4OS7A 2PKSB 3GCTG 3TU7H 2QIQA 5F8XA 3MU5A 2XCFA 4FUFA 3A84A 3KF2A 2JJ2D 1C2MA 1TIOA 3E91A 3QGJA 3ZZ3A 3GY3A 1NFXA 1K1IA 1K9OE 4NSYA 2Y7XA 2P59A 3N7OA 2Y80A 1DSTA 3NWUA 3RXTA 5HM2A 2BM2A 2OCVB 1RXPA 3MQKC 1CU1A 4I32A 3SU6A 1MQ6A 3A7VA 3GDUA 1ANDA 1O3AA 2VIDA 1MKXH 3LGYA 4RI0A 1O3IA 4DOQA 1O3LA 1A0LA 3EYDA 1KMHB 1HV7A 3TK6A 4GCHG 3A83A 2EA3A 1AVWA 2YNBA 4GAWA 1EP6A 3TVJB 3F9EA 4ZCNA 4JCNA 1SBWA 1AMHA 1K21H 1VCPA 1ZPCA 5T6DA 1P0SH 2ODQA 2VVVA 2OD3B 1AY6H 1FY4A 1PPCE 3NXPA 3B9FH 3S69A 1GGDB 2FMJA 4U30A 1GMHG 2J4IA 4Y7AA 3SV7A 4D8NA 3LJOA 3SJIA 3BTWE 2XWAA 1GHBF 2W5EA 1A0JA 2G81E 5A0BA 2AGGX 2H9TH 1FV9A 1O2UA 2NU0E 3UNQA 3BSQA 3RXAA 1QRWA 3V13A 3F0OA 3W1EA 4GVUA 1ZPBA 1WDIA 4I8JA 2AGEX 1SPJA 1UTNA 1ZHMA 5DG6A 1B7XB 5EW2H 1W13U 2PP6A 3IG6B 2RDEA 1U6QA 2QXGA 1L2EA 1LPKB 4ABBA 2EEKA 2ULLA 4IMQA 4Q7XA 1TRMA 3OAAD 1PQAA 3KNXA 1C5XB 2H5CA 4BTIB 2BOHB 2OUAA 3A89A 2CF9H 5GIBA 1HBTH 5AFZH 1ESAA 2FTMA 2O8LA 1G37A 2ZDLA 2BXUH 4UEHH 1SC8U 3KIDU 1IQKA 1GL1A 2F91A 1IHTH 2ZA5A 4I8HA 3VB3A 3CS0A 3PMHB 1ELAA 1YC0A 3QGNB 1C1VH 3SUGA 2ALVA 1HRTH 5C67A 1H9HE 3U1IB 1UJ1A 1MKXK 1V2OT 1CGJE 3HKJB 1XXDA 2VH6A 4ZKSU 3RXJA 3ZVEA 4K1SA 1H9LB 1ABIH 1BMFD 1MBQA 1WU1A 3HK6B 1ANCA 5GJ4B 3SYJA 1O38A 1GMCG 6GCHG 2A0QB 4BANB 2Y5GA 2Z6BD 1MCTA 1SKYE 1P3EA 1OP2A 4NFFA 5DK1A 3TK5A 3A8BA 1CA8B 4CR5A 9ESTA 5CE1A 1JRTA 4YESB 1GI9B 1QJ1B 2F9NA 5TCCA 3QTVH 5JPMH 3K2UA 1GDNA 1LPZB 2ANMH 1LHDH 2J9NA 1UVOA 1WOFA 1EB1H 4MQAA 4ACBA 3M37A 1YGCH 3AAVA 2JETC 1W10U 4MPUA 2C93B 1T4UH 2C3SA 1GBEA 1ESBA 5C20A 5DO4H 3SZEA 2ODPA 3F6UH 2B0FA 1TONA 2EI7A 2HVYB 1SG8B 2A7CA 1A2CH 2OXSA 1QNJA 3JZ2B 1AQ7A 4E7RG 4A1TA 5E2OA 1CGIE 4TSFD 2XBVA 1O2SA 2HNTC 2CJIA 3OY5U 3A8AA 1TPOA 3B8JA 5FPSA 4AFUA 2ZDNA 1BJUA 1BHXB 4R8TB 3BIUH 5JB8S 1BRUP 5F03A 2XWBI 3SI3H 3VPKA 1IQEA 1ZRBA 4RKJB 4ABEA 3LC5A 4IBLH 1GI8B 1NRNH 1TGTA 1PJPA 