4OS1A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk601 (bicyclic 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A01
1G2MA 4X1SU 3LOXA 2PUXB 1N6XA 4WF8A 1MD8A 1GI8B 3I77A 1LHFH 1Y5AT 4INLA 2R2MB 2G81E 1YBWA 5J4QA 1G9IE 3OTJE 1WU1A 1MH0A 2Y6TA 2NU3E 2G51A 3BEUA 4AN7A 1THSH 1P12E 1N8OC 1QNJA 3A8AA 3SGBE 2OQ5A 1IQEA 1HYLA 3CS0A 3RXCA 3NUMA 1ZJDA 3P95A 4WMDA 1G3DA 1QBVH 2VU8E 3MO9A 4MVNA 1HAIH 1T7CA 3UFAA 5JYIA 1GJ8B 2GMTB 1ELBA 2GX4A 1BMMH 4HZHA 1BHXF 3VPKA 4NIYA 2FLRH 2ZFRH 4NSVA 3FZDA 3ZVFA 1Z6JH 3RXFA 3KCGH 1KY9A 2UUYA 2A2QH 1O2YA 1DWDH 1QTFA 1K1LA 4K8YA 3M5OA 1TWXB 4FUHA 4YOGA 3T27A 1ANDA 3SNBA 5J4SA 1ANEA 1XXFA 1MQ6A 3L33A 1AFEH 1C1SA 5AVDA 2CXVA 2W5EA 1UTJA 3QLPH 3KGPA 3ZVGA 4ZHLU 3BTFE 3ODDA 6GCHF 1LKAA 4R0IA 4YOIA 3LGYA 3RXHA 2V35A 4TY6A 1G32B 3SU1A 4OS6A 1B5GH 1HIAB 1GBIA 3GICB 3GY7A 5EU8A 1SGPE 3IWMA 4TPYA 4NFEA 3SU2A 4D9RA 2ZECA 1F0RA 2FTMA 1LHDH 1P11E 4FUDA 1D6WA 4OS7A 4K69A 1TGTA 1C1OA 1NO9H 3QGJA 1QY6A 1EAXA 3KHVA 4MPXA 2Q1JA 3KQDA 1FDPA 1G3CA 4ZHMU 3OX7U 1O0DH 3AW0A 3LGWA 2BDAA 1GBEA 5C1XA 1C4U2 1LVYA 5EODA 1C2GA 1YPLH 3T62A 3MU5A 2SGPE 1SQOA 1AVWA 4ZXYH 1U6QA 1K28D 1BMAA 3F68H 1KXDA 2VIDA 5GCHG 2XBXA 4A6LA 1C1PA 3UIRA 1CA8B 3HKIB 1OS8A 3KQBA 4BAQB 3MMGA 3GISB 3I29A 4CH2B 4E7NA 1W7XH 2QXJA 4ABGA 4GPGA 2ZCKP 4RN6A 1EB1H 1D9IA 4JK6A 1AGJA 1EZSC 2TBSA 3FZZA 1O2HA 4A5TS 4ABEA 1EAIA 5LH8A 2STAE 5A8XA 2ZHQH 1O36A 2PUQH 3ODFA 3U1JB 1YPKH 4UFFH 1BIOA 3KQEA 2FOCA 3ZYEA 1LDTT 1SGDE 4VGCC 1W11U 3RXMA 1DWCH 3NCLA 3PMBB 2C8YB 2TPIZ 3EA8A 3M61U 4FUBA 3D23A 2BLVA 1DXPA 2Y7XA 1O5BB 3P6ZB 1MQ5A 3SI3H 1IQGA 5I25A 4CRBA 1GI6A 4H6TA 5ESBA 2VGCB 4OS2A 2CHAC 1KDQA 3LC5A 4IN1A 1AVXA 1MKWK 2VH6A 3LGUA 4GHTA 4NWKA 3A81A 1GJ6A 2FS9A 3ZZ6A 1C2LA 3RUOA 4ABHA 1XUKA 1LPGB 5C1YA 5JBBS 1IQJA 4Y8XA 3TGIE 1HBTH 3BTHE 1YGCH 3HPTB 1A1RA 1FY8E 2AIPA 1GJCB 1E36B 3SZNA 5DO4H 3RU4E 2Z9KA 1K1NA 1K1PA 3SORA 4D7FA 2FWWA 4X8TH 1O3KA 1O3BA 1TONA 2W7SA 4H6SB 2PR3A 1E34B 2GMTC 1HAVA 3LGVA 1BMLA 1WBGB 1XMNB 3SNEA 2RDLA 1TPOA 2UWLA 4ZAEA 3R3GB 4JYTA 1RIWC 2QA9E 1ORFA 5BPEA 2XCNA 1FPCH 4BNRA 4Y7AA 4Z0KA 2GDDA 4ZKRU 1EASA 1F0UA 1G37A 1HXEH 1SFQB 1WSSH 1L4DA 1P57B 2CMYA 3LH1A 1DOJA 1AE5A 1ZLRA 1ZHRA 2BMGB 1CHOG 5LGOA 1XKBC 5DP7A 1S0RA 3A7ZA 1QB6A 4UFDH 3M7UA 1FN6A 1DFPA 4X2WA 3EA7A 1O2TA 1ELTA 5AHGH 4J1YA 1TNIA 1Y3XA 1IQMA 4CRCA 2P8OB 3AW1A 2BX4A 4I31A 1SFIA 1ZRBA 4YESB 5DP9A 1FJSA 1O34A 1OKXA 2ZFFH 1MTWA 4ABFA 3RDZA 1SGQE 3PROA 1MCTA 1KLTA 2GDEH 1O3OA 3A7WA 1P0SH 2NU4E 1TGNA 3TGKE 4I7YH 2ZDNA 1QQ4A 1DUEA 5T3HA 2ZWLH 3B8JA 2ZPSA 1NZQH 3UNQA 4IW4E 5DJ7A 1FUJA 1C2DA 1A0LA 2JH5D 3HK3B 3S69A 2GZ8A 1TGBA 1ZSLA 1MTUA 3Q3XA 1IQFA 5EPYA 1PPHE 1ZRKA 1Y3YA 4NG9H 2CJIA 2ZEBA 1MCVA 3PWCA 3FP8E 1EKBB 1KYNA 1GG6B 1OWDA 1O2MA 3U9AH 1ZGVA 2H9TH 2XXLA 3VB7A 2BDIA 1THPB 3I78A 1NU7B 5DPAA 5SGAE 3NWUA 3CENA 1PYTC 4IGDA 1H9IE 5DP8A 4B2CA 2ALVA 4UEHH 3U8OH 2FYQA 3A88A 1EZQA 1K1JA 2GCTB 2NWNA 5JDUB 2BD8A 1TRYA 1YC0A 3SN8A 2BXUH 1RFNA 3MYWA 1QB9A 4A92A 4BXSA 1EUFA 2VWLA 3SUEA 3LT3A 2FDAA 3GCTG 4CR9A 4ISHH 3Q77A 3WY8A 1ELEE 1SGYE 3TGJE 1CE5A 3VB5A 1C2JA 2C90B 4MPVA 4OGYA 5FX5A 2BD5A 2NU0E 1O38A 1J14A 4OS1A 2G00A 3K6YA 4X2YA 1P2IA 1NU9A 3GY3A 4A1VA 4RKOB 3UUZA 3VB4A 2O8MA 1S85A 3EQ0H 5PTPA 3ZZBA 2K1QA 1BTYA 2CGAA 4X0WU 1LQDB 1TQ7B 2TRMA 1NRSH 1TNHA 3LDXH 4DW2U 1UJ1A 3SJ9A 5C20A 1UTMA 2HLCA 2TGDA 5TCAA 1C5ZB 3KL6A 1C5OH 2P95A 3KEEA 1M9UA 1V2JT 4ABJA 1MBQA 1IQHA 4X2XA 1Z1JA 1AD8H 4X1NU 3GYLB 2QGRA 8GCHF 2FPZA 1ETRH 5DP5A 1UCYE 2P3FH 3HK6B 1GCDA 4OS5A 1SGEE 1IHTH 2ZDKA 1T8OA 2G8TA 2BD3A 1XVMA 3BTWE 1NFUA 3SHAH 1WV7H 2GZ7A 3G01A 4NA7A 3SUFA 2ZGXH 4NSYA 2KAIA 1ZMJA 1C5NH 2SGAA 4QT8C 5L2YH 1GVZA 1QL8A 1J17T 3U8TH 1QJ1B 1T8NA 2HGTH 1AZ8A 1MAYA 1O2LA 3A84A 1OOKB 4A1TA 1VGCB 1B7XB 1WAYB 1PYTD 1SSXA 1GHBF 5EW2H 2OXSA 3TH3H 4ZH8A 1GL1A 3NZIA 1K2I1 5HM9A 3W94A 1LPZB 2PKAA 2XC4A 3RP2A 1MD7A 2FZZA 3PV4A 2QC2A 2YOLA 4TYDA 4NA9H 2OC8A 5FBIA 2J92A 2PSXA 2HOBA 3SGQE 1TRNA 2ZC9H 2FYRA 3JZ1B 1TOCB 2UUJB 1CU1A 4X8SH 2Z7FE 1BUIA 5EOKA 3PB1E 1P3CA 1Z1IA 1L4ZA 1BHXB 3HKJB 5L6NH 1W7GH 1N8OB 1QL9A 2W3IA 5ABWA 3R0FA 1O2XA 2Y5FA 4F49A 3QUMP 3NPSA 1GG6C 3E0NB 1E37B 1VZQH 4MG3A 4ZXXH 3O8RA 2VVUA 2IOTA 2Q6DA 1TMUH 1AVGH 1GHXH 3ZZ3A 2CF8H 1V2PT 1GBJA 2QAAA 3QN7A 4ESTE 2ZHFH 5E8EH 1P10A 1LHEH 3RXGA 3S7HB 3TNTA 1HJ9A 1O3IA 1GMCF 3TJVA 1VCQA 1HAOH 4KTSA 1MKXK 1ZJKA 1YF4A 4I8HA 4ISOA 3SO3A 2H5CA 2PLXA 5JBAS 1SVPA 5LPRA 2UUFB 1WOFA 1ACBE 1GBDA 1K1MA 3Q3KA 1EPTA 2BD4A 4ABIA 4Y71A 1O5CB 1XUJA 1QA0A 2QXIA 1TPAE 4I8GA 2OD3B 5A2MH 4X8UH 2ZQ2A 1Y5BT 3KIDU 1C2MA 5E0JA 3QGNB 1N1LA 5C67A 3A80A 1YPHC 2IJOB 1OWIA 2PTNA 2BM2A 1DSTA 2Z9JA 3PWBA 3NK8A 1T4UH 1HV7A 4K8BA 2F9OA 5FHTA 2GKVE 1P8VC 2TIOA 3T25A 3V7TA 2ZFTA 4ABBA 1S5SA 1O3NA 2CF9H 1GI3A 1QCPA 3ATWA 1SLVB 2AMDA 2WUCA 1FMGA 4DT7B 3CS7A 3H7OA 2Z3CA 3TIUA 5LPFA 2H9EH 3C1KA 3PMHB 1C1NA 3RC6A 4Y6DA 2Y81A 1AY6H 4E05H 5F03A 1XUHA 1AFQB 2ANKH 3SGAE 3UWIA 1QA7A 2F91A 3GY2A 1NRPH 1UVOA 1SGFG 1JRSA 4GHQA 2AGEX 1WTHD 2ULLA 4AG1A 1BBRK 