1ZYOA

Crystal structure of the serine protease domain of sesbania mosaic virus polyprotein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
184
Chain Sequence
SFYSPVKAGDEPASLVAIKSGPTTIGFGCRTKIEDCLLTAHHVWCNSMRPTGLAKAGKQVSVEDWEISMSSSDKMLDFAIVRVPTHVWSKLGVKSTPLVCPSSKDVITCYGGSSSDCLMSGVGSSSTSEFTWKLTHTCPTAAGWSGTPLYSSRGVVGMHVGFEEIGKLNRGVNMFYVANYLLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine protease
publication title Crystal structure of the serine protease domain of Sesbania mosaic virus polyprotein and mutational analysis of residues forming the S1-binding pocket
pubmed doi rcsb
source organism Sesbania mosaic virus
molecule tags Hydrolase
total genus 40
structure length 184
sequence length 186
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02122 Peptidase_S39 Peptidase S39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA02
2PTCE 3RXOA 4GLYA 4Q7XA 3D62A 5E2OA 3S9AA 2BD3A 1LVBA 2J4IA 3PM3A 4WH6A 2BLWA 2OXSA 2GCTB 4IN2A 1C5MD 2FLRH 1GCDA 2WYJA 3PV4A 4AGJA 4FU8A 1SFIA 1GJ7B 1PPGE 5HM2A 1ELBA 3SZNA 1JIMA 2F3CE 2HALA 1AFQB 2Z94A 1P8VC 2FP7B 1EJNA 5E0GA 1ELGA 1C2LA 2AMPA 1QIXB 2TIOA 1ZGIA 1MZDA 2BZAA 2Y5GA 2SNVA 1HIAB 3RM2H 1C1SA 1LPKB 1NM6A 2G5NA 5LGOA 2Y5HA 2WYGA 3PWCA 3TU7H 3HPTB 1UTNA 1MKXH 4YO9A 3BTQE 1Z8GA 1A4WH 5IYTA 1ZR0A 3FZDA 5LPRA 4K2YA 3SV9A 1BQYA 1J16A 1UTOA 2J94A 2Y6TA 1EUFA 1F2SE 1YF4A 3KQCA 1A46H 5C20A 4D76A 3GISB 1FJSA 2ZFQH 1L4ZA 1FI8A 2Q6FA 4KTSA 4D9QA 4DURA 4YESB 4NSVA 3PLPA 1PQ8A 1WU1A 2HNTC 1TRMA 3MHWU 1C5SA 1GMDG 3O8DA 3H5CB 1GHBF 3QWCH 1BRCE 1GVKB 4X1SU 5CHAB 2ODYB 1TE0A 1TNIA 1MUEB 1P2JA 2QN5T 1TPOA 2ZEBA 2LPRA 2QC2A 3F9FA 1FMGA 6LPRA 3A7XA 3GCTF 2VIOA 1HAYB 1YC0A 3HK3B 3DHKH 3TNTA 1GVZA 5DP8A 1FIZA 4TPYA 8LPRA 1MKWK 1BHXF 1VCWA 4FVBA 2ESTE 3UQVA 1LQDB 1ZTKA 1OX1A 3P8NA 3L6PA 2PW8H 4OS6A 3T28A 1ZRBA 1O34A 1G9IE 3FP7E 4MDSA 5ESBA 1AWFH 1YPGH 3P92A 1C5XB 1BUIA 1O3GA 4ZXXH 1F5RA 2ZGCA 1O2SA 2FTMA 2G55A 5FXLA 4ABBA 3RXTA 1ELCA 1KXCA 3E1XB 4CR5A 1S82A 2BDYA 1T8NA 3UUZA 1GBLA 3LIWA 2CF8H 1DICA 1FY1A 1BMAA 2D2DA 1V3XA 1GMHF 1JBUH 3A85A 4X0WU 5C1YA 1SBWA 1THRH 1ESBA 3UOPA 2WUCA 2ZHEH 1C2EA 4I8KA 4LXBH 2A2QH 2H5CA 4TYDA 1YPHC 6ESTA 4IW4E 1O5CB 3AW1A 1YLDA 3SNBA 1J9CH 1P9SA 4XDEA 1P3EA 4Q80A 2TGAA 3LGWA 2OQ5A 4F49A 1AB9C 1FAXA 2KAIB 3P8OA 1VJ9U 1XM1A 1ESAA 1QFKH 2HLCA 1LHEH 1XUIA 1DWBH 2P8OC 3EE0B 4AZ2B 2FI4E 1Z6EA 4FU7A 1GBDA 3A7ZA 1C1UH 3ZZ7A 1H8DH 5B6OA 3U1JB 1S81A 3ZZ8A 1YPJH 4FUHA 3MH6A 1BTUA 2R9PA 1SOZA 4MVNA 4Y0YE 2GZ7A 2FO9A 2ZFPH 1O30A 1UJ1A 2JETB 3MU1A 3EGKH 3A86A 2EI8A 1DX5M 3C1KA 4Y10E 2B0FA 3K65B 3KGPA 1XUKA 4ZROA 4Z0KA 3T25A 2Z9JA 1GDUA 3DA9B 3O8CA 3SGAE 2RG3A 4DCDA 3SGQE 3QX5H 1UTKA 4J2YB 4X6NA 1IHTH 2FOAA 1MBMA 5C1XA 1YPHE 1QCPA 2AH4X 4HI3A 4MPVA 1A0JA 2ULLA 4E7RG 2GMTB 1QR3E 3MO6A 3V7TA 2F9BH 1SI5H 5GPIB 1W13U 3M37A 2C93B 2NU1E 1WYKA 4D9RA 5C2ZA 1G3BA 4GCHG 4OS2A 1ZHMA 2C8YB 4JK5A 4AFQA 5ESTE 3MH4A 5C5OA 5JDUB 1PPHE 5ETXA 1ANBA 4XBCA 1QY6A 2VIPA 5C5NA 2HPQH 2ZQ1A 4FUCA 1FDPA 1O2QA 4BXWA 5I25A 1XKAC 3UREA 1FLEE 5A0BA 1GL0E 1ID5H 1AVWA 2FM2A 1GJ8B 3RMNH 3L33A 1IQIA 1AB9B 1WBGB 2W26A 1BTYA 2CV3A 2Z9GA 4K69A 4MPXA 1FN6A 1KDQA 4X2VA 3MI4A 2C4FH 1ZTJA 4AG1A 2ZGHA 1OXGA 2QAAA 3VPKA 1MU8B 1MMJN 3LPRA 1GI0A 1RS0A 2P8OB 2BXUH 1ZPBA 2BOHB 1ANDA 1OP0A 1P2MA 1HAOH 1CHGA 1ANCA 2OC7A 1GG6C 2A5KA 5FCRA 2TGDA 2FI3E 1L2EA 4Q2KA 5EQQA 5DGJA 4Y8YA 3T26A 1A3EH 4TY6A 1GHAF 3BV9B 3SJ9A 1CBWC 4UD9H 1LVYA 1GJ9B 5EPYA 5DP6A 4Y7BA 5EODA 1TLDA 3A88A 3UWJH 4NWKA 4INLA 1GWAA 1C5NH 4O3TA 1V2MT 2FS8A 1BTXA 3UNQA 5EGMA 3JZ2B 2XWBI 3D65E 1QB9A 4IMQA 3PMJA 2RDLA 3SU1A 1EAXA 4NA7A 2UUJB 2YNAA 1LHDH 4MQAA 4DJZB 1MD7A 3HKJB 1T8LA 3LGIA 3A8CA 1SHYA 1SFQB 1YCPK 3RXDA 4OGYA 3QDZB 1SGFA 3Q00A 1VZQH 2SGQE 4HGCA 1E0FD 2FWWA 1GJ4H 1THPB 1AE5A 3A7VA 3KL6A 1P57B 4UDWH 3ZZDA 3RXQA 1EAIA 3TLOA 1BDAA 2XBWA 3FAOA 3RXFA 1EOLA 2FIRH 3GYMA 1O31A 1TPSA 4ZKNU 3A83A 2STAE 2UWLA 2STBE 2OBQA 1FPHH 1V2QT 3VB6A 2O8LA 1UCYH 1G3CA 1W0ZU 3SV6A 1KXDA 1TABE 1TGSZ 1QB6A 3V13A 1ACBE 1H9LB 1O3FA 1TNHA 3SORA 1LDTT 3RXCA 3S9BA 1ANEA 3SNCA 3HGNA 1E35B 1ZJDA 5A8XA 1K1OA 2PKAB 2LNCA 2Q1JA 4H42U 1IQHA 2XW9A 3FP8E 3TK6A 3GCHC 3K6YA 5BRRE 1GG6B 1OP8A 4RKJB 3P8GA 5GWZA 4ZHLU 2BQWB 2UUKB 1A0LA 2FOHA 2ZG0H 2ZFRH 5FX6A 1O3PB 1G36A 1CBWB 2G4UA 2GT8A 3SNEA 2ZU4A 2ILNA 3SU4A 4B71A 1MH0A 3A8DA 1TRNA 1GJCB 1VCPA 3RXLA 1Y3WA 3STIA 1AIXH 1YYY1 4GUXA 1SL3A 1EZSC 1C4U2 1TNJA 3MU0A 1ZYOA 2GVFA 3CENA 1NO9H 1VITG 2WPJS 1TBQH 4WXVA 1V2LT 3SUFA 4DGJA 4NSYA 1K1IA 1WTGH 5DP3A 4FU9A 1MQ6A 1Z1IA 2ANMH 6GCHG 4TWWA 4ZMAH 3KHVA 5TJXA 1FY5A 1F0TA 2BDIA 3S7HB 1FY4A 2HNTF 3K9XB 2BD8A 3TH2H 1CA0B 3U8OH 3QZQA 3BEIB 1O2PA 3ZZ5A 3BTEE 3RU4D 2XRCA 2BDBA 2ZGBH 3TK5A 4ABAA 3H7OA 1F92A 1BRAA 1HPGA 1V2WT 4ISIH 4TY7A 2O8TA 1S6FA 1EPTC 7LPRA 2BY7X 5A8YA 1HAVA 1AD8H 4K8BA 2ZGJA 1PPFE 3B8JA 1GDNA 2VU8E 3UR9A 3MH5A 1EASA 1LHFH 4H6SB 3TH3H 1BMMH 1BHXB 1TFXA 3RXGA 2ZFSA 2AEIH 2VB0A 2P59A 2SGFE 1HAPH 1B0FA 2XC4A 1GL1A 1H9HE 4A6LA 3KQDA 3O8RA 4UFDH 3P70B 1HAGE 5GJ4B 4I8LA 2BD2A 4DIIH 4X8TH 2F83A 3KQEA 2Z3CA 3EA7A 1K9OE 3SU2A 4XE4A 2A2XH 2QXGA 