4OS1A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk601 (bicyclic 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A01
2ZDMA 3K65B 2GCHG 1AB9B 2BD4A 1SLWB 5LPEA 1O2UA 1WTHD 3SUFA 1SG8B 3UUZA 1EXFA 1X7AC 2I6QA 2CN0H 2G8TA 3EA8A 1C1WH 1LDTT 2VB0A 2FIRH 4FUIA 1ESAA 2BY7X 1QBOA 4UDWH 2OQ5A 3ZZDA 1KXDA 1TPSA 3BIVH 1H8IH 1O2HA 5C1UA 2V35A 1O36A 3RC4A 1P9SA 4ZHMU 4YOIA 1A4WH 2GTBA 1QY6A 2GV6A 1BMLA 3OY5U 2D2DA 4ZKSU 1BJVA 2J9NA 1QNJA 2JH6D 1SHYA 1GJ9B 1ANEA 1KXFA 2BXTH 3UTUH 1VGCB 1BT7A 3LGIA 1OS8A 1SL3A 2NU3E 1GBKA 2HPQH 4ZKNU 4NG9H 1P3EA 3MU8A 1VGCC 1FZZA 4K2YA 4A1TA 3SV6A 1CT2E 1UTNA 1O31A 2BLQA 1O3LA 3FAOA 5JBTA 1RS0A 1NRPH 2ZZUH 3B8JA 1C5YB 2XBVA 3TNSA 2FO9A 3I29A 2PTNA 2OP9A 3QWCH 5DP7A 1GHWH 4X6OA 2EI8A 1GVZA 2TGAA 3NUMA 1VR1H 3BTDE 1P9UA 1XM1A 3A81A 1UTPA 3A85A 1CVWH 4ABAA 2G5NA 2V0BA 1EP6A 3BTGE 1BTXA 3UWIA 4K1EA 1SI5H 5JBBS 4X0WU 4TYDA 2VIVA 1ELVA 4RKOB 5JB8S 1GHXH 1H8DH 1ABIH 1RFNA 1AI8H 4Y0ZE 2W7SA 2XC5A 4YM9A 2BLWA 2R3YA 1AHTH 1DITH 1O39A 1BIOA 1TMBH 4K3JA 2PSXA 1ZJKA 1IHSH 4FUDA 3GYLB 3FZDA 1TX7A 1GMDF 2PUQH 1YF4A 4GHTA 1HNEE 1DWDH 1WBGB 3AW1A 4CRDA 1LMWB 2A1DB 1SGYE 4XSKU 3LC5A 1RXPA 3BSQA 1PFXC 1MTVA 1IQJA 2ZTYA 1LHEH 1G2MA 1AQ7A 1HV7A 2ZDNA 4FU7A 3VGCB 8GCHF 4ZXXH 2GT7A 5C5NA 2Q6DA 1SBWA 1MAYA 4JZDH 4DW2U 1TGNA 2G00A 5A8YA 3VXEH 3AAUA 1Z8RA 3SN8A 1YBWA 1MTWA 4WXVA 1HXFH 3GICB 1TNJA 1QB1A 4Z6AH 1Q3XA 1GI5A 1HAIH 2G5VA 4UE7H 3U9AH 1OYTH 1XXDA 3GDUA 3M61U 3P6ZB 3U1IB 1C5MD 1DWCH 3QK1A 4IW4E 2C4FH 2ZPSA 5GDSH 1F7ZA 2C8WB 1UVTH 2TRMA 1B0FA 5G4BA 1NTPA 4WXIA 1NZQH 1H1BA 1HIAB 2ALVA 3IG6B 1C5WB 4OS2A 4E06H 3D49H 2W26A 1C5UA 1EQ9A 3M5MA 4I8GA 3NZIA 1TA6A 1L1GA 2D8WA 2PR3A 1IQLA 2F91A 2HWLB 4GVUA 4MLFB 2KAIA 3F6UH 3SJKA 4Y8ZA 4XBDA 2HNTE 4BAHB 3ZYEA 3M5OA 4GCHF 3JZ2B 1DOJA 2PV9B 1HAPH 5L2ZH 1EZQA 4AB9A 3KL6A 4B74A 1WOFA 3MH4A 1O3OA 1FDPA 1DX5M 4A92A 3QN7A 1DT2A 3ZVDA 2BD7A 1OWDA 3P8FA 1PPCE 1DY9A 2Y5FA 1K1LA 2ZGXH 2C90B 2SGDE 4UD9H 2Y7XA 3MU0A 1ELTA 4Q7XA 3LC3A 2GV7A 1ZMLA 2FLBH 1QJ7B 3ZVCA 3PO1B 1O3GA 3TJUA 1SQAA 3AW0A 1G9IE 3U8OH 2XBYA 1O2LA 5A8ZA 1C1SA 4X1SU 3RXCA 3B9FH 3KQBA 4ZROA 2BQ7B 1RTFB 3M3VA 1F92A 4NA8A 1LCYA 3M36A 1VITF 1C2DA 1TGSZ 1UK2A 3KF2A 4MPVA 3SJ9A 3RXOA 3Q3KA 2ZGJA 1BTYA 2W7UA 4SGAE 2O8UA 1ETSH 5F8XA 3VB6A 4A5TS 1A0LA 3L33A 2BDAA 3RLWH 5DK1A 1KTSB 1HAHH 5FPSA 1KTTB 1SGCA 1QL9A 1IQKA 1C5QA 3PTBA 4FU9A 1W12U 3PYHA 1BMAA 1T8LA 3LH3A 1SSXA 1QIXB 3A8CA 4NFEA 1SGRE 2CF9H 3OYPA 1GPZA 1XUIA 2ZU3A 1AD8H 3CS7A 1BBRK 2J95A 1PJPA 2QXJA 3Q77A 4WMFA 1V2WT 1O33A 2QGRA 4ABDA 1AWHB 2A7HA 2PKAA 1J16A 3SHCH 3Q76A 3BG4B 4ESTE 2UWPA 2ZU4A 3RU4T 4DIHH 1C2MA 1CGJE 2FPZA 1P10A 4JYVH 2ZWLH 1KDQA 4KGAA 1ARCA 3E0PB 1O34A 3QTVH 4ABHA 1G3CA 4OS7A 3A88A 5FCKA 1GHYH 2PHBA 3V7TA 2Y82A 3UNQA 4X6PA 1AMHA 1P12E 1DDJA 2XW9A 1RIWB 2W5EA 1GBEA 3GY4A 1C9PA 1GCDA 3A89A 1ESTA 1UVPA 2FODA 4UEHH 4NA7A 1FN6A 3VB5A 2ZDVH 3ZZCA 5A2MH 1SLXB 2THFB 3GY7A 1GBDA 3UREA 4FUBA 4MDSA 2O8LA 1G36A 3G01A 2Z3CA 2YNAA 1TB6H 4ISHH 4X8VH 3U8TH 1NRNH 3UY9A 2VVVA 3BG8A 1MKWK 1EKBB 4WH8A 3UQOA 3DUXH 3PROA 3KN2A 1TLDA 1A61H 2FOMB 1V2QT 2A2QH 2NWNA 1KDQB 1MUEB 2ZU5A 2RG3A 2ZFPH 1KIGH 1O2SA 1RD3B 1GBCA 3A82A 1DM4B 4BAKB 4JZIA 1D3TB 1QB9A 1Z6EA 3MNSA 1P2JA 2WINI 2A7CA 1QFKH 1V2RT 3IITA 4H42U 1O2JA 1YP9A 5LPRA 3RXQA 3UFAA 2Z9IA 2QY0B 1JRSA 1GBTA 3RXIA 3LKWA 3BIUH 3EQ0H 2QAAA 3VB4A 1AFQB 4YOGA 1QQUA 1VJAU 1FY5A 2BDBA 4JK5A 4UFFH 1TQ7B 2BB4A 2DE8A 1E0FD 1EATA 5FX6A 1LO6A 3ELAH 2A2XH 1S6HA 3KCGH 2FYRA 3ZVGA 1IHTH 2IPHA 4NZQA 4Y71A 3QGNB 1UCYK 1CE5A 1SGDE 5CMXH 1K1JA 5JBCS 1G37A 3FP6E 5A09A 2FOHA 3NCLA 3SI3H 1SHHB 3SNAA 1Q31A 1AVGH 1XUGA 1FJSA 3SZNA 3DHKH 2H2ZA 2VVUA 4J2YB 1O2IA 1BRCE 2ZCLP 1O2PA 3UR9A 1MZAA 2R3UA 1MKXH 3RMNH 1L1NA 1O37A 3EAJA 2ZFTA 2HOBA 3P8NA 1E38B 3ZZBA 1O3KA 3U1JB 4Y10E 1V2NT 1TOCB 5GXPA 1TE0A 4ABIA 4CHAC 1GBBA 1C1PA 3ATIA 1AFQC 3A8BA 3BTWE 1JIMA 3A84A 2Y5GA 3Q3XA 3RXSA 2A4RA 3AASA 5ESTE 3RXAA 2LPRA 1ORFA 1H9HE 1O2RA 1O3BA 3BTFE 6ESTA 3TK9A 3SV8A 1O5EH 4AFUA 1FAXA 1YPKH 2W3KA 1PQ8A 2PTCE 3BEIB 2F9UA 1BMMH 1TRYA 7GCHF 3LU9B 2SGPE 1V2KT 4ABBA 1O3AA 1O3PB 3GY5A 4AGJA 6CHAB 4ABFA 4FXGH 1GL1A 4O3TA 2GX4A 1TABE 3KQCA 4ISNA 4B2AA 2HRVA 5E2PA 1MBMA 3E16B 4IMQA 3PMHB 4F49A 4Y7AA 2ZG0H 2DE9A 1CU1A 3ZZ9A 2BDCA 2TIOA 1B7XB 4LZ1H 2Z3DA 3ZVAA 1Y5BT 2FESH 1EAIA 1HGTH 4CBOA 2BD5A 4NWLA 2Z9KA 1C1OA 4TPYA 1GBLA 1ZYOA 2G4TA 2FI5E 2FX6A 1F2SE 1V2TT 2VIDA 3F9EA 6GCHF 3T29A 5AF9H 4UONA 3A86A 3K6YA 4FUFA 1XVMA 4ISIH 5AHGH 1BTHH 1G3EA 1QBVH 3ESTA 5J4SA 3D65E 1LQEA 3W94A 2VWMA 2B7DH 1DSUA 1YC0A 4INLA 3PLPA 1GJDB 3HK3B 3NKKA 5EOKA 1E36B 2XXLA 4ZKOU 1ELCA 5EGMA 1S0RA 1GG6B 3RXDA 4IN1A 1MCVA 4ABGA 1OOKB 1A1RA 1W11U 1J9CH 2A7JA 1MQ6A 3M7UA 1O2YA 4HI3A 2H1UA 3STIA 2C8YB 3U69H 1QRZA 1EB2A 4E7RG 2QF3A 2BDGA 3RXTA 4X1NU 3FFGA 4JMYA 4NWKA 1ZPBA 4DG4A 1W7GH 3OY6U 2OUAA 2QV1A 1OXGA 2GCHF 1G30B 2O8MA 4DVAU 3TH3H 4H6SB 3LGUA 1P06A 3BF6H 3MNBA 3LPRA 2ESTE 1S0QA 4O97A 3RMMH 1JMOH 2SGAA 1GL0E 2ZEBA 5F8TA 3LGWA 3TNTA 1KXBA 3PLBA 1FN8A 3PWBA 