1ZYOA

Crystal structure of the serine protease domain of sesbania mosaic virus polyprotein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
184
Chain Sequence
SFYSPVKAGDEPASLVAIKSGPTTIGFGCRTKIEDCLLTAHHVWCNSMRPTGLAKAGKQVSVEDWEISMSSSDKMLDFAIVRVPTHVWSKLGVKSTPLVCPSSKDVITCYGGSSSDCLMSGVGSSSTSEFTWKLTHTCPTAAGWSGTPLYSSRGVVGMHVGFEEIGKLNRGVNMFYVANYLLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine protease
publication title Crystal structure of the serine protease domain of Sesbania mosaic virus polyprotein and mutational analysis of residues forming the S1-binding pocket
pubmed doi rcsb
source organism Sesbania mosaic virus
molecule tags Hydrolase
total genus 40
structure length 184
sequence length 186
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02122 Peptidase_S39 Peptidase S39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA02
4IMQA 3E6PH 1YPMH 3T26A 2CN0H 4FXGH 1BJUA 1SGPE 2HVXA 2SGEE 1E34B 1BMLA 1PPHE 3AW1A 2JH6D 1D3PB 3MNSA 3RXOA 1NU9A 3IITA 3SV7A 2ANWA 3TK9A 1MUEB 4ZKOU 2O8TA 4BAOB 2ODYB 2PGBB 2ZPSA 1MU8B 4AYYB 1ANCA 1AFQC 1WV7H 1KDQA 3NUMA 3LJOA 1GBCA 1MKWH 1SGCA 1GI6A 1C5SA 2Z9GA 1SC8U 1PPBH 2ZA5A 1ZTJA 2GT8A 1BRBE 1O3JA 1GMCG 3RMMH 4CHAC 1OWEA 3M7QA 2NU3E 3TK5A 3SUEA 1BTHH 3VPKA 5LPFA 3S9BA 1DFPA 1P2NA 1SSXA 1Z71A 2Y81A 2O8WA 4IC6A 1JMOH 1FV9A 1VCPA 2AEIH 1C1VH 1TNLA 4R8TB 5C20A 5DO4H 2A4OA 2THFB 3HKIB 1TB6H 3MNBA 2QXJA 3TJVA 5AFZH 1DM4B 2QGRA 1V2WT 1ETRH 4YOIA 3AW0A 1ELEE 4YOJA 3VXFH 4B2CA 8KME2 1MCTA 1GBIA 1QBVH 1D3TB 2G55A 3H7OA 3QK1A 4JMYA 2XBYA 4NZQA 1XKBC 2WPHS 3MFJA 4Z0KA 1SHHB 3MNCA 4UONA 2EI8A 1EB1H 3TGJE 1XVOA 1O3FA 1BTUA 5T6FA 5DGJA 1GDNA 2P3TB 3SU3A 1ELGA 2D26C 4AYVB 3D62A 4Q7ZA 5HGGA 3OY5U 1MKXH 3ZVBA 1O36A 2DUCA 5EQSA 1D3QB 1E0FD 1FUJA 2AH4X 5FBIA 2GT7A 2AGIX 3SGQE 2HALA 2OQUA 3HKJB 1BIOA 2GZ8A 1CA0B 1QRWA 2BMGB 1SFIA 5HMAA 5J4QA 1DSTA 1L1GA 3MO3A 4IGDA 2CF8H 2ODQA 1MTUA 1O5DH 1MTNB 2BDYA 4H4FA 2P95A 5E2OA 3ODDA 2ZHFH 3SU4A 2PUQH 5CHAB 4FVDA 1YBWA 1ZPBA 1CT0E 1HAVA 4U01A 1GL0E 2C90B 2WPMS 3ZZ5A 4GSOA 2C8WB 1MTVA 1Q3XA 2ANYA 3F9HA 2ZNKH 2OC1A 3MO9A 1ZHMA 2JETB 1GPZA 2RDLA 3VGCC 5HYOA 2ZGHA 1SHYA 4GCHG 1V2PT 1VZQH 3QTVH 1HAGE 5BRRE 4GPGA 1C1WH 1C1NA 2HNTC 4I7YH 3D65E 3HGPA 1K2I1 4ZKNU 1GJ4H 1SGDE 1ZR0A 1MQ6A 5I46H 3TLOA 5C5NA 5C1XA 1Y5AT 1EAUA 1Z7KA 3RXVA 5A8XA 5ESBA 3NCLA 2BXTH 1GI3A 1IQEA 3P8FA 3GY3A 1BJVA 3UPEA 1TX8A 3R3GB 3LJJA 2FX6A 2XWBI 4MQAA 3LC3A 1C5WB 1AB9C 3MHWU 2J34A 5A8YA 3BG4C 1WUNH 2RA0A 2F9NA 5FPTA 1C5VA 4K5ZA 4ZHLU 1Y59T 2BYAX 2ZKSA 4AOQA 1YYY1 1AKSB 4JZEH 5JPMH 1MD8A 3A88A 3E91A 3LDXH 4JZFH 3U8RH 2ZGBH 3GOVB 1TGBA 1CT2E 2BLQA 1V2RT 4ZKSU 3SNAA 3SO3A 1BBRE 1NRQH 1OYTH 1SOZA 3ZVDA 1HXEH 1GI2A 1TX7A 2OC0A 3PMHB 1O2OA 3BTWE 2NU0E 1HJ8A 3A7ZA 2PGQB 3IWMA 7GCHG 1S0RA 1TRYA 1UVSH 1O34A 3BEIB 1ZGVA 2NU1E 2Z7FE 3A7WA 2KAIB 1BTPA 4IN1A 2GZ7A 2Z3EA 1QTFA 3LGYA 2ZFFH 1LHCH 2ZIQH 3TJNA 1OP0A 1P2OA 3S9AA 2SNVA 3GCHC 1P2JA 3KN2A 4B2BA 5GIBA 3TNTA 1PYTD 1PQ5A 4FUEA 1C5YB 1GGDC 2BTCE 2FWWA 1EKBB 4UFFH 1INCA 3QZRA 1C5MD 2ANKH 3RXEA 1TPSA 2C4FH 1V2ST 1ETSH 1O2VA 5AVDA 4DVAU 2HWLB 2R9PA 3GY4A 1HAHH 1GJ6A 3SU2A 4HTCH 1CHGA 4Z6AH 1Q2WA 1ZMNA 2IOTA 1UO6A 1YKTA 1TPOA 4Y8YA 3P8GA 1P57B 1BZXE 3MTYA 2H9HA 1BOQA 2UUJB 5F03A 1TNKA 2ZCLP 1S82A 1JWTA 1YF4A 6CHAC 3A8BA 3FP7E 2G5VA 3KQDA 3S0NA 4CBOA 2BD4A 1P2QA 2AERH 1MTWA 1SLWB 4A1TA 1IQGA 1K9OE 1SGTA 2ASUB 3RXMA 2J94A 4CRBA 1O2XA 3M5NA 1EZXC 4X6OA 3UUZA 1GG6B 3EA7A 1RRKA 2G00A 2ZQ2A 1NRPH 3DUXH 1C1UH 4AFUA 3SNEA 2PLXA 3RXSA 2A7CA 3EE0B 1JXPA 1HIAA 2J2UA 1EJMA 1N8OC 2QV1A 3OX7U 2HLCA 4VGCB 2STBE 3ZYDA 1KYNA 1THRH 1BHXF 1CBWB 1RTFB 1P01A 3SU6A 1ELBA 5CMXH 4CR9A 1C2GA 1O3MA 2ESTE 2VVUA 3C27B 4NIVA 1EQ9A 5G4BA 1FMGA 3KNXA 3AAUA 1C2DA 4KKDA 1F0UA 1A4WH 1H9LB 4H42U 2FEQH 2WUBA 2A32A 3BTTE 1PQ7A 1DY9A 1EUFA 8LPRA 1KSNA 4X8SH 4D9QA 1HBTH 1J16A 5I25A 3V0XA 3A83A 1VITG 3RM0H 2AFQB 2ZEBA 2FOFA 2XC4A 1AU8A 3M5LA 3SBKA 3TNSA 1GMHG 4BANB 2ZFTA 1A1RA 2QXIA 1C2KA 2PSXA 3M3TA 3F9FA 1QL8A 1VGCB 4OGXA 1YPLH 4MPXA 4K3JA 4NFEA 1NS3A 4D8NA 2ZU5A 3IG6B 4JZDH 1P06A 5ETXA 2KAIA 3A7TA 1HFDA 2OC7A 3K6YA 4FUHA 4NWLA 1AWHB 1PPEE 2A7JA 2W5EA 1MZDA 4OS1A 1L4DA 5C5OA 3B23B 3BIUH 4X8VH 4JYVH 1O2GH 2FOCA 2QYIA 3VB5A 2BDIA 1C5RA 3PTNA 3GY2A 2XXLA 3RU4T 5GCHG 4ABHA 2AMQA 5EODA 1O2WA 1W14U 4TY7A 2GDDA 4HFPB 1DY8A 2CJIA 1SQAA 1SGFG 3SV9A 1Y3YA 1J14A 4X8UH 1GDUA 4FUBA 1YPHE 5E8EH 1Z6EA 1PPCE 5A0BA 1RIWB 3T27A 4IMZA 1D3DB 1O2RA 2BD3A 1OKXA 2B9LA 2JH5D 7GCHF 2AMPA 4JK5A 1P03A 5J4SA 1OS8A 1K1MA 1GBMA 1QJ1B 2FX4A 4WJG2 1BRCE 1C5TA 1KXFA 2UWPA 3O8CA 1Y3XA 2TGPZ 1KDQB 1BTXA 1A5IA 1UVUH 2O9QA 1GHYH 2PTCE 3MNXA 5FHTA 3U98H 2ZO3H 2VWNA 1IQMA 1GJ8B 3UWJH 1G3CA 1LO6A 4Y11E 2VVVA 1O2IA 1KXEA 3LGTA 6ESTA 2Q6DA 2XW9A 1LVMA 5JB9S 1GHWH 1PPZA 3BTQE 4TPIZ 1CU1A 1ID5H 2Z3DA 3UFAA 3RU4D 2TGTA 3DFLA 1O3EA 1ZTLA 2FODA 4OS4A 3RXDA 3VGCB 4AORA 4DW2U 5JBBS 4BTTB 2HPPH 4ASHA 4AN7A 1H4WA 3ELAH 2C3SA 4UDWH 1C1QA 1GJCB 2HPQH 3EAJA 2G8TA 1K21H 4XDEA 4U30A 1JBUH 4Q7YA 3SV2H 2VH6A 2CGAA 1XVMA 1UK3A 2FS9A 5EXMA 1AIXH 1QA7A 2GCTC 4DY7B 3V7TA 4MNYA 4RKJB 2BY5X 3GDUA 