1ZYOA

Crystal structure of the serine protease domain of sesbania mosaic virus polyprotein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
186
structure length
184
Chain Sequence
b'SFYSPVKAGDEPASLVAIKSGPTTIGFGCRTKIEDCLLTAHHVWCNSMRPTGLAKAGKQVSVEDWEISMSSSDKMLDFAIVRVPTHVWSKLGVKSTPLVCPSSKDVITCYGGSSSDCLMSGVGSSSTSEFTWKLTHTCPTAAGWSGTPLYSSRGVVGMHVGFEEIGKLNRGVNMFYVANYLLRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine protease
molecule tags Hydrolase
source organism Sesbania mosaic virus
publication title Crystal structure of the serine protease domain of Sesbania mosaic virus polyprotein and mutational analysis of residues forming the S1-binding pocket
pubmed doi rcsb
total genus 40
structure length 184
sequence length 186
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02122 Peptidase_S39 Peptidase S39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zyoA02
5ESBA 3HKJB 3LJJA 3HPTB 4JZFH 4FU9A 2OBOA 3T2NA 2GD4B 2P59A 1V2JT 2J34A 3RMMH 2ODPA 4HTCH 1DXPA 2Z9IA 2FOMB 1C5PA 3MTYA 1IQNA 1GBMA 1IQKA 1QA7A 3HK6B 1FN6A 2F9OA 4XBDA 1SGQE 2VVVA 1LHEH 4IN1A 3T29A 2AGIX 2HWLB 1AWHB 3RXSA 3SORA 1TMBH 4AGJA 3PM3A 2XTTB 1TFXA 5CE1A 1P2KA 1F7ZA 5GPIB 4NIYA 4Q80A 1B5GH 1BHXF 4FUHA 5FPSA 5F03A 3SGBE 3SNBA 1YGCH 2Z9GA 5DJ7A 1ID5H 2ZQ1A 4Y11E 1V2TT 3RXUA 1PPGE 3MO6A 1MQ5A 2VJ1A 1XUHA 4F4OC 4ZKNU 4OS1A 3EA9A 1IQMA 1WCZA 1AKSA 3M3SA 2BD3A 4D8NA 2YOLA 2Y6TA 1O5EH 2Y5HA 3GCOA 2F9VA 2D1JA 1TMUH 1O2HA 1BRAA 1O2OA 3T5FH 5IDKA 7GCHF 1FPHH 1B0EA 1G36A 3M37A 2PFEA 5T3HA 1YCPH 1ELAA 1PQ8A 1Y3YA 2PTNA 4AGKA 1W3CA 1LVBA 2ZFTA 4XE4A 3U1JB 3RLYH 2GGVB 1GJ5H 1BTPA 2G5VA 1DWCH 2VWMA 3ATMA 2J94A 2WUCA 1MTWA 1GJBB 3RXLA 3GCTG 3BN9A 2H9TH 3SV9A 3RXMA 4D76A 1CT0E 4KTUA 2BLOA 4XBCA 1ORFA 3ZVAA 1O5CB 3V0XA 1EP5A 4HGCA 1GI5A 1LHFH 6LPRA 3S9AA 4BTIB 1FDPA 4CHAC 4JZDH 2Y5FA 3V12A 2CV3A 1Y3XA 4FUFA 2Z3DA 1UK3A 3PWCA 1RIWC 1OYTH 2BOHB 1Z1JA 1OX1A 3KCGH 2H5DA 3PLBA 5DP8A 2ZFQH 1TONA 3EA8A 1V2WT 1SGCA 1FJSA 1TPOA 1ZOMA 3SNDA 4GHTA 2XBXA 1NPMA 4Y7BA 1JIMA 1NC6A 3AAUA 3FP8E 3S9BA 1MAYA 5I46H 3A7WA 1GWAA 1FI8A 3P8NA 2ZDAH 2PGBB 4UFDH 8GCHG 1BBRK 2XC5A 3Q00A 8ESTE 5L30H 2WPHS 3MU5A 1DWEH 3A82A 4O03A 1GL0E 4A7IB 3K9XB 3WY8A 4D7FA 3M5LA 3V13A 1G2LA 1ELCA 2ZCLP 1ZMLA 4INKA 3KL6A 1K1IA 2VB0A 3K65B 1O2SA 1FY1A 1TNLA 5F8TA 3VGCB 1V2LT 1A7SA 1GJ4H 1PQAA 4LOYH 1GHAG 2C93B 1WTHD 4UFGH 1KLTA 2VWNA 4HI3A 1C1TA 1TMTH 1PJPA 3H5CB 1YC0A 4R8TB 1NRQH 1O2VA 1OP0A 3RDZA 3UTUH 3K6ZA 3LU9B 3NCLA 3P70B 1DSUA 1Q2WA 2GMTB 2GZ7A 5FX5A 4AB8A 5F6MA 2BD4A 1AQ7A 2ZHEH 1PQ5A 2ZPQA 1SLWB 2ZFFH 3QLPH 3T25A 3L33A 4H4FA 2FODA 2GV7A 3A89A 4ABIA 1QIXB 1SQAA 3ZZ9A 2AIQA 3RC6A 3A7XA 1Z8JB 3D62A 1VCPA 5E2PA 5EW2H 1MU6B 4MPVA 7GCHG 2I6QA 1H8DH 3K2UA 1P2NA 3TVJB 2GKVE 3UIRA 3M7UA 3GISB 1T8MA 4NIWA 3BTKE 1DFPA 3URCA 1C9TA 1J9CH 2G8TA 2P8OB 1FY5A 1GHBF 3STJA 2RCEA 1GBCA 1C2GA 1TOCB 2RA3A 1EOJA 2WPMS 1S81A 3GY3A 1VGCC 1D3PB 1BBRH 1Y5BT 1HB0B 2OC7A 4UFEH 1A0HB 1C1PA 2VGCB 1D3TB 1H8IH 1LHDH 5E0HA 1C5UA 1EX3A 1KTSB 4Y8ZA 1JRSA 5FPTA 4WMDA 4AB9A 1LDTT 1ZGVA 3OTJE 5DP9A 2WUBA 3DFJA 5I25A 1O37A 3ZZDA 2BD2A 4BAHB 1C5SA 4NWLA 1QA0A 5GCHF 5K0HA 1UCYK 4Y8XA 3NXPA 1TGNA 4UE7H 3F9FA 4X2VA 1NT1A 2D8WA 1GGDC 4BANB 4DURA 1IQIA 1P3EA 2XC4A 3ATIA 1G37A 1G9IE 1NN6A 5B6OA 4THNH 3PO1B 1SVPA 4TWWA 2H1UA 1LKBA 2BLQA 1XVMA 3PTNA 3M36A 1HIAA 5EXMA 5C67A 1GDQA 1K1OA 3STIA 5HYOA 3RXIA 1C1UH 3SUGA 1GMDF 2ZA5A 3BIUH 4CRDA 3E0PB 2JH5D 1HJAC 3DFLA 1THSH 4WXIA 4Q7XA 3NZIA 2VIVA 1RRKA 2VU8E 4X0WU 5AFZH 3TK5A 3TJVA 5FHTA 2STAE 4X8TH 2P8OC 5G4BA 4U32A 4A5TS 1SGTA 3RXGA 2ESTE 4CRBA 1BMNH 1JOUB 2FTLE 1MAXA 1P8VC 2WYGA 1CHOF 1P12E 3SNAA 1P11E 1HNEE 3F68H 1C5QA 3QZQA 1SGDE 1EJMA 1EXFA 4O3TA 2OQ5A 2YNAA 2XW9A 1K21H 4F49A 3BEIB 1O36A 3SO3A 1NFUA 1Y5AT 2SGPE 4NFEA 1A46H 3UNSA 1WUNH 1O3EA 3QTVH 4DVAU 2H9HA 1O2IA 3RXEA 4XOJA 1DANH 4JYUH 1UVTH 1UMAH 1S6HA 1FQ3A 1BTZA 1D6RA 1MBQA 2FM2A 2R0KA 3RP2A 1ZMNA 4X6NA 1ZRKA 1J14A 1LPZB 3BEUA 3I78A 2GCHG 4BXWA 1BT7A 1UK4A 1DS2E 1BMAA 1SOZA 1EPTA 2PKSC 3ATLA 5DPAA 4YOIA 3M35A 1OP2A 5ESTE 3A88A 1HV7A 1BTXA 1XX9A 2KAIA 4IMQA 4AORA 1O2YA 1CQQA 1EPTB 1HAPH 1EZXC 1QQ4A 2F9NA 2ZIQH 1BTYA 1HJ9A 2P3UB 1O3OA 1IQLA 2A32A 1P05A 2GDDA 3PB1E 1P57B 3GCTF 3PROA 3TU7H 2PSYA 4Q7ZA 1SLUB 2XC0A 2ZHQH 2F9PA 3LGYA 4XFQA 4ZXXH 4WVPE 2VIPA 2ZQ2A 5FX6A 2XRCA 1GVKB 1HXEH 1KTTB 1E37B 1RFNA 3TITA 4RN6A 3O8CA 1MMJN 1QY6A 1ANEA 1TRYA 5AF9H 1AU8A 1O3BA 3PTBA 2HPPH 2VIOA 1O3PB 3KHVA 1N1LA 2FI5E 1O2KA 1UVOA 2BVXH 5LH8A 1HFDA 1DVAH 2R0LA 2ZGJA 1GI3A 2A45B 4X2WA 1AFQC 5EXLA 2FMJA 5PTPA 4I7YH 2ZDNA 1OWIA 1KXCA 1T31A 3N7OA 4NSYA 3ZZBA 1VZQH 2AS9A 2FYQA 4X2XA 1O3DA 1AB9C 1G3EA 4WWYA 1G3DA 2D2DA 3LKWA 4DCDA 1W13U 1KLJH 4AG2A 2GZ8A 1GI0A 2P3TB 5L2ZH 1K1PA 3BTFE 2A5KA 3GY4A 4X6OA 5HMAA 5A0BA 2BVSH 1L1NA 2ZU5A 4UDWH 2O8WA 3RXPA 2QC2A 1DWBH 1E38B 4XDEA 1UTOA 3T26A 1P02A 1NRNH 1O34A 1OXGA 1W7XH 1JIRA 1HYLA 3GY6A 1IQJA 4QT8C 1K22H 4UFFH 1GI1A 1GBLA 1ZTJA 1NY22 5DP6A 1O3MA 2CGAA 1C1SA 4ZH8A 1T4VH 2A7CA 3LPRA 4K8YA 2ZTZA 3A7YA 1GBKA 4CBNA 4BAMB 2W7UA 2IOTA 3RXVA 2CF9H 1O2ZA 3L3TA 3SUFA 2BHGA 3SV7A 3F6UH 