4OS1A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk601 (bicyclic 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A01
1O5DH 3DT0H 1C5LH 1K1OA 4RN6A 1LMWB 1Z8GA 5HXFA 2H9EH 1VJ9U 5FAHA 1O5GH 2OBOA 1ZPCA 1YCPK 1UCYK 4IMQA 4UFGH 2XWBI 2ZGCA 2VVCA 3UNQA 3SU1A 1FPCH 2ODYB 3ITIA 3TPIZ 8ESTE 2QF3A 1FY8E 1XMNB 5FBIA 1GCDA 2TGDA 2TGAA 4Y76A 1VGCC 4AZ2B 1DXPA 3EDXB 3UY9A 2A5IA 3F1SB 1HUTH 4ISIH 1OPHB 2JETC 1N1LA 3U8RH 1EZQA 1AY6H 3CS7A 4DG4A 2F9PA 3ZZ4A 1CA0B 3T29A 2ZHQH 1F2SE 1N8OC 2ZTXA 1G3CA 2ZHEH 2BXTH 3QUMP 3IITA 1GJ4H 1AGJA 1A61H 5CMXH 2BY6X 4YO9A 2FOFA 2FTMA 2O8LA 1GHZA 4IN2A 1MBMA 1MKWH 3STJA 1GJ5H 4ASHA 4GUXA 1AVGH 4JZDH 1SOTA 1O3GA 4X1RU 1SB1H 3S9CA 3H5CB 1TA6A 5T3HA 1DUAA 2OINA 4MLFB 1V2VT 2HOBA 4ISLA 1FN8A 4K8YA 2FOBA 3MHWU 3BTME 2OLGA 1QA7A 3MOCA 1QBNA 1BHXB 2ZTZA 1ANDA 1O3JA 2Q6GA 1TFXA 1IQNA 3BSQA 2FOMB 1GBBA 3RMNH 4CRAA 3O8RA 1J8AA 4AFUA 1VITF 1QGFA 3KQDA 1WV7H 3FP6E 4MNXA 1H4WA 1SGEE 4AG1A 2BDGA 1PYTC 2Z9GA 1TBRH 4NCYA 3RXPA 5GJ4B 4OGXA 3SUGA 1WCZA 1ANBA 2ZCKP 1AZZA 1D4PB 2ZU4A 1O3DA 3MO9A 2QGRA 3ATLA 1O2KA 3LIWA 3E6PH 1GI4A 6CHAB 1GHVH 3RXHA 1GI1A 1O5EH 1TALA 1W11U 2BMGB 3ZZAA 2YOLA 1MZAA 2FI3E 1OX1A 4BANB 1GHBG 2F9BH 3BN9A 1Q3XA 3AASA 1MKXH 1FONA 5AFZH 4K60A 1LQDB 1AWFH 1OXGA 2QN5T 2ZFQH 4MG3A 2ZDKA 1O2HA 1BIOA 3UQOA 2QCYA 2ZU3A 3M7TA 2V3OH 3T26A 4AB9A 3OU0A 2OBQA 1P9UA 1SOZA 4D7GA 3KNXA 1ZHMA 2VIPA 1ZTJA 1Y5AT 1GG6C 1HDTH 4ABBA 5AVDA 3TIUA 4TYDA 1C1QA 1S6FA 3FP7E 3F6UH 1RS0A 4J1YA 1WU1A 2FP7B 1JRSA 3S9AA 4CRDA 1ELAA 3SZNA 4AGKA 4NIYA 3QLPH 1INCA 4R8TB 3V12A 1DS2E 2TGPZ 1UTJA 1JMOH 4CBNA 4ZAEA 1UVOA 3B8JA 4MPVA 1HBTH 1NC6A 2XBWA 5DO4H 2IOTA 1W7GH 1BOQA 4TWWA 3TU7H 3E8LA 1UVUH 1HAHH 5ETXA 3NUMA 3KCGH 1HGTH 1P3CA 3MNBA 2Y80A 5E0HA 1V2QT 1RGQA 1GMCF 3S9BA 1C5NH 4CRGA 3RXTA 5DKMA 3BTKE 4ISOA 3LH1A 4U32A 2WPHS 1G30B 3MU5A 3BG4C 4AN7A 1QQUA 1ELFA 1DWDH 3D65E 1LCYA 1YP9A 2GGVB 1O39A 2NU3E 2OD3B 1BRCE 1F5LA 2TGTA 1ELTA 3O8BA 1JIMA 2SGFE 1G2LA 2PKSC 4F4OC 3ZVCA 1UTLM 7GCHF 5GPIB 1HRTH 1LHDH 1WUNH 1HAPH 2HPPH 3LC5A 1HFDA 4X8UH 2BD2A 1OS8A 1PQAA 1AFQB 3GISB 8GCHG 4CHAC 5GCHG 1BJVA 9ESTA 4ABDA 4CH8B 1O2WA 3A8AA 3ZZBA 4O3TA 1LVBA 5GWZA 1K1LA 2FOCA 2ZFSA 1FUJA 1GI0A 1P2QA 1W10U 5B6OA 2V0BA 2R3UA 2W5EA 3TLOA 1TGSZ 3PMHB 4ABIA 1GBCA 3U8TH 5PTPA 3AVZA 1P12E 4K5ZA 2VWLA 4BAHB 3P8FA 2ZPSA 3PMBB 3SUDA 5JDUB 3M36A 2FOEA 1SI5H 4TY6A 1Y3UA 2HGTH 4RKOB 2AGEX 3GY8A 1YYY1 3RU4D 2HLCA 3SNDA 4TY7A 1CA0C 1EQ9A 4E7NA 1EUFA 1Y5UT 1VITG 4K2YA 1XKAC 3ZYEA 1L1GA 2GVFA 2H5CA 1ABJH 4NIWA 1MBQA 1SG8B 3RM0H 5DK1A 1PPFE 3U1JB 1W3CA 1O3CA 3DA9B 1LVOA 1O34A 4YT6H 4YOGA 4QT8C 4FUIA 1O3LA 5FPTA 3RXUA 2HWLB 1O2VA 4AG2A 2PR3A 6LPRA 2QY0B 1MD8A 1ESTA 2BZAA 2ZECA 3LGIA 3TH3H 3MU1A 2BB4A 1Y8TA 1GDNA 1KSNA 3K6ZA 2EC9H 5A0AE 3LGVA 2IN2A 1A5GH 2XBVA 4ABHA 1H1BA 5T6FA 3SN8A 1NRQH 1Z1IA 3RXQA 1MCTA 2GZ8A 1D3PB 4M7GA 1TNLA 1O3MA 3BTFE 1V2JT 2GV6A 1QIXB 4UE7H 1B5GH 4NA9H 1FIWA 1UVPA 1MTWA 1UK3A 2BQ7B 4FU7A 1TX8A 1YPKH 2SGDE 3RU4E 4JYVH 1MTNB 3JZ1B 3UOPA 2BDBA 1DFPA 3A88A 1GHYH 2V3HH 1NS3A 3GY2A 1PPCE 2ZDNA 1BTXA 3GDUA 4UFFH 1SGCA 2ZO3H 2CMYA 1XXFA 1B0FA 1LPZB 2WPJS 1O3KA 1K2I1 2O9QA 3ENSB 3F9GA 3W94A 2ZP0H 1NZQH 2G4TA 3MH5A 4YLUA 2ZDAH 1DWEH 1ZGIA 3A85A 1SVPA 1W14U 4INHA 3UOUA 3FAOA 4O3UA 3HKJB 3AW0A 4DY7B 1PPHE 5AF9H 3QO6A 1B0EA 2ODPA 3WY8A 3A7VA 1DE7H 2ZPRA 2CGAA 2O8TA 4Z0KA 2ZU2A 2V35A 1TYNA 1L4DA 2VWOA 1AO5A 4KP0A 3I77A 1THSH 1EZSC 3GCOA 2VU8E 5F8ZA 2CXVA 2FOHA 1GMDF 3HK6B 2XXLA 3NCLA 3TK5A 1U6QA 1QFKH 1J9CH 4LK4A 2A45B 2A4RA 1K9OE 1WYKA 5EGMA 1MAYA 1IHSH 2FI5E 2FOGA 2YNBA 3RMMH 1BHXF 1SGRE 1MMJN 3GCTG 4X6NA 3ZZ6A 1YCPH 1UCYH 1DPOA 7GCHG 2F9OA 3M3VA 1HNEE 1BRAA 2D2DA 3OSYA 1C5UA 1EJMA 3S7HB 4OS7A 1DWBH 3PB1E 3KGPA 4BXSA 2JH0D 2BX3A 3RXGA 2VIDA 3TJNA 1GI3A 1RTFB 2UUFB 1QRZA 1S0RA 3SGAE 2ILNA 3OX7U 4NG9H 4I32A 1FY3A 1TPPA 2QXHA 2J94A 2W7UA 1MUEB 1QBVH 1GBAA 1P2NA 1KXAA 1NFYA 3RXLA 1TQ7B 1TNJA 2OQUA 1QJ7B 1ZGVA 3F9EA 2PSXA 3A89A 1WTHD 4GSOA 1EAUA 2GDEH 1A46H 1H9IE 4ZXXH 2VNTA 2G81E 3GY6A 2VWMA 4H4FA 3VB4A 1IQHA 1E38B 1KYNA 1O2YA 1BJUA 1GI9B 4MPWA 2GT8A 1NT1A 2B0FA 1QCPA 4FUBA 3BF6H 2ZEBA 4X6PA 2NU1E 2H6MA 4UDWH 1H8IH 1PPEE 2FI4E 2GV7A 4MNWA 3UQVA 3TGJE 4GHTA 2ZHDA 1RRKA 4HI3A 4X1PU 4HGCA 4KTSA 3SNEA 1GGDB 4OS4A 1YPGH 3GYMA 4DOQA 2OC8A 1P02A 3EQ0H 4CRCA 1F0TA 3SV6A 3MNSA 1LVYA 3KQEA 2ZCLP 3D49H 4B2AA 1C2HA 1BMAA 1OWJA 2VGCC 2V6NA 1C5ZB 1UTPA 4TWYA 2Z9KA 1HB0B 2EI6A 3E0PB 1KTTB 1PPGE 1IQKA 3Q77A 3EAJA 1K28D 4A5TS 1XX9A 1GI7B 2BOHB 3UTUH 5L30H 1PQ7A 3SUFA 4Y0YE 1IQJA 1TNIA 4H42U 1O3BA 3UNSA 2J9NA 2R9PA 3S0NA 1GJ8B 2VH0A 4FUEA 4I8JA 4AYVB 4NIXA 1UHBA 1MTSA 3UWJH 1P3EA 3VB7A 5EXNA 1PYTD 2PHBA 4GCHF 1TA2A 1MH0A 1QJ1B 2PUQH 3VEQB 1IAUA 3Q76A 2PGBB 9LPRA 3ZZ3A 4ZUHA 3QX5H 5FBEA 1EOLA 1UTQA 2P8OB 2ZTYA 4BOHA 1RJXB 3UIRA 3RXJA 1B7XB 2ANKH 1DVAH 3NKKA 4MPXA 4ZKSU 2Q6DA 2FZZA 1NROH 5H4IB 2XNIA 1FDPA 4TPIZ 1J17T 3SJOA 3R0FA 4K69A 5EW2H 1KXCA 2PV9B 1GHXH 4K1SA 4VGCB 1C1RA 4INLA 3VPKA 2BD3A 1JIRA 1GI8B 1GBFA 5L2ZH 1Z8RA 4WH6A 