3Q3KA 1F5KU 1GJBB 1V2PT 2VH0A 5TCAA 3RMMH 2AGGX 1IHSH 2BVSH 2FOFA 1S0QA 4CRGA 2QF0A 3QO6A 2C8ZB 1WOFA 4CHAB 2A32A 1W14U 4QT8C 1RFNA 1SG8B 4ZKOU 2OUAA 1ETSH 3FZZA 1DANH 5EW2H 1DWCH 3E91A 1AZZA 3KQBA 1EAWA 2HVXA 5HYOA 3E0PB 1ESTA 5AFZH 1O3EA 1QJ7B 2QY0B 2QCYA 1SGRE 4FVDA 4AGKA 3A84A 5EQSA 3QGJA 1L0ZA 1XXFA 1RXPA 2ZDLA 3UNSA 4IMZA 1GI9B 1AE8H 4Y76A 1C5TA 3K2UA 3PO1C 2BXTH 3ATLA 1OS8A 1NTPA 1EPTB 2AERH 1Y3UA 1O3HA 1WUNH 1SQAA 2ZTYA 3U1IB 9LPRA 3N7OA 1K22H 3F9EA 4VGCC 5DJ7A 3HK6B 4YZUA 4A5TS 1MTNC 5EQRA 1F0UA 4AYVB 1YPMH 2FYRA 1V2NT 1Q2WA 1ABJH 1XX9A 1P2IA 4X6PA 1KXBA 1LVOA 3RXAA 3SU0A 1NN6A 4DT7B 3ZVFA 1BBRK 1C5PA 2OTVA 1BRUP 4OS1A 1N6YA 1GHBG 1O2TA 1MBQA 3VEQB 4NZLA 2FZZA 4H6TA 1RTLA 1GBTA 4WY3A 4FUJA 1D3QB 1WV7H 3M5MA 1QTFA 1QJ6B 1IQGA 3GCTG 2Y7ZA 3SOSA 1Y3XA 4INKA 2FEQH 1GBJA 1O5BB 1A5IA 1W3CA 1TWXB 3RXSA 2A4RA 2HRVA 2V6NA 1FQ3A 2BTCE 4X8UH 2PV9B 1T31A 3F68H 1HB0B 1RD3B 3RC6A 1AN1E 2QGRA 2C8XB 4IBLH 3BTFE 1D4PB 2PWXA 2Z7FE 3VB5A 2ANYA 2PFEA 3SW2B 4K1SA 2BDAA 2WPHS 3NXPA 1FZZA 1GHYH 1QL7A 1C2GA 4BOHA 1LPZB 2GCHF 1UHBB 2BLQA 4NA8A 1BOQA 2BLOA 2EA3A 2VVVA 2A4OA 2H6MA 1GHVH 1V2RT 2AIPA 1OSSA 1SLXB 2OCVB 2XBXA 3BTWE 1W7GH 2GZ9A 1GGDC 2VIDA 1G32B 1TNLA 3TNSA 2HPPH 4GAWA 1QRWA 1BT7A 8KME2 1C2FA 2BX3A 2ZC9H 1NPMA 3UOUA 4VGCB 4ABDA 3SV8A 1MTNB 1GMHG 1MTSA 1AO5A 3UTUH 2FESH 4IN1A 2XCFA 1C1NA 1E34B 1SLWB 2BY8X 1O2OA 4Z6AH 1WQSA 3SU3A 4Y0ZE 3UY9A 3QTOH 1XVMA 2SFAA 2GV6A 3TGIE 1HCGA 2J95A 1HNEE 3P6ZB 1SGEE 3W94A 1AZ8A 1HXEH 1C5LH 3NKKA 3QLPH 2ZIQH 3M3SA 2PUQH 1A7SA 1P01A 2CF9H 1OWDA 1TX6A 3MNXA 3OY5U 1ZMLA 1SQTA 3GOVB 2PKSC 4UFEH 2FOBA 3KNXA 2J34A 1TQ7B 1DLKB 3CS7A 3SJIA 1J14A 3TVJB 1P9UA 1BMNH 2HWLB 2VVUA 2F9PA 1XUGA 1C1QA 1YGCH 2G8TA 2V3OH 2FOEA 1N1LA 3EA9A 3ITIA 1O2LA 3RXVA 2FLBH 3U9AH 3QK1A 2PUXB 4Y8ZA 2BLVA 2FODA 3RLWH 5E2PA 3ZVBA 1F0SA 1UVSH 3NK8A 4FUBA 4BNRA 2EC9H 4X1NU 4KELA 2VJ1A 3RXKA 4AX9H 4X1QU 1G37A 2ZA5A 4NIVA 2K1QA 4IGDA 2UUYA 3KCGH 4YLUA 1B5GH 1E38B 1WSSH 1GGDB 1QA7A 4AFZA 3AW0A 3A82A 1FY8E 3O8BA 3ZVCA 1Y59T 3T27A 1IAUA 3DFJA 3DT0H 1OWJA 3BG8A 1G30B 4TPIZ 1ABIH 2PGQB 2HOBA 2P93A 1O3CA 1P09A 3MH7A 1ORFA 1HAIH 3F9GA 3RU4T 1TA6A 2AMQA 3ATIA 1K1MA 3VB4A 4R0IA 5EXNA 5T6GA 3NWUA 4ZXYH 1WAYB 1G3EA 1O3BA 1TMUH 1KLJH 2HNTE 1YBWA 1SMFE 2B9LA 1OKXA 3ZZ9A 4K60A 2ZF0H 5A0AE 2TGTA 3BTME 2QXHA 2PGBB 3U98H 1PYTC 3GY3A 1O3LA 2PKSB 1O2UA 4ISHH 2AS9A 1PYTD 2BVXH 2Q6GA 3ODFA 2SGDE 1HJ9A 1X7AC 2XXLA 1PPCE 4LOYH 3ZZAA 1CE5A 2OP9A 5F03A 1EP6A 2A31A 1C4V2 4FUIA 1J8AA 1UK4A 3A7YA 1EJAA 1CO7E 1GHAG 2GT7A 1BMLA 5JYIA 1Z7KA 2WV5A 5FBEA 1V2UT 1K1JA 1TB6H 3BEFB 1KIGH 1YLCA 2BDCA 2J2UA 1O3DA 2ALPA 1BTZA 4B74A 1OYQA 1SHHB 2D1JA 1ZJKA 4MLFB 3LJJA 2WPMS 2BY6X 1ZPCA 5HMAA 3T29A 4DOQA 5L2YH 1Z71A 1KXEA 1O0DH 4K1TA 4HTCH 2IPHA 2VINA 4ZH8A 4WMFA 2P3FH 3SUGA 4Q7ZA 2BM2A 1XUFA 1ZHRA 1HFDA 2CN0H 1C1OA 2F9VA 1GCTC 3EDXB 1AGJA 3MFJA 1HAXB 1GBBA 2CHAC 3M61U 1K21H 2VWLA 1XXDA 1O2MA 3MU4A 3LH1A 5JB9S 1P2KA 4GHTA 5FPYA 5SGAE 1VCQA 4D8NA 4I8JA 1DT2A 1YPLH 4ESTE 2DUCA 5C67A 4ZKSU 2BY9X 3M7UA 1PQ7A 3V0XA 3KEEA 4ABHA 2UUFB 2VNTA 2TBSA 2ZCKP 1K1PA 8GCHG 3I78A 2GTBA 3QGNB 1HUTH 2ANWA 1O2HA 4MNYA 2D26C 3QZRA 4DIHH 3FANA 1W11U 1HGTH 3SNDA 1NS3A 1UVUH 1BCUH 5GDSH 1A61H 2F9NA 5BPEA 1TPPA 4B73A 1JRTA 1INCA 1K2I1 2GZ8A 1N8OC 1MZAA 4JYUH 1KYNA 1ZRKA 3LDXH 4XOJA 3SNAA 1YKTA 1BA8B 3QN7A 4GPGA 4NIXA 2XTTB 3A8AA 3TITA 4UFFH 5I46H 1DFPA 3PTNA 3R0FA 1EXFA 1L1GA 2OQUA 4Y79A 1AI8H 2KAIA 1IQFA 5EPNA 2ZU5A 3GCNA 2HGTH 2ALVA 3OTJE 2CXVA 3MO3A 3SQEE 4ABGA 1MU6B 1P05A 1Z8JB 2THFB 1WQVH 1XKBC 1BIOA 1SGTA 2XBYA 4I32A 1EB2A 3M5LA 2VWNA 4X6MA 2BD4A 2Y82A 1AFEH 3GCOA 3RXUA 3F6UH 2NWNA 3UR6A 1CHOF 3L3TA 2FX4A 1PJPA 1ELVA 1GI4A 1MTUA 1DDJA 7KMEH 2NU3E 1J17T 3E16B 3GY5A 1YM0A 5JB8S 2H9TH 2QF3A 1ZSKA 1RTFB 4NIWA 3LT3A 2SGEE 2AMDA 2I6SA 1KXAA 2AIQA 5F6MA 2VVCA 3GDUA 1TGNA 2ZPQA 4MG3A 3OYPA 2BDHA 2XNIA 1PPBH 2ODPA 2VH6A 1NRPH 1SGFG 4NA9H 2C90B 2Y5FA 1TOMH 2W3KA 3UPEA 1N8OB 4X1PU 3ZZBA 1IOEA 1SB1H 3SHCH 2YOLA 8GCHF 3Q3YA 1KXFA 3S9CA 1FXYA 3A7TA 3E0NB 1BTPA 4UONA 5A2MH 2AGIX 4E05H 4JZFH 3Q77A 1NC6A 1WTHD 2TPIZ 2OD3B 2ZWLH 1Z8RA 2H2ZA 3SHAH 4WWYA 1H1BA 1KY9A 4X2WA 4ZHAA 1OWIA 2AGEX 4ZHMU 2FOCA 2Z3DA 3SUDA 5TCCA 3RXJA 3EYDA 1C1RA 1TNKA 4PROA 3SI3H 7ESTE 1BJUA 1S0RA 1AUTC 1EB1H 1P06A 2NU0E 1AKSB 4KP0A 1YCPM 1TRYA 1DPOA 4WF8A 1V2ST 1CGIE 2WINI 1D6WA 1EKBB 1CGJE 2ZCLP 1JOUB 2A7HA 4JZIA 2AYWA 2FI5E 2BVRH 1TGTA 1O2KA 3GYLB 1NU9A 3M36A 2GV7A 1GI1A 5L30H 3A80A 4JMYA 3FFGA 1MD8A 2QIQA 1JXPA 1MTVA 3UQOA 2A0QB 4BANB 2A5IA 2RA3A 2JH5D 2ZKSA 1GI7B 5A0CA 1HBTH 1GI5A 1YPKH 3NUMA 1SGYE 4CRFA 3M7QA 1NRNH 1KTSB 3ENSB 5HM9A 3LGYA 1W2KH 5F8TA 3URDA 1UVTH 1QGFA 4KGAA 2XWAA 4X8VH 1O39A 3DUXH 3V3MA 4CRDA 3U8RH 1SR5C 1HV7A 1CT0E 1VGCC 4U32A 2ZDNA 3ZYEA 1UTLM 3MU5A 2PLXA 1P02A 1SPJA 3MOCA 3SO3A 1Y3VA 1DE7H 1XVOA 4I33A 4WXIA 3TJVA 3GCHB 3ESTA 4MPWA 4A1TA 1LCYA 1GI2A 5FAHA 2GCHG 3KN2A 1MKXK 2GDEH 1Z8IB 4JYVH 3SU5A 4F4OC 1OWHA 3TGJE 4MNXA 3RU4E 1HJAC 1O3IA 1Q3XA 2PKAA 3R3GB 4CRBA 3BTHE 1A1RA 1O33A 1W8BH 2PSXA 5FBIA 2QXIA 1SLUB 1C5UA 2PHBA 4AOQA 5FHTA 3BG4C 5DKMA 2FTLE 1GVLA 1C2HA 