2WPKS 1Z6JH 4NSVA 2VH0A 4B74A 1G30B 3GDSA 3OYPA 3CENA 2XBWA 1BITA 4ABGA 2GCHF 1S84A 2BZAA 4BTTB 1GJ9B 1WU1A 1L4DA 1NTPA 2P93A 1KYNA 3C1KA 1CVWH 2FPZA 3P8OA 2OP9A 1N6YA 2C8YB 8KME2 2BXTH 3M61U 5EQQA 5EXNA 1THRH 1BTHH 2BY7X 1TBQH 2AMPA 5FBIA 1CE5A 3TNTA 1FY4A 3M5NA 1HIAB 3B9FH 3HK3B 4GAWA 3RMLH 1C5VA 1YPJH 3PWBA 3ESTA 2Q6FA 1FUJA 1GVZA 2OLGA 1GJ6A 2CN0H 2BQ7B 3NPSA 1GMHG 3F9GA 1O3LA 3Q76A 1NROH 4DOQA 6GCHG 2EI7A 3ZVGA 2BTCE 3P17H 4WH6A 1ELEE 3GCHC 2ZGBH 1P2MA 3SHCH 1KY9A 1EASA 1GBAA 1YPGH 3UNQA 2Y80A 1GJCB 2FX6A 1QB1A 2XCNA 4ABJA 3LONA 1UJ1A 1GMCG 8GCHF 2AYWA 1ZSJA 4KTSA 4TPIZ 4K8BA 1O2TA 1GDUA 2B7DH 2C8ZB 1SGYE 3ZZAA 3GDVA 1XVOA 1DPOA 4BXSA 3BG4B 1HXFH 1IQEA 4ABAA 3D49H 2G4TA 3RUOA 3HGNA 2OXSA 2J9NA 1UTNA 2BMGB 2OC8A 5A0AE 1TABE 2C3SA 1CHGA 1DDJA 3IWMA 1U6QA 1C2HA 2WINI 1C5MD 5DP4A 1MTNC 1O0DH 1S0RA 2FYRA 1IQGA 3PMHB 3PO1C 2QF0A 2JKHA 1MKWK 2CHAC 3RXAA 5EG4A 1ABJH 3DUXH 1NFWA 3RMNH 1TPPA 3TK9A 4E06H 1M9UA 5TJXA 2RA0A 1K2I1 4DJZB 1YLCA 4DT7B 1ETRH 2A2XH 3MNCA 2EC9H 3BF6H 4Y71A 3ODDA 1BIOA 1HAIH 2Y7XA 1EAXA 5AFYH 1NM6A 1W14U 4TWYA 2FLRH 1LQEA 3A8AA 2FDAA 1UVSH 3F9EA 2G51A 4FUDA 1QJ6B 4K1SA 1J8AA 4OS2A 5GDSH 5GJ4B 2Y5GA 1NFYA 1A3EH 1SG8B 4MQAA 5T6FA 2LPRA 1RTLA 2VGCC 1N8OB 3RXQA 1GHBG 1YKTA 2GTBA 2ZU2A 2OBQA 1C2KA 2QYIA 1NZQH 3BSQA 4YOJA 1O3CA 1Q3XA 2OTVA 1QBNA 3GY8A 2AEIH 4NA8A 1C5RA 2J2UA 2BD5A 1INCA 1B7XB 1Z7KA 4LK4A 1V2OT 4RKOB 1QRZA 4ISHH 1C1RA 1NU7B 2FIRH 1ZRBA 2IJOB 1O2NA 3TJOA 4JMYA 3ZZ7A 2YNBA 4RKJB 1Y3UA 2BY8X 1ZTKA 2OINA 1BQYA 1GMDG 4GLYA 3AW0A 4FXGH 1TX7A 3TGKE 4GPGA 3W94A 5HM2A 4TY6A 2CMYA 1WYKA 3EQ0H 3TH4H 2TGDA 4WF8A 1GCDA 4D9RA 4GCHG 3QO6A 1BRBE 5C5OA 3TH3H 1QL7A 4AZ2B 1P9SA 3SBKA 2NU2E 1ZHPA 1A5IA 1O3HA 5JB8S 4Y10E 3S69A 3RXHA 1LMWB 1ZLRA 5AVDA 1P01A 2JETC 1HAXB 1QTFA 4X6PA 3TLOA 1PPCE 4ZXYH 4OS4A 1FY3A 4YT7H 4OS7A 5BRRE 5C1YA 4K1EA 1O39A 1CBWC 1ZHMA 4K1TA 1TGBA 1UHBB 3T62A 4Y76A 1TOMH 2BDBA 1P2OA 4B71A 2JH0D 1F5RA 1QL8A 4KKDA 1HRTH 2V6NA 3L6PA 2HPQH 1QRXA 1C2EA 3P8FA 1QL9A 4FUIA 1BB0B 1DY8A 5BPEA 2FESH 2UUKB 1GHZA 3MNXA 1O3FA 5E8EH 3UREA 4ASHA 1O5GH 4UONA 1ZTLA 3O8DA 1GJAB 3QN7A 4O9VA 3S7KB 6CHAC 1GL1A 1Y3WA 3VXFH 1C5TA 1CU1A 3GY2A 4AYVB 5EQRA 2TGPZ 3BTTE 4XSKU 1XMNB 1AVWA 1XUKA 3W95A 3ZZ5A 1ZPBA 2XWBI 3RXJA 3SJ9A 2F9UA 6GCHF 2HNTC 1FAXA 4MPXA 4WMEA 3RM2H 2BXUH 5C1XA 4R0IA 1DM4B 3VB4A 3MI4A 2XBVA 1H1BA 3O8RA 4U30A 2OD3B 1QR3E 1C1QA 2Z9KA 3BV9B 1ELTA 3A7TA 1LQDB 2BDHA 3SGAE 1O3NA 1KXFA 2G5NA 2UUFB 4JCNA 5EU8A 3CS7A 4FUBA 4GVUA 3PV4A 2BLVA 1DY9A 4MPWA 1O30A 2XXLA 2ZKSA 4OGXA 4BAKB 1JMOH 2J38A 1YP9A 2NU3E 1BCUH 2FXRA 1K28D 3JZ2B 1FIZA 2PLXA 1GG6C 1SBWA 1SGPE 2PUQH 2A5IA 3PMJA 1SC8U 4I8LA 3SU0A 9LPRA 3VEQB 4CRFA 2Q6GA 2D26C 2XWAA 3RU4D 2VIDA 1KDQB 1C1MA 3EYDA 2O8TA 4YO9A 1PFXC 1BJUA 1LHCH 2GCTB 4FVBA 1RJXB 4ISOA 3ZZCA 2OUAA 2B8OH 3LGVA 2FTMA 4ZKOU 3SJOA 2QXHA 1O3IA 1H9IE 3ATWA 4FUCA 1MD8A 1SQTA 1EOLA 1YYY1 1SGEE 4D9QA 2BD7A 2R2MB 1XXDA 4Y0ZE 1E34B 1W12U 3SU2A 2FOEA 4YZUA 4A1VA 1ABIH 1TNHA 2GDEH 1LVOA 1P2IA 5SGAE 1C2MA 1GHYH 2TGAA 5EW1H 1BTUA 4AX9H 1QB9A 2BX3A 4ZMAH 6ESTA 1OWJA 1FXYA 4NIVA 3A81A 3OY5U 4TY7A 3ZVFA 3UOPA 2BDCA 1EZQA 1T8OA 3A86A 5CHAB 4ABFA 3QGNB 3MHWU 5JBAS 5TCAA 1AUTC 1BRCE 3HGPA 2FS9A 1ESTA 8LPRA 1FONA 4M7GA 1K1MA 1D6WA 1D9IA 1TNKA 2SGQE 3S0NA 1V2NT 1F0RA 1UTPA 1W7GH 4BNRA 3LGWA 1A61H 2C90B 3MNBA 5JB9S 1EP6A 3SHAH 3TPIZ 5A2MH 4IS5A 2H2ZA 1D4PB 1LVMA 1O32A 4A6LA 4ZHMU 2QXIA 1SOTA 3TJUA 3BG8A 1OOKB 2PKAB 2PKAA 3MO3A 4CRGA 1FZZA 1O5AB 1C1VH 4NCYA 2R3UA 5EODA 3UR6A 1CT2E 2BM2A 3A7VA 1Q31A 1O31A 2A7HA 2VIWA 3KQEA 1ESBA 2F9BH 1C1OA 5F8XA 3EAJA 1FY8E 1ZGIA 4CRAA 4HFPB 4X8VH 4A92A 1S83A 2ZCKP 1TQ0B 4LZ1H 1TIOA 2QAAA 1GJ8B 1TALA 1LVYA 2ZFSA 5EGMA 1TB6H 2ZG0H 4IW4E 2CF8H 1SL3A 4YT6H 1N8OC 4MG3A 2F91A 4KELA 5IYTA 4JZIA 1IHSH 3QDZB 1A4WH 1P3CA 3E1XB 5FPYA 3U9AH 4ZKRU 1SLVB 1A0JA 4WJG2 3OY6U 1SGFG 5H4IB 2AMDA 3V3MA 5JDUB 3SN8A 1GBHA 2TBSA 2Z3CA 2XNIA 1W2KH 2VNTA 5A8XA 2AGEX 1A5GH 4B2CA 3VPKA 1K1LA 3FVFB 1A2CH 1AI8H 1A3BH 4ZKSU 3A80A 4I8KA 1N6XA 4Y8YA 1HGTH 2GV6A 2WPLS 1EAUA 2ZDVH 2HNTE 4DIHH 1QHRB 1W10U 2BQ6B 4VGCC 4KTCA 3R3GB 4X8UH 1BA8B 4AG1A 3NKKA 1LO6A 4YTAA 3EGKH 2ZO3H 1MTSA 2ULLA 2STBE 4AN7A 1XXFA 2KAIB 2ZWLH 2PR3A 1KDQA 2ZI2H 2XBYA 1C2IA 1SPJA 2ZU4A 1TLDA 1IQHA 2Z94A 3MNSA 3FZDA 2ANKH 1DWDH 2GT8A 1SMFE 1S82A 2QXGA 1HBTH 1H9HE 1HDTH 3E0NB 4WY3A 2BZ6H 2ZNKH 1GJDB 3LIWA 2BOKA 3KQDA 1TQ7B 5LPRA 1YPMH 1H4WA 1VR1H 4ABBA 2BQWB 4BTUB 1FNIA 3QX5H 1MCVA 2Z3EA 1JRTA 4U2WA 5A8YA 3SI3H 1WQVH 2WV4A 2ZGXH 1UTKA 4CR5A 3SUDA 1BZXE 2P16A 1WBGB 3KQBA 1FPCH 5FBEA 2FOCA 3LDXH 1EZSC 3RXDA 3BEFB 3VXEH 1VJAU 4MNVA 1QFKH 1RXPA 2ZPRA 1MTVA 1GCTC 4ISNA 1C2DA 1F5KU 1IHTH 1C5WB 2HRVA 3QUMP 3UOUA 1ZR0A 3HKIB 1LPKB 1GBBA 1O2WA 2F83A 5LPEA 1F2SE 3MH6A 4NA9H 1VITH 4HZHA 1C4Y2 1OYQA 2EA3A 1ELVA 4GHQA 3E90B 1AHTH 1SSXA 3EDXB 1RGQA 2O9QA 2J4IA 5DK1A 3E91A 1OWDA 4IMZA 2PHBA 1YPLH 1ARBA 2CXVA 2ZFRH 2BDAA 2P94A 3O8BA 4ZAEA 3SJ8A 2VVUA 4I8GA 2A4GA 4E7RG 1A0LA 1CT4E 2H9EH 4FUEA 3GY7A 2Y7ZA 1ZPZA 1AVGH 2GT7A 1C2JA 1XKBC 2FOAA 1KLIH 1YPKH 4MLFB 1GI8B 1JWTA 2VINA 3BTEE 3NUMA 3VB3A 4BOHA 3SZNA 1TNIA 