4OS1A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk601 (bicyclic 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A01
1QY6A 3OY5U 1AY6H 1LVMA 2Y5HA 5C1XA 2RG3A 1P11E 1O36A 1C1NA 3FAOA 4J2YB 3ZV8A 1BB0B 1S5SA 1NPMA 1P04A 2ZI2H 1LQDB 4GCHF 4TPYA 1P02A 3K65B 1RTLA 2VWLA 2XW9A 4KELA 1EATA 1H8DH 4XFQA 1BOQA 1G3BA 2H9EH 3A80A 4GUXA 1JRSA 2FWWA 5C5NA 5EXNA 1FIWA 1W13U 1UO6A 2C90B 6LPRA 2ANKH 1AVXA 3F6UH 3M36A 5EODA 1AVWA 4YOJA 2BDCA 1P8VC 3SV9A 1XUJA 3SUEA 3EGKH 1C2FA 2CV3A 3IITA 1A46H 1T4UH 3NUMA 3GICB 1VJAU 1MBQA 3M5MA 3Q3KA 2HRVA 4ISHH 3UREA 5HM9A 2HALA 5DP5A 3STIA 2FOBA 5L30H 2A5AA 2BVRH 4NA9H 1GWAA 3ELAH 1U6QA 1YYY1 1S6HA 1NFWA 1ABJH 1HFDA 1SG8B 2FX4A 3MU1A 1TONA 1GJ6A 1THPB 2P3FH 4ASHA 2GX4A 1Z8RA 1GBBA 1BMLA 1O3IA 1C1UH 1G36A 7LPRA 4R0IA 1GI4A 1D4PB 1ANBA 2VWOA 2XTTB 3DT0H 1A5IA 1O2LA 4HFPB 1O32A 1YPGH 1F5LA 2SFAA 3PLPA 4IN1A 4NA7A 1F7ZA 4CH2B 4CRDA 1O2GH 5F03A 1C5QA 3SHCH 4CRFA 7GCHG 4YTAA 1DY9A 3A83A 2FODA 3T2NA 1SVPA 3LC3A 3MH7A 4Q80A 4IGDA 2B0FA 3U9AH 5DP6A 1QA7A 1O2QA 1XUFA 1INCA 3S7KB 5E0JA 1KLJH 2RCEA 3FANA 1YPEH 5AF9H 3LGUA 1CQQA 1VR1H 1BTUA 3A89A 2F91A 2OC1A 2PTNA 2QN5T 2ILNA 1C1WH 1QRXA 3ATKA 4X2YA 3AASA 3E8LA 3GY7A 2GKVE 3E0NB 2AMPA 3QUMP 3BF6H 1UVSH 5DKMA 3W95A 3V3MA 4OS6A 3BG4B 1LVOA 2TGTA 1FIZA 1EXFA 2OTVA 3BEIB 2A7CA 1GBMA 2QIQA 1VCQA 3E6PH 1ZPCA 2AFQB 2GZ9A 3MO3A 4AB8A 3UNRA 1O30A 2FIRH 1EAUA 1LPGB 3KN2A 4B2AA 1P57B 2PKSB 1FJSA 2FOFA 3ODDA 3RXKA 5EOKA 4ABEA 1GCTC 3SJ8A 5L6NH 1BZXE 3MYWA 1GHYH 2P95A 2UUKB 2HGTH 1GBIA 1HAGE 4FXGH 1G30B 1EOLA 4NIYA 3B8JA 2JH5D 3RLYH 3PTBA 1MBMA 3IWMA 2D26C 5GCHF 3A7TA 3BV9B 1UK4A 4CRGA 4F49A 5C3NA 5A0AE 2WUCA 2ZGCA 3MU4A 1J17T 1A7SA 2ZZUH 2G4TA 3NZIA 1XXDA 1C2DA 3MHWU 1HNEE 5E0HA 3BTEE 3ZVCA 5JBBS 3ZZ7A 1EX3A 4CR9A 1WU1A 1P2OA 3A8CA 3VGCB 2TRMA 3OTJE 1V2ST 2R2WU 4D8NA 2XBWA 1Y8TA 5C1YA 2P8OC 3PB1E 2ZFRH 1SFQB 4Q2KA 1O31A 4MPXA 4JZIA 2FZZA 2ZKSA 1MCVA 5C2ZA 1KSNA 3SQHE 1TGNA 1JXPA 1EAXA 1C5UA 2ZPRA 1QTFA 1LVYA 1SLWB 1GVZA 5A0BA 5DG6A 1ARBA 1TMBH 1P3CA 3RXLA 3GY2A 4KGAA 3SOSA 4A6LA 3QX5H 3SGQE 1UVUH 3T29A 5C20A 3G01A 1O5EH 1GHXH 2VJ1A 3TITA 3FP8E 2F9NA 1EZUC 2KAIA 4MTBA 1P9UA 4GVUA 1JRTA 1O37A 1GL1A 1K21H 3TNSA 5JDUB 2SGDE 2CN0H 1K1IA 1YPHC 4JZFH 2WPLS 5PTPA 1QL9A 1OWKA 3RMNH 3D62A 2RDLA 2GV7A 2OD3B 1GHBF 3TGJE 2O8LA 1F0RA 4D7FA 4O9VA 4BAHB 3BN9A 2BM2A 1IQHA 2BXTH 1T31A 4FUGA 3MU5A 3BIVH 2XWAA 1TOMH 1Z1JA 1O2ZA 4Y11E 1EPTC 5EPNA 1HV7A 4MPVA 1DOJA 1OWHA 3LGVA 1LHGH 1O3KA 4ZHLU 1SGDE 3OYPA 2ZWLH 1O2HA 4K5ZA 2FYQA 1HRTH 1W0YH 2OLGA 1BMNH 2WV5A 4Q7XA 3HGNA 2ZDVH 4CR5A 1BT7A 3VB4A 3RM2H 3NK8A 1GBEA 2ODQA 2ZDMA 2ZCLP 1GJ8B 4NSYA 1FAXA 1GBTA 1QRWA 1TAWA 5C1UA 1TRMA 3R3GB 4K1EA 1BHXB 3MNXA 5AVDA 2FEQH 5GJ4B 2QAAA 1P03A 1DWBH 1GMCG 1CGIE 2R3YA 5DP7A 1UTNA 1HAZB 1LKAA 4AGKA 4BAQB 4X6NA 3VFEA 1L4ZA 1O2XA 3SU6A 1EP5A 3RXUA 3OU0A 2BQ6B 1HJ8A 3ZZ9A 5I46H 4A1XA 3F9HA 4BTTB 3R0FA 1QCPA 1G2LA 2UWPA 