3VXFH 1IQLA 1O2NA 2BYAX 3BSQA 1NRRH 3KIDU 4IC6A 5H4IB 3PROA 1AU8A 1G2MA 1TBZH 4RSPA 1Z6JH 2ZPRA 1OWKA 2ZP0H 2ODQA 1UO6A 3MNSA 4RN6A 5L6NH 1S83A 4BAKB 3OY6U 3MTYA 2QA9E 5EXMA 4CRAA 4AB9A 3SBKA 2TGPZ 1JIRA 1AWHB 2SGPE 1ZZZA 1P0SH 2VGCC 2WV4A 3K6ZA 1TAWA 2H9HA 1ZOMA 1FIWA 1GHWH 4B2BA 5CMXH 2FPZA 2V3HH 1C1TA 2O8WA 4THNH 4U30A 1GMCF 2B7DH 2QV1A 2ZO3H 1VGCB 1O36A 1A2CH 4Y71A 3ZYDA 3T2NA 2Y80A 2ZCHP 4BTTB 1C2IA 1FNIA 3SU6A 1UVPA 1F0RA 3A7WA 1SSXA 1OWEA 2R3YA 3E8LA 3MYWA 2Y7XA 1C5VA 1HRTH 2P94A 3F9HA 1SGPE 2ZHWH 1MCTA 4YM9A 5K7RA 5JPMH 2VWMA 3ZZCA 3ATKA 3I29A 1O2YA 1HAZB 3FP6E 4ZAEA 3GY2A 3BG4B 1TA2A 6CHAC 3LU9B 1RGQA 4FUGA 3RMOH 2C3SA 2BZ6H 5DPAA 5J4SA 4ABFA 5AVDA 4CBNA 4AYYB 1PQAA 4E06H 4ISNA 3LONA 2CGAA 3H7TA 4K1EA 1O2RA 2W7UA 1AMHA 1CA8B 1DWDH 3RXEA 2FOMB 3PO1B 2C8WB 3M7TA 4U2WA 4B1TA 4X1RU 5G4BA 3HATH 3RXPA 1YP9A 5JBCS 2VGCB 3QTVH 1EOJA 1NESE 1QB1A 2GKVE 1IQNA 3S7KB 4E7NA 4NCYA 1QL8A 1C2MA 1DWEH 3S69A 1N6XA 3A87A 1DY9A 1D3PB 3CS0A 5GCHF 1YPEH 3GDVA 3ZVDA 1GJAB 3UIRA 1AVGH 3LGVA 4NFEA 3UWIA 1LPGB 1EPTA 2BY5X 2ZFFH 1RTKA 1QBOA 2F91A 4A92A 3PLKA 1AUJA 1TYNA 3AAUA 2VIQA 1NY22 2O8UA 3RM0H 4O3UA 2VWOA 2ASUB 4XFQA 1NRSH 4A1XA 3U69H 1SQOA 1AVXA 2EEKA 4FUFA 1GHZA 1ELDE 1O5FH 3RXHA 5PTPA 3SV7A 1QBNA 2O8MA 1LHGH 1UCYE 5A09A 3LJOA 1O3KA 1HLTH 4FXGH 1UTJA 5AFYH 5GXPA 1NU7B 3SUEA 1GBAA 1THSH 7GCHF 1FV9A 3RC5A 6CHAB 1ZPZA 4X2XA 4B2AA 5C3NA 1QURH 1LTOA 1DXWA 2ZU1A 1EX3A 4UE7H 3FVFB 3LKWA 1LVMA 4I7YH 1FUJA 2RA0A 1IQEA 3P95A 2CMYA 2AFQB 5K0HA 1P2QA 1QRZA 1GBHA 3BIUH 2JH6D 4UEHH 4HZHA 2TRMA 4BAQB 4LZ1H 1SOTA 1LKAA 3B9FH 1Y5UT 3AASA 1FONA 4X2YA 5LPEA 1UTPA 2OBOA 1L4DA 2BX4A 1P2NA 1D3DB 3BTGE 1CSOE 1NFYA 4BAMB 1C4Y2 1RIWC 1PPZA 1UHBA 3SV2H 2XCNA 1NFWA 5E0JA 1QBVH 1C5YB 2PTNA 1P11E 2BD7A 3DFLA 5T6DA 1P2OA 1SVPA 1EQ9A 3PTBA 1IQKA 1P3CA 2A4GA 2BOKA 1SLVB 1ELTA 1O3OA 2JETC 2BHGA 3IITA 3GY8A 1K28D 2BMGB 2VIVA 1P10A 1C5OH 1GBEA 1GJDB 5JBBS 2ZHFH 4CH8B 1GBKA 1S84A 3ODDA 1BBRH 3ZVEA 1S85A 2ZECA 1O3MA 1T4VH 3EAJA 3VXEH 4CRCA 1KLTA 4AN7A 1C5ZB 4GHQA 1QQUA 4Y6DA 3ZV8A 1NZQH 4WVPE 4DVAU 1BITA 1DS2E 1EAUA 2GMTC 1GBIA 4LZ4B 1HIAA 1AQ7A 5CE1A 5DP5A 4YT6H 4BAOB 3BTKE 1KDQB 3MNBA 3GY6A 5J4QA 1U6QA 1UVOA 5HGGA 3MNCA 1Y5AT 1HYLA 1A5GH 3BF6H 2A7JA 2PSYA 4I8HA 1UCYK 1ETTH 2NU4E 2P3UB 3TPIZ 3V12A 1AHTH 1Z1JA 4J1YA 4NFFA 3W95A 2OLGA 4DW2U 1H8IH 2ZTXA 1EZXC 1O3JA 2F9OA 2G5VA 2BB4A 3Q76A 5LPFA 2PR3A 3D23A 1M9UA 1CHOG 1H9IE 3VGCC 4BTIB 1ZTLA 1GBMA 2CJIA 1QNJA 2OC0A 4JK6A 1LKBA 3RUOA 3BTDE 2UWPA 2Z9KA 1RIWB 1GBFA 2XC5A 4WMEA 3ATWA 1GMDF 4AFUA 3MWIU 3PLBA 5DP7A 2G81E 1UK3A 1TALA 1O2JA 4XSKU 2B8OH 2GGVB 1ETRH 2G00A 1DXPA 2ZFTA 2ZGXH 5DP9A 2I6QA 2IOTA 3NPSA 4MTBA 1LO6A 2XC0A 1C1PA 2GDDA 3P17H 4X6OA 3E90B 3TK9A 4KKDA 3ATMA 2W5EA 4A1VA 3LC5A 1T32A 2JKHA 3STJA 1GJ6A 1TIOA 4X8SH 1CT4E 4NIYA 2WPKS 1XMNB 3TJOA 4LK4A 1O3NA 1JWTA 2Z9IA 1PFXC 1LHCH 5JBAS 3MO9A 2UWOA 1UTMA 3RXBA 3TGKE 3B23B 1L1NA 1MAYA 3PWBA 1T4UH 1QRXA 2H9EH 3IG6B 4OGXA 2ZU2A 1LMWB 1TOCB 2Y81A 4YTAA 2WUBA 2EI6A 2H1UA 4XBDA 4ABJA 1BB0B 1QJ1B 4AORA 3UNRA 3ELAH 1ELEE 3TJUA 2VIWA 5A8ZA 1FY3A 1V6DA 2ZZUH 4ABIA 1QA0A 4SGAE 1TGBA 1CGHA 2FS9A 4JYTA 3RXMA 5L2ZH 1A3BH 3PMBB 1TMBH 2ZDKA 3RXRA 5EW1H 2G51A 4KTCA 4O9VA 1DSTA 1O37A 1O38A 2A4QA 1MKWH 4UFGH 3VGCB 4AG2A 1S5SA 4I8GA 1TQ0B 1OPHB 5EU8A 1SGCA 4K3JA 3MMGA 1F7ZA 5T3HA 2ZDVH 1A5HA 3SGBE 4ZKRU 2Q6DA 1GCTB 4Y7AA 2Z9LA 1O2ZA 4Y8XA 1O2XA 1C2KA 2CHAB 1ZHPA 1J15A 3QUMP 3RP2A 5AF9H 4BXSA 3MU8A 4K5ZA 1VJAU 1FN8A 4A7IB 5DP4A 3UFAA 1TBRH 2W7SA 4CR9A 2P16A 1W12U 2ZPSA 3VB3A 3ZVGA 2QXJA 1UK2A 1W10U 1HAVB 1EP5A 1V2OT 1O2IA 2IJOB 1RJXB 3SJOA 2R0KA 3ZVAA 3SJKA 1KLIH 1O35A 1ZMJA 1FPCH 3KF2A 1Q31A 1CA0C 2ANKH 3SN8A 1C5WB 1QQ4A 3VB7A 1TONA 1KSNA 2NU2E 2J38A 3RC4A 3VFEA 1ARBA 2R2MB 1MQ5A 2ZHDA 2ZTZA 1GI6A 2ZQ2A 5F8XA 1O32A 4MNVA 2J9NA 2ZDAH 1GDQA 2OINA 1V2VT 1SGNE 1NROH 3M5OA 2A1DB 2P95A 2BDGA 2A7CA 2G4TA 1CVWH 2IN2A 5DG6A 2WPLS 4GCHF 3LOXA 1GJ5H 2Z6BD 2BQ6B 4TWYA 1NT1A 3P8FA 3AAVA 3NCLA 1HAHH 3NZIA 1C2DA 1D6RA 3LH3A 2FOGA 1EZQA 1OOKB 1TX7A 1SGDE 3C27B 2YNBA 1XUHA 1OP2A 3A89A 2WPIS 4D7FA 1O5DH 2DE9A 1OYTH 3U8TH 1NFUA 1O2WA 4CBOA 1BRBE 1QL9A 4Y11E 4YOGA 1S6HA 3OU0A 2J92A 1EZUC 3GICB 4HFPB 1BJVA 5GIBA 3T5FH 3G01A 5EXLA 1TPAE 1DUAA 2JH0D 1Y3YA 1JRSA 2V35A 1DSUA 4NG9H 4DG4A 4CHAC 1DUEA 2OC8A 1SGQE 1P12E 1GMCG 1V2TT 2P3TB 2XYAA 3LGTA 1LQEA 3PMHB 1ELFA 2ZU3A 1ARCA 4AB8A 3E3TA 3A81A 1RRKA 1Y8TA 1AY6H 3DD2H 1MTWA 3EQ0H 2DE8A 3Q3XA 3T62A 5DO4H 4ISLA 4KTUA 4B75A 2GP9B 2R0LA 1P04A 3AVZA 2FYQA 1C9TA 1ZMNA 1O5GH 1PQ5A 2A45B 5E8EH 1XUJA 5ABWA 4ISOA 1NRQH 1GI8B 1O2GH 4YLQH 1W7XH 5DK1A 5EG4A 2G52A 4IC5A 1F5LA 4CH2B 4B2CA 1FAKH 1MCVA 2R2WU 3RMLH 4WJG2 1W0YH 4IS5A 1BBRE 9ESTA 1L1JA 3WY8A 1T8OA 1BTWA 3I77A 1SC8U 1O2VA 1WCZA 4ASHA 1KTTB 1V2JT 1EJMA 3TIUA 1C9PA 1EATA 5LH8A 3SJ8A 2FX6A 4R8TB 1DITH 3CP7A 4INHA 3ZZ4A 2A5AA 3LC3A 2RCEA 5FX5A 4YT7H 5FPTA 1T7CA 4SGBE 1C5RA 3GY4A 1GI3A 3BN9A 2M5TA 4MPUA 1TNGA 4B76A 4DY7B 2GX4A 4NWLA 4OS4A 3JZ1B 4O03A 4AFSA 1O3AA 1B0EA 1C2JA 1YCPH 5GCHG 3E6PH 4YOIA 4D7GA 3HKIB 3SQHE 1HJ8A 1GBCA 3GY7A 1DLEA 2R3UA 1ZSJA 4ABEA 5T6FA 4BTUB 