4ZHLU 1V2ST 1FN8A 3UPEA 4DG4A 1EZUC 4DY7B 1CA8B 1J17T 4Y0YE 4YOGA 4FU8A 1BRUP 1C4V2 1GG6B 2C8XB 5C20A 3VB6A 5HGGA 1O2JA 3U8OH 2AMQA 4FVDA 4BAQB 2F3CE 3VB7A 1LHGH 2K1QA 2Y81A 5L2YH 4ZHAA 1TX6A 3S7HB 1FV9A 1UVUH 3S9CA 1WTGH 5DG6A 5EOKA 3FZZA 3OX7U 1DSTA 2PWXA 2C8WB 1ELDE 3A84A 2IPHA 1NRPH 1UVPA 2WYJA 1F5LA 2BDIA 3G01A 4ISLA 1ZZZA 1UHBA 4INHA 1O5FH 3B8JA 5J4QA 2GX4A 2SNWA 4A1TA 4NA7A 1V2VT 4A1XA 2UUYA 1XKAC 2ZCHP 1AE5A 3VB5A 1SLXB 4Q2KA 2PW8H 5L6NH 1TRNA 1P09A 4KGAA 1AE8H 2ZTXA 1DLKB 1WV7H 1LPGB 1YBWA 3SJKA 1MKXK 3K6YA 1GDNA 1HCGA 2QIQA 3ZVDA 1AB9B 1TBRH 2ZZUH 4ABHA 1QQUA 2FEQH 5TCCA 1AFQB 1KIGH 1V2RT 4AFUA 1TGCA 5DKMA 3ZZ6A 4B2BA 3LH1A 2ANMH 4I8HA 3ENSB 2A0QB 1G3BA 1T8LA 1AZ8A 2ZDKA 3LT3A 1DLEA 1SGIB 4AFZA 4NG9H 5F8ZA 1SI5H 3ZYEA 2ZHWH 1MU8B 5C2ZA 1X7AC 3VFEA 2BYAX 1C1NA 1YPHE 3MU0A 4ZROA 1C5XB 3Q3KA 1OP8A 2XYAA 1CBWB 3M7TA 3UFAA 3A87A 1EPTC 1AZZA 3I29A 1GBEA 2JETB 4SGAE 3MU8A 3M5OA 4GSOA 1UTMA 4K60A 1AY6H 1GPZA 2CJIA 1TGSZ 3P95A 1S0QA 4RSPA 3SI4H 1BMMH 1AFEH 1GBJA 1WSSH 1GHAF 4NFFA 1VJ9U 1K1JA 2G4UA 1MTUA 5E0JA 1F0SA 1F0TA 2GZ9A 1C5LH 2BLWA 5A09A 3GOVB 3QK1A 1Y3VA 2BY6X 2FZZA 3ITIA 4B75A 5FCKA 1MKXH 1QBOA 2ZECA 3B23B 3SU1A 2SGDE 2ALPA 1PPBH 4UEHH 1BJVA 3U8TH 2AH4X 2UUJB 5EQSA 4DGJA 1QNJA 1SHYA 2FI4E 4CH2B 1O2MA 2A31A 1HAYB 3PYHA 5J4SA 2Z6BD 1OPHB 2FOFA 4KP0A 1C5ZB 1O2RA 5A0CA 1ZMJA 1O2LA 1O5BB 3UR9A 1KXAA 2VIQA 1Z6EA 2HGTH 4B76A 5GWZA 4I8JA 3QWCH 4Z6AH 3M5MA 1TE0A 2ANWA 2R2WU 1P2JA 1EB2A 1O38A 3SUEA 3SV8A 4U01A 4OGYA 3CP7A 4YLQH 3KEEA 1NRSH 2SGFE 5K7RA 1DE7H 2FOGA 1ZSKA 1GJ7B 1SGNE 3FFGA 1O3GA 1ETSH 4TYDA 1SQOA 4YM9A 3TGIE 1GHVH 2W26A 1MD7A 2Y82A 3UQVA 3MO9A 4Z0KA 4MTBA 3SW2B 2ZFPH 3MFJA 4MVNA 2PSXA 4X1PU 2Z7FE 2UWLA 1GGDB 1XM1A 1O5DH 1PQ7A 3R0FA 2H6MA 1JBUH 1RD3B 3ZZ3A 2O8MA 4IC5A 1EJNA 3BTWE 4Y6DA 1P2QA 1TRMA 1C5NH 1FIWA 1HAGE 2ZHDA 4NZLA 2TGTA 2SFAA 4K5ZA 2A4RA 1DUAA 3LC5A 1TPSA 2A2QH 3UNRA 4H42U 1G2MA 3SV2H 1HAHH 4YLUA 1AMHA 2AFQB 3ELAH 3P6ZB 1H9LB 3ATKA 1NESE 3LJOA 3A8DA 2B0FA 2ZDLA 1VGCB 3BG4C 2LNCA 4OS6A 1HPGA 1AWFH 1CGJE 4AFSA 1S5SA 2HALA 1OSSA 1CSOE 1QB6A 1FLEE 1AKSB 1NRRH 1WQSA 4UD9H 5FCRA 3RXTA 1TGTA 1VITF 1G3CA 1NU9A 4XBBA 4X1NU 1K9OE 2SGEE 3GCHB 3BIVH 5JBCS 3T27A 2AGGX 3MU1A 1PPEE 3E8LA 3MOCA 3SU6A 1E35B 2G81E 3F9HA 2AIPA 3TJNA 3CS0A 4ABEA 2PGQB 1EATA 3AAVA 1CO7E 1L1JA 3IG6B 4FUGA 5C3NA 2BVRH 2VH6A 3ZZ8A 1GI9B 3TH2H 1JXPA 1T7CA 2GVFA 4YESB 1F0UA 1LTOA 2ASUB 3RU4T 1P10A 3SGQE 5LGOA 2FX4A 1KSNA 2A1DB 1O3KA 3LH3A 1TA6A 3MH4A 3TIUA 2QA9E 1L2EA 7LPRA 5DP7A 3E3TA 3H7OA 3PMAB 4I33A 4ISIH 1QGFA 3GICB 4I32A 1ZYOA 2QY0B 2O8UA 3GCNA 3QTOH 1E36B 2QCYA 1TBZH 3MU4A 2I6SA 1C9PA 3Q3YA 5FAHA 1C2FA 1O3JA 4FU7A 3BTME 1UCYE 3A7ZA 3TK6A 1ETTH 1L0ZA 1PPZA 2EI6A 1SFIA 1TNGA 4B1TA 1GHXH 1Z1IA 1V3XA 5DP3A 2W3IA 3LGTA 7KMEH 2G00A 9ESTA 3SV6A 1BHXB 2BY5X 2QF3A 3TGJE 3MH7A 2A7JA 1J15A 1TPAE 3UY9A 4X1SU 2FS8A 3KIDU 2EI8A 3OU0A 5CMXH 5E0GA 4NIXA 3BTHE 1PYTC 1QJ7B 1Z8IB 3ZVBA 1GHWH 4K3JA 1YF4A 3RLWH 1MUEB 1HUTH 1BBRE 5T6DA 4GUXA 3V7TA 1AGJA 1V2KT 2B9LA 3KGPA 1DICA 4WH8A 1UK2A 3BTDE 1YCPM 3NK8A 2J95A 2WV5A 3MH5A 1FAKH 2FOBA 2SGAA 1W8BH 2BD8A 3AW1A 3E16B 4LZ4B 2NU0E 1HAOH 2TPIZ 2PUXB 3NWUA 4WMFA 2W5EA 5JPMH 2TRMA 1W0ZU 2BY9X 3QGJA 1YLDA 1ZJKA 1YPHC 2BX4A 2G52A 4IBLH 3UWIA 3BTGE 1V6DA 3RXRA 1C5YB 3HATH 1EB1H 5LPFA 4BAOB 5DGJA 3A83A 2QV1A 1AIXH 3IITA 3T28A 1OWEA 3FAOA 3TNSA 3ZVCA 1AVXA 2GCTC 3OSYA 1BMLA 1C5OH 1O33A 2ZU3A 1CGIE 7ESTE 1OWHA 3D23A 3GYMA 2V3HH 2V0BA 5DO4H 1UTLM 1Z8GA 2Q6DA 1O2QA 1E0FD 4NGAH 1AN1E 1TNJA 2J92A 2HVXA 4IN2A 4TPYA 2PTCE 2ODQA 4NZQA 4NWKA 2FP7B 4JYVH 5JYIA 4JZ1A 2UWOA 1EQ9A 3I77A 2ZF0H 1GMHF 4JK6A 1IOEA 2G55A 1SB1H 1T32A 2HNTF 2NU4E 3DD2H 3LOXA 2HOBA 2PKSB 1J16A 5DP5A 1KXDA 1IAUA 2V35A 1V2UT 1SGFA 3RXOA 3MMGA 5EPYA 1BDAA 2HLCA 3A8CA 3PMBB 1NFXA 4X2YA 2Q1JA 2FI3E 3EA7A 3ODFA 3FP7E 4O3UA 3SNEA 2ZU1A 1ANBA 2RG3A 1DXWA 1DUEA 1SFQB 3U1IB 2O8LA 4ABDA 1NS3A 1ANDA 1WAYB 1F92A 3KN2A 3ZYDA 3UWJH 1MKWH 3SJIA 4O97A 1DOJA 4CRCA 6CHAB 3FP6E 1VITG 1V2QT 1EUFA 1GI6A 4X1RU 1D3QB 1S85A 4IGDA 3SU4A 1P0SH 1QBVH 2ZGHA 1WOFA 2FOHA 1AUJA 3SQHE 4K2YA 2EEKA 1P06A 1TWXB 1UCYH 2C4FH 3AVZA 2W7SA 2W3KA 1TYNA 5JBTA 1W0YH 4INLA 3RU4E 1QRWA 2ALVA 5GCHG 4B73A 1AO5A 1GVLA 1MQ6A 1HJAB 1GBTA 4E7NA 2FLBH 2ZP0H 1P03A 4MPUA 2R9PA 3RMOH 1ACBE 1THPB 1ANCA 1C4U2 3PLPA 4JYTA 4K69A 4Q7YA 3MYWA 1SHHB 4X6MA 3ZZ4A 4ESTE 1DX5M 5C1UA 4MDSA 1MBMA 3LGIA 1PPFE 3GY5A 1TX8A 4CBOA 1W11U 3UQOA 1HAVB 3H7TA 3U69H 2OCVB 4CH8B 3A85A 1GCTB 1GI7B 1LCYA 4Y79A 2TIOA 1ZHRA 1NO9H 1Y59T 4JK5A 4SGBE 1EJAA 4OS5A 4JZEH 2A5AA 2DE9A 2NU1E 1G32B 2JH6D 3M3TA 1BTWA 2ZPSA 1CA0C 1V2MT 5ETXA 3EE0B 2WPJS 4X8SH 3P92A 1C2LA 2VWOA 3PLKA 2BDYA 3U8RH 5JBBS 5AHGH 5GIBA 5T6GA 1KXEA 1VCWA 2OQUA 1ELFA 1YPEH 2QN5T 3P8GA 4PROA 3QZRA 1L1GA 2ODYB 3URDA 1QURH 1ZJDA 4MNXA 2ZC9H 5GXPA 1OKXA 1Y5UT 1DT2A 1QCPA 1Z8RA 2Z9JA 4DIIH 1AD8H 1DITH 1HJ8A 4WXVA 1BOQA 3RC4A 1HLTH 2BD9A 4H6TA 3RC5A 1CHOG 1B0FA 5A8ZA 1O2UA 3M7QA 4DW2U 2WPIS 4Y7AA 2OC0A 3KNXA 4IC6A 1Y8TA 3KQCA 4LXBH 3E6PH 1ESAA 3DT0H 3Q3XA 4AFQA 1GBDA 1O2PA 1OS8A 3RXBA 2NWNA 1P9UA 4VGCB 4I31A 3RM0H 1O2GH 2IN2A 1GI4A 