2K1QA 2ZU2A 2SNWA 3L3TA 1S6HA 5TJXA 3SGAE 5GJ4B 1NO9H 3QX5H 1ZHPA 4LOYH 4X2VA 3MMGA 3PWBA 1V2OT 1YC0A 2FYRA 3I78A 3KEEA 4PROA 5C67A 1T7CA 1AB9B 1ZPCA 4K69A 1EAXA 1S83A 3BG4B 2W7UA 1AWFH 1SGNE 3E16B 3RXLA 1RD3B 1P2KA 1V3XA 4Y10E 4NGAH 3ATIA 1LCYA 1GBHA 1G36A 2V0BA 1PPGE 3TPIZ 4XOJA 1O5AB 2H9TH 5DP7A 3RXRA 1YPJH 2QCYA 3E1XB 2WPIS 2A4RA 2XCNA 2V35A 1GJAB 3SGBE 2A45B 2VVCA 3SV8A 1QQUA 3M37A 4JK6A 1YPGH 1PQ8A 2Y7XA 4ABDA 1HAVB 2R3YA 2FS8A 2XYAA 1GVZA 1LKBA 2G4TA 3LIWA 3V3MA 1S6FA 3ATMA 3A8CA 3OSYA 1F0TA 1DOJA 5EXNA 2XBVA 1UK2A 3BTGE 4U32A 1AFEH 2ZFQH 3O8BA 3SJOA 2R3UA 1P9SA 2C8ZB 4ZH8A 3GCHB 2QAAA 3CP7A 1EB2A 1L4ZA 4NIXA 3O8RA 2BQWB 2ZWLH 5FX6A 1F7ZA 1KXCA 1O3HA 1YCPK 1CHOG 1K1PA 1GGDB 2B7DH 1G3DA 3F9GA 4NIWA 1C4V2 1P04A 3DHKH 1LTOA 4J2YB 3RLYH 4JYUH 2ZDLA 4ZXYH 1A5GH 2ZTZA 1V2MT 3STIA 2EA3A 1GJBB 3BTHE 2J38A 1HXFH 1YLDA 1N6XA 4JZ1A 5AFYH 3L6PA 3B9FH 4CRGA 5F6MA 2P8OC 1OWHA 4MNXA 4Y6DA 3RXFA 1K28D 2GV6A 4XFQA 4X6NA 1QGFA 3P6ZB 3U69H 1DE7H 1OXGA 2XBWA 4CH2B 6CHAB 1K1LA 1K1OA 1O3NA 5PTPA 2WV5A 3MU1A 4D9RA 1TGSZ 3ATKA 1KTTB 3RU4E 4BNRA 1FDPA 3M61U 3MOCA 5FPSA 3ZVAA 3BEUA 1BMNH 2BM2A 3VB6A 1F92A 5F8ZA 4ESTE 2ZFSA 4Q80A 1HGTH 3AAVA 1IQIA 1FAKH 4BAKB 1NRNH 2GCHF 1MD7A 1CA8B 3MU8A 2B0FA 4Y0YE 3T5FH 1EP6A 2Z94A 1S84A 4GUXA 4DOQA 2B8OH 4X1SU 2YNBA 3E0NB 1C1MA 1P8VC 2BZAA 3M3SA 1F0SA 2ZC9H 3PLBA 4B75A 4X1QU 1AVGH 4NSVA 2VB0A 1KTSB 2UWOA 1G3BA 1O3IA 1DWDH 3L33A 4MDSA 3PMBB 1P02A 4WWYA 2O8UA 1FI8A 1F0RA 4GVUA 2FLRH 3Q3YA 1EAIA 3PM3A 4AGKA 2QY0B 1ZJKA 3OU0A 1HAPH 3WY8A 5L30H 1HJAC 3SNDA 3T62A 2BX4A 4X1NU 4BTIB 2HNTE 1G9IE 1J17T 4AZ2B 2RG3A 1TONA 1DICA 1SB1H 3SQEE 4RKOB 4CRAA 1ABJH 4I8LA 1H9HE 5FBEA 2J4IA 1AUTC 2Z9LA 5A2MH 1TQ7B 3BV9B 1O2SA 2PTNA 1WCZA 2P94A 1FJSA 4ABIA 3ZZ3A 5EXLA 3TJUA 3FAOA 2F9UA 4FU9A 1O3LA 2BQ6B 1S5SA 1BT7A 5E0HA 5IDKA 1O2TA 4MPWA 3Q3KA 2PHBA 5FXLA 3RXQA 2SGFE 2QF0A 5H4IB 3UNSA 2AGEX 4RN6A 3T28A 3FP8E 4RSPA 1QNJA 2ULLA 1ZMJA 2WUCA 1O5GH 2VIDA 4AG2A 4XBBA 2Y82A 1O2JA 3NK8A 3S9CA 1TPPA 1Z8GA 2ZTYA 1Z1IA 4CRDA 1ZSJA 1C2FA 4DIHH 4CRFA 2A0QB 2VGCC 4BAQB 1EAWA 1TPAE 2OXSA 3LGIA 1AZ8A 1C4U2 1HIAB 1IHSH 2BDAA 2FESH 2TBSA 1C5LH 2H6MA 3PO1C 1SGIB 3FZDA 1TFXA 1SLVB 3DA9B 1IQNA 2H1UA 2QIQA 2ZCKP 1ELAA 3LU9B 1CGHA 3KF2A 3U8OH 1DANH 3Q77A 1SGEE 3HPTB 1RTLA 1W3CA 3OYPA 2C8XB 1K22H 1L1JA 1FY3A 2CMYA 5ESTE 1C9PA 1QBOA 3STJA 1VCWA 1ZRKA 5LH8A 3GICB 1FONA 3QLPH 1YCPH 1P2IA 2Y6TA 1O5EH 4D7GA 1YLCA 1GHAG 9LPRA 4INHA 2ZPQA 4AFZA 1ANDA 2LPRA 2H5CA 1N1LA 2Q6FA 3ZZDA 2AYWA 2PWXA 2Q1JA 2A7HA 4TWYA 5C1YA 4A92A 1TGCA 3RMLH 5JDUB 1OWJA 1ZZZA 5E0GA 4Q2KA 1FY4A 3LOXA 1MAXA 1O3BA 1O2PA 3M5MA 1NFXA 1CO7E 4J1YA 3FANA 2BX3A 4K1SA 8GCHG 1CHOF 2UUYA 3KQCA 2GD4B 3SORA 3SI3H 6LPRA 2Z9IA 3T29A 1NT1A 2TGDA 2BY6X 2EEKA 3TU7H 3A82A 4ZAEA 3ZZAA 2ALVA 2BY7X 2ZI2H 1A7SA 2XC0A 2HGTH 3D49H 2W3KA 3ZZ4A 1BB0B 4XBCA 1CQQA 2P59A 1DPOA 4GHQA 4ZHMU 1W12U 3CENA 5F8XA 3JZ1B 1SI5H 1HYLA 1NRSH 2I6SA 2VH0A 3QUMP 1O3GA 3E0PB 5A8ZA 1C2HA 1ZHRA 1CVWH 3UNRA 1AHTH 1ZMLA 4AB9A 4F49A 1GMCF 2ZCHP 1GHXH 1GJ5H 2GCTB 4UE7H 3RXGA 4ABEA 1EX3A 2FXRA 3SHAH 4ABFA 2XTTB 4UFGH 2VWLA 2H9EH 4YESB 1ORFA 1O2QA 4QT8C 3MI4A 4CREA 2Y5GA 1NZQH 2SGQE 1QY6A 5LPEA 3V12A 1T8NA 2ODPA 8ESTE 2YOLA 2J92A 5SGAE 2RA3A 3ATLA 1AO5A 2BY9X 1UTJA 3MWIU 1SR5C 1PPFE 1V2UT 2M5TA 4Y8XA 4HGCA 3A8DA 5EQQA 3P70B 4DG4A 1QJ7B 3GISB 1O32A 3GCNA 1UCYK 2AS9A 2BLVA 2ZDNA 3BTDE 2Z9JA 2FPZA 2XC5A 1AE5A 4YLQH 3A87A 1XX9A 2G4UA 1XUHA 4MNVA 5L6NH 3RXTA 1C2JA 1P2MA 4UD9H 1FLEE 1QQ4A 4ISLA 5K0HA 1MAYA 2ZGCA 1DLKB 1OX1A 3HATH 1WQSA 4Y7BA 2VNTA 1DDJA 1GBAA 1FIZA 1MBQA 5DK1A 2BD9A 1BHXB 1P09A 3BTME 4B76A 2F91A 3TITA 3F9EA 2WV4A 2BB4A 4DGJA 3TH4H 2NWNA 1AZZA 1HV7A 1W8BH 4FVBA 1WQVH 1T8MA 1G2MA 3H5CB 1LHGH 1F2SE 1OYQA 2ZECA 3ZVFA 1TOCB 1GCDA 1YP9A 2OBOA 3VB3A 1W0ZU 1SMFE 3F68H 1O35A 1KXBA 3A7VA 1T32A 2C8YB 1AFQB 2BLOA 4ISOA 3SNCA 1OWKA 3RXBA 3EA8A 1MBMA 5L2ZH 2P8OB 1MU6B 4GCHF 4A1VA 1TA6A 5FCRA 1RJXB 2A2QH 2ZU1A 3LONA 1THPB 4CHAB 3ZYEA 1TQ0B 1NM6A 3W95A 1JOUB 1GBEA 4U2WA 3GCTG 4AFQA 3BTKE 2XRCA 1LHEH 2BVSH 3TVJB 4FUCA 1W2KH 1JRSA 1MZAA 4O3TA 4GLYA 1W13U 4O03A 1DUEA 2RCEA 1NFUA 1ZSLA 1LKAA 5AHGH 1QFKH 1A61H 4WXVA 2GKVE 6GCHG 1CGJE 5EQRA 3ESTA 5HXFA 3LH1A 2B5TB 2FLBH 1HJ9A 1EASA 2W26A 4CR5A 1TBQH 1O2HA 2P3FH 1B0EA 2V3HH 1HCGA 1C5QA 1NPMA 1TOMH 3UNQA 3F1SB 5A0AE 1E37B 2VWOA 3FFGA 3R0FA 1ELTA 1O3CA 1TYNA 2BD8A 3T2NA 1FAXA 2FOHA 3BIVH 2FOEA 1Y3UA 2BLWA 4ZMAH 1O0DH 4FU8A 1HJAB 1PFXC 3LC5A 4X1RU 1LVOA 1FXYA 1O3AA 1Y5BT 8GCHF 1NY22 1S81A 1ABIH 2W7SA 1P10A 2VJ1A 2YNAA 2D8WA 5DP4A 2G5NA 2BZ6H 1FPCH 3DT0H 1KIGH 1O31A 1XMNB 2ZHEH 3S7KB 1D9IA 1AQ7A 2BD7A 4MLFB 1FY5A 1P0SH 3BEFB 5AF9H 3QGNB 1KLJH 1P3EA 1UTKA 1Z8JB 2AIQA 2P93A 4IBLH 3LGVA 1S85A 3EA9A 4TPYA 2GZ9A 3MH4A 4Y8ZA 2V6NA 3HGNA 5CE1A 2GX4A 4SGAE 1ELCA 5HM9A 1W10U 1IQFA 4MPUA 4CBNA 1UCYH 1O5BB 3VB4A 1U6QA 4YT7H 1EZSC 2G51A 2BD5A 1DWEH 1AVWA 1NRRH 2VGCB 3MYWA 1BMMH 1SGQE 4ABAA 1IQLA 2F9VA 3UY9A 3E3TA 3D23A 4ABGA 4FUFA 1H9IE 5T6GA 1GJ9B 1XKAC 1G30B 1XUGA 1UK4A 2Z9KA 4Q7XA 2OTVA 4Y71A 5A09A 1D4PB 5EPYA 2EI6A 1V2KT 5DP5A 3SOSA 1DITH 1GBBA 4X2XA 1UVPA 