1AZ8A 3LPRA 1VJAU 1COWD 4Q80A 7GCHF 5K0HA 2C90B 1ACBE 4Y79A 4DURA 1GJ5H 2K0QA 2R0KA 3SNBA 3T62A 1XM1A 2ASUB 1DDJA 1HAVA 3RXVA 1YY3A 1O3CA 1YPGH 1V2WT 1S84A 4AFSA 2FZZA 3URCA 2F3CE 3ZV8A 1HXFH 4Y0ZE 3F9FA 2PSYA 1QQ4A 1P06A 5GNDA 1TOCB 1GI0A 4FVBA 4XOJA 1S81A 5C94A 3WW7A 5EXMA 3SUFA 1H8DH 3TITA 5T1VA 4IW4E 1TRNA 1P02A 1J8AA 4IC5A 1P57B 2Q6FA 2AH4X 1GBTA 1SQOA 1DFPA 4DT7B 1G3EA 1HDTH 3VB4A 2F4LA 1O3NA 1E37B 2BDCA 2VIWA 1TNKA 4D9QA 2J5UA 1HJAC 1EZXC 2WPIS 1ELTA 4DW2U 1FONA 1T7CA 2R2WU 3NRLA 2IJOB 3BTDE 1GBCA 1OP8A 4P00A 1JWTA 4XD7D 5EJLA 4F4OC 1ZTJA 4IS5A 3OU0A 2AMQA 5DP4A 1LVYA 2ZDAH 3E90B 3PTBA 3LJJA 2IPHA 2H6MA 1VITH 2P3FH 4CH2B 3ZZ4A 1BMLA 2TBSA 2DE8A 3TNTA 4TWWA 4ZH8A 1TWXB 1A5IA 1KIGH 1P10A 4ESTE 4X8UH 4DIHH 3UOUA 1C5LH 1HJAB 2F9UA 1IAUA 1Y5UT 3TGKE 1UCYH 2WV9A 1O2QA 1T4VH 1RS0A 4X6MA 1Z71A 2KCYA 1O5DH 1C2HA 1EP5A 4H6TA 4TY6A 3AVZA 1UVSH 1O0DH 1DANH 2WV4A 1C2LA 4Y8ZA 1O2LA 2ZZUH 1EAUA 2J92A 5FAHA 1K1JA 5FHTA 3MWIU 4AB9A 2Y6TA 2AIQA 3A88A 1PQ8A 2VVCA 4ZXXH 1IQMA 1NTPA 1SGDE 1L4DA 4UONA 1OPHB 2YMSD 2GTBA 2BDGA 1E34B 2GZ8A 1E35B 1O3DA 4ASUD 2I6QA 4ABDA 5EW1H 1XUIA 4RT1A 1ZJDA 3QN7A 2FDAA 1AE8H 2PFEA 1W12U 1SGTA 3SNCA 4NIYA 5DJ7A 2VINA 3A8CA 1ELEE 3O8CA 1O3OA 3E0NB 3PB1E 3TJOA 5EXNA 1LMWB 4XBDA 4I8KA 1TX6A 1K22H 4LZ1H 1D9IA 1LPGB 2WPJS 2C4FH 1QRXA 1A3BH 3SQHE 4NGAH 1F0UA 1Z1IA 1HAGE 2FODA 2TPIZ 2H2ZA 3RLWH 3CNRA 1O2ZA 4YM9A 2ZO3H 1WV7H 3GYLB 3S7HB 4AGJA 3BTHE
chains in the Genus database with same CATH topology
1BTHH 1ELGA 3IWMA 1RJXB 1KXBA 4AX9H 1O30A 3RC4A 2FOAA 3MNXA 3Q3KA 2RA3A 1BCUH 4AYYB 4GSOA 1X7AC 5A8YA 3ZZ9A 2WUBA 3M61U 1HAVB 1XVOA 1CE5A 3AASA 2CHAC 5GWZA 1QRZA 3NKKA 1MD8A 4AOQA 1UCYK 2HPPH 3JZ1B 3URDA 3A7XA 3LC3A 5DP5A 1WTHD 2W7UA 3MO9A 1ABJH 2BTCE 1ZGVA 1BTXA 1ORFA 4NA7A 3LONA 2TIOA 1NU7B 2FS8A 1QJ6B 1YPKH 1P05A 1RD3B 2BXTH 1QCPA 3E8LA 1ID5H 3DUXH 