1QJ7B 4JYVH 2H6MA 3SNDA 1VITF 1ARBA 4IN2A 1NS3A 1OWJA 2G4UA 4X1PU 3T2NA 1DE7H 1TYNA 1HUTH 3SNAA 5GWZA 1O3DA 3BTME 2FTLE 4AGJA 4GCHG 4BAMB 1OX1A 3M36A 3B23B 1O3GA 2XW9A 1GMDF 4K2YA 1UVTH 1IOEA 5GIBA 1YLCA 9ESTA 1G2LA 2HPQH 4FVDA 3M37A 1A3EH 1KLJH 4LK4A 3SU4A 3TK5A 1ZPBA 4GLYA 1C1MA 2Y7ZA 2ZA5A 3BG4C 1O5FH 1V3XA 1BDAA 4VGCB 2Y5GA 1O3JA 1YCPH 4IS5A 4MNVA 1ZGIA 1GBHA 3F9EA 1KXEA 4NWLA 1ABIH 1WTGH 1ZMNA 1DICA 1UHBB 1G36A 2OC1A 1PPBH 2CHAB 1A2CH 1MTNC 4LZ1H 3L3TA 4TPIZ 3V12A 2J38A 1EOLA 1SR5C 3TK6A 4YM9A 3A87A 2VINA 3E90B 1AKSB 3URCA 2BY5X 2RA0A 2RA3A 2CN0H 3BTEE 1KXFA 4I8KA 5F8XA 5FPSA 3IITA 2AERH 2FOGA 3ZZ7A 2BVRH 3BEFB 4GSOA 4KP0A 2ZTZA 5ESTE 1RS0A 1DPOA 4NZLA 2SGQE 1YP9A 1OWKA 1GMHG 3RXRA 1TNGA 6CHAB 1V2KT 1RIWB 3ZZ4A 1H8IH 1SI5H 2FOFA 2FODA 1CT2E 3MO6A 1ARCA 1W2KH 4MPWA 2QY0B 1Z71A 4I8LA 1SLWB 1FLEE 3RC5A 2FXRA 1NRRH 2A5KA 1H1BA 3SV7A 2VWMA 3SUDA 2G5VA 4GAWA 5E0GA 4HI3A 2ANYA 1GI0A 1YCPM 3LJJA 4B2AA 1F0SA 2R0KA 5IDKA 2XNIA 2WPKS 1C4V2 1QRWA 4CRDA 4CRGA 3MNBA 3O8CA 1C5PA 3GY5A 4O3TA 1DXWA 1FPHH 1JIMA 1ELVA 1O33A 2BVXH 5EQRA 4H4FA 1LKBA 2ZCHP 3KQCA 3MH5A 1TRMA 4AB8A 3DFJA 3T26A 1F5KU 1J8AA 1SOTA 3RXSA 1Y3UA 1PQAA 2O8WA 3QDZB 1JIRA 2XWBI 2ZGJA 4B71A 3VB3A 1XM1A 2AIQA 4WXIA 2F83A 1Q2WA 2VNTA 1AFQC 3GDUA 1GDUA 1Q3XA 5C3NA 1FONA 1FV9A 3MI4A 4B75A 2XBWA 1A0HB 4AYYB 1C5TA 2AEIH 1SBWA 2BQ6B 3EAJA 1P2OA 5HGGA 1CBWB 4HTCH 3FVFB 2A4GA 3BTQE 3E3TA 3DHKH 3UQVA 3UQOA 4NGAH 1OP8A 1NC6A 4KGAA 2ZFPH 5HYOA 1BBRE 3OU0A 1D3DB 4BAHB 3URDA 3RMLH 1SC8U 2WUBA 2Y82A 4XDEA 4WWYA 2PW8H 2ZGCA 4I33A 2V0BA 4ZKNU 1O2VA 2JETB 3SU0A 1C5LH 1OYTH 4M7GA 3RXDA 3SHCH 2A32A 4AX9H 1DT2A 3E6PH 2ZQ1A 3SU5A 2STBE 2ZU2A 4LZ4B 1XX9A 1AWFH 1EQ9A 1AHTH 5EXLA 1C5QA 4BANB 1QURH 2XC0A 1H8DH 4HFPB 4ASHA 1W0YH 1C2FA 3B9FH 1SPJA 2O8TA 4OGXA 5FBEA 1O5EH 2I6SA 4YLQH 2ILNA 2AGGX 1L1JA 4Q7XA 1GBFA 2B5TB 2VJ1A 2H2ZA 3OY5U 2Z3DA 1GI1A 3UREA 2ZHEH 4UE7H 1AMHA 2V3HH 1INCA 3GDVA 4XSKU 2VB0A 3GOVB 3MNSA 3SJOA 3P70B 4Y8YA 1UTPA 4K5ZA 1K9OE 1BRAA 3T28A 2H5DA 5GCHF 7LPRA 1O2ZA 2ZHDA 1GJ4H 1SLUB 1UMAH 3ITIA 1QBNA 3F6UH 6CHAC 4U2WA 1CO7E 1HAHH 1DVAH 4FUFA 1SGCA 1Y8TA 4X1RU 3TK9A 1D3QB 2Y80A 1C5UA 1MZAA 2GD4B 3MH4A 1ELCA 1CA0C 3AAUA 2JKHA 3M3TA 4IC5A 1ELDE 4BTUB 1EB2A 1PQ5A 3RXQA 4IBLH 1HB0B 2Q6GA 1T32A 2G52A 1GBBA 1TBRH 1UTNA 2AGIX 3A82A 4FU7A 4HGCA 3ZZ8A 7GCHF 2PWXA 5GXPA 2CV3A 1ABJH 4AORA 2GZ9A 1EZXC 3SV9A 1HJAC 2XBVA 3TVJB 2VIWA 1GCTB 1O5DH 1EJAA 5C5OA 3VGCB 2ZDVH 3LIWA 2P93A 1O3AA 3UY9A 3BN9A 2ZKSA 2Z9LA 1ETTH 4MPUA 1OP0A 3K65B 2BDGA 1HIAA 4YOJA 2C8WB 2WPHS 3RC4A 1MAXA 1UK3A 3F9GA 1V2MT 2OP9A 3A7XA 1GI9B 1WYKA 1PPEE 3M5LA 3PLBA 2VIVA 3HATH 3ZVAA 4DGJA 3UNRA 1BA8B 4UONA 1WQVH 3P17H 3RXAA 1P04A 1CGIE 2VIOA 2F9VA 3PMJA 3MH6A 4JCNA 2PTCE 2ZU3A 1X7AC 1UK2A 3QZQA 4YZUA 2AS9A 1UK4A 1L2EA 1QHRB 3ESTA 1CBWC 4FVBA 1W0ZU 2WPLS 1F92A 1FY5A 2YNBA 3UNSA 4INKA 3RXJA 4Y7BA 3GCNA 1UVSH 4XBCA 2VIQA 1H9LB 5AFYH 2ZDLA 1BTPA 2P16A 3BEIB 2PKSC 3LC3A 1BT7A 4D7GA 1NM6A 3LH3A 1QQUA 1DSUA 2JETC 1Q31A 1J15A 3E1XB 3A86A 1JRTA 1OSSA 1CHOF 2SGDE 4NIWA 1T31A 1BMNH 1BTUA 3BIUH 2D26C 1GGDC 1AU8A 3QO6A 3A7VA 4RKJB 2ODQA 5DP3A 3MO3A 4WJG2 1CVWH 2J2UA 2W7UA 2BDBA 3PO1B 8GCHG 2WYGA 1SGRE 2BZ6H 2OUAA 1VR1H 1W14U 2O8UA 1TQ0B 1ZHPA 1ZPCA 2VIPA 1C5YB 5JB8S 2ZU5A 3S9CA 1L1GA 2A4RA 3DT0H 4LOYH 1Y5UT 2AH4X 1RTLA 5DGJA 4JZEH 3ZV8A 3RU4D 2B7DH 1RTFB 1SQTA 2TGAA 2B8OH 1V2OT 1ZYOA 2LNCA 1GHAG 3PTBA 4AZ2B 1YCPK 1A5IA 1UTLM 2PSYA 4K3JA 1YPJH 4WH6A 1P9UA 3ZVBA 1EX3A 3RXIA 1S84A 2FLBH 1SOZA 2ANWA 2SNVA 1UTKA 4KKDA 4MNXA 1IQNA 1O2KA 1GBMA 3CP7A 4O03A 4OS4A 2BLOA 1KSNA 5E2PA 1BTZA 1FAXA 4DCDA 2EEKA 4Y0YE 1BZXE 3FP7E 1S6FA 4CBNA 3S9AA 1C2KA 1O2GH 1HCGA 1W13U 1C5RA 1GI7B 3F9HA 1O35A 1C1TA 2WV5A 1V2WT 3M5NA 1P2JA 2ZTYA 3FANA 2A5AA 1GCTC 2ODPA 2Z9GA 3VGCC 3GCTF 1GWAA 2ZGHA 3SOSA 1DWEH 5CMXH 1O3MA 3BG4B 2F9UA 2BD9A 3VXEH 3E8LA 1L1NA 1O3EA 3MU8A 5A8ZA 3P8FA 3TLOA 1TNKA 2VH0A 1ZTKA 4BTIB 2BY6X 1ANCA 1Z8GA 2AYWA 2C8XB 1GBKA 4CRAA 1ETSH 2V3OH 1PPZA 3AASA 8ESTE 5A0BA 2UWOA 1ZHMA 4XE4A 1MTNB 1YKTA 1YPEH 3TU7H 3LPRA 1TAWA 3ZZ5A 1LTOA 4FUIA 2G4TA 1GHVH 4INHA 3SI4H 3SU6A 2SGFE 1C1RA 1WUNH 5C5NA 1QFKH 1GL0E 5GJ4B 5B6OA 2B0FA 3M35A 1C5MD 1P09A 2V6NA 1P2NA 1SGNE 1UCYH 1EZUC 1AUTC 1LHCH 1O3FA 4ABAA 3ZYDA 1O31A 1O2OA 2VVCA 1O2WA 1P03A 3E0PB 1BTXA 5LPEA 1QB1A 3A83A 4CRFA 4MNWA 1O5GH 1O2QA 2WPMS 1BQYA 1C5SA 2GCHG 1T4VH 2Q6FA 4A1XA 1DUAA 1LO6A 1DX5M 3OSYA 1NN6A 4A7IB 2EI7A 5DP6A 3A7YA 2GVFA 1O3CA 4SGAE 4WMFA 1C1VH 1C5XB 1O2UA 1TPPA 4IMQA 4KTCA 1WCZA 3UOUA 4WMEA 2I6QA 3VFEA 1FY1A 1GDQA 1HAPH 1UTOA 5FPYA 3MFJA 2VWNA 3VXFH 5EG4A 4YLUA 2A4QA 4UFGH 3PO1C 1LMWB 2PGQB 1HAYB 3DUXH 2THFB 1OWHA 1ZMLA 1QR3E 1GBLA 5GDSH 1IQKA 1C1WH 1HFDA 5EQQA 2ZPRA 2ZGBH 4BAKB 4AFUA 4NIXA 9LPRA 2H9HA 2EA3A 1GJ7B 1DS2E 1K21H 1XUFA 3A8BA 4THNH 4DIHH 1NESE 2FP7B 1ZSKA 5CHAC 1V2VT 5G4BA 1LVBA 4X8VH 4B2BA 1ID5H 2A45B 3A7TA 1B0EA 2XBYA 5L30H 1C5WB 1ZOMA 2ZU4A 5JB9S 1VJAU 1P3EA 3D49H 3EGKH 1DLKB 1VITH 1N6YA 3MU1A 1TNJA 1G3EA 2QV1A 1UTQA 3TPIZ 1A4WH 1A3BH 