4U30A 1LHCH 2Q6FA 4MPXA 1ZTJA 1TIOA 5AVDA 1QGFA 1XUHA 4NIYA 1BTPA 2SGFE 2NU4E 4QT8C 2Z94A 5T6GA 3D62A 1GHBG 1QL7A 2BXUH 5K7RA 2XWBI 2FLRH 4JZ1A 4LXBH 3BTQE 4CHAB 3VXFH 5EW2H 2ODQA 3T5FH 4YLUA 4B1TA 3TK6A 2Z7FE 2XBXA 1ID5H 2ZA5A 3TGKE 1VCWA 2GDEH 1CBWC 3S9BA 4UFEH 1SGIB 4GSOA 4E05H 4BXSA 1V2PT 1EZSC 4LZ4B 2I6SA 3SI4H 1CGIE 2BY9X 3ATLA 5TCCA 1LHDH 3W95A 5C3NA 4Y8YA 1GJ6A 2P93A 2H9TH 2P3UB 1OWKA 1BTZA 2BTCE 2RA3A 2GD4B 2ZP0H 1UTKA 1K21H 1O2NA 1DY8A 3TIUA 4AORA 5C1YA 2VIOA 2P3TB 2CXVA 4FUGA 5C5OA 1J17T 3VEQB 1T8OA 3HKJB 4CREA 4KTSA 3E8LA 4NGAH 1LPZB 2TGDA 2J38A 1TBZH 1D6WA 2WUCA 3K6ZA 5TCAA 1AUTC 1Y3XA 2A5IA 1F5LA 4NFFA 1W0ZU 3TGIE 2B9LA 3LONA 4NSVA 8KME2 3SNEA 2QA9E 2J2UA 1XUJA 2F3CE 2ZECA 1QJ6B 5EXMA 2P95A 2W3IA 1P2OA 4H6TA 1PQ5A 1GHBF 1OP0A 3RXFA 1W13U 1MU6B 2Y80A 1EP5A 2OINA 3DFLA 2P8OB 1HJAC 2BVSH 3RC5A 1LQDB 4KTCA 1GJBB 1KLIH 1GMDG 1A7SA 4UFGH 2F9BH 4RN6A 3T2NA 3QX5H 3M3TA 4MTBA 2VH0A 1EAUA 2BX4A 4DY7B 4RKJB 3FANA 4I8JA 1WCZA 3I77A 1O2WA 2Q1JA 1T8MA 2ZIQH 4IBLH 3JZ1B 2FI4E 1S82A 3WY8A 1O2OA 2V3HH 2G4UA 1TNGA 1ZOMA 4HZHA 1GBMA 2KAIB 1GI9B 3SO3A 2FOEA 2GZ8A 3P8GA 4K8YA 3T62A 2JH5D 4CRBA 3SGBE 4B76A 3MU4A 1OP2A 1J14A 4Y6DA 1W10U 2ZGHA 1EASA 4I31A 4WH6A 1MD7A 2AIQA 4RSPA 3ATKA 1THSH 2EI6A 5BPEA 1NT1A 4I32A 3NXPA 2M5TA 2ZU1A 2BZ6H 2AMDA 5EW1H 2C93B 2ZGCA 3LH1A 3RXPA 4WMEA 3MO3A 1V3XA 4WWYA 3ZZ4A 3UIRA 1CT4E 2TPIZ 5J4QA 2EA3A 1DXPA 1IQHA 1D3QB 2JETB 4XDEA 1C5SA 1FPHH 1O35A 2HVXA 1ACBE 3OX7U 1MD8A 1C1TA 1VITG 3DA9B 1DS2E 3SNBA 1AU8A 4I8KA 3F68H 1W8BH 1V2MT 2FWWA 2HGTH 1F0RA 1LPGB 1O2ZA 2G81E 4Y11E 1VCPA 2O9QA 1CGHA 4CR9A 5CHAB 1RIWC 1P04A 3BTHE 1TAWA 7GCHG 1PPFE 3O8RA 2B8OH 1BUIA 1QB6A 2HNTF 1T32A 3Q3YA 1SQOA 1CHOG 1TBQH 1QHRB 1ZSJA 2A5AA 1EPTB 3PMBB 5E0HA 2OD3B 5F6MA 1BDAA 3CP7A 5EXLA 4MNXA 2H5CA 3V13A 5FHTA 1RGQA 3QZQA 1FONA 3RM2H 2WPLS 1ETTH 2STAE 4XBBA 3ZV9A 3QLPH 3L6PA 4LOYH 1IQNA 1YPHE 5FBEA 1BHXF 2Y7ZA 2VGCC 3SHAH 1BRUP 2SGEE 4TPIZ 3P17H 1AN1E 1C2JA 5T6DA 1VJ9U 3Q00A 1PPGE 1BB0B 4X8SH 5EPYA 5EQRA 3TJVA 1ZTLA 2H6MA 5E0JA 1CO7E 1GVKB 1ZZZA 4I8LA 1FY4A 4AG2A 1TNLA 1YPHC 3FVFB 2ZDAH 1Z8GA 2FOGA 3FP7E 1EX3A 2BM2A 1FMGA 3ZZ8A 3CS0A 1P2IA 1C1RA 3S9CA 1GI2A 1WU1A 4KP0A 1CBWB 2H5DA 5JBAS 1QBNA 1FLEE 1SLVB 1YCPM 1F0SA 5EODA 3L3TA 4CRGA 3E91A 1C1QA 5TJXA 4U32A 8GCHG 3MNXA 2WV4A 1V6DA 1C5NH 3ZZ7A 1FAKH 1ELGA 4AFSA 1QJ1B 1LTOA 1UTOA 3ITIA 3NWUA 1ETRH 5C67A 4K1SA 1YPLH 2EI7A 1W7XH 1HRTH 1MKXK 4ZUHA 1ANCA 1BCUH 2ZPRA 1SLUB 1QURH 2ZQ2A 2XYAA 3M7TA 4B75A 4O03A 1WQVH 1UJ1A 3LGVA 2IN2A 1SMFE 2A5KA 1K1MA 1ZJDA 1K2I1 1HAYB 1QA0A 1T4UH 5DPAA 2OC7A 2GMTC 1HPGA 2A0QB 5F03A 3SJOA 3HPTB 1AWFH 4Q2KA 1DSTA 2GZ7A 3A7XA 4Q7YA 4NA9H 3DT0H 4AFZA 3URCA 1C2FA 1RRKA 5FPYA 1LHFH 1O2TA 2R2WU 5JPMH 5E8EH 2F9PA 1C5ZB 1ZHMA 2FOCA 4KKDA 5GIBA 1DFPA 3GDVA 1A5GH 1EJMA 4O9VA 4NIWA 1O3EA 4GUXA 2GGVB 5EPNA 1L1JA 1BA8B 1V2UT 3LT3A 2ANMH 1EB1H 1QQ4A 1IQIA 4A1VA 1L0ZA 3BTTE 4X6NA 3D23A 2VH6A 1C9TA 1RTLA 1C5LH 1GDQA 2CHAC 2ANWA 1GMHF 1P2KA 5FX5A 1MKWH 5JYIA 4MNWA 1MCTA 3TJOA 1Y5UT 1D6RA 4WJG2 4AYVB 1JIRA 2PSYA 3E3TA 1P2QA 3TLOA 1SGPE 1NFUA 1K1IA 3GCNA 7ESTE 1Z8JB 2VNTA 1SGEE 1WV7H 1NU9A 1C1VH 4D7FA 3I78A 5FCRA 1AKSA 1ABJH 1S84A 2BD8A 1AFEH 1ANBA 4D7GA 2HLCA 1C1MA 1N6YA 3VB7A 1WSSH 2A4GA 1TMTH 3PMJA 3EA9A 1VITH 4LK4A 3V12A 3RXMA 2AS9A 3EYDA 3RDZA 5I46H 1WTGH 2A4OA 6GCHG 1C5XB 1E35B 5K0HA 2A45B 5A8XA 2ZU2A 1Z71A 5GCHG 4CR5A 2FMJA 3E0NB 1HIAA 1DLKB 1ZPCA 3SUGA 4I8HA 2FZZA 2G52A 5FAHA 2ZHFH 2ANKH 1ANDA 4TY6A 3ZVEA 3SGAE 1XMNB 4FUJA 1L2EA 4TWYA 8LPRA 1NPMA 3SU1A 2ANYA 3GCHC 1SFIA 3AVZA 1MAXA 1UVSH 1P09A 2OC8A 1TGBA 4AYYB 5DP9A 4MPWA 5B6OA 4X2VA 2EEKA 1JOUB 3ATWA 4YESB 3FZZA 5C2ZA 3TH2H 1GI3A 1UVOA 2J4IA 1P01A 2J94A 2UWLA 3RMLH 1SFQB 1YLCA 3RU4E 1J8AA 4Z0KA 1K22H 1Y8TA 4AG1A 2VWOA 2BHGA 5AFZH 3PLKA 2J34A 4CRCA 1EPTA 1OSSA 2XC4A 3LJOA 2FDAA 3SGQE 2AGEX 3SV2H 1MBQA 1ELDE 1GGDC 1O38A 2FM2A 3ENSB 3QO6A 4M7GA 4GPGA 4HFPB 1UK3A 1THRH 2AMQA 4YZUA 2Z6BD 1OP8A 3LGYA 1SGNE 1GDNA 1EJAA 5T3HA 1C2HA 3RXVA 4A6LA 1YPEH 3BTEE 3M37A 1GI7B 1IQEA 5ETXA 1JXPA 3A8DA 5GPIB 1JBUH 3P95A 1XX9A 4D8NA 1XUKA 3TITA 1OWHA 3SNCA 4YT7H 3ZZAA 4CH2B 2R0LA 5EU8A 4WY3A 1D3DB 5HXFA 1BTWA 2CMYA 1NFXA 2ZTZA 5GCHF 5C20A 3F1SB 3N7OA 4R8TB 3O8CA 1ESBA 2F9VA 1A0HB 1YKTA 2XC0A 1YM0A 2Z9LA 4YLQH 4JYTA 5GJ4B 2XRCA 3RXHA 1UTMA 4FUHA 2WPKS 4DURA 5L6NH 1GI8B 1C2GA 1CA0B 1EZXC 3U8RH 1BTUA 3ODDA 4DCDA 2ZFRH 7LPRA 2PUXB 1B5GH 1P57B 2ZHEH 1IQGA 3EE0B 1CHGA 3H5CB 1M9UA 1V2LT 1SOTA 2ZHQH 1N8OC 4JCNA 4I7YH 1IQMA 5DKMA 4B2CA 4SGBE 1TNHA 1S5SA 1TONA 4MPUA 1YPMH 4WMDA 5BRRE 3R3GB 3URDA 4IGDA 1GDUA 5DG6A 3SJIA 1SQTA 3A7VA 2HPPH 4ZKRU 2BY8X 2H9HA 3M5LA 1TNIA 3PTNA 1D9IA 4XOJA 3A7TA 1TALA 3S69A 1G3BA 1C4V2 1GJ7B 1MTNB 3RXUA 1HUTH 3M7QA 3T26A 5DGJA 3R0FA 4HGCA 1QTFA 5C1XA 4U2WA 3MOCA 3SW2B 5A0BA 1QRWA 1GI1A 3P8OA 3QGJA 1HJ9A 5LPFA 1UO6A 1OPHB 4BAQB 1AIXH 3LGTA 4A1XA 1OX1A 1C2LA 1ZHPA 1HAVB 3A7WA 1QCPA 1NO9H 1YGCH 3SU5A 1QRXA 1DVAH 3MH5A 5JDUB 1MMJN 2ZKSA 3DD2H 4ZHLU 1QL8A 4D9QA 1RTKA 1TQ0B 1WYKA 