5JBTA 4DJZB 3SHCH 1V2PT 1K1IA 2ANYA 4AGJA 2FIRH 5LGOA 1CGHA 2ZNKH 3GOVB 4FUCA 4B2CA 1GBDA 1VR1H 5JBAS 3QGJA 1CSOE 1ZOMA 1ELEE 1KDQB 2ZWLH 1EZXC 4Q7ZA 1NFWA 4BAMB 1EAIA 2BQWB 2FESH 2BD5A 5BRRE 5DP8A 2D26C 1LHGH 1OWKA 1ZTLA 3UREA 2HPQH 3ZZCA 4NA8A 1T8NA 5GIBA 1O5AB 2H1UA 1QB6A 3RC5A 2OTVA 3ODDA 4WMDA 3P17H 1RIWB 1KLIH 5FXLA 3VXEH 2G51A 5IDKA 1DOJA 1EAXA 1HJAB 1G2MA 3SGQE 1EX3A 1HXEH 5JB9S 3ATWA 2BLWA 1KXBA 2HVXA 1WQVH 3LDXH 5FPYA 1GVLA 3F9HA 1E0FD 1EPTB 2VVUA 1S0QA 1O2PA 2OC1A 1DY9A 3RMLH 3RUOA 3OY6U 2P16A 2ZFTA 1ZHPA 1GBEA 2VIOA 3KF2A 3SI3H 1DWCH 1YPHC 5GXPA 1G32B 1ZJKA 5EODA 3B23B 8GCHF 3GCHB 3D62A 3IWMA 1SSXA 4KKDA 5DGJA 1EKBB 5GCHF 1CGIE 1LO6A 3LPRA 2W3KA 5JPMH 4OGYA 2TRMA 2UWOA 4KGAA 4PROA 1DXWA 3BTDE 3E16B 3NK8A 1T4UH 2EI8A 1ZRBA 5CHAB 1PPBH 5DPAA 4H6SB 3BTQE 3RC6A 4SGBE 1V2UT 2XRCA 2FYQA 4WF8A 3UUZA 3UNRA 4Y8XA 4YT7H 1KLTA 3TNSA 1A5IA 3K65B 1C5MD 1N6XA 1Q31A 1TNKA 2NU0E 3O8DA 3PWCA 1IQGA 1ARCA 1ID5H 1GBHA 1A4WH 2ZFFH 1O2QA 1OOKB 4R0IA 1OWDA 1GBIA 3M3SA 1ZYOA 4AYYB 1QY6A 4A1VA 1LPKB 1A5HA 1C4Y2 1O3NA 2WUCA 4LXBH 3SV2H 5E0GA 3GDVA 1C5PA 3QN7A 3E91A 2RA0A 4YZUA 3LGYA 2EI7A 3LGTA 5F6MA 1EZUC 4NZLA 1TX6A 2ZHWH 1DM4B 5CE1A 3RXCA 4Y7AA 1EXFA 1ETSH 1A3EH 4O03A 1WBGB 3QK1A 2DE9A 3RXDA 4X2XA 5FCRA 3TH2H 1KY9A 3E90B 1F7ZA 4JZEH 1L1NA 1T8LA 1CBWB 3EA7A 1OP2A 2NWNA 3ZV9A 4BTIB 5EPYA 1HAOH 1V2KT 1EB2A 1G36A 1GI2A 3OTJE 1DITH 2CN0H 1XUKA 2SFAA 5IYTA 1AI8H 1HIAA 3M61U 3M7QA 2WPKS 4JZIA 4GCHG 1BTPA 1SGYE 3ZZ7A 1O3OA 1GGDC 3M3TA 1JBUH 3SV8A 1DY8A 4YLQH 2JH6D 1O3FA 3BTGE 1ELDE 1LKAA 1AMHA 4KTUA 1SQAA 2FPZA 1L0ZA 1ELVA 3KQCA 1O3HA 2OUAA 2A4OA 2O8UA 4FVBA 1P9SA 1JWTA 3IG6B 2Y7XA 4K1EA 1MTUA 1W13U 5C1YA 2C90B 1D6RA 2H2ZA 1FV9A 5J4QA 1UTOA 2Z7FE 4FUJA 3PYHA 5DP4A 1C2GA 2ZC9H 1BBRK 1C5XB 5DP9A 4WWYA 4JYUH 1C5VA 5DP6A 4X6MA 4B2BA 3EYDA 4O97A 1P2JA 1W0ZU 2VWNA 4X2VA 1TPSA 1SHYA 1MTVA 1BUIA 2F83A 3LJOA 1O2OA 2XBXA 1XUFA 1SGTA 2ZGBH 3SV7A 2A2QH 2K1QA 1GDQA 1C5QA 2J38A 2ULLA 1NESE 1LHEH 2J4IA 2WPMS 3LT3A 4U30A 2LPRA 4MQAA 2J92A 4AFQA 3PV4A 4DURA 2P94A 3P8OA 5C5NA 3EA8A 2BM2A 1XUHA 3FZZA 1O2GH 2SGEE 2ZGJA 2WYGA 5GDSH 1AIXH 2ANMH 1AE8H 5LPRA 4I8LA 4Y11E 1SLVB 4CREA 4VGCC 3RLWH 4X8TH 4XBBA 2PSYA 1KIGH 1OWHA 3PLPA 2FMJA 1K1NA 1AHTH 7KMEH 1C1UH 4FUHA 3RLYH 1UCYE 2C8WB 3A80A 1TGBA 4ZKNU 1NRRH 1QRWA 1V3XA 1GJ6A 3MO3A 1AU8A 3GCTF 2VB0A 2SGQE 2Z9LA 1XUGA 2OCVB 1SL3A 2QXIA 4NFEA 2GCHG 5BPEA 3RC4A 2O8WA 2XWAA 5HMAA 3OYPA 8KME2 1Z8JB 3UFAA 1WAYB 3LOXA 3VGCB 4CR9A 1ELBA 3MYWA 1SPJA 1AB9B 4Y8ZA 5EXMA 3U8OH 3UR6A 1LQEA 5JB8S 1QL8A 1TABE 2D8WA 2AMQA 4YOJA 1RIWC 2PLXA 2FX4A 1D3DB 1UVSH 1C1VH 1P57B 1ANCA 2BD8A 2H5DA 3DD2H 1LHCH 2F9NA 2P3UB 2M5TA 2BY9X 4ESTE 3ZVBA 3A83A 2IJOB 1EPTC 1ZR0A 2XC0A 1AE5A 2Y7ZA 4ABGA 3G01A 4TPYA 3UWIA 1G37A 3TGIE 1C4U2 1HJ8A 1QNJA 5LPFA 4B1TA 1ZSLA 1RD3B 3TVJB 3V0XA 3RM2H 1AVWA 3ODFA 3FANA 4DW2U 2A31A 3SU3A 2ZDLA 1C1SA 4B75A 1CT0E 4WXIA 4RKJB 2ZFRH 3SGBE 5CHAC 2KAIA 5K0HA 3GICB 1G9IE 2CV3A 1C5WB 3BTEE 1HXFH 1O3EA 3DFLA 2SGPE 3P6ZB 4K1TA 2B7DH 1KXEA 1EB1H 1K22H 4O9VA 2UWPA 3A7XA 3STIA 3RMOH 3D23A 2VVVA 1MZDA 4WVPE 1BA8B 3R3GB 4MTBA 2BOKA 1AKSA 2PKAA 3P92A 1P0SH 3GY5A 4FUFA 5G4BA 2FM2A 1SLUB 2A7CA 3V3MA 1Z8IB 5FX5A 4NIVA 4ISHH 3K9XB 4ABEA 1TMUH 3KIDU 1BTZA 1ZMNA 1FNIA 1NTPA 1SQOA 4Z6AH 3QGNB 4Y8YA 1XUIA 1FAXA 3U69H 1QB9A 1WSSH 1QTFA 2NU2E 5LPEA 1TRMA 1ZHRA 3P70B 3M5MA 2R0KA 4X6OA 4UD9H 5ABWA 1GJCB 3PTBA 3SOSA 2Y82A 1QHRB 1NRNH 1CE5A 1V2WT 4BAKB 5LH8A 3ATIA 2QC2A 3QTOH 4A6LA 3KL6A 1ABIH 1CBWC 4NWLA 1AQ7A 1O5FH 2UUYA 2XC4A 5TCAA 4U2WA 4A1TA 3BIUH 1O2XA 1SGFA 6CHAC 1O36A 2C93B 1NU7B 2D1JA 1PJPA 1NO9H 3RP2A 2ZCHP 2F91A 1QRXA 2QYIA 2EEKA 3SU2A 1UTMA 2UUKB 1W12U 2Y5GA 1C1OA 1HAZB 2QV1A 3MMGA 2FODA 2G5VA 4UFDH 2GTBA 2BDAA 2AS9A 2WPIS 1P8VC 3RXIA 4X1SU 2Y5HA 1V2MT 5A2MH 5EW1H 2THFB 5EG4A 2JETB 1YBWA 4NGAH 1SLWB 4IMZA 4E7RG 1EP5A 1IQMA 4BAQB 2Z3CA 2A4GA 3MU4A 2VJ1A 3L33A 3W95A 4FU8A 1N8OB 1AN1E 1C2KA 1C2MA 2ZZUH 1UK2A 1A7SA 4JCNA 3RU4T 2EA3A 2BDHA 4X8SH 1CQQA 4Y0ZE 2W7SA 1SR5C 1CA8B 1O2TA 1BZXE 1ZPBA 2AIQA 3MI4A 3ATMA 1DSUA 2G5NA 2ZDMA 1VCWA 4KELA 3SORA 3KQBA 3T62A 1O33A 4WJG2 4HTCH 3RXEA 4E05H 1VCPA 1GVZA 2YNAA 4HZHA 2HNTE 2G55A 1KTSB 1NPMA 3ZYDA 1MU6B 5A09A 5JBCS 1UJ1A 2C8ZB 1TBQH 1F0UA 3EA9A 1Y59T 1QL7A 1RTLA 2AGIX 4NSVA 3TH4H 1GJDB 1OYTH 4XE4A 1ORFA 3T25A 5ESBA 3M7UA 3E0NB 4IW4E 1ANEA 4ZHLU 5L2YH 2WV4A 1AFQC 1ZZZA 5C2ZA 1BTHH 3M35A 4JZFH 3VGCC 1FN6A 4ABJA 1K1PA 3O8CA 1AB9C 4IN1A 5FPSA 1K21H 1GBKA 3C1KA 1O3IA 4AFSA 4X0WU 2PWXA 1A3BH 4OS1A 3M37A 3HGNA 1RFNA 2CJIA 3TNTA 3LJJA 2IPHA 1KXDA 5EQQA 3SBKA 2TBSA 1DUEA 1Y3WA 3GY7A 2A0QB 1BB0B 4SGAE 1ESAA 4IC5A 1BTUA 4YESB 1GVKB 3UPEA 1L2EA 1OKXA 2W26A 4NZQA 1O2UA 4YM9A 1Y3XA 4MNYA 4UEHH 1C9TA 3ZVDA 3MH4A 1PQ5A 3DFJA 1BITA 2Y6TA 3A8DA 2BDCA 4D7FA 4B76A 1AWHB 2I6QA 2QXGA 1GBLA 3NXPA 3MNCA 5JYIA 4XDEA 4FU9A 2A4QA 3HKIB 1HAIH 1O2NA 2STAE 3MU0A 1P09A 2CF8H 5DP3A 1OWIA 2ZHFH 3GYLB 1V2ST 3EE0B 2BDIA 1K1JA 2C4FH 4D9RA 5A8XA 3MNXA 2FXRA 1GL1A 4XOJA 1PQ8A 2BY5X 1TQ0B 2SGAA 