1ZPZA 3GY8A 2H2ZA 4UFDH 4F4OC 5JBTA 1C2LA 1IQJA 1O38A 3NPSA 3VB7A 1GI5A 2O8LA 4KTUA 2HOBA 2F3CE 1IAUA 1M9UA 1TNGA 2OD3B 1EOLA 1HAXB 2EI7A 4X2WA 1KLTA 1G3EA 4CH8B 3S7HB 4OS7A 1O3DA 3HK3B 3GY7A 4DURA 4TWWA 1AGJA 2FIRH 1TA2A 3EYDA 1GCTC 4H6TA 2H5DA 1TBZH 2ZPRA 4GHTA 1X7AC 1LQEA 3SU1A 1WTHD 3RC6A 1P3CA 2VINA 4D76A 1H1BA 3SJ8A 3QN7A 1V2NT 2D2DA 4NWKA 1SQTA 3Q3XA 1ESBA 1GHZA 1LVYA 2VIWA 2ZZUH 4XBDA 1C1SA 1KXDA 2BVRH 1XXFA 2SGAA 1VITF 1DLEA 3PLPA 4ISIH 3RMOH 1GDQA 1QB9A 1T31A 2GP9B 1L2EA 3SZNA 1WAYB 3RXAA 1GMHF 1AUJA 1C5ZB 3MU5A 1XUIA 1YGCH 2QN5T 2A5AA 1QB6A 4I32A 3TIUA 3UOPA 1AE8H 1ANEA 1ETTH 2FP7B 1JRTA 1EPTC 1XUFA 4DJZB 2Y5HA 3ZZ7A 3QO6A 3GCTF 4LK4A 2OINA 3S69A 1XUKA 3RXCA 4OGYA 1HDTH 5L2YH 2WYGA 4MPVA 2ZHDA 4B1TA 5C2ZA 1BQYA 4XSKU 1T4VH 1GI8B 2GVFA 1EATA 2UUFB 4YLUA 3PMAB 2VIOA 1TMBH 3EDXB 3SUGA 2UWLA 4JCNA 4WMDA 1DX5M 1YM0A 1DWBH 1XM1A 3M36A 3UWIA 1BITA 6GCHF 2GMTC 4HZHA 4INLA 2PW8H 2J9NA 2J95A 3M7TA 3ZZBA 1IQKA 2Z3CA 3OY6U 4D7FA 2V3OH 1UHBA 5DP9A 2EC9H 1TNJA 4NFFA 3PB1E 3ZZ9A 2VU8E 2R0KA 5GCHF 2A1DB 1O2MA 1UTLM 2WPLS 1VGCC 4BXSA 5EG4A 2A31A 1AVXA 1SGYE 4Y76A 1HNEE 1TABE 4X0WU 3GCOA 1N8OB 1J8AA 4DIIH 3ZV9A 3SQHE 1KY9A 3ITIA 3UR9A 1CGIE 4AFSA 2FI5E 2R2MB 1EJNA 5LPRA 3LKWA 4I8KA 3Q76A 1SLUB 3F6UH 1L0ZA 3BTEE 1K1NA 3UQOA 1K1IA 2ZHWH 2ZDVH 1RXPA 4K8BA 2PR3A 5E0JA 4THNH 2ZF0H 5FX5A 1A3EH 2ALPA 2GTBA 1KXAA 1G2LA 1ZGIA 2AMDA 1TNHA 3C1KA 1C5UA 1O2LA 5JB8S 1GI7B 4O3UA 3NWUA 1O2UA 2STAE 1TBRH 4ZHAA 5JYIA 1CSOE 1Z6JH 4MG3A 1L1NA 3PLKA 4UFEH 1WYKA 3A84A 3M3VA 4JYTA 3T25A 4INKA 3MH7A 3K6ZA 5DPAA 3UTUH 1O3KA 3BN9A 4AX9H 2FZZA 4ABJA 1V2JT 3NZIA 1C5PA 1A5HA 2XCFA 2PKSC 1IHTH 1DUAA 1HUTH 1LQDB 1QCPA 1RIWC 1BBRK 1ZRBA 1UTNA 2DE9A 5B6OA 1OWIA 4ISHH 2F9PA 1OP2A 1LHDH 3RC5A 2WPKS 5DJ7A 1LDTT 1WU1A 1T8OA 4X6MA 1JIMA 2PKAA 1V2VT 1J15A 4B73A 1S0QA 4FU7A 1OP8A 1ZSKA 1TMTH 1EZQA 4A5TS 4K1EA 3ZV8A 2WPJS 2FTMA 3B8JA 2WINI 4OS5A 2F83A 4UEHH 3RDZA 4MVNA 3GY5A 1A2CH 1EZUC 1QBNA 1C1PA 1VCQA 3I29A 4M7GA 1P12E 3DD2H 4WY3A 3K65B 4KELA 1DT2A 2C93B 2R0LA 2TRMA 2BQ7B 4K8YA 4NA7A 1NFWA 2VWMA 4WXIA 3FP6E 1W0YH 2TGAA 1W7XH 3ENSB 3TH3H 4LZ4B 1C2MA 3RXKA 2ZDMA 1YCPM 5JBCS 4O97A 2I6QA 2ZG0H 1F5RA 2PFEA 4BAHB 1FY1A 1BRUP 3RXHA 4WF8A 2ANMH 1DXWA 4X8TH 2GGVB 5FPYA 3RLWH 1T4UH 4ISNA 1DSUA 4IC5A 3U9AH 2PSYA 2PV9B 2QC2A 1A46H 1D6RA 1Z8RA 2FMJA 1GBLA 2CHAC 5FAHA 7ESTE 5LGOA 3KQEA 5IYTA 3TK6A 4FUIA 5C1UA 5GDSH 1UVTH 2ZGXH 1BTWA 1UMAH 1TAWA 3O8DA 1O2ZA 1NU7B 3PYHA 3ATWA 1GBDA 3RUOA 1GVLA 2FYQA 3K2UA 5ABWA 3LGWA 3NXPA 1SGFA 2WYJA 3LGUA 3ZZ6A 1DWCH 3GYMA 3BSQA 1A3BH 1TGNA 5C3NA 4MTBA 1YPEH 4FUDA 3E90B 3QDZB 3UREA 1UTOA 3GDSA 3P95A 5E2PA 3UR6A 1GHBG 3VFEA 1HLTH 2OBQA 1QIXB 1C5OH 5FCKA 3N7OA 4WH8A 1TX6A 3A80A 4ZROA 2LNCA 2ZTXA 2QF3A 3MH6A 4E7RG 1PQAA 1Z1JA 2IJOB 3QTOH 1MTSA 3EQ0H 3PMJA 4OS2A 1MH0A 3SU5A 1TRMA 3A89A 1V2QT 1B0FA 5EGMA 5JBAS 3A7YA 3KCGH 2XNIA 2ZQ1A 2JKHA 1G32B 2FTLE 2DE8A 2IN2A 1TALA 3TGIE 3SUDA 4WMEA 3NKKA 4KTSA 1AMHA 1Y5UT 3SW2B 1GJDB 1QRXA 2ZHQH 3H7TA 1LVBA 4YO9A 4HI3A 1P05A 1VITH 1ZYOA 1BA8B 1IOEA 3KL6A 1C5NH 1LHFH 3SV6A 1DXPA 2VIPA 4LZ1H 1O2NA 2XWAA 2OUAA 2VIVA 1FQ3A 2F9BH 3SJIA 1SQOA 1O33A 1H8IH 1SPJA 3A8AA 1GCTB 1P9UA 2NU4E 1FN6A 3RXIA 1O2YA 1TIOA 4YTAA 1W11U 2BXUH 5EPNA 1AD8H 4IW4E 1HB0B 4X2YA 4YM9A 1BTZA 1TE0A 2SGPE 3BF6H 3PROA 5HM2A 1C1RA 1QB1A 4LXBH 1ZTKA 2FOMB 3A85A 1Q31A 2HRVA 4ABBA 2ZGJA 1FN8A 1BBRH 3U8TH 3FZZA 5A0CA 4ZUHA 4AG1A 1QURH 1F5KU 1EOJA 3ZZ8A 4K1TA 4XE4A 3RXUA 4NCYA 3SN8A 1MQ5A 1NN6A 1ZLRA 4BOHA 4NG9H 1V2LT 2A4GA 1QR3E 3CS0A 1FPHH 1HAYB 1NTPA 3RC4A 3VXEH 1ZOMA 4FUJA 2Q6GA 1OPHB 3CS7A 1SGRE 1W7GH 2FOBA 2R2WU 2UUKB 3P8OA 1BRAA 1TWXB 2VIQA 1OSSA 1EPTB 2ILNA 2OC8A 3RP2A 3UOUA 3VEQB 3M35A 1GWAA 2BVXH 1BDAA 1OOKB 1GMDG 2QA9E 4I33A 4MNWA 2CXVA 4X1PU 1GVKB 2ZP0H 4DCDA 5EOKA 3BTFE 4E05H 2BOHB 1ARCA 2FOAA 1B7XB 1RGQA 1WSSH 3DFJA 1CE5A 4GAWA 4OS6A 4IS5A 3P8NA 4K60A 1ELFA 3SJ9A 4SGBE 1DVAH 2JH0D 1CA0C 3EGKH 1AKSA 3KQBA 5T6DA 1SVPA 4DT7B 1BCUH 1HAIH 1FIWA 1TRNA 1VR1H 2SFAA 2GMTB 1QHRB 3Q00A 4I8GA 3ODFA 1SBWA 1GBTA 2ZDKA 4WVPE 1FNIA 4CRCA 3QGJA 2A4QA 2BDBA 2G81E 3KHVA 1MTNC 4Y0ZE 1EXFA 2ZFRH 2OLGA 3I77A 1FZZA 1UCYE 5CHAC 5DP8A 3V13A 3PTBA 1D6WA 2O8MA 1KLIH 4FUGA 1O3PB 4NA9H 2QXGA 2BDHA 3JZ2B 2JETC 2QXHA 1A0HB 1ESTA 1O3OA 1Y3WA 1GHAF 1C4Y2 3AVZA 1UVOA 1GL1A 3GDVA 4AGJA 1C2IA 1C9TA 1F5LA 3TGKE 3SI4H 2IPHA 1A0LA 1QJ6B 3A81A 1MMJN 1SG8B 1ARBA 2NU2E 3ZZCA 1AY6H 1ACBE 4H6SB 3TH2H 4A6LA 2OQ5A 1C5XB 1B5GH 4I8JA 1HAOH 2GV7A 1BTYA 1GBKA 3BG8A 1UTMA 3P92A 1GJ7B 4NIYA 1O2KA 3PV4A 3QZQA 3SHCH 4E7NA 4JZIA 1O30A 3MU0A 1GBFA 1HPGA 1MKWK 3MU4A 1SFQB 5DP6A 2GCHG 2BY8X 2TPIZ 1BUIA 4K2YA 5GPIB 1GHBF 1TGTA 5K7RA 2A5IA 5EW2H 1GBJA 1FY8E 1JIRA 3W94A 3HK6B 3G01A 1N6YA 1WTGH 1IQHA 3GYLB 2FO9A 2PKSB 4A1XA 3E8LA 4BXWA 4TYDA 5F8TA 4I8HA 3U1JB 3URCA 5EW1H 3ZVEA 1AI8H 1V2TT 1PYTC 4NSYA 2P3UB 3KIDU 3LT3A 4BAMB 1BMAA 1OWDA 3RXJA 4B2AA 4E06H 1QL9A 1RS0A 2ZFPH 1VJAU 4KP0A 1XUJA 1SLXB 1TMUH 1UHBB 1C1TA 7LPRA 4B74A 2FI4E 3LH3A 1WBGB 2Y80A 1E36B 3GY6A 5TCAA 4IN2A 1GI9B 1LPGB 1ZJDA 3SNBA 1YPKH 1E38B 2SGDE 4NZLA 3M5OA 4YOGA 5T3HA 5DKMA 2FDAA 