1HAVA 1MZAA 4J1YA 2ZTYA 3KF2A 1UO6A 4FUJA 2ZEBA 2P3FH 3ZVEA 2B5TB 1MCTA 4B2AA 3GYLB 1L4ZA 1O2XA 2FO9A 1PYTD 4CR9A 2BDGA 3C27B 1GI2A 2XCFA 3FANA 2Z9LA 2A4QA 5HM9A 1GMCF 4H6SB 1CA0B 3RXCA 1GBIA 2A4OA 3DA9B 3MWIU 2GMTC 3UUZA 1ELBA 1FMGA 2AERH 3RXFA 2V3OH 4MNYA 1XUGA 5E2OA 1XUFA 1VCQA 3BTQE 4CREA 1UTJA 5EPNA 3A8BA 1O3AA 3ZV8A 4D7GA 3JZ1B 2P95A 2CHAB 4AOQA 2FWWA 1BUIA 2ZDMA 1GBFA 2R3YA 1EAWA 1XUJA 1MTNB 4GCHF 1UTQA 3VGCC 1S6FA 3SU3A 1MH0A 1O35A 1SR5C 3SU5A 4ZUHA 3RXKA 5ABWA 1OWKA 2VVCA 1EAIA 3GDUA 1LKAA 1YCPK 2ILNA 1A5HA 5HXFA 5C5NA 1RTFB 1KXBA 3F1SB 1Z71A 4J2YB 1T8NA 4MNWA 1ELGA 4E05H 2QGRA 1IQFA 1YM0A 2QXJA 2GP9B 1ZSLA 2M5TA 1PPHE 1D3DB 3SNCA 3SQEE 2ANYA 3AASA 1C1WH 2BB4A 4AYYB 2THFB 1P04A 3M3VA 2SNVA 1K1NA 2DUCA 2DE8A 3Q77A 1A1RA 1CGHA 1V2PT 1TA2A 1XUIA 1TAWA 5FXLA 1T4UH 2VWLA 2OC1A 3LC3A 1RS0A 1QJ1B 2RDLA 2ZHFH 3SOSA 4X1QU 1RIWB 3D65E 1RTKA 1SGRE 1ARCA 2H5CA 2PV9B 1HAZB 2UWPA 2ZGCA 1EKBB 4CHAB 5CHAC 3LGUA 3DHKH 3ZV9A 3U98H 1ZPCA 1MZDA
chains in the Genus database with same CATH superfamily
5ESBA 3HKJB 3LJJA 3HPTB 4JZFH 3AK5A 4FU9A 2OBOA 3T2NA 2GD4B 2P59A 2EY4C 1V2JT 2J34A 3RMMH 2ODPA 4HTCH 1DXPA 2Z9IA 2FOMB 1C5PA 3MTYA 1IQNA 1GBMA 1IQKA 1QA7A 3HK6B 1FN6A 2F9OA 4XBDA 1SGQE 2VVVA 1LHEH 4IN1A 3T29A 1YLNA 2AGIX 2HWLB 1AWHB 3RXSA 3SORA 1TMBH 4AGJA 3PM3A 2XOKD 2XTTB 1TFXA 5CE1A 1P2KA 1F7ZA 5GPIB 4NIYA 4Q80A 1B5GH 4XRNA 1BHXF 4FUHA 5FPSA 5F03A 3SGBE 3SNBA 1YGCH 2Z9GA 5DJ7A 1ID5H 2ZQ1A 4Y11E 1V2TT 3RXUA 1PPGE 1S6LA 1MQ5A 3MO6A 2VJ1A 1XUHA 4F4OC 4ZKNU 4OS1A 3EA9A 1IQMA 1WCZA 1AKSA 3M3SA 2BD3A 4D8NA 2YOLA 2Y6TA 1O5EH 2Y5HA 3GCOA 2F9VA 2D1JA 1TMUH 1O2HA 1BRAA 1O2OA 3T5FH 5IDKA 7GCHF 1FPHH 1B0EA 1G36A 3M37A 2PFEA 5T3HA 1YCPH 1ELAA 1PQ8A 1Y3YA 2PTNA 4AGKA 1W3CA 1LVBA 1BMFD 2ZFTA 4XE4A 3U1JB 3RLYH 2GGVB 1GJ5H 1BTPA 2G5VA 1DWCH 2VWMA 3ATMA 1NBMD 2J94A 2WUCA 1MTWA 1GJBB 5HIZA 5EIYA 3RXLA 3GCTG 3BN9A 2H9TH 3SV9A 3RXMA 4D76A 1CT0E 4KTUA 2BLOA 4XBCA 1ORFA 3ZVAA 1O5CB 3V0XA 1EP5A 4HGCA 1GI5A 1LHFH 6LPRA 3S9AA 4BTIB 1FDPA 4CHAC 4JZDH 2Y5FA 3V12A 2CV3A 1Y3XA 4FUFA 2Z3DA 1UK3A 3PWCA 1RIWC 1OYTH 2BOHB 4RT0A 1Z1JA 1OX1A 3KCGH 2H5DA 3PLBA 5DP8A 2ZFQH 1TONA 3EA8A 1V2WT 1SGCA 1FJSA 1TPOA 1ZOMA 3SNDA 2J5UA 4GHTA 2XBXA 1NPMA 4Y7BA 1JIMA 1NC6A 3AAUA 3FP8E 3S9BA 1MAYA 5I46H 3A7WA 1GWAA 1FI8A 3P8NA 2ZDAH 2PGBB 4UFDH 8GCHG 1BBRK 2XC5A 3Q00A 8ESTE 5L30H 2WPHS 3MU5A 1DWEH 3A82A 4O03A 1GL0E 4A7IB 3K9XB 3WY8A 4D7FA 3M5LA 3V13A 1G2LA 1ELCA 2ZCLP 1ZMLA 4INKA 3KL6A 1K1IA 2VB0A 3K65B 1O2SA 1FY1A 1TNLA 5F8TA 3VGCB 1V2LT 1A7SA 1GJ4H 1PQAA 4LOYH 1GHAG 2C93B 1WTHD 4UFGH 1KLTA 2VWNA 5KEDA 4HI3A 1C1TA 1TMTH 1PJPA 3H5CB 1YC0A 4R8TB 1NRQH 1O2VA 1OP0A 3RDZA 3UTUH 3K6ZA 3LU9B 3NCLA 3P70B 1DSUA 1Q2WA 2GMTB 2GZ7A 5FX5A 4AB8A 5F6MA 2BD4A 1AQ7A 2ZHEH 1PQ5A 2ZPQA 1SLWB 2ZFFH 3QLPH 3T25A 3L33A 4H4FA 2FODA 2GV7A 3A89A 4ABIA 1QIXB 5EJZA 1SQAA 3ZZ9A 2AIQA 5B6LA 3RC6A 3A7XA 1Z8JB 3D62A 1VCPA 3SYJA 5E2PA 5EW2H 1MU6B 4MPVA 7GCHG 2I6QA 1H8DH 3K2UA 1P2NA 3TVJB 2GKVE 3UIRA 3M7UA 3GISB 1T8MA 4NIWA 3BTKE 1DFPA 3URCA 1C9TA 1J9CH 2G8TA 3N99A 2P8OB 1FY5A 1GHBF 3STJA 2RCEA 1GBCA 1C2GA 1TOCB 2RA3A 1EOJA 2WPMS 1S81A 3GY3A 1VGCC 1D3PB 1BBRH 1Y5BT 4FETA 1HB0B 2OC7A 4UFEH 1A0HB 1C1PA 2VGCB 1D3TB 1H8IH 1LHDH 5E0HA 1C5UA 1EX3A 1KTSB 2PP6A 4Y8ZA 1JRSA 5FPTA 4WMDA 4AB9A 1LDTT 1ZGVA 3OTJE 5DP9A 2WUBA 3DFJA 5I25A 1O37A 5C0TA 3ZZDA 2BD2A 4BAHB 1C5SA 4NWLA 2JDID 1QA0A 5GCHF 5K0HA 1UCYK 4Y8XA 3NXPA 1TGNA 4UE7H 3F9FA 4X2VA 1NT1A 2D8WA 1GGDC 4BANB 4DURA 5DN6D 1IQIA 1P3EA 2XC4A 3ATIA 1G37A 1G9IE 1NN6A 5B6OA 4THNH 3PO1B 1SVPA 4TWWA 2H1UA 1LKBA 2BLQA 1EFRD 1XVMA 3PTNA 3M36A 1HIAA 5EXMA 5C67A 1GDQA 1K1OA 3STIA 5HYOA 3RXIA 1C1UH 3SUGA 1GMDF 2ZA5A 3BIUH 4CRDA 3E0PB 2JH5D 1HJAC 3DFLA 1THSH 4WXIA 4Q7XA 2RDEA 3NZIA 2VIVA 1RRKA 2VU8E 4X0WU 5AFZH 3TK5A 3TJVA 5FHTA 2STAE 4X8TH 2P8OC 5G4BA 4U32A 4A5TS 1SGTA 3RXGA 2ESTE 4CRBA 1BMNH 1JOUB 2FTLE 1MAXA 1P8VC 2WYGA 3F0OA 1CHOF 1P12E 3SNAA 1P11E 1HNEE 3F68H 1C5QA 3QZQA 1SGDE 1EJMA 2YMSD 1EXFA 4O3TA 2OQ5A 2YNAA 2XW9A 1K21H 4F49A 3BEIB 1O36A 3SO3A 2HVYB 1NFUA 3U28C 1Y5AT 2SGPE 4NFEA 3FOAA 1A46H 3UNSA 1WUNH 1O3EA 2WV9A 3QTVH 4DVAU 2H9HA 1O2IA 3RXEA 4XOJA 1DANH 3GS9A 4JYUH 1UVTH 1UMAH 1S6HA 1FQ3A 1BTZA 1D6RA 1MBQA 2FM2A 2R0KA 3RP2A 1ZMNA 4X6NA 1ZRKA 1J14A 1LPZB 3BEUA 3I78A 2GCHG 4BXWA 1BT7A 1UK4A 1DS2E 1BMAA 1SOZA 1EPTA 2PKSC 3ATLA 5DPAA 4YOIA 3M35A 1OP2A 5ESTE 3A88A 1HV7A 1BTXA 1XX9A 2KAIA 4IMQA 4AORA 1O2YA 1CQQA 1EPTB 1HAPH 1EZXC 1E79D 1FX0B 1QQ4A 2KCYA 2F9NA 2ZIQH 1BTYA 1HJ9A 2P3UB 1O3OA 1IQLA 2A32A 1P05A 2GDDA 3PB1E 1P57B 3GCTF 3PROA 3TU7H 2PSYA 4Q7ZA 1SLUB 2XC0A 2ZHQH 2F9PA 3LGYA 4XFQA 4ZXXH 4WVPE 2VIPA 2ZQ2A 5FX6A 2XRCA 1GVKB 1HXEH 1KTTB 1E37B 1RFNA 3TITA 4RN6A 3O8CA 1MMJN 1QY6A 1ANEA 1TRYA 5AF9H 1AU8A 1O3BA 3PTBA 2HPPH 2V7QD 1O3PB 2VIOA 1N1LA 2FI5E 1O2KA 1UVOA 2BVXH 3KHVA 1HFDA 5LH8A 1DVAH 2R0LA 2ZGJA 1GI3A 2A45B 4X2WA 1AFQC 5EXLA 2FMJA 5PTPA 4I7YH 2ZDNA 1OWIA 1KXCA 1T31A 3N7OA 1NBME 4NSYA 1VZQH 2AS9A 2FYQA 4X2XA 1O3DA 1AB9C 1G3EA 4WWYA 1G3DA 2D2DA 3LKWA 4DCDA 1W13U 1KLJH 4AG2A 2GZ8A 1GI0A 2P3TB 5L2ZH 1K1PA 3BTFE 2A5KA 1KMHB 