3MNCA 1FY1A 4O97A 3LDXH 5DGJA 3S9BA 3SI4H 3BG8A 4DGJA 1F92A 1WQVH 4Y8XA 2CHAB 1QGFA 2FOEA 2VWOA 1JOUB 2A4RA 3E0PB 3EA8A 2BDIA 2FOHA 1FUJA 1D4PB 4A6LA 1L1GA 4GHQA 4BAHB 4JMYA 3F9HA 1O37A 1UVTH 1P04A 5GCHF 4X1RU 4ZXYH 2FIRH 1QA0A 2GCHG 1EJMA 3K9XB 4NWKA 1C5MD 2G4UA 1YPJH 3GDVA 1TYNA 3UY9A 2DUCA 4MNYA 1O3FA 1MKWK 3M35A 4A1VA 1GI4A 4WMDA 1HAYB 2D2DA 4NCYA 4AG2A 3L3TA 3OYPA 1AB9C 5C3NA 1HB0B 2FOGA 1BTYA 2SGAA 3PM3A 3UTUH 4NA8A 1FPHH 2D26C 1SLWB 2NWNA 2B9LA 5EG4A 1BTUA 4NIWA 1YP9A 1ETRH 1P03A 3ODDA 1QURH 2FTLE 4IGDA 1VCWA 3EA7A 4WMFA 4CBNA 1BOQA 1SLUB 1V3XA 2GP9B 3MFJA 1TA6A 4U01A 2RCEA 4FUCA 3ZZDA 1C5YB 4ZROA 2V0BA 2AEIH 2XBXA 1AB9B 1SGCA 3GICB 1CT2E 3I77A 4J2YB 2XW9A 2Y5FA 4BAOB 1HPGA 2RA0A 2FOCA 1GJBB 4UFGH 1QB1A 2ZU3A 8ESTE 1QB9A 1TALA 3UNSA 3SGQE 5PTPA 3SU4A 1DWDH 4B2CA 1TGCA 2BDHA 3BTKE 3A82A 5JBAS 4YT7H 3STIA 3SZNA 2STBE 2R3YA 4JK6A 2R9PA 4O3UA 4H42U 1AVXA 1E0FD 1Y3XA 1ELBA 1SGFA 4X1PU 1O2OA 1OYTH 2Q6GA 2SGFE 2VB0A 4BXWA 4XBCA 4JZ1A 2BQWB 2TGPZ 3F1SB 3ELAH 2BHGA 1QY6A 1NZQH 5C1YA 3T25A 4ZHMU 1BDAA 2GD4B 2ZHDA 1SSXA 1C2JA 2V3HH 3RXKA 3QO6A 4ABHA 1F0SA 4KTCA 2H5DA 4UE7H 2O8WA 1ZMJA 1GCTB 4QT8C 1KXFA 3PWBA 3EA9A 1V2PT 1DICA 2ZGHA 1WAYB 2VWNA 1CT0E 4Y6DA 3SU1A 2SNVA 3TK9A 2BZAA 3MH6A 3SGAE 1CA0C 4X8SH 1C4V2 2LNCA 4LK4A 2OC0A 3MU0A 1UTLM 1QBNA 1CSOE 3V7TA 2ZTZA 5A0AE 3PYHA 3P6ZB 2BD4A 3RU4T 4NIVA 1G32B 2Q1JA 2J38A 3MO3A 2B8OH 4Y8YA 2A7JA 3BTGE 1UMAH 2P95A 4FXGH 4AB8A 3OSYA 3Q00A 3RXUA 3RU4E 1GHWH 3SJKA 1CO7E 3FP6E 1BBRK 5ETXA 3A7ZA 4Y10E 1IQLA 1Z1JA 2PGBB 1HYLA 2JH5D 4YZUA 1CHOG 4FUGA 5EXLA 1LHGH 3SV8A 1CA0B 1TX7A 2BD9A 1YPLH 1EOLA 1A5GH 2ZFFH 1ANEA 1PYTD 3OY6U 5FCRA 2BY7X 5HYOA 2FX6A 5A2MH 1JIMA 4MNVA 3P8GA 1MD7A 5J4SA 4FU8A 4CRDA 1SR5C 3SU0A 1NRSH 4Q2KA 1T8NA 1THRH 2F83A 1MAYA 1V6DA 4WVPE 1T8MA 2Z3CA 3S9AA 3I29A 3F68H 5E0JA 4CREA 3QWCH 2ZTYA 4A7IB 2SGQE 