2D2DA 1LVMA 1OWEA 4WVPE 1TIOA 2FI4E 3U69H 1QBOA 3PM3A 3A89A 4TWWA 4K60A 2ZCLP 2O9QA 2C93B 3DFLA 4UDWH 3SJIA 1O2SA 5HXFA 6LPRA 1AUJA 4JYUH 4AG2A 2IPHA 1V2TT 1AIXH 2C8ZB 1BJUA 5EQSA 2QCYA 3RXTA 4ZROA 1C1QA 4U01A 2R2WU 3SQEE 2ZDMA 1C9PA 2NU1E 3OYPA 3KF2A 4FUCA 4ISIH 2WPJS 1LHGH 2UUKB 4Y79A 1TX8A 2G55A 3IG6B 4YO9A 4B76A 1C4Y2 2Y5HA 3TJOA 2HRVA 1AB9C 3BG8A 3RMOH 1KLIH 1P02A 3PTNA 1NFWA 5DP4A 2JH0D 1EP6A 3S0NA 1SHHB 2J95A 3QWCH 1O30A 4WXVA 4ISLA 2XRCA 2EI6A 1TOMH 1MTVA 1O32A 3K2UA 7KMEH 3GDSA 2ZFSA 3Q3YA 1E35B 4O9VA 2OC0A 2ZNKH 2QN5T 1HJ8A 3M7TA 3T5FH 6GCHG 3QX5H 1KDQB 1TBZH 3BTDE 1AN1E 1ELGA 3BSQA 2TGTA 2XC5A 1VJ9U 1K1IA 2BDYA 4X6NA 2W26A 1SL3A 2FX4A 4DG4A 2BX3A 2DE8A 3K6ZA 4K1SA 1CGHA 4DURA 4LXBH 3RXVA 1Y59T 4YT7H 1Z8JB 5A8YA 2BOKA 1FZZA 1HRTH 3JZ2B 3MTYA 4RSPA 1RTKA 4GCHF 1MU8B 3C27B 4BXWA 2ZPQA 3GCHB 1HAVB 3ZV9A 5FXLA 1C1UH 1Z7KA 1PPGE 2UWPA 1CA0B 4CHAC 3MWIU 2ZF0H 2OINA 3ZZAA 5E2OA 2O8LA 1EAWA 3RXPA 4AFZA 1GDNA 3RXLA 3P8OA 4MQAA 5DG6A 1K22H 4IC6A 5DKMA 5EXMA 1ZPZA 1E0FD 3O8DA 5T6DA 1CT4E 4XBBA 3BV9B 3PLPA 1EAUA 2ZO3H 1HJAB 1H9HE 4UD9H 1NROH 3ZZ9A 2R3UA 1T8MA 2BHGA 2FOBA 3SV6A 5F8TA 1O2PA 1NFYA 3KN2A 2Z9IA 2AMPA 2HNTE 3PLKA 5CE1A 4ZMAH 1P06A 1DITH 1BRUP 2ZG0H 1O2NA 3BIVH 1LCYA 1BJVA 3ATLA 1P05A 5F8ZA 1QJ6B 1TPSA 2C4FH 1NT1A 4MLFB 4NA8A 5FCKA 3GYMA 3ZVDA 5T6FA 2GV7A 1DY9A 1GHWH 2HPPH 1ZZZA 1FIZA 1AZZA 2G5NA 2QXHA 1GBTA 1YPGH 2FOEA 1CHGA 1GMHF 5GPIB 1EJMA 1PJPA 1NTPA 2NU2E 1SHYA 2YNAA 1IHSH 1MKXH 3NKKA 2BDCA 5AF9H 1VCPA 2QF3A 1J9CH 4NIVA 4B73A 2PKSB 1UO6A 2P94A 3EDXB 1SG8B 2HNTC 4R8TB 1T8LA 1YYY1 2BB4A 4CH8B 1O39A 1Y3WA 5FCRA 1W10U 2RG3A 2FI5E 2ZI2H 1NFXA 1DM4B 1JXPA 3GCOA 3RXKA 4B74A 1BOQA 1THRH 3H7TA 1JMOH 1JWTA 2LPRA 3AVZA 2QXGA 1TA2A 1GGDB 1YLDA 4X2VA 1GVLA 2IN2A 1IQLA 5ETXA 1JOUB 1VCWA 3ENSB 2HNTF 2XCFA 1PQ8A 2XWAA 1V2RT 1UHBA 1TMTH 1QIXB 5JPMH 5FPTA 2BDHA 2F9BH 1W3CA 3QZRA 7GCHG 4FUEA 3U98H 4JMYA 1V2ST 3RMNH 3ZVCA 3QTVH 4IMZA 1BTWA 3V13A 1S0QA 5E0HA 1C2EA 3GY4A 1BRCE 1AKSA 4D9QA 2A7JA 1B0FA 3RM2H 4BOHA 3STIA 1FAKH 1BBRH 3UTUH 3QK1A 3MHWU 4Q80A 4MNYA 1GHYH 1O3PB 4TY7A 5A0CA 5EPNA 1MZDA 1BRBE 1K1OA 5EXNA 1AQ7A 1HAXB 3VB6A 1EJNA 1CT0E 4ZKSU 2B9LA 2A2XH 3UOPA 3MNCA 1L0ZA 4JZFH 3SUGA 2J34A 2OBQA 2M5TA 3HGPA 3GCHC 1FXYA 3LGIA 4ZUHA 3P8NA 2A5IA 1FIWA 4O3UA 1C2HA 4SGBE 4AYVB 1H4WA 2ZZUH 1TNLA 3M7QA 5A09A 2PFEA 1LVOA 1EP5A 1TBQH 1D3TB 2WV4A 1UCYK 1O2RA 3FFGA 2FIRH 3BTGE 1GPZA 2QF0A 4GVUA 1WQSA 4DVAU 1F5RA 2GP9B 4O97A 1JBUH 3Q76A 3OY6U 1ZSJA 2VWOA 3SV8A 2W3KA 1RD3B 4ABDA 2GTBA 2FI3E 2KAIB 4X1QU 4D8NA 4Y8ZA 3DA9B 3S7KB 1HXFH 1EATA 2XTTB 4Q7ZA 2TGPZ 3TITA 2BLWA 1CQQA 1D3PB 1P2QA 1HAZB 1YM0A 2OC7A 4X6OA 1F0TA 1EOJA 1SQAA 3SW2B 2HWLB 1TABE 4JK5A 4K1EA 5L2ZH 5HM2A 2PKAB 2A31A 4Y0ZE 1BTHH 1TALA 4KTUA 1GBCA 5T6GA 3Q00A 2WYJA 4YT6H 2BTCE 2HVXA 3SJKA 1TMBH 2EC9H 1D4PB 2GT8A 3RM0H 2GT7A 3BTKE 3GY6A 2OTVA 1HGTH 3V0XA 3E16B 1QRXA 1HLTH 3BF6H 1TGCA 1AE8H 3P8GA 5DK1A 2QYIA 5JBCS 4BTTB 2SGEE 8KME2 2F9NA 3RXOA 1IAUA 2JH6D 3ZZDA 4U30A 1PQ7A 4PROA 2ZDAH 1P01A 3ZZCA 1AO5A 3STJA 2F9PA 1NY22 1AI8H 1Y3VA 1FQ3A 1ESAA 2ANMH 3MOCA 4D76A 5JBTA 3S9BA 3SJ8A 1HNEE 3NXPA 3E91A 2A1DB 4J2YB 1G30B 4Y11E 1FY4A 1BCUH 1Z8RA 1QRZA 1DANH 3ELAH 1S6HA 1W8BH 2FOAA 2FX6A 1P2MA 8LPRA 3QTOH 2ZFQH 3U8RH 1J16A 1ZTLA 2DE9A 2OBOA 2BLQA 5HMAA 1A7SA 1GI5A 2H1UA 4DIIH 4ISNA 4ZHAA 3N7OA 4Q2KA 1GJAB 2J9NA 1EPTB 3VEQB 2J4IA 3MH7A 3MU4A 3RLWH 1RXPA 3UPEA 1A46H 1S81A 2QIQA 1C5VA 5I46H 4GUXA 1FI8A 5CHAB 4XBDA 1MBMA 3TH4H 3TJUA 2GGVB 3W95A 1O3LA 1GI4A 1TB6H 2VGCC 3RXEA 3V3MA 1RRKA 2ZIQH 4DOQA 5C2ZA 1GHBG 2C3SA 1O2JA 3SQHE 2ODYB 3P92A 4U32A 2D1JA 1RGQA 1Z6EA 3TJNA 1NRNH 3RMMH 1CGJE 5C1UA 1CSOE 1D6RA 1PPCE 1V2LT 1FNIA 2HALA 1GI2A 1GJBB 1XUIA 2BY9X 5F6MA 4F4OC 1GJ9B 1P9SA 1V2UT 4WH8A 2FO9A 3L6PA 4AFSA 1TFXA 5FX6A 1LPKB 2Z94A 1KXBA 2FOHA 3ATIA 2OQUA 1A5HA 1C2IA 4JZIA 3RLYH 2ASUB 1XVOA 1OPHB 1E38B 3D65E 4TWYA 1O2IA 6ESTA 4Z6AH 5EGMA 1DY8A 1KXAA 2A7HA 1ELAA 1GJDB 1A5GH 1TA6A 2BQWB 4JZ1A 2R9PA 3LKWA 1DWBH 4I32A 2OLGA 1ESTA 2ALPA 1IQIA 1MKWH 4YTAA 3EYDA 3ATKA 1GMCG 1AB9B 4UFEH 3FAOA 4NCYA 2ESTE 3A85A 4MTBA 2BD7A 1QL7A 3O8BA 2P59A 3M5MA 2FMJA 4E06H 4Y10E 4I8JA 1A0JA 3DD2H 3LGTA 4XFQA 1KIGH 2P8OC 3H5CB 1BB0B 3M3VA 7ESTE 1TGSZ 1KXCA 4K1TA 2A7CA 1PFXC 2ZTXA 1P2KA 2BQ7B 3ATMA 1GHAF 4E7RG 1OP2A 1A61H 1TX7A 1UVUH 3D62A 1OYQA 3T29A 4BAOB 3F9FA 1BITA 3A8CA 1LQEA 2BVSH 4Y76A 3K9XB 2BZAA 5H4IB 1GJ5H 5K0HA 2FEQH 1F5LA 2PV9B 2BD2A 2EI8A 4X6PA 3UR6A 1UVPA 2R0LA 4CREA 1O37A 1AWHB 2FS8A 2AMQA 1YPMH 3SU3A 1ZR0A 1NRQH 1YPHE 2GV6A 2D8WA 1GBAA 5EW1H 2P3TB 4AGKA 1S82A 4FU8A 1HDTH 2J94A 1SGTA 3M3SA 2A4OA 2FESH 4FXGH 5AFZH 4H42U 5TJXA 3UWJH 4AB9A 3EA9A 1ZTJA 4CHAB 2AFQB 2F3CE 1GVKB 1DDJA 1MU6B 4NFFA 3ZVEA 1VITG 3UR9A 4X6MA 1MMJN 4MDSA 5A0AE 3AAVA 1G3BA 2BYAX 1O3HA 1DLEA 1EPTC 4CR5A 2BY7X 1XKAC 1ESBA 2Z3EA 3GY8A 5TCCA 1V6DA 3EE0B 3MNXA 1Z8IB 2GCTC 4B1TA 1GMDG 1GHZA 2OCVB 1MUEB 3RXBA 1W12U 3LONA 5FAHA 1EXFA 2Z6BD 3U1IB 1PPFE 2ZHWH 1SGIB 4Q7YA 1QGFA 2BY8X 4ZKOU 1RJXB 5BRRE 3TNSA 1XXDA 4CBOA 3F1SB 2ZP0H 3PMAB 1FY3A 3RU4T 1HAGE 1ELFA 1F7ZA 1XUGA 4NZQA 5K7RA 2GCHF 4WY3A 4JZDH 1V2NT 2BXTH 4FUGA 4XOJA 2VVVA 1F2SE 3BTTE 2SFAA 2WPIS 4FU9A 1FN8A 3TH2H 1O5AB 2DUCA 3A8DA 2FM2A 1C9TA 1TLDA 2PHBA 3HGNA 2PGBB 2ZU1A 3MU0A 1KTTB 3PYHA 4FUJA 1KTSB 4AOQA 1SMFE 2BOHB 1TX6A 2P3UB 1NPMA 2XYAA 3FP6E 2RCEA 1SLXB 2SNWA 4AFQA 1SB1H 2A0QB 3SV2H 1OXGA 1HPGA 5IYTA 4DJZB 3KNXA 1TE0A 4DY7B 3LJOA 2WINI 3RXUA 1S83A 1ANBA 1VGCC 2R3YA 1V2QT 3SBKA 1SGFA 3SNCA 1MTSA 2FOMB 4KELA 3LU9B