1SL3A 3ZVCA 1NROH 2Z6BD 1K1JA 1Y3VA 1UJ1A 1EPTA 3PO1B 2FM2A 2AIPA 4O9VA 4NA8A 1H8DH 1O5FH 1ELDE 4KTCA 4KGAA 1V6DA 9ESTA 1Y8TA 2XBXA 1UTPA 4AB8A 1YPHC 2HNTF 5GXPA 1MKXK 5EU8A 1C2EA 2D1JA 1GHVH 3RXPA 2BDGA 2F9OA 4YZUA 3TJOA 1AN1E 3OTJE 1ANBA 2FOGA 1ELVA 3KGPA 1XXDA 3PWCA 1A0JA 4WMFA 3UIRA 2OCVB 1NESE 2BD2A 4ZKRU 1J9CH 5GWZA 1GI0A 1Z8IB 1LPZB 3FVFB 1RFNA 5DG6A 4ZXXH 1EP5A 2CHAB 1MCVA 3M7UA 1DS2E 7KMEH 3SU0A 1LMWB 2W3IA 1SOTA 1P11E 3SJKA 3LPRA 2P16A 1HRTH 2CV3A 1C1OA 2ZU3A 2TIOA 4Y7AA 4A7IB 2OP9A 3U1IB 3RMNH 1NFYA 2PUXB 1O39A 2ZDAH 2A2XH 3MO6A 1E35B 4R0IA 4YT6H 1GI1A 1PJPA 1QL7A 1VJ9U 5BPEA 3MH5A 5TCCA 1CT4E 1ESAA 2BHGA 3RM2H 4X6PA 2BDCA 1GG6C 1LPKB 1UTQA 3URDA 1GMDF 3SUFA 3A7XA 1WOFA 3A86A 2CF9H 3K9XB 2Y7ZA 2PKAB 2A5KA 1TNIA 1EJAA 1T8LA 1GI4A 2Y5FA 4Y79A 1QA0A 1THSH 4BTUB 4VGCC 4I31A 4TY6A 2FI3E 4B71A 2BOKA 2G52A 2AGGX 3P17H 1CBWC 4WH6A 3UQVA 2GDEH 5DP3A 3QWCH 1G37A 3ZVGA 1NC6A 1QRZA 1HAZB 1RTKA 3AASA 1TLDA 1O5CB 1O37A 2ZU4A
chains in the Genus database with same CATH superfamily
3DSOA 4IMQA 3E6PH 1YPMH 3T26A 1E1RD 2CN0H 4FXGH 1BJUA 1SGPE 2HVXA 4FETA 4M9FA 2SGEE 1E34B 1BMLA 4OM9A 1PPHE 3AW1A 2JH6D 1D3PB 3MNSA 3RXOA 1NU9A 3IITA 3SV7A 3KYGA 2ANWA 3PV2A 1MUEB 3TK9A 4ZKOU 2O8TA 4BAOB 2ODYB 2PGBB 2ZPSA 1MU8B 4AYYB 1ANCA 1AFQC 1WV7H 1KDQA 3NUMA 3LJOA 1GBCA 1MKWH 1SGCA 1GI6A 1C5SA 2Z9GA 1SC8U 1PPBH 2ZA5A 1ZTJA 2GT8A 3F0OA 1BRBE 1O3JA 1GMCG 3RMMH 4CHAC 5EJLA 1OWEA 3M7QA 2NU3E 3TK5A 3SUEA 1BTHH 3VPKA 5LPFA 3S9BA 1DFPA 1P2NA 1SSXA 1Z71A 2Y81A 2O8WA 4IC6A 1JMOH 1FV9A 1VCPA 2AEIH 1C1VH 1TNLA 4R8TB 5C20A 5DO4H 2A4OA 2THFB 1NBME 3HKIB 3CNRA 1TB6H 3MNBA 2QXJA 3EE7A 3TJVA 5AFZH 1DM4B 2QGRA 1V2WT 1ETRH 4YOIA 3FN8A 3AW0A 1ELEE 2V7QD 3VXFH 4B2CA 4YOJA 8KME2 1MCTA 1GBIA 1QBVH 1D3TB 2G55A 3H7OA 3QK1A 4JMYA 2XBYA 4NZQA 1XKBC 2WPHS 3MFJA 4Z0KA 1SHHB 3MNCA 4UONA 2EI8A 1EB1H 3TGJE 1XVOA 1O3FA 2LP6A 1BTUA 5T6FA 5DGJA 1GDNA 2P3TB 3SU3A 1ELGA 2D26C 4AYVB 3D62A 4Q7ZA 5HGGA 3OY5U 1MKXH 3ZVBA 1O36A 2DUCA 5EQSA 1D3QB 1E0FD 1FUJA 2AH4X 5FBIA 2GT7A 2AGIX 3SGQE 2HALA 2OQUA 3HKJB 1BIOA 2GZ8A 1CA0B 1QRWA 2BMGB 1SFIA 5HMAA 5J4QA 1DSTA 1L1GA 3OEHD 3MO3A 4IGDA 2CF8H 2ODQA 1MTUA 4Q4LA 1O5DH 1MTNB 2BDYA 4H4FA 2P95A 3PRBA 5E2OA 3ODDA 2ZHFH 3SU4A 2PUQH 5CHAB 4FVDA 1YBWA 1ZPBA 1CT0E 1HAVA 4U01A 1GL0E 2C90B 2WPMS 3ZZ5A 4GSOA 2C8WB 1MTVA 1Q3XA 2ANYA 3F9HA 2ZNKH 2OC1A 3MO9A 1ZHMA 2JETB 1GPZA 2RDLA 3VGCC 5HYOA 2ZGHA 1SHYA 4GCHG 1V2PT 1VZQH 3QTVH 1HAGE 5BRRE 4GPGA 1C1WH 1C1NA 2HNTC 2WZQA 4I7YH 3D65E 3HGPA 1K2I1 4ZKNU 1GJ4H 1SGDE 1ZR0A 1MQ6A 5I46H 3TLOA 5C5NA 5C1XA 5DSFA 1Y5AT 1EAUA 1Z7KA 3RXVA 5A8XA 5ESBA 3NCLA 2BXTH 1GI3A 1IQEA 3P8FA 3GY3A 1BJVA 3UPEA 1TX8A 3R3GB 3LJJA 2FX6A 2XWBI 4MQAA 3LC3A 1C5WB 2M2AA 1AB9C 3MHWU 2J34A 5A8YA 3BG4C 1WUNH 2RA0A 2YMSC 2F9NA 5FPTA 1C5VA 4K5ZA 4ZHLU 1Y59T 2BYAX 2ZKSA 4AOQA 3W1EA 4I86A 1YYY1 1AKSB 4JZEH 5JPMH 1MD8A 3A88A 3E91A 3LDXH 4JZFH 3U8RH 3WW7A 2ZGBH 3GOVB 1TGBA 1CT2E 2BLQA 1V2RT 4ZKSU 3SNAA 3SO3A 1BBRE 1NRQH 1OYTH 1SOZA 3ZVDA 1HXEH 1GI2A 1TX7A 2OC0A 2KFWA 3PMHB 1O2OA 3BTWE 2NU0E 1HJ8A 3A7ZA 2PGQB 3IWMA 7GCHG 1S0RA 1TRYA 1UVSH 1O34A 3BEIB 1ZGVA 2NU1E 2Z7FE 3A7WA 2KAIB 1BTPA 4IN1A 2GZ7A 2Z3EA 1QTFA 3LGYA 2ZFFH 1LHCH 2ZIQH 3TJNA 1OP0A 1P2OA 3S9AA 2SNVA 3GCHC 5T1VA 1P2JA 3KN2A 4B2BA 5GIBA 3TNTA 1PYTD 1PQ5A 4FUEA 1C5YB 1GGDC 2BTCE 2FWWA 1EKBB 4UFFH 1INCA 3QZRA 1C5MD 2ANKH 3RXEA 1TPSA 2C4FH 1V2ST 1ETSH 1O2VA 5AVDA 4DVAU 2HWLB 1E1QD 2R9PA 3GY4A 1HAHH 1GJ6A 3SU2A 4HTCH 1CHGA 4Z6AH 1Q2WA 1ZMNA 2IOTA 1UO6A 1YKTA 1TPOA 4Y8YA 3P8GA 1P57B 3KYFA 1BZXE 3MTYA 2H9HA 1BOQA 2UUJB 5F03A 1TNKA 3OTPA 2ZCLP 1S82A 1JWTA 1YF4A 6CHAC 5KEDA 3A8BA 3FP7E 2G5VA 3KQDA 3S0NA 4CBOA 2BD4A 1P2QA 2AERH 1MTWA 1SLWB 4A1TA 1IQGA 1K9OE 1SGTA 2ASUB 3RXMA 2J94A 4CRBA 2JJ1D 1O2XA 3M5NA 1FX0B 1EZXC 4X6OA 3UUZA 1GG6B 3EA7A 1RRKA 2G00A 2ZQ2A 1NRPH 3DUXH 1C1UH 4AFUA 3SNEA 2PLXA 3RXSA 2A7CA 3EE0B 3H09A 1JXPA 1HIAA 2J2UA 1EJMA 1N8OC 2L74A 2QV1A 3OX7U 2HLCA 4VGCB 2STBE 3ZYDA 1KYNA 1THRH 1BHXF 1CBWB 1RTFB 1P01A 3SU6A 1ELBA 1YLNA 5CMXH 4CR9A 1C2GA 1O3MA 2ESTE 2VVUA 3C27B 4NIVA 1EQ9A 5G4BA 1FMGA 3KNXA 3AAUA 1C2DA 4KKDA 1F0UA 1A4WH 1H9LB 4H42U 2CK3D 2FEQH 3KQ5A 2WUBA 2A32A 3BTTE 2IJD1 1PQ7A 2GJGA 1DY9A 1EUFA 8LPRA 1KSNA 4X8SH 4D9QA 1HBTH 1J16A 5I25A 3V0XA 3A83A 1VITG 3RM0H 2AFQB 2ZEBA 2FOFA 2XC4A 1AU8A 4DT7B 3M5LA 3SBKA 3TNSA 1GMHG 4BANB 2ZFTA 1A1RA 5C0TA 2QXIA 1C2KA 2PSXA 3M3TA 3F9FA 1QL8A 1VGCB 4OGXA 1YPLH 4MPXA 4K3JA 4NFEA 1NS3A 5EJ1A 1COWD 3U28C 4D8NA 2ZU5A 3IG6B 4JZDH 1P06A 5ETXA 2KAIA 3A7TA 1HFDA 2XOKD 2OC7A 3K6YA 4FUHA 4NWLA 1AWHB 1PPEE 2A7JA 2W5EA 1MZDA 4OS1A 1L4DA 2KM0A 5C5OA 3B23B 3BIUH 2RDEA 4X8VH 4JYVH 2J97A 1O2GH 2FOCA 2QYIA 3VB5A 2BDIA 3F0PA 1C5RA 2QE7D 3PTNA 5IK2D 3GY2A 2XXLA 3RU4T 5GCHG 4ABHA 2AMQA 2WHXA 5EODA 1O2WA 1W14U 4TY7A 2GDDA 4HFPB 1DY8A 2CJIA 1SQAA 1SGFG 3SV9A 1Y3YA 1J14A 3DSGA 4X8UH 1GDUA 5C17A 4FUBA 1YPHE 5E8EH 1Z6EA 1PPCE 2L6OA 5A0BA 1RIWB 3T27A 4IMZA 1D3DB 1O2RA 2BD3A 1OKXA 2B9LA 2JH5D 7GCHF 2AMPA 4JK5A 1P03A 5J4SA 1OS8A 1K1MA 1GBMA 1QJ1B 2FX4A 4WJG2 2EY4C 1BRCE 1C5TA 1KXFA 2UWPA 3O8CA 1Y3XA 2TGPZ 1KDQB 1BTXA 