1S82A 2WYJA 4WH8A 3EGKH 2A5AA 1O5CB 3RXVA 2AYWA 2ZIQH 4GVUA 3ZVFA 3RXBA 2XW9A 3SJIA 4CRFA 1QJ6B 2GKVE 1P01A 3SNAA 2FS9A 2PKAB 1D3TB 1BBRH 2ZPQA 3SV9A 1IQIA 2FYRA 4H6TA 1P06A 2Q1JA 3HPTB 4E06H 1TMBH 2ASUB 3L3TA 1UMAH 3UR9A 4IS5A 2TPIZ 1Z1JA 1HAGE 1RXPA 2A2XH 3A7ZA 1MTNC 2GZ9A 1DLKB 4NWKA 3BG4B 1TNGA 4IGDA 4Y79A 1SHHB 5EXLA 1D9IA 1NY22 1E34B 1AZ8A 4CR5A 4B73A 1BMLA 1C1PA 1TGTA 4NA7A 5EU8A 3LH3A 1TIOA 2P3TB 4UFEH 5F8TA 3ZZ8A 1Y5BT 1MQ5A 2RA3A 1UVTH 3JZ2B 1SFIA 1O31A 3LONA 1C4V2 1H8DH 3MH6A 2VIQA 1ACBE 2TIOA 3BV9B 2BVRH 3QWCH 4LOYH 1C1WH 5C1XA 1P10A 4CHAB 3VB3A 2C3SA 2BY8X 4AB8A 2BD7A 2P3FH 1E37B 2PFEA 5HYOA 2OQ5A 1FXYA 3SNCA 1BRBE 2FEQH 3GDSA 2VIWA 2ZA5A 2GCHF 1L4ZA 2DE8A 3ZVEA 3M5OA 3BTWE 4IC6A 4D8NA 4DIIH 5JBBS 4Q80A 3AAVA 2WINI 3FZDA 3A7TA 4U01A 4ZHMU 1V2LT 1GI5A 1JOUB 4A92A 4CRBA 5EQRA 1EATA 4GHQA 6GCHG 2OXSA 2WV5A 1TMTH 1KLJH 2BVSH 5AFYH 3SJKA 1G3EA 4A7IB 1SBWA 2HNTF 3PO1B 2Z9IA 1N6YA 5L6NH 2ZKSA 1FPHH 4DVAU 2ZQ2A 2ALVA 1LDTT 4WXVA 2ZDVH 1MAXA 1GJ9B 1NRPH 1VJAU 1O2SA 5FCKA 1V2NT 2G4UA 1YF4A 4JYTA 3U1IB 4DIHH 1FIZA 2R2WU 1HAVA 4NSYA 3QZQA 3HGPA 2Y81A 2FWWA 2BD9A 1QURH 4BNRA 3QZRA 1ELGA 3MU8A 3T27A 1GJ7B 4X1NU 3LC3A 2ANWA 2ZGXH 4I33A 1V6DA 5E0JA 5SGAE 3SJ9A 1XVOA 3A8CA 2Z9JA 1P04A 2AMDA 2CHAB 1CHGA 1NN6A 4X1QU 5A8ZA 2VINA 1NU9A 2Z3EA 3KN2A 1T8OA 1VITH 5T6GA 4LZ4B 4OS5A 2ZU5A 3GCNA 1UTNA 4IBLH 3RXKA 2FLBH 3VB6A 1IQLA 4YTAA 3BEFB 3FP8E 2PTCE 1ETTH 5DP7A 2PUXB 3Q3YA 5TCCA 5K7RA 1O2LA 1CHOF 4X2YA 3P8NA 1JRTA 4XBDA 3P8GA 2SNVA 2W3IA 4WMEA 3SU4A 1C5OH 3MTYA 3SU0A 1S84A 2ESTE 3A84A 4AOQA 1F5RA 3SHAH 1TX7A 1FZZA 5EPNA 1YM0A 1ZLRA 3ZZDA 2J34A 1ZRKA 1ZSJA 1TAWA 4ZH8A 3NZIA 3CS0A 2BLQA 2QF0A 1A0JA 1GBTA 2Z6BD 1ETRH 1Y3VA 4MPUA 4B74A 1XM1A 4JZ1A 1TRYA 1T7CA 4LZ1H 1HLTH 4GAWA 1TOMH 1SGPE 5DG6A 3AAUA 1LPGB 2Q6FA 4JK5A 1GHAG 1H9LB 2R0LA 1TBZH 3SQEE 2BHGA 2ZG0H 4ZXYH 1SMFE 2QXJA 4YOIA 1UHBB 1BMMH 2P8OC 1AFEH 1YLCA 2A7HA 4CH2B 2F9UA 1S6HA 4FUDA 3A86A 4Q7XA 1IQFA 2LNCA 3P95A 1W8BH 4FVDA 1V2TT 2HALA 1HAYB 1IQEA 1NM6A 1QR3E 3KEEA 3HK3B 4HFPB 2F9VA 2CF9H 5HM2A 8LPRA 3MH7A 1E35B 5ESTE 1P2OA 4Y7BA 2RG3A 1BRUP 2FTLE 2UWLA 3N7OA 1MQ6A 2GD4B 1GJBB 3RXSA 1T32A 3SI4H 4AORA 1D6WA 1WOFA 2DUCA 3LGWA 1S5SA 3LGUA 3U9AH 5FHTA 1CT4E 2RDLA 1O2MA 3A81A 2B9LA 3BEUA 1C2EA 1C2DA 1KXFA 2QAAA 1OYQA 3F9FA 3ATKA 2BX4A 2VIVA 1QA0A 1FJSA 3ZZ5A 3T2NA 2ALPA 5E2PA 3URDA 1F5KU 1O3AA 2A7JA 1GJAB 1E36B 4DT7B 1SFQB 1GWAA 4BXWA 3URCA 2GCTB 1C5SA 4ABFA 4ZKRU 1FY1A 1TNHA 4MNVA 3CP7A 1HJAC 1MD7A 3B9FH 2A5KA 5AHGH 1BQYA 3TK6A 5C67A 1C2JA 1O37A 3A87A 1MKWK 4BTUB 1ARBA 3VXFH 1L1JA 4I8HA 3PMAB 1CU1A 3K6YA 1W2KH 1HV7A 1XKBC 3E3TA 1DT2A 2Z94A 3TJVA 3GY3A 2NU4E 2VGCB 4Y71A 3GCHC 2GZ7A 4XFQA 1QBOA 1THPB 1UK4A 2I6SA 2QIQA 1Z71A 4X2WA 3OY5U 2BXUH 2P59A 1FI8A 5F03A 1H9HE 1DSTA 1C5YB 2XCFA 3ZVGA 3PTNA 3PO1C 1O35A 1MCVA 3LU9B 1HJ9A 1A2CH 3SU6A 4K3JA 5C1UA 1BT7A 3SQHE 1J16A 1TPOA 4D9QA 2FS8A 1MU8B 2GP9B 3PMJA 1CHOG 1P2IA 3TITA 1GMHF 3E1XB 5HM9A 1S81A 2GT7A 3RXRA 1P2MA 1AD8H 3SUEA 1GCTB 1UO6A 1VZQH 2J2UA 4ISNA 1M9UA 3MWIU 3RDZA 1HAVB 1TB6H 2FX6A 1BCUH 1C1NA 7LPRA 2G00A 5I46H 4ZKOU 2GMTB 2CHAC 1OWEA 7ESTE 5TJXA 3RXMA 1HCGA 1O2IA 2AFQB 4Y10E 2FOAA 4ZMAH 2BLOA 1MKXK 1V2RT 4ZHAA 3M5LA 1NFXA 4K8BA 5FX6A 2ZF0H 1TGNA 2UUJB 4OS2A 1KDQA 5C3NA 1TRNA 1O0DH 4GLYA 4THNH 1NRSH 1PFXC 3PLBA 1BBRE 1EOJA 1J15A 2BYAX 2F3CE 1SLXB 4DCDA 1EASA 4I31A 1YPEH 4Q2KA 1TWXB 3GY4A 4I8KA 1C2IA 1FY4A 3A7YA 1FAKH 4RSPA 1WQSA 1F0RA 4NFFA 3BG8A 1TGCA 2H9HA 3A8BA 1O2JA 1HIAB 3VFEA 6ESTA 3V13A 3SNBA 1CO7E 1LKBA 3NWUA 4INKA 3RXAA 2C8YB 2FO9A 1YCPM 4I7YH 2AEIH 1EPTA 1O3PB 1F0SA 1LVMA 1A0HB 2FLRH 1YPJH 4XSKU 1YC0A 2J95A 2ZU1A 2FDAA 1VGCB 2BY7X 1BMNH 5A0BA 4JMYA 1G3DA 2C8XB 5A8YA 3ESTA 4A1XA 3TJUA 3SW2B 4BTTB 2H9TH 1UTKA 1JXPA 1P03A 5EOKA 1XUJA 2XCNA 1G3BA 5F8XA 4AX9H 1BDAA 1GI6A 1O2ZA 3F68H 1QB1A 3SO3A 1GMCG 3KHVA 1S85A 1S83A 1XXDA 2JH5D 3AW1A 2Y5FA 3PM3A 1SGNE 4KTCA 1LTOA 3SU5A 1AUTC 2B5TB 3U98H 3H7TA 4J2YB 5E8EH 3TK9A 2GDDA 3SJ8A 1T4VH 3BIVH 4GPGA 3CENA 1W7XH 1DLEA 3S69A 2R3YA 1THRH 1HPGA 2RCEA 1OP8A 3H7OA 1SQTA 1ESBA 4CBOA 1P2KA 1ZJDA 1FLEE 1Z7KA 1LHFH 6GCHF 1OP0A 5J4SA 1A1RA 1GBJA 3ZVAA 3HATH 2BLVA 3ELAH 3M5NA 5DP5A 5DJ7A 3S7KB 1FMGA 3L6PA 1GL0E 1DANH 1P11E 3MFJA 1GPZA 1HAXB 1QL9A 1EJAA 2AIPA 4D76A 5A0CA 1X7AC 1C5RA 2JKHA 2BD4A 2VH6A 1DICA 1TPAE 2OC0A 2WPLS 1AUJA 1V2OT 4ABAA 1ZMLA 1C9PA 2BVXH 2A1DB 4B71A 1AVXA 1SGQE 2STBE 4BAOB 3PROA 2XC5A 1YPMH 2BZ6H 2AGGX 3LKWA 2R2MB 1TLDA 2GCTC 4FUGA 4WMFA 3RXOA 4DGJA 2O8MA 2QA9E 2G52A 4F49A 4MDSA 3T28A 2ZQ1A 3TGKE 1T8MA 1Q2WA 3PLKA 3QTVH 4X8VH 3I29A 3PWBA 1GDUA 1GHWH 5EQSA 1EJNA 1YKTA 2B8OH 1YPLH 5HGGA 1GMHG 2AMPA 2P95A 3BTTE 2XYAA 4AFZA 1BTYA 2AERH 2ZFPH 5C20A 1SC8U 2AH4X 1ZPZA 3A7WA 2G8TA 4UONA 1CT2E 1IHTH 2OC7A 1YGCH 1YLDA 1O30A 3BTHE 1NFUA 1TONA 1F92A 3FVFB 4ZROA 5I25A 2OP9A 2GX4A 2BQ6B 3NPSA 1GG6B 2PTNA 3QDZB 1SGFG 1EP6A 1YPHE 1RTKA 3T5FH 3Q00A 3K2UA 1CGJE 2KAIB 4MVNA 2A32A 4WY3A 1C1MA 3A82A 1A0LA 1SGIB 1W0YH 1O38A 1T31A 2WUBA 2BTCE 3Q3KA 1Y3YA 1BTWA 3VB5A 4I8GA 2HRVA 1P05A 1CVWH 1GHBF 2Z3DA 1DDJA 1FQ3A 2PW8H 1AKSB 1IOEA 1ZTKA 5E2OA 1C2FA 2ZI2H 2HNTC 4Q7YA 3V7TA 1GCTC 3DHKH 3TJOA 1O5BB 3DUXH 2XBYA 1GHAF 4XBCA 1QQ4A 1ZSKA 1O32A 2GMTC 3FFGA 4OS6A 3RXFA 3I78A 3ZZ9A 4JK6A 1VCQA 1DX5M 1ELCA 3ZV8A 3Q3XA 1Z6JH 1TE0A 1D3QB 1WTGH 1GBMA 1SGDE 4Y6DA 2P93A 2XTTB 1J14A 2BDYA 2ODQA 1PPZA 1ZMJA 1O2RA 5T6DA 1K1MA 1Z6EA 1C5TA 1TOCB 1XVMA 2PKSB 3BEIB 5C5OA 3C27B 1C2LA 1EAWA 1OSSA 2ZGHA 1HYLA 3MO6A 1FY5A 4FXGH 1C1TA 2SNWA 2PGQB 1GMDG