1XUHA 3A86A 3SW2B 3BEFB 2Q6DA 1QBOA 1H1BA 1GGDC 1NY22 2VIOA 3V12A 1RIWC 4HFPB 5T3HA 1QFKH 2Z9JA 1AWFH 1GHXH 5IYTA 3O8RA 1GJ7B 3UQVA 3QX5H 3T28A 2PWXA 1SOZA 3RXBA 7LPRA 1RTFB 3RXLA 3K6ZA 3RC6A 3STJA 1S83A 2OBQA 1UTOA 1TBRH 1C2IA 3UREA 1IQHA 1YYY1 2F9OA 2XTTB 2BY6X 1EJNA 4CH8B 1GBFA 1O2JA 2JH6D 1TE0A 2VU8E 1FY8E 2WPKS 3ATWA 4K60A 4B1TA 1C1MA 2BY9X 4MVNA 2HPQH 1ZTKA 3UFAA 3SNEA 3P70B 4B75A 1PYTC 1RIWB 3A85A 1SHHB 2Y7ZA 1HAZB 1G30B 1C2EA 5GXPA 1UK3A 5DKMA 2FXRA 2FOFA 4D9RA 5GPIB 2W7SA 4Y11E 1ZZZA 2H1UA 1TB6H 3PMAB 1ZJKA 4X6PA 2H9EH 1EAIA 2P8OC 2Z9LA 1Y3YA 1EB2A 4NIXA 1TQ0B 1K1OA 1W7GH 2OQUA 1S6HA 1EZUC 1CHGA 3GDSA 3TJUA 4F49A 2ZCHP 1PPGE 2VJ1A 3KN2A 3T5FH 1P09A 2GGVB 5HMAA 4ZMAH 8GCHF 3RP2A 1C5QA 3DHKH 4X2WA 7ESTE 3U8RH 3MH7A 2VIVA 3MU8A 1S82A 2B5TB 4ABAA 1AE5A 3KHVA 3HKIB 1O3PB 3V0XA 2SNWA 6CHAC 1LVBA 4JZEH 2FYQA 2AMDA 2P8OB 1V2JT 1GMDG 1VITF 2XC5A 3ZVFA 1QB6A 2W3IA 3GCTF 3SV6A 5EGMA 1XKBC 3UWIA 2W26A 4DG4A 3SV2H 1XXFA 2FOBA 5L30H 1UVUH 5LGOA 1NM6A 2WPLS 1IQNA 1D6WA 4K2YA 1SGIB 1TPPA 5E0GA 4OS4A 3UIRA 6CHAB 2F9PA 1A7SA 3RC5A 2Z9KA 3A7TA 7KMEH 1ZRKA 3C27B 4HZHA 2CGAA 1Y59T 3W94A 1SB1H 2OINA 4UDWH 4BNRA 2HRVA 3RM0H 1SGFG 1KTSB 3SBKA 1OXGA 1UHBA 1HAXB 1K28D 3S9CA 1OSSA 1QA7A 1C4U2 2ZQ2A 1EAXA 2P16A 3MMGA 4YLUA 1TNIA 2VWMA 1GHAG 5A0CA 3BTTE 1A46H 1HJ8A 3D62A 1T8OA 3T26A 4JZFH 3U9AH 5FBEA 1GHYH 1C5PA 2BD7A 1OX1A 1K1MA 4DVAU 2B7DH 1GI1A 2AMPA 3SNAA 5E8EH 4DCDA 2BD5A 1GBHA 3P17H 2WV5A 1P2OA 3M36A 3PLKA 4FU9A 6LPRA 1ETTH 1G3BA 2AS9A 1MTVA 3A7YA 3M3VA 1NRQH 1FXYA 3RLYH 3T2NA 1GMHF 2FYRA 2AFQB 1O2HA 5ABWA 3RMNH 1ETSH 1O2NA 1FNIA 4UFEH 2VNTA 1C5ZB 1BA8B 4WXVA 1ZMLA 1BT7A 6ESTA 3SHCH 1KLJH 1AFEH 2GKVE 4ISHH 1GJ6A 1O3GA 1AKSA 4LXBH 4XSKU 5T6GA 2WYJA 2ZF0H 1GI2A 2A5IA 1VR1H 5AFYH 2BDBA 2SGEE 1J17T 1IQJA 2ZIQH 3UR9A 1C5UA 1AUTC 1MTUA 5H4IB 4DIIH 1LHCH 3RMLH 1O5FH 1DVAH 