1AKSA 1QHRB 4WH8A 3GDSA 4FUEA 4H4FA 3M35A 5F8ZA 3F1SB 1NFXA 2BD5A 4JZEH 2QYIA 1UTQA 1VITH 1JMOH 1ZLRA 2B5TB 4RKOB 3OX7U 3TJNA 2F9UA 1Y5BT 4NGAH 2GD4B 3PYHA 5JBTA 1ZSLA 1GHXH 2GCTC 4JCNA 1K1LA 4CREA 1VITF 1GPZA 4I31A 3RDZA 3TH4H 5AHGH 1TX8A 1D3TB 1HXFH 1V2KT 2D8WA 3RLYH 4YOJA 4OS5A 3ZZ6A 6GCHF 2SGAA 1ELAA 1VR1H 4K8YA 1AFQC 1G2LA 4GVUA 3PMAB 3ZV9A 4U01A 1IQJA 4XBBA 1C1WH 7GCHG 1O5AB 1CT2E 4BAHB 3EA8A 2H5DA 1E37B 4WMDA 2W3IA 2FMJA 2V0BA 1ZGVA 1HJAB 2FDAA 1TGCA 3IWMA 1D9IA 1PPEE 1B7XB 1HDTH 1BZXE 1SGIB 3LGUA 4ZUHA 1G3DA 1T8MA 5C1UA 1CQQA 1UMAH 4Q7YA 3D49H 3URCA 2FXRA 4MNWA 2BQ7B 5EOKA 2OC1A 2ZNKH 1DVAH 4FUDA 1DY8A 3M3VA 3ZZ3A 1BTHH 1K1NA 2O9QA 1O5EH 2BD9A 3A8BA 1A0HB 1TMTH 3PB1E 5FPSA 3BIVH 3BEUA 4O97A 5CHAC 4GSOA 3RXIA 2Z3EA 1CU1A 2ZDMA 4OS7A 3BTTE 1IQMA 2SNWA 8ESTE 1C1MA 2EI7A 3S0NA 5IDKA 1E36B 1MAXA 4JZDH 1DM4B 3SI4H 1C5QA 3M5NA 5FCKA 4M7GA 3M3TA 3HGPA 5E0HA 1DOJA 4NZQA 3OSYA 5HXFA 2ZHQH 4JZ1A 1C1VH 1H4WA 2ZI2H 1P03A 2XBVA
chains in the Genus database with same CATH superfamily
2PTCE 3RXOA 4GLYA 4Q7XA 3D62A 5E2OA 3S9AA 2BD3A 1LVBA 2J4IA 3PM3A 4WH6A 2BLWA 4ACBA 2OXSA 2GCTB 4IN2A 1C5MD 2FLRH 1GCDA 2WYJA 3PV4A 4AGJA 4FU8A 1SFIA 1GJ7B 1PPGE 5HM2A 1ELBA 3SZNA 1JIMA 2F3CE 2HALA 1AFQB 2Z94A 1P8VC 2FP7B 1EJNA 5E0GA 1ELGA 1C2LA 2AMPA 1QIXB 2TIOA 1ZGIA 1MZDA 5IK2D 2BZAA 2Y5GA 2SNVA 1HIAB 3RM2H 1C1SA 1LPKB 1NM6A 2G5NA 5LGOA 2Y5HA 2WYGA 3PWCA 3TU7H 3HPTB 1UTNA 1MKXH 4YO9A 3BTQE 1Z8GA 1A4WH 5IYTA 1ZR0A 3FZDA 5LPRA 4K2YA 3SV9A 1BQYA 1J16A 2RFKC 1UTOA 2J94A 2Y6TA 1EUFA 1F2SE 1YF4A 3KQCA 1A46H 5C20A 4D76A 3GISB 1FJSA 2ZFQH 1L4ZA 1FI8A 2Q6FA 4KTSA 4D9QA 4DURA 4YESB 4NSVA 3PLPA 1PQ8A 1WU1A 2HNTC 1TRMA 3MHWU 1C5SA 1GMDG 3O8DA 3H5CB 1GHBF 3QWCH 1BRCE 1GVKB 4X1SU 5CHAB 2ODYB 1TE0A 1TNIA 1MUEB 1P2JA 2QN5T 1TPOA 2ZEBA 2LPRA 2QC2A 3F9FA 1FMGA 6LPRA 3A7XA 3GCTF 2VIOA 1HAYB 1YC0A 3HK3B 3DHKH 3TNTA 1GVZA 4HG6A 1FIZA 5DP8A 4TPYA 8LPRA 1MKWK 1BHXF 1VCWA 3OEHD 4FVBA 2ESTE 3UQVA 1LQDB 1ZTKA 4ACAA 1OX1A 3P8NA 3L6PA 2PW8H 4OS6A 3T28A 1ZRBA 1O34A 4P00A 1G9IE 3FP7E 4MDSA 5C94A 5ESBA 1AWFH 1YPGH 3P92A 1C5XB 1BUIA 1O3GA 4ZXXH 1F5RA 1EFRD 2ZGCA 1O2SA 2FTMA 2G55A 5FXLA 4ABBA 3PRDA 3RXTA 1ELCA 1KXCA 3E1XB 4CR5A 1S82A 2BDYA 1T8NA 3UUZA 1GBLA 3LIWA 2CF8H 1DICA 1FY1A 1BMAA 2D2DA 1V3XA 1GMHF 1JBUH 3A85A 4X0WU 5C1YA 1SBWA 1THRH 1ESBA 3UOPA 2WUCA 2ZHEH 1C2EA 4I8KA 4LXBH 2A2QH 2H5CA 4TYDA 1YPHC 6ESTA 4IW4E 1O5CB 3AW1A 1YLDA 3SNBA 1J9CH 1P9SA 4XDEA 1P3EA 4Q80A 2TGAA 3LGWA 2OQ5A 4F49A 1AB9C 1FAXA 2KAIB 3P8OA 1VJ9U 1XM1A 1ESAA 1QFKH 2HLCA 1LHEH 1XUIA 1DWBH 2P8OC 3EE0B 4AZ2B 2FI4E 1Z6EA 4FU7A 4P02A 1GBDA 3A7ZA 1C1UH 3ZZ7A 1H8DH 5B6OA 3U1JB 1S81A 3ZZ8A 5EJLA 1YPJH 4FUHA 3SZEA 3MH6A 1BTUA 2R9PA 1SOZA 4MVNA 4Y0YE 2GZ7A 2FO9A 2ZFPH 1O30A 3H09A 1UJ1A 4AC9A 2JETB 3MU1A 4M9FA 3EGKH 3A86A 2EI8A 2OK5A 1DX5M 3C1KA 4Y10E 2B0FA 3K65B 3KGPA 1XUKA 4ZROA 4Z0KA 3T25A 2Z9JA 1GDUA 3DA9B 3O8CA 3SGAE 2RG3A 4DCDA 3SGQE 3QX5H 1UTKA 4J2YB 4X6NA 1K0HA 2WPDD 1IHTH 2FOAA 1MBMA 5C1XA 1YPHE 1QCPA 2AH4X 4HI3A 4MPVA 1A0JA 2ULLA 4E7RG 2GMTB 1QR3E 3MO6A 3V7TA 2F9BH 1SI5H 5GPIB 1W13U 3M37A 2XOKD 2C93B 2NU1E 1WYKA 4D9RA 5C2ZA 1G3BA 4GCHG 4OS2A 1ZHMA 2C8YB 4JK5A 4AFQA 5ESTE 3MH4A 5FL7D 5C5OA 5JDUB 1PPHE 5ETXA 1ANBA 4XBCA 1QY6A 2VIPA 3W1EA 2HPQH 2ZQ1A 5C5NA 4FUCA 1FDPA 5F53A 1O2QA 4BXWA 5I25A 1XKAC 3UREA 1FLEE 5A0BA 1GL0E 1ID5H 1AVWA 2FM2A 1GJ8B 3RMNH 3L33A 1IQIA 1AB9B 1WBGB 2W26A 1BTYA 2CV3A 2Z9GA 4K69A 4MPXA 1FN6A 1KDQA 4X2VA 3MI4A 2AHME 2C4FH 1ZTJA 4AG1A 2ZGHA 1OXGA 2QAAA 3VPKA 1MU8B 1MMJN 3LPRA 1GI0A 1RS0A 2P8OB 2BXUH 1ZPBA 2BOHB 1ANDA 1OP0A 1P2MA 1HAOH 4TSFD 2JDID 1CHGA 1ANCA 2OC7A 1GG6C 2A5KA 2PP6A 5FCRA 2TGDA 2FI3E 1L2EA 4Q2KA 5EQQA 5DGJA 4Y8YA 3T26A 1A3EH 4TY6A 1GHAF 3BV9B 3SJ9A 1CBWC 4UD9H 1LVYA 1GJ9B 5EPYA 5DP6A 4Y7BA 5EODA 1TLDA 3A88A 3UWJH 4NWKA 4INLA 1GWAA 1C5NH 4O3TA 1V2MT 2FS8A 1BTXA 3UNQA 5EGMA 3JZ2B 2XWBI 3D65E 1QB9A 4IMQA 3PMJA 2RDLA 3SU1A 1EAXA 4NA7A 2UUJB 2YNAA 1LHDH 4MQAA 4DJZB 1MD7A 3HKJB 2HLDD 1T8LA 3LGIA 4B6FA 3A8CA 1SHYA 1SFQB 1YCPK 3RXDA 4OGYA 3QDZB 1KMHB 1SGFA 3Q00A 1VZQH 2SGQE 4HGCA 2V7QD 1W0KD 1E0FD 2FWWA 1GJ4H 1THPB 1AE5A 3A7VA 3KL6A 1P57B 4UDWH 3ZZDA 3RXQA 1EAIA 4I86A 3TLOA 1BDAA 2XBWA 3FAOA 3RXFA 1EOLA 2FIRH 3GYMA 1O31A 1TPSA 4ZKNU 3A83A 2STAE 2UWLA 2STBE 2OBQA 1FPHH 1V2QT 3VB6A 2O8LA 1UCYH 1G3CA 1W0ZU 3SV6A 1KXDA 1TABE 1TGSZ 1QB6A 3V13A 1ACBE 1H9LB 1O3FA 1TNHA 3SORA 1LDTT 3RXCA 3S9BA 1ANEA 3SNCA 3HGNA 1FX0B 1E35B 1ZJDA 5A8XA 1K1OA 2PKAB 2LNCA 2Q1JA 4H42U 1IQHA 2XW9A 3FP8E 3TK6A 3GCHC 3K6YA 5BRRE 3OTPA 5T1VA 1GG6B 1OP8A 4RKJB 3P8GA 5GWZA 4ZHLU 2BQWB 2UUKB 1A0LA 2FOHA 2ZG0H 2ZFRH 5FX6A 1O3PB 1G36A 1CBWB 2G4UA 2GT8A 3SNEA 2ZU4A 2ILNA 3SU4A 4B71A 1MH0A 3A8DA 1TRNA 1GJCB 1VCPA 3RXLA 1Y3WA 2F43B 3STIA 1AIXH 1YYY1 4GUXA 1SL3A 1EZSC 1C4U2 1TNJA 3MU0A 1ZYOA 4B6EA 2GVFA 3CENA 1NO9H 1VITG 2WPJS 1TBQH 4WXVA 1V2LT 3SUFA 4DGJA 4NSYA 1K1IA 1WTGH 5DP3A 4FU9A 1MQ6A 1Z1IA 2ANMH 6GCHG 4TWWA 4ZMAH 3KHVA 5TJXA 2JJ2D 1FY5A 1F0TA 2BDIA 3S7HB 1FY4A 2HNTF 3K9XB 2BD8A 3TH2H 1CA0B 3U8OH 3QZQA 3BEIB 1O2PA 3ZZ5A 3BTEE 3RU4D 2XRCA 2BDBA 2ZGBH 3TK5A 4ABAA 