chains in the Genus database with same CATH superfamily
1O5DH 3DT0H 1C5LH 1K1OA 4RN6A 2RFKC 1LMWB 1Z8GA 5HXFA 2H9EH 1VJ9U 5FAHA 1O5GH 2OBOA 1ZPCA 1YCPK 1NBMD 1UCYK 4IMQA 4UFGH 2XWBI 2ZGCA 2VVCA 3UNQA 3SU1A 1FPCH 2ODYB 3ITIA 3TPIZ 8ESTE 2QF3A 1FY8E 4I86A 1XMNB 5FBIA 1GCDA 2TGDA 2TGAA 4Y76A 1VGCC 4AZ2B 3F3BA 1DXPA 3EDXB 3UY9A 2V3MA 2A5IA 1SQRA 3F1SB 3WWFA 1HUTH 4ISIH 1OPHB 2JETC 1N1LA 3U8RH 1EZQA 1AY6H 3CS7A 4DG4A 2F9PA 3ZZ4A 1CA0B 3T29A 2ZHQH 1F2SE 1N8OC 2ZTXA 1G3CA 2ZHEH 2BXTH 4TSFD 3OTPA 3QUMP 2HVYB 3IITA 1GJ4H 1AGJA 1A61H 5CMXH 2BY6X 4YO9A 2FOFA 1BMFD 2FTMA 2O8LA 1GHZA 4IN2A 1MBMA 1MKWH 3STJA 1GJ5H 4ASHA 4GUXA 1AVGH 4JZDH 1SOTA 1O3GA 4X1RU 1SB1H 3S9CA 3H5CB 1TA6A 5T3HA 1DUAA 2OINA 4MLFB 1V2VT 2HOBA 4ISLA 1FN8A 4K8YA 2FOBA 3MHWU 3BTME 2OLGA 1QA7A 3MOCA 1QBNA 1BHXB 4TT3D 2ZTZA 1ANDA 1O3JA 2Q6GA 1E1QD 1TFXA 1IQNA 3BSQA 2FOMB 1GBBA 3RMNH 4ACBA 4CRAA 3O8RA 1J8AA 4AFUA 1VITF 1QGFA 3KQDA 1WV7H 3FP6E 4MNXA 1H4WA 1SGEE 4AG1A 2BDGA 1PYTC 2Z9GA 1TBRH 4NCYA 3RXPA 5GJ4B 4OGXA 3SUGA 1WCZA 1ANBA 2ZCKP 1AZZA 1D4PB 2ZU4A 1EFRD 1O3DA 3MO9A 1H8HD 2QGRA 3ATLA 1O2KA 3LIWA 3E6PH 1GI4A 6CHAB 1GHVH 3RXHA 1GI1A 1O5EH 1TALA 1W11U 2BMGB 3ZZAA 2YOLA 1MZAA 2FI3E 1OX1A 4BANB 1GHBG 2F9BH 3BN9A 1Q3XA 3AASA 1MKXH 1FONA 5AFZH 4K60A 1LQDB 1AWFH 1OXGA 2QN5T 2ZFQH 4MG3A 2ZDKA 1O2HA 1BIOA 3UQOA 2QCYA 2ZU3A 3M7TA 2V3OH 3T26A 4AB9A 3OU0A 2OBQA 1P9UA 1SOZA 4D7GA 3KNXA 1ZHMA 2VIPA 1ZTJA 1Y5AT 1GG6C 1HDTH 4ABBA 5AVDA 3TIUA 4TYDA 1C1QA 1S6FA 3FP7E 3F6UH 1RS0A 4J1YA 1WU1A 2FP7B 1JRSA 3OAAD 3S9AA 3WW7A 4CRDA 1ELAA 3SZNA 4AGKA 4NIYA 3QLPH 1INCA 4R8TB 3V12A 1DS2E 4F55A 2TGPZ 1UTJA 1JMOH 4CBNA 4ZAEA 1UVOA 3B8JA 5C17A 1UW7A 4MPVA 1HBTH 1NC6A 2XBWA 2YMSC 5DO4H 1SKYE 2IOTA 1W7GH 1BOQA 4TWWA 3TU7H 3E8LA 1UVUH 1HAHH 5ETXA 3NUMA 3KCGH 1HGTH 1P3CA 3MNBA 2Y80A 5E0HA 1V2QT 1RGQA 1GMCF 3S9BA 1C5NH 4CRGA 3RXTA 5DKMA 3BTKE 4ISOA 3LH1A 4U32A 2WPHS 1G30B 3MU5A 3BG4C 4AN7A 5HIYA 1QQUA 1ELFA 2KZ4A 2QF4A 1DWDH 3D65E 1LCYA 1YP9A 2GGVB 1O39A 2KM0A 2NU3E 2OD3B 1BRCE 1F5LA 2TGTA 1ELTA 3O8BA 1JIMA 2SGFE 1G2LA 2PKSC 4F4OC 3ZVCA 1UTLM 5GNDA 7GCHF 5GPIB 1HRTH 1LHDH 1WUNH 1HAPH 2HPPH 3LC5A 1HFDA 4X8UH 2BD2A 1OS8A 1PQAA 1AFQB 3GISB 8GCHG 4CHAC 5GCHG 1BJVA 9ESTA 4ABDA 4B6FA 4CH8B 1O2WA 3A8AA 3ZZBA 4O3TA 1LVBA 5GWZA 1K1LA 2FOCA 2ZFSA 1FUJA 5DSFA 1GI0A 1P2QA 1W10U 5B6OA 2V0BA 2R3UA 3UB0A 2W5EA 3TLOA 1TGSZ 3PMHB 4ABIA 1GBCA 3U8TH 5PTPA 3AVZA 1P12E 4K5ZA 2VWLA 4BAHB 3P8FA 2ZPSA 3PMBB 3SUDA 5JDUB 3M36A 2FOEA 1SI5H 4TY6A 1Y3UA 2HGTH 3F2GA 2AGEX 3GY8A 1YYY1 4RKOB 3RU4D 2HLCA 3SNDA 4TY7A 1CA0C 1EQ9A 4E7NA 1EUFA 1Y5UT 1VITG 4K2YA 1XKAC 1W0JD 3ZYEA 1L1GA 2GVFA 2H5CA 1ABJH 4NIWA 1MBQA 1SG8B 3RM0H 5DK1A 1PPFE 3U1JB 1W3CA 1O3CA 3DA9B 1LVOA 1O34A 4YT6H 4YOGA 4QT8C 4FUIA 4Q4LA 1O3LA 5FPTA 3RXUA 2HWLB 1O2VA 4AG2A 2PR3A 6LPRA 2QY0B 1MD8A 1ESTA 2BZAA 2ZECA 3LGIA 3TH3H 3MU1A 2BB4A 1Y8TA 1GDNA 1KSNA 3K6ZA 2EC9H 5A0AE 3LGVA 2IN2A 1A5GH 2XBVA 4ABHA 1H1BA 5T6FA 3SN8A 1NRQH 1Z1IA 3RXQA 1MCTA 2GZ8A 1D3PB 4M7GA 1TNLA 1O3MA 3BTFE 1V2JT 2GV6A 1QIXB 4UE7H 1B5GH 4NA9H 5EJZA 1FIWA 1UVPA 1MTWA 1UK3A 2BQ7B 4FU7A 1TX8A 1YPKH 2SGDE 3RU4E 4JYVH 1MTNB 3JZ1B 3UOPA 2BDBA 1DFPA 3A88A 1GHYH 2V3HH 1NS3A 3GY2A 1PPCE 2ZDNA 1BTXA 3GDUA 4UFFH 1SGCA 2ZO3H 2CMYA 1XXFA 1B0FA 1LPZB 2WPJS 1O3KA 1K2I1 2O9QA 3ENSB 3F9GA 3W94A 2ZP0H 1NZQH 2G4TA 3MH5A 4YLUA 2ZDAH 5C0UA 1DWEH 1ZGIA 2AHME 3A85A 2LELA 1SVPA 1W14U 4INHA 3UOUA 3FAOA 4O3UA 3HKJB 3AW0A 4DY7B 1PPHE 5AF9H 3QO6A 1B0EA 2ODPA 3WY8A 3A7VA 1DE7H 2ZPRA 2CGAA 2O8TA 4Z0KA 2ZU2A 2V35A 1TYNA 1L4DA 2VWOA 1AO5A 4KP0A 3I77A 1THSH 1EZSC 3GCOA 2VU8E 5F8ZA 2CXVA 2FOHA 1GMDF 3HK6B 2XXLA 3NCLA 3TK5A 1U6QA 1QFKH 1J9CH 4LK4A 2A45B 2A4RA 1K9OE 1WYKA 5EGMA 1MAYA 1IHSH 2FI5E 2FOGA 2YNBA 3RMMH 1BHXF 1SGRE 4RT1A 1MMJN 3GCTG 4X6NA 3ZZ6A 1YCPH 1UCYH 1DPOA 7GCHG 2F9OA 2J98B 3M3VA 1HNEE 1BRAA 2D2DA 3OSYA 1C5UA 1EJMA 3S7HB 4OS7A 1DWBH 3PB1E 3KGPA 4BXSA 2JH0D 2BX3A 3RXGA 2VIDA 3TJNA 1GI3A 1RTFB 2UUFB 1QRZA 1S0RA 3SGAE 2ILNA 3OX7U 4NG9H 4I32A 1FY3A 1TPPA 2QXHA 2J94A 2W7UA 1MUEB 1QBVH 1GBAA 1P2NA 1KXAA 2RDEA 1NFYA 3RXLA 1TQ7B 4B6EA 1TNJA 2OQUA 1QJ7B 1ZGVA 3F9EA 2PSXA 5B6LA 3A89A 1WTHD 4GSOA 1EAUA 2GDEH 1A46H 1H9IE 4ZXXH 2VNTA 2G81E 3GY6A 2VWMA 4H4FA 3VB4A 1IQHA 3KQ5A 1E38B 1KYNA 1O2YA 1BJUA 1GI9B 2EQNA 4MPWA 2GT8A 1NT1A 2B0FA 1QCPA 4FUBA 3BF6H 2ZEBA 4X6PA 2NU1E 2H6MA 4UDWH 1H8IH 1PPEE 2FI4E 2GV7A 4MNWA 3UQVA 3TGJE 4GHTA 2ZHDA 1RRKA 4HI3A 4X1PU 4HGCA 4KTSA 3SNEA 1GGDB 4OS4A 1YPGH 3GYMA 4DOQA 2OC8A 1P02A 3EQ0H 4CRCA 