chains in the Genus database with same CATH superfamily
1G2MA 4X1SU 3LOXA 2LP6A 2PUXB 1N6XA 4WF8A 1MD8A 1GI8B 3I77A 1LHFH 1Y5AT 4INLA 2R2MB 2G81E 1YBWA 3F2FA 5J4QA 1G9IE 3OTJE 1WU1A 1MH0A 2Y6TA 2NU3E 2G51A 3BEUA 4AN7A 5DSFA 1THSH 1P12E 2KCAA 1N8OC 1QNJA 2F4LA 3A8AA 3SGBE 2OQ5A 1IQEA 1HYLA 3CS0A 4RT0A 3RXCA 3NUMA 1ZJDA 3P95A 4WMDA 1G3DA 1SQRA 1QBVH 2VU8E 3MO9A 4MVNA 1HAIH 1T7CA 3UFAA 5JYIA 1GJ8B 2GMTB 1EFRD 1ELBA 2GX4A 1BMMH 4HZHA 1BHXF 3VPKA 4NIYA 2FLRH 2ZFRH 4NSVA 3FZDA 3F0PA 3ZVFA 2HLDD 1Z6JH 3RXFA 3KCGH 1KY9A 2UUYA 2A2QH 1O2YA 1DWDH 1QTFA 1H8HD 1K1LA 4K8YA 3M5OA 1TWXB 5KEDA 4FUHA 4YOGA 3T27A 1ANDA 1K0HA 3SNBA 5J4SA 1ANEA 1XXFA 1MQ6A 3L33A 1AFEH 1C1SA 5AVDA 2CXVA 2W5EA 1UTJA 3QLPH 3KGPA 3ZVGA 4ZHLU 3BTFE 3ODDA 6GCHF 1LKAA 4R0IA 5C17A 4YOIA 3LGYA 3RXHA 2V35A 4TY6A 1G32B 3SU1A 4OS6A 1B5GH 1HIAB 1GBIA 3GICB 3GY7A 5EU8A 1SGPE 3IWMA 4TPYA 4NFEA 3SU2A 4D9RA 2ZECA 1F0RA 2FTMA 1LHDH 1P11E 4FUDA 1D6WA 4OS7A 4K69A 1TGTA 1C1OA 1NO9H 3QGJA 1QY6A 1EAXA 3KHVA 4MPXA 2Q1JA 3KQDA 1FDPA 1G3CA 4ZHMU 3OX7U 1O0DH 3AW0A 3LGWA 5KGOA 2BDAA 1GBEA 5C1XA 1C4U2 1LVYA 5EODA 1C2GA 1YPLH 3T62A 3MU5A 2SGPE 1SQOA 1AVWA 4ZXYH 1U6QA 1K28D 1BMAA 3F68H 1KXDA 2VIDA 5GCHG 2XBXA 4A6LA 1C1PA 3UIRA 1CA8B 3HKIB 1OS8A 3KQBA 4BAQB 3MMGA 3GISB 3I29A 4CH2B 4E7NA 1W7XH 2QXJA 4ABGA 4GPGA 2ZCKP 4RN6A 1EB1H 1D9IA 1H8ED 4JK6A 1AGJA 1EZSC 2TBSA 3FZZA 1O2HA 4A5TS 4ABEA 1EAIA 5LH8A 2STAE 5A8XA 2ZHQH 1O36A 2PUQH 3ODFA 3U1JB 1YPKH 4UFFH 1BIOA 3KQEA 2FOCA 3ZYEA 1LDTT 1SGDE 3N7DA 3N7EA 4VGCC 1W11U 3RXMA 1DWCH 3NCLA 3PMBB 2C8YB 3OE7D 2TPIZ 3EA8A 3M61U 4FUBA 3D23A 2BLVA 1DXPA 2Y7XA 1O5BB 3P6ZB 1MQ5A 3SI3H 1IQGA 5I25A 4CRBA 1GI6A 4H6TA 2L74A 5ESBA 2VGCB 4OS2A 2CHAC 1KDQA 3LC5A 4IN1A 1AVXA 1MKWK 2VH6A 3LGUA 4GHTA 4NWKA 3A81A 1GJ6A 2FS9A 3ZZ6A 1C2LA 3RUOA 4ABHA 1XUKA 1LPGB 5C1YA 5JBBS 1IQJA 4Y8XA 3TGIE 1HBTH 3BTHE 1YGCH 3HPTB 1A1RA 1FY8E 2AIPA 1GJCB 1E36B 3SZNA 5DO4H 3RU4E 2Z9KA 1K1NA 1K1PA 3SORA 4D7FA 2FWWA 4X8TH 1O3KA 1O3BA 1TONA 2W7SA 4H6SB 2PR3A 1E34B 2GMTC 1HAVA 4TSFD 3LGVA 1BMLA 2QE7D 1WBGB 1XMNB 3SNEA 2RDLA 1TPOA 2UWLA 4ZAEA 3R3GB 4JYTA 1RIWC 2QA9E 1ORFA 5BPEA 2XCNA 2KCYA 1FPCH 1VKYA 4BNRA 4Y7AA 4Z0KA 2GDDA 4ZKRU 1EASA 1F0UA 1G37A 1HXEH 1SFQB 1WSSH 1L4DA 1P57B 2CMYA 3LH1A 1DOJA 1AE5A 1ZLRA 1ZHRA 2BMGB 3MQKC 1CHOG 5LGOA 1XKBC 2CK3D 5DP7A 1S0RA 3A7ZA 1QB6A 4UFDH 3M7UA 1FN6A 1DFPA 4X2WA 3EA7A 1O2TA 1ELTA 5AHGH 4J1YA 1TNIA 2J98A 1Y3XA 1IQMA 3EE7A 4CRCA 2P8OB 3AW1A 2BX4A 4I31A 1SFIA 1ZRBA 4YESB 5DP9A 1FJSA 1O34A 1OKXA 2ZFFH 4Q4LA 1MTWA 4ABFA 3RDZA 1SGQE 3PROA 1MCTA 1KLTA 2GDEH 1O3OA 3A7WA 1P0SH 2NU4E 1TGNA 5HIZA 3TGKE 4I7YH 2ZDNA 1QQ4A 1DUEA 5T3HA 2ZWLH 3B8JA 2ZPSA 1NZQH 3UNQA 4IW4E 5DJ7A 1FUJA 1C2DA 1A0LA 2JH5D 3HK3B 3S69A 2QF5A 2GZ8A 1TGBA 1ZSLA 1MTUA 3Q3XA 1IQFA 5EPYA 1PPHE 2OK5A 3KYGA 3PRDA 1ZRKA 1Y3YA 4NG9H 2CJIA 2ZEBA 1MCVA 3PWCA 3FP8E 1EKBB 1KYNA 1GG6B 5C94A 1OWDA 1O2MA 3U9AH 1ZGVA 2H9TH 2XXLA 3VB7A 2BDIA 1THPB 3I78A 1NU7B 5DPAA 5SGAE 3NWUA 3CENA 1PYTC 4IGDA 1H9IE 5DP8A 4B2CA 2ALVA 4UEHH 3U8OH 2FYQA 1SKYE 2IPQX 3A88A 1EZQA 1K1JA 2GCTB 2NWNA 5JDUB 2BD8A 1TRYA 1YC0A 3SN8A 2BXUH 1RFNA 3MYWA 1QB9A 4A92A 4BXSA 1EUFA 2VWLA 3SUEA 3LT3A 2FDAA 3GCTG 4CR9A 2EQNA 4ISHH 3Q77A 3WY8A 4RT1A 1ELEE 1SGYE 3TGJE 1CE5A 3VB5A 1C2JA 2C90B 4MPVA 4OGYA 5FX5A 2BD5A 2NU0E 1O38A 1J14A 4OS1A 2G00A 3K6YA 4X2YA 1P2IA 1NU9A 3GY3A 4A1VA 4RKOB 3UUZA 3VB4A 2O8MA 2YMSB 1S85A 3EQ0H 5PTPA 3ZZBA 2K1QA 1BTYA 2CGAA 4X0WU 4B6EA 1LQDB 1TQ7B 2TRMA 1NRSH 1TNHA 3LDXH 4DW2U 1UJ1A 3SJ9A 5C20A 1E1QD 1UTMA 2HLCA 2TGDA 5TCAA 1C5ZB 3KL6A 1C5OH 2P95A 3KEEA 1M9UA 1V2JT 4ABJA 1MBQA 1IQHA 4X2XA 1Z1JA 1AD8H 3KYFA 4X1NU 3GYLB 2QGRA 8GCHF 2FPZA 1ETRH 5DP5A 1UCYE 2P3FH 3HK6B 1GCDA 4OS5A 1SGEE 1IHTH 2ZDKA 1T8OA 2G8TA 2BD3A 1XVMA 3WW7A 3BTWE 1NFUA 3SHAH 1WV7H 2GZ7A 3G01A 4NA7A 3SUFA 2ZGXH 4NSYA 2KAIA 1ZMJA 1C5NH 2SGAA 4QT8C 5L2YH 1GVZA 1QL8A 1J17T 3U8TH 1QJ1B 1T8NA 2HGTH 1AZ8A 1MAYA 1O2LA 3A84A 1OOKB 2J97A 1VGCB 4A1TA 1B7XB 1WAYB 1PYTD 1SSXA 1GHBF 5EW2H 2OXSA 3TH3H 4ZH8A 1GL1A 3NZIA 1K2I1 5HM9A 3W94A 1LPZB 2PKAA 2XC4A 3RP2A 2L6OA 1MD7A 2FZZA 3PV4A 2QC2A 2YOLA 4TYDA 4NA9H 2OC8A 5FBIA 2J92A 2PSXA 2HOBA 3SGQE 1TRNA 2ZC9H 2FYRA 3JZ1B 1TOCB 2UUJB 1CU1A 4X8SH 2Z7FE 1BUIA 5EOKA 3FOAA 3PB1E 1P3CA 1Z1IA 1L4ZA 4ASUD 1BHXB 3HKJB 5L6NH 1W7GH 1N8OB 1QL9A 2W3IA 5ABWA 3R0FA 1O2XA 2Y5FA 4F49A 3QUMP 3NPSA 3NRLA 1GG6C 3SYJA 3E0NB 1E37B 1VZQH 4MG3A 4ZXXH 3O8RA 2VVUA 2IOTA 2Q6DA 1TMUH 1AVGH 1GHXH 3ZZ3A 2CF8H 1V2PT 1GBJA 5EJ1A 2RFKC 3F2HA 2QAAA 