3H7OA 1F92A 1BRAA 1HPGA 1V2WT 4ISIH 4TY7A 2O8TA 1S6FA 1EPTC 7LPRA 2BY7X 5A8YA 1HAVA 1AD8H 4K8BA 2ZGJA 1PPFE 3B8JA 1GDNA 2VU8E 3UR9A 3MH5A 1EASA 1LHFH 4H6SB 3TH3H 1BMMH 1BHXB 1TFXA 3RXGA 2ZFSA 2AEIH 2VB0A 2P59A 2SGFE 1HAPH 1B0FA 2XC4A 1GL1A 1H9HE 4A6LA 2KCAA 3F2HA 3KQDA 3O8RA 4UFDH 3P70B 4F48B 1HAGE 5GJ4B 4I8LA 2BD2A 4DIIH 4X8TH 2F83A 3KQEA 2Z3CA 2QF4A 3EA7A 1K9OE 2KM0A 3SU2A 3EE7A 4XE4A 2A2XH 2QXGA 3Q3KA 2JIZD 1F5KU 1GJBB 1V2PT 2VH0A 5TCAA 3RMMH 2AGGX 3WW7A 1IHSH 2BVSH 2FOFA 1S0QA 4CRGA 2QF0A 3QO6A 2C8ZB 1WOFA 4CHAB 2A32A 1W14U 4QT8C 1RFNA 1SG8B 4ZKOU 2OUAA 1ETSH 3FZZA 1DANH 5EW2H 1DWCH 3E91A 1AZZA 3KQBA 1EAWA 2HVXA 5HYOA 3E0PB 4Q4LA 1ESTA 5AFZH 1O3EA 1QJ7B 2QY0B 2QCYA 1SGRE 4FVDA 4AGKA 3A84A 5EQSA 3QGJA 1L0ZA 1XXFA 1RXPA 2ZDLA 3UNSA 4IMZA 1GI9B 1AE8H 4Y76A 1C5TA 3K2UA 3PO1C 2BXTH 3ATLA 1OS8A 1NTPA 1EPTB 2AERH 1Y3UA 1O3HA 1WUNH 1SQAA 2ZTYA 3U1IB 9LPRA 3N7OA 1K22H 3F9EA 4VGCC 1WXRA 5DJ7A 3HK6B 4YZUA 4A5TS 1MTNC 5EQRA 1F0UA 4AYVB 1YPMH 2FYRA 1V2NT 1Q2WA 1ABJH 1XX9A 1P2IA 4X6PA 1KXBA 1LVOA 3RXAA 3SU0A 1NN6A 4DT7B 3ZVFA 1BBRK 1C5PA 3FN8A 5CDFE 2OTVA 1BRUP 4OS1A 1N6YA 1GHBG 1O2TA 1MBQA 3VEQB 4NZLA 2FZZA 4H6TA 1RTLA 1GBTA 4WY3A 4FUJA 1D3QB 1WV7H 3M5MA 1QTFA 1BMFD 1QJ6B 1IQGA 3GCTG 2Y7ZA 3SOSA 1Y3XA 4INKA 2FEQH 4DT4A 1GBJA 1O5BB 1A5IA 1W3CA 1TWXB 3RXSA 2A4RA 2HRVA 2V6NA 4XRNA 1FQ3A 2BTCE 4X8UH 2PV9B 1T31A 3F68H 1HB0B 1RD3B 2L6OA 3RC6A 1AN1E 2QGRA 2C8XB 4IBLH 3BTFE 1D4PB 2PWXA 2Z7FE 3VB5A 2ANYA 2PFEA 3SW2B 4K1SA 2BDAA 2WPHS 3NXPA 1FZZA 3OAAD 1GHYH 1YY3A 1QL7A 1C2GA 4BOHA 1LPZB 2J98A 2GCHF 1UHBB 2BLQA 4NA8A 1BOQA 2BLOA 2EA3A 2VVVA 2A4OA 2H6MA 1GHVH 1V2RT 2AIPA 1OSSA 1SLXB 2OCVB 2XBXA 3BTWE 1W7GH 2GZ9A 1GGDC 2VIDA 1G32B 1TNLA 3TNSA 2HPPH 4GAWA 1QRWA 1BT7A 8KME2 1C2FA 2BX3A 2ZC9H 1NPMA 3UOUA 4VGCB 4ABDA 3SV8A 1MTNB 1GMHG 1MTSA 1AO5A 3UTUH 2FESH 4IN1A 2XCFA 1C1NA 1E34B 1SLWB 2BY8X 1O2OA 4Z6AH 1WQSA 3SU3A 5HIYA 4Y0ZE 3UY9A 3QTOH 1XVMA 2SFAA 2GV6A 3TGIE 1HCGA 2J95A 1HNEE 3P6ZB 1SGEE 3W94A 3WWBA 1AZ8A 1HXEH 1C5LH 3NKKA 3QLPH 2ZIQH 3M3SA 2PUQH 1A7SA 1P01A 2CF9H 1OWDA 1TX6A 3MNXA 3OY5U 1ZMLA 1SQTA 3GOVB 2PKSC 4UFEH 2FOBA 3KNXA 2J34A 1TQ7B 1DLKB 3CS7A 3SJIA 1J14A 3TVJB 3CNRA 1P9UA 1BMNH 2HWLB 2VVUA 2F9PA 1XUGA 3U28C 1C1QA 1YGCH 2G8TA 2V3OH 2FOEA 1N1LA 3EA9A 3ITIA 1O2LA 3RXVA 2FLBH 3U9AH 3QK1A 2WZQA 2PUXB 4Y8ZA 2BLVA 2FODA 3RLWH 5E2PA 3ZVBA 1F0SA 1UVSH 3NK8A 4FUBA 2KCOA 4BNRA 2EC9H 4X1NU 4KELA 2VJ1A 3RXKA 4AX9H 4X1QU 1G37A 2ZA5A 4NIVA 2K1QA 5C17A 4IGDA 2UUYA 3KCGH 4YLUA 1B5GH 1E38B 1WSSH 1GGDB 1QA7A 4AFZA 3AW0A 3A82A 1FY8E 3O8BA 3ZVCA 1Y59T 3T27A 1IAUA 2KFWA 3DFJA 1OWJA 3DT0H 3BG8A 1G30B 4TPIZ 1ABIH 2PGQB 2HOBA 2P93A 1O3CA 1P09A 3MH7A 1ORFA 1HAIH 3F9GA 3RU4T 1TA6A 2AMQA 3ATIA 1K1MA 3F0PA 3VB4A 4R0IA 2CK3D 5EXNA 5T6GA 4FETA 3NWUA 4ZXYH 1WAYB 1G3EA 1O3BA 1TMUH 1KLJH 2HNTE 2VBCA 1YBWA 1SMFE 2B9LA 1OKXA 3ZZ9A 4K60A 2ZF0H 2EQNA 5KEDA 5A0AE 2TGTA 3BTME 2QXHA 2PGBB 3U98H 1PYTC 3GY3A 1O3LA 2PKSB 1O2UA 4ISHH 2AS9A 1PYTD 2BVXH 1NBMD 3ODFA 2Q6GA 2SGDE 1HJ9A 1X7AC 2XXLA 1PPCE 4LOYH 3ZZAA 1CE5A 2OP9A 5F03A 1EP6A 2A31A 1C4V2 4FUIA 1J8AA 1UK4A 3A7YA 1EJAA 1CO7E 1GHAG 2GT7A 5DN6D 1BMLA 5JYIA 1Z7KA 2WV5A 5FBEA 1V2UT 1K1JA 1TB6H 3BEFB 1KIGH 1YLCA 2BDCA 2J2UA 1O3DA 2ALPA 3PRBA 1BTZA 4B74A 1OYQA 1SHHB 5EJ1A 2D1JA 1ZJKA 4MLFB 3LJJA 1E1QD 3KQ5A 2WPMS 2BY6X 1ZPCA 5HMAA 3T29A 4DOQA 5L2YH 1Z71A 1KXEA 1O0DH 1YLNA 4ZCNA 4K1TA 4HTCH 1E79D 2IPHA 2VINA 3WWFA 4ZH8A 4WMFA 2P3FH 3SUGA 4Q7ZA 1NBME 2BM2A 1XUFA 1ZHRA 1HFDA 2CN0H 1C1OA 2F9VA 1GCTC 3EDXB 3FKSD 1AGJA 3MFJA 1HAXB 1GBBA 2CHAC 3M61U 2J97A 1K21H 2VWLA 1XXDA 1MABB 1O2MA 3MU4A 3LH1A 5JB9S 1P2KA 4GHTA 5FPYA 5SGAE 1VCQA 4D8NA 4I8JA 1DT2A 1YPLH 4ESTE 2DUCA 5C67A 2LP6A 4ZKSU 2BY9X 3M7UA 1PQ7A 3V0XA 3KEEA 4ABHA 2UUFB 2VNTA 2TBSA 2ZCKP 1K1PA 8GCHG 3I78A 2GTBA 3QGNB 1HUTH 2ANWA 1O2HA 4MNYA 2D26C 3QZRA 4DIHH 3FANA 1W11U 1HGTH 3SNDA 1NS3A 1UVUH 1BCUH 5GDSH 1A61H 2F9NA 2K0QA 5BPEA 1TPPA 4B73A 1JRTA 1INCA 1K2I1 2GZ8A 1N8OC 1MZAA 4JYUH 1KYNA 1ZRKA 3LDXH 4XOJA 1W0JD 5GNDA 3SNAA 1YKTA 1BA8B 3QN7A 4GPGA 4NIXA 2XTTB 3A8AA 3TITA 4UFFH 5I46H 1DFPA 3PTNA 3R0FA 1EXFA 1L1GA 2OQUA 4Y79A 1AI8H 2WHXA 5HIZA 2KAIA 1IQFA 5EPNA 2ZU5A 3GCNA 2HGTH 2ALVA 3OTJE 2CXVA 3MO3A 3SQEE 4ABGA 1MU6B 1P05A 1Z8JB 2THFB 1WQVH 1XKBC 3DCLA 1BIOA 1SGTA 2XBYA 4I32A 1EB2A 3M5LA 2VWNA 4X6MA 2BD4A 2Y82A 1AFEH 2M2AA 3GCOA 3RXUA 3F6UH 2NWNA 3UR6A 1CHOF 3L3TA 2FX4A 1PJPA 1ELVA 1GI4A 1MTUA 1DDJA 7KMEH 2NU3E 1J17T 3E16B 3GY5A 1YM0A 2W6ID 5JB8S 2H9TH 2QF3A 1ZSKA 4OM9A 1RTFB 4NIWA 3LT3A 2SGEE 2AMDA 2I6SA 1KXAA 2AIQA 5F6MA 2VVCA 3GDUA 1TGNA 2ZPQA 4MG3A 3OYPA 2BDHA 2XNIA 1PPBH 2ODPA 2VH6A 1NRPH 1SGFG 4NA9H 2C90B 2Y5FA 1TOMH 2W3KA 3UPEA 1N8OB 4X1PU 3ZZBA 1IOEA 1SB1H 1SQRA 3SHCH 2YOLA 8GCHF 3Q3YA 1KXFA 3S9CA 1FXYA 3A7TA 3E0NB 1BTPA 4UONA 5A2MH 2AGIX 4E05H 4JZFH 3Q77A 1NC6A 1WTHD 2TPIZ 2OD3B 2ZWLH 1Z8RA 2H2ZA 3SHAH 4WWYA 1H1BA 1KY9A 4X2WA 4ZHAA 1OWIA 2AGEX 4YXWD 4ZHMU 2FOCA 2Z3DA 3SUDA 5TCCA 3RXJA 3EYDA 1C1RA 1TNKA 4PROA 3SI3H 7ESTE 1BJUA 1S0RA 1AUTC 1EB1H 1P06A 2NU0E 1AKSB 4KP0A 1YCPM 1TRYA 1DPOA 3OE7D 4WF8A 1V2ST 1CGIE 3KYGA 