1F0TA 3SV6A 3MNSA 1LVYA 3KQEA 2ZCLP 3D49H 4B2AA 1C2HA 1BMAA 1OWJA 2VGCC 2V6NA 1C5ZB 1UTPA 4TWYA 2Z9KA 1HB0B 2EI6A 3N7DA 3E0PB 1KTTB 1PPGE 3FKSD 1IQKA 1MABB 3EAJA 1K28D 3Q77A 4A5TS 1XX9A 1GI7B 2BOHB 3UTUH 5L30H 1PQ7A 3SUFA 4Y0YE 1IQJA 1TNIA 4H42U 1O3BA 3UNSA 2J9NA 2R9PA 3S0NA 1GJ8B 2VH0A 4FUEA 4I8JA 4AYVB 2QF5A 4NIXA 1UHBA 1MTSA 3UWJH 1P3EA 3VB7A 5EXNA 5HIZA 4ASUD 1PYTD 2PHBA 4GCHF 1TA2A 1MH0A 1QJ1B 2PUQH 3VEQB 1IAUA 3Q76A 2PGBB 9LPRA 3ZZ3A 4ZUHA 3QX5H 5FBEA 1EOLA 1UTQA 2P8OB 2ZTYA 4BOHA 1RJXB 3UIRA 3RXJA 1B7XB 2ANKH 1DVAH 3NKKA 4MPXA 4ZKSU 2Q6DA 5EJ1A 2FZZA 1NROH 5H4IB 2XNIA 1FDPA 4TPIZ 1J17T 3SJOA 3R0FA 4K69A 5EW2H 1KXCA 2PV9B 1GHXH 4K1SA 4VGCB 1C1RA 4INLA 2CK3D 3VPKA 2BD3A 1JIRA 1GI8B 1GBFA 2KCPA 5IK2D 5L2ZH 1Z8RA 4WH6A 5JBTA 4DJZB 3SHCH 1V2PT 1K1IA 2ANYA 4AGJA 2FIRH 5LGOA 1CGHA 2ZNKH 3GOVB 4FUCA 2JJ2D 4B2CA 1GBDA 1VR1H 5JBAS 3QGJA 1CSOE 1ZOMA 1ELEE 1KDQB 2ZWLH 1EZXC 4Q7ZA 1NFWA 4BAMB 1EAIA 2BQWB 2FESH 2BD5A 5BRRE 4HG6A 5DP8A 2D26C 1LHGH 1OWKA 1ZTLA 3UREA 2HPQH 3ZZCA 4NA8A 1T8NA 5GIBA 1O5AB 2H1UA 1QB6A 3RC5A 2OTVA 3ODDA 4WMDA 3P17H 3DSGA 1RIWB 1KLIH 3DCLA 5FXLA 3VXEH 2G51A 5IDKA 3N99A 1DOJA 1EAXA 1HJAB 1G2MA 3SGQE 1EX3A 1HXEH 5JB9S 3ATWA 2BLWA 1KXBA 2HVXA 1WQVH 3LDXH 5FPYA 1GVLA 3F9HA 1E0FD 1EPTB 1E79D 2VVUA 4ACAA 1S0QA 1O2PA 2OC1A 1DY9A 3RMLH 3RUOA 3OY6U 2P16A 2ZFTA 3NRLA 1ZHPA 1GBEA 2VIOA 3KF2A 3SI3H 1DWCH 1YPHC 5GXPA 1G32B 1ZJKA 5EODA 3B23B 8GCHF 3GCHB 3D62A 3IWMA 1SSXA 4KKDA 5DGJA 1EKBB 5GCHF 1CGIE 1LO6A 2W6JD 3LPRA 2W3KA 5JPMH 4OGYA 2TRMA 2UWOA 4KGAA 4PROA 1DXWA 3BTDE 3E16B 3NK8A 1T4UH 2EI8A 1ZRBA 5CHAB 1PPBH 5DPAA 4H6SB 3BTQE 3RC6A 4SGBE 5KGOA 1V2UT 1WXRA 2XRCA 2FYQA 4WF8A 3UUZA 3UNRA 4Y8XA 4YT7H 5KECA 1KLTA 3TNSA 1A5IA 3K65B 1C5MD 1N6XA 1Q31A 1TNKA 1NBME 2NU0E 3O8DA 3PWCA 1IQGA 1ARCA 1ID5H 1GBHA 1A4WH 2ZFFH 1O2QA 1OOKB 4R0IA 1OWDA 1GBIA 3M3SA 1ZYOA 3DSOA 4AYYB 1QY6A 3PV5A 4A1VA 1LPKB 1A5HA 1C4Y2 1O3NA 2WUCA 4LXBH 3SV2H 5E0GA 3GDVA 1C5PA 3QN7A 3E91A 2RA0A 4YZUA 3LGYA 2EI7A 2KCAA 3LGTA 5F6MA 1EZUC 4NZLA 1TX6A 4F48B 2ZHWH 5EIYA 1DM4B 5CE1A 3RXCA 4Y7AA 1EXFA 1ETSH 1A3EH 4O03A 1WBGB 3QK1A 2DE9A 3RXDA 4X2XA 5FCRA 3TH2H 1KY9A 3E90B 1F7ZA 4JZEH 1L1NA 1T8LA 1CBWB 3EA7A 1OP2A 2NWNA 3ZV9A 4BTIB 5EPYA 1HAOH 1V2KT 1EB2A 1G36A 1GI2A 3OTJE 1DITH 2CN0H 1XUKA 2SFAA 5IYTA 1AI8H 1HIAA 3M61U 3M7QA 2WPKS 4JZIA 4GCHG 1BTPA 1SGYE 3ZZ7A 1O3OA 1GGDC 3M3TA 1JBUH 3SV8A 1DY8A 4YLQH 2JH6D 1O3FA 3BTGE 1ELDE 1LKAA 1AMHA 4KTUA 1SQAA 2FPZA 1L0ZA 1ELVA 3KQCA 1O3HA 2OUAA 2A4OA 2O8UA 4FVBA 1P9SA 1JWTA 3IG6B 2Y7XA 3EE7A 4K1EA 1MTUA 2IJD1 1W13U 5C1YA 2C90B 1D6RA 3KYFA 2H2ZA 1FV9A 5J4QA 1UTOA 2Z7FE 4FUJA 3PYHA 5DP4A 1C2GA 1FX0B 2ZC9H 1BBRK 1C5XB 5DP9A 4WWYA 4JYUH 1C5VA 5DP6A 4X6MA 4B2BA 3EYDA 4O97A 3PRDA 1P2JA 1H8ED 1W0ZU 2VWNA 4X2VA 1TPSA 5EJLA 3GS9A 2M2AA 1SHYA 1MTVA 1BUIA 2F83A 3LJOA 1O2OA 3MQKC 2XBXA 1XUFA 1SGTA 2ZGBH 3SV7A 2A2QH 2K1QA 1GDQA 1C5QA 2J38A 2ULLA 1NESE 1LHEH 2J4IA 2WPMS 3LT3A 4U30A 2LPRA 4MQAA 2J92A 4AFQA 3PV4A 4DURA 1COWD 2P94A 3P8OA 5C5NA 3EA8A 2BM2A 1XUHA 3FZZA 1O2GH 2SGEE 2ZGJA 2WYGA 5GDSH 1AIXH 2ANMH 1AE8H 5LPRA 4I8LA 4Y11E 1SLVB 4CREA 4VGCC 3RLWH 4X8TH 4XBBA 2PSYA 1KIGH 1OWHA 3PLPA 2FMJA 1K1NA 1AHTH 7KMEH 1C1UH 4FUHA 3RLYH 1UCYE 2C8WB 3A80A 1TGBA 4ZKNU 1NRRH 1QRWA 1V3XA 1GJ6A 3MO3A 1AU8A 3GCTF 2VB0A 2SGQE 2Z9LA 1XUGA 4OM9A 2OCVB 1SL3A 2QXIA 4NFEA 5C0TA 2GCHG 5BPEA 2JDID 3RC4A 2O8WA 2XWAA 5HMAA 3OYPA 8KME2 1Z8JB 3UFAA 1WAYB 3LOXA 3VGCB 4CR9A 1ELBA 3MYWA 1SPJA 1AB9B 4Y8ZA 5EXMA 3FN8A 3U8OH 3UR6A 1LQEA 5JB8S 1QL8A 1TABE 2D8WA 2AMQA 4YOJA 1RIWC 3U28C 2PLXA 2FX4A 1D3DB 1UVSH 1C1VH 1VKYA 1P57B 1ANCA 2BD8A 2H5DA 3DD2H 1LHCH 2F9NA 2P3UB 2M5TA 2BY9X 4ESTE 3ZVBA 3A83A 2IJOB 1EPTC 1ZR0A 2XC0A 1AE5A 2Y7ZA 4ABGA 3OEHD 3G01A 4TPYA 3UWIA 1G37A 2PP6A 3TGIE 1C4U2 1HJ8A 1QNJA 2XOKD 5LPFA 4B1TA 2IPQX 1ZSLA 1RD3B 3TVJB 3V0XA 3RM2H 1AVWA 3ODFA 3FANA 4DW2U 2A31A 3SU3A 2ZDLA 1C1SA 4B75A 1CT0E 4WXIA 4RKJB 2ZFRH 3SGBE 5CHAC 2KAIA 5K0HA 3GICB 1G9IE 2CV3A 1C5WB 3BTEE 1HXFH 1O3EA 3DFLA 2SGPE 3P6ZB 4K1TA 2B7DH 1KXEA 1EB1H 1K22H 4O9VA 2UWPA 3A7XA 3STIA 3RMOH 3D23A 2VVVA 1MZDA 4WVPE 1BA8B 3R3GB 4MTBA 2BOKA 1AKSA 2PKAA 2OK5A 3P92A 1P0SH 3GY5A 3VG8A 4FUFA 5G4BA 2FM2A 1SLUB 2A7CA 3V3MA 1Z8IB 5FX5A 4NIVA 4ISHH 3K9XB 4ABEA 1TMUH 3KIDU 1BTZA 2EY4C 1ZMNA 1FNIA 1NTPA 1SQOA 4Z6AH 3QGNB 4P00A 4Y8YA 5DN6D 1XUIA 1FAXA 3U69H 1QB9A 1WSSH 1QTFA 2NU2E 5LPEA 1TRMA 1ZHRA 3P70B 3M5MA 2R0KA 4X6OA 4UD9H 5ABWA 1GJCB 3PTBA 3SOSA 2Y82A 1QHRB 1NRNH 1CE5A 1V2WT 4BAKB 3H09A 5LH8A 3ATIA 2QC2A 3QTOH 4A6LA 3KL6A 1ABIH 1CBWC 4NWLA 1QZ8A 1AQ7A 1O5FH 2UUYA 2XC4A 5TCAA 4P02A 4U2WA 4A1TA 3BIUH 1O2XA 1SGFA 6CHAC 1O36A 2C93B 1NU7B 2D1JA 1PJPA 1NO9H 3RP2A 2ZCHP 2F91A 1QRXA 2QYIA 2EEKA 3SU2A 1UTMA 2UUKB 1W12U 2Y5GA 1C1OA 1HAZB 4RI0A 2QV1A 3MMGA 2FODA 2G5VA 4UFDH 2GTBA 2BDAA 2AS9A 2WPIS 1P8VC 3RXIA 4X1SU 2Y5HA 1V2MT 5A2MH 5EW1H 2THFB 5EG4A 2JETB 1YBWA 4NGAH 1SLWB 4IMZA 4E7RG 1EP5A 1IQMA 4BAQB 2Z3CA 2A4GA 3MU4A 2VJ1A 3L33A 2QE7D 3W95A 4FU8A 1N8OB 1AN1E 1C2KA 