3QN7A 4ESTE 2ZHFH 5E8EH 1P10A 1LHEH 3RXGA 3S7HB 3TNTA 1HJ9A 3WWBA 1O3IA 5C0UA 1GMCF 3TJVA 1VCQA 1HAOH 4KTSA 1QZ8A 1MKXK 1ZJKA 1YF4A 4I8HA 4ISOA 3FKSD 3SO3A 2H5CA 2PLXA 5JBAS 3H09A 1SVPA 5LPRA 2UUFB 1WOFA 1ACBE 1GBDA 1K1MA 2F43B 3Q3KA 1EPTA 2BD4A 4ABIA 4Y71A 1O5CB 1XUJA 1QA0A 2QXIA 1TPAE 4I8GA 2OD3B 5A2MH 4X8UH 2ZQ2A 1Y5BT 3KIDU 1C2MA 5E0JA 3QGNB 1N1LA 5C67A 3A80A 2LELA 1YPHC 2IJOB 1OWIA 2PTNA 2BM2A 1DSTA 2Z9JA 3PWBA 3NK8A 1T4UH 1HV7A 4K8BA 2F9OA 5FHTA 2GKVE 1P8VC 2TIOA 3T25A 3V7TA 2ZFTA 4ABBA 1S5SA 1O3NA 2CF9H 2YMSC 1GI3A 1QCPA 3ATWA 2WHXA 1SLVB 2AMDA 2WUCA 1FMGA 4DT7B 3CS7A 3N99A 3H7OA 2Z3CA 3TIUA 5LPFA 2H9EH 3C1KA 3PMHB 1C1NA 3RC6A 4Y6DA 2Y81A 1AY6H 4E05H 5F03A 1XUHA 1AFQB 2ANKH 3SGAE 3UWIA 1QA7A 2F91A 3GY2A 1NRPH 1UVOA 1SGFG 1JRSA 1MABB 4GHQA 2AGEX 3F0OA 1WTHD 2ULLA 4AG1A 1BBRK 1QJ7B 5HIYA 3W1EA 4JYVH 2H6MA 3SNDA 1VITF 1ARBA 4IN2A 1NS3A 1OWJA 2G4UA 4X1PU 3T2NA 1DE7H 1FX0B 1TYNA 1HUTH 3SNAA 5GWZA 1O3DA 3BTME 2FTLE 3PRBA 4AGJA 4GCHG 4BAMB 1OX1A 3M36A 3B23B 1O3GA 2XW9A 1GMDF 4K2YA 1UVTH 1IOEA 5GIBA 1YLCA 9ESTA 1BMFD 1G2LA 2HPQH 2KR7A 4FVDA 3M37A 2K8IA 3UAIC 1A3EH 1KLJH 4LK4A 3SU4A 3TK5A 1ZPBA 4GLYA 1C1MA 2Y7ZA 2ZA5A 3BG4C 1O5FH 1V3XA 1BDAA 4VGCB 2Y5GA 1O3JA 1YCPH 4IS5A 4MNVA 1ZGIA 1GBHA 3F9EA 1KXEA 4NWLA 1ABIH 1WTGH 1ZMNA 1DICA 1UHBB 1G36A 2EY4C 2OC1A 1PPBH 2W6JD 2CHAB 1A2CH 1MTNC 4LZ1H 3L3TA 4TPIZ 3V12A 2J38A 1EOLA 1SR5C 3TK6A 4YM9A 3A87A 1UW7A 2VINA 3E90B 1AKSB 3URCA 2BY5X 2RA0A 2RA3A 2CN0H 5EJZA 3BTEE 1KXFA 4I8KA 5F8XA 5FPSA 3IITA 2AERH 2FOGA 4XD7D 2BVRH 2YMSD 3ZZ7A 3BEFB 4GSOA 4KP0A 2ZTZA 5ESTE 1RS0A 1DPOA 4NZLA 2SGQE 1YP9A 1OWKA 1GMHG 3RXRA 1TNGA 6CHAB 1V2KT 1RIWB 3ZZ4A 1H8IH 1SI5H 2FOFA 2FODA 1CT2E 3MO6A 1ARCA 1W2KH 4MPWA 2QY0B 1Z71A 4I8LA 1SLWB 1FLEE 3RC5A 2FXRA 4B6FA 1NRRH 2A5KA 1H1BA 3SV7A 2VWMA 3SUDA 2G5VA 4GAWA 5E0GA 4HI3A 2ANYA 1S6LA 3VG8A 1GI0A 1YCPM 3LJJA 5C0TA 4B2AA 1F0SA 2R0KA 4FETA 5IDKA 2XNIA 2WPKS 1C4V2 1COWD 1QRWA 4CRDA 4CRGA 3MNBA 3O8CA 1C5PA 3GY5A 4O3TA 1DXWA 5CHBA 1FPHH 1JIMA 1ELVA 1O33A 2BVXH 5EQRA 4H4FA 1LKBA 2ZCHP 3KQCA 3MH5A 1TRMA 4AB8A 3DFJA 3T26A 1F5KU 1J8AA 1SOTA 3RXSA 1Y3UA 1PQAA 2O8WA 1YWUA 3QDZB 1JIRA 2XWBI 2ZGJA 4B71A 3VB3A 1XM1A 3DSPA 2AIQA 4WXIA 2F83A 1Q2WA 2XOKD 2VNTA 1AFQC 3GDUA 1GDUA 1Q3XA 5C3NA 1FONA 1FV9A 3MI4A 4B75A 2XBWA 3OEED 1A0HB 4AYYB 1C5TA 2AEIH 1SBWA 2BQ6B 3EAJA 1P2OA 5HGGA 1CBWB 4HTCH 3FVFB 2A4GA 3BTQE 3E3TA 3DHKH 3OTPA 3UQVA 3UQOA 4NGAH 1OP8A 1NC6A 2AHME 4KGAA 2ZFPH 5HYOA 1BBRE 3OU0A 1D3DB 4BAHB 3URDA 3RMLH 1SC8U 2WUBA 2Y82A 4XDEA 4WWYA 2PW8H 2ZGCA 4I33A 2V0BA 4ZKNU 1O2VA 2JETB 3SU0A 1C5LH 1OYTH 4M7GA 3RXDA 3SHCH 2A32A 4AX9H 1DT2A 3E6PH 2ZQ1A 3SU5A 2STBE 2ZU2A 4LZ4B 1XX9A 1AWFH 1EQ9A 1AHTH 5EXLA 1C5QA 4BANB 1QURH 2XC0A 1H8DH 4HFPB 4ASHA 1W0YH 1C2FA 3B9FH 1SPJA 2O8TA 4HG6A 4OGXA 5FBEA 1O5EH 2I6SA 4YLQH 2ILNA 2AGGX 1L1JA 4Q7XA 1GBFA 2B5TB 2VJ1A 2H2ZA 3OY5U 2Z3DA 1GI1A 3UREA 2ZHEH 4UE7H 1AMHA 2V3HH 1INCA 3GDVA 4XSKU 2VB0A 3GOVB 3MNSA 3SJOA 3P70B 5FL7D 4Y8YA 1UTPA 4K5ZA 1K9OE 1BRAA 3T28A 2H5DA 5CDFE 5GCHF 7LPRA 1O2ZA 2ZHDA 1GJ4H 1SLUB 2WSSD 1UMAH 3ITIA 1QBNA 3F6UH 6CHAC 4U2WA 1CO7E 1HAHH 1DVAH 4FUFA 1SGCA 1Y8TA 4X1RU 3TK9A 1D3QB 2Y80A 1C5UA 1MZAA 2KZ4A 2GD4B 3MH4A 1ELCA 1NBME 1CA0C 3AAUA 2JKHA 3M3TA 4IC5A 1ELDE 4BTUB 1EB2A 1PQ5A 3RXQA 1KMHB 4IBLH 1HB0B 2Q6GA 1T32A 2G52A 1GBBA 1TBRH 1UTNA 2AGIX 3A82A 4FU7A 4HGCA 3ZZ8A 7GCHF 2PWXA 5GXPA 2CV3A 1ABJH 4AORA 2GZ9A 1EZXC 3SV9A 1HJAC 2XBVA 3TVJB 2VIWA 1GCTB 1O5DH 1EJAA 5C5OA 3VGCB 2ZDVH 3LIWA 2P93A 1O3AA 3UY9A 3BN9A 2ZKSA 3UB0A 2Z9LA 1ETTH 4MPUA 1OP0A 3K65B 2BDGA 1HIAA 4YOJA 2C8WB 2WPHS 3RC4A 1MAXA 1UK3A 3F9GA 1V2MT 2OP9A 3A7XA 1GI9B 1WYKA 1PPEE 3M5LA 3PLBA 2VIVA 3HATH 3ZVAA 4DGJA 3UNRA 1BA8B 4UONA 1WQVH 3P17H 3RXAA 1P04A 1CGIE 2VIOA 2F9VA 3PMJA 3MH6A 4JCNA 2PTCE 2ZU3A 1X7AC 1UK2A 3QZQA 4YZUA 2AS9A 1UK4A 1L2EA 1QHRB 3ESTA 1CBWC 4FVBA 1W0ZU 2WPLS 1F92A 1FY5A 2YNBA 3UNSA 4INKA 3RXJA 4Y7BA 3WWFA 3GCNA 1UVSH 4XBCA 2VIQA 1H9LB 5AFYH 2ZDLA 1BTPA 2P16A 3BEIB 2PKSC 3LC3A 3OEHD 1BT7A 4D7GA 2JJ2D 1NM6A 3LH3A 1QQUA 1DSUA 2JETC 1Q31A 1J15A 3E1XB 3A86A 1JRTA 1OSSA 2HVYB 1CHOF 2SGDE 4ACBA 4NIWA 1T31A 1BMNH 1BTUA 3BIUH 2D26C 1GGDC 1AU8A 3QO6A 3A7VA 4RKJB 2ODQA 5DP3A 3MO3A 5T1VA 4WJG2 1CVWH 2J2UA 2W7UA 2BDBA 3PO1B 8GCHG 4Q63A 2WYGA 1SGRE 2BZ6H 2OUAA 1VR1H 1W14U 2O8UA 1TQ0B 1ZHPA 1ZPCA 2VIPA 1C5YB 5JB8S 2ZU5A 3S9CA 1L1GA 2A4RA 3DT0H 4LOYH 1Y5UT 2AH4X 1RTLA 5DGJA 4JZEH 3ZV8A 3RU4D 2B7DH 2WPDD 1RTFB 1SQTA 2TGAA 2B8OH 1V2OT 1ZYOA 2LNCA 4YXWD 1GHAG 3PTBA 4AZ2B 1YCPK 1A5IA 1UTLM 2PSYA 4K3JA 1YPJH 4WH6A 1P9UA 3ZVBA 1EX3A 3RXIA 1S84A 2FLBH 1SOZA 2ANWA 2SNVA 1UTKA 4KKDA 4MNXA 1IQNA 1O2KA 1GBMA 1NBMD 3CP7A 4O03A 4OS4A 2BLOA 1KSNA 5E2PA 1BTZA 5DN6D 1FAXA 4DCDA 2EEKA 4Y0YE 1BZXE 3FP7E 1S6FA 4CBNA 3S9AA 1C2KA 1O2GH 1HCGA 1W13U 1C5RA 1GI7B 3F9HA 1O35A 3U28C 1C1TA 2WV5A 1V2WT 1W0KD 3M5NA 1P2JA 2ZTYA 3FANA 2A5AA 1GCTC 2ODPA 2Z9GA 3VGCC 3GCTF 1GWAA 2ZGHA 3SOSA 1DWEH 5CMXH 1O3MA 3BG4B 2F9UA 2BD9A 3VXEH 2JIZD 3E8LA 1L1NA 1O3EA 