4I8GA 2FP7B 1TX8A 4ZAEA 1YPMH 1VZQH 5LPRA 2XC4A 1NN6A 1EXFA 1P2QA 3Q77A 4WWYA 3PLBA 1SGRE 1Z8JB 3ZVAA 2JH0D 2GMTC 2UWOA 2QC2A 1UTKA 5BRRE 5L2YH 1S0RA 1EZSC 1MZDA 1P12E 3P95A 1C5WB 1Y5AT 2ZP0H 1VGCB 1UTPA 1A3EH 3KQDA 3MYWA 1C1PA 4OS2A 1O2RA 1GI7B 4KKDA 4UFFH 1GI5A 2VVUA 1OYQA 1HCGA 1O3EA 1DT2A 1GMCF 4TWYA 4E05H 6GCHF 5FX5A 2PLXA 1YPHE 3BEIB 2GMTB 3H5CB 1GVLA 4MPWA 4TYDA 2ZGJA 3R0FA 2BVSH 4JZIA 1SGQE 4ISNA 1AFQB 1QIXB 3DD2H 1O2XA 1LVOA 4K69A 1THPB 1VCQA 1DXPA 1KLTA 3L33A 4INKA 3PTNA 1PPZA 5JDUB 3QZRA 1C2GA 1DY9A 1BTWA 3TH3H 1Z8RA 2ZKSA 1G3CA 3MNBA 2KAIA 2ZFRH 1UHBB 2AERH 3MH4A 3B23B 2HVXA 1EJAA 4CR9A 2O8MA 1L4ZA 1XUFA 1NC6A 1J15A 5AHGH 3RXPA 3ZVDA 5JBCS 1IQFA 1Q2WA 1B0FA 1KYNA 4RN6A 5A09A 1FY5A 1O34A 1N6XA 1W0YH 2HGTH 2PGQB 2FPZA 1O2IA 1A5HA 1C5RA 1V2RT 1P2JA 3GCOA 1DE7H 1Z6JH 3M7UA 5FCKA 1GJ8B 4HTCH 2ZFPH 1MKWH 3VGCC 1Y3WA 3SO3A 1TMBH 2WUCA 1E36B 1C1SA 1O2TA 1ESTA 2ILNA 4FU7A 2BLOA 3SNDA 2OLGA 1O35A 4NG9H 1GG6B 2NU3E 1C1WH 1KTTB 1JBUH 1MH0A 4NSVA 4NZLA 2ZFSA 3LU9B 3BV9B 1BRAA 3ATKA 3P8NA 1KY9A 1XVMA 2QY0B 3SHAH 2STAE 4BXSA 2Z94A 4X8TH 1C1TA 1C1UH 1DSUA 5IDKA 2ZU2A 2NU4E 1TQ7B 4X2YA 2XBYA 2OQ5A 1AKSB 3VGCB 2BQ6B 2PR3A 1THSH 1P2MA 2XC0A 4B2BA 4JYTA 2A2QH 3EGKH 3E16B 2QV1A 2QXJA 2BOKA 4X8VH 1DY8A 3TJVA 2A4OA 4D76A 5BPEA 1ANBA 3QLPH 3GY2A 4CRGA 2GDEH 1V2MT 1MU6B 1FIZA 2Z3DA 1BHXF 4FVDA 2QXIA 1O2VA 2WPHS 1QL7A 5JYIA 1XUKA 1MTNB 4X2VA 4OGYA 2QGRA 3A7WA 4MTBA 4ABIA 1DUEA 2ZHQH 3LGWA 5A8XA 3PROA 1ZGIA 3LKWA 5GDSH 1RGQA 1SGPE 3MU4A 4K3JA 3PWCA 1GJCB 2D8WA 1OWEA 1LVMA 3GCHC 3GOVB 5C5OA 1C2FA 3EAJA 2GT7A 1ARBA 2HNTF 1A0HB 3TH2H 1IOEA 1GBMA 1V2KT 2AIPA 5K7RA 1F0TA 2A2XH 3KEEA 3LH1A 1ZSKA 2GVFA 1O5AB 3ATLA 3EE0B 4XDEA 5F8ZA 1XUJA 2ANKH 3ZZCA 1UTMA 1HAIH 2ZECA 1C5SA 1W0ZU 4I33A 2ZG0H 2IN2A 1ELFA 2CXVA 2PTNA 2VIPA 3D65E 3SU3A 1W8BH 1NRRH 1DWBH 2GCTC 8KME2 2UWLA 1E38B 4B2AA 