1C2MA 2ZZUH 1UK2A 1A7SA 4JCNA 3RU4T 2EA3A 2BDHA 4X8SH 1CQQA 4Y0ZE 2W7SA 1SR5C 1CA8B 1O2TA 1BZXE 1ZPBA 2AIQA 3MI4A 3ATMA 1DSUA 2G5NA 2ZDMA 1VCWA 4KELA 3SORA 3KQBA 3T62A 2W6ID 1O33A 4WJG2 4HTCH 3RXEA 4E05H 1VCPA 1GVZA 1OHHD 2YNAA 2HNTE 2G55A 4HZHA 2L74A 1KTSB 1NPMA 3ZYDA 1MU6B 5A09A 5JBCS 1UJ1A 2C8ZB 1TBQH 1F0UA 3EA9A 1Y59T 1QL7A 1RTLA 2AGIX 4NSVA 3TH4H 1GJDB 1OYTH 4XE4A 1ORFA 3T25A 5ESBA 3M7UA 3E0NB 4IW4E 1ANEA 4ZHLU 5L2YH 2WV4A 1AFQC 1ZZZA 5C2ZA 1BTHH 3M35A 4JZFH 3VGCC 1FN6A 4ABJA 1K1PA 2KCYA 3O8CA 1AB9C 4IN1A 5FPSA 1K21H 1GBKA 3C1KA 1O3IA 4AFSA 4X0WU 2PWXA 1A3BH 4OS1A 3M37A 3HGNA 1RFNA 2CJIA 3TNTA 3LJJA 2IPHA 1KXDA 5EQQA 3SBKA 4DT4A 2TBSA 1DUEA 1Y3WA 3GY7A 2A0QB 1BB0B 5F53A 4SGAE 1ESAA 4IC5A 1BTUA 4YESB 1GVKB 3UPEA 1L2EA 1OKXA 2W26A 4NZQA 1O2UA 4YM9A 1Y3XA 4MNYA 4UEHH 1C9TA 3ZVDA 3MH4A 1PQ5A 3DFJA 3WWBA 1BITA 2Y6TA 3A8DA 2BDCA 4D7FA 4B76A 1AWHB 2I6QA 2QXGA 1GBLA 3NXPA 3MNCA 2LP6A 5JYIA 4XDEA 4FU9A 5FL7D 2A4QA 3HKIB 1HAIH 1O2NA 2STAE 3MU0A 1P09A 2CF8H 5DP3A 1OWIA 2ZHFH 3GYLB 1V2ST 3EE0B 2BDIA 1K1JA 3ZIAD 2C4FH 4D9RA 5A8XA 3MNXA 2FXRA 1GL1A 4XOJA 1PQ8A 2BY5X 1TQ0B 3N7EA 2SGAA 1S82A 2WYJA 4WH8A 3EGKH 2A5AA 1O5CB 3RXVA 2AYWA 2ZIQH 4GVUA 3ZVFA 3RXBA 2XW9A 3SJIA 4CRFA 1QJ6B 2GKVE 1P01A 3SNAA 2FS9A 2PKAB 1D3TB 1BBRH 2ZPQA 3SV9A 1IQIA 2FYRA 4H6TA 1P06A 2Q1JA 3HPTB 4E06H 1TMBH 2ASUB 3L3TA 1UMAH 3UR9A 4IS5A 2TPIZ 1Z1JA 1HAGE 1RXPA 2A2XH 3A7ZA 1MTNC 2GZ9A 1DLKB 4NWKA 3BG4B 1TNGA 4IGDA 4Y79A 1SHHB 5EXLA 1D9IA 1NY22 1E34B 1AZ8A 4CR5A 4B73A 1BMLA 1C1PA 1TGTA 4NA7A 5EU8A 3LH3A 1TIOA 2P3TB 4UFEH 5F8TA 3ZZ8A 1Y5BT 1MQ5A 2RA3A 1UVTH 3JZ2B 1SFIA 1O31A 3LONA 1C4V2 1H8DH 3MH6A 2VIQA 1ACBE 2TIOA 3BV9B 2BVRH 3QWCH 4LOYH 1C1WH 5C1XA 1P10A 4CHAB 3VB3A 2C3SA 2YMSD 1YLNA 2BY8X 4AB8A 2BD7A 2P3FH 1E37B 2PFEA 5HYOA 2OQ5A 1FXYA 3SNCA 1BRBE 2FEQH 3GDSA 2VIWA 2ZA5A 2GCHF 1W0KD 1L4ZA 2DE8A 3ZVEA 3M5OA 2K0QA 3BTWE 4IC6A 4D8NA 4DIIH 5JBBS 4Q80A 3AAVA 2WINI 3FZDA 3A7TA 3SZEA 4U01A 4ZHMU 1V2LT 1GI5A 1JOUB 4A92A 4CRBA 5EQRA 1EATA 4GHQA 6GCHG 2OXSA 2WV5A 1TMTH 1KLJH 2BVSH 5AFYH 3SJKA 1G3EA 4A7IB 1SBWA 2HNTF 3PO1B 2Z9IA 1N6YA 2WPDD 2ZKSA 5L6NH 1FPHH 4DVAU 2ZQ2A 2ALVA 1LDTT 4WXVA 2J5UA 2ZDVH 1MAXA 1GJ9B 1NRPH 1VJAU 1O2SA 5FCKA 1V2NT 2G4UA 1YF4A 3KYGA 4JYTA 3U1IB 4DIHH 1FIZA 2R2WU 1HAVA 2WSSD 4NSYA 3QZQA 3HGPA 2Y81A 2FWWA 2BD9A 1QURH 4BNRA 3QZRA 1ELGA 3MU8A 3T27A 1GJ7B 4X1NU 3LC3A 2ANWA 2ZGXH 4I33A 1V6DA 5E0JA 5SGAE 3SJ9A 1XVOA 3A8CA 2Z9JA 1P04A 2AMDA 2CHAB 3SYJA 1CHGA 1NN6A 3PV2A 4X1QU 5A8ZA 2VINA 1NU9A 2Z3EA 3KN2A 1T8OA 1VITH 5T6GA 4LZ4B 4OS5A 2ZU5A 3GCNA 1UTNA 4IBLH 3F0PA 3RXKA 2FLBH 3VB6A 1IQLA 3OFND 4YTAA 3BEFB 3FP8E 2PTCE 1ETTH 3PRBA 5DP7A 2PUXB 3Q3YA 5TCCA 5K7RA 1O2LA 5C94A 1CHOF 4X2YA 3P8NA 1JRTA 1KMHB 4XBDA 3P8GA 2SNVA 2W3IA 4WMEA 3SU4A 1C5OH 3MTYA 3SU0A 1S84A 2ESTE 3A84A 4AOQA 1F5RA 3SHAH 1TX7A 1FZZA 5EPNA 1YM0A 2J97A 1ZLRA 3ZZDA 2J34A 1ZRKA 1ZSJA 1TAWA 4ZH8A 3NZIA 3CS0A 2BLQA 2QF0A 1A0JA 1GBTA 2Z6BD 3FO8D 1ETRH 1Y3VA 4MPUA 4B74A 1XM1A 4JZ1A 1TRYA 1T7CA 4LZ1H 1HLTH 4GAWA 1TOMH 1SGPE 5DG6A 1S6LA 3AAUA 1LPGB 2Q6FA 4JK5A 1GHAG 1H9LB 2R0LA 1TBZH 3SQEE 2BHGA 2ZG0H 4ZXYH 1SMFE 2QXJA 4YOIA 1UHBB 1BMMH 2P8OC 1AFEH 1YLCA 2A7HA 4CH2B 2J98A 2F9UA 1S6HA 4FUDA 3A86A 4Q7XA 1IQFA 3DSPA 2LNCA 3P95A 1W8BH 4FVDA 1V2TT 2HALA 3F2HA 2KX4A 1HAYB 1IQEA 1NM6A 1QR3E 3KEEA 4Q63A 3HK3B 4HFPB 2F9VA 2CF9H 5HM2A 8LPRA 4AC9A 3MH7A 1E35B 5ESTE 1P2OA 4Y7BA 2KR7A 2RG3A 1BRUP 2FTLE 2UWLA 3N7OA 1MQ6A 2GD4B 1GJBB 3RXSA 1T32A 3SI4H 4AORA 1D6WA 1WOFA 2DUCA 3LGWA 1S5SA 3LGUA 3U9AH 2HLDD 5FHTA 1CT4E 2RDLA 1O2MA 3A81A 2B9LA 3BEUA 4XD7D 1C2EA 1C2DA 1KXFA 2QAAA 1OYQA 3F9FA 3ATKA 2BX4A 2VIVA 1QA0A 1FJSA 3ZZ5A 3T2NA 2ALPA 5E2PA 3URDA 1F5KU 1O3AA 2A7JA 1GJAB 1E36B 4DT7B 1SFQB 1GWAA 4BXWA 3URCA 2GCTB 1C5SA 4ABFA 4ZKRU 1FY1A 1TNHA 4MNVA 3CP7A 1HJAC 1MD7A 2KFWA 2F43B 3B9FH 2A5KA 5AHGH 1BQYA 3TK6A 5C67A 1C2JA 1O37A 3A87A 5CHBA 1MKWK 4BTUB 1ARBA 3VXFH 1L1JA 4I8HA 2GJGA 3PMAB 1CU1A 3K6YA 1W2KH 1HV7A 1XKBC 3E3TA 1DT2A 2Z94A 3TJVA 2WV9A 3GY3A 2NU4E 2VGCB 4Y71A 3GCHC 2GZ7A 4XFQA 1QBOA 1THPB 1UK4A 2I6SA 2QIQA 1Z71A 4X2WA 3OY5U 2BXUH 2P59A 1FI8A 5F03A 1H9HE 1DSTA 1C5YB 2XCFA 3ZVGA 3PTNA 3PO1C 1O35A 1MCVA 3LU9B 1HJ9A 1A2CH 3SU6A 4K3JA 5C1UA 1BT7A 3SQHE 1J16A 1TPOA 4D9QA 2FS8A 1MU8B 2GP9B 3PMJA 1CHOG 2V7QD 1P2IA 3TITA 4YXWD 1GMHF 3E1XB 5HM9A 1S81A 2GT7A 3RXRA 1P2MA 1AD8H 3SUEA 1GCTB 1UO6A 1VZQH 2J2UA 4ISNA 1M9UA 3MWIU 3RDZA 1YY3A 1HAVB 1TB6H 2FX6A 1BCUH 1C1NA 7LPRA 2G00A 5I46H 4ZKOU 2GMTB 2CHAC 1OWEA 7ESTE 2KCOA 5TJXA 3RXMA 1HCGA 1O2IA 2F4LA 2AFQB 4Y10E 2FOAA 4M9FA 4ZMAH 2BLOA 1MKXK 1V2RT 4ZHAA 3M5LA 1NFXA 4K8BA 5FX6A 2ZF0H 1TGNA 2UUJB 4OS2A 1KDQA 5C3NA 1TRNA 1O0DH 1YWUA 1E1RD 4GLYA 4THNH 1NRSH 1PFXC 3PLBA 1BBRE 1EOJA 1J15A 2BYAX 2F3CE 1SLXB 4DCDA 1EASA 4I31A 1YPEH 4Q2KA 1TWXB 3GY4A 4I8KA 1C2IA 1FY4A 3A7YA 1FAKH 4RSPA 1WQSA 1F0RA 4NFFA 3BG8A 1TGCA 2H9HA 3A8BA 1O2JA 1HIAB 3VFEA 6ESTA 3AK5A 3V13A 3SNBA 1CO7E 1LKBA 3NWUA 4INKA 3RXAA 2C8YB 2FO9A 1YCPM 3W1EA 4I7YH 4XRNA 2AEIH 