3MU8A 5A8ZA 3P8FA 3TLOA 1TNKA 2VH0A 1ZTKA 4BTIB 2BY6X 1ANCA 1Z8GA 2AYWA 2C8XB 1GBKA 4CRAA 1ETSH 2V3OH 1PPZA 3AASA 8ESTE 5A0BA 2UWOA 1ZHMA 4XE4A 1MTNB 1YKTA 1YPEH 3TU7H 3LPRA 1TAWA 3ZZ5A 1LTOA 4FUIA 2G4TA 1GHVH 1WDIA 4INHA 3SI4H 3SU6A 2SGFE 1C1RA 2RDEA 1WUNH 5C5NA 1QFKH 1GL0E 5GJ4B 5B6OA 2B0FA 3M35A 1C5MD 1P09A 2V6NA 1P2NA 2XNDD 1SGNE 1UCYH 1EZUC 2JDID 1AUTC 1LHCH 1O3FA 4ABAA 3ZYDA 1O31A 1O2OA 2VVCA 1O2WA 1P03A 3E0PB 1BTXA 5LPEA 1QB1A 2J5UA 3A83A 4CRFA 4MNWA 1O5GH 1O2QA 2WPMS 1BQYA 1C5SA 2GCHG 1T4VH 2Q6FA 4A1XA 1DUAA 1LO6A 4XRNA 1DX5M 3OSYA 4TT3D 1NN6A 4A7IB 2EI7A 5DP6A 3A7YA 2GVFA 1O3CA 4SGAE 4WMFA 1C1VH 1C5XB 1O2UA 1TPPA 4IMQA 4KTCA 1WCZA 3UOUA 4WMEA 2I6QA 5GNDA 3VFEA 1FY1A 1GDQA 1HAPH 1UTOA 5FPYA 3MFJA 2VWNA 3VXFH 5EG4A 4YLUA 2A4QA 4UFGH 3PO1C 1LMWB 2PGQB 1HAYB 3DUXH 2THFB 1OWHA 1ZMLA 1QR3E 1GBLA 5GDSH 1IQKA 1C1WH 1HFDA 5EQQA 2ZPRA 2ZGBH 4BAKB 4AFUA 4NIXA 9LPRA 2H9HA 2EA3A 1GJ7B 1DS2E 1K21H 1XUFA 3A8BA 4THNH 4DIHH 1NESE 2FP7B 1ZSKA 5CHAC 1V2VT 5G4BA 1LVBA 4X8VH 4B2BA 1ID5H 2A45B 3A7TA 1B0EA 2XBYA 3F2GA 5L30H 1C5WB 1ZOMA 2ZU4A 5JB9S 1VJAU 1P3EA 3D49H 3EGKH 1DLKB 1VITH 1N6YA 4RI0A 3MU1A 1TNJA 1G3EA 2QV1A 2KCPA 1UTQA 3TPIZ 1A4WH 1A3BH 2D2DA 1LVMA 1OWEA 2IJD1 4WVPE 1TIOA 2FI4E 3U69H 1QBOA 3PM3A 3A89A 4TWWA 4K60A 2ZCLP 2O9QA 2C93B 3DFLA 4UDWH 3SJIA 1O2SA 5HXFA 6LPRA 1AUJA 4JYUH 3CNRA 4AG2A 2IPHA 1V2TT 1AIXH 2W6ID 2C8ZB 1BJUA 5EQSA 2QCYA 3RXTA 4ZROA 1C1QA 4U01A 2R2WU 3SQEE 2ZDMA 1C9PA 2NU1E 3OYPA 3KF2A 4FUCA 4ISIH 2WPJS 1LHGH 2UUKB 4Y79A 1E79D 1TX8A 2G55A 3IG6B 4YO9A 4B76A 1C4Y2 2Y5HA 3TJOA 2HRVA 1AB9C 3BG8A 3RMOH 1KLIH 1P02A 3PTNA 1NFWA 5DP4A 2JH0D 1EP6A 3S0NA 1SHHB 2J95A 3QWCH 1O30A 4WXVA 4ISLA 2XRCA 2EI6A 1TOMH 1MTVA 1O32A 3K2UA 7KMEH 3GDSA 2ZFSA 3Q3YA 1E35B 4O9VA 2OC0A 2ZNKH 2QN5T 1HJ8A 4FOUC 3M7TA 3T5FH 6GCHG 3QX5H 1KDQB 1TBZH 3BTDE 1AN1E 1ELGA 3BSQA 2TGTA 2XC5A 1VJ9U 1K1IA 2BDYA 4X6NA 2W26A 1SL3A 2FX4A 3KQ5A 3PV2A 4DG4A 2BX3A 2DE8A 3K6ZA 4K1SA 1CGHA 4DURA 4LXBH 3RXVA 1Y59T 4YT7H 1Z8JB 5A8YA 2BOKA 1FZZA 1HRTH 3JZ2B 3MTYA 4RSPA 4OM9A 1RTKA 4GCHF 1MU8B 3C27B 4BXWA 2ZPQA 3GCHB 1HAVB 3ZV9A 5FXLA 1C1UH 1Z7KA 1PPGE 2UWPA 1CA0B 4CHAC 3OFND 3MWIU 2ZF0H 2OINA 5KECA 3ZZAA 5E2OA 2O8LA 1EAWA 3RXPA 4AFZA 1GDNA 1E1RD 3RXLA 3P8OA 4MQAA 5DG6A 3ZIAD 1K22H 4IC6A 5DKMA 5EXMA 1ZPZA 1E0FD 3O8DA 5T6DA 1CT4E 5EJLA 4XBBA 3BV9B 3PLPA 1EAUA 2ZO3H 1HJAB 1H9HE 4UD9H 2PP6A 1NROH 3ZZ9A 2R3UA 3SZEA 1T8MA 2BHGA 2FOBA 3SV6A 5F8TA 1O2PA 1NFYA 3KN2A 2Z9IA 2AMPA 2HNTE 3PLKA 5CE1A 4ZMAH 1P06A 1DITH 1BRUP 2ZG0H 1O2NA 3BIVH 2J98B 1LCYA 1BJVA 3ATLA 1P05A 5F8ZA 1QJ6B 2KCOA 1TPSA 2C4FH 1NT1A 4MLFB 4NA8A 5FCKA 3GYMA 3ZVDA 5T6FA 2GV7A 1DY9A 1GHWH 2HPPH 1ZZZA 1FIZA 1AZZA 2G5NA 2QXHA 1GBTA 1YPGH 2FOEA 1CHGA 1GMHF 5GPIB 1EJMA 1PJPA 1NTPA 2NU2E 1SHYA 2JJ1D 2YNAA 1IHSH 1MKXH 3NKKA 2BDCA 5AF9H 1VCPA 2QF3A 1J9CH 4NIVA 4B73A 2PKSB 1UO6A 2P94A 3EDXB 1SG8B 2HNTC 4R8TB 1T8LA 1YYY1 2BB4A 4CH8B 1O39A 1Y3WA 5FCRA 1W10U 2RG3A 2FI5E 2ZI2H 1NFXA 1DM4B 1JXPA 3GCOA 3RXKA 4B74A 1BOQA 1THRH 3H7TA 1JMOH 1JWTA 2LPRA 3AVZA 2QXGA 1TA2A 1GGDB 1YLDA 4X2VA 1GVLA 2IN2A 1IQLA 5ETXA 1JOUB 1VCWA 3ENSB 2HNTF 2XCFA 1PQ8A 2V7QD 2XWAA 1V2RT 1UHBA 4F55A 1TMTH 1QIXB 5JPMH 5FPTA 2BDHA 2F9BH 1W3CA 3QZRA 7GCHG 4FUEA 3U98H 4JMYA 1V2ST 3RMNH 3ZVCA 3QTVH 4IMZA 1YY3A 1BTWA 3V13A 1S0QA 5E0HA 1C2EA 3GY4A 1BRCE 1AKSA 4D9QA 2A7JA 1B0FA 3RM2H 4BOHA 3STIA 1FAKH 1BBRH 3UTUH 3QK1A 3MHWU 4Q80A 4MNYA 1GHYH 1O3PB 4TY7A 5A0CA 5EPNA 1MZDA 1BRBE 2VBCA 1K1OA 5EXNA 1AQ7A 1HAXB 3VB6A 1EJNA 1CT0E 4ZKSU 2B9LA 2A2XH 3UOPA 3MNCA 1L0ZA 4JZFH 3SUGA 2J34A 2OBQA 2M5TA 3HGPA 3GCHC 1FXYA 3LGIA 4ZUHA 3P8NA 2A5IA 1FIWA 4O3UA 1C2HA 4SGBE 4AYVB 1H4WA 2ZZUH 1TNLA 3M7QA 5A09A 2PFEA 1LVOA 1EP5A 1TBQH 1D3TB 2WV4A 1UCYK 5IK2D 1O2RA 3FFGA 2FIRH 3BTGE 1GPZA 2QF0A 3FO8D 5EIYA 4GVUA 1WQSA 4DVAU 3OAAD 1F5RA 2GP9B 4O97A 1JBUH 3Q76A 3OY6U 1ZSJA 2VWOA 3SV8A 1W0JD 2W3KA 1RD3B 4ABDA 2GTBA 2FI3E 2KAIB 4X1QU 4D8NA 4Y8ZA 3DA9B 3S7KB 1HXFH 1EATA 3PV5A 2XTTB 4Q7ZA 2TGPZ 3TITA 2BLWA 1CQQA 1D3PB 1P2QA 1HAZB 1YM0A 2OC7A 4X6OA 1F0TA 1EOJA 1SQAA 3FN8A 3SW2B 2HWLB 1TABE 4JK5A 4K1EA 5L2ZH 5HM2A 2PKAB 2A31A 4Y0ZE 1BTHH 1TALA 4KTUA 1GBCA 5T6GA 3Q00A 2WYJA 4YT6H 2BTCE 2HVXA 3SJKA 1TMBH 2EC9H 1D4PB 2GT8A 3RM0H 2GT7A 3BTKE 3GY6A 4ACAA 2OTVA 1HGTH 3V0XA 3E16B 1QRXA 4F48B 1HLTH 3BF6H 1TGCA 1AE8H 3P8GA 5DK1A 2QYIA 5JBCS 4BTTB 2SGEE 8KME2 2F9NA 3RXOA 1IAUA 2JH6D 3ZZDA 4U30A 1PQ7A 3GS9A 4PROA 2ZDAH 1P01A 2GJGA 3ZZCA 1AO5A 3STJA 2F9PA 1NY22 1AI8H 4DT4A 1Y3VA 1FQ3A 1ESAA 2ANMH 3MOCA 4D76A 5JBTA 3S9BA 3SJ8A 1HNEE 3NXPA 3E91A 2A1DB 4J2YB 1G30B 4Y11E 1FY4A 1BCUH 1Z8RA 1QRZA 1DANH 3ELAH 1S6HA 1W8BH 2FOAA 2FX6A 1P2MA 8LPRA 3QTOH 2ZFQH 3U8RH 4ZCNA 1J16A 1ZTLA 2DE9A 2OBOA 2BLQA 5HMAA 1A7SA 1GI5A 2H1UA 4DIIH 4ISNA 4ZHAA 3N7OA 4Q2KA 1GJAB 2QF4A 2J9NA 1EPTB 3VEQB 2J4IA 3MH7A 3MU4A 3RLWH 1RXPA 2WV9A 3UPEA 1A46H 1S81A 2QIQA 1C5VA 5I46H 4GUXA 1FI8A 5CHAB 4XBDA 1MBMA 3TH4H 3TJUA 2GGVB 3W95A 1O3LA 1GI4A 1TB6H 2VGCC 3RXEA 3V3MA 1RRKA 2ZIQH 4DOQA 5C2ZA 