2WINI 1D6WA 1EKBB 1CGJE 2ZCLP 1JOUB 2A7HA 4JZIA 2AYWA 2FI5E 2BVRH 1TGTA 1O2KA 3GYLB 1NU9A 3F2GA 2GV7A 1GI1A 3M36A 5L30H 3A80A 4JMYA 3FFGA 1MD8A 2QIQA 1JXPA 1MTVA 3UQOA 2A0QB 4BANB 2A5IA 2RA3A 2JH5D 2ZKSA 1GI7B 5A0CA 1HBTH 1GI5A 1YPKH 3NUMA 1SGYE 4CRFA 3M7QA 1NRNH 1KTSB 3ENSB 5HM9A 3LGYA 1W2KH 5F8TA 3URDA 1UVTH 1QGFA 4KGAA 2XWAA 4X8VH 1O39A 3DUXH 3V3MA 4CRDA 3U8RH 1SR5C 1HV7A 1CT0E 1VGCC 4U32A 2ZDNA 3ZYEA 1UTLM 3MU5A 2PLXA 1P02A 1SPJA 3MOCA 3SO3A 1Y3VA 1DE7H 1XVOA 4I33A 4WXIA 3TJVA 3GCHB 4RT1A 3ESTA 4MPWA 4A1TA 3GS9A 2L74A 1LCYA 1GI2A 5FAHA 2GCHG 3KN2A 1MKXK 2GDEH 1Z8IB 4JYVH 3SU5A 4F4OC 1OWHA 3TGJE 4MNXA 5CHBA 3RU4E 1HJAC 1O3IA 1Q3XA 2PKAA 3R3GB 4CRBA 3BTHE 1A1RA 1H8ED 1O33A 1W8BH 2PSXA 3PV5A 2KR7A 5FBIA 2QXIA 1SLUB 1C5UA 2PHBA 2HVYB 4AOQA 5FHTA 3BG4C 5DKMA 2FTLE 1GVLA 1C2HA 3VXFH 1IQLA 1O2NA 2BYAX 3BSQA 1NRRH 3KIDU 4IC6A 5H4IB 3PROA 1AU8A 3FOAA 1G2MA 1TBZH 4RSPA 1Z6JH 2ZPRA 1OWKA 2ZP0H 2ODQA 1UO6A 3MNSA 4RN6A 5L6NH 1S83A 4BAKB 3OY6U 3MTYA 2QA9E 5EXMA 4CRAA 4AB9A 3SBKA 2TGPZ 1JIRA 1AWHB 2SGPE 1ZZZA 1P0SH 2VGCC 2WV4A 3K6ZA 1TAWA 2H9HA 2XNDD 1ZOMA 1FIWA 1GHWH 4B2BA 5CMXH 2FPZA 2V3HH 1C1TA 2O8WA 4THNH 4U30A 1GMCF 2B7DH 2QV1A 2ZO3H 1VGCB 1O36A 1A2CH 4Y71A 3ZYDA 3T2NA 2Y80A 2ZCHP 4BTTB 3VG8A 1C2IA 1FNIA 3SU6A 1UVPA 1F0RA 3A7WA 3F3BA 1SSXA 1OWEA 2R3YA 3E8LA 3MYWA 2Y7XA 1C5VA 1HRTH 2P94A 3F9HA 1SGPE 2ZHWH 1MCTA 4YM9A 5K7RA 5JPMH 3FO8D 2VWMA 3ZZCA 3ATKA 1COWD 3I29A 1O2YA 1HAZB 3FP6E 4ZAEA 3GY2A 3BG4B 1TA2A 6CHAC 3LU9B 1RGQA 4FUGA 3RMOH 2C3SA 2BZ6H 5DPAA 5J4SA 4ABFA 5AVDA 4CBNA 4AYYB 1PQAA 4E06H 4ISNA 3LONA 2CGAA 3H7TA 4K1EA 1O2RA 2W7UA 1AMHA 1CA8B 1DWDH 3RXEA 2FOMB 3PO1B 2C8WB 3M7TA 4U2WA 4B1TA 4X1RU 5G4BA 3HATH 3RXPA 1YP9A 3KYFA 5JBCS 2VGCB 3QTVH 2KCPA 1EOJA 1NESE 1QB1A 2GKVE 1IQNA 3S7KB 4E7NA 4NCYA 1QL8A 1C2MA 1DWEH 3S69A 1N6XA 3A87A 1DY9A 1D3PB 3CS0A 5GCHF 1YPEH 3GDVA 3ZVDA 1GJAB 3UIRA 2W6JD 1AVGH 2V3MA 3LGVA 2EY4C 4NFEA 3UWIA 1LPGB 1EPTA 2BY5X 2ZFFH 1RTKA 1QBOA 2F91A 4A92A 3PLKA 1AUJA 1TYNA 3AAUA 2VIQA 1NY22 2O8UA 3RM0H 4O3UA 2VWOA 3ZIAD 2ASUB 4XFQA 1NRSH 4A1XA 3U69H 1SQOA 1AVXA 2EEKA 4FUFA 1GHZA 1ELDE 1O5FH 3RXHA 5PTPA 3SV7A 1QBNA 2O8MA 2YMSC 1LHGH 1UCYE 5A09A 3LJOA 1O3KA 1HLTH 2YMSD 4FXGH 1UTJA 5AFYH 5GXPA 1NU7B 3SUEA 1GBAA 1THSH 7GCHF 1FV9A 3RC5A 6CHAB 1ZPZA 4X2XA 4B2AA 5C3NA 1QURH 1LTOA 1DXWA 2ZU1A 1EX3A 4UE7H 3FVFB 3LKWA 1OHHD 1LVMA 4I7YH 1FUJA 2RA0A 1IQEA 3P95A 2CMYA 2AFQB 5K0HA 1P2QA 1QRZA 1GBHA 3BIUH 2JH6D 4UEHH 4HZHA 2TRMA 4BAQB 4LZ1H 1SOTA 2QF5A 1LKAA 3B9FH 1Y5UT 3AASA 1FONA 4X2YA 5LPEA 1UTPA 2OBOA 1L4DA 4F55A 2BX4A 1P2NA 1D3DB 3BTGE 3MQKC 1CSOE 1NFYA 4BAMB 1C4Y2 1RIWC 1PPZA 1UHBA 2KZ4A 3SV2H 2XCNA 1NFWA 5E0JA 1QBVH 1C5YB 2PTNA 1P11E 2BD7A 3DFLA 5T6DA 1P2OA 1SVPA 1EQ9A 3PTBA 1IQKA 1P3CA 2A4GA 2BOKA 1SLVB 1ELTA 1O3OA 2JETC 2BHGA 3IITA 3GY8A 1K28D 2BMGB 2VIVA 1P10A 1C5OH 1GBEA 1GJDB 5JBBS 2ZHFH 4CH8B 1GBKA 1S84A 3ODDA 1BBRH 3ZVEA 1S85A 2ZECA 1O3MA 1T4VH 3EAJA 3VXEH 4CRCA 1KLTA 4AN7A 1C5ZB 4GHQA 1QQUA 4Y6DA 3ZV8A 1NZQH 4WVPE 4DVAU 1BITA 1DS2E 1EAUA 2GMTC 1GBIA 4LZ4B 1HIAA 1AQ7A 5CE1A 5DP5A 4YT6H 4BAOB 2YMSB 3BTKE 1KDQB 3MNBA 3GY6A 5J4QA 1U6QA 1UVOA 5HGGA 3MNCA 1Y5AT 1HYLA 1A5GH 3BF6H 2A7JA 2PSYA 4I8HA 1UCYK 1ETTH 2NU4E 2P3UB 3TPIZ 3V12A 1AHTH 1Z1JA 4J1YA 4NFFA 3W95A 2OLGA 4DW2U 2GJGA 1H8IH 2ZTXA 1EZXC 1O3JA 2F9OA 3NRLA 2G5VA 2BB4A 3Q76A 5LPFA 2PR3A 3D23A 1M9UA 1CHOG 1H9IE 3N99A 3VGCC 4BTIB 1ZTLA 1GBMA 2CJIA 1QNJA 2OC0A 4JK6A 1LKBA 3RUOA 3BTDE 1QZ8A 2UWPA 2Z9KA 4RT0A 1RIWB 3DSGA 1GBFA 2XC5A 4WMEA 3ATWA 2J5UA 1VKYA 1GMDF 4AFUA 3MWIU 3PLBA 5DP7A 2G81E 1UK3A 1TALA 1O2JA 4RI0A 4XSKU 2B8OH 2GGVB 1ETRH 2G00A 1DXPA 2ZFTA 2ZGXH 5DP9A 2I6QA 2IOTA 3NPSA 4MTBA 1LO6A 2XC0A 1C1PA 2GDDA 3P17H 4X6OA 3E90B 2IPQX 3TK9A 4KKDA 3ATMA 2W5EA 4A1VA 3LC5A 1T32A 2JKHA 5HKKD 3STJA 1GJ6A 1TIOA 4X8SH 1CT4E 4NIYA 2WPKS 1XMNB 3TJOA 4LK4A 1O3NA 1JWTA 2Z9IA 1PFXC 3DSPA 1LHCH 5JBAS 3MO9A 2UWOA 2WSSD 1UTMA 3RXBA 3TGKE 3B23B 1L1NA 1MAYA 3PWBA 1T4UH 1QRXA 2H9EH 3IG6B 4OGXA 2ZU2A 1LMWB 1TOCB 2RDEA 2Y81A 4YTAA 2WUBA 2EI6A 2H1UA 4XBDA 4ABJA 1BB0B 1QJ1B 4AORA 3UNRA 3ELAH 1ELEE 3TJUA 2VIWA 5A8ZA 1FY3A 1V6DA 2ZZUH 4ABIA 1QA0A 4SGAE 1TGBA 1CGHA 2FS9A 4JYTA 3RXMA 5L2ZH 1A3BH 3PMBB 1TMBH 2ZDKA 3RXRA 5EW1H 2G51A 4KTCA 4O9VA 1DSTA 1O37A 3OEED 1O38A 2A4QA 1MKWH 4UFGH 3VGCB 4AG2A 3UB0A 1S5SA 4I8GA 1TQ0B 1OPHB 5EU8A 1SGCA 4K3JA 3MMGA 1F7ZA 5T3HA 2ZDVH 1A5HA 3SGBE 4ZKRU 2Q6DA 1GCTB 4Y7AA 2Z9LA 1O2ZA 4Y8XA 1O2XA 1C2KA 2CHAB 1ZHPA 1J15A 1UW7A 3QUMP 3RP2A 5AF9H 4BXSA 3MU8A 4K5ZA 1VJAU 1FN8A 4A7IB 5DP4A 3UFAA 5EIYA 1TBRH 2W7SA 4CR9A 5C0TA 2P16A 1W12U 2ZPSA 3VB3A 3ZVGA 2QXJA 1UK2A 1W10U 1HAVB 1EP5A 1V2OT 2WV9A 1O2IA 3PV2A 2IJOB 1RJXB 3N7DA 3SJOA 2R0KA 3ZVAA 3SJKA 1SKYE 1KLIH 1O35A 1ZMJA 1FPCH 2KCYA 3KF2A 1Q31A 3UAIC 1CA0C 2ANKH 3SN8A 1C5WB 1QQ4A 3VB7A 1TONA 1KSNA 2NU2E 2J38A 3RC4A 5C0UA 3VFEA 4ASUD 1ARBA 2R2MB 1MQ5A 2ZHDA 2ZTZA 1GI6A 2ZQ2A 5F8XA 1O32A 4MNVA 5DSFA 2J9NA 2ZDAH 1GDQA 2OINA 1V2VT 1SGNE 1NROH 3M5OA 2A1DB 2P95A 3SYJA 2BDGA 2A7CA 2G4TA 1CVWH 1WDIA 2IN2A 5DG6A 2WPLS 4GCHF 3LOXA 1GJ5H 2Z6BD 2JJ1D 2BQ6B 4TWYA 1NT1A 