3GY4A 4X6OA 5HMAA 5A0BA 3ZIAD 2BVSH 1L1NA 2ZU5A 4UDWH 2O8WA 3RXPA 2QC2A 1DWBH 1E38B 4XDEA 1UTOA 3T26A 1P02A 2KFWA 1NRNH 1O34A 2KX4A 1OXGA 1W7XH 1JIRA 1HYLA 3GY6A 1IQJA 4QT8C 1K22H 4UFFH 1GI1A 1GBLA 1ZTJA 1NY22 5DP6A 1O3MA 2CGAA 1C1SA 4ZH8A 1T4VH 2A7CA 3LPRA 2L6OA 4K8YA 2ZTZA 3A7YA 1GBKA 4CBNA 4BAMB 3F2HA 2W7UA 2IOTA 3RXVA 2CF9H 1O2ZA 3L3TA 3SUFA 2BHGA 3SV7A 3F6UH 2WPKS 1Z6JH 4NSVA 2VH0A 1SQRA 4B74A 1G30B 3GDSA 3OYPA 3CENA 2XBWA 1BITA 4ABGA 2GCHF 1S84A 2BZAA 4BTTB 1GJ9B 1YY3A 1WU1A 1L4DA 1NTPA 2P93A 1KYNA 3C1KA 1CVWH 2FPZA 3P8OA 2OP9A 1N6YA 2C8YB 8KME2 2BXTH 3M61U 5EQQA 5EXNA 1THRH 1BTHH 2BY7X 1TBQH 2KCPA 2AMPA 5FBIA 1CE5A 3TNTA 1FY4A 3M5NA 1HIAB 3B9FH 3HK3B 4GAWA 3RMLH 1C5VA 1YPJH 3PWBA 3ESTA 2Q6FA 1FUJA 1GVZA 2OLGA 1GJ6A 2CN0H 2BQ7B 3NPSA 1GMHG 3F9GA 1O3LA 3Q76A 1NROH 4DOQA 3WW7A 6GCHG 2EI7A 3CNRA 3ZVGA 2BTCE 3P17H 4WH6A 1ELEE 3GCHC 2ZGBH 1P2MA 3SHCH 1KY9A 3SZEA 1EASA 1GBAA 1YPGH 3UNQA 1VKYA 2Y80A 1GJCB 1W0KD 2FX6A 1QB1A 2XCNA 4ABJA 3LONA 1UJ1A 1GMCG 8GCHF 2AYWA 1ZSJA 4KTSA 4TPIZ 4K8BA 5T1VA 1O2TA 1GDUA 2B7DH 4ZCNA 2C8ZB 1SGYE 3ZZAA 3GDVA 1XVOA 1DPOA 4BXSA 3BG4B 1HXFH 1IQEA 4ABAA 3D49H 2G4TA 3RUOA 3HGNA 2OXSA 2J9NA 1UTNA 2BMGB 2OC8A 5A0AE 1TABE 2C3SA 1CHGA 1DDJA 3IWMA 1U6QA 1C2HA 2WINI 2K0QA 1C5MD 4I86A 5DP4A 1MTNC 1O0DH 1S0RA 2FYRA 1IQGA 3PMHB 3PO1C 2QF0A 2JKHA 1MKWK 3MQKC 2CHAC 3RXAA 5EG4A 1ABJH 3DUXH 1NFWA 3RMNH 1TPPA 3TK9A 4E06H 1M9UA 5TJXA 2RA0A 1K2I1 4DJZB 1YLCA 4DT7B 1ETRH 2A2XH 3MNCA 2EC9H 3WWBA 3BF6H 4Y71A 3ODDA 1BIOA 1HAIH 2Y7XA 1EAXA 5AFYH 1NM6A 1W14U 4TWYA 2FLRH 1LQEA 3A8AA 2FDAA 1UVSH 3F9EA 2G51A 4FUDA 1QJ6B 4K1SA 1J8AA 4OS2A 5GDSH 2CK3D 5GJ4B 2J98A 2Y5GA 1NFYA 1A3EH 1SG8B 4MQAA 5T6FA 2LPRA 1RTLA 2VGCC 1N8OB 3RXQA 1QZ8A 1GHBG 1YKTA 2GTBA 2ZU2A 2OBQA 1C2KA 2QYIA 1NZQH 3BSQA 4YOJA 1O3CA 1Q3XA 2OTVA 1QBNA 3GY8A 2AEIH 4NA8A 1C5RA 2J2UA 2BD5A 1INCA 1B7XB 1Z7KA 4LK4A 1V2OT 2VBCA 4RKOB 1QRZA 4ISHH 1C1RA 1NU7B 2FIRH 1ZRBA 4FOUC 2IJOB 1O2NA 3TJOA 4JMYA 3KYGA 3ZZ7A 2YNBA 4RKJB 1MABB 1Y3UA 2BY8X 1ZTKA 2OINA 1BQYA 1GMDG 4GLYA 3AW0A 3DSGA 1TX7A 4FXGH 3TGKE 4GPGA 3W94A 5HM2A 4TY6A 2CMYA 1WYKA 3EQ0H 3TH4H 2TGDA 4WF8A 1GCDA 4D9RA 4GCHG 3QO6A 1BRBE 5C5OA 3TH3H 1QL7A 4AZ2B 1P9SA 3SBKA 2NU2E 1ZHPA 1A5IA 1O3HA 5JB8S 4Y10E 3S69A 3RXHA 1LMWB 1ZLRA 5AVDA 1P01A 2JETC 1HAXB 1QTFA 4X6PA 3TLOA 1PPCE 4ZXYH 4OS4A 1FY3A 4YT7H 4OS7A 5BRRE 5C1YA 4K1EA 1O39A 1CBWC 1ZHMA 4K1TA 1TGBA 1UHBB 3T62A 4Y76A 1TOMH 2BDBA 4ACBA 1P2OA 4B71A 2JH0D 1F5RA 1QL8A 4KKDA 1HRTH 2V6NA 3L6PA 2HPQH 1QRXA 1C2EA 3P8FA 1QL9A 2J98B 4FUIA 2WHXA 1BB0B 2L74A 1DY8A 5BPEA 2FESH 3KYFA 2UUKB 1GHZA 2IPQX 3MNXA 1O3FA 5E8EH 3UREA 1K0HA 4ASHA 1O5GH 4UONA 1ZTLA 3O8DA 1GJAB 3QN7A 4O9VA 5C94A 4RT1A 3S7KB 6CHAC 1GL1A 1Y3WA 3VXFH 1C5TA 1CU1A 3GY2A 4AYVB 5EQRA 2TGPZ 3BTTE 4XSKU 1XMNB 1AVWA 1XUKA 3W95A 3ZZ5A 1ZPBA 2XWBI 3RXJA 3SJ9A 2F9UA 5FL7D 6GCHF 2HNTC 1FAXA 4MPXA 4WMEA 3RM2H 2BXUH 5C1XA 4R0IA 1DM4B 3VB4A 3MI4A 2XBVA 1H1BA 3O8RA 4U30A 2OD3B 1QR3E 1C1QA 2Z9KA 3BV9B 1ELTA 3A7TA 4ACAA 1LQDB 2BDHA 3SGAE 1O3NA 1KXFA 2G5NA 2UUFB 4JCNA 5EU8A 3CS7A 4FUBA 4GVUA 3PV4A 2BLVA 1DY9A 4MPWA 1O30A 2XXLA 2ZKSA 4OGXA 4BAKB 1JMOH 2J38A 1YP9A 2NU3E 1BCUH 2FXRA 1K28D 3JZ2B 1FIZA 2PLXA 1GG6C 1SBWA 1SGPE 2PUQH 2A5IA 3PMJA 1SC8U 4I8LA 3SU0A 4F55A 9LPRA 3VEQB 4CRFA 2Q6GA 2D26C 3OEED 2XWAA 3RU4D 5CDFE 2VIDA 1KDQB 1C1MA 3F0PA 3EYDA 4YXWD 2O8TA 4YO9A 1PFXC 1BJUA 1LHCH 2GCTB 4FVBA 1RJXB 4ISOA 3ZZCA 2OUAA 2B8OH 3LGVA 2FTMA 4ZKOU 3SJOA 2QXHA 1O3IA 1H9IE 3ATWA 4FUCA 1MD8A 1SQTA 1EOLA 1YYY1 1SGEE 4D9QA 2BD7A 2R2MB 1XXDA 4Y0ZE 1E34B 1W12U 3SU2A 2FOEA 4YZUA 4A1VA 1ABIH 1TNHA 2GDEH 1LVOA 1P2IA 5SGAE 1C2MA 1GHYH 2TGAA 5EW1H 1BTUA 4AX9H 1QB9A 2BX3A 4ZMAH 6ESTA 1OWJA 1FXYA 4NIVA 3A81A 3OY5U 4TY7A 3ZVFA 3UOPA 2BDCA 1EZQA 1T8OA 3A86A 2WSSD 5CHAB 4ABFA 3QGNB 3MHWU 5JBAS 5TCAA 1AUTC 2KM0A 1BRCE 3HGPA 2FS9A 1ESTA 4TSFD 8LPRA 1FONA 4M7GA 1K1MA 1D6WA 1D9IA 1TNKA 2SGQE 3S0NA 1V2NT 1F0RA 1UTPA 1W7GH 4BNRA 3LGWA 1A61H 2IJD1 3DSPA 2C90B 3MNBA 5JB9S 1EP6A 3SHAH 3TPIZ 5A2MH 4IS5A 2H2ZA 1D4PB 1LVMA 1O32A 4A6LA 4ZHMU 2QXIA 1SOTA 3TJUA 3BG8A 1OOKB 2PKAB 2PKAA 3MO3A 4CRGA 1FZZA 1O5AB 1C1VH 4NCYA 2R3UA 5EODA 3UR6A 1CT2E 2BM2A 3A7VA 1Q31A 1O31A 2A7HA 2VIWA 3KQEA 1E1RD 2W6JD 1ESBA 2F9BH 1C1OA 5F8XA 3EAJA 1FY8E 1ZGIA 4CRAA 4Q63A 4HFPB 4X8VH 4A92A 1S83A 2ZCKP 1UW7A 1TQ0B 4LZ1H 1TIOA 2QAAA 1GJ8B 1TALA 1LVYA 2ZFSA 5EGMA 1TB6H 2ZG0H 4IW4E 2CF8H 1SL3A 4YT6H 1N8OC 4MG3A 2F91A 4KELA 5IYTA 4JZIA 1IHSH 3QDZB 1A4WH 1P3CA 3E1XB 5FPYA 3U9AH 4ZKRU 1SLVB 1A0JA 4WJG2 3OY6U 1SGFG 5H4IB 2AMDA 3V3MA 5JDUB 3SN8A 1GBHA 2TBSA 3EE7A 2Z3CA 2XNIA 1W2KH 2VNTA 5A8XA 2AGEX 1A5GH 3OTPA 3PV2A 4B2CA 3VPKA 1K1LA 3FVFB 1A2CH 1AI8H 1A3BH 4ZKSU 3A80A 4I8KA 1N6XA 4Y8YA 1HGTH 2GV6A 2WPLS 2QF4A 1EAUA 3H09A 2ZDVH 2HNTE 4DIHH 3OE7D 1QHRB 1E1QD 1W10U 2BQ6B 4VGCC 4KTCA 3R3GB 4X8UH 1BA8B 4AG1A 3NKKA 1H8HD 1LO6A 4OM9A 4YTAA 3EGKH 2ZO3H 1MTSA 2ULLA 2STBE 4AN7A 1XXFA 2KAIB 2ZWLH 2PR3A 1KDQA 2ZI2H 2XBYA 1C2IA 1SPJA 2JJ1D 1TLDA 2ZU4A 1IQHA 2Z94A 3MNSA 3FZDA 2ANKH 1DWDH 2GT8A 1SMFE 1S82A 2QXGA 1HBTH 1H9HE 1HDTH 3E0NB 4WY3A 2BZ6H 2ZNKH 1WXRA 