2ZPQA 3T25A 4YT7H 3VB5A 3SBKA 2H5CA 1DFPA 1BCUH 1EZXC 3F9FA 4BAOB 1S81A 5DK1A 4TWYA 4KTUA 1SHYA 1TALA 3BTHE 1CA8B 3V12A 1CBWB 2GD4B 1L1JA 5E8EH 2QYIA 4MVNA 4HZHA 2WPJS 3HKJB 3QTOH 4OS7A 3BEFB 2ZP0H 1ELFA 1FXYA 2ALPA 4Y0ZE 1CHGA 2HNTE 4A92A 4LK4A 4ZHMU 4NIVA 2ZHQH 1EB1H 1GHZA 1L2EA 1EAWA 1MU6B 2VWNA 1L4DA 1JIMA 1T8LA 1Y3VA 2HPQH 1EOJA 1XMNB 2ZCHP 1LKBA 5EGMA 1EB2A 1GCDA 1RS0A 3A86A 1P2IA 2C4FH 3HATH 4B2BA 3S7HB 4BTUB 1KXFA 4HI3A 1ETTH 3SNEA 1GMDG 2H6MA 1DSTA 2BY5X 3E91A 4NA8A 1A2CH 4UFEH 3ATWA 1K22H 1CGHA 1Y5BT 3V7TA 1ESBA 2VVUA 3T26A 3PM3A 2BY6X 1SSXA 1NT1A 1V2QT 2K1QA 1C5YB 3PYHA 1HIAA 3A8BA 1SQTA 2B8OH 5LH8A 1C2GA 2BDBA 1Z6JH 1THRH 2A32A 1S82A 1TGCA 1GVKB 1V2RT 1XUGA 3A85A 1BTHH 1AE5A 2XC4A 5JB8S 3RC5A 2WYGA 3URDA 3PO1C 3UNQA 1O2KA 1C1VH 1O3JA 3K6ZA 3H5CB 1DUAA 1V2JT 5C67A 2DE8A 3SI3H 2J2UA 1N8OC 2XCFA 4D7GA 1D3TB 3GCTF 4FU9A 4Y79A 1XUHA 1KXBA 2VIWA 2ZECA 2GT8A 2BD4A 2VB0A 1TRNA 2FM2A 4BAMB 1C5TA 1PPGE 4AN7A 4H42U 3TJUA 1T7CA 2LNCA 1IQLA 1UHBA 3RUOA 1KTTB 3DFLA 1BBRH 1C1RA 2A4OA 2H5DA 1E37B 5GCHG 5GIBA 3TH2H 4ZXYH 3QTVH 4CBNA 1RJXB 1ELVA 1JIRA 1J14A 1NY22 3GCHB 2B7DH 4H4FA 2NU4E 3KQEA 2NU3E 4TY6A 4UFGH 5FHTA 3ZYDA 1HGTH 1ZOMA 1SLUB 3Q76A 1KLTA 3Q77A 2FLBH 1CE5A 1ZMLA 3SJOA 3SO3A 1KXAA 4NZQA 5FBIA 1PPZA 2ZFQH 1DSUA 4OGXA 1YCPM 1SB1H 3STJA 1NESE 3Q3YA 4GAWA 3SV2H 3P92A 1FZZA 1GHVH 2QV1A 1MMJN 2ZTXA 3AW0A 3KCGH 4A5TS 1LHEH 1GGDC 1OS8A 2ZHWH 3A81A 3LJOA 2B5TB 2F9UA 2ZA5A 1FPHH 1XVOA 5FCRA 3GY3A 2OUAA 1CVWH 2CMYA 1Y5UT 1W2KH 1O2IA 1HAPH 1V3XA 4GHTA 2D8WA 1G3EA 1GBDA 3D65E 3NWUA 2HPPH 3LOXA 1GBCA 2PWXA 2FI4E 1FMGA 1SI5H 1G3CA 2IJOB 3OSYA 3VPKA 2YNBA 2Y7ZA 4B76A 1TABE 1TLDA 1GG6C 1K1MA 1NFUA 2BY7X 2W3KA 1Q31A 1TYNA 1BTXA 2CHAC 2M5TA 2DUCA 2ZGHA 2A7HA 3QK1A 1K2I1 1O2NA 1PQ7A 1TGTA 1Y3UA 1SR5C 1NO9H 3RP2A 3SN8A 3KF2A 3SNCA 1TIOA 1NS3A 3CP7A 1GHBG 4MNYA 1RIWB 2R3UA 2NWNA 1F5RA 1UVPA 5AHGH 1UCYE 2ZDNA 2G81E 5EXLA 5IYTA 7ESTE 1VJ9U 1AHTH 3PV4A 4SGBE 1YPJH 3FZDA 1CA0B 4JK5A 4FUJA 4TPIZ 1K1LA 2F9VA 1BHXF 1O3EA 1V2VT 5A0CA 3RXPA 1WQSA 1C2HA 1BRAA 1ELEE 4X0WU 1ESTA 1A0JA 1HXFH 1H9LB 2ANMH 4AFSA 1HJAC 4FU8A 2FS9A 3SGAE 2P3UB 1GHWH 3TH4H 4ABIA 3RXJA 1PQ5A 3DHKH 1B0EA 1C5SA 1IQEA 3BG8A 4BNRA 2CJIA 1ZPBA 3SV7A 3P8GA 1AWHB 1P2JA 1FY5A 1XX9A 1A61H 3LH1A 3C1KA 1VITH 2PHBA 5DP3A 1O3MA 4OGYA 8LPRA 3ZZ4A 3UTUH 1V2MT 1GI0A 3P17H 4BXSA 3PMAB 1TX8A 7KMEH 1FY8E 1YCPK 1LHFH 4NZLA 1C4U2 1V2UT 1LPZB 1KTSB 1WBGB 1GMCF 2BDGA 1BMMH 2G4UA 2BQ7B 4XBCA 1AMHA 3TJNA 2NU1E 3TJOA 4CHAC 1SHHB 2BX3A 1V2KT 1C2MA 4JCNA 3JZ1B 3L6PA 6GCHF 2XBXA 2SGQE 1ANEA 2RA3A 1D3PB 1SPJA 3TK9A 1HDTH 1SLXB 4NCYA 4ESTE 1ZJKA 1C1OA 2FI5E 4I33A 1P0SH 2A7JA 2IN2A 4TYDA 1DXPA 3B23B 2XBVA 1ELTA 1GJ9B 1LVBA 4O3UA 1FLEE 1H4WA 3GDUA 3KIDU 3SV6A 2AYWA 3SNAA 4LXBH 4NG9H 3M7QA 2J94A 2BLVA 1RFNA 2WPKS 2C3SA 1SGQE 2Z3DA 1F5KU 2FI3E 4D9RA 1MTVA 2AEIH 2PLXA 3FP6E 1YF4A 3ZZ5A 2SNWA 2SGEE 2V35A 1SGPE 4B2CA 4TY7A 