3GCOA 2ALPA 2BOKA 4GAWA 3E1XB 1F5RA 1O30A 1GHAF 3FP8E 3QUMP 3S7KB 2JETC 6LPRA 1HJ8A 1MH0A 1TOMH 2CF8H 2F83A 3RXRA 5FBIA 1K1OA 1THPB 3A7YA 4E7NA 1TPAE 1GCTB 3HK6B 4BXWA 1PPZA 1AE8H 3UQVA 4BTTB 3TGJE 1TFXA 1T8NA 1NRSH 3LOXA 2OBOA 1H4WA 1KXCA 1MTNC 1NROH 4F4OC 4AZ2B 2ASUB 1P05A 2NU0E 3A83A 1O3MA 4NCYA 2FS8A 1O5BB 5FXLA 1C5TA 5DP8A 1CQQA 5H4IB 3V3MA 1UTLM 2FOFA 4YT6H 1AZ8A 2BVRH 2QF0A 2NU1E 5HMAA 5EG4A 1O5FH 3KNXA 3ATMA 1GBJA 4K1TA 3GYMA 4CRAA 1O3IA 2P59A 1INCA 2WYJA 1EOJA 4AGKA 1IQFA 1G32B 1BMNH 1MU8B 2O8WA 1E34B 1N1LA 1A2CH 2ZCHP 1HAVA 2XBWA 1F5KU 1JWTA 3HGPA 1UCYH 1A5IA 4DOQA 1C4Y2 1GHVH 4I33A 3TH4H 4MNYA 1Y3VA 1ZHRA 5A0CA 1MTSA 5ESBA 1O3HA 3ZYDA 1NFYA 1UK4A 1LHGH 3SUEA 4R0IA 4AB8A 1P2NA 2FXRA 3UNSA 1BJUA 1FV9A 3RXBA 4KELA 1C4U2 2H9EH 3EA7A 3UOPA 1KY9A 3MMGA 1G3DA 3S9AA 3T25A 1FY3A 1IOEA 5LGOA 2BMGB 2R9PA 2WYGA 4FUEA 1ELBA 4H4FA 4GHQA 2ZFSA 4U01A 3HGNA 1TYNA 3RP2A 1MZDA 1GMCG 1SOZA 3MH6A 2R2MB 1ZLRA 2TBSA 1T4VH 4IMZA 5DJ7A 1UVUH 1BITA 1XUFA 4X6MA 1DE7H 3QDZB 2JKHA 2PKAB 3T28A 2R0KA 2SNWA 3MYWA 1HBTH 1PYTD 4Q80A 3BEUA 4JZFH 2G55A 1SGTA 2V6NA 1UCYE 1J15A 1YCPK 4BOHA 3SUDA 1Z7KA 1P3CA 3F9FA 2PWXA 2BD2A 1ZR0A 4FUCA 2OTVA 2BDIA 4D9RA 4X8UH 1SB1H 3VFEA 1A46H 1FY1A 5A0AE 1TPOA 2AERH 1TGTA 2UUFB 1TRNA 5IDKA 4CH8B 1KSNA 1GWAA 2FTLE 3GY8A 4X2XA 1ELEE 3MH7A 1O3DA 1CA0C 4X8TH 1BZXE 2WV5A 7KMEH 4IC5A 4MG3A 5FPTA 1C5OH 2FX4A 1ZSLA 2FYQA 2PKSC 2BDYA 2DUCA 1A3EH 2BLVA 1VCQA 1FUJA 2BQWB 1ZRKA 4XFQA 4MNVA 1GMCF 1Q2WA 4BAOB 1C1UH 3LJJA 4O3UA 3UPEA 1NC6A 1XKAC 3STJA 2CGAA 4Y0YE 1UMAH 3M35A 5LH8A 1Z1IA 2VWNA 1K1NA 3SOSA 2ZDKA 4OS5A 4K8BA 1O2QA 2FI3E 1QA7A 1O5AB 4ZHAA 1DUAA 2GCTB 2SGQE 4INKA 3SU2A 1Y3YA 4ISOA 2AMPA 3QZRA 1EJNA 1O2MA 4DT7B 1JRTA 2D26C 3SU0A 3TK5A 1TX6A 4BAMB 4CBNA 3PV4A 3GCTF 1OYQA 1TX8A 2ZCKP 1B0EA 4K69A 3EDXB 3A87A 9LPRA 2CHAB 5IYTA 5DP6A 1GJAB 2Z9GA 1NU7B 2PGQB 1DPOA 3S0NA 3GY2A 2P16A 2B5TB 1HB0B 1Z8IB 2P8OC 3KEEA 1V2VT 2OC0A 3RXJA 2ZHWH 1GG6C 3P70B 1FIWA 3MO6A 3GCTG 1U6QA 2XCFA 2Q6GA 1SR5C 4ABEA 2VGCB 2OBQA 2QN5T 1BBRE 2OLGA 5L2YH 2ZI2H 1WQSA 3MWIU 2IOTA 1O5GH 4X1PU 1NFWA 3PO1C 1OWIA 4GLYA 1GJ5H 3OU0A 2FS9A 1V2ST 1XKBC 2WPIS 3BG4C 3A7ZA 4J1YA 3QTOH 1AB9C 5CHAC 1BOQA 3MI4A 2ZDLA 2VWLA 1AKSB 4IS5A 1ELAA 4WVPE 4Y79A 2BY6X 1L4ZA 3MTYA 2ULLA 1GVLA 3C1KA 4KTUA 4NSYA 4OGYA 4XE4A 3TJNA 2GDDA 3TPIZ 4BTUB 3RMOH 1Z6JH 2Y81A 2QIQA 5JB9S 1SVPA 1YLDA 2ZPQA 1S6FA 2QCYA 1PQAA 2HALA 2FP7B 2OC1A 1Y3WA 1OKXA 1AVXA 4FVDA 4OS1A 1RJXB 3AAVA 2UWOA 2B0FA 1SGFG 2PW8H 1AE5A 4YOJA 5CE1A 3BTKE 3MU1A 2QXGA 1LVMA 3BV9B 1W3CA 2P3FH 4ISLA 2BQ6B 1IAUA 1C5RA 4PROA 4DIIH 5EQSA 4ZXYH 4DJZB 2OXSA 1OWEA 2GVFA 4IC6A 4ASHA 1O5CB 1PQ7A 2CV3A 1C2KA 1DICA 2RDLA 2PGBB 5HGGA 3SV9A 3V0XA 5DP4A 2SFAA 3ZZ3A 3MU5A 1GGDB 1EZUC 2VINA 3NK8A 1O2GH 4AOQA 2OQUA 3KIDU 1K9OE 3PWCA 3H7TA 1P11E 4A7IB 1MTUA 2QYIA 2VU8E 1XXFA 1PPEE 2Z3EA 5GWZA 3VPKA 4JK6A 1GJ8B 1T31A 1TMUH 1O2KA 1BBRH 5DP3A 3GISB 1TGCA 3U98H 1AZZA 1N6XA 1Y3UA 2GCTC 4K60A 1UHBB 3F9HA 4TY7A 1S81A 3UWJH 4FVBA 3NPSA 1KXAA 1KYNA 1HXEH 1BRAA 1P03A 2GT8A 1HAOH 1KXEA 4AX9H 1HAZB 1DLEA 2RA0A 4D76A 1O3CA 3SNDA 2AEIH 3ZZ5A 1LKBA 1P2MA 4X1QU 4B71A 1GI6A 1NN6A 4X2YA 1GJ4H 1GBAA 4Q7ZA 4WF8A 8ESTE 1C1NA 1ZMNA 3KQDA 4Y8XA 2D1JA 5DO4H 1GI0A 3VGCC 1K28D 2ZHDA 4BANB 2XNIA 2AFQB 1HAXB 1BRBE 3KHVA 1ZRBA 1V2OT 1ZTKA 2WPMS 1DWBH 3SV7A 2YOLA 2Z9JA 2O8TA 4JYUH 3E6PH 3GY6A 4NIVA 1W2KH 2XWAA 1CHOF 2C3SA 5PTPA 2BDHA 1BHXB 1GHAG 2FOBA 2UUJB 1S85A 1V2JT 4YO9A 3RXGA 1NESE 1O5DH 1D3PB 1O3FA 2FEQH 4BTIB 1PYTC 4ZH8A 1EUFA 1NRQH 3UOUA 1KLTA 1GBIA 2JH0D 3OTJE 3SQEE 4BNRA 2QXHA 3RXLA 1S83A 2CJIA 1H9LB 2BVXH 1P02A 1HYLA 1GHZA 3ZVBA 2Y5HA 3PM3A 5HYOA 4VGCC 2AIPA 3LIWA 4Y7BA 1BQYA 1YCPH 1NS3A 1GJCB 1P0SH 3BN9A 3CENA 3M5NA 1SC8U 1EPTC 2SNVA 3E90B 3RU4D 2FTMA 3GY3A 2AH4X 4ZAEA 1AY6H 5T6FA 5L30H 1SPJA 3ZV8A 1FNIA 2A4QA 5EXNA 1DWEH 1Y5AT 1LKAA 4DGJA 1AGJA 3B23B 2UUKB 3RM0H 2TGTA 1NY22 1VZQH 1E37B 2C8ZB 5SGAE 3HKIB 3KGPA 3SU6A 3P92A 1HDTH 2ZGBH 3S7HB 4ABJA 3UNRA 4XBCA 3OSYA 2LNCA 2IJOB 1Y59T 3K2UA 4Y76A 2WPHS 4AN7A 2ZNKH 2K1QA 2QXIA 1P8VC 1GCTC 1TNKA 5ABWA 1HFDA 3SBKA 1FXYA 1L4DA 3GDSA 4UFDH 1HLTH 3SJ8A 3RXEA 5I25A 1O2XA 3K9XB 3ZVFA 4NZLA 1ZMJA 1O3JA 1NRRH 1G2LA 4JZEH 3SU4A 3A8AA 1H9IE 3SORA 4OS4A 1A3BH 4CRFA 1F0TA 2BD3A 1C5PA 5F8ZA 1ARBA 3PB1E 5DP5A 2A31A 2EC9H 3M3SA 1DUEA 1NM6A 1ZGVA 4OGXA 2VVCA 2GKVE 1FY8E 4X2WA 4B73A 4ZMAH 1QR3E 2A32A 3VB3A 3GCHB 1FI8A 1FQ3A 3MO9A 1HCGA 1FIZA 3A80A 1EAWA 2RCEA 2ODPA 2ZO3H 1D4PB 2G51A 3RC6A 2VIWA 3IWMA 1MQ5A 1ZGIA 2XTTB 2P94A 2ODYB 3RUOA 3SU3A 3RXKA 3SQHE 1DXWA 2PFEA 2BY5X 1W14U 1ZPZA 1LPKB 1HAGE 4MVNA 1A0JA 4HTCH 1EOLA 1TBRH 3O8DA 5E2OA 3HATH 4GCHG 1UTQA 3H7OA 1Z1JA 1DANH 1LVBA 2VJ1A 1TPPA 2AGGX 1C2EA 4AFQA 1WUNH 2ILNA 2WPJS 5EQQA 2QC2A 1HJAB 1GBHA 2GMTB 5AFYH 1ZSKA 1LVOA 1T7CA 1TA2A 2WUBA 1O3NA 2FOAA 1GI4A 1GBFA 2STBE 3MHWU 4INHA 1C5VA 5E0GA 3TVJB 6CHAC 1YYY1 2UUYA 2VIPA 1PPHE 1AVWA 2BZAA 3O8BA 4YTAA 1YPJH 2OCVB 4OS6A 1FPCH 2ZFQH 1TRMA 1CT0E 4IN2A 2C8XB 2V3OH 1SGQE 9ESTA 2ZTXA 2AYWA 4TWWA 3DFJA 4VGCB 2GZ9A 5HM2A 1O2VA 2Y6TA 3TU7H 2ZFFH 5HM9A 1UTJA 2AGIX 2ZQ1A 1CSOE 1F0UA 2GP9B 1ELFA 2PLXA 4MQAA 1C2IA 3C27B 1WAYB 2NU2E 3BTME 2VIQA 2F9OA 3RLYH 2HNTC 1YPGH 3LDXH 3F9GA 4B2BA 2PKSB 1AO5A 1CA8B 3KQEA 1N8OB 4K5ZA 1EAXA 1A5HA 2BYAX 2XCNA 4FU8A 3MFJA 2BOHB 3UR6A 1KLJH 1XVOA 2ZF0H 3EGKH 1O0DH 3T27A 1W0YH 3ODFA 1UHBA 2BD9A 2ZC9H 3MNCA 1O32A 1OWJA 1AUJA 1K1PA 1PPBH 4THNH 3GOVB 3ZZ6A 1GMHG 1SGFA 4X1RU 1TWXB 2BLOA 3PMAB 4NIXA 1LVYA 2F9NA 2YNBA 3BEFB 2J92A 2BX3A 2TGPZ