1A5IA 1UVUH 2O9QA 1GHYH 2PTCE 3MNXA 5FHTA 3U98H 2ZO3H 2VWNA 1IQMA 1GJ8B 3UWJH 1G3CA 1LO6A 4Y11E 2VVVA 1O2IA 1KXEA 3LGTA 6ESTA 2Q6DA 2XW9A 1LVMA 5JB9S 1GHWH 1PPZA 3BTQE 4TPIZ 1CU1A 1ID5H 2Z3DA 3SZEA 3RU4D 3UFAA 2TGTA 3DFLA 1O3EA 1ZTLA 2FODA 4OS4A 3RXDA 3VGCB 4ACBA 4AORA 4DW2U 3DCLA 5JBBS 4BTTB 2HPPH 4ASHA 4AN7A 1H4WA 3ELAH 2C3SA 2J98A 4UDWH 1C1QA 1GJCB 2HPQH 3EAJA 2G8TA 1K21H 4XDEA 4U30A 1JBUH 4Q7YA 3SV2H 2VH6A 2CGAA 3OAAD 1XVMA 1UK3A 2FS9A 5EXMA 1AIXH 1QA7A 2GCTC 4DY7B 3V7TA 4MNYA 4RKJB 2BY5X 3GDUA 2K1QA 2ZU2A 3VG8A 2SNWA 3L3TA 1S6HA 5TJXA 3SGAE 5GJ4B 1NO9H 3QX5H 1ZHPA 4LOYH 4X2VA 3MMGA 4P02A 3PWBA 1V2OT 1YC0A 3GS9A 2FYRA 3I78A 3KEEA 4PROA 5C67A 1T7CA 1AB9B 1ZPCA 4K69A 1EAXA 1S83A 3BG4B 2W7UA 1AWFH 1SGNE 2YMSB 3E16B 3RXLA 1RD3B 1P2KA 1V3XA 4Y10E 4NGAH 3ATIA 1LCYA 1GBHA 1G36A 2V0BA 1PPGE 3TPIZ 4XOJA 1O5AB 2H9TH 5DP7A 3RXRA 1YPJH 2QCYA 3E1XB 2WPIS 3F2GA 2A4RA 2XCNA 2V35A 1GJAB 3SGBE 2A45B 2VVCA 3SV8A 1QQUA 3M37A 4JK6A 1YPGH 1PQ8A 2Y7XA 4ABDA 1HAVB 2R3YA 2FS8A 2XYAA 1GVZA 1LKBA 2G4TA 3LIWA 3NRLA 3V3MA 1S6FA 3ATMA 3A8CA 3OSYA 1F0TA 1DOJA 5EXNA 2YMSD 2XBVA 1UK2A 3BTGE 2QF4A 4U32A 1AFEH 2ZFQH 3O8BA 3SJOA 2QF5A 2R3UA 1P9SA 2C8ZB 4ZH8A 3GCHB 2QAAA 3CP7A 1EB2A 1L4ZA 4NIXA 3O8RA 2BQWB 2ZWLH 5FX6A 1F7ZA 1KXCA 1O3HA 1YCPK 1CHOG 1K1PA 1GGDB 2B7DH 2F4LA 1G3DA 3F9GA 4NIWA 1C4V2 1P04A 3DHKH 1LTOA 4J2YB 3RLYH 4JYUH 2ZDLA 4ZXYH 1A5GH 2ZTZA 1V2MT 3STIA 2EA3A 1GJBB 3BTHE 2J38A 1HXFH 1YLDA 1N6XA 4JZ1A 5AFYH 3L6PA 3B9FH 4CRGA 5F6MA 2P8OC 1OWHA 4MNXA 4Y6DA 3RXFA 1K28D 2GV6A 4XFQA 4X6NA 1QGFA 3P6ZB 3U69H 1DE7H 1OXGA 2XBWA 4CH2B 6CHAB 1K1LA 1K1OA 1O3NA 5PTPA 2WV5A 3MU1A 4D9RA 1TGSZ 3ATKA 1KTTB 3RU4E 4BNRA 1FDPA 3M61U 3MOCA 5FPSA 3ZVAA 3BEUA 1BMNH 2BM2A 3VB6A 1F92A 5F8ZA 4ESTE 2ZFSA 4Q80A 1HGTH 3AAVA 1IQIA 1FAKH 4BAKB 1NRNH 2GCHF 1MD7A 1CA8B 3MU8A 2B0FA 4Y0YE 3T5FH 1EP6A 2Z94A 1S84A 4GUXA 4DOQA 2B8OH 4X1SU 2YNBA 3E0NB 1C1MA 3PV5A 1P8VC 2BZAA 3M3SA 1F0SA 2ZC9H 3PLBA 4B75A 4X1QU 1AVGH 4NSVA 2VB0A 2PP6A 1KTSB 2UWOA 1G3BA 1O3IA 1DWDH 3L33A 4MDSA 3PMBB 1P02A 4WWYA 2O8UA 1FI8A 1F0RA 4GVUA 2FLRH 3Q3YA 1EAIA 3PM3A 4AGKA 2QY0B 1ZJKA 3OU0A 1HAPH 3WY8A 1H8HD 5L30H 1HJAC 3SNDA 3T62A 2BX4A 4X1NU 4BTIB 2HNTE 1G9IE 1J17T 4AZ2B 2RG3A 1TONA 1DICA 1SB1H 3SQEE 4RKOB 4CRAA 1ABJH 4I8LA 1H9HE 5FBEA 2J4IA 1AUTC 2KCYA 2Z9LA 5A2MH 1TQ7B 3BV9B 1O2SA 2PTNA 1WCZA 2P94A 1FJSA 4ABIA 3ZZ3A 5EXLA 3TJUA 3FAOA 2F9UA 4FU9A 1O3LA 2BQ6B 4FOUC 1S5SA 1BT7A 5E0HA 5IDKA 1O2TA 4MPWA 3Q3KA 2PHBA 5FXLA 1H8ED 2SGFE 3RXQA 4HG6A 2QF0A 5H4IB 2KCOA 3UNSA 2AGEX 4RN6A 3T28A 3FP8E 4RSPA 1QNJA 2ULLA 1ZMJA 2WUCA 1O5GH 2VIDA 4AG2A 4XBBA 2Y82A 1O2JA 3NK8A 3S9CA 1TPPA 1Z8GA 2ZTYA 1Z1IA 4CRDA 1ZSJA 1C2FA 4DIHH 4CRFA 2A0QB 2VGCC 4BAQB 1EAWA 1TPAE 2OXSA 3LGIA 1AZ8A 1C4U2 1HIAB 1IHSH 2BDAA 2FESH 2TBSA 1C5LH 2H6MA 3PO1C 1SGIB 3FZDA 1TFXA 1SLVB 3DA9B 1IQNA 2H1UA 2QIQA 2ZCKP 1ELAA 3LU9B 2KZ4A 1CGHA 3KF2A 3U8OH 1DANH 3Q77A 1SGEE 3HPTB 1RTLA 1W3CA 3OYPA 3AK5A 2C8XB 1K22H 1L1JA 1FY3A 2CMYA 5ESTE 1C9PA 1QBOA 3STJA 1VCWA 1ZRKA 5LH8A 3GICB 1FONA 2JIZD 3QLPH 1YCPH 1P2IA 2Y6TA 1O5EH 1UW7A 4D7GA 1YLCA 1GHAG 9LPRA 4INHA 4AC9A 2ZPQA 4AFZA 1ANDA 2LPRA 2V3MA 2H5CA 1N1LA 2Q6FA 3ZZDA 2AYWA 2PWXA 2Q1JA 2A7HA 4TWYA 5C1YA 4A92A 1TGCA 3RMLH 5JDUB 1OWJA 1ZZZA 5E0GA 4Q2KA 1FY4A 3LOXA 1MAXA 1O3BA 1MABB 1O2PA 3M5MA 1NFXA 1CO7E 4J1YA 3FANA 2BX3A 4K1SA 8GCHG 1CHOF 2UUYA 3KQCA 2GD4B 3SORA 3SI3H 6LPRA 2Z9IA 3T29A 1NT1A 2TGDA 2BY6X 2EEKA 3TU7H 3A82A 4ZAEA 3ZZAA 2ALVA 2BY7X 2ZI2H 1A7SA 2XC0A 2HGTH 3D49H 2W3KA 3ZZ4A 1BB0B 4XBCA 1CQQA 2P59A 1DPOA 4GHQA 4ZHMU 1W12U 3CENA 5F8XA 3JZ1B 1SI5H 1HYLA 1NRSH 2I6SA 2VH0A 3QUMP 1O3GA 3E0PB 5A8ZA 1C2HA 1ZHRA 1CVWH 5HIZA 4B6FA 3UNRA 1AHTH 1ZMLA 4AB9A 4F49A 1GMCF 2ZCHP 1GHXH 1GJ5H 2GCTB 4UE7H 3RXGA 4ABEA 1EX3A 2FXRA 3SHAH 4ABFA 2XTTB 4UFGH 2VWLA 2H9EH 3PRDA 4YESB 1ORFA 1O2QA 4QT8C 3MI4A 4CREA 2Y5GA 1NZQH 2SGQE 1QY6A 5LPEA 3V12A 1T8NA 2ODPA 8ESTE 2YOLA 2J92A 5SGAE 2RA3A 3ATLA 1AO5A 2BY9X 1UTJA 3MWIU 1SR5C 1PPFE 1V2UT 2M5TA 4Y8XA 4HGCA 3A8DA 5EQQA 3P70B 4DG4A 1QJ7B 3GISB 1O32A 3GCNA 3SYJA 1UCYK 2AS9A 2BLVA 2ZDNA 3BTDE 2Z9JA 2FPZA 2XC5A 1AE5A 4YLQH 3A87A 1XX9A 1W0KD 2G4UA 1XUHA 4MNVA 5L6NH 3RXTA 1C2JA 1P2MA 4UD9H 1FLEE 1QQ4A 4ISLA 5K0HA 1MAYA 2ZGCA 1DLKB 1OX1A 3HATH 1WQSA 4Y7BA 2VNTA 1DDJA 1GBAA 1FIZA 1MBQA 4ZCNA 5DK1A 2BD9A 1BHXB 1P09A 3BTME 4B76A 2F91A 3TITA 3F9EA 2WV4A 2BB4A 4DGJA 3TH4H 2J98B 2NWNA 1AZZA 1HV7A 4B6EA 1W8BH 4FVBA 1WQVH 1T8MA 1G2MA 3H5CB 1LHGH 1F2SE 1OYQA 2ZECA 3ZVFA 1TOCB 1GCDA 1YP9A 2OBOA 3VB3A 1W0ZU 1SMFE 3F68H 1O35A 1KXBA 3A7VA 1T32A 2C8YB 1AFQB 2BLOA 4ISOA 3SNCA 1OWKA 3RXBA 3EA8A 1MBMA 5L2ZH 2P8OB 1MU6B 4GCHF 4A1VA 1TA6A 5FCRA 1SQRA 1RJXB 2A2QH 2ZU1A 3LONA 1THPB 1VKYA 4CHAB 3ZYEA 1TQ0B 1NM6A 3W95A 1QZ8A 1JOUB 1GBEA 4XD7D 4U2WA 1YWUA 3UAIC 3GCTG 4AFQA 3BTKE 2XRCA 1LHEH 2BVSH 3TVJB 4FUCA 1W2KH 1JRSA 1MZAA 4O3TA 4GLYA 1W13U 2WSSD 4O03A 1DUEA 2RCEA 1NFUA 1ZSLA 1LKAA 5AHGH 1QFKH 1A61H 4WXVA 4F55A 2GKVE 2AHME 6GCHG 1CGJE 5EQRA 3ESTA 5HXFA 3LH1A 2B5TB 2FLBH 1HJ9A 1EASA 2W26A 4CR5A 1TBQH 1O2HA 2P3FH 1B0EA 2V3HH 1HCGA 1C5QA 1NPMA 1TOMH 3UNQA 