1EPTA 1O3PB 1F0SA 1LVMA 1A0HB 2FLRH 1YPJH 4FOUC 1YC0A 2J95A 2ZU1A 4XSKU 2FDAA 1VGCB 2BY7X 1BMNH 5A0BA 4JMYA 1G3DA 2C8XB 5A8YA 3ESTA 4A1XA 3TJUA 3SW2B 4BTTB 2H9TH 1UTKA 1JXPA 1P03A 4FETA 5EOKA 1XUJA 2XCNA 1G3BA 5F8XA 4AX9H 1BDAA 1GI6A 1O2ZA 3F68H 1QB1A 3SO3A 1GMCG 3KHVA 1S85A 1S83A 1XXDA 2JH5D 3AW1A 2Y5FA 3PM3A 1SGNE 4KTCA 1LTOA 3SU5A 1AUTC 2B5TB 3U98H 3H7TA 4J2YB 5E8EH 3TK9A 3UAIC 2GDDA 3SJ8A 1T4VH 3BIVH 4GPGA 3CENA 1W7XH 1DLEA 3S69A 2R3YA 1THRH 1HPGA 2RCEA 1OP8A 3H7OA 4ZCNA 1SQTA 1WDIA 2L6OA 1ESBA 4CBOA 1P2KA 1ZJDA 1FLEE 1Z7KA 1LHFH 3F0OA 6GCHF 1OP0A 3F2FA 5J4SA 1A1RA 1GBJA 3ZVAA 3HATH 2BLVA 3ELAH 2WHXA 3M5NA 5DP5A 5DJ7A 3S7KB 1FMGA 3L6PA 1GL0E 1DANH 1P11E 3MFJA 1GPZA 1HAXB 1QL9A 1EJAA 2AIPA 4D76A 5A0CA 1X7AC 1C5RA 2JKHA 2BD4A 2VH6A 1K0HA 1DICA 5KEDA 1TPAE 2OC0A 2WPLS 1AUJA 1V2OT 4ABAA 1ZMLA 1C9PA 2BVXH 2A1DB 4B71A 1AVXA 1SGQE 2STBE 4BAOB 2VBCA 3PROA 2XC5A 1YPMH 2XNDD 2BZ6H 2AGGX 3LKWA 2R2MB 1TLDA 2GCTC 4FUGA 4RT0A 4WMFA 3RXOA 4DGJA 2O8MA 2QA9E 2G52A 4F49A 4MDSA 3T28A 2ZQ1A 3TGKE 1T8MA 1Q2WA 3PLKA 3QTVH 4X8VH 3I29A 3PWBA 1GDUA 1GHWH 4Z1MD 5EQSA 1EJNA 1YKTA 2B8OH 1YPLH 5HGGA 1GMHG 2AMPA 2P95A 3BTTE 2XYAA 3FOAA 2K8IA 4AFZA 1BTYA 2AERH 2ZFPH 5C20A 1SC8U 3OE7D 2AH4X 1ZPZA 3A7WA 2G8TA 4UONA 1CT2E 1IHTH 1YGCH 1YLDA 2OC7A 1O30A 3BTHE 1NFUA 1TONA 1F92A 3FVFB 4ZROA 5I25A 2OP9A 2GX4A 2BQ6B 3NPSA 1GG6B 2PTNA 3QDZB 3CNRA 2JJ1D 1SGFG 2WZQA 1EP6A 1YPHE 1RTKA 3T5FH 3Q00A 3K2UA 1CGJE 2KAIB 4MVNA 2A32A 4WY3A 1C1MA 3A82A 1A0LA 1SGIB 1W0YH 1O38A 1T31A 2WUBA 2BTCE 3Q3KA 1Y3YA 1BTWA 3VB5A 4I8GA 5CDFE 2HRVA 1P05A 1CVWH 1GHBF 2Z3DA 1DDJA 2YMSB 1FQ3A 2PW8H 1AKSB 1IOEA 1ZTKA 5E2OA 1C2FA 2ZI2H 2HNTC 4Q7YA 3V7TA 1GCTC 3DHKH 3TJOA 1O5BB 3DUXH 2JIZD 2XBYA 1GHAF 4XBCA 1QQ4A 1ZSKA 1O32A 2GMTC 3FFGA 4OS6A 3RXFA 3I78A 3ZZ9A 4JK6A 1VCQA 1DX5M 1ELCA 3ZV8A 3Q3XA 1Z6JH 1TE0A 1D3QB 1WTGH 1GBMA 1SGDE 4Y6DA 2P93A 2XTTB 1J14A 2BDYA 3OEED 2ODQA 1PPZA 1ZMJA 1O2RA 5T1VA 5T6DA 1K1MA 1Z6EA 1C5TA 1TOCB 1XVMA 2PKSB 3BEIB 5HKKD 5C5OA 3C27B 1C2LA 1EAWA 1OSSA 2ZGHA 1HYLA 3MO6A 1FY5A 4FXGH 1C1TA 2SNWA 2PGQB 1GMDG
chains in the Genus database with same CATH topology
1O5DH 3DT0H 1C5LH 1K1OA 4RN6A 1LMWB 1Z8GA 5HXFA 2H9EH 1VJ9U 5FAHA 1O5GH 2OBOA 1ZPCA 1YCPK 1UCYK 4IMQA 4UFGH 2XWBI 2ZGCA 2VVCA 3UNQA 3SU1A 1FPCH 2ODYB 3ITIA 3TPIZ 8ESTE 2QF3A 1FY8E 1XMNB 5FBIA 1GCDA 2TGDA 2TGAA 4Y76A 1VGCC 4AZ2B 1DXPA 3EDXB 3UY9A 2A5IA 3F1SB 1HUTH 4ISIH 1OPHB 2JETC 1N1LA 3U8RH 1EZQA 1AY6H 3CS7A 4DG4A 2F9PA 3ZZ4A 1CA0B 3T29A 2ZHQH 1F2SE 1N8OC 2ZTXA 1G3CA 2ZHEH 2BXTH 3QUMP 3IITA 1GJ4H 1AGJA 1A61H 5CMXH 2BY6X 4YO9A 2FOFA 2FTMA 2O8LA 1GHZA 4IN2A 1MBMA 1MKWH 3STJA 1GJ5H 4ASHA 4GUXA 1AVGH 4JZDH 1SOTA 1O3GA 4X1RU 1SB1H 3S9CA 3H5CB 1TA6A 5T3HA 1DUAA 2OINA 4MLFB 1V2VT 2HOBA 4ISLA 1FN8A 4K8YA 2FOBA 3MHWU 3BTME 2OLGA 1QA7A 3MOCA 1QBNA 1BHXB 2ZTZA 1ANDA 1O3JA 2Q6GA 1TFXA 1IQNA 3BSQA 2FOMB 1GBBA 3RMNH 4CRAA 3O8RA 1J8AA 4AFUA 1VITF 1QGFA 3KQDA 1WV7H 3FP6E 4MNXA 1H4WA 1SGEE 4AG1A 2BDGA 1PYTC 2Z9GA 1TBRH 4NCYA 3RXPA 5GJ4B 4OGXA 3SUGA 1WCZA 1ANBA 2ZCKP 1AZZA 1D4PB 2ZU4A 1O3DA 3MO9A 2QGRA 3ATLA 1O2KA 3LIWA 3E6PH 1GI4A 6CHAB 1GHVH 3RXHA 1GI1A 1O5EH 1TALA 1W11U 2BMGB 3ZZAA 2YOLA 1MZAA 2FI3E 1OX1A 4BANB 1GHBG 2F9BH 3BN9A 1Q3XA 3AASA 1MKXH 1FONA 5AFZH 4K60A 1LQDB 1AWFH 1OXGA 2QN5T 2ZFQH 4MG3A 2ZDKA 1O2HA 1BIOA 3UQOA 2QCYA 2ZU3A 3M7TA 2V3OH 3T26A 4AB9A 3OU0A 2OBQA 1P9UA 1SOZA 4D7GA 3KNXA 1ZHMA 2VIPA 1ZTJA 1Y5AT 1GG6C 1HDTH 4ABBA 5AVDA 3TIUA 4TYDA 1C1QA 1S6FA 3FP7E 3F6UH 1RS0A 4J1YA 1WU1A 2FP7B 1JRSA 3S9AA 4CRDA 1ELAA 3SZNA 4AGKA 4NIYA 3QLPH 1INCA 4R8TB 3V12A 1DS2E 2TGPZ 1UTJA 1JMOH 4CBNA 4ZAEA 1UVOA 3B8JA 4MPVA 1HBTH 1NC6A 2XBWA 5DO4H 2IOTA 1W7GH 1BOQA 4TWWA 3TU7H 3E8LA 1UVUH 1HAHH 5ETXA 3NUMA 3KCGH 1HGTH 1P3CA 3MNBA 2Y80A 5E0HA 1V2QT 1RGQA 1GMCF 3S9BA 1C5NH 4CRGA 3RXTA 5DKMA 3BTKE 4ISOA 3LH1A 4U32A 2WPHS 1G30B 3MU5A 3BG4C 4AN7A 1QQUA 1ELFA 1DWDH 3D65E 1LCYA 1YP9A 2GGVB 1O39A 2NU3E 2OD3B 1BRCE 1F5LA 2TGTA 1ELTA 3O8BA 1JIMA 2SGFE 1G2LA 2PKSC 4F4OC 3ZVCA 1UTLM 7GCHF 5GPIB 1HRTH 1LHDH 1WUNH 1HAPH 2HPPH 3LC5A 1HFDA 4X8UH 2BD2A 1OS8A 1PQAA 1AFQB 3GISB 8GCHG 4CHAC 5GCHG 1BJVA 9ESTA 4ABDA 4CH8B 1O2WA 3A8AA 3ZZBA 4O3TA 1LVBA 5GWZA 1K1LA 2FOCA 2ZFSA 1FUJA 1GI0A 1P2QA 1W10U 5B6OA 2V0BA 2R3UA 2W5EA 3TLOA 1TGSZ 3PMHB 4ABIA 1GBCA 3U8TH 5PTPA 3AVZA 1P12E 4K5ZA 2VWLA 4BAHB 3P8FA 2ZPSA 3PMBB 3SUDA 5JDUB 3M36A 2FOEA 1SI5H 4TY6A 1Y3UA 2HGTH 4RKOB 2AGEX 3GY8A 1YYY1 3RU4D 2HLCA 3SNDA 4TY7A 1CA0C 1EQ9A 4E7NA 1EUFA 1Y5UT 1VITG 4K2YA 1XKAC 3ZYEA 1L1GA 2GVFA 2H5CA 1ABJH 4NIWA 1MBQA 1SG8B 3RM0H 5DK1A 1PPFE 3U1JB 1W3CA 1O3CA 3DA9B 1LVOA 1O34A 4YT6H 4YOGA 4QT8C 4FUIA 1O3LA 5FPTA 3RXUA 2HWLB 1O2VA 4AG2A 2PR3A 6LPRA 2QY0B 1MD8A 1ESTA 2BZAA 2ZECA 3LGIA 3TH3H 3MU1A 2BB4A 1Y8TA 1GDNA 1KSNA 3K6ZA 2EC9H 5A0AE 3LGVA 2IN2A 1A5GH 2XBVA 4ABHA 1H1BA 5T6FA 3SN8A 1NRQH 1Z1IA 3RXQA 1MCTA 2GZ8A 1D3PB 4M7GA 1TNLA 1O3MA 3BTFE 1V2JT 2GV6A 1QIXB 4UE7H 1B5GH 4NA9H 1FIWA 1UVPA 1MTWA 1UK3A 2BQ7B 4FU7A 1TX8A 1YPKH 2SGDE 3RU4E 