chains in the Genus database with same CATH superfamily
2ZDMA 3K65B 2GCHG 1AB9B 2BD4A 1SLWB 5LPEA 1O2UA 1WTHD 3SUFA 1SG8B 3UUZA 1EXFA 1X7AC 2I6QA 2CN0H 2G8TA 3EA8A 1C1WH 1LDTT 2VB0A 2FIRH 4FUIA 1ESAA 2BY7X 1QBOA 4UDWH 2OQ5A 3ZZDA 1KXDA 1TPSA 3BIVH 1H8IH 1O2HA 5C1UA 2V35A 1O36A 3RC4A 1P9SA 4ZHMU 4M9FA 4YOIA 1A4WH 2GTBA 1QY6A 2GV6A 1BMLA 3OY5U 2D2DA 4ZKSU 1BJVA 2J9NA 5C0TA 1QNJA 2JH6D 1SHYA 1GJ9B 2KR7A 1YWUA 1ANEA 1KXFA 2BXTH 3UTUH 1VGCB 1BT7A 3LGIA 1OS8A 1SL3A 2NU3E 1GBKA 1KMHB 2HPQH 4TT3D 4ZKNU 4NG9H 1P3EA 3MU8A 1VGCC 1FZZA 4K2YA 4A1TA 3SV6A 1CT2E 1UTNA 1O31A 2BLQA 2LELA 1O3LA 3FAOA 5JBTA 1NBME 1RS0A 4I86A 1NRPH 2ZZUH 3B8JA 1C5YB 2XBVA 3TNSA 2F4LA 2FO9A 3OTPA 3I29A 2PTNA 2XOKD 2OP9A 3QWCH 5DP7A 1GHWH 4X6OA 2EI8A 1GVZA 2TGAA 4RT1A 3NUMA 1VR1H 3BTDE 1P9UA 1XM1A 3A81A 1UTPA 3A85A 1CVWH 4ABAA 2G5NA 2V0BA 1EP6A 3BTGE 1BTXA 3UWIA 4K1EA 1SI5H 5JBBS 3F0OA 4X0WU 4TYDA 2VIVA 1ELVA 4RKOB 5JB8S 1GHXH 1H8DH 1ABIH 1RFNA 1AI8H 4Y0ZE 2W7SA 2XC5A 4YM9A 2BLWA 2R3YA 3N7DA 1AHTH 1DITH 5HIYA 1O39A 1BIOA 1TMBH 4K3JA 2PSXA 1ZJKA 1IHSH 4FUDA 5KECA 3GYLB 3FZDA 1TX7A 1GMDF 2PUQH 3N99A 1YF4A 3CNRA 4GHTA 1HNEE 1DWDH 1WBGB 3AW1A 4CRDA 1LMWB 3SZEA 2A1DB 1SGYE 4XSKU 3LC5A 1RXPA 3BSQA 1PFXC 1MTVA 1IQJA 2ZTYA 1LHEH 1G2MA 1AQ7A 1HV7A 2ZDNA 4FU7A 3VGCB 8GCHF 1H8HD 4ZXXH 2GT7A 5C5NA 2Q6DA 1SBWA 1MAYA 4JZDH 4DW2U 1TGNA 2G00A 5A8YA 3VXEH 3AAUA 1Z8RA 3SN8A 1YBWA 1MTWA 1OHHD 4WXVA 1HXFH 3GICB 1TNJA 1QB1A 4Z6AH 1Q3XA 1GI5A 1HAIH 2G5VA 4UE7H 3U9AH 1OYTH 1XXDA 3GDUA 3M61U 3P6ZB 3U1IB 1C5MD 1DWCH 3QK1A 4IW4E 2C4FH 2ZPSA 5GDSH 1F7ZA 2C8WB 1UVTH 2TRMA 1B0FA 5G4BA 1NTPA 4WXIA 1NZQH 1H1BA 1HIAB 2ALVA 3IG6B 2W6ID 1C5WB 4OS2A 4E06H 3D49H 2W26A 1C5UA 1EQ9A 3M5MA 4I8GA 3NZIA 1TA6A 1L1GA 2D8WA 2PR3A 1IQLA 2F91A 2HWLB 4GVUA 4MLFB 2KAIA 3F6UH 3SJKA 4Y8ZA 4XBDA 2HNTE 4BAHB 3ZYEA 3M5OA 4GCHF 3JZ2B 1DOJA 2PV9B 1HAPH 5L2ZH 1EZQA 4AB9A 3KL6A 4B74A 4Z1MD 1WOFA 3MH4A 1E1QD 1O3OA 3UAIC 1FDPA 1DX5M 4A92A 3QN7A 1DT2A 4FOUC 3ZVDA 2BD7A 1OWDA 3P8FA 1PPCE 1DY9A 2Y5FA 1K1LA 2ZGXH 2C90B 2SGDE 4UD9H 2Y7XA 3MU0A 1ELTA 4Q7XA 3LC3A 2GV7A 1ZMLA 2FLBH 1QJ7B 3PRDA 3ZVCA 3PO1B 1O3GA 3TJUA 1SQAA 3AW0A 1G9IE 3U8OH 2XBYA 1O2LA 5A8ZA 1C1SA 4X1SU 3RXCA 3B9FH 3KQBA 4ZROA 2BQ7B 1RTFB 3M3VA 1F92A 4NA8A 1LCYA 3M36A 1VITF 1C2DA 1TGSZ 1EFRD 1UK2A 3KF2A 4MPVA 3SJ9A 3RXOA 3Q3KA 2ZGJA 1BTYA 2W7UA 4SGAE 2O8UA 1ETSH 5F8XA 3VB6A 4A5TS 1A0LA 3L33A 2BDAA 3RLWH 5DK1A 1KTSB 1HAHH 5FPSA 1KTTB 1SGCA 1QL9A 1IQKA 1C5QA 3PTBA 4FU9A 1W12U 3PYHA 1BMAA 1T8LA 3LH3A 1SSXA 1QIXB 3A8CA 4NFEA 1SGRE 2CF9H 3OYPA 5C0UA 1MABB 1GPZA 1XUIA 2ZU3A 1AD8H 3CS7A 1BBRK 2J95A 1PJPA 2QXJA 3Q77A 4WMFA 1V2WT 1O33A 2QGRA 4ABDA 1AWHB 2A7HA 2PKAA 1J16A 3SHCH 3Q76A 3BG4B 4ESTE 2UWPA 2IPQX 1YLNA 2ZU4A 3RU4T 4DIHH 1C2MA 1CGJE 2FPZA 1P10A 4JYVH 2ZWLH 1KDQA 4KGAA 1ARCA 2KCOA 3E0PB 1O34A 3QTVH 4ABHA 1G3CA 4OS7A 3A88A 5FCKA 1GHYH 2PHBA 3V7TA 2Y82A 3UNQA 3DSPA 4X6PA 1AMHA 2OK5A 1P12E 1DDJA 2XW9A 1RIWB 2W5EA 4ZCNA 5CHBA 1GBEA 3GY4A 1C9PA 1GCDA 3A89A 1ESTA 1UVPA 2FODA 4UEHH 4NA7A 1FN6A 3VB5A 2ZDVH 3ZZCA 5A2MH 1SLXB 2THFB 3GY7A 1GBDA 3UREA 4FUBA 4MDSA 2O8LA 1G36A 3G01A 2Z3CA 2YNAA 1TB6H 4ISHH 4X8VH 3U8TH 1NRNH 3UY9A 2VVVA 3BG8A 1MKWK 1EKBB 4WH8A 3UQOA 3DUXH 3PROA 3KN2A 1TLDA 1A61H 2FOMB 1V2QT 2A2QH 2NWNA 1KDQB 1MUEB 1QZ8A 2RG3A 2ZFPH 2ZU5A 1KIGH 1O2SA 1RD3B 1GBCA 3A82A 1DM4B 4BAKB 4JZIA 1D3TB 1QB9A 1Z6EA 3MNSA 1P2JA 2WINI 2A7CA 1QFKH 1V2RT 3IITA 4H42U 1O2JA 1YP9A 5LPRA 3RXQA 3UFAA 2Z9IA 2QY0B 1JRSA 1GBTA 3RXIA 3LKWA 3BIUH 3EQ0H 2QAAA 3VB4A 1AFQB 4YOGA 1QQUA 1VJAU 1FY5A 2BDBA 4JK5A 4UFFH 1TQ7B 2BB4A 2DE8A 1E0FD 1EATA 5FX6A 1LO6A 3ELAH 2A2XH 1S6HA 3KCGH 2FYRA 3ZVGA 1IHTH 2IPHA 4NZQA 4Q4LA 4Y71A 3QGNB 1UCYK 1CE5A 1SGDE 5CMXH 1K1JA 5JBCS 1G37A 3FP6E 5A09A 2FOHA 3NCLA 3SI3H 1SHHB 3SNAA 1Q31A 1AVGH 1XUGA 1SQRA 1FJSA 3SZNA 3DHKH 2YMSD 2H2ZA 2VVUA 4J2YB 1O2IA 1BRCE 2ZCLP 1O2PA 3UR9A 2JJ2D 1MZAA 2R3UA 1MKXH 3RMNH 1L1NA 1O37A 3EAJA 2ZFTA 2HOBA 3P8NA 1E38B 3ZZBA 1O3KA 3U1JB 4Y10E 1V2NT 1TOCB 5GXPA 1TE0A 4ABIA 2KCYA 1GBBA 1C1PA 3ATIA 4CHAC 1AFQC 3A8BA 3BTWE 1JIMA 3A84A 2Y5GA 3Q3XA 3RXSA 2A4RA 3AASA 2JDID 5ESTE 3RXAA 2LPRA 1ORFA 5EJLA 1H9HE 1O2RA 1O3BA 3BTFE 6ESTA 3TK9A 3SV8A 1O5EH 4AFUA 1FAXA 1YPKH 2W3KA 1PQ8A 2PTCE 3BEIB 2F9UA 1BMMH 1TRYA 7GCHF 3LU9B 2SGPE 1V2KT 2KM0A 4ABBA 1O3AA 1O3PB 3GY5A 4AGJA 6CHAB 4ABFA 4FXGH 1GL1A 4O3TA 2GX4A 1TABE 3KQCA 1E79D 2VBCA 4ISNA 4B2AA 2HRVA 5E2PA 4YXWD 1MBMA 3E16B 4IMQA 3PMHB 3WWBA 4F49A 4Y7AA 2ZG0H 3OEED 2DE9A 1CU1A 3ZZ9A 2BDCA 