2FS9A 1JRSA 4CRAA 1BMNH 2H9HA 3GCHB 2CN0H 4MNWA 3SU2A 1YBWA 4BOHA 1V2UT 4GUXA 2GT8A 1ZHRA 1T8LA 2TGTA 3EDXB 1QL8A 2Y5HA 1WSSH 1BBRH 2QA9E 3UQOA 1GVZA 2P93A 4VGCB 4NFEA 1TNJA 1ZSJA 1P9UA 1Z8GA 3L6PA 2J34A 4MG3A 2ZGXH 1SHYA 4YOIA 3AW1A 4B73A 5JBTA 3GY7A 2KAIB 3RXOA 3ATMA 3LGIA 1C2KA 3PO1B 1HXEH 2GCTB 2GZ9A 4B74A 5FBIA 2ZCLP 1HAOH 2THFB 3H7TA 3RXGA 3FANA 1GCTC 2C8YB 2PHBA 4Q7YA 2ANYA 4MPVA 3HGPA 1K1LA 4JK5A 2A31A 1BB0B 4X6NA 2ZPQA 4X6OA 4I7YH 4OGXA 1PPBH 2FI3E 2LPRA 2HNTE 1HIAA 3QZQA 1GJAB 4SGAE 1OP0A 1XKAC 3DT0H 3QUMP 3GY6A 2GV7A 2QN5T 1CGHA 1DXWA 2EI6A 5EQSA 1RRKA 1KDQA 2TRMA 1CQQA 1LHFH 5SGAE 4TPYA 1O2KA 3R3GB 4YO9A 3MO6A 5EQRA 2BMGB 4JYVH 1OWJA 1NFWA 4U2WA 1AD8H 1ELCA 1D3QB 1OWDA 4H4FA 3HATH 3UNRA 2D1JA 4ABGA 5EOKA 4E7NA 1GHBG 4Y0YE 3ZZAA 3S0NA 1LKAA 2ANWA 4FUJA 4GPGA 2HALA 4XBBA 3RXSA 2FLRH 3PV4A 1CBWB 2GCHF 2ZDMA 3VXEH 1EATA 1A4WH 3RXDA 1AHTH 1TA2A 1PQ7A 1YCPM 3M3TA 1XX9A 1TMTH 3U1JB 1ZOMA 4YT6H 1G36A 2G55A 4CRFA 3EQ0H 3NUMA 4X2XA 1DWCH 1AGJA 1S0QA 1G3DA 3K6YA 3ODFA 4ISOA 2BD8A 2XXLA 3ZVGA 2ZFQH 2ZTXA 1UK4A 2FX4A 2OP9A 4KELA 1GBJA 5FPYA 1C9TA 4U32A 4BAQB 4NA9H 3BTQE 5E0HA 3A87A 4JZDH 1Z6EA 1W14U 3BG4B 1BZXE 3CP7A 5EU8A 4AORA 1SGNE 3RXHA 3OX7U 2CMYA 2FI5E 3HGNA 1TABE 3BEUA 3M7QA 3ZZ5A 2UUJB 5JBBS 1V2VT 1D3TB 5DPAA 4BTUB 3VB7A 1TNHA 3M5NA 3RMMH 4KTUA 3U8TH 2OC1A 4IN1A 4AGKA 3ZZBA 4Q7ZA 3NK8A 2CV3A 1O33A 1C4Y2 1NFUA 1TMUH 4OS6A 1W7XH 2I6SA 2XNIA 5LPEA 3DFJA 3QK1A 3Q3YA 1ZSLA 5ESTE 2RDLA 3HK3B 1V2TT 4IMZA 1V2NT 3RM2H 3VB5A 4SGBE 1BMMH 1YM0A 2Y82A 4IN2A 3UPEA 1BTZA 1C5OH 3U69H 1H9IE 5G4BA 1G2MA 1O3MA 2BX3A 3MH5A 1HGTH 3MI4A 1GJ4H 1O2GH 1TNGA 5F6MA 1C9PA 1OWIA 5CHAC 1HAHH 1GBIA 1J14A 3E6PH 2ZI2H 1EKBB 2F9BH 1SQAA 1JXPA 1O2PA 1F5KU 1GBDA 4J1YA 1PFXC 1C2DA 1FI8A 1TFXA 1N1LA 4K1EA 1B5GH 5E2PA 1SGYE 1QR3E 4YTAA 1NT1A 1LTOA 2QYIA 2UWPA 3VB6A 1N8OC 4K8BA 1Y8TA