3P8FA 3AAVA 3NCLA 1HAHH 3NZIA 1C2DA 1D6RA 3LH3A 2FOGA 1EZQA 1OOKB 1TX7A 1SGDE 3C27B 2YNBA 1XUHA 1OP2A 3A89A 2WPIS 4D7FA 1O5DH 2DE9A 1OYTH 3U8TH 1NFUA 1O2WA 4CBOA 1BRBE 3N7EA 1QL9A 4Y11E 3F0OA 4YOGA 1S6HA 3OU0A 2J92A 1EZUC 3GICB 4HFPB 1BJVA 2K8IA 5GIBA 3T5FH 3G01A 5EXLA 1TPAE 1DUAA 2JH0D 1Y3YA 1JRSA 2V35A 1DSUA 4NG9H 4DG4A 4CHAC 1DUEA 2OC8A 1SGQE 1P12E 1GMCG 1V2TT 2P3TB 2XYAA 3LGTA 5KGOA 1LQEA 3PMHB 1ELFA 2ZU3A 1ARCA 2KX4A 4AB8A 3E3TA 3A81A 1RRKA 1Y8TA 1AY6H 3DD2H 5EJZA 1MTWA 3EQ0H 2DE8A 3Q3XA 3T62A 5DO4H 4ISLA 4KTUA 4B75A 2GP9B 2R0LA 1P04A 3AVZA 2FYQA 1C9TA 1ZMNA 1O5GH 1PQ5A 2A45B 5E8EH 1XUJA 5ABWA 4ISOA 1NRQH 1GI8B 3F2FA 1O2GH 4YLQH 1W7XH 5DK1A 5EG4A 2G52A 4IC5A 1F5LA 4CH2B 4B2CA 1FAKH 1MCVA 2R2WU 3RMLH 4WJG2 1W0YH 4IS5A 1BBRE 4Z1MD 9ESTA 2F4LA 1L1JA 3WY8A 4Q63A 1H8HD 1T8OA 1E1RD 1BTWA 3I77A 1SC8U 1O2VA 5B6LA 1WCZA 4ASHA 1KTTB 4FOUC 1V2JT 1EJMA 3TIUA 1C9PA 1EATA 4XD7D 5LH8A 3SJ8A 2FX6A 4R8TB 1DITH 3CP7A 4INHA 3ZZ4A 2A5AA 2J98B 3LC3A 2RCEA 5FX5A 4YT7H 5FPTA 1T7CA 3DSOA 4SGBE 1C5RA 2IJD1 3GY4A 1GI3A 3BN9A 2M5TA 4MPUA 1TNGA 4B76A 4DY7B 2GX4A 4NWLA 4OS4A 3JZ1B 4O03A 4AFSA 1O3AA 1B0EA 1C2JA 1YCPH 5GCHG 3E6PH 4YOIA 4D7GA 3HKIB 3SQHE 1HJ8A 1GBCA 3GY7A 1DLEA 2R3UA 1ZSJA 4ABEA 5T6FA 4BTUB 1AKSA 1QHRB 4WH8A 3GDSA 4FUEA 4H4FA 3M35A 5F8ZA 3AK5A 3F1SB 1NFXA 2BD5A 4JZEH 2QYIA 1UTQA 1VITH 1JMOH 1ZLRA 2B5TB 4RKOB 3OX7U 3TJNA 2F9UA 1Y5BT 4NGAH 2GD4B 3PYHA 5JBTA 1ZSLA 1GHXH 2GCTC 4JCNA 1K1LA 4CREA 1VITF 1GPZA 4I31A 3RDZA 3TH4H 5AHGH 1TX8A 1D3TB 1HXFH 1V2KT 2D8WA 3RLYH 4YOJA 4OS5A 3ZZ6A 6GCHF 2SGAA 1ELAA 1VR1H 4K8YA 1AFQC 1G2LA 4GVUA 3PMAB 3ZV9A 4U01A 1IQJA 1S6LA 4XBBA 1C1WH 7GCHG 1O5AB 1CT2E 4BAHB 3EA8A 2QE7D 2H5DA 1E37B 4WMDA 2W3IA 2FMJA 2V0BA 1ZGVA 1HJAB 2FDAA 1TGCA 3IWMA 1D9IA 1PPEE 1B7XB 1HDTH 1BZXE 1SGIB 3LGUA 4ZUHA 1G3DA 1T8MA 5C1UA 1CQQA 1UMAH 4Q7YA 3D49H 3URCA 3OFND 2FXRA 4MNWA 2BQ7B 5EOKA 2OC1A 2ZNKH 1DVAH 4FUDA 1DY8A 2LELA 3M3VA 3ZZ3A 1BTHH 1K1NA 2O9QA 1O5EH 2BD9A 3A8BA 1A0HB 1TMTH 3PB1E 5FPSA 3BIVH 3BEUA 4O97A 5CHAC 4GSOA 3RXIA 2Z3EA 1CU1A 2ZDMA 4OS7A 3BTTE 1IQMA 1YWUA 2SNWA 8ESTE 1C1MA 2EI7A 3S0NA 5IDKA 1E36B 1MAXA 4JZDH 1DM4B 4TT3D 3SI4H 1C5QA 3M5NA 5FCKA 4M7GA 3M3TA 3HGPA 5KECA 5E0HA 1DOJA 4NZQA 3OSYA 5HXFA 2ZHQH 4JZ1A 1C1VH 1H4WA 2ZI2H 1P03A 2XBVA
chains in the Genus database with same CATH topology
2PTCE 3RXOA 4GLYA 4Q7XA 3D62A 5E2OA 3S9AA 2BD3A 1LVBA 2J4IA 3PM3A 4WH6A 2BLWA 2OXSA 2GCTB 4IN2A 1C5MD 2FLRH 1GCDA 2WYJA 3PV4A 4AGJA 4FU8A 1SFIA 1GJ7B 1PPGE 5HM2A 1ELBA 3SZNA 1JIMA 2F3CE 2HALA 1AFQB 2Z94A 1P8VC 2FP7B 1EJNA 5E0GA 1ELGA 1C2LA 2AMPA 1QIXB 2TIOA 1ZGIA 1MZDA 2BZAA 2Y5GA 2SNVA 1HIAB 3RM2H 1C1SA 1LPKB 1NM6A 2G5NA 5LGOA 2Y5HA 2WYGA 3PWCA 3TU7H 3HPTB 1UTNA 1MKXH 4YO9A 3BTQE 1Z8GA 1A4WH 5IYTA 1ZR0A 3FZDA 5LPRA 4K2YA 3SV9A 1BQYA 1J16A 1UTOA 2J94A 2Y6TA 1EUFA 1F2SE 1YF4A 3KQCA 1A46H 5C20A 4D76A 3GISB 1FJSA 2ZFQH 1L4ZA 1FI8A 2Q6FA 4KTSA 4D9QA 4DURA 4YESB 4NSVA 3PLPA 1PQ8A 1WU1A 2HNTC 1TRMA 3MHWU 1C5SA 1GMDG 3O8DA 3H5CB 1GHBF 3QWCH 1BRCE 1GVKB 4X1SU 5CHAB 2ODYB 1TE0A 1TNIA 1MUEB 1P2JA 2QN5T 1TPOA 2ZEBA 2LPRA 2QC2A 3F9FA 1FMGA 6LPRA 3A7XA 3GCTF 2VIOA 1HAYB 1YC0A 3HK3B 3DHKH 3TNTA 1GVZA 5DP8A 1FIZA 4TPYA 8LPRA 1MKWK 1BHXF 1VCWA 4FVBA 2ESTE 3UQVA 1LQDB 1ZTKA 1OX1A 3P8NA 3L6PA 2PW8H 4OS6A 3T28A 1ZRBA 1O34A 1G9IE 3FP7E 4MDSA 5ESBA 1AWFH 1YPGH 3P92A 1C5XB 1BUIA 1O3GA 4ZXXH 1F5RA 2ZGCA 1O2SA 2FTMA 2G55A 5FXLA 4ABBA 3RXTA 1ELCA 1KXCA 3E1XB 4CR5A 1S82A 2BDYA 1T8NA 3UUZA 1GBLA 3LIWA 2CF8H 1DICA 1FY1A 1BMAA 2D2DA 1V3XA 1GMHF 1JBUH 3A85A 4X0WU 5C1YA 1SBWA 1THRH 1ESBA 3UOPA 2WUCA 2ZHEH 1C2EA 4I8KA 4LXBH 2A2QH 2H5CA 4TYDA 1YPHC 6ESTA 4IW4E 1O5CB 3AW1A 1YLDA 3SNBA 1J9CH 1P9SA 4XDEA 1P3EA 4Q80A 2TGAA 3LGWA 2OQ5A 4F49A 1AB9C 1FAXA 2KAIB 3P8OA 1VJ9U 1XM1A 1ESAA 1QFKH 2HLCA 1LHEH 1XUIA 1DWBH 2P8OC 3EE0B 4AZ2B 2FI4E 1Z6EA 4FU7A 1GBDA 3A7ZA 1C1UH 3ZZ7A 1H8DH 5B6OA 3U1JB 1S81A 3ZZ8A 1YPJH 4FUHA 3MH6A 1BTUA 2R9PA 1SOZA 4MVNA 4Y0YE 2GZ7A 2FO9A 2ZFPH 1O30A 1UJ1A 2JETB 3MU1A 3EGKH 3A86A 2EI8A 1DX5M 3C1KA 4Y10E 2B0FA 3K65B 3KGPA 1XUKA 4ZROA 4Z0KA 3T25A 2Z9JA 1GDUA 3DA9B 3O8CA 3SGAE 2RG3A 4DCDA 3SGQE 3QX5H 1UTKA 4J2YB 4X6NA 1IHTH 2FOAA 1MBMA 5C1XA 1YPHE 1QCPA 2AH4X 4HI3A 4MPVA 1A0JA 2ULLA 4E7RG 2GMTB 1QR3E 3MO6A 3V7TA 2F9BH 1SI5H 5GPIB 1W13U 3M37A 2C93B 2NU1E 1WYKA 4D9RA 5C2ZA 1G3BA 4GCHG 4OS2A 1ZHMA 2C8YB 4JK5A 4AFQA 5ESTE 3MH4A 5C5OA 5JDUB 1PPHE 5ETXA 1ANBA 4XBCA 1QY6A 2VIPA 5C5NA 2HPQH 2ZQ1A 4FUCA 1FDPA 1O2QA 4BXWA 5I25A 1XKAC 3UREA 1FLEE 5A0BA 1GL0E 1ID5H 1AVWA 2FM2A 1GJ8B 3RMNH 3L33A 1IQIA 1AB9B 1WBGB 2W26A 1BTYA 2CV3A 2Z9GA 4K69A 4MPXA 1FN6A 1KDQA 4X2VA 3MI4A 2C4FH 1ZTJA 4AG1A 2ZGHA 1OXGA 2QAAA 3VPKA 1MU8B 1MMJN 3LPRA 1GI0A 1RS0A 2P8OB 2BXUH 1ZPBA 2BOHB 1ANDA 1OP0A 1P2MA 1HAOH 1CHGA 1ANCA 2OC7A 1GG6C 2A5KA 5FCRA 2TGDA 2FI3E 1L2EA 4Q2KA 5EQQA 5DGJA 4Y8YA 3T26A 1A3EH 4TY6A 1GHAF 3BV9B 3SJ9A 1CBWC 4UD9H 1LVYA 1GJ9B 5EPYA 5DP6A 4Y7BA 5EODA 1TLDA 3A88A 3UWJH 4NWKA 4INLA 1GWAA 1C5NH 4O3TA 1V2MT 2FS8A 1BTXA 3UNQA 5EGMA 3JZ2B 2XWBI 3D65E 1QB9A 4IMQA 3PMJA 2RDLA 3SU1A 1EAXA 4NA7A 2UUJB 2YNAA 1LHDH 4MQAA 4DJZB 