3L33A 4AOQA 2ZU1A 2PKAB 3H7TA 1O3BA 1MAYA 1FNIA 4NGAH 3UIRA 2VH6A 2ANYA 2XRCA 5F6MA 1D6WA 1TFXA 1TMUH 4AG2A 2G5NA 1ZLRA 1GMDF 1UTQA 1SGRE 5EPYA 1LDTT 2Z3EA 1LTOA 2BTCE 2GP9B 4CREA 1HAVB 2WPHS 1OXGA 1GCTB 1SBWA 3D23A 1C5VA 2Q1JA 2VIOA 4I32A 1N6XA 1QB6A 2VU8E 1C1PA 5HGGA 4TWWA 3V13A 1ID5H 1QJ1B 2Z94A 4D76A 1SLVB 2FMJA 1S85A 1TPSA 4X1NU 5SGAE 1YPKH 1Z7KA 3U8OH 2BHGA 3AVZA 4U01A 2ZGBH 5DPAA 2BD7A 4E7RG 1T8MA 1FY4A 2QA9E 2BZAA 1LMWB 2Z9GA 2Z7FE 3MWIU 3P8NA 4RSPA 4XDEA 1GI2A 1TX7A 3FP7E 3GCTG 2G55A 4I8KA 2QXJA 1TX6A 5EQRA 4AGJA 1DY8A 3EDXB 2ZF0H 1JOUB 4B1TA 2G52A 1FAKH 1C2LA 1S6FA 3LH3A 1ZSLA 6CHAC 3LJJA 1OYTH 5ESTE 2P8OB 2C93B 1QBNA 2ODYB 3EA9A 4IMQA 4I8JA 5C5OA 1WUNH 3ZYEA 1ELGA 4E7NA 1CU1A 4ZKRU 4ZUHA 5E2PA 1P3EA 4O03A 1GBFA 1IQGA 1Q3XA 2I6QA 2QF0A 1MUEB 1GBHA 1EUFA 2BDIA 3RMLH 2OQ5A 4X2VA 3EE0B 3SZNA 5T6GA 1V2OT 2SGAA 2QCYA 1VITF 4PROA 4X8TH 4DY7B 3A84A 1NU7B 2CXVA 2G5VA 1TWXB 4X8VH 3SU0A 1MD8A 2BLOA 1Z8GA 1GJDB 2TBSA 4KP0A 4NFFA 4BANB 2Z3CA 1JBUH 2XWBI 3B9FH 5HXFA 3ITIA 1HAHH 3GDVA 4AYYB 1GBLA 1EQ9A 1HJ9A 2W5EA 1SGIB 1MTSA 1O2JA 2GVFA 3GY4A 4UFDH 4Z0KA 2BD8A 2EI8A 3PMBB 2A4QA 4IBLH 3FVFB 4ZROA 4U32A 4ABBA 1ELAA 3A87A 1J16A 1C2KA 3Q3XA 1B5GH 4X1PU 2BXUH 1QR3E 1V2PT 1EPTB 3EA8A 4M7GA 4DIHH 2A0QB 3VEQB 1GDNA 1T8NA 1V2WT 1GHAG 3AW1A 4WXVA 4AFUA 2R0LA 1GL0E 3TK6A 3LT3A 1MKWK 3O8BA 2WPMS 3RXRA 3UNSA 1MKXK 1DITH 4WWYA 3RC6A 4WXIA 1TOCB 3QZRA 3QLPH 2Q6DA 3M5OA 1SGTA 2C8WB 3GY8A 4DVAU 1BTPA 2W7UA 1FI8A 3MU0A 4LOYH 2VWMA 1G3DA 2QF3A 1LO6A 1SOZA 4JK6A 4ABAA 4AORA 1QNJA 1ZGIA 4Y10E 1AB9C 3WY8A 1X7AC 4E05H 2Q6FA 1TGBA 3URCA 4BXWA 1WSSH 1VCPA 3KNXA 2OBQA 5A2MH 3LGWA 1O5FH 1HYLA 1DWDH 2ZPSA 1ACBE 2BD2A 2GZ8A 2ZFSA 2QXHA 3ZZAA 3U98H 1XXFA 1OX1A 2Y5GA 1BJVA 4OS4A 3RXOA 1W11U 1AZ8A 4D9QA 1SGEE 5FX5A 3TH3H 4NFEA 3M61U 3CS0A 2Y6TA 5JBTA 1UTKA 2DE9A 1EKBB 1PYTC 1NU9A 3MMGA 2CF8H 3I29A 2RA0A 1D6RA 3S9BA 1C9TA 3ZVBA 1KDQB 1JMOH 3ZVGA 2XYAA 2PR3A 4ABDA 1XKBC 1O3LA 2FXRA 5F8XA 1KIGH 5ABWA 3UUZA 1FPCH 5FPSA 4YM9A 1DLKB 1K1PA 1O3FA 2O8TA 1MAXA 1TBQH 2FESH 2ZDKA 3FZZA 3N7OA 1A5HA 2A1DB 1SGYE 3O8DA 1FV9A 1YKTA 1T32A 1QHRB 6GCHG 1QB9A 3UR9A 1CT2E 2WPIS 4MNVA 1PFXC 1OPHB 2OC7A 1EJMA 2EA3A 1MZDA 2BY9X 4K3JA 4R8TB 2AGIX 1BBRE 2BVXH 2VIPA 2Y7XA 1TQ7B 1E38B 3QZQA 4GPGA 1KXCA 1GBJA 1UK3A 2Y80A 2F9OA 1GDUA 2BLQA 1NROH 1KXEA 2BDYA 2BOHB 3LKWA 1HXEH 3SJIA 3KHVA 1TPPA 1BTWA 1XVMA 1AE8H 1SQAA 4UDWH 3GDSA 3K6YA 1MTNC 1DUEA 2P59A 1P10A 1BRCE 3QN7A 3PO1B 3OY6U 4ZXXH 2YOLA 1BDAA 1H1BA 1K1JA 1C2EA 2XXLA 1O3DA 3RM0H 1AGJA 3VB3A 1AKSB 1N8OB 4LZ4B 1KY9A 2J92A 3SU5A 3M5NA 4INLA 1O5BB 4QT8C 3BIUH 2HOBA 2GCTC 2R2MB 2V6NA 2ZHDA 2ZU2A 2CGAA 4IC6A 2AH4X 4WF8A 2IOTA 1C9PA 4XSKU 3MO6A 1OWDA 5JPMH 4GSOA 5TCAA 3ATMA 2OC0A 1YPMH 2OBOA 3H7OA 3SUFA 4DIIH 3KQCA 1SGNE 3UOPA 3LC5A 2VGCB 1C2JA 1DDJA 1TGSZ 2AGEX 5A8YA 4WH8A 3M37A 4Q7YA 1ZMJA 1AFQB 2Y82A 1BITA 1UVOA 9LPRA 8KME2 2GCHF 1IQNA 4DURA 1PPEE 1BMAA 