1GJDB 3LIWA 2BOKA 3KQDA 1TQ7B 5LPRA 1YPMH 1H4WA 1VR1H 4ABBA 2BQWB 4BTUB 1FNIA 3QX5H 1MCVA 2Z3EA 1JRTA 4U2WA 5A8YA 3SI3H 1WQVH 2WV4A 5KECA 2ZGXH 1UTKA 4CR5A 3SUDA 1BZXE 2P16A 1WBGB 3KQBA 1FPCH 5FBEA 2FOCA 3LDXH 1EZSC 3RXDA 3BEFB 3VXEH 1VJAU 4MNVA 1QFKH 1RXPA 2ZPRA 1MTVA 2V3MA 1GCTC 4ISNA 1C2DA 1F5KU 1IHTH 1C5WB 2HRVA 3QUMP 3UOUA 1WDIA 1ZR0A 3HKIB 1LPKB 1GBBA 1O2WA 2F83A 5LPEA 1F2SE 3MH6A 4NA9H 1VITH 4HZHA 1C4Y2 1OYQA 2EA3A 1ELVA 4GHQA 3PRDA 3E90B 1AHTH 1SSXA 3EDXB 1RGQA 2O9QA 2J4IA 5DK1A 3E91A 1OWDA 4IMZA 2PHBA 1YPLH 1ARBA 2CXVA 2ZFRH 2BDAA 2P94A 3O8BA 4ZAEA 3SJ8A 2VVUA 4I8GA 2A4GA 4E7RG 1A0LA 1CT4E 2H9EH 4FUEA 3GY7A 2Y7ZA 1ZPZA 1AVGH 2GT7A 3PRBA 1C2JA 4XD7D 1XKBC 2FOAA 1KLIH 1YPKH 4MLFB 1GI8B 1JWTA 2VINA 3BTEE 3NUMA 3VB3A 4BOHA 3SZNA 1TNIA 4ZHLU 1V2ST 1FN8A 3UPEA 4DG4A 1EZUC 4DY7B 1CA8B 1J17T 4Y0YE 4YOGA 4FU8A 1BRUP 1C4V2 1GG6B 2C8XB 5C20A 3VB6A 5HGGA 1O2JA 3U8OH 2AMQA 4FVDA 4BAQB 2F3CE 3VB7A 1LHGH 2K1QA 2Y81A 5L2YH 4ZHAA 1TX6A 3S7HB 1FV9A 1UVUH 4P02A 3S9CA 1WTGH 5DG6A 5EOKA 3FZZA 3OX7U 1DSTA 2PWXA 2C8WB 1ELDE 3A84A 2IPHA 1NRPH 5F53A 1UVPA 2WYJA 1F5LA 2BDIA 3G01A 4ISLA 1ZZZA 1UHBA 4INHA 1O5FH 3B8JA 5J4QA 2GX4A 4HG6A 2SNWA 4A1TA 4NA7A 1V2VT 4A1XA 2UUYA 1XKAC 2ZCHP 1AE5A 3VB5A 1SLXB 4Q2KA 2PW8H 5L6NH 1TRNA 1P09A 4KGAA 5GNDA 1AE8H 2ZTXA 1DLKB 1WV7H 1LPGB 1YBWA 3SJKA 1MKXK 3K6YA 1GDNA 1HCGA 2QIQA 1W0JD 1AB9B 3ZVDA 1TBRH 2ZZUH 4ABHA 1QQUA 2FEQH 5TCCA 1AFQB 1KIGH 1V2RT 4AFUA 3OEHD 1TGCA 3DSOA 5DKMA 3ZZ6A 4B2BA 3OFND 3LH1A 2ANMH 4I8HA 3ENSB 2A0QB 1G3BA 1T8LA 1AZ8A 2ZDKA 3LT3A 1DLEA 2M2AA 1SGIB 4AFZA 4NG9H 5F8ZA 1SI5H 3ZYEA 2ZHWH 1MU8B 5C2ZA 1X7AC 3VFEA 2BYAX 1C1NA 1YPHE 3MU0A 4M9FA 4ZROA 1C5XB 3Q3KA 1OP8A 2XYAA 1CBWB 3M7TA 2YMSC 3UFAA 3A87A 1EPTC 1AZZA 3I29A 1GBEA 2JETB 4SGAE 3MU8A 3M5OA 4GSOA 1UTMA 4K60A 1AY6H 2GJGA 1GPZA 2CJIA 1TGSZ 3P95A 1S0QA 4RSPA 3SI4H 1BMMH 1AFEH 1GBJA 1WSSH 1GHAF 4NFFA 1VJ9U 1K1JA 2G4UA 1MTUA 5E0JA 1F0SA 1F0TA 2GZ9A 1C5LH 2BLWA 5A09A 3GOVB 3QK1A 1Y3VA 2BY6X 2FZZA 1COWD 3ITIA 3UAIC 4B75A 5FCKA 1MKXH 1QBOA 2ZECA 3B23B 3SU1A 2SGDE 2ALPA 1PPBH 4UEHH 1BJVA 3U8TH 2AH4X 2UUJB 5EQSA 4DGJA 1QNJA 1SHYA 2FI4E 4CH2B 1O2MA 2A31A 1HAYB 3PYHA 5J4SA 2Z6BD 1OPHB 2FOFA 4KP0A 1C5ZB 1O2RA 5A0CA 1ZMJA 1O2LA 1O5BB 3UR9A 1KXAA 2VIQA 2W6ID 1Z6EA 2HGTH 4B76A 5GWZA 4I8JA 3QWCH 4Z6AH 3M5MA 1TE0A 2ANWA 2R2WU 1P2JA 1EB2A 1O38A 3SUEA 3SV8A 4U01A 4OGYA 2WZQA 3CP7A 4YLQH 3KEEA 2SGFE 1NRSH 5K7RA 1DE7H 3N7EA 2FOGA 1ZSKA 1GJ7B 1SGNE 3FFGA 2WPDD 1O3GA 1ETSH 4TYDA 1SQOA 4YM9A 3TGIE 1GHVH 2W26A 1MD7A 2Y82A 3UQVA 3MO9A 4Z0KA 4MTBA 3SW2B 2ZFPH 2EQNA 3MFJA 4MVNA 2PSXA 4X1PU 2Z7FE 2UWLA 1GGDB 1XM1A 1O5DH 1PQ7A 3R0FA 2H6MA 1JBUH 1RD3B 3ZZ3A 2O8MA 4IC5A 1EJNA 3BTWE 4Y6DA 1P2QA 1TRMA 1C5NH 1FIWA 1HAGE 2ZHDA 4NZLA 2TGTA 2SFAA 5KGOA 4K5ZA 2A4RA 1DUAA 3LC5A 1TPSA 2A2QH 3UNRA 4H42U 1G2MA 3SV2H 1HAHH 1YWUA 4YLUA 1AMHA 2AFQB 3ELAH 3P6ZB 1H9LB 2JIZD 3ATKA 1NESE 3LJOA 3A8DA 2B0FA 2ZDLA 1VGCB 3BG4C 2LNCA 4OS6A 1HPGA 1AWFH 3PV5A 1CGJE 4AFSA 1S5SA 2HALA 1OSSA 1CSOE 1QB6A 1FLEE 1AKSB 1NRRH 1WQSA 3UB0A 4UD9H 5FCRA 3RXTA 1TGTA 1VITF 1G3CA 1NU9A 4XBBA 4X1NU 2KZ4A 4DT4A 1K9OE 2SGEE 3FN8A 3GCHB 3BIVH 5JBCS 3T27A 2AGGX 3MU1A 1PPEE 3E8LA 3MOCA 3SU6A 1E35B 2G81E 3F9HA 2AIPA 3TJNA 3CS0A 5C0UA 4ABEA 2PGQB 1EATA 3AAVA 1CO7E 1L1JA 3IG6B 4FUGA 5C3NA 4RI0A 2LP6A 2BVRH 2VH6A 3ZZ8A 1GI9B 3TH2H 1JXPA 1T7CA 2GVFA 4YESB 1F0UA 1LTOA 2ASUB 3RU4T 1P10A 1H8ED 3SGQE 5LGOA 2FX4A 1KSNA 2A1DB 1O3KA 3LH3A 1TA6A 3MH4A 3TIUA 2QA9E 1L2EA 7LPRA 5DP7A 3E3TA 3H7OA 3PMAB 4I33A 4ISIH 2OK5A 1QGFA 3GICB 4I32A 1ZYOA 2QY0B 4Q4LA 2O8UA 3GCNA 3QTOH 4AC9A 2LELA 1E36B 2QCYA 1TBZH 3MU4A 2I6SA 1C9PA 3Q3YA 5FAHA 1C2FA 1O3JA 4FU7A 5IK2D 3BTME 4P00A 1UCYE 3W1EA 3A7ZA 3TK6A 1ETTH 1L0ZA 1PPZA 2EI6A 1SFIA 1TNGA 4B1TA 1GHXH 1Z1IA 3FKSD 1V3XA 5DP3A 3ZZBA 2W3IA 3LGTA 7KMEH 2G00A 9ESTA 3SV6A 1BHXB 2BY5X 2QF3A 3TGJE 3MH7A 2A7JA 1J15A 1TPAE 3UY9A 4X1SU 2FS8A 3KIDU 2EI8A 2F43B 3OU0A 2J97A 5E0GA 4NIXA 3BTHE 5CMXH 1PYTC 1QJ7B 1Z8IB 3ZVBA 1GHWH 4K3JA 1YF4A 3RLWH 2QE7D 1MUEB 1HUTH 1BBRE 5T6DA 4B6FA 4GUXA 3V7TA 1AGJA 1V2KT 2B9LA 2JJ2D 3KGPA 1DICA 4WH8A 1UK2A 3BTDE 2YMSB 1YCPM 2QF5A 3NK8A 2J95A 2WV5A 3MH5A 1FAKH 2FOBA 2SGAA 1W8BH 2BD8A 3AW1A 3E16B 4LZ4B 2NU0E 1HAOH 2TPIZ 2PUXB 3NWUA 4WMFA 3WWFA 2W5EA 2AHME 5JPMH 2TRMA 5EJLA 1W0ZU 2BY9X 3QGJA 1YLDA 1ZJKA 1YPHC 2BX4A 2G52A 4IBLH 3UWIA 3BTGE 1V6DA 3RXRA 1C5YB 3HATH 1EB1H 5LPFA 4BAOB 5DGJA 3A83A 2QV1A 1AIXH 3IITA 3T28A 1OWEA 3FAOA 3TNSA 3ZVCA 1AVXA 2GCTC 3OSYA 1BMLA 1C5OH 1O33A 2ZU3A 3F2FA 1CGIE 7ESTE 1OWHA 3D23A 3GYMA 2V0BA 2V3HH 5DO4H 1UTLM 1Z8GA 2Q6DA 1O2QA 1E0FD 4NGAH 1AN1E 1TNJA 2J92A 2HVXA 4IN2A 4TPYA 2PTCE 2ODQA 4NZQA 4NWKA 2FP7B 4JYVH 5JYIA 4JZ1A 2UWOA 4ASUD 1EQ9A 3I77A 2ZF0H 1GMHF 4JK6A 1IOEA 2G55A 1SB1H 1T32A 2HNTF 2NU4E 3VG8A 3DD2H 3LOXA 2HOBA 2PKSB 1J16A 5DP5A 1KXDA 1IAUA 2V35A 1V2UT 1SGFA 3RXOA 3MMGA 5EPYA 1BDAA 2HLCA 3A8CA 3PMBB 1NFXA 4X2YA 2Q1JA 2FI3E 3EA7A 3ODFA 3FP7E 4O3UA 3SNEA 2ZU1A 1ANBA 2RG3A 1DXWA 1DUEA 1SFQB 3U1IB 2O8LA 4ABDA 1NS3A 1ANDA 1WAYB 1F92A 3KN2A 3ZYDA 5C17A 3UWJH 1MKWH 3SJIA 4O97A 1DOJA 4CRCA 