1MD7A 3HKJB 1T8LA 3LGIA 3A8CA 1SHYA 1SFQB 1YCPK 3RXDA 4OGYA 3QDZB 1SGFA 3Q00A 1VZQH 2SGQE 4HGCA 1E0FD 2FWWA 1GJ4H 1THPB 1AE5A 3A7VA 3KL6A 1P57B 4UDWH 3ZZDA 3RXQA 1EAIA 3TLOA 1BDAA 2XBWA 3FAOA 3RXFA 1EOLA 2FIRH 3GYMA 1O31A 1TPSA 4ZKNU 3A83A 2STAE 2UWLA 2STBE 2OBQA 1FPHH 1V2QT 3VB6A 2O8LA 1UCYH 1G3CA 1W0ZU 3SV6A 1KXDA 1TABE 1TGSZ 1QB6A 3V13A 1ACBE 1H9LB 1O3FA 1TNHA 3SORA 1LDTT 3RXCA 3S9BA 1ANEA 3SNCA 3HGNA 1E35B 1ZJDA 5A8XA 1K1OA 2PKAB 2LNCA 2Q1JA 4H42U 1IQHA 2XW9A 3FP8E 3TK6A 3GCHC 3K6YA 5BRRE 1GG6B 1OP8A 4RKJB 3P8GA 5GWZA 4ZHLU 2BQWB 2UUKB 1A0LA 2FOHA 2ZG0H 2ZFRH 5FX6A 1O3PB 1G36A 1CBWB 2G4UA 2GT8A 3SNEA 2ZU4A 2ILNA 3SU4A 4B71A 1MH0A 3A8DA 1TRNA 1GJCB 1VCPA 3RXLA 1Y3WA 3STIA 1AIXH 1YYY1 4GUXA 1SL3A 1EZSC 1C4U2 1TNJA 3MU0A 1ZYOA 2GVFA 3CENA 1NO9H 1VITG 2WPJS 1TBQH 4WXVA 1V2LT 3SUFA 4DGJA 4NSYA 1K1IA 1WTGH 5DP3A 4FU9A 1MQ6A 1Z1IA 2ANMH 6GCHG 4TWWA 4ZMAH 3KHVA 5TJXA 1FY5A 1F0TA 2BDIA 3S7HB 1FY4A 2HNTF 3K9XB 2BD8A 3TH2H 1CA0B 3U8OH 3QZQA 3BEIB 1O2PA 3ZZ5A 3BTEE 3RU4D 2XRCA 2BDBA 2ZGBH 3TK5A 4ABAA 3H7OA 1F92A 1BRAA 1HPGA 1V2WT 4ISIH 4TY7A 2O8TA 1S6FA 1EPTC 7LPRA 2BY7X 5A8YA 1HAVA 1AD8H 4K8BA 2ZGJA 1PPFE 3B8JA 1GDNA 2VU8E 3UR9A 3MH5A 1EASA 1LHFH 4H6SB 3TH3H 1BMMH 1BHXB 1TFXA 3RXGA 2ZFSA 2AEIH 2VB0A 2P59A 2SGFE 1HAPH 1B0FA 2XC4A 1GL1A 1H9HE 4A6LA 3KQDA 3O8RA 4UFDH 3P70B 1HAGE 5GJ4B 4I8LA 2BD2A 4DIIH 4X8TH 2F83A 3KQEA 2Z3CA 3EA7A 1K9OE 3SU2A 4XE4A 2A2XH 2QXGA 3Q3KA 1F5KU 1GJBB 1V2PT 2VH0A 5TCAA 3RMMH 2AGGX 1IHSH 2BVSH 2FOFA 1S0QA 4CRGA 2QF0A 3QO6A 2C8ZB 1WOFA 4CHAB 2A32A 1W14U 4QT8C 1RFNA 1SG8B 4ZKOU 2OUAA 1ETSH 3FZZA 1DANH 5EW2H 1DWCH 3E91A 1AZZA 3KQBA 1EAWA 2HVXA 5HYOA 3E0PB 1ESTA 5AFZH 1O3EA 1QJ7B 2QY0B 2QCYA 1SGRE 4FVDA 4AGKA 3A84A 5EQSA 3QGJA 1L0ZA 1XXFA 1RXPA 2ZDLA 3UNSA 4IMZA 1GI9B 1AE8H 4Y76A 1C5TA 3K2UA 3PO1C 2BXTH 3ATLA 1OS8A 1NTPA 1EPTB 2AERH 1Y3UA 1O3HA 1WUNH 1SQAA 2ZTYA 3U1IB 9LPRA 3N7OA 1K22H 3F9EA 4VGCC 5DJ7A 3HK6B 4YZUA 4A5TS 1MTNC 5EQRA 1F0UA 4AYVB 1YPMH 2FYRA 1V2NT 1Q2WA 1ABJH 1XX9A 1P2IA 4X6PA 1KXBA 1LVOA 3RXAA 3SU0A 1NN6A 4DT7B 3ZVFA 1BBRK 1C5PA 2OTVA 1BRUP 4OS1A 1N6YA 1GHBG 1O2TA 1MBQA 3VEQB 4NZLA 2FZZA 4H6TA 1RTLA 1GBTA 4WY3A 4FUJA 1D3QB 1WV7H 3M5MA 1QTFA 1QJ6B 1IQGA 3GCTG 2Y7ZA 3SOSA 1Y3XA 4INKA 2FEQH 1GBJA 1O5BB 1A5IA 1W3CA 1TWXB 3RXSA 2A4RA 2HRVA 2V6NA 1FQ3A 2BTCE 4X8UH 2PV9B 1T31A 3F68H 1HB0B 1RD3B 3RC6A 1AN1E 2QGRA 2C8XB 4IBLH 3BTFE 1D4PB 2PWXA 2Z7FE 3VB5A 2ANYA 2PFEA 3SW2B 4K1SA 2BDAA 2WPHS 3NXPA 1FZZA 1GHYH 1QL7A 1C2GA 4BOHA 1LPZB 2GCHF 1UHBB 2BLQA 4NA8A 1BOQA 2BLOA 2EA3A 2VVVA 2A4OA 2H6MA 1GHVH 1V2RT 2AIPA 1OSSA 1SLXB 2OCVB 2XBXA 3BTWE 1W7GH 2GZ9A 1GGDC 2VIDA 1G32B 1TNLA 3TNSA 2HPPH 4GAWA 1QRWA 1BT7A 8KME2 1C2FA 2BX3A 2ZC9H 1NPMA 3UOUA 4VGCB 4ABDA 3SV8A 1MTNB 1GMHG 1MTSA 1AO5A 3UTUH 2FESH 4IN1A 2XCFA 1C1NA 1E34B 1SLWB 2BY8X 1O2OA 4Z6AH 1WQSA 3SU3A 4Y0ZE 3UY9A 3QTOH 1XVMA 2SFAA 2GV6A 3TGIE 1HCGA 2J95A 1HNEE 3P6ZB 1SGEE 3W94A 1AZ8A 1HXEH 1C5LH 3NKKA 3QLPH 2ZIQH 3M3SA 2PUQH 1A7SA 1P01A 2CF9H 1OWDA 1TX6A 3MNXA 3OY5U 1ZMLA 1SQTA 3GOVB 2PKSC 4UFEH 2FOBA 3KNXA 2J34A 1TQ7B 1DLKB 3CS7A 3SJIA 1J14A 3TVJB 1P9UA 1BMNH 2HWLB 2VVUA 2F9PA 1XUGA 1C1QA 1YGCH 2G8TA 2V3OH 2FOEA 1N1LA 3EA9A 3ITIA 1O2LA 3RXVA 2FLBH 3U9AH 3QK1A 2PUXB 4Y8ZA 2BLVA 2FODA 3RLWH 5E2PA 3ZVBA 1F0SA 1UVSH 3NK8A 4FUBA 4BNRA 2EC9H 4X1NU 4KELA 2VJ1A 3RXKA 4AX9H 4X1QU 1G37A 2ZA5A 4NIVA 2K1QA 4IGDA 2UUYA 3KCGH 4YLUA 1B5GH 1E38B 1WSSH 1GGDB 1QA7A 4AFZA 3AW0A 3A82A 1FY8E 3O8BA 3ZVCA 1Y59T 3T27A 1IAUA 3DFJA 3DT0H 1OWJA 3BG8A 1G30B 4TPIZ 1ABIH 2PGQB 2HOBA 2P93A 1O3CA 1P09A 3MH7A 1ORFA 1HAIH 3F9GA 3RU4T 1TA6A 2AMQA 3ATIA 1K1MA 3VB4A 4R0IA 5EXNA 5T6GA 3NWUA 4ZXYH 1WAYB 1G3EA 1O3BA 1TMUH 1KLJH 2HNTE 1YBWA 1SMFE 2B9LA 1OKXA 3ZZ9A 4K60A 2ZF0H 5A0AE 2TGTA 3BTME 2QXHA 2PGBB 3U98H 1PYTC 3GY3A 1O3LA 2PKSB 1O2UA 4ISHH 2AS9A 1PYTD 2BVXH 2Q6GA 3ODFA 2SGDE 1HJ9A 1X7AC 2XXLA 1PPCE 4LOYH 3ZZAA 1CE5A 2OP9A 5F03A 1EP6A 2A31A 1C4V2 4FUIA 1J8AA 1UK4A 3A7YA 1EJAA 1CO7E 1GHAG 2GT7A 1BMLA 5JYIA 1Z7KA 2WV5A 5FBEA 1V2UT 1K1JA 1TB6H 3BEFB 1KIGH 1YLCA 2BDCA 2J2UA 1O3DA 2ALPA 1BTZA 4B74A 1OYQA 1SHHB 2D1JA 1ZJKA 4MLFB 3LJJA 2WPMS 2BY6X 1ZPCA 5HMAA 3T29A 4DOQA 5L2YH 1Z71A 1KXEA 1O0DH 4K1TA 4HTCH 2IPHA 2VINA 4ZH8A 4WMFA 2P3FH 3SUGA 4Q7ZA 2BM2A 1XUFA 1ZHRA 1HFDA 2CN0H 1C1OA 2F9VA 1GCTC 3EDXB 1AGJA 3MFJA 1HAXB 1GBBA 2CHAC 3M61U 1K21H 2VWLA 1XXDA 1O2MA 3MU4A 3LH1A 5JB9S 1P2KA 4GHTA 5FPYA 5SGAE 1VCQA 4D8NA 4I8JA 1DT2A 1YPLH 4ESTE 2DUCA 5C67A 4ZKSU 2BY9X 3M7UA 1PQ7A 3V0XA 3KEEA 4ABHA 2UUFB 2VNTA 2TBSA 2ZCKP 1K1PA 8GCHG 3I78A 2GTBA 3QGNB 1HUTH 2ANWA 1O2HA 4MNYA 2D26C 3QZRA 4DIHH 3FANA 1W11U 1HGTH 3SNDA 1NS3A 1UVUH 1BCUH 5GDSH 1A61H 2F9NA 5BPEA 1TPPA 4B73A 1JRTA 1INCA 1K2I1 2GZ8A 1N8OC 1MZAA 4JYUH 1KYNA 1ZRKA 3LDXH 4XOJA 3SNAA 1YKTA 1BA8B 3QN7A 4GPGA 4NIXA 2XTTB 3A8AA 3TITA 4UFFH 5I46H 1DFPA 3PTNA 3R0FA 1EXFA 1L1GA 2OQUA 4Y79A 1AI8H 2KAIA 1IQFA 5EPNA 2ZU5A 3GCNA 2HGTH 2ALVA 3OTJE 2CXVA 3MO3A 3SQEE 4ABGA 1MU6B 1P05A 1Z8JB 2THFB 1WQVH 1XKBC 1BIOA 1SGTA 2XBYA 4I32A 1EB2A 3M5LA 2VWNA 4X6MA 2BD4A 2Y82A 1AFEH 3GCOA 3RXUA 3F6UH 2NWNA 3UR6A 1CHOF