3F1SB 5A0AE 1E37B 2VWOA 3FFGA 3R0FA 1ELTA 1O3CA 1TYNA 2BD8A 3T2NA 1FAXA 2FOHA 3BIVH 2FOEA 1OHHD 1Y3UA 2BLWA 4ZMAH 1O0DH 4FU8A 1HJAB 1PFXC 3LC5A 4X1RU 1LVOA 1FXYA 1O3AA 1Y5BT 8GCHF 1NY22 1S81A 1ABIH 2W7SA 1P10A 2VJ1A 2YNAA 4RT1A 2IPQX 2D8WA 5DP4A 2G5NA 2BZ6H 1FPCH 3DT0H 1KIGH 1O31A 1XMNB 2ZHEH 3S7KB 1D9IA 1AQ7A 2BD7A 4MLFB 1FY5A 1P0SH 3BEFB 5AF9H 3QGNB 1KLJH 1P3EA 1UTKA 1Z8JB 2KX4A 2AIQA 2P93A 4IBLH 3LGVA 1S85A 3EA9A 4TPYA 2GZ9A 3MH4A 4Y8ZA 2V6NA 3HGNA 3F3BA 5CE1A 2GX4A 4SGAE 1ELCA 5HM9A 1W10U 1IQFA 4MPUA 4CBNA 1UCYH 1O5BB 2JDID 3VB4A 1U6QA 4YT7H 1EZSC 2G51A 2BD5A 1DWEH 1AVWA 1NRRH 2VGCB 3MYWA 1BMMH 1SGQE 4ABAA 1IQLA 2F9VA 3UY9A 3E3TA 3D23A 4ABGA 4FUFA 1H9IE 5T6GA 1GJ9B 1XKAC 1G30B 1XUGA 1UK4A 1KMHB 2Z9KA 4Q7XA 2OTVA 4Y71A 5A09A 5KECA 1D4PB 5EPYA 2EI6A 1V2KT 5DP5A 3SOSA 1DITH 1GBBA 4X2XA 1UVPA 1ZPZA 3GY8A 2H2ZA 4UFDH 4F4OC 5JBTA 1C2LA 1IQJA 1O38A 3NPSA 3VB7A 1GI5A 2O8LA 4KTUA 2HOBA 2F3CE 1IAUA 1M9UA 1TNGA 3MQKC 1EOLA 1HAXB 2OD3B 2EI7A 4X2WA 1KLTA 5EJZA 1G3EA 4CH8B 3S7HB 4OS7A 1O3DA 3HK3B 3GY7A 4DURA 4TWWA 1AGJA 2FIRH 1TA2A 3DSPA 3EYDA 1GCTC 4H6TA 2H5DA 1TBZH 2ZPRA 4GHTA 1X7AC 1LQEA 3SU1A 1WTHD 3RC6A 1P3CA 2VINA 4D76A 1H1BA 3SJ8A 3QN7A 1S6LA 1V2NT 2D2DA 4NWKA 1SQTA 3N7DA 3Q3XA 1ESBA 1GHZA 1LVYA 2VIWA 2ZZUH 4XBDA 1C1SA 1KXDA 2BVRH 1XXFA 2SGAA 1VITF 2KCAA 1DLEA 3PLPA 4ISIH 3RMOH 1GDQA 1QB9A 1T31A 2GP9B 5CHBA 1L2EA 3SZNA 1WAYB 3RXAA 3N99A 1GMHF 1AUJA 4YXWD 1C5ZB 5DN6D 3MU5A 1XUIA 1YGCH 1W0JD 2QN5T 2A5AA 1QB6A 4I32A 3TIUA 3UOPA 1AE8H 1ANEA 1ETTH 2FP7B 1JRTA 1EPTC 1XUFA 4ASUD 4DJZB 2Y5HA 3ZZ7A 3QO6A 3GCTF 4LK4A 4F48B 2OINA 3S69A 1XUKA 2KR7A 3RXCA 4OGYA 1HDTH 5L2YH 2WYGA 4MPVA 2ZHDA 4B1TA 5C2ZA 1BQYA 4XSKU 1T4VH 1GI8B 2GVFA 1EATA 2UUFB 4YLUA 2HLDD 3PMAB 4RT0A 2VIOA 1TMBH 3EDXB 3SUGA 2UWLA 4JCNA 2RFKC 4WMDA 1DX5M 1YM0A 1DWBH 1XM1A 3M36A 3UWIA 1BITA 6GCHF 2GMTC 4HZHA 4INLA 2PW8H 2J9NA 2J95A 3M7TA 3ZZBA 1IQKA 2Z3CA 3OY6U 4D7FA 2V3OH 1UHBA 5DP9A 2EC9H 1TNJA 4NFFA 3PB1E 3ZZ9A 2VU8E 2R0KA 5GCHF 2A1DB 1O2MA 1UTLM 2WPLS 2HVYB 1VGCC 4BXSA 5B6LA 5EG4A 2A31A 1AVXA 1SGYE 4Y76A 1HNEE 1TABE 4X0WU 3GCOA 1N8OB 1J8AA 4DIIH 3ZV9A 3SQHE 1K0HA 1KY9A 3FKSD 3ITIA 3UR9A 5HIYA 1CGIE 4AFSA 2FI5E 2R2MB 1EJNA 3ZIAD 3LKWA 5LPRA 4I8KA 3Q76A 1SLUB 3F6UH 1L0ZA 3BTEE 1K1NA 2KCPA 3UQOA 1K1IA 2ZHWH 2ZDVH 1RXPA 4K8BA 2PR3A 5E0JA 4THNH 2ZF0H 5FX5A 1A3EH 2ALPA 2GTBA 1KXAA 1G2LA 1ZGIA 2AMDA 1TNHA 3C1KA 1C5UA 1O2LA 5JB8S 1GI7B 4O3UA 3NWUA 1O2UA 2STAE 1TBRH 4ZHAA 5JYIA 1CSOE 5CDFE 1Z6JH 4MG3A 1L1NA 3PLKA 4UFEH 1WYKA 3A84A 3M3VA 4JYTA 3T25A 4INKA 3MH7A 3K6ZA 5DPAA 3UTUH 1O3KA 3BN9A 4AX9H 2FZZA 4ABJA 1V2JT 3NZIA 1C5PA 1A5HA 2XCFA 5GNDA 2PKSC 1IHTH 1DUAA 1HUTH 1LQDB 1QCPA 1RIWC 1BBRK 1ZRBA 1UTNA 2DE9A 5B6OA 1OWIA 4ISHH 2F9PA 1OP2A 1LHDH 3RC5A 2WPKS 5DJ7A 2W6JD 1LDTT 1WU1A 1T8OA 4ACAA 4X6MA 1JIMA 2PKAA 4TSFD 1V2VT 1J15A 4B73A 1S0QA 4FU7A 1OP8A 1ZSKA 1TMTH 1EZQA 4A5TS 4K1EA 3ZV8A 2WPJS 2FTMA 3B8JA 2WINI 4OS5A 2LELA 2F83A 4UEHH 3RDZA 4Z1MD 4MVNA 3GY5A 1A2CH 1EZUC 1QBNA 1C1PA 1VCQA 3I29A 4M7GA 1P12E 3DD2H 4WY3A 3K65B 4KELA 1DT2A 1YY3A 2C93B 2R0LA 2TRMA 2BQ7B 4K8YA 4NA7A 1NFWA 2VWMA 4WXIA 3FP6E 1W0YH 2TGAA 1W7XH 3ENSB 4P00A 3TH3H 4LZ4B 1C2MA 3RXKA 2ZDMA 3FO8D 1YCPM 5JBCS 4O97A 2I6QA 2ZG0H 3WWBA 1F5RA 2PFEA 4BAHB 1FY1A 1BRUP 3RXHA 4WF8A 2ANMH 1DXWA 4X8TH 2GGVB 5FPYA 3RLWH 1T4UH 4ISNA 1DSUA 4IC5A 3U9AH 2PSYA 2PV9B 2QC2A 2EQNA 5C0UA 1A46H 1D6RA 1Z8RA 2FMJA 1GBLA 2CHAC 5FAHA 7ESTE 5LGOA 3KQEA 5IYTA 3TK6A 4FUIA 5C1UA 5GDSH 1UVTH 2ZGXH 1BTWA 1UMAH 1TAWA 3OEED 5EIYA 3O8DA 1O2ZA 1NU7B 3PYHA 3ATWA 1GBDA 3RUOA 1GVLA 2FYQA 3K2UA 5ABWA 3LGWA 3NXPA 5F53A 1SGFA 2WYJA 3LGUA 3ZZ6A 1DWCH 3GYMA 3BSQA 1A3BH 2W6ID 1TGNA 5C3NA 4MTBA 1YPEH 4FUDA 3E90B 3QDZB 3UREA 1UTOA 3GDSA 3P95A 5E2PA 3UR6A 1GHBG 3VFEA 1HLTH 2OBQA 3OFND 1QIXB 1C5OH 5FCKA 3N7OA 4WH8A 1TX6A 3A80A 4ZROA 2LNCA 2ZTXA 2QF3A 3MH6A 4E7RG 1PQAA 1Z1JA 2IJOB 3QTOH 1MTSA 3EQ0H 3PMJA 4OS2A 1MH0A 3SU5A 1TRMA 3A89A 1V2QT 1B0FA 5EGMA 5JBAS 3A7YA 4Q63A 3KCGH 2XNIA 2ZQ1A 2JKHA 1G32B 2FTLE 4XRNA 5FL7D 2DE8A 2IN2A 1TALA 3TGIE 3SUDA 4WMEA 3NKKA 4KTSA 1AMHA 1Y5UT 3SW2B 1GJDB 1QRXA 2ZHQH 3H7TA 1LVBA 4YO9A 4HI3A 1P05A 1VITH 1ZYOA 1BA8B 1IOEA 3KL6A 4DT4A 1C5NH 1LHFH 3SV6A 1DXPA 2VIPA 4LZ1H 1O2NA 2XWAA 2OUAA 2VIVA 1FQ3A 3N7EA 2F9BH 3SJIA 1SQOA 1O33A 1H8IH 1SPJA 3A8AA 1GCTB 1P9UA 2NU4E 1FN6A 3RXIA 1O2YA 1TIOA 4YTAA 1W11U 2BXUH 5EPNA 1AD8H 4IW4E 1HB0B 4X2YA 4YM9A 1BTZA 1TE0A 2SGPE 3BF6H 3PROA 5HM2A 1C1RA 1QB1A 4LXBH 1ZTKA 2FOMB 3A85A 1Q31A 2HRVA 4ABBA 2ZGJA 1FN8A 1BBRH 3U8TH 3FZZA 5A0CA 4ZUHA 4AG1A 1QURH 1F5KU 1EOJA 3ZZ8A 4K1TA 4XE4A 3RXUA 4NCYA 3SN8A 1MQ5A 1NN6A 1ZLRA 4BOHA 4NG9H 1V2LT 2A4GA 1QR3E 3CS0A 1FPHH 1HAYB 1NTPA 3RC4A 3VXEH 1ZOMA 4FUJA 2Q6GA 1OPHB 5HKKD 3CS7A 1SGRE 1W7GH 2FOBA 2R2WU 2UUKB 3P8OA 1BRAA 1TWXB 2VIQA 1OSSA 2VBCA 1EPTB 2ILNA 2OC8A 3RP2A 3UOUA 3VEQB 3M35A 1GWAA 2BVXH 1BDAA 1OOKB 1GMDG 2QA9E 4I33A 4MNWA 2CXVA 4X1PU 1GVKB 2ZP0H 4DCDA 1SKYE 5EOKA 3BTFE 4E05H 2BOHB 1ARCA 2FOAA 1B7XB 1RGQA 1WSSH 3DFJA 1CE5A 4GAWA 4OS6A 4IS5A 3P8NA 4K60A 1ELFA 4TT3D 3SJ9A 4SGBE 1DVAH 2JH0D 1CA0C 3EGKH 3F2FA 