2OQUA 2FOMB 1K28D 1W7GH 1TQ0B 2TGAA 4O97A 3GOVB 1UTLM 1GI8B 3MOCA 4U2WA 1WAYB 3LU9B 2HVXA 2ZEBA 3SI4H 3SV8A 1QQUA 2B9LA 1P2QA 3ZZ8A 1LQEA 1T8OA 5T3HA 1ZRKA 3KQDA 3ZVFA 1IQKA 3RMOH 3RXSA 2PUXB 2P3TB 1E34B 1GGDB 1ORFA 1AI8H 3BTDE 1P12E 4JYUH 4MG3A 5FX6A 3RMMH 1GMHF 2V0BA 3SJKA 1QJ7B 3M35A 1DLEA 1NN6A 5CMXH 1O2PA 3TIUA 1F92A 1EAIA 1VITG 2JETC 4A1VA 1MQ6A 2VIDA 3I78A 3UOUA 3TPIZ 4K69A 3BEUA 4NWLA 3BSQA 1C5MD 5CHAC 2I6SA 2ALVA 3U8RH 2TGDA 1WTHD 3S0NA 2HNTC 1GG6B 1UCYK 1AD8H 2CHAB 4ZAEA 1TA2A 1HAYB 3HK3B 1AIXH 4IS5A 1D3QB 3LONA 3MNCA 1DICA 1SGFG 3SGBE 4VGCC 1AFEH 1DM4B 1O3GA 1YBWA 4DJZB 1QIXB 1TPAE 1DWCH 2PGQB 3A7ZA 1GPZA 4FUEA 4KTCA 2AIPA 5EW1H 4I8HA 2Z6BD 8ESTE 1WQVH 1LHDH 3HGPA 1Y3YA 1UTOA 2ZU4A 5AFZH 1HCGA 1C4Y2 1WV7H 1C1MA 1TNGA 1NRNH 4H6TA 1HJAB 1LPKB 4X1QU 3ATLA 1GJBB 1O3OA 1ZHPA 4K1TA 2BB4A 1V6DA 3T62A 1GHAF 5T6DA 1B7XB 3AAUA 3ZZ3A 1PPBH 1QL7A 1C4V2 1O39A 1YPLH 1GI3A 4I8LA 1ZYOA 2FO9A 1GJ7B 1ANDA 1NFYA 2ZGJA 2ZU5A 3V0XA 5A8ZA 2BDAA 2FDAA 6ESTA 1O3NA 1HAVA 1QQ4A 3SW2B 2V3OH 1EASA 2GMTC 1XUKA 2W26A 3RXDA 3RLWH 4Q7ZA 3RU4D 3SU1A 2UWOA 3GYLB 1O2TA 1QRZA 1SMFE 1F2SE 5TJXA 4GLYA 1S0RA 3UQVA 1BRUP 4RN6A 3HKIB 1QBVH 4U30A 1A3BH 4CHAB 4DT7B 1Z8JB 4X1RU 4AFZA 1TBZH 1V2TT 2STAE 5FBEA 2XNIA 1HBTH 4I7YH 2BD3A 1RTFB 3MO9A 1F0SA 2G51A 1XM1A 4YT6H 4H6SB 1HIAB 3U1IB 1EZQA 1TA6A 1CHOF 1GI6A 1Z8IB 4MDSA 1C5LH 2G8TA 1CT4E 1BA8B 1W10U 2JH6D 4ABHA 1YGCH 2EI7A 3QDZB 2TIOA 1ANCA 3UQOA 1D3DB 3ZV9A 3M3TA 4YLUA 3VB6A 1VGCC 3QGNB 3A82A 1V2LT 4Y71A 3RXHA 4ZKOU 4YLQH 3UR6A 3TK5A 1BJUA 2ANWA 3SNDA 4AX9H 1O2VA 2ZQ1A 1BTYA 4X6MA 1IHSH 3MH5A 4X2XA 1UTJA 2QXGA 1OP0A 4MLFB 1TNKA 1O33A 2J95A 2OCVB 1GI7B 1UVTH 1G37A 2BMGB 3MFJA 1O3HA 1WCZA 4NIWA 4XOJA 2BVSH 1N6YA 1YLCA 1GJ4H 4ISIH 1SQOA 4MPUA 3PWCA 2Z9JA 1CT0E 4AG1A 3A7XA 5IDKA 1JWTA 5I25A 1GBKA 2JKHA 1EPTA 3KQBA 3ZZCA 4INHA 3D49H 5BPEA 1IQFA 3ZZ6A 1A4WH 5CE1A 4WH6A 2BQWB 5J4QA 5EG4A 3UWJH 2WUBA 2FLRH 2FOHA 1AN1E 3MH6A 1H9IE 2ZTZA 3ODFA 1DPOA 4WMDA 5FPTA 4K8YA 1O2YA 3LIWA 2GDDA 1ZTLA 4CH8B 5A8XA 5DP9A 3O8RA 2QXIA 2HNTF 1QURH 1J15A 6CHAB 3MU8A 1ZZZA 1IQJA 2J9NA 1C5ZB 2O8WA 4WMFA 2ESTE 4X8SH 4K60A 5LPEA 4HTCH 2THFB 1L1GA 4B73A 1UTMA 3DA9B 2ZQ2A 4Y76A 1GI5A 1K1OA 2ZDLA 1UCYH 5JBAS 2VNTA 2ZHFH 4IN2A 1C5NH 3ESTA 3ZZBA 1C1QA 1ZMNA 3EA7A 3IG6B 2GCHG 1ZRBA 1QJ6B 1NRPH 3UWIA 4J1YA 1Z1IA 5E0GA 4KKDA 5FXLA 1DANH 4Y7BA 5G4BA 4DGJA 1YP9A 3E3TA 2R0KA 1WOFA 4YZUA 1LCYA 1SGCA 2ZTYA 4UD9H 2SGFE 5DJ7A 4X8UH 2F9BH 5LGOA 3NPSA 4FUIA 4RKOB 2J4IA 1O35A 2P93A 2FPZA 1FONA 2PUQH 1MCTA 4DCDA 3GY5A 3LDXH 4MNXA 2FTMA 4FUCA 8GCHF 2WINI 1H8IH 4X6PA 5FAHA 1AVGH 1GMHG 3KGPA 1TBRH 1W14U 3GISB 1A1RA 5JYIA 1HLTH 4THNH 1KDQA 4ZMAH 2FS8A 2PGBB 3HK6B 3QWCH 1O2SA 1O5AB 5J4SA 1IOEA 1DXWA 1MTWA 3BTTE 1AUJA 1WTGH 1EZSC 4K8BA 4AYVB 2Q6GA 2Z9IA 2PW8H 1TNJA 2GGVB 4A7IB 4CRCA 1YPHE 2STBE 4K1SA 3E16B 2ZG0H 1TB6H 4YOGA 3SUGA 2ULLA 2FP7B 2BYAX 3QGJA 1B0FA 3ZZDA 2AS9A 