4JYVH 1MTNB 3JZ1B 3UOPA 2BDBA 1DFPA 3A88A 1GHYH 2V3HH 1NS3A 3GY2A 1PPCE 2ZDNA 1BTXA 3GDUA 4UFFH 1SGCA 2ZO3H 2CMYA 1XXFA 1B0FA 1LPZB 2WPJS 1O3KA 1K2I1 2O9QA 3ENSB 3F9GA 3W94A 2ZP0H 1NZQH 2G4TA 3MH5A 4YLUA 2ZDAH 1DWEH 1ZGIA 3A85A 1SVPA 1W14U 4INHA 3UOUA 3FAOA 4O3UA 3HKJB 3AW0A 4DY7B 1PPHE 5AF9H 3QO6A 1B0EA 2ODPA 3WY8A 3A7VA 1DE7H 2ZPRA 2CGAA 2O8TA 4Z0KA 2ZU2A 2V35A 1TYNA 1L4DA 2VWOA 1AO5A 4KP0A 3I77A 1THSH 1EZSC 3GCOA 2VU8E 5F8ZA 2CXVA 2FOHA 1GMDF 3HK6B 2XXLA 3NCLA 3TK5A 1U6QA 1QFKH 1J9CH 4LK4A 2A45B 2A4RA 1K9OE 1WYKA 5EGMA 1MAYA 1IHSH 2FI5E 2FOGA 2YNBA 3RMMH 1BHXF 1SGRE 1MMJN 3GCTG 4X6NA 3ZZ6A 1YCPH 1UCYH 1DPOA 7GCHG 2F9OA 3M3VA 1HNEE 1BRAA 2D2DA 3OSYA 1C5UA 1EJMA 3S7HB 4OS7A 1DWBH 3PB1E 3KGPA 4BXSA 2JH0D 2BX3A 3RXGA 2VIDA 3TJNA 1GI3A 1RTFB 2UUFB 1QRZA 1S0RA 3SGAE 2ILNA 3OX7U 4NG9H 4I32A 1FY3A 1TPPA 2QXHA 2J94A 2W7UA 1MUEB 1QBVH 1GBAA 1P2NA 1KXAA 1NFYA 3RXLA 1TQ7B 1TNJA 2OQUA 1QJ7B 1ZGVA 3F9EA 2PSXA 3A89A 1WTHD 4GSOA 1EAUA 2GDEH 1A46H 1H9IE 4ZXXH 2VNTA 2G81E 3GY6A 2VWMA 4H4FA 3VB4A 1IQHA 1E38B 1KYNA 1O2YA 1BJUA 1GI9B 4MPWA 2GT8A 1NT1A 2B0FA 1QCPA 4FUBA 3BF6H 2ZEBA 4X6PA 2NU1E 2H6MA 4UDWH 1H8IH 1PPEE 2FI4E 2GV7A 4MNWA 3UQVA 3TGJE 4GHTA 2ZHDA 1RRKA 4HI3A 4X1PU 4HGCA 4KTSA 3SNEA 1GGDB 4OS4A 1YPGH 3GYMA 4DOQA 2OC8A 1P02A 3EQ0H 4CRCA 1F0TA 3SV6A 3MNSA 1LVYA 3KQEA 2ZCLP 3D49H 4B2AA 1C2HA 1BMAA 1OWJA 2VGCC 2V6NA 1C5ZB 1UTPA 4TWYA 2Z9KA 1HB0B 2EI6A 3E0PB 1KTTB 1PPGE 1IQKA 3Q77A 3EAJA 1K28D 4A5TS 1XX9A 1GI7B 2BOHB 3UTUH 5L30H 1PQ7A 3SUFA 4Y0YE 1IQJA 1TNIA 4H42U 1O3BA 3UNSA 2J9NA 2R9PA 3S0NA 1GJ8B 2VH0A 4FUEA 4I8JA 4AYVB 4NIXA 1UHBA 1MTSA 3UWJH 1P3EA 3VB7A 5EXNA 1PYTD 2PHBA 4GCHF 1TA2A 1MH0A 1QJ1B 2PUQH 3VEQB 1IAUA 3Q76A 2PGBB 9LPRA 3ZZ3A 4ZUHA 3QX5H 5FBEA 1EOLA 1UTQA 2P8OB 2ZTYA 4BOHA 1RJXB 3UIRA 3RXJA 1B7XB 2ANKH 1DVAH 3NKKA 4MPXA 4ZKSU 2Q6DA 2FZZA 1NROH 5H4IB 2XNIA 1FDPA 4TPIZ 1J17T 3SJOA 3R0FA 4K69A 5EW2H 1KXCA 2PV9B 1GHXH 4K1SA 4VGCB 1C1RA 4INLA 3VPKA 2BD3A 1JIRA 1GI8B 1GBFA 5L2ZH 1Z8RA 4WH6A 5JBTA 4DJZB 3SHCH 1V2PT 1K1IA 2ANYA 4AGJA 2FIRH 5LGOA 1CGHA 2ZNKH 3GOVB 4FUCA 4B2CA 1GBDA 1VR1H 5JBAS 3QGJA 1CSOE 1ZOMA 1ELEE 1KDQB 2ZWLH 1EZXC 4Q7ZA 1NFWA 4BAMB 1EAIA 2BQWB 2FESH 2BD5A 5BRRE 5DP8A 2D26C 1LHGH 1OWKA 1ZTLA 3UREA 2HPQH 3ZZCA 4NA8A 1T8NA 5GIBA 1O5AB 2H1UA 1QB6A 3RC5A 2OTVA 3ODDA 4WMDA 3P17H 1RIWB 1KLIH 5FXLA 3VXEH 2G51A 5IDKA 1DOJA 1EAXA 1HJAB 1G2MA 3SGQE 1EX3A 1HXEH 5JB9S 3ATWA 2BLWA 1KXBA 2HVXA 1WQVH 3LDXH 5FPYA 1GVLA 3F9HA 1E0FD 1EPTB 2VVUA 1S0QA 1O2PA 2OC1A 1DY9A 3RMLH 3RUOA 3OY6U 2P16A 2ZFTA 1ZHPA 1GBEA 2VIOA 3KF2A 3SI3H 1DWCH 1YPHC 5GXPA 1G32B 1ZJKA 5EODA 3B23B 8GCHF 3GCHB 3D62A 3IWMA 1SSXA 4KKDA 5DGJA 1EKBB 5GCHF 1CGIE 1LO6A 3LPRA 2W3KA 5JPMH 4OGYA 2TRMA 2UWOA 4KGAA 4PROA 1DXWA 3BTDE 3E16B 3NK8A 1T4UH 2EI8A 1ZRBA 5CHAB 1PPBH 5DPAA 4H6SB 3BTQE 3RC6A 4SGBE 1V2UT 2XRCA 2FYQA 4WF8A 3UUZA 3UNRA 4Y8XA 4YT7H 1KLTA 3TNSA 1A5IA 3K65B 1C5MD 1N6XA 1Q31A 1TNKA 2NU0E 3O8DA 3PWCA 1IQGA 1ARCA 1ID5H 1GBHA 1A4WH 2ZFFH 1O2QA 1OOKB 4R0IA 1OWDA 1GBIA 3M3SA 1ZYOA 4AYYB 1QY6A 4A1VA 1LPKB 1A5HA 1C4Y2 1O3NA 2WUCA 4LXBH 3SV2H 5E0GA 3GDVA 1C5PA 3QN7A 3E91A 2RA0A 4YZUA 3LGYA 2EI7A 3LGTA 5F6MA 1EZUC 4NZLA 1TX6A 2ZHWH 1DM4B 5CE1A 3RXCA 4Y7AA 1EXFA 1ETSH 1A3EH 4O03A 1WBGB 3QK1A 2DE9A 3RXDA 4X2XA 5FCRA 3TH2H 1KY9A 3E90B 1F7ZA 4JZEH 1L1NA 1T8LA 1CBWB 3EA7A 1OP2A 2NWNA 3ZV9A 4BTIB 5EPYA 1HAOH 1V2KT 1EB2A 1G36A 1GI2A 3OTJE 1DITH 2CN0H 1XUKA 2SFAA 5IYTA 1AI8H 1HIAA 3M61U 3M7QA 2WPKS 4JZIA 4GCHG 1BTPA 1SGYE 3ZZ7A 1O3OA 1GGDC 3M3TA 1JBUH 3SV8A 1DY8A 4YLQH 2JH6D 1O3FA 3BTGE 1ELDE 1LKAA 1AMHA 4KTUA 1SQAA 2FPZA 1L0ZA 1ELVA 3KQCA 1O3HA 2OUAA 2A4OA 2O8UA 4FVBA 1P9SA 1JWTA 3IG6B 2Y7XA 4K1EA 1MTUA 1W13U 5C1YA 2C90B 1D6RA 2H2ZA 1FV9A 5J4QA 1UTOA 2Z7FE 4FUJA 3PYHA 5DP4A 1C2GA 2ZC9H 1BBRK 1C5XB 5DP9A 4WWYA 4JYUH 1C5VA 5DP6A 4X6MA 4B2BA 3EYDA 4O97A 1P2JA 1W0ZU 2VWNA 4X2VA 1TPSA 1SHYA 1MTVA 1BUIA 2F83A 3LJOA 1O2OA 2XBXA 1XUFA 1SGTA 2ZGBH 3SV7A 2A2QH 2K1QA 1GDQA 1C5QA 2J38A 2ULLA 1NESE 1LHEH 2J4IA 2WPMS 3LT3A 4U30A 2LPRA 4MQAA 2J92A 4AFQA 3PV4A 4DURA 2P94A 3P8OA 5C5NA 3EA8A 2BM2A 1XUHA 3FZZA 1O2GH 2SGEE 2ZGJA 2WYGA 5GDSH 1AIXH 2ANMH 1AE8H 5LPRA 4I8LA 4Y11E 1SLVB 4CREA 4VGCC 3RLWH 4X8TH 4XBBA 2PSYA 1KIGH 1OWHA 3PLPA 2FMJA 1K1NA 1AHTH 7KMEH 1C1UH 4FUHA 3RLYH 1UCYE 2C8WB 3A80A 1TGBA 4ZKNU 1NRRH 1QRWA 1V3XA 1GJ6A 3MO3A 1AU8A 3GCTF 2VB0A 2SGQE 2Z9LA 1XUGA 2OCVB 1SL3A 2QXIA 4NFEA 2GCHG 5BPEA 3RC4A 2O8WA 2XWAA 5HMAA 3OYPA 8KME2 1Z8JB 3UFAA 1WAYB 3LOXA 3VGCB 4CR9A 1ELBA 3MYWA 1SPJA 1AB9B 4Y8ZA 5EXMA 3U8OH 3UR6A 1LQEA 5JB8S 1QL8A 1TABE 2D8WA 2AMQA 4YOJA 1RIWC 2PLXA 2FX4A 1D3DB 1UVSH 1C1VH 1P57B 1ANCA 2BD8A 2H5DA 3DD2H 1LHCH 2F9NA 2P3UB 2M5TA 2BY9X 4ESTE 3ZVBA 3A83A 2IJOB 1EPTC 1ZR0A 2XC0A 1AE5A 2Y7ZA 4ABGA 3G01A 4TPYA 3UWIA 1G37A 3TGIE 1C4U2 1HJ8A 1QNJA 5LPFA 4B1TA 1ZSLA 1RD3B 3TVJB 3V0XA 3RM2H 1AVWA 3ODFA 3FANA 4DW2U 2A31A 3SU3A 2ZDLA 1C1SA 4B75A 1CT0E 4WXIA 4RKJB 2ZFRH 3SGBE 5CHAC 2KAIA 5K0HA 3GICB 1G9IE 2CV3A 1C5WB 3BTEE 1HXFH 1O3EA