4B6EA 6CHAB 3FP6E 1VITG 1V2QT 1EUFA 1GI6A 4X1RU 1D3QB 1S85A 4IGDA 2HLDD 1P0SH 1QBVH 2ZGHA 1WOFA 2FOHA 1AUJA 3SQHE 4K2YA 3SU4A 2EEKA 1P06A 1TWXB 1UCYH 2C4FH 3AVZA 2W7SA 2W3KA 1TYNA 5JBTA 1W0YH 4INLA 3RU4E 1QRWA 2ALVA 5GCHG 4B73A 3OAAD 1AO5A 1GVLA 1MQ6A 1HJAB 1GBTA 4E7NA 2RFKC 2FLBH 2ZP0H 1P03A 4MPUA 2R9PA 3RMOH 1ACBE 1THPB 1ANCA 1C4U2 3PLPA 4JYTA 4K69A 4Q7YA 3MYWA 1SHHB 5CHBA 4X6MA 3ZZ4A 4ESTE 1DX5M 5C1UA 4MDSA 1MBMA 3LGIA 1PPFE 3GY5A 2KCOA 1TX8A 4CBOA 1W11U 5HKKD 3UQOA 1HAVB 3H7TA 3U69H 2OCVB 4CH8B 3A85A 1GCTB 1GI7B 1LCYA 4Y79A 2TIOA 1ZHRA 3NRLA 1NO9H 1Y59T 5DSFA 4JK5A 4SGBE 1EJAA 4OS5A 4JZEH 2A5AA 2DE9A 2NU1E 1G32B 2JH6D 2K8IA 3M3TA 1BTWA 2ZPSA 1CA0C 1V2MT 5ETXA 3EE0B 2WPJS 4X8SH 3P92A 1C2LA 2VWOA 3PLKA 2BDYA 3U8RH 5JBBS 5AHGH 5GIBA 5T6GA 4F48B 1KXEA 1VCWA 2OQUA 1ELFA 1YPEH 2QN5T 2F4LA 3P8GA 4PROA 3QZRA 1L1GA 2ODYB 3URDA 1QURH 1ZJDA 4MNXA 2ZC9H 5GXPA 1OKXA 1Y5UT 1DT2A 3N7DA 1QCPA 5HIYA 1Z8RA 2Z9JA 4DIIH 1AD8H 1DITH 1HJ8A 4WXVA 1BOQA 3RC4A 3F3BA 1HLTH 2BD9A 4H6TA 3RC5A 1CHOG 1B0FA 5A8ZA 1O2UA 3M7QA 4DW2U 2WPIS 4Y7AA 3F2GA 2OC0A 3KNXA 4IC6A 1Y8TA 3KQCA 4LXBH 3E6PH 1ESAA 3DT0H 3Q3XA 4AFQA 1GBDA 1O2PA 1OS8A 3RXBA 2NWNA 1P9UA 4VGCB 4I31A 3KQ5A 3RM0H 1O2GH 2IN2A 1GI4A 1HAVA 1MZAA 4J1YA 2ZTYA 3KF2A 1UO6A 4FUJA 2ZEBA 2P3FH 3ZVEA 2B5TB 1MCTA 4B2AA 3GYLB 1L4ZA 1O2XA 2FO9A 1PYTD 4CR9A 2BDGA 3C27B 1GI2A 2XCFA 3FANA 2Z9LA 2A4QA 5HM9A 1GMCF 1SKYE 4H6SB 1CA0B 3RXCA 1GBIA 2A4OA 3DA9B 3MWIU 2GMTC 3UUZA 1ELBA 1FMGA 2AERH 3RXFA 2V3OH 4MNYA 1XUGA 5E2OA 1XUFA 1VCQA 3BTQE 4CREA 1UTJA 5EPNA 3A8BA 1O3AA 3ZV8A 4D7GA 3JZ1B 2P95A 2CHAB 4AOQA 2FWWA 1BUIA 2ZDMA 1GBFA 2R3YA 1EAWA 1XUJA 3DCLA 1MTNB 4GCHF 1UTQA 3VGCC 1S6FA 3SU3A 1MH0A 1O35A 1SR5C 3SU5A 4ZUHA 3RXKA 5ABWA 1OWKA 2KCAA 2VVCA 1EAIA 3GDUA 1LKAA 1YCPK 2ILNA 1A5HA 5HXFA 5C5NA 1RTFB 1KXBA 3F1SB 1Z71A 4J2YB 1T8NA 4MNWA 1ELGA 4E05H 2QGRA 1IQFA 1YM0A 2QXJA 2GP9B 4Z1MD 4TT3D 1ZSLA 1OHHD 2M5TA 1PPHE 1D3DB 3SNCA 3SQEE 2ANYA 3AASA 1C1WH 2BB4A 4AYYB 2THFB 1P04A 3M3VA 2SNVA 1K1NA 2DUCA 2DE8A 3Q77A 1A1RA 1CGHA 1V2PT 1TA2A 1XUIA 1TAWA 5FXLA 1T4UH 2VWLA 2OC1A 3LC3A 1RS0A 1QJ1B 2RDLA 2ZHFH 3SOSA 5EJ1A 4X1QU 1RIWB 3D65E 1RTKA 1SGRE 1ARCA 2H5CA 2PV9B 1HAZB 2UWPA 2KR7A 2ZGCA 1EKBB 3FO8D 4CHAB 5CHAC 3LGUA 2XNDD 3DHKH 3ZV9A 3U98H 1ZPCA 1MZDA
chains in the Genus database with same CATH topology
5ESBA 3HKJB 3LJJA 3HPTB 4JZFH 4FU9A 2OBOA 3T2NA 2GD4B 2P59A 1V2JT 2J34A 3RMMH 2ODPA 4HTCH 1DXPA 2Z9IA 2FOMB 1C5PA 3MTYA 1IQNA 1GBMA 1IQKA 1QA7A 3HK6B 1FN6A 2F9OA 4XBDA 1SGQE 2VVVA 1LHEH 4IN1A 3T29A 2AGIX 2HWLB 1AWHB 3RXSA 3SORA 1TMBH 4AGJA 3PM3A 2XTTB 1TFXA 5CE1A 1P2KA 1F7ZA 5GPIB 4NIYA 4Q80A 1B5GH 1BHXF 4FUHA 5FPSA 5F03A 3SGBE 3SNBA 1YGCH 2Z9GA 5DJ7A 1ID5H 2ZQ1A 4Y11E 1V2TT 3RXUA 1PPGE 3MO6A 1MQ5A 2VJ1A 1XUHA 4F4OC 4ZKNU 4OS1A 3EA9A 1IQMA 1WCZA 1AKSA 3M3SA 2BD3A 4D8NA 2YOLA 2Y6TA 1O5EH 2Y5HA 3GCOA 2F9VA 2D1JA 1TMUH 1O2HA 1BRAA 1O2OA 3T5FH 5IDKA 7GCHF 1FPHH 1B0EA 1G36A 3M37A 2PFEA 5T3HA 1YCPH 1ELAA 1PQ8A 1Y3YA 2PTNA 4AGKA 1W3CA 1LVBA 2ZFTA 4XE4A 3U1JB 3RLYH 2GGVB 1GJ5H 1BTPA 2G5VA 1DWCH 2VWMA 3ATMA 2J94A 2WUCA 1MTWA 1GJBB 3RXLA 3GCTG 3BN9A 2H9TH 3SV9A 3RXMA 4D76A 1CT0E 4KTUA 2BLOA 4XBCA 1ORFA 3ZVAA 1O5CB 3V0XA 1EP5A 4HGCA 1GI5A 1LHFH 6LPRA 3S9AA 4BTIB 1FDPA 4CHAC 4JZDH 2Y5FA 3V12A 2CV3A 1Y3XA 4FUFA 2Z3DA 1UK3A 3PWCA 1RIWC 1OYTH 2BOHB 1Z1JA 1OX1A 3KCGH 2H5DA 3PLBA 5DP8A 2ZFQH 1TONA 3EA8A 1V2WT 1SGCA 1FJSA 1TPOA 1ZOMA 3SNDA 4GHTA 2XBXA 1NPMA 4Y7BA 1JIMA 1NC6A 3AAUA 3FP8E 3S9BA 1MAYA 5I46H 3A7WA 1GWAA 1FI8A 3P8NA 2ZDAH 2PGBB 4UFDH 8GCHG 1BBRK 2XC5A 3Q00A 8ESTE 5L30H 2WPHS 3MU5A 1DWEH 3A82A 4O03A 1GL0E 4A7IB 3K9XB 3WY8A 4D7FA 3M5LA 3V13A 1G2LA 1ELCA 2ZCLP 1ZMLA 4INKA 3KL6A 1K1IA 2VB0A 3K65B 1O2SA 1FY1A 1TNLA 5F8TA 3VGCB 1V2LT 1A7SA 1GJ4H 1PQAA 4LOYH 1GHAG 2C93B 1WTHD 4UFGH 1KLTA 2VWNA 4HI3A 1C1TA 1TMTH 1PJPA 3H5CB 1YC0A 4R8TB 1NRQH 1O2VA 1OP0A 3RDZA 3UTUH 3K6ZA 3LU9B 3NCLA 3P70B 1DSUA 1Q2WA 2GMTB 2GZ7A 5FX5A 4AB8A 5F6MA 2BD4A 1AQ7A 2ZHEH 1PQ5A 2ZPQA 1SLWB 2ZFFH 3QLPH 3T25A 3L33A 4H4FA 2FODA 2GV7A 3A89A 4ABIA 1QIXB 1SQAA 3ZZ9A 2AIQA 3RC6A 3A7XA 1Z8JB 3D62A 1VCPA 5E2PA 5EW2H 1MU6B 4MPVA 7GCHG 2I6QA 1H8DH 3K2UA 1P2NA 3TVJB 2GKVE 3UIRA 3M7UA 3GISB 1T8MA 4NIWA 3BTKE 1DFPA 3URCA 1C9TA 1J9CH 2G8TA 2P8OB 1FY5A 1GHBF 3STJA 2RCEA 1GBCA 1C2GA 1TOCB 2RA3A 1EOJA 2WPMS 1S81A 3GY3A 1VGCC 1D3PB 1BBRH 1Y5BT 1HB0B 2OC7A 4UFEH 1A0HB 1C1PA 2VGCB 1D3TB 1H8IH 1LHDH 5E0HA 1C5UA 1EX3A 1KTSB 4Y8ZA 1JRSA 5FPTA 4WMDA 4AB9A 1LDTT 1ZGVA 3OTJE 5DP9A 2WUBA 3DFJA 5I25A 1O37A 3ZZDA 2BD2A 4BAHB 1C5SA 4NWLA 1QA0A 5GCHF 5K0HA 1UCYK 4Y8XA 3NXPA 1TGNA 4UE7H 3F9FA 4X2VA 1NT1A 2D8WA 1GGDC 4BANB 4DURA 1IQIA 1P3EA 2XC4A 3ATIA 1G37A 1G9IE 1NN6A 5B6OA 4THNH 3PO1B 1SVPA 4TWWA 2H1UA 1LKBA 2BLQA 1XVMA 3PTNA 3M36A 1HIAA 5EXMA 5C67A 1GDQA 1K1OA 3STIA 5HYOA 3RXIA 1C1UH 3SUGA 1GMDF 2ZA5A 3BIUH 4CRDA 3E0PB 2JH5D 1HJAC 3DFLA 1THSH 4WXIA 4Q7XA 3NZIA 2VIVA 1RRKA 2VU8E 4X0WU 5AFZH 3TK5A 3TJVA 5FHTA 2STAE 4X8TH 2P8OC 5G4BA 4U32A 4A5TS 1SGTA 3RXGA 2ESTE 4CRBA 1BMNH 1JOUB 2FTLE 1MAXA 1P8VC 2WYGA 1CHOF 1P12E 3SNAA 1P11E 1HNEE 3F68H 1C5QA 