1GHBG 2C3SA 1O2JA 3SQHE 2ODYB 3P92A 4I86A 4U32A 2D1JA 1RGQA 1Z6EA 3TJNA 1NRNH 2KX4A 3RMMH 1CGJE 5C1UA 1CSOE 1D6RA 1PPCE 1V2LT 1FNIA 2HALA 1GI2A 1GJBB 1XUIA 2BY9X 5F6MA 4F4OC 1GJ9B 1P9SA 1V2UT 4WH8A 2FO9A 3L6PA 4AFSA 1TFXA 5FX6A 1LPKB 2Z94A 1KXBA 2FOHA 3ATIA 2OQUA 1A5HA 1C2IA 3F3BA 4JZIA 3RLYH 2ASUB 1XVOA 1OPHB 1E38B 3D65E 4TWYA 1O2IA 6ESTA 4Z6AH 5EGMA 1DY8A 1KXAA 2A7HA 1ELAA 1GJDB 1A5GH 1TA6A 2BQWB 4JZ1A 2R9PA 3LKWA 1DWBH 4I32A 2OLGA 1ESTA 2ALPA 1IQIA 1MKWH 4YTAA 3EYDA 3ATKA 1GMCG 1AB9B 4UFEH 3FAOA 4NCYA 2ESTE 3A85A 4MTBA 1YLNA 2BD7A 1QL7A 3O8BA 2P59A 3M5MA 2FMJA 4E06H 4Y10E 4I8JA 1A0JA 3DD2H 3LGTA 4XFQA 3AK5A 5B6LA 1KIGH 2P8OC 3H5CB 1BB0B 3M3VA 7ESTE 1TGSZ 1KXCA 4K1TA 2A7CA 1PFXC 2KFWA 1P2KA 2BQ7B 2ZTXA 1GHAF 3ATMA 4E7RG 1OP2A 1A61H 1TX7A 1UVUH 3D62A 1OYQA 3T29A 4BAOB 3F9FA 1BITA 3A8CA 5F53A 1LQEA 2BVSH 4Y76A 3K9XB 2BZAA 3DCLA 1GJ5H 5H4IB 5K0HA 2K0QA 2FEQH 1F5LA 2PV9B 2BD2A 2EI8A 4X6PA 3UR6A 1UVPA 5HKKD 2R0LA 4CREA 1O37A 1AWHB 2FS8A 3DSGA 2AMQA 1YPMH 3SU3A 1ZR0A 1NRQH 1YPHE 2GV6A 2D8WA 1GBAA 5EW1H 2P3TB 4AGKA 1S82A 4FU8A 1HDTH 2J94A 1SGTA 3M3SA 2A4OA 2FESH 4FXGH 5AFZH 2V3MA 4H42U 5TJXA 3UWJH 4AB9A 3EA9A 1ZTJA 4CHAB 2AFQB 2F3CE 1GVKB 1DDJA 1MU6B 4NFFA 3ZVEA 1VITG 3UR9A 4X6MA 1MMJN 4MDSA 5A0AE 3AAVA 4M9FA 1G3BA 2BYAX 1O3HA 1DLEA 1EPTC 4CR5A 2BY7X 1XKAC 1ESBA 2Z3EA 3GY8A 5TCCA 1V6DA 3EE0B 3MNXA 1Z8IB 2GCTC 4B1TA 1GMDG 1GHZA 2OCVB 1MUEB 3RXBA 1W12U 3LONA 5FAHA 1EXFA 2Z6BD 3U1IB 1PPFE 2ZHWH 1SGIB 4Q7YA 1QGFA 4AC9A 2BY8X 4ZKOU 1RJXB 5BRRE 3TNSA 1XXDA 4CBOA 2WZQA 3F1SB 2ZP0H 3PMAB 4Z1MD 1FY3A 3RU4T 1HAGE 1ELFA 1F7ZA 1XUGA 4NZQA 5K7RA 2GCHF 4WY3A 4JZDH 1V2NT 2BXTH 4FUGA 4XOJA 2VVVA 1F2SE 3BTTE 2SFAA 2WPIS 4FU9A 1FN8A 3TH2H 1WXRA 1O5AB 2DUCA 3A8DA 2FM2A 1C9TA 1TLDA 2M2AA 2PHBA 3HGNA 2PGBB 2KM0A 2ZU1A 4P00A 3MU0A 1KTTB 3PYHA 4FUJA 1KTSB 4AOQA 1SMFE 2BOHB 1TX6A 2P3UB 1NPMA 2XYAA 3FP6E 2RCEA 1SLXB 2SNWA 4AFQA 1SB1H 2A0QB 3SV2H 1OXGA 1HPGA 5IYTA 4DJZB 3KNXA 1TE0A 1OHHD 4DY7B 3LJOA 2WINI 3RXUA 1S83A 1ANBA 1VGCC 2R3YA 1V2QT 4P02A 3SBKA 1SGFA 3SNCA 1MTSA 2FOMB 4KELA 3DSOA 3LU9B
chains in the Genus database with same CATH topology
1G2MA 4X1SU 3LOXA 2PUXB 1N6XA 4WF8A 1MD8A 1GI8B 3I77A 1LHFH 1Y5AT 4INLA 2R2MB 2G81E 1YBWA 5J4QA 1G9IE 3OTJE 1WU1A 1MH0A 2Y6TA 2NU3E 2G51A 3BEUA 4AN7A 1THSH 1P12E 1N8OC 1QNJA 3A8AA 3SGBE 2OQ5A 1IQEA 1HYLA 3CS0A 3RXCA 3NUMA 1ZJDA 3P95A 4WMDA 1G3DA 1QBVH 2VU8E 3MO9A 4MVNA 1HAIH 1T7CA 3UFAA 5JYIA 1GJ8B 2GMTB 1ELBA 2GX4A 1BMMH 4HZHA 1BHXF 3VPKA 4NIYA 2FLRH 2ZFRH 4NSVA 3FZDA 3ZVFA 1Z6JH 3RXFA 3KCGH 1KY9A 2UUYA 2A2QH 1O2YA 1DWDH 1QTFA 1K1LA 4K8YA 3M5OA 1TWXB 4FUHA 4YOGA 3T27A 1ANDA 3SNBA 5J4SA 1ANEA 1XXFA 1MQ6A 3L33A 1AFEH 1C1SA 5AVDA 2CXVA 2W5EA 1UTJA 3QLPH 3KGPA 3ZVGA 4ZHLU 3BTFE 3ODDA 6GCHF 1LKAA 4R0IA 4YOIA 3LGYA 3RXHA 2V35A 4TY6A 1G32B 3SU1A 4OS6A 1B5GH 1HIAB 1GBIA 3GICB 3GY7A 5EU8A 1SGPE 3IWMA 4TPYA 4NFEA 3SU2A 4D9RA 2ZECA 1F0RA 2FTMA 1LHDH 1P11E 4FUDA 1D6WA 4OS7A 4K69A 1TGTA 1C1OA 1NO9H 3QGJA 1QY6A 1EAXA 3KHVA 4MPXA 2Q1JA 3KQDA 1FDPA 1G3CA 4ZHMU 3OX7U 1O0DH 3AW0A 3LGWA 2BDAA 1GBEA 5C1XA 1C4U2 1LVYA 5EODA 1C2GA 1YPLH 3T62A 3MU5A 2SGPE 1SQOA 1AVWA 4ZXYH 1U6QA 1K28D 1BMAA 3F68H 1KXDA 2VIDA 5GCHG 2XBXA 4A6LA 1C1PA 3UIRA 1CA8B 3HKIB 1OS8A 3KQBA 4BAQB 3MMGA 3GISB 3I29A 4CH2B 4E7NA 1W7XH 2QXJA 4ABGA 4GPGA 2ZCKP 4RN6A 1EB1H 1D9IA 4JK6A 1AGJA 1EZSC 2TBSA 3FZZA 1O2HA 4A5TS 4ABEA 1EAIA 5LH8A 2STAE 5A8XA 2ZHQH 1O36A 2PUQH 3ODFA 3U1JB 1YPKH 4UFFH 1BIOA 3KQEA 2FOCA 3ZYEA 1LDTT 1SGDE 4VGCC 1W11U 3RXMA 1DWCH 3NCLA 3PMBB 2C8YB 2TPIZ 3EA8A 3M61U 4FUBA 3D23A 2BLVA 1DXPA 2Y7XA 1O5BB 3P6ZB 1MQ5A 3SI3H 1IQGA 5I25A 4CRBA 1GI6A 4H6TA 5ESBA 2VGCB 4OS2A 2CHAC 1KDQA 3LC5A 4IN1A 1AVXA 1MKWK 2VH6A 3LGUA 4GHTA 4NWKA 3A81A 1GJ6A 2FS9A 3ZZ6A 1C2LA 3RUOA 4ABHA 1XUKA 1LPGB 5C1YA 5JBBS 1IQJA 4Y8XA 3TGIE 1HBTH 3BTHE 1YGCH 3HPTB 1A1RA 1FY8E 2AIPA 1GJCB 1E36B 3SZNA 5DO4H 3RU4E 2Z9KA 1K1NA 1K1PA 3SORA 4D7FA 2FWWA 4X8TH 1O3KA 1O3BA 1TONA 2W7SA 4H6SB 2PR3A 1E34B 2GMTC 1HAVA 3LGVA 1BMLA 1WBGB 1XMNB 3SNEA 2RDLA 1TPOA 2UWLA 4ZAEA 3R3GB 4JYTA 1RIWC 2QA9E 1ORFA 5BPEA 2XCNA 1FPCH 4BNRA 4Y7AA 4Z0KA 2GDDA 4ZKRU 1EASA 1F0UA 1G37A 1HXEH 1SFQB 1WSSH 1L4DA 1P57B 2CMYA 3LH1A 1DOJA 1AE5A 1ZLRA 1ZHRA 2BMGB 1CHOG 5LGOA 1XKBC 5DP7A 1S0RA 3A7ZA 1QB6A 4UFDH 3M7UA 1FN6A 1DFPA 4X2WA 3EA7A 1O2TA 1ELTA 5AHGH 4J1YA 1TNIA 1Y3XA 1IQMA 4CRCA 2P8OB 3AW1A 2BX4A 4I31A 1SFIA 1ZRBA 4YESB 5DP9A 1FJSA 1O34A 1OKXA 2ZFFH 1MTWA 4ABFA 3RDZA 1SGQE 3PROA 1MCTA 1KLTA 2GDEH 1O3OA 3A7WA 1P0SH 2NU4E 1TGNA 3TGKE 4I7YH 2ZDNA 1QQ4A 1DUEA 5T3HA 2ZWLH 3B8JA 2ZPSA 1NZQH 3UNQA 4IW4E 5DJ7A 1FUJA 1C2DA 1A0LA 2JH5D 3HK3B 3S69A 2GZ8A 1TGBA 1ZSLA 1MTUA 3Q3XA 1IQFA 5EPYA 1PPHE 1ZRKA 1Y3YA 4NG9H 2CJIA 2ZEBA 1MCVA 3PWCA 3FP8E 1EKBB 1KYNA 1GG6B 1OWDA 1O2MA 3U9AH 1ZGVA 2H9TH 2XXLA 3VB7A 2BDIA 1THPB 3I78A 1NU7B 5DPAA 5SGAE 3NWUA 3CENA 1PYTC 4IGDA 1H9IE 5DP8A 4B2CA 2ALVA 4UEHH 3U8OH 2FYQA 3A88A 1EZQA 1K1JA 2GCTB 2NWNA 5JDUB 2BD8A 1TRYA 1YC0A 3SN8A 2BXUH 1RFNA 3MYWA 1QB9A 