1AKSA 3KQBA 5T6DA 1SVPA 5KGOA 1BCUH 1HAIH 1FIWA 1TRNA 1VR1H 2SFAA 2GMTB 1QHRB 3Q00A 4I8GA 3ODFA 1SBWA 1GBTA 2ZDKA 4WVPE 1FNIA 4CRCA 3QGJA 2A4QA 2BDBA 2G81E 3KHVA 2K0QA 1MTNC 4Y0ZE 3UB0A 1EXFA 2ZFRH 2OLGA 3I77A 1FZZA 1UCYE 5CHAC 5DP8A 3V13A 3PTBA 1D6WA 2O8MA 1KLIH 4FUGA 1O3PB 2WPDD 4NA9H 2QXGA 2BDHA 3JZ2B 2JETC 2QXHA 1A0HB 1ESTA 1O3OA 1Y3WA 1GHAF 1C4Y2 3AVZA 1UVOA 1GL1A 3GDVA 4AGJA 1C2IA 1C9TA 1F5LA 3TGKE 3SI4H 2IPHA 1A0LA 1QJ6B 3A81A 1MMJN 1SG8B 1ARBA 2NU2E 3ZZCA 1AY6H 1ACBE 4H6SB 3TH2H 4A6LA 2OQ5A 2JJ2D 1C5XB 1B5GH 4I8JA 1HAOH 2GV7A 1BTYA 1GBKA 3BG8A 1UTMA 3P92A 1GJ7B 1BMFD 4NIYA 1O2KA 3PV4A 3QZQA 3SHCH 4E7NA 4JZIA 1O30A 3MU0A 1GBFA 1HPGA 1MKWK 3MU4A 1SFQB 5DP6A 2GCHG 2BY8X 2TPIZ 1BUIA 3OE7D 4K2YA 5GPIB 1GHBF 1TGTA 5K7RA 2A5IA 5EW2H 1GBJA 1FY8E 1JIRA 3W94A 3HK6B 3G01A 1N6YA 1WTGH 1IQHA 3GYLB 2FO9A 2PKSB 4A1XA 3E8LA 4BXWA 4TYDA 2K8IA 5F8TA 4I8HA 3U1JB 2OK5A 3URCA 5EW1H 3ZVEA 1AI8H 1V2TT 1PYTC 4NSYA 2P3UB 3KIDU 3LT3A 4RI0A 1BMAA 1OWDA 3RXJA 4B2AA 4BAMB 4E06H 1QL9A 1RS0A 2ZFPH 1VJAU 4KP0A 1XUJA 1SLXB 1TMUH 1UHBB 1C1TA 7LPRA 4B74A 2FI4E 3LH3A 1WBGB 3FOAA 3WWFA 2Y80A 1E36B 3GY6A 2XNDD 5TCAA 4IN2A 1GI9B 1LPGB 1ZJDA 3SNBA 1YPKH 1E38B 2SGDE 4NZLA 3M5OA 4YOGA 5T3HA 5DKMA 2FDAA 1SL3A 3ZVCA 1NROH 2Z6BD 1K1JA 1Y3VA 1UJ1A 1EPTA 3PO1B 2FM2A 2AIPA 4O9VA 4NA8A 1H8DH 1O5FH 1ELDE 4KTCA 4KGAA 1V6DA 9ESTA 1Y8TA 2XBXA 1UTPA 4AB8A 1YPHC 1NBMD 2HNTF 5GXPA 1EFRD 1MKXK 5EU8A 1C2EA 2D1JA 1GHVH 3RXPA 2BDGA 2F9OA 3F2HA 4YZUA 1AN1E 3TJOA 3OTJE 1WDIA 1ANBA 2FOGA 1ELVA 3KGPA 1XXDA 3PWCA 1A0JA 4WMFA 3UIRA 2OCVB 1NESE 2BD2A 4ZKRU 1J9CH 5GWZA 1GI0A 1Z8IB 1LPZB 3FVFB 1WXRA 1RFNA 5DG6A 4ZXXH 2F43B 1EP5A 2CHAB 1MCVA 3M7UA 1DS2E 7KMEH 3SU0A 1LMWB 2W3IA 1SOTA 1P11E 3SJKA 3LPRA 2P16A 1HRTH 2CV3A 1C1OA 2ZU3A 2TIOA 4Y7AA 4A7IB 2OP9A 3U1IB 3RMNH 1NFYA 2PUXB 1O39A 2ZDAH 2A2XH 3MO6A 1E35B 4R0IA 4YT6H 1GI1A 1PJPA 1QL7A 1VJ9U 5BPEA 3MH5A 1E79D 5TCCA 1CT4E 1ESAA 2BHGA 3RM2H 4X6PA 2BDCA 2WV9A 1GG6C 1LPKB 1UTQA 3URDA 1GMDF 3SUFA 3A7XA 1WOFA 5C94A 3A86A 2CF9H 3K9XB 2Y7ZA 2PKAB 2A5KA 1TNIA 1EJAA 1T8LA 1GI4A 2Y5FA 4Y79A 1QA0A 1THSH 4BTUB 4VGCC 4I31A 4TY6A 2FI3E 4B71A 2BOKA 2G52A 2AGGX 3P17H 1CBWC 4WH6A 3UQVA 2GDEH 5DP3A 3QWCH 1G37A 3ZVGA 1NC6A 1QRZA 1HAZB 1RTKA 3AASA 1TLDA 2J5UA 1O5CB 1O37A 2ZU4A
chains in the Genus database with same CATH topology
4IMQA 3E6PH 1YPMH 3T26A 2CN0H 4FXGH 1BJUA 1SGPE 2HVXA 2SGEE 1E34B 1BMLA 1PPHE 3AW1A 2JH6D 1D3PB 3MNSA 3RXOA 1NU9A 3IITA 3SV7A 2ANWA 3TK9A 1MUEB 4ZKOU 2O8TA 4BAOB 2ODYB 2PGBB 2ZPSA 1MU8B 4AYYB 1ANCA 1AFQC 1WV7H 1KDQA 3NUMA 3LJOA 1GBCA 1MKWH 1SGCA 1GI6A 1C5SA 2Z9GA 1SC8U 1PPBH 2ZA5A 1ZTJA 2GT8A 1BRBE 1O3JA 1GMCG 3RMMH 4CHAC 1OWEA 3M7QA 2NU3E 3TK5A 3SUEA 1BTHH 3VPKA 5LPFA 3S9BA 1DFPA 1P2NA 1SSXA 1Z71A 2Y81A 2O8WA 4IC6A 1JMOH 1FV9A 1VCPA 2AEIH 1C1VH 1TNLA 4R8TB 5C20A 5DO4H 2A4OA 2THFB 3HKIB 1TB6H 3MNBA 2QXJA 3TJVA 5AFZH 1DM4B 2QGRA 1V2WT 1ETRH 4YOIA 3AW0A 1ELEE 4YOJA 3VXFH 4B2CA 8KME2 1MCTA 1GBIA 1QBVH 1D3TB 2G55A 3H7OA 3QK1A 4JMYA 2XBYA 4NZQA 1XKBC 2WPHS 3MFJA 4Z0KA 1SHHB 3MNCA 4UONA 2EI8A 1EB1H 3TGJE 1XVOA 1O3FA 1BTUA 5T6FA 5DGJA 1GDNA 2P3TB 3SU3A 1ELGA 2D26C 4AYVB 3D62A 4Q7ZA 5HGGA 3OY5U 1MKXH 3ZVBA 1O36A 2DUCA 5EQSA 1D3QB 1E0FD 1FUJA 2AH4X 5FBIA 2GT7A 2AGIX 3SGQE 2HALA 2OQUA 3HKJB 1BIOA 2GZ8A 1CA0B 1QRWA 2BMGB 1SFIA 5HMAA 5J4QA 1DSTA 1L1GA 3MO3A 4IGDA 2CF8H 2ODQA 1MTUA 1O5DH 1MTNB 2BDYA 4H4FA 2P95A 5E2OA 3ODDA 2ZHFH 3SU4A 2PUQH 5CHAB 4FVDA 1YBWA 1ZPBA 1CT0E 1HAVA 4U01A 1GL0E 2C90B 2WPMS 3ZZ5A 4GSOA 2C8WB 1MTVA 1Q3XA 2ANYA 3F9HA 2ZNKH 2OC1A 3MO9A 1ZHMA 2JETB 1GPZA 2RDLA 3VGCC 5HYOA 2ZGHA 1SHYA 4GCHG 1V2PT 1VZQH 3QTVH 1HAGE 5BRRE 4GPGA 1C1WH 1C1NA 2HNTC 4I7YH 3D65E 3HGPA 1K2I1 4ZKNU 1GJ4H 1SGDE 1ZR0A 1MQ6A 5I46H 3TLOA 5C5NA 5C1XA 1Y5AT 1EAUA 1Z7KA 3RXVA 5A8XA 5ESBA 3NCLA 2BXTH 1GI3A 1IQEA 3P8FA 3GY3A 1BJVA 3UPEA 1TX8A 3R3GB 3LJJA 2FX6A 2XWBI 4MQAA 3LC3A 1C5WB 1AB9C 3MHWU 2J34A 5A8YA 3BG4C 1WUNH 2RA0A 2F9NA 5FPTA 1C5VA 4K5ZA 4ZHLU 1Y59T 2BYAX 2ZKSA 4AOQA 1YYY1 1AKSB 4JZEH 5JPMH 1MD8A 3A88A 3E91A 3LDXH 4JZFH 3U8RH 2ZGBH 3GOVB 1TGBA 1CT2E 2BLQA 1V2RT 4ZKSU 3SNAA 3SO3A 1BBRE 1NRQH 1OYTH 1SOZA 3ZVDA 1HXEH 1GI2A 1TX7A 2OC0A 3PMHB 1O2OA 3BTWE 2NU0E 1HJ8A 3A7ZA 2PGQB 3IWMA 7GCHG 1S0RA 1TRYA 1UVSH 1O34A 3BEIB 1ZGVA 2NU1E 2Z7FE 3A7WA 2KAIB 1BTPA 4IN1A 2GZ7A 2Z3EA 1QTFA 3LGYA 2ZFFH 1LHCH 2ZIQH 3TJNA 1OP0A 1P2OA 3S9AA 2SNVA 3GCHC 1P2JA 3KN2A 4B2BA 5GIBA 3TNTA 1PYTD 1PQ5A 4FUEA 1C5YB 1GGDC 2BTCE 2FWWA 1EKBB 4UFFH 1INCA 3QZRA 1C5MD 2ANKH 3RXEA 1TPSA 2C4FH 1V2ST 1ETSH 1O2VA 5AVDA 4DVAU 2HWLB 2R9PA 3GY4A 1HAHH 1GJ6A 3SU2A 4HTCH 1CHGA 4Z6AH 1Q2WA 1ZMNA 2IOTA 1UO6A 1YKTA 1TPOA 4Y8YA 3P8GA 1P57B 1BZXE 3MTYA 2H9HA 1BOQA 2UUJB 5F03A 1TNKA 2ZCLP 1S82A 1JWTA 1YF4A 6CHAC 3A8BA 3FP7E 2G5VA 3KQDA 3S0NA 4CBOA 2BD4A 1P2QA 2AERH 1MTWA 1SLWB 4A1TA 1IQGA 1K9OE 1SGTA 2ASUB 3RXMA 2J94A 4CRBA 1O2XA 3M5NA 1EZXC 4X6OA 3UUZA 1GG6B 3EA7A 1RRKA 2G00A 2ZQ2A 1NRPH 3DUXH 1C1UH 4AFUA 3SNEA 2PLXA 3RXSA 2A7CA 3EE0B 1JXPA 1HIAA 2J2UA 1EJMA 1N8OC 2QV1A 3OX7U 2HLCA 4VGCB 2STBE 3ZYDA 1KYNA 1THRH 1BHXF 1CBWB 1RTFB 1P01A 3SU6A 1ELBA 