2TIOA 1B7XB 4LZ1H 2Z3DA 3ZVAA 1Y5BT 2FESH 1EAIA 1HGTH 4CBOA 2BD5A 4NWLA 2Z9KA 1C1OA 3OE7D 4TPYA 1GBLA 1ZYOA 2G4TA 2FI5E 2FX6A 1F2SE 1V2TT 2VIDA 3F9EA 6GCHF 3T29A 5AF9H 4UONA 3A86A 3K6YA 4FUFA 1XVMA 4ISIH 5AHGH 1BTHH 1G3EA 1QBVH 3ESTA 5J4SA 3D65E 1LQEA 3W94A 3ZIAD 2VWMA 2B7DH 1DSUA 1YC0A 4INLA 3PLPA 1GJDB 3HK3B 3NKKA 5EOKA 1E36B 2KCPA 2XXLA 4ZKOU 1ELCA 5HKKD 5EGMA 1S0RA 1GG6B 3RXDA 4IN1A 1MCVA 4ABGA 1OOKB 1A1RA 1W11U 1J9CH 2A7JA 1MQ6A 3M7UA 1O2YA 4HI3A 2H1UA 3STIA 2C8YB 3U69H 1QRZA 1EB2A 4E7RG 2QF3A 2BDGA 3RXTA 4X1NU 3FFGA 4JMYA 4NWKA 1ZPBA 4DG4A 1W7GH 3OY6U 2OUAA 2QV1A 1OXGA 2GCHF 1G30B 2O8MA 4DVAU 3TH3H 4H6SB 3LGUA 1P06A 3BF6H 3MNBA 3LPRA 2ESTE 1S0QA 4O97A 3RMMH 1JMOH 2SGAA 1GL0E 2ZEBA 5F8TA 3LGWA 3TNTA 1KXBA 3PLBA 1FN8A 3PWBA 4U30A 1LHCH 2Q6FA 4MPXA 1ZTJA 1TIOA 5AVDA 1QGFA 1XUHA 4NIYA 1BTPA 2SGFE 2NU4E 4QT8C 2Z94A 5T6GA 3D62A 1GHBG 1QL7A 2BXUH 2AHME 5K7RA 2XWBI 2FLRH 4JZ1A 4LXBH 3BTQE 4CHAB 3VXFH 5EW2H 2ODQA 3T5FH 4YLUA 4B1TA 4DT4A 3TK6A 2Z7FE 2XBXA 1ID5H 2ZA5A 3TGKE 1VCWA 2GDEH 1CBWC 3S9BA 4UFEH 1SGIB 4GSOA 4E05H 4BXSA 1V2PT 1EZSC 5KEDA 2I6SA 4LZ4B 3SI4H 1CGIE 2BY9X 3ATLA 5TCCA 1LHDH 3W95A 5C3NA 4Y8YA 1GJ6A 2P93A 2H9TH 2P3UB 3KYGA 3PV2A 1OWKA 1BTZA 2BTCE 2RA3A 3EE7A 2GD4B 2ZP0H 1UTKA 1K21H 1O2NA 1DY8A 1W0KD 3TIUA 4AORA 5C1YA 2VIOA 1SKYE 2P3TB 2CXVA 4FUGA 5C5OA 1J17T 3VEQB 1T8OA 5EJ1A 3HKJB 4CREA 4KTSA 3E8LA 4NGAH 1LPZB 2TGDA 2J38A 1TBZH 1D6WA 2WUCA 3K6ZA 5TCAA 1AUTC 1Y3XA 2A5IA 1F5LA 4NFFA 1W0ZU 3TGIE 2B9LA 3LONA 4NSVA 8KME2 3SNEA 2QA9E 2XNDD 2J2UA 1XUJA 2F3CE 2ZECA 1QJ6B 5EXMA 2P95A 2W3IA 1P2OA 4H6TA 1PQ5A 1GHBF 1OP0A 3RXFA 1W13U 1MU6B 2Y80A 1EP5A 2OINA 3DFLA 2P8OB 1HJAC 2BVSH 3RC5A 1LQDB 4KTCA 1GJBB 1KLIH 1GMDG 1A7SA 4UFGH 2F9BH 4RN6A 3T2NA 3QX5H 3M3TA 4MTBA 2VH0A 1EAUA 2BX4A 4DY7B 4RKJB 3FANA 4I8JA 1WCZA 3I77A 1O2WA 2Q1JA 1T8MA 2ZIQH 4IBLH 3JZ1B 2FI4E 1S82A 3WY8A 1O2OA 2V3HH 2G4UA 1TNGA 1ZOMA 4HZHA 1GBMA 2KAIB 2K8IA 1GI9B 3SO3A 2FOEA 2GZ8A 3P8GA 4K8YA 3T62A 2JH5D 4CRBA 3SGBE 4B76A 3MU4A 1OP2A 1J14A 4Y6DA 1W10U 2ZGHA 1EASA 4I31A 4WH6A 1MD7A 2AIQA 4RSPA 3DSOA 3ATKA 1THSH 2EI6A 5BPEA 1NT1A 4I32A 3NXPA 2M5TA 2ZU1A 2BZ6H 2AMDA 5EW1H 2C93B 2ZGCA 3LH1A 3RXPA 4WMEA 3MO3A 1V3XA 4WWYA 3ZZ4A 3UIRA 1CT4E 2TPIZ 5J4QA 2EA3A 1DXPA 1IQHA 1D3QB 2JETB 4XDEA 1C5SA 3SYJA 1FPHH 1O35A 2HVXA 1ACBE 3OX7U 1MD8A 1C1TA 1VITG 3DA9B 1DS2E 3SNBA 1AU8A 4I8KA 3F68H 1W8BH 1V2MT 2FWWA 2HGTH 1F0RA 1LPGB 1O2ZA 2G81E 4Y11E 1VCPA 2O9QA 1CGHA 4CR9A 5CHAB 1RIWC 1P04A 3BTHE 1TAWA 7GCHG 1PPFE 3O8RA 2B8OH 2WZQA 1BUIA 1QB6A 2HNTF 1T32A 2V3MA 3Q3YA 1SQOA 1CHOG 1TBQH 1QHRB 1ZSJA 2A5AA 1EPTB 3PMBB 5E0HA 2OD3B 5F6MA 1BDAA 3CP7A 5EXLA 4MNXA 2H5CA 3V13A 5FHTA 1RGQA 3QZQA 5F53A 1FONA 3RM2H 2WPLS 1ETTH 2STAE 4XBBA 3ZV9A 3QLPH 3L6PA 4LOYH 1IQNA 1YPHE 5FBEA 1BHXF 2Y7ZA 2VGCC 3SHAH 1BRUP 2SGEE 4TPIZ 3P17H 1AN1E 1C2JA 5T6DA 1VJ9U 3Q00A 1PPGE 1BB0B 4X8SH 5EPYA 5EQRA 3TJVA 1ZTLA 2H6MA 5E0JA 1CO7E 1GVKB 1ZZZA 4I8LA 1FY4A 4AG2A 1TNLA 1YPHC 3FVFB 2ZDAH 2KZ4A 1Z8GA 2FOGA 3FP7E 1EX3A 2BM2A 1FMGA 3ZZ8A 2WSSD 3CS0A 1P2IA 1C1RA 3S9CA 1GI2A 2GJGA 1WU1A 4KP0A 1CBWB 2H5DA 5JBAS 1QBNA 1FLEE 4F55A 1SLVB 1YCPM 1F0SA 2L6OA 5EODA 3L3TA 4CRGA 3E91A 1C1QA 5TJXA 4U32A 8GCHG 3MNXA 2WV4A 1V6DA 1C5NH 2J97A 3ZZ7A 1FAKH 1ELGA 4AFSA 1QJ1B 1LTOA 1UTOA 3ITIA 3NWUA 1ETRH 3F2HA 3FOAA 5C67A 4K1SA 2WV9A 1YPLH 2EI7A 1W7XH 1HRTH 1MKXK 4ZUHA 1ANCA 1BCUH 2ZPRA 1SLUB 1QURH 2ZQ2A 2XYAA 3M7TA 4B75A 4O03A 1WQVH 1UJ1A 2HVYB 3LGVA 2IN2A 2KFWA 1SMFE 2A5KA 1K1MA 1ZJDA 1K2I1 1HAYB 1QA0A 1T4UH 5DPAA 2OC7A 2GMTC 3DSGA 1HPGA 2A0QB 5F03A 3SJOA 3HPTB 2WPDD 1AWFH 4Q2KA 2RFKC 2IJD1 1DSTA 2GZ7A 3A7XA 4Q7YA 4NA9H 3DT0H 4TSFD 4AFZA 3URCA 1C2FA 1RRKA 5FPYA 1LHFH 1O2TA 2R2WU 5JPMH 5E8EH 2F9PA 1C5ZB 1ZHMA 2FOCA 4KKDA 5GIBA 1DFPA 1UW7A 3GDVA 1A5GH 1EJMA 4O9VA 4NIWA 1O3EA 4GUXA 2GGVB 3VG8A 5EPNA 1L1JA 1BA8B 1V2UT 3LT3A 2ANMH 1EB1H 1QQ4A 1IQIA 4A1VA 1L0ZA 3BTTE 4X6NA 3D23A 2VH6A 1C9TA 1RTLA 3PRBA 1C5LH 1GDQA 2CHAC 2ANWA 1GMHF 1P2KA 3N7EA 4AC9A 5FX5A 1MKWH 5JYIA 4MNWA 1MCTA 3TJOA 1Y5UT 1D6RA 4WJG2 4AYVB 1JIRA 2PSYA 3E3TA 1P2QA 3TLOA 1SGPE 1NFUA 1K1IA 3GCNA 3UB0A 7ESTE 1Z8JB 2VNTA 5DSFA 1SGEE 1WV7H 1NU9A 1C1VH 4D7FA 3I78A 5FCRA 1AKSA 1ABJH 1S84A 2BD8A 1AFEH 1ANBA 4D7GA 2HLCA 1C1MA 1N6YA 3VB7A 3OFND 1WSSH 2A4GA 1TMTH 3PMJA 3EA9A 1VITH 4LK4A 3V12A 3RXMA 2AS9A 3EYDA 3RDZA 5I46H 1WTGH 2A4OA 6GCHG 1C5XB 1E35B 5K0HA 2A45B 5A8XA 2ZU2A 1Z71A 5GCHG 4CR5A 2FMJA 3E0NB 1HIAA 1DLKB 1ZPCA 3SUGA 4I8HA 5C94A 2FZZA 2G52A 3AK5A 5FAHA 2ZHFH 2ANKH 1ANDA 4TY6A 3ZVEA 3SGAE 1XMNB 4FUJA 5DN6D 1L2EA 4TWYA 2F43B 8LPRA 1NPMA 2L74A 3SU1A 2ANYA 3GCHC 1SFIA 3AVZA 1MAXA 1UVSH 1P09A 1NBMD 2OC8A 1TGBA 4AYYB 5DP9A 4MPWA 5B6OA 4X2VA 2EEKA 1JOUB 3ATWA 4YESB 3FZZA 5C2ZA 3TH2H 1GI3A 1UVOA 2J4IA 1P01A 2J94A 2UWLA 3RMLH 3FO8D 1SFQB 1YLCA 3RU4E 1J8AA 4Z0KA 1K22H 1Y8TA 4AG1A 2VWOA 2BHGA 5AFZH 3PLKA 2J34A 4CRCA 1EPTA 1OSSA 2XC4A 3LJOA 2FDAA 3SGQE 2AGEX 3SV2H 2QE7D 1MBQA 1ELDE 1GGDC 1O38A 2FM2A 3ENSB 3QO6A 4M7GA 4GPGA 4HFPB 1UK3A 1THRH 