4A92A 4BXSA 1EUFA 2VWLA 3SUEA 3LT3A 2FDAA 3GCTG 4CR9A 4ISHH 3Q77A 3WY8A 1ELEE 1SGYE 3TGJE 1CE5A 3VB5A 1C2JA 2C90B 4MPVA 4OGYA 5FX5A 2BD5A 2NU0E 1O38A 1J14A 4OS1A 2G00A 3K6YA 4X2YA 1P2IA 1NU9A 3GY3A 4A1VA 4RKOB 3UUZA 3VB4A 2O8MA 1S85A 3EQ0H 5PTPA 3ZZBA 2K1QA 1BTYA 2CGAA 4X0WU 1LQDB 1TQ7B 2TRMA 1NRSH 1TNHA 3LDXH 4DW2U 1UJ1A 3SJ9A 5C20A 1UTMA 2HLCA 2TGDA 5TCAA 1C5ZB 3KL6A 1C5OH 2P95A 3KEEA 1M9UA 1V2JT 4ABJA 1MBQA 1IQHA 4X2XA 1Z1JA 1AD8H 4X1NU 3GYLB 2QGRA 8GCHF 2FPZA 1ETRH 5DP5A 1UCYE 2P3FH 3HK6B 1GCDA 4OS5A 1SGEE 1IHTH 2ZDKA 1T8OA 2G8TA 2BD3A 1XVMA 3BTWE 1NFUA 3SHAH 1WV7H 2GZ7A 3G01A 4NA7A 3SUFA 2ZGXH 4NSYA 2KAIA 1ZMJA 1C5NH 2SGAA 4QT8C 5L2YH 1GVZA 1QL8A 1J17T 3U8TH 1QJ1B 1T8NA 2HGTH 1AZ8A 1MAYA 1O2LA 3A84A 1OOKB 4A1TA 1VGCB 1B7XB 1WAYB 1PYTD 1SSXA 1GHBF 5EW2H 2OXSA 3TH3H 4ZH8A 1GL1A 3NZIA 1K2I1 5HM9A 3W94A 1LPZB 2PKAA 2XC4A 3RP2A 1MD7A 2FZZA 3PV4A 2QC2A 2YOLA 4TYDA 4NA9H 2OC8A 5FBIA 2J92A 2PSXA 2HOBA 3SGQE 1TRNA 2ZC9H 2FYRA 3JZ1B 1TOCB 2UUJB 1CU1A 4X8SH 2Z7FE 1BUIA 5EOKA 3PB1E 1P3CA 1Z1IA 1L4ZA 1BHXB 3HKJB 5L6NH 1W7GH 1N8OB 1QL9A 2W3IA 5ABWA 3R0FA 1O2XA 2Y5FA 4F49A 3QUMP 3NPSA 1GG6C 3E0NB 1E37B 1VZQH 4MG3A 4ZXXH 3O8RA 2VVUA 2IOTA 2Q6DA 1TMUH 1AVGH 1GHXH 3ZZ3A 2CF8H 1V2PT 1GBJA 2QAAA 3QN7A 4ESTE 2ZHFH 5E8EH 1P10A 1LHEH 3RXGA 3S7HB 3TNTA 1HJ9A 1O3IA 1GMCF 3TJVA 1VCQA 1HAOH 4KTSA 1MKXK 1ZJKA 1YF4A 4I8HA 4ISOA 3SO3A 2H5CA 2PLXA 5JBAS 1SVPA 5LPRA 2UUFB 1WOFA 1ACBE 1GBDA 1K1MA 3Q3KA 1EPTA 2BD4A 4ABIA 4Y71A 1O5CB 1XUJA 1QA0A 2QXIA 1TPAE 4I8GA 2OD3B 5A2MH 4X8UH 2ZQ2A 1Y5BT 3KIDU 1C2MA 5E0JA 3QGNB 1N1LA 5C67A 3A80A 1YPHC 2IJOB 1OWIA 2PTNA 2BM2A 1DSTA 2Z9JA 3PWBA 3NK8A 1T4UH 1HV7A 4K8BA 2F9OA 5FHTA 2GKVE 1P8VC 2TIOA 3T25A 3V7TA 2ZFTA 4ABBA 1S5SA 1O3NA 2CF9H 1GI3A 1QCPA 3ATWA 1SLVB 2AMDA 2WUCA 1FMGA 4DT7B 3CS7A 3H7OA 2Z3CA 3TIUA 5LPFA 2H9EH 3C1KA 3PMHB 1C1NA 3RC6A 4Y6DA 2Y81A 1AY6H 4E05H 5F03A 1XUHA 1AFQB 2ANKH 3SGAE 3UWIA 1QA7A 2F91A 3GY2A 1NRPH 1UVOA 1SGFG 1JRSA 4GHQA 2AGEX 1WTHD 2ULLA 4AG1A 1BBRK 1QJ7B 4JYVH 2H6MA 3SNDA 1VITF 1ARBA 4IN2A 1NS3A 1OWJA 2G4UA 4X1PU 3T2NA 1DE7H 1TYNA 1HUTH 3SNAA 5GWZA 1O3DA 3BTME 2FTLE 4AGJA 4GCHG 4BAMB 1OX1A 3M36A 3B23B 1O3GA 2XW9A 1GMDF 4K2YA 1UVTH 1IOEA 5GIBA 1YLCA 9ESTA 1G2LA 2HPQH 4FVDA 3M37A 1A3EH 1KLJH 4LK4A 3SU4A 3TK5A 1ZPBA 4GLYA 1C1MA 2Y7ZA 2ZA5A 3BG4C 1O5FH 1V3XA 1BDAA 4VGCB 2Y5GA 1O3JA 1YCPH 4IS5A 4MNVA 1ZGIA 1GBHA 3F9EA 1KXEA 4NWLA 1ABIH 1WTGH 1ZMNA 1DICA 1UHBB 1G36A 2OC1A 1PPBH 2CHAB 1A2CH 1MTNC 4LZ1H 3L3TA 4TPIZ 3V12A 2J38A 1EOLA 1SR5C 3TK6A 4YM9A 3A87A 2VINA 3E90B 1AKSB 3URCA 2BY5X 2RA0A 2RA3A 2CN0H 3BTEE 1KXFA 4I8KA 5F8XA 5FPSA 3IITA 2AERH 2FOGA 3ZZ7A 2BVRH 3BEFB 4GSOA 4KP0A 2ZTZA 5ESTE 1RS0A 1DPOA 4NZLA 2SGQE 1YP9A 1OWKA 1GMHG 3RXRA 1TNGA 6CHAB 1V2KT 1RIWB 3ZZ4A 1H8IH 1SI5H 2FOFA 2FODA 1CT2E 3MO6A 1ARCA 1W2KH 4MPWA 2QY0B 1Z71A 4I8LA 1SLWB 1FLEE 3RC5A 2FXRA 1NRRH 2A5KA 1H1BA 3SV7A 2VWMA 3SUDA 2G5VA 4GAWA 5E0GA 4HI3A 2ANYA 1GI0A 1YCPM 3LJJA 4B2AA 1F0SA 2R0KA 5IDKA 2XNIA 2WPKS 1C4V2 1QRWA 4CRDA 4CRGA 3MNBA 3O8CA 1C5PA 3GY5A 4O3TA 1DXWA 1FPHH 1JIMA 1ELVA 1O33A 2BVXH 5EQRA 4H4FA 1LKBA 2ZCHP 3KQCA 3MH5A 1TRMA 4AB8A 3DFJA 3T26A 1F5KU 1J8AA 1SOTA 3RXSA 1Y3UA 1PQAA 2O8WA 3QDZB 1JIRA 2XWBI 2ZGJA 4B71A 3VB3A 1XM1A 2AIQA 4WXIA 2F83A 1Q2WA 2VNTA 1AFQC 3GDUA 1GDUA 1Q3XA 5C3NA 1FONA 1FV9A 3MI4A 4B75A 2XBWA 1A0HB 4AYYB 1C5TA 2AEIH 1SBWA 2BQ6B 3EAJA 1P2OA 5HGGA 1CBWB 4HTCH 3FVFB 2A4GA 3BTQE 3E3TA 3DHKH 3UQVA 3UQOA 4NGAH 1OP8A 1NC6A 4KGAA 2ZFPH 5HYOA 1BBRE 3OU0A 1D3DB 4BAHB 3URDA 3RMLH 1SC8U 2WUBA 2Y82A 4XDEA 4WWYA 2PW8H 2ZGCA 4I33A 2V0BA 4ZKNU 1O2VA 2JETB 3SU0A 1C5LH 1OYTH 4M7GA 3RXDA 3SHCH 2A32A 4AX9H 1DT2A 3E6PH 2ZQ1A 3SU5A 2STBE 2ZU2A 4LZ4B 1XX9A 1AWFH 1EQ9A 1AHTH 5EXLA 1C5QA 4BANB 1QURH 2XC0A 1H8DH 4HFPB 4ASHA 1W0YH 1C2FA 3B9FH 1SPJA 2O8TA 4OGXA 5FBEA 1O5EH 2I6SA 4YLQH 2ILNA 2AGGX 1L1JA 4Q7XA 1GBFA 2B5TB 2VJ1A 2H2ZA 3OY5U 2Z3DA 1GI1A 3UREA 2ZHEH 4UE7H 1AMHA 2V3HH 1INCA 3GDVA 4XSKU 2VB0A 3GOVB 3MNSA 3SJOA 3P70B 4Y8YA 1UTPA 4K5ZA 1K9OE 1BRAA 3T28A 2H5DA 5GCHF 7LPRA 1O2ZA 2ZHDA 1GJ4H 1SLUB 1UMAH 3ITIA 1QBNA 3F6UH 6CHAC 4U2WA 1CO7E 1HAHH 1DVAH 4FUFA 1SGCA 1Y8TA 4X1RU 3TK9A 1D3QB 2Y80A 1C5UA 1MZAA 2GD4B 3MH4A 1ELCA 1CA0C 3AAUA 2JKHA 3M3TA 4IC5A 1ELDE 4BTUB 1EB2A 1PQ5A 3RXQA 4IBLH 1HB0B 2Q6GA 1T32A 2G52A 1GBBA 1TBRH 1UTNA 2AGIX 3A82A 4FU7A 4HGCA 3ZZ8A 7GCHF 2PWXA 5GXPA 2CV3A 1ABJH 4AORA 2GZ9A 1EZXC 3SV9A 1HJAC 2XBVA 3TVJB 2VIWA 1GCTB 1O5DH 1EJAA 5C5OA 3VGCB 2ZDVH 3LIWA 2P93A 1O3AA 3UY9A 3BN9A 2ZKSA 2Z9LA 1ETTH 4MPUA 1OP0A 3K65B 2BDGA 1HIAA 4YOJA 2C8WB 2WPHS 3RC4A 1MAXA 1UK3A 3F9GA 1V2MT 2OP9A 3A7XA 1GI9B 1WYKA 1PPEE 3M5LA 3PLBA 2VIVA 3HATH 3ZVAA 4DGJA 3UNRA 1BA8B 4UONA 1WQVH 3P17H 3RXAA 1P04A 1CGIE 2VIOA 2F9VA 3PMJA 3MH6A 4JCNA 2PTCE 2ZU3A 1X7AC 1UK2A 3QZQA 4YZUA 2AS9A 1UK4A 1L2EA 1QHRB 3ESTA 1CBWC 4FVBA 1W0ZU 2WPLS 1F92A 1FY5A 2YNBA 3UNSA 4INKA 3RXJA 4Y7BA 3GCNA 1UVSH 4XBCA 2VIQA 1H9LB 5AFYH 2ZDLA 1BTPA 2P16A 3BEIB 2PKSC 3LC3A 1BT7A 4D7GA 1NM6A 3LH3A 1QQUA 1DSUA