1LHCH 1CO7E 5DGJA 1YC0A 2EC9H 1W3CA 1V2NT 4NSVA 1P01A 1DS2E 3GY6A 2Y5FA 4JZ1A 3O8CA 2EI6A 4JMYA 1EJNA 1T4VH 1EJAA 1RTKA 2XCNA 4JZEH 1NTPA 3UPEA 1VCWA 1OKXA 1L1NA 1UK2A 3P70B 4X2WA 3RXMA 3F9EA 3DUXH 3RXEA 9ESTA 5K0HA 1AB9B 1C1TA 5DP8A 3SU2A 1BIOA 1SL3A 5DP4A 2Y81A 2F3CE 2GDEH 4FUFA 3ZVEA 1ARCA 2ZU3A 1OP2A 2WYJA 3A7WA 1E35B 3MTYA 4UONA 2HLCA 4Y0YE 4MQAA 4DOQA 3RXFA 2GT7A 3BG4C 3M7TA 2C8XB 2AIQA 3K9XB 1O5CB 3RU4E 2BZ6H 3UY9A 1AU8A 1AKSA 4ZHAA 5H4IB 2ODPA 1W8BH 2A4RA 1Y59T 2Z9KA 1DVAH 2A5IA 2ZCKP 3TU7H 3PMJA 1BUIA 2PKSC 1ZHRA 1AZZA 2A4GA 2FTLE 4DG4A 4DW2U 2H2ZA 2O9QA 5FCKA 3AAVA 4ZKNU 1PPHE 3RDZA 1YCPH 4OS1A 2OC8A 2D1JA 2BY8X 4SGAE 3PTNA 3C27B 1TRYA 1GJCB 2AERH 3SU4A 1K1NA 1DWEH 3FFGA 2J34A 1NZQH 3TGKE 3U1JB 3TLOA 1P2MA 3NXPA 5EW2H 1BBRK 2O8UA 3ENSB 2YNAA 5K7RA 4B71A 1C5WB 3A7VA 4CRAA 1NRQH 3RXAA 3GCOA 3TGIE 1NRSH 1WYKA 2EEKA 5ESBA 4YO9A 1GI9B 3P6ZB 3W94A 1OOKB 3VGCC 1CGJE 1ESAA 1FN6A 3M3VA 4IW4E 2BD9A 4BOHA 2BDHA 1BQYA 4FVDA 3U8TH 2BD5A 1CHOG 1RXPA 3A7YA 2PTCE 5E2OA 2A2XH 1S0QA 2ZFFH 2ZC9H 2G00A 3PMHB 2R9PA 5GDSH 1J9CH 1O5DH 5T6FA 4XBDA 1G2MA 4Y6DA 2OP9A 3BTWE 1RRKA 5EQQA 3F68H 1FY1A 1MQ5A 1MTNB 1P9SA 3A8AA 2GTBA 1IAUA 3PLBA 3L3TA 5L2ZH 1QL8A 1BTZA 1PQ8A 5FPYA 1VZQH 2VIQA 2VINA 3RXBA 2ZIQH 2GV6A 3S9AA 1AQ7A 2FOAA 3TJVA 5GWZA 2HWLB 1S83A 2QC2A 2NU0E 2GCTB 2IPHA 2TGPZ 1J8AA 1ELBA 1K9OE 1CSOE 2ZDAH 1SFIA 2UUFB 3E1XB 4CBOA 3P8FA 1KXDA 5EXMA 3T5FH 1O2MA 5TCCA 3NKKA 4MNWA 1E0FD 3E90B 3DFJA 3T27A 2AMQA 4GCHG 1P05A 1DX5M 1L0ZA 1S84A 3I77A 3BTME 4FUBA 1ZR0A 3RXCA 1OSSA 2LPRA 1O2WA 1OWIA 1OYQA 3S69A 2XBYA 1HB0B 1P09A 1D9IA 4ABFA 1C1SA 4X6OA 1HAIH 1QFKH 2ZGXH 4ABGA 1QBOA 4WJG2 1FN8A 1GBAA 1SGFA 4ISLA 3A8DA 1O2OA 1H9HE 1GJAB 1PPFE 4JYVH 1NC6A 3SORA 3BTKE 1TNIA 3U69H 3ZVAA 4AFQA 2OXSA 4I8GA 1ETSH 4UE7H 4I31A 1O3PB 5EQSA 1Q2WA 3E0PB 1O3AA 3LGIA 4MPWA 1C5RA 1ABIH 2H1UA 2FOEA 4Y7AA 1Y3XA 2ZO3H 2TPIZ 1SOTA 1C5PA 2XC5A 4Y8XA 4BTIB 2Z9LA 3S9CA 1NRRH 1C2IA 2JETB 4NIXA 1C5OH 1RD3B 3GCNA 3SUDA 2BLWA 2VVCA 2FX6A 5ETXA 1GDQA 5GXPA 3EYDA 5CHAB 2SGPE 1UMAH 2J38A 1BRBE 2PSYA 3GYMA 4AB9A 2W7SA 2FOGA 1Z6EA 1PPCE 2PSXA 3ZVDA 3VB7A 4HGCA 1IQMA 2KAIB 4JYTA 3P8OA 4ZH8A 1G32B 3K2UA 2C8ZB 4OS2A 1CBWC 4OS5A 3F9GA 7GCHF 3RC4A 8GCHG 1M9UA 1ZTJA 4VGCB 2C8YB 5JBCS 3KEEA 1FDPA 4ISOA 2P16A 1DE7H 3OX7U 1P06A 1QGFA 4FU7A 2UWLA 2VH0A 4IMZA 1PJPA 4LZ1H 1O3CA 2UUJB 3PLKA 2CF9H 2W3IA 1MD7A 3NCLA 1GJ5H 1MKWH 1NM6A 1OWJA 3F1SB 3Q00A 2GZ7A 2ZNKH 1W12U 3BTQE 4E06H 1MKXH 5F8TA 1TPOA 2A2QH 2P94A 3LGYA 1NFXA 1F0TA 4WY3A 2A31A 1OWEA 4ZKSU 2PV9B 4X1SU 2O8MA 4KTSA 4UFFH 3M7UA 4YESB 5HMAA 2BX4A 1W7XH 2JH0D 3KL6A 2ZFPH 1ZPZA 3MNSA 5DO4H 2V3HH 1AWFH 1E36B 1ETRH 1C5XB 5F8ZA 3RXTA 2VGCC 1MH0A 2GMTB 3RXQA 3HPTB 5HYOA 1A5GH 1ZJDA 1F0UA 2H9HA 3LPRA 1AFQC 1MU8B 4FUDA 3RXVA 1Y5AT 1O2RA 4Y8ZA 3LGTA 3SQEE 2OINA 4NWKA 5A09A 2PFEA 2FOCA 5LPFA 2QY0B 4O3TA 1A0HB 3CENA 4Y8YA 1O34A 1MZAA 1RGQA 3ATIA 2PKAA 4B74A 1EP6A 