2AMQA 4YZUA 2Z6BD 1OP8A 3LGYA 1SGNE 1GDNA 1EJAA 5T3HA 1C2HA 3RXVA 4A6LA 1YPEH 3BTEE 3M37A 1GI7B 1IQEA 5ETXA 1JXPA 3A8DA 5GPIB 1JBUH 3P95A 1XX9A 4D8NA 1XUKA 3TITA 1OWHA 5T1VA 3SNCA 4YT7H 3ZZAA 1YY3A 4CH2B 2R0LA 5EU8A 4WY3A 1D3DB 5HXFA 1BTWA 2CMYA 1NFXA 2ZTZA 5GCHF 5C20A 3F1SB 3N7OA 4R8TB 3O8CA 1ESBA 2F9VA 1A0HB 1YKTA 2XC0A 1YM0A 2Z9LA 4YLQH 4JYTA 5GJ4B 2XRCA 3RXHA 1UTMA 4FUHA 2WPKS 4DURA 5L6NH 1GI8B 1C2GA 1CA0B 1EZXC 3U8RH 1BTUA 3ODDA 4DCDA 2ZFRH 7LPRA 2PUXB 1B5GH 1P57B 2ZHEH 1IQGA 3EE0B 1CHGA 3H5CB 1M9UA 1V2LT 1SOTA 2ZHQH 1N8OC 4XRNA 4JCNA 4I7YH 1IQMA 3W1EA 5DKMA 4ACBA 4B2CA 4SGBE 1TNHA 1S5SA 1TONA 4MPUA 1YPMH 4WMDA 4B6EA 5BRRE 3R3GB 3URDA 4IGDA 1GDUA 5DG6A 3SJIA 1SQTA 3A7VA 2HPPH 4ZKRU 2BY8X 2H9HA 3M5LA 1TNIA 3PTNA 1D9IA 4XOJA 3A7TA 1TALA 3S69A 1G3BA 1C4V2 1GJ7B 1MTNB 3RXUA 1HUTH 3M7QA 3T26A 5DGJA 3R0FA 4HGCA 1QTFA 5C1XA 4U2WA 3MOCA 3SW2B 5A0BA 1QRWA 1GI1A 3P8OA 3QGJA 1HJ9A 1BMFD 5LPFA 1UO6A 1OPHB 4BAQB 1AIXH 3LGTA 4A1XA 1OX1A 1C2LA 1ZHPA 1HAVB 3A7WA 1QCPA 1NO9H 1YGCH 3SU5A 1QRXA 1DVAH 3MH5A 5JDUB 1MMJN 2ZKSA 3DD2H 4ZHLU 1QL8A 4D9QA 1RTKA 1TQ0B 1WYKA 3GCOA 2ALPA 2BOKA 4GAWA 3E1XB 2JIZD 1F5RA 1O30A 1GHAF 3FP8E 3QUMP 3S7KB 2JETC 6LPRA 1HJ8A 1MH0A 1TOMH 2CF8H 2F83A 3RXRA 5FBIA 1K1OA 1THPB 3A7YA 4Q63A 4E7NA 1TPAE 1GCTB 3HK6B 3WW7A 4BXWA 1PPZA 1AE8H 2V7QD 3UQVA 4BTTB 3TGJE 1TFXA 1T8NA 1NRSH 3LOXA 2OBOA 1H4WA 1KXCA 1MTNC 1NROH 4F4OC 4AZ2B 2ASUB 1P05A 3DCLA 4XD7D 2NU0E 3A83A 1O3MA 4NCYA 2FS8A 1O5BB 5FXLA 1C5TA 5DP8A 1CQQA 5H4IB 3V3MA 1UTLM 2FOFA 4YT6H 1AZ8A 2BVRH 1COWD 2QF0A 2NU1E 5HMAA 5EG4A 1O5FH 3KNXA 2J98A 3ATMA 1GBJA 4K1TA 3GYMA 4CRAA 1O3IA 2P59A 1INCA 2WYJA 1EOJA 4AGKA 1IQFA 1G32B 1BMNH 1MU8B 2O8WA 1E34B 1N1LA 1A2CH 2QF4A 2ZCHP 3F2GA 1HAVA 2XBWA 4OM9A 1F5KU 1JWTA 3HGPA 1UCYH 1A5IA 4DOQA 1C4Y2 1GHVH 4I33A 3TH4H 4MNYA 1Y3VA 1ZHRA 5A0CA 2W6JD 1MTSA 5ESBA 1O3HA 3ZYDA 1NFYA 1UK4A 1LHGH 3SUEA 4R0IA 4AB8A 1P2NA 3U28C 2FXRA 3UNSA 1BJUA 1FV9A 3RXBA 4KELA 1C4U2 2H9EH 5FL7D 3EA7A 3UOPA 1KY9A 3MMGA 1G3DA 3S9AA 3T25A 1FY3A 1IOEA 3WWFA 5LGOA 2BMGB 2R9PA 2WYGA 4FUEA 1ELBA 4H4FA 4GHQA 2ZFSA 4RI0A 4U01A 3F3BA 3HGNA 1TYNA 3RP2A 1MZDA 1GMCG 1SOZA 3MH6A 2R2MB 2YMSC 1ZLRA 2TBSA 1T4VH 4IMZA 5DJ7A 1UVUH 1BITA 1XUFA 4X6MA 1DE7H 3QDZB 2JKHA 2PKAB 3T28A 2R0KA 2SNWA 3MYWA 1HBTH 1PYTD 4Q80A 3BEUA 4JZFH 2G55A 1SGTA 2V6NA 1UCYE 1J15A 1YCPK 4BOHA 3SUDA 1Z7KA 1P3CA 3F9FA 2PWXA 2BD2A 1ZR0A 4FUCA 2OTVA 2BDIA 4D9RA 4X8UH 1SB1H 3VFEA 1A46H 1FY1A 5A0AE 1TPOA 2AERH 1TGTA 5IK2D 2UUFB 1TRNA 5IDKA 4CH8B 1KSNA 1GWAA 2FTLE 3GY8A 4X2XA 1ELEE 3MH7A 1O3DA 1CA0C 4X8TH 1BZXE 2WV5A 4ACAA 7KMEH 4IC5A 4MG3A 5FPTA 1C5OH 2FX4A 5CDFE 1ZSLA 2FYQA 2PKSC 2BDYA 2DUCA 1A3EH 2BLVA 1VCQA 3KYFA 1FUJA 2BQWB 1ZRKA 3FKSD 4XFQA 4MNVA 1FX0B 1WXRA 1GMCF 1Q2WA 4BAOB 1C1UH 3LJJA 3F2FA 4O3UA 3UPEA 1NC6A 1XKAC 3STJA 2CGAA 4Y0YE 1UMAH 3M35A 5LH8A 1Z1IA 2VWNA 1K1NA 3SOSA 2ZDKA 4OS5A 4K8BA 1O2QA 2RDEA 2FI3E 1QA7A 1O5AB 4ZHAA 1DUAA 2GCTB 2SGQE 4INKA 2QF5A 3SU2A 1Y3YA 4ISOA 2AMPA 3QZRA 1EJNA 1O2MA 4DT7B 1JRTA 2D26C 3SU0A 3TK5A 1TX6A 4BAMB 4CBNA 3PV4A 3GCTF 1OYQA 1TX8A 2ZCKP 1B0EA 5EIYA 4K69A 3EDXB 3A87A 9LPRA 2CHAB 5IYTA 5DP6A 1GJAB 2Z9GA 1NU7B 2PGQB 1DPOA 3S0NA 3GY2A 2P16A 2B5TB 1HB0B 1Z8IB 2P8OC 3KEEA 2KCAA 1V2VT 2OC0A 3RXJA 2ZHWH 1GG6C 3P70B 1FIWA 3MO6A 3GCTG 1U6QA 2XCFA 2Q6GA 1SR5C 4ABEA 2VGCB 4HG6A 2OBQA 3FN8A 2QN5T 4FETA 1BBRE 2OLGA 5L2YH 2ZI2H 1WQSA 3MWIU 5B6LA 2IOTA 1O5GH 4X1PU 2J5UA 1NFWA 3PO1C 1OWIA 4GLYA 1GJ5H 3OU0A 2FS9A 1V2ST 1XKBC 2WPIS 3BG4C 3A7ZA 4J1YA 3QTOH 1AB9C 5CHAC 1BOQA 3MI4A 2ZDLA 2VWLA 1AKSB 4IS5A 1ELAA 4WVPE 4Y79A 2BY6X 1L4ZA 3MTYA 2ULLA 1GVLA 3C1KA 4KTUA 4NSYA 4OGYA 4XE4A 3TJNA 2GDDA 3TPIZ 4BTUB 3RMOH 1Z6JH 2Y81A 2QIQA 2PP6A 5EJZA 5JB9S 1SVPA 1YLDA 2ZPQA 1S6FA 2QCYA 1PQAA 2HALA 2FP7B 2OC1A 1Y3WA 1OKXA 1AVXA 3H09A 4FVDA 4OS1A 1RJXB 5KGOA 3AAVA 2UWOA 2B0FA 1SGFG 2PW8H 1AE5A 4YOJA 5CE1A 3BTKE 3MU1A 2QXGA 1LVMA 3BV9B 1W3CA 2P3FH 4ISLA 2BQ6B 1IAUA 1C5RA 4PROA 4DIIH 5EQSA 3KQ5A 4ZXYH 4DJZB 2OXSA 1OWEA 2GVFA 4IC6A 4ASHA 1O5CB 1PQ7A 1K0HA 2CV3A 1C2KA 1DICA 2RDLA 4P02A 2PGBB 5HGGA 3SV9A 3V0XA 1H8ED 5DP4A 2SFAA 3ZZ3A 3MU5A 1GGDB 1EZUC 2VINA 3NK8A 1O2GH 4AOQA 2OQUA 3KIDU 1K9OE 3PWCA 3H7TA 1P11E 4A7IB 1MTUA 2QYIA 2VU8E 1XXFA 1PPEE 2Z3EA 5GWZA 3VPKA 4JK6A 1GJ8B 1T31A 1TMUH 1O2KA 1BBRH 5DP3A 3GISB 1TGCA 3U98H 1AZZA 1N6XA 2J98B 1Y3UA 2GCTC 4K60A 1UHBB 3F9HA 4TY7A 1S81A 2KX4A 3UWJH 4FVBA 3NPSA 3MQKC 1KXAA 1KYNA 1HXEH 1BRAA 1P03A 2GT8A 1HAOH 1KXEA 4AX9H 1HAZB 1DLEA 2RA0A 4D76A 1O3CA 3SNDA 2AEIH 3ZZ5A 1LKBA 1P2MA 4X1QU 4B71A 1GI6A 1NN6A 4X2YA 4B6FA 1GJ4H 1GBAA 4Q7ZA 4WF8A 8ESTE 1C1NA 1ZMNA 3KQDA 2EY4C 4Y8XA 2D1JA 2EQNA 5DO4H 1GI0A 3VGCC 1K28D 2ZHDA 4BANB 2XNIA 2AFQB 1HAXB 1BRBE 3KHVA 1ZRBA 1V2OT 1ZTKA 2WPMS 1DWBH 3SV7A 5C17A 2YOLA 2Z9JA 2O8TA 4JYUH 3E6PH 3GY6A 4NIVA 1W2KH 2XWAA 1CHOF 2C3SA 5PTPA 2BDHA 1BHXB 1GHAG 2FOBA 2UUJB 1S85A 1V2JT 4YO9A 2M2AA 3RXGA 1NESE 1O5DH 4P00A 1D3PB 1O3FA 2FEQH 4BTIB 1PYTC 4ASUD 4F48B 4ZH8A 1EUFA 1NRQH 3UOUA 1KLTA 1GBIA 