3QZQA 1SGDE 1EJMA 1EXFA 4O3TA 2OQ5A 2YNAA 2XW9A 1K21H 4F49A 3BEIB 1O36A 3SO3A 1NFUA 1Y5AT 2SGPE 4NFEA 1A46H 3UNSA 1WUNH 1O3EA 3QTVH 4DVAU 2H9HA 1O2IA 3RXEA 4XOJA 1DANH 4JYUH 1UVTH 1UMAH 1S6HA 1FQ3A 1BTZA 1D6RA 1MBQA 2FM2A 2R0KA 3RP2A 1ZMNA 4X6NA 1ZRKA 1J14A 1LPZB 3BEUA 3I78A 2GCHG 4BXWA 1BT7A 1UK4A 1DS2E 1BMAA 1SOZA 1EPTA 2PKSC 3ATLA 5DPAA 4YOIA 3M35A 1OP2A 5ESTE 3A88A 1HV7A 1BTXA 1XX9A 2KAIA 4IMQA 4AORA 1O2YA 1CQQA 1EPTB 1HAPH 1EZXC 1QQ4A 2F9NA 2ZIQH 1BTYA 1HJ9A 2P3UB 1O3OA 1IQLA 2A32A 1P05A 2GDDA 3PB1E 1P57B 3GCTF 3PROA 3TU7H 2PSYA 4Q7ZA 1SLUB 2XC0A 2ZHQH 2F9PA 3LGYA 4XFQA 4ZXXH 4WVPE 2VIPA 2ZQ2A 5FX6A 2XRCA 1GVKB 1HXEH 1KTTB 1E37B 1RFNA 3TITA 4RN6A 3O8CA 1MMJN 1QY6A 1ANEA 1TRYA 5AF9H 1AU8A 1O3BA 3PTBA 2HPPH 2VIOA 1O3PB 3KHVA 1N1LA 2FI5E 1O2KA 1UVOA 2BVXH 5LH8A 1HFDA 1DVAH 2R0LA 2ZGJA 1GI3A 2A45B 4X2WA 1AFQC 5EXLA 2FMJA 5PTPA 4I7YH 2ZDNA 1OWIA 1KXCA 1T31A 3N7OA 4NSYA 3ZZBA 1VZQH 2AS9A 2FYQA 4X2XA 1O3DA 1AB9C 1G3EA 4WWYA 1G3DA 2D2DA 3LKWA 4DCDA 1W13U 1KLJH 4AG2A 2GZ8A 1GI0A 2P3TB 5L2ZH 1K1PA 3BTFE 2A5KA 3GY4A 4X6OA 5HMAA 5A0BA 2BVSH 1L1NA 2ZU5A 4UDWH 2O8WA 3RXPA 2QC2A 1DWBH 1E38B 4XDEA 1UTOA 3T26A 1P02A 1NRNH 1O34A 1OXGA 1W7XH 1JIRA 1HYLA 3GY6A 1IQJA 4QT8C 1K22H 4UFFH 1GI1A 1GBLA 1ZTJA 1NY22 5DP6A 1O3MA 2CGAA 1C1SA 4ZH8A 1T4VH 2A7CA 3LPRA 4K8YA 2ZTZA 3A7YA 1GBKA 4CBNA 4BAMB 2W7UA 2IOTA 3RXVA 2CF9H 1O2ZA 3L3TA 3SUFA 2BHGA 3SV7A 3F6UH 2WPKS 1Z6JH 4NSVA 2VH0A 4B74A 1G30B 3GDSA 3OYPA 3CENA 2XBWA 1BITA 4ABGA 2GCHF 1S84A 2BZAA 4BTTB 1GJ9B 1WU1A 1L4DA 1NTPA 2P93A 1KYNA 3C1KA 1CVWH 2FPZA 3P8OA 2OP9A 1N6YA 2C8YB 8KME2 2BXTH 3M61U 5EQQA 5EXNA 1THRH 1BTHH 2BY7X 1TBQH 2AMPA 5FBIA 1CE5A 3TNTA 1FY4A 3M5NA 1HIAB 3B9FH 3HK3B 4GAWA 3RMLH 1C5VA 1YPJH 3PWBA 3ESTA 2Q6FA 1FUJA 1GVZA 2OLGA 1GJ6A 2CN0H 2BQ7B 3NPSA 1GMHG 3F9GA 1O3LA 3Q76A 1NROH 4DOQA 6GCHG 2EI7A 3ZVGA 2BTCE 3P17H 4WH6A 1ELEE 3GCHC 2ZGBH 1P2MA 3SHCH 1KY9A 1EASA 1GBAA 1YPGH 3UNQA 2Y80A 1GJCB 2FX6A 1QB1A 2XCNA 4ABJA 3LONA 1UJ1A 1GMCG 8GCHF 2AYWA 1ZSJA 4KTSA 4TPIZ 4K8BA 1O2TA 1GDUA 2B7DH 2C8ZB 1SGYE 3ZZAA 3GDVA 1XVOA 1DPOA 4BXSA 3BG4B 1HXFH 1IQEA 4ABAA 3D49H 2G4TA 3RUOA 3HGNA 2OXSA 2J9NA 1UTNA 2BMGB 2OC8A 5A0AE 1TABE 2C3SA 1CHGA 1DDJA 3IWMA 1U6QA 1C2HA 2WINI 1C5MD 5DP4A 1MTNC 1O0DH 1S0RA 2FYRA 1IQGA 3PMHB 3PO1C 2QF0A 2JKHA 1MKWK 2CHAC 3RXAA 5EG4A 1ABJH 3DUXH 1NFWA 3RMNH 1TPPA 3TK9A 4E06H 1M9UA 5TJXA 2RA0A 1K2I1 4DJZB 1YLCA 4DT7B 1ETRH 2A2XH 3MNCA 2EC9H 3BF6H 4Y71A 3ODDA 1BIOA 1HAIH 2Y7XA 1EAXA 5AFYH 1NM6A 1W14U 4TWYA 2FLRH 1LQEA 3A8AA 2FDAA 1UVSH 3F9EA 2G51A 4FUDA 1QJ6B 4K1SA 1J8AA 4OS2A 5GDSH 5GJ4B 2Y5GA 1NFYA 1A3EH 1SG8B 4MQAA 5T6FA 2LPRA 1RTLA 2VGCC 1N8OB 3RXQA 1GHBG 1YKTA 2GTBA 2ZU2A 2OBQA 1C2KA 2QYIA 1NZQH 3BSQA 4YOJA 1O3CA 1Q3XA 2OTVA 1QBNA 3GY8A 2AEIH 4NA8A 1C5RA 2J2UA 2BD5A 1INCA 1B7XB 1Z7KA 4LK4A 1V2OT 4RKOB 1QRZA 4ISHH 1C1RA 1NU7B 2FIRH 1ZRBA 2IJOB 1O2NA 3TJOA 4JMYA 3ZZ7A 2YNBA 4RKJB 1Y3UA 2BY8X 1ZTKA 2OINA 1BQYA 1GMDG 4GLYA 3AW0A 4FXGH 1TX7A 3TGKE 4GPGA 3W94A 5HM2A 4TY6A 2CMYA 1WYKA 3EQ0H 3TH4H 2TGDA 4WF8A 1GCDA 4D9RA 4GCHG 3QO6A 1BRBE 5C5OA 3TH3H 1QL7A 4AZ2B 1P9SA 3SBKA 2NU2E 1ZHPA 1A5IA 1O3HA 5JB8S 4Y10E 3S69A 3RXHA 1LMWB 1ZLRA 5AVDA 1P01A 2JETC 1HAXB 1QTFA 4X6PA 3TLOA 1PPCE 4ZXYH 4OS4A 1FY3A 4YT7H 4OS7A 5BRRE 5C1YA 4K1EA 1O39A 1CBWC 1ZHMA 4K1TA 1TGBA 1UHBB 3T62A 4Y76A 1TOMH 2BDBA 1P2OA 4B71A 2JH0D 1F5RA 1QL8A 4KKDA 1HRTH 2V6NA 3L6PA 2HPQH 1QRXA 1C2EA 3P8FA 1QL9A 4FUIA 1BB0B 1DY8A 5BPEA 2FESH 2UUKB 1GHZA 3MNXA 1O3FA 5E8EH 3UREA 4ASHA 1O5GH 4UONA 1ZTLA 3O8DA 1GJAB 3QN7A 4O9VA 3S7KB 6CHAC 1GL1A 1Y3WA 3VXFH 1C5TA 1CU1A 3GY2A 4AYVB 5EQRA 2TGPZ 3BTTE 4XSKU 1XMNB 1AVWA 1XUKA 3W95A 3ZZ5A 1ZPBA 2XWBI 3RXJA 3SJ9A 2F9UA 6GCHF 2HNTC 1FAXA 4MPXA 4WMEA 3RM2H 2BXUH 5C1XA 4R0IA 1DM4B 3VB4A 3MI4A 2XBVA 1H1BA 3O8RA 4U30A 2OD3B 1QR3E 1C1QA 2Z9KA 3BV9B 1ELTA 3A7TA 1LQDB 2BDHA 3SGAE 1O3NA 1KXFA 2G5NA 2UUFB 4JCNA 5EU8A 3CS7A 4FUBA 4GVUA 3PV4A 2BLVA 1DY9A 4MPWA 1O30A 2XXLA 2ZKSA 4OGXA 4BAKB 1JMOH 2J38A 1YP9A 2NU3E 1BCUH 2FXRA 1K28D 3JZ2B 1FIZA 2PLXA 1GG6C 1SBWA 1SGPE 2PUQH 2A5IA 3PMJA 1SC8U 4I8LA 3SU0A 9LPRA 3VEQB 4CRFA 2Q6GA 2D26C 2XWAA 3RU4D 2VIDA 1KDQB 1C1MA 3EYDA 2O8TA 4YO9A 1PFXC 1BJUA 1LHCH 2GCTB 4FVBA 1RJXB 4ISOA 3ZZCA 2OUAA 2B8OH 3LGVA 2FTMA 4ZKOU 3SJOA 2QXHA 1O3IA 1H9IE 3ATWA 4FUCA 1MD8A 1SQTA 1EOLA 1YYY1 1SGEE 4D9QA 2BD7A 2R2MB 1XXDA 4Y0ZE 1E34B 1W12U 3SU2A 2FOEA 4YZUA 4A1VA 1ABIH 1TNHA 2GDEH 1LVOA 1P2IA 5SGAE 1C2MA 1GHYH 2TGAA 5EW1H 1BTUA 4AX9H 1QB9A 2BX3A 4ZMAH 6ESTA 1OWJA 1FXYA 4NIVA 3A81A 3OY5U 4TY7A 3ZVFA 3UOPA 2BDCA 1EZQA 1T8OA 3A86A 5CHAB 4ABFA 3QGNB 3MHWU 5JBAS 5TCAA 1AUTC 1BRCE 3HGPA 2FS9A 1ESTA 8LPRA 1FONA 4M7GA 1K1MA 1D6WA 1D9IA 1TNKA 2SGQE 3S0NA 1V2NT 1F0RA 1UTPA 1W7GH 4BNRA 3LGWA 1A61H 2C90B 3MNBA 5JB9S 1EP6A 3SHAH 3TPIZ 5A2MH 4IS5A 2H2ZA 1D4PB 1LVMA 1O32A 4A6LA 4ZHMU 2QXIA 1SOTA 3TJUA 3BG8A 1OOKB 2PKAB 2PKAA 3MO3A 4CRGA 1FZZA 1O5AB 1C1VH 4NCYA 2R3UA 5EODA 3UR6A 1CT2E 2BM2A 3A7VA 1Q31A 1O31A 2A7HA 2VIWA 3KQEA 1ESBA 2F9BH 1C1OA 5F8XA 3EAJA 1FY8E 1ZGIA 4CRAA 4HFPB 4X8VH 4A92A 1S83A 2ZCKP 1TQ0B 4LZ1H 1TIOA 2QAAA 1GJ8B 1TALA