1GI1A 4RKJB 1TNLA 4WMEA 3RXIA 2QGRA 5GPIB 2VIVA 1ZSKA 3T28A 1N1LA 1KLIH 4XE4A 2A5KA 1O38A 5B6OA 3SJ9A 4JZDH 1O0DH 5LPRA 2D2DA 3A88A 1SC8U 4ISNA 3RU4T 3M3SA 4XBBA 4K2YA 3VXEH 1ELCA 3M5LA 3VXFH 5L2YH 4ABJA 2UUYA 1THSH 2FYRA 2BOKA 3DD2H 1YLDA 1PYTD 2AMDA 4CRBA 1VGCB 2F83A 1FY3A 3MH4A 1UJ1A 3RXGA 3GCHC 1FQ3A 1P2NA 3CS7A 1FUJA 1O2UA 1HPGA 1HUTH 2F9PA 2VVVA 3EQ0H 3JZ2B 3BTFE 1TNHA 1XKAC 4BAKB 4WVPE 1ZGVA 1QB1A 3MI4A 1TMTH 1Y3WA 5HM2A 3P95A 3PWBA 4GHQA 2ZFTA 4YOIA 5BRRE 1PQAA 3SU3A 1MTUA 5JB9S 5AFYH 1HAOH 1OP8A 3TNTA 4IC5A 4INKA 2ASUB 3BTGE 4UEHH 4A1TA 2WV4A 4FVBA 2ZHEH 1A0LA 4B75A 2SNVA 1YM0A 1O5GH 1UTPA 4AZ2B 3SHAH 1Z71A 1ELDE 1QA0A 3QO6A 1W0ZU 3MNBA 2AGGX 1ZSJA 3UFAA 5EU8A 1AUTC 2XC0A 1TE0A 1AO5A 2A45B 1A3EH 1DT2A 1GVLA 3TVJB 1P2KA 1RIWC 1ZHMA 3EAJA 4Z6AH 2H9TH 4FUHA 1IQIA 2NU2E 1HAXB 3SNBA 1KYNA 1UHBB 1IHTH 3PROA 1ZTKA 4F4OC 1G9IE 1XUIA 1CA0C
chains in the Genus database with same CATH superfamily
1QY6A 3OY5U 3OEED 1AY6H 1LVMA 2Y5HA 1QZ8A 1W0KD 5C1XA 2RG3A 1P11E 1O36A 4TT3D 3WWFA 1C1NA 3FAOA 4J2YB 3ZV8A 1BB0B 1S5SA 1NPMA 1P04A 2ZI2H 1LQDB 4GCHF 4TPYA 1P02A 3K65B 1RTLA 2VWLA 2XW9A 4KELA 1EATA 1H8DH 2QF4A 4XFQA 1BOQA 1G3BA 2H9EH 3A80A 4GUXA 1JRSA 2FWWA 5C5NA 5EXNA 1FIWA 1W13U 5CDFE 1UO6A 2C90B 6LPRA 2ANKH 1AVXA 3F6UH 3M36A 5EODA 1AVWA 4YOJA 2BDCA 1P8VC 3SV9A 1XUJA 3SUEA 3EGKH 1C2FA 2CV3A 3IITA 1A46H 1T4UH 3NUMA 3GICB 1VJAU 1MBQA 3M5MA 3Q3KA 2HRVA 4ISHH 3UREA 5HM9A 2HALA 5DP5A 3STIA 2FOBA 5L30H 2A5AA 2BVRH 4NA9H 1GWAA 2HLDD 1U6QA 3ELAH 3SZEA 1YYY1 1S6HA 1NFWA 1ABJH 1HFDA 1SG8B 2FX4A 3MU1A 1TONA 1GJ6A 1THPB 2P3FH 4ASHA 2GX4A 1Z8RA 1GBBA 1BMLA 1O3IA 1C1UH 1G36A 7LPRA 4R0IA 1GI4A 1D4PB 1ANBA 2VWOA 2XTTB 3DT0H 1A5IA 1O2LA 4HFPB 1O32A 1YPGH 1F5LA 2SFAA 3FOAA 3PLPA 4IN1A 4NA7A 1F7ZA 4CH2B 4CRDA 1O2GH 2RDEA 5F03A 1C5QA 3SHCH 4CRFA 7GCHG 4YTAA 1DY9A 3A83A 2FODA 5HIYA 3T2NA 1SVPA 3LC3A 3MH7A 4Q80A 4IGDA 2B0FA 3U9AH 5DP6A 3DSOA 1QA7A 1O2QA 1XUFA 1INCA 3S7KB 5E0JA 1KLJH 2RCEA 3FANA 1YPEH 5AF9H 3LGUA 1CQQA 1VR1H 1BTUA 3A89A 2F91A 2OC1A 2PTNA 1UW7A 2ILNA 2QN5T 1C1WH 1QRXA 3ATKA 4X2YA 3AASA 3E8LA 3GY7A 2GKVE 3E0NB 2AMPA 3QUMP 3BF6H 1UVSH 5DKMA 3AK5A 3W95A 3UAIC 3V3MA 4OS6A 3BG4B 1LVOA 2TGTA 1FIZA 1EXFA 2OTVA 3BEIB 2A7CA 1GBMA 2QIQA 1VCQA 3E6PH 1ZPCA 2AFQB 2GZ9A 3MO3A 4AB8A 3UNRA 1O30A 2FIRH 1EAUA 1LPGB 2EY4C 3KN2A 4B2AA 1P57B 2PKSB 1FJSA 2FOFA 3ODDA 3RXKA 3DSPA 5EOKA 4ABEA 1GCTC 3SJ8A 5L6NH 1BZXE 3MYWA 1GHYH 2P95A 2UUKB 2HGTH 1GBIA 1HAGE 4FXGH 1G30B 1EOLA 4NIYA 4B6EA 2WV9A 3B8JA 2JH5D 3RLYH 3PTBA 1MBMA 3IWMA 2D26C 5GCHF 3A7TA 3BV9B 1UK4A 4CRGA 4F49A 5C3NA 5A0AE 2WUCA 2ZGCA 3MU4A 1J17T 1A7SA 2ZZUH 2G4TA 3NZIA 1XXDA 1C2DA 3MHWU 1HNEE 5E0HA 3BTEE 3ZVCA 5JBBS 3ZZ7A 1EX3A 4CR9A 1WU1A 1P2OA 3A8CA 3VGCB 2TRMA 3OTJE 1V2ST 2R2WU 4D8NA 2XBWA 1Y8TA 5C1YA 2P8OC 3PB1E 2ZFRH 1SFQB 4Q2KA 5KEDA 1O31A 4MPXA 4JZIA 2FZZA 2ZKSA 1MCVA 5C2ZA 1KSNA 3SQHE 1TGNA 3WW7A 1JXPA 1EAXA 