2JH0D 3OTJE 3SQEE 4BNRA 2QXHA 3RXLA 1S83A 2JJ1D 2CJIA 1H9LB 2BVXH 1P02A 1HYLA 1GHZA 3ZVBA 2Y5HA 3PM3A 5HYOA 4VGCC 2AIPA 3LIWA 4Y7BA 1BQYA 1YCPH 1NS3A 1GJCB 1P0SH 3BN9A 3CENA 3M5NA 1SC8U 1EPTC 2SNVA 3E90B 3RU4D 2FTMA 3GY3A 2AH4X 4ZAEA 1AY6H 5T6FA 5L30H 1SPJA 3ZV8A 1FNIA 2A4QA 1VKYA 5EXNA 1DWEH 1Y5AT 1LKAA 4DGJA 1AGJA 2K0QA 3B23B 2UUKB 3RM0H 2TGTA 1NY22 1VZQH 1E37B 2C8ZB 5SGAE 3HKIB 3KGPA 3SU6A 3P92A 1HDTH 2ZGBH 3S7HB 4ABJA 3UNRA 4XBCA 3OSYA 2LNCA 2IJOB 1Y59T 3K2UA 4Y76A 2WPHS 4AN7A 2ZNKH 2K1QA 2QXIA 2LP6A 1P8VC 1GCTC 1TNKA 5ABWA 1HFDA 3OEHD 1S6LA 3SBKA 1FXYA 1L4DA 3GDSA 4UFDH 1HLTH 3SJ8A 3GS9A 3RXEA 5I25A 1O2XA 3K9XB 3ZVFA 4NZLA 1ZMJA 1O3JA 1NRRH 1G2LA 4JZEH 3SU4A 3A8AA 1H9IE 3SORA 4OS4A 1A3BH 4CRFA 1F0TA 2BD3A 1C5PA 5F8ZA 1ARBA 3PB1E 5DP5A 2A31A 2EC9H 3M3SA 1DUEA 1NM6A 1ZGVA 1WDIA 2VVCA 2GKVE 4OGXA 1FY8E 4X2WA 4B73A 4ZMAH 1QR3E 2A32A 3VB3A 3GCHB 1FI8A 1FQ3A 3MO9A 1HCGA 1FIZA 3A80A 1EAWA 2RCEA 2ODPA 3PV5A 2ZO3H 1D4PB 2G51A 3RC6A 2VIWA 3IWMA 1MQ5A 1E1RD 1ZGIA 3F0PA 2XTTB 2P94A 2ODYB 3RUOA 3SU3A 3RXKA 3SQHE 1DXWA 2HLDD 2PFEA 2BY5X 1W14U 1ZPZA 1LPKB 1HAGE 4MVNA 5GNDA 1A0JA 4HTCH 1EOLA 1TBRH 3O8DA 5E2OA 3HATH 4GCHG 1UTQA 3H7OA 1Z1JA 1DANH 1LVBA 2VJ1A 1TPPA 2AGGX 1C2EA 4AFQA 1WUNH 2ILNA 2WPJS 5EQQA 2QC2A 1HJAB 1GBHA 2GMTB 5AFYH 1ZSKA 1LVOA 1T7CA 1TA2A 2WUBA 1O3NA 2FOAA 3OAAD 1GI4A 1GBFA 2STBE 3MHWU 3NRLA 2CK3D 2YMSB 1W0JD 4INHA 1C5VA 5E0GA 3TVJB 6CHAC 1YYY1 2UUYA 4RT0A 2VIPA 1PPHE 1AVWA 2BZAA 3O8BA 4YTAA 1YPJH 2WHXA 2OCVB 4OS6A 1FPCH 2ZFQH 1TRMA 1CT0E 4IN2A 5HIZA 2C8XB 2V3OH 1SGQE 9ESTA 2ZTXA 2AYWA 4TWWA 3DFJA 4VGCB 2GZ9A 5HM2A 1O2VA 2Y6TA 3TU7H 2ZFFH 5HM9A 1UTJA 2AGIX 2ZQ1A 1CSOE 1F0UA 2GP9B 1ELFA 2PLXA 4MQAA 1C2IA 3C27B 1WAYB 2NU2E 3BTME 2VIQA 2F9OA 3RLYH 2HNTC 1YPGH 3LDXH 3F9GA 4B2BA 2PKSB 1AO5A 1CA8B 3KQEA 1N8OB 4K5ZA 1EAXA 1A5HA 2BYAX 2XCNA 4FU8A 3MFJA 2BOHB 3UR6A 1KLJH 1XVOA 2ZF0H 3EGKH 1O0DH 3T27A 1W0YH 3ODFA 1UHBA 2BD9A 2ZC9H 3MNCA 1O32A 1OWJA 1AUJA 1K1PA 1PPBH 4THNH 3GOVB 3ZZ6A 1GMHG 1SGFA 4X1RU 1TWXB 2BLOA 3PMAB 4NIXA 1LVYA 2F9NA 2YNBA 3BEFB 2J92A 2BX3A 2TGPZ
chains in the Genus database with same CATH topology
2ZDMA 3K65B 2GCHG 1AB9B 2BD4A 1SLWB 5LPEA 1O2UA 1WTHD 3SUFA 1SG8B 3UUZA 1EXFA 1X7AC 2I6QA 2CN0H 2G8TA 3EA8A 1C1WH 1LDTT 2VB0A 2FIRH 4FUIA 1ESAA 2BY7X 1QBOA 4UDWH 2OQ5A 3ZZDA 1KXDA 1TPSA 3BIVH 1H8IH 1O2HA 5C1UA 2V35A 1O36A 3RC4A 1P9SA 4ZHMU 4YOIA 1A4WH 2GTBA 1QY6A 2GV6A 1BMLA 3OY5U 2D2DA 4ZKSU 1BJVA 2J9NA 1QNJA 2JH6D 1SHYA 1GJ9B 1ANEA 1KXFA 2BXTH 3UTUH 1VGCB 1BT7A 3LGIA 1OS8A 1SL3A 2NU3E 1GBKA 2HPQH 4ZKNU 4NG9H 1P3EA 3MU8A 1VGCC 1FZZA 4K2YA 4A1TA 3SV6A 1CT2E 1UTNA 1O31A 2BLQA 1O3LA 3FAOA 5JBTA 1RS0A 1NRPH 2ZZUH 3B8JA 1C5YB 2XBVA 3TNSA 2FO9A 3I29A 2PTNA 2OP9A 3QWCH 5DP7A 1GHWH 4X6OA 2EI8A 1GVZA 2TGAA 3NUMA 1VR1H 3BTDE 1P9UA 1XM1A 3A81A 1UTPA 3A85A 1CVWH 4ABAA 2G5NA 2V0BA 1EP6A 3BTGE 1BTXA 3UWIA 4K1EA 1SI5H 5JBBS 4X0WU 4TYDA 2VIVA 1ELVA 4RKOB 5JB8S 1GHXH 1H8DH 1ABIH 1RFNA 1AI8H 4Y0ZE 2W7SA 2XC5A 4YM9A 2BLWA 2R3YA 1AHTH 1DITH 1O39A 1BIOA 1TMBH 4K3JA 2PSXA 1ZJKA 1IHSH 4FUDA 3GYLB 3FZDA 1TX7A 1GMDF 2PUQH 1YF4A 4GHTA 1HNEE 1DWDH 1WBGB 3AW1A 4CRDA 1LMWB 2A1DB 1SGYE 4XSKU 3LC5A 1RXPA 3BSQA 1PFXC 1MTVA 1IQJA 2ZTYA 1LHEH 1G2MA 1AQ7A 1HV7A 2ZDNA 4FU7A 3VGCB 8GCHF 4ZXXH 2GT7A 5C5NA 2Q6DA 1SBWA 1MAYA 4JZDH 4DW2U 1TGNA 2G00A 5A8YA 3VXEH 3AAUA 1Z8RA 3SN8A 1YBWA 1MTWA 4WXVA 1HXFH 3GICB 1TNJA 1QB1A 4Z6AH 1Q3XA 1GI5A 1HAIH 2G5VA 4UE7H 3U9AH 1OYTH 1XXDA 3GDUA 3M61U 3P6ZB 3U1IB 1C5MD 1DWCH 3QK1A 4IW4E 2C4FH 2ZPSA 5GDSH 1F7ZA 2C8WB 1UVTH 2TRMA 1B0FA 5G4BA 1NTPA 4WXIA 1NZQH 1H1BA 1HIAB 2ALVA 3IG6B 1C5WB 4OS2A 4E06H 3D49H 2W26A 1C5UA 1EQ9A 3M5MA 4I8GA 3NZIA 1TA6A 1L1GA 2D8WA 2PR3A 1IQLA 2F91A 2HWLB 4GVUA 4MLFB 2KAIA 3F6UH 3SJKA 4Y8ZA 4XBDA 2HNTE 4BAHB 3ZYEA 3M5OA 4GCHF 3JZ2B 1DOJA 2PV9B 1HAPH 5L2ZH 1EZQA 4AB9A 3KL6A 4B74A 1WOFA 3MH4A 1O3OA 1FDPA 1DX5M 4A92A 3QN7A 1DT2A 3ZVDA 2BD7A 1OWDA 3P8FA 1PPCE 1DY9A 2Y5FA 1K1LA 2ZGXH 2C90B 2SGDE 4UD9H 2Y7XA 3MU0A 1ELTA 4Q7XA 3LC3A 2GV7A 1ZMLA 2FLBH 1QJ7B 3ZVCA 3PO1B 1O3GA 3TJUA 1SQAA 3AW0A 1G9IE 3U8OH 2XBYA 1O2LA 5A8ZA 1C1SA 4X1SU 3RXCA 3B9FH 3KQBA 4ZROA 2BQ7B 1RTFB 3M3VA 1F92A 4NA8A 1LCYA 3M36A 1VITF 1C2DA 1TGSZ 1UK2A 3KF2A 4MPVA 3SJ9A 3RXOA 3Q3KA 2ZGJA 1BTYA 2W7UA 4SGAE 2O8UA 1ETSH 5F8XA 3VB6A 4A5TS 1A0LA 3L33A 2BDAA 3RLWH 5DK1A 1KTSB 1HAHH 5FPSA 1KTTB 1SGCA 1QL9A 1IQKA 1C5QA 3PTBA 4FU9A 1W12U 3PYHA 1BMAA 1T8LA 3LH3A 1SSXA 1QIXB 3A8CA 4NFEA 1SGRE 2CF9H 3OYPA 1GPZA 1XUIA 2ZU3A 1AD8H 3CS7A 1BBRK 2J95A 1PJPA 2QXJA 3Q77A 4WMFA 1V2WT 1O33A 2QGRA 4ABDA 1AWHB 2A7HA 2PKAA 1J16A 3SHCH 3Q76A 3BG4B 4ESTE 2UWPA 2ZU4A 3RU4T 4DIHH 1C2MA 1CGJE 2FPZA 1P10A 4JYVH 2ZWLH 1KDQA 4KGAA 1ARCA 3E0PB 1O34A 3QTVH 4ABHA 1G3CA 4OS7A 3A88A 5FCKA 1GHYH 2PHBA 3V7TA 2Y82A 3UNQA 4X6PA 1AMHA 1P12E 1DDJA 2XW9A 1RIWB 2W5EA 1GBEA 3GY4A 1C9PA 1GCDA 3A89A 1ESTA 1UVPA 2FODA 4UEHH 4NA7A 1FN6A 3VB5A 2ZDVH 3ZZCA 5A2MH 1SLXB 2THFB 3GY7A 1GBDA 3UREA 4FUBA 4MDSA 2O8LA 1G36A 3G01A 2Z3CA 2YNAA 1TB6H 