5CMXH 4CR9A 1C2GA 1O3MA 2ESTE 2VVUA 3C27B 4NIVA 1EQ9A 5G4BA 1FMGA 3KNXA 3AAUA 1C2DA 4KKDA 1F0UA 1A4WH 1H9LB 4H42U 2FEQH 2WUBA 2A32A 3BTTE 1PQ7A 1DY9A 1EUFA 8LPRA 1KSNA 4X8SH 4D9QA 1HBTH 1J16A 5I25A 3V0XA 3A83A 1VITG 3RM0H 2AFQB 2ZEBA 2FOFA 2XC4A 1AU8A 3M5LA 3SBKA 3TNSA 1GMHG 4BANB 2ZFTA 1A1RA 2QXIA 1C2KA 2PSXA 3M3TA 3F9FA 1QL8A 1VGCB 4OGXA 1YPLH 4MPXA 4K3JA 4NFEA 1NS3A 4D8NA 2ZU5A 3IG6B 4JZDH 1P06A 5ETXA 2KAIA 3A7TA 1HFDA 2OC7A 3K6YA 4FUHA 4NWLA 1AWHB 1PPEE 2A7JA 2W5EA 1MZDA 4OS1A 1L4DA 5C5OA 3B23B 3BIUH 4X8VH 4JYVH 1O2GH 2FOCA 2QYIA 3VB5A 2BDIA 1C5RA 3PTNA 3GY2A 2XXLA 3RU4T 5GCHG 4ABHA 2AMQA 5EODA 1O2WA 1W14U 4TY7A 2GDDA 4HFPB 1DY8A 2CJIA 1SQAA 1SGFG 3SV9A 1Y3YA 1J14A 4X8UH 1GDUA 4FUBA 1YPHE 5E8EH 1Z6EA 1PPCE 5A0BA 1RIWB 3T27A 4IMZA 1D3DB 1O2RA 2BD3A 1OKXA 2B9LA 2JH5D 7GCHF 2AMPA 4JK5A 1P03A 5J4SA 1OS8A 1K1MA 1GBMA 1QJ1B 2FX4A 4WJG2 1BRCE 1C5TA 1KXFA 2UWPA 3O8CA 1Y3XA 2TGPZ 1KDQB 1BTXA 1A5IA 1UVUH 2O9QA 1GHYH 2PTCE 3MNXA 5FHTA 3U98H 2ZO3H 2VWNA 1IQMA 1GJ8B 3UWJH 1G3CA 1LO6A 4Y11E 2VVVA 1O2IA 1KXEA 3LGTA 6ESTA 2Q6DA 2XW9A 1LVMA 5JB9S 1GHWH 1PPZA 3BTQE 4TPIZ 1CU1A 1ID5H 2Z3DA 3UFAA 3RU4D 2TGTA 3DFLA 1O3EA 1ZTLA 2FODA 4OS4A 3RXDA 3VGCB 4AORA 4DW2U 5JBBS 4BTTB 2HPPH 4ASHA 4AN7A 1H4WA 3ELAH 2C3SA 4UDWH 1C1QA 1GJCB 2HPQH 3EAJA 2G8TA 1K21H 4XDEA 4U30A 1JBUH 4Q7YA 3SV2H 2VH6A 2CGAA 1XVMA 1UK3A 2FS9A 5EXMA 1AIXH 1QA7A 2GCTC 4DY7B 3V7TA 4MNYA 4RKJB 2BY5X 3GDUA 2K1QA 2ZU2A 2SNWA 3L3TA 1S6HA 5TJXA 3SGAE 5GJ4B 1NO9H 3QX5H 1ZHPA 4LOYH 4X2VA 3MMGA 3PWBA 1V2OT 1YC0A 2FYRA 3I78A 3KEEA 4PROA 5C67A 1T7CA 1AB9B 1ZPCA 4K69A 1EAXA 1S83A 3BG4B 2W7UA 1AWFH 1SGNE 3E16B 3RXLA 1RD3B 1P2KA 1V3XA 4Y10E 4NGAH 3ATIA 1LCYA 1GBHA 1G36A 2V0BA 1PPGE 3TPIZ 4XOJA 1O5AB 2H9TH 5DP7A 3RXRA 1YPJH 2QCYA 3E1XB 2WPIS 2A4RA 2XCNA 2V35A 1GJAB 3SGBE 2A45B 2VVCA 3SV8A 1QQUA 3M37A 4JK6A 1YPGH 1PQ8A 2Y7XA 4ABDA 1HAVB 2R3YA 2FS8A 2XYAA 1GVZA 1LKBA 2G4TA 3LIWA 3V3MA 1S6FA 3ATMA 3A8CA 3OSYA 1F0TA 1DOJA 5EXNA 2XBVA 1UK2A 3BTGE 4U32A 1AFEH 2ZFQH 3O8BA 3SJOA 2R3UA 1P9SA 2C8ZB 4ZH8A 3GCHB 2QAAA 3CP7A 1EB2A 1L4ZA 4NIXA 3O8RA 2BQWB 2ZWLH 5FX6A 1F7ZA 1KXCA 1O3HA 1YCPK 1CHOG 1K1PA 1GGDB 2B7DH 1G3DA 3F9GA 4NIWA 1C4V2 1P04A 3DHKH 1LTOA 4J2YB 3RLYH 4JYUH 2ZDLA 4ZXYH 1A5GH 2ZTZA 1V2MT 3STIA 2EA3A 1GJBB 3BTHE 2J38A 1HXFH 1YLDA 1N6XA 4JZ1A 5AFYH 3L6PA 3B9FH 4CRGA 5F6MA 2P8OC 1OWHA 4MNXA 4Y6DA 3RXFA 1K28D 2GV6A 4XFQA 4X6NA 1QGFA 3P6ZB 3U69H 1DE7H 1OXGA 2XBWA 4CH2B 6CHAB 1K1LA 1K1OA 1O3NA 5PTPA 2WV5A 3MU1A 4D9RA 1TGSZ 3ATKA 1KTTB 3RU4E 4BNRA 1FDPA 3M61U 3MOCA 5FPSA 3ZVAA 3BEUA 1BMNH 2BM2A 3VB6A 1F92A 5F8ZA 4ESTE 2ZFSA 4Q80A 1HGTH 3AAVA 1IQIA 1FAKH 4BAKB 1NRNH 2GCHF 1MD7A 1CA8B 3MU8A 2B0FA 4Y0YE 3T5FH 1EP6A 2Z94A 1S84A 4GUXA 4DOQA 2B8OH 4X1SU 2YNBA 3E0NB 1C1MA 1P8VC 2BZAA 3M3SA 1F0SA 2ZC9H 3PLBA 4B75A 4X1QU 1AVGH 4NSVA 2VB0A 1KTSB 2UWOA 1G3BA 1O3IA 1DWDH 3L33A 4MDSA 3PMBB 1P02A 4WWYA 2O8UA 1FI8A 1F0RA 4GVUA 2FLRH 3Q3YA 1EAIA 3PM3A 4AGKA 2QY0B 1ZJKA 3OU0A 1HAPH 3WY8A 5L30H 1HJAC 3SNDA 3T62A 2BX4A 4X1NU 4BTIB 2HNTE 1G9IE 1J17T 4AZ2B 2RG3A 1TONA 1DICA 1SB1H 3SQEE 4RKOB 4CRAA 1ABJH 4I8LA 1H9HE 5FBEA 2J4IA 1AUTC 2Z9LA 5A2MH 1TQ7B 3BV9B 1O2SA 2PTNA 1WCZA 2P94A 1FJSA 4ABIA 3ZZ3A 5EXLA 3TJUA 3FAOA 2F9UA 4FU9A 1O3LA 2BQ6B 1S5SA 1BT7A 5E0HA 5IDKA 1O2TA 4MPWA 3Q3KA 2PHBA 5FXLA 3RXQA 2SGFE 2QF0A 5H4IB 3UNSA 2AGEX 4RN6A 3T28A 3FP8E 4RSPA 1QNJA 2ULLA 1ZMJA 2WUCA 1O5GH 2VIDA 4AG2A 4XBBA 2Y82A 1O2JA 3NK8A 3S9CA 1TPPA 1Z8GA 2ZTYA 1Z1IA 4CRDA 1ZSJA 1C2FA 4DIHH 4CRFA 2A0QB 2VGCC 4BAQB 1EAWA 1TPAE 2OXSA 3LGIA 1AZ8A 1C4U2 1HIAB 1IHSH 2BDAA 2FESH 2TBSA 1C5LH 2H6MA 3PO1C 1SGIB 3FZDA 1TFXA 1SLVB 3DA9B 1IQNA 2H1UA 2QIQA 2ZCKP 1ELAA 3LU9B 1CGHA 3KF2A 3U8OH 1DANH 3Q77A 1SGEE 3HPTB 1RTLA 1W3CA 3OYPA 2C8XB 1K22H 1L1JA 1FY3A 2CMYA 5ESTE 1C9PA 1QBOA 3STJA 1VCWA 1ZRKA 5LH8A 3GICB 1FONA 3QLPH 1YCPH 1P2IA 2Y6TA 1O5EH 4D7GA 1YLCA 1GHAG 9LPRA 4INHA 2ZPQA 4AFZA 1ANDA 2LPRA 2H5CA 1N1LA 2Q6FA 3ZZDA 2AYWA 2PWXA 2Q1JA 2A7HA 4TWYA 5C1YA 4A92A 1TGCA 3RMLH 5JDUB 1OWJA 1ZZZA 5E0GA 4Q2KA 1FY4A 3LOXA 1MAXA 1O3BA 1O2PA 3M5MA 1NFXA 1CO7E 4J1YA 3FANA 2BX3A 4K1SA 8GCHG 1CHOF 2UUYA 3KQCA 2GD4B 3SORA 3SI3H 6LPRA 2Z9IA 3T29A 1NT1A 2TGDA 2BY6X 2EEKA 3TU7H 3A82A 4ZAEA 3ZZAA 2ALVA 2BY7X 2ZI2H 1A7SA 2XC0A 2HGTH 3D49H 2W3KA 3ZZ4A 1BB0B 4XBCA 1CQQA 2P59A 1DPOA 4GHQA 4ZHMU 1W12U 3CENA 5F8XA 3JZ1B 1SI5H 1HYLA 1NRSH 2I6SA 2VH0A 3QUMP 1O3GA 3E0PB 5A8ZA 1C2HA 1ZHRA 1CVWH 3UNRA 1AHTH 1ZMLA 4AB9A 4F49A 1GMCF 2ZCHP 1GHXH 1GJ5H 2GCTB 4UE7H 3RXGA 4ABEA 1EX3A 2FXRA 3SHAH 4ABFA 2XTTB 4UFGH 2VWLA 2H9EH 4YESB 1ORFA 1O2QA 4QT8C 3MI4A 4CREA 2Y5GA 1NZQH 2SGQE 1QY6A 5LPEA 3V12A 1T8NA 2ODPA 8ESTE 2YOLA 2J92A 5SGAE 2RA3A 3ATLA 1AO5A 2BY9X 1UTJA 3MWIU 1SR5C 1PPFE 1V2UT 2M5TA 4Y8XA 4HGCA 3A8DA 5EQQA 3P70B 4DG4A 1QJ7B 3GISB 1O32A 3GCNA 1UCYK 2AS9A 2BLVA 2ZDNA 3BTDE 2Z9JA 2FPZA 2XC5A 1AE5A 4YLQH 3A87A 1XX9A 2G4UA 1XUHA 4MNVA 5L6NH 3RXTA 1C2JA 1P2MA 4UD9H 1FLEE 1QQ4A 4ISLA 5K0HA 1MAYA 2ZGCA 1DLKB 1OX1A 3HATH 1WQSA 4Y7BA 2VNTA 1DDJA 1GBAA 1FIZA 1MBQA 5DK1A 2BD9A 1BHXB 1P09A 3BTME 4B76A 2F91A 3TITA 3F9EA 2WV4A 2BB4A 4DGJA