1C5UA 2ZPRA 1QTFA 1LVYA 1SLWB 1GVZA 2GJGA 5A0BA 5DG6A 1ARBA 1TMBH 1P3CA 3RXLA 3GY2A 4KGAA 3SOSA 4A6LA 3QX5H 3SGQE 1UVUH 3T29A 5C20A 3G01A 1O5EH 1GHXH 2VJ1A 4RT0A 3TITA 3FP8E 2F9NA 1EZUC 1H8ED 2KAIA 4MTBA 1P9UA 4GVUA 1JRTA 1O37A 1GL1A 1K21H 2CK3D 3TNSA 5JDUB 2SGDE 2CN0H 1K1IA 1YPHC 4JZFH 2WPLS 5PTPA 1QL9A 1OWKA 3RMNH 3D62A 2RDLA 2GV7A 2OD3B 1GHBF 3TGJE 2O8LA 1F0RA 2YMSC 3N99A 4D7FA 4O9VA 4BAHB 3BN9A 2BM2A 1IQHA 2BXTH 1T31A 4FUGA 3MU5A 3BIVH 2XWAA 1TOMH 1Z1JA 1O2ZA 4Y11E 1EPTC 5EPNA 1HV7A 4MPVA 1DOJA 1OWHA 3LGVA 1LHGH 1O3KA 1S6LA 4ZHLU 1SGDE 3OYPA 2ZWLH 1O2HA 4P02A 4K5ZA 2FYQA 1HRTH 1W0YH 2OLGA 1BMNH 2WV5A 4Q7XA 3HGNA 2ZDVH 4CR5A 1BT7A 3VB4A 3RM2H 3NK8A 1GBEA 2ODQA 2ZDMA 2ZCLP 1GJ8B 4NSYA 1FAXA 1GBTA 1QRWA 1TAWA 5KECA 5C1UA 1TRMA 3R3GB 4K1EA 1BHXB 3MNXA 5AVDA 2FEQH 5GJ4B 2QAAA 1P03A 2W6ID 1DWBH 1GMCG 1CGIE 2R3YA 5DP7A 1UTNA 1HAZB 1LKAA 4AGKA 4BAQB 4X6NA 3VFEA 3F2FA 1L4ZA 1O2XA 3SU6A 1EP5A 3RXUA 3OU0A 1NBMD 2BQ6B 1HJ8A 3ZZ9A 5I46H 4A1XA 3F9HA 4BTTB 3R0FA 1QCPA 1G2LA 2UWPA 2ZPQA 3T25A 4YT7H 3VB5A 3SBKA 2H5CA 1DFPA 1BCUH 4XRNA 1EZXC 3F9FA 4BAOB 1S81A 5DK1A 4TWYA 2HVYB 4KTUA 1SHYA 1TALA 3BTHE 3DCLA 1CA8B 3V12A 1CBWB 2GD4B 1L1JA 4FOUC 5E8EH 2QYIA 4MVNA 4HZHA 2WPJS 3HKJB 3QTOH 4OS7A 3BEFB 2ZP0H 1ELFA 1FXYA 2ALPA 4Y0ZE 1CHGA 2HNTE 4A92A 4LK4A 4ZHMU 4NIVA 2ZHQH 1EB1H 1GHZA 1L2EA 1EAWA 1MU6B 2VWNA 1L4DA 1JIMA 1T8LA 1Y3VA 2HPQH 1EOJA 1XMNB 2ZCHP 1LKBA 5EGMA 1EB2A 1GCDA 1RS0A 3A86A 1P2IA 2C4FH 3HATH 4B2BA 3S7HB 4BTUB 1KXFA 4HI3A 1ETTH 3SNEA 2F43B 1GMDG 2H6MA 1DSTA 2BY5X 3OEHD 3E91A 4NA8A 1A2CH 4UFEH 3ATWA 1K22H 1CGHA 3SYJA 1Y5BT 3V7TA 1ESBA 2VVUA 3T26A 3PM3A 2BY6X 1SSXA 1NT1A 1V2QT 2K1QA 1C5YB 3PYHA 1HIAA 3A8BA 1SQTA 2B8OH 5LH8A 1C2GA 2BDBA 1Z6JH 1THRH 2A32A 1S82A 1TGCA 1GVKB 1V2RT 1XUGA 3A85A 1BTHH 1AE5A 2XC4A 5JB8S 3RC5A 2WYGA 3URDA 1WDIA 3PO1C 3UNQA 1O2KA 1C1VH 1O3JA 3K6ZA 3H5CB 1DUAA 1V2JT 5C67A 2DE8A 3SI3H 2J2UA 1N8OC 2XCFA 4D7GA 1D3TB 3GCTF 4FU9A 4Y79A 1XUHA 1KXBA 2VIWA 2ZECA 2GT8A 2BD4A 2VB0A 1TRNA 2FM2A 4BAMB 1C5TA 1PPGE 4AN7A 4I86A 4H42U 3TJUA 1T7CA 2LNCA 5C0TA 1IQLA 1UHBA 3RUOA 1KTTB 3DFLA 1BBRH 1C1RA 2A4OA 2H5DA 1E37B 5GCHG 3OTPA 5GIBA 3TH2H 4ZXYH 3QTVH 4CBNA 1RJXB 1ELVA 1JIRA 1J14A 1NY22 2M2AA 3GCHB 2B7DH 4H4FA 2NU4E 3KQEA 2NU3E 4TY6A 4UFGH 5FHTA 3ZYDA 1HGTH 1ZOMA 1SLUB 3Q76A 1KLTA 3Q77A 2FLBH 1CE5A 1ZMLA 3SJOA 3SO3A 1KXAA 4NZQA 5FBIA 1PPZA 2ZFQH 1DSUA 4OGXA 1YCPM 1SB1H 3STJA 1NESE 3Q3YA 4GAWA 3SV2H 3P92A 1FZZA 1GHVH 2QV1A 1MMJN 2ZTXA 3AW0A 3KCGH 4A5TS 1LHEH 1GGDC 1OS8A 2ZHWH 3A81A 3LJOA 2B5TB 2F9UA 2ZA5A 3WWBA 1FPHH 1XVOA 5FCRA 3GY3A 2OUAA 1COWD 1CVWH 2CMYA 1Y5UT 2V7QD 1W2KH 1O2IA 1HAPH 1V3XA 4GHTA 2D8WA 1G3EA 1GBDA 3D65E 3NWUA 2HPPH 3LOXA 1GBCA 2PWXA 2FI4E 3FO8D 1FMGA 1SI5H 1G3CA 2IJOB 3OSYA 3VPKA 2YNBA 2Y7ZA 4B76A 1TABE 1TLDA 2J5UA 1GG6C 1K1MA 1NFUA 2BY7X 2W3KA 1Q31A 1SKYE 1TYNA 1BTXA 2CHAC 2M5TA 2DUCA 2ZGHA 2A7HA 3QK1A 1K2I1 1O2NA 1PQ7A 1TGTA 1Y3UA 1SR5C 1NO9H 3RP2A 3SN8A 3KF2A 3SNCA 1TIOA 1NS3A 3CP7A 1GHBG 4MNYA 1RIWB 2R3UA 2NWNA 1F5RA 1UVPA 3N7EA 5AHGH 1UCYE 2ZDNA 2G81E 5EXLA 5IYTA 7ESTE 1VJ9U 1AHTH 3PV4A 4SGBE 1YPJH 3FZDA 1CA0B 4JK5A 4FUJA 4TPIZ 1K1LA 2F9VA 1BHXF 1O3EA 1V2VT 5A0CA 3RXPA 1WQSA 1C2HA 1BRAA 1ELEE 4X0WU 1ESTA 1A0JA 1HXFH 1H9LB 1OHHD 2ANMH 4AFSA 1HJAC 4FU8A 2FS9A 3SGAE 2P3UB 1GHWH 3TH4H 4ABIA 3RXJA 1PQ5A 1NBME 1B0EA 1C5SA 1IQEA 3DHKH 1K0HA 4FETA 3BG8A 4BNRA 2CJIA 1ZPBA 3SV7A 3P8GA 1AWHB 1P2JA 1FY5A 1XX9A 1A61H 3LH1A 3C1KA 1VITH 2PHBA 5DP3A 1O3MA 3GS9A 4OGYA 8LPRA 3ZZ4A 3UTUH 2J97A 1V2MT 1E1QD 1GI0A 3P17H 4BXSA 3PMAB 1TX8A 7KMEH 3F3BA 1FY8E 1YCPK 4YXWD 1LHFH 4NZLA 1C4U2 1V2UT 1LPZB 1KTSB 1WBGB 1GMCF 2BDGA 1BMMH 2G4UA 2BQ7B 4XBCA 1AMHA 3TJNA 2NU1E 3TJOA 3PV5A 4CHAC 1SHHB 2BX3A 1V2KT 1C2MA 4JCNA 3JZ1B 3L6PA 6GCHF 2RFKC 2XBXA 2SGQE 1ANEA 2RA3A 1D3PB 1SPJA 3FKSD 3TK9A 1HDTH 2L6OA 1SLXB 4NCYA 4ESTE 1ZJKA 1C1OA 2FI5E 4I33A 1P0SH 2A7JA 2IN2A 4TYDA 1DXPA 3B23B 2XBVA 1ELTA 1GJ9B 1LVBA 4O3UA 2JJ2D 1FLEE 1H4WA 2J98B 3GDUA 3KIDU 2AYWA 3SV6A 3SNAA 4LXBH 4NG9H 3M7QA 2J94A 2BLVA 1RFNA 2WPKS 2C3SA 1SGQE 2Z3DA 1F5KU 2FI3E 4D9RA 1MTVA 3DSGA 2AEIH 2PLXA 3FP6E 1YF4A 3ZZ5A 2SNWA 2SGEE 2V35A 1SGPE 4B2CA 4TY7A 3L33A 4AOQA 2ZU1A 2PKAB 3H7TA 1O3BA 1MAYA 1FNIA 1YWUA 4NGAH 3UIRA 2VH6A 2ANYA 2XRCA 5F6MA 1D6WA 1TFXA 1TMUH 2KM0A 4AG2A 2G5NA 1ZLRA 1GMDF 1UTQA 1SGRE 5EPYA 1LDTT 2Z3EA 1LTOA 2BTCE 2GP9B 4CREA 1HAVB 2WPHS 1OXGA 1GCTB 1SBWA 3D23A 2JDID 1C5VA 2Q1JA 2VIOA 4I32A 1N6XA 1QB6A 2VU8E 1C1PA 5HGGA 4TWWA 3V13A 1ID5H 1YLNA 1QJ1B 2Z94A 4D76A 4Z1MD 1SLVB 2FMJA 1S85A 1TPSA 2KCYA 4X1NU 5SGAE 5EJLA 1YPKH 1Z7KA 3U8OH 2BHGA 3AVZA 4U01A 2ZGBH 5DPAA 2BD7A 4E7RG 1T8MA 1FY4A 2QA9E 2BZAA 1LMWB 2Z9GA 2Z7FE 3MWIU 3P8NA 4RSPA 4XDEA 1GI2A 1TX7A 3FP7E 5HIZA 3GCTG 2G55A 4I8KA 2QXJA 1TX6A 5EQRA 4AGJA 1DY8A 3EDXB 2ZF0H 1JOUB 4B1TA 2G52A 1FAKH 1C2LA 1EFRD 1S6FA 3LH3A 1ZSLA 6CHAC 3LJJA 1OYTH 5ESTE 2P8OB 2C93B 1QBNA 2ODYB 3EA9A 4IMQA 4I8JA 5C5OA 1WUNH 3ZYEA 3NRLA 1ELGA 4E7NA 1CU1A 2QF5A 4ZUHA 4ZKRU 5E2PA 1P3EA 4O03A 1GBFA 1IQGA 1Q3XA 2I6QA 2QF0A 1MUEB 1GBHA 1EUFA 2BDIA 3RMLH 2OQ5A 4X2VA 3EE0B 3SZNA 5T6GA 3PV2A 1V2OT 2SGAA 2QCYA 1VITF 4PROA 4X8TH 4DY7B 3A84A 2WSSD 1NU7B 2CXVA 2G5VA 1TWXB 4X8VH 3SU0A 1MD8A 2BLOA 1Z8GA 1GJDB 2TBSA 4KP0A 4NFFA 4BANB 2Z3CA 1JBUH 5GNDA 2XWBI 3B9FH 5HXFA 3ITIA 1HAHH 3GDVA 4AYYB 1GBLA 1EQ9A 1HJ9A 2W5EA 1SGIB 1MTSA 1O2JA 2GVFA 3GY4A 4UFDH 4Z0KA 2BD8A 2EI8A 2YMSB 2A4QA 3PMBB 4IBLH 4RI0A 3FVFB 4ZROA 4U32A 5IK2D 4ABBA 1ELAA 3A87A 3CNRA 1J16A 2WHXA 1C2KA 3Q3XA 1B5GH 4X1PU 2BXUH 1QR3E 1V2PT 1EPTB 3EA8A 4M7GA 4DIHH 2A0QB 3VEQB 1GDNA 1T8NA 1V2WT 1GHAG 3AW1A 4WXVA 4AFUA 2R0LA 2IJD1 1GL0E 3TK6A 3LT3A 1MKWK 3O8BA 2WPMS 3RXRA 3UNSA 1MKXK 1DITH 1SQRA 4WWYA 3RC6A 4WXIA 1TOCB 3QZRA 3QLPH 2Q6DA 3M5OA 1SGTA 2C8WB 3GY8A 4DVAU 1BTPA 2W7UA 1FI8A 3MU0A 4LOYH 2VWMA 1G3DA 2QF3A 1LO6A 1SOZA 4JK6A 4ABAA