4ISHH 4X8VH 3U8TH 1NRNH 3UY9A 2VVVA 3BG8A 1MKWK 1EKBB 4WH8A 3UQOA 3DUXH 3PROA 3KN2A 1TLDA 1A61H 2FOMB 1V2QT 2A2QH 2NWNA 1KDQB 1MUEB 2ZU5A 2RG3A 2ZFPH 1KIGH 1O2SA 1RD3B 1GBCA 3A82A 1DM4B 4BAKB 4JZIA 1D3TB 1QB9A 1Z6EA 3MNSA 1P2JA 2WINI 2A7CA 1QFKH 1V2RT 3IITA 4H42U 1O2JA 1YP9A 5LPRA 3RXQA 3UFAA 2Z9IA 2QY0B 1JRSA 1GBTA 3RXIA 3LKWA 3BIUH 3EQ0H 2QAAA 3VB4A 1AFQB 4YOGA 1QQUA 1VJAU 1FY5A 2BDBA 4JK5A 4UFFH 1TQ7B 2BB4A 2DE8A 1E0FD 1EATA 5FX6A 1LO6A 3ELAH 2A2XH 1S6HA 3KCGH 2FYRA 3ZVGA 1IHTH 2IPHA 4NZQA 4Y71A 3QGNB 1UCYK 1CE5A 1SGDE 5CMXH 1K1JA 5JBCS 1G37A 3FP6E 5A09A 2FOHA 3NCLA 3SI3H 1SHHB 3SNAA 1Q31A 1AVGH 1XUGA 1FJSA 3SZNA 3DHKH 2H2ZA 2VVUA 4J2YB 1O2IA 1BRCE 2ZCLP 1O2PA 3UR9A 1MZAA 2R3UA 1MKXH 3RMNH 1L1NA 1O37A 3EAJA 2ZFTA 2HOBA 3P8NA 1E38B 3ZZBA 1O3KA 3U1JB 4Y10E 1V2NT 1TOCB 5GXPA 1TE0A 4ABIA 4CHAC 1GBBA 1C1PA 3ATIA 1AFQC 3A8BA 3BTWE 1JIMA 3A84A 2Y5GA 3Q3XA 3RXSA 2A4RA 3AASA 5ESTE 3RXAA 2LPRA 1ORFA 1H9HE 1O2RA 1O3BA 3BTFE 6ESTA 3TK9A 3SV8A 1O5EH 4AFUA 1FAXA 1YPKH 2W3KA 1PQ8A 2PTCE 3BEIB 2F9UA 1BMMH 1TRYA 7GCHF 3LU9B 2SGPE 1V2KT 4ABBA 1O3AA 1O3PB 3GY5A 4AGJA 6CHAB 4ABFA 4FXGH 1GL1A 4O3TA 2GX4A 1TABE 3KQCA 4ISNA 4B2AA 2HRVA 5E2PA 1MBMA 3E16B 4IMQA 3PMHB 4F49A 4Y7AA 2ZG0H 2DE9A 1CU1A 3ZZ9A 2BDCA 2TIOA 1B7XB 4LZ1H 2Z3DA 3ZVAA 1Y5BT 2FESH 1EAIA 1HGTH 4CBOA 2BD5A 4NWLA 2Z9KA 1C1OA 4TPYA 1GBLA 1ZYOA 2G4TA 2FI5E 2FX6A 1F2SE 1V2TT 2VIDA 3F9EA 6GCHF 3T29A 5AF9H 4UONA 3A86A 3K6YA 4FUFA 1XVMA 4ISIH 5AHGH 1BTHH 1G3EA 1QBVH 3ESTA 5J4SA 3D65E 1LQEA 3W94A 2VWMA 2B7DH 1DSUA 1YC0A 4INLA 3PLPA 1GJDB 3HK3B 3NKKA 5EOKA 1E36B 2XXLA 4ZKOU 1ELCA 5EGMA 1S0RA 1GG6B 3RXDA 4IN1A 1MCVA 4ABGA 1OOKB 1A1RA 1W11U 1J9CH 2A7JA 1MQ6A 3M7UA 1O2YA 4HI3A 2H1UA 3STIA 2C8YB 3U69H 1QRZA 1EB2A 4E7RG 2QF3A 2BDGA 3RXTA 4X1NU 3FFGA 4JMYA 4NWKA 1ZPBA 4DG4A 1W7GH 3OY6U 2OUAA 2QV1A 1OXGA 2GCHF 1G30B 2O8MA 4DVAU 3TH3H 4H6SB 3LGUA 1P06A 3BF6H 3MNBA 3LPRA 2ESTE 1S0QA 4O97A 3RMMH 1JMOH 2SGAA 1GL0E 2ZEBA 5F8TA 3LGWA 3TNTA 1KXBA 3PLBA 1FN8A 3PWBA 4U30A 1LHCH 2Q6FA 4MPXA 1ZTJA 1TIOA 5AVDA 1QGFA 1XUHA 4NIYA 1BTPA 2SGFE 2NU4E 4QT8C 2Z94A 5T6GA 3D62A 1GHBG 1QL7A 2BXUH 5K7RA 2XWBI 2FLRH 4JZ1A 4LXBH 3BTQE 4CHAB 3VXFH 5EW2H 2ODQA 3T5FH 4YLUA 4B1TA 3TK6A 2Z7FE 2XBXA 1ID5H 2ZA5A 3TGKE 1VCWA 2GDEH 1CBWC 3S9BA 4UFEH 1SGIB 4GSOA 4E05H 4BXSA 1V2PT 1EZSC 4LZ4B 2I6SA 3SI4H 1CGIE 2BY9X 3ATLA 5TCCA 1LHDH 3W95A 5C3NA 4Y8YA 1GJ6A 2P93A 2H9TH 2P3UB 1OWKA 1BTZA 2BTCE 2RA3A 2GD4B 2ZP0H 1UTKA 1K21H 1O2NA 1DY8A 3TIUA 4AORA 5C1YA 2VIOA 2P3TB 2CXVA 4FUGA 5C5OA 1J17T 3VEQB 1T8OA 3HKJB 4CREA 4KTSA 3E8LA 4NGAH 1LPZB 2TGDA 2J38A 1TBZH 1D6WA 2WUCA 3K6ZA 5TCAA 1AUTC 1Y3XA 2A5IA 1F5LA 4NFFA 1W0ZU 3TGIE 2B9LA 3LONA 4NSVA 8KME2 3SNEA 2QA9E 2J2UA 1XUJA 2F3CE 2ZECA 1QJ6B 5EXMA 2P95A 2W3IA 1P2OA 4H6TA 1PQ5A 1GHBF 1OP0A 3RXFA 1W13U 1MU6B 2Y80A 1EP5A 2OINA 3DFLA 2P8OB 1HJAC 2BVSH 3RC5A 1LQDB 4KTCA 1GJBB 1KLIH 1GMDG 1A7SA 4UFGH 2F9BH 4RN6A 3T2NA 3QX5H 3M3TA 4MTBA 2VH0A 1EAUA 2BX4A 4DY7B 4RKJB 3FANA 4I8JA 1WCZA 3I77A 1O2WA 2Q1JA 1T8MA 2ZIQH 4IBLH 3JZ1B 2FI4E 1S82A 3WY8A 1O2OA 2V3HH 2G4UA 1TNGA 1ZOMA 4HZHA 1GBMA 2KAIB 1GI9B 3SO3A 2FOEA 2GZ8A 3P8GA 4K8YA 3T62A 2JH5D 4CRBA 3SGBE 4B76A 3MU4A 1OP2A 1J14A 4Y6DA 1W10U 2ZGHA 1EASA 4I31A 4WH6A 1MD7A 2AIQA 4RSPA 3ATKA 1THSH 2EI6A 5BPEA 1NT1A 4I32A 3NXPA 2M5TA 2ZU1A 2BZ6H 2AMDA 5EW1H 2C93B 2ZGCA 3LH1A 3RXPA 4WMEA 3MO3A 1V3XA 4WWYA 3ZZ4A 3UIRA 1CT4E 2TPIZ 5J4QA 2EA3A 1DXPA 1IQHA 1D3QB 2JETB 4XDEA 1C5SA 1FPHH 1O35A 2HVXA 1ACBE 3OX7U 1MD8A 1C1TA 1VITG 3DA9B 1DS2E 3SNBA 1AU8A 4I8KA 3F68H 1W8BH 1V2MT 2FWWA 2HGTH 1F0RA 1LPGB 1O2ZA 2G81E 4Y11E 1VCPA 2O9QA 1CGHA 4CR9A 5CHAB 1RIWC 1P04A 3BTHE 1TAWA 7GCHG 1PPFE 3O8RA 2B8OH 1BUIA 1QB6A 2HNTF 1T32A 3Q3YA 1SQOA 1CHOG 1TBQH 1QHRB 1ZSJA 2A5AA 1EPTB 3PMBB 5E0HA 2OD3B 5F6MA 1BDAA 3CP7A 5EXLA 4MNXA 2H5CA 3V13A 5FHTA 1RGQA 3QZQA 1FONA 3RM2H 2WPLS 1ETTH 2STAE 4XBBA 3ZV9A 3QLPH 3L6PA 4LOYH 1IQNA 1YPHE 5FBEA 1BHXF 2Y7ZA 2VGCC 3SHAH 1BRUP 2SGEE 4TPIZ 3P17H 1AN1E 1C2JA 5T6DA 1VJ9U 3Q00A 1PPGE 1BB0B 4X8SH 5EPYA 5EQRA 3TJVA 1ZTLA 2H6MA 5E0JA 1CO7E 1GVKB 1ZZZA 4I8LA 1FY4A 4AG2A 1TNLA 1YPHC 3FVFB 2ZDAH 1Z8GA 2FOGA 3FP7E 1EX3A 2BM2A 1FMGA 3ZZ8A 3CS0A 1P2IA 1C1RA 3S9CA 1GI2A 1WU1A 4KP0A 1CBWB 2H5DA 5JBAS 1QBNA 1FLEE 1SLVB 1YCPM 1F0SA 5EODA 3L3TA 4CRGA 3E91A 1C1QA 5TJXA 4U32A 8GCHG 3MNXA 2WV4A 1V6DA 1C5NH 3ZZ7A 1FAKH 1ELGA 4AFSA 1QJ1B 1LTOA 1UTOA 3ITIA 3NWUA 1ETRH 5C67A 4K1SA 1YPLH 2EI7A 1W7XH 1HRTH 1MKXK 4ZUHA 1ANCA 1BCUH 2ZPRA 1SLUB 1QURH 2ZQ2A 2XYAA 3M7TA 4B75A 4O03A 1WQVH 1UJ1A 3LGVA 2IN2A 1SMFE 2A5KA 1K1MA 1ZJDA 1K2I1 1HAYB 1QA0A 1T4UH 5DPAA 2OC7A 2GMTC 1HPGA 2A0QB 5F03A 3SJOA 3HPTB 1AWFH 4Q2KA 1DSTA 2GZ7A 3A7XA 4Q7YA 4NA9H 3DT0H 4AFZA 3URCA 1C2FA 1RRKA 5FPYA 1LHFH 1O2TA 2R2WU 5JPMH 5E8EH 2F9PA 1C5ZB 1ZHMA 2FOCA 4KKDA 5GIBA 1DFPA 3GDVA 1A5GH 1EJMA 4O9VA 4NIWA 1O3EA 4GUXA 2GGVB 5EPNA 1L1JA 1BA8B 1V2UT 3LT3A 2ANMH 1EB1H 1QQ4A 1IQIA 4A1VA 1L0ZA 3BTTE 4X6NA 3D23A 2VH6A 1C9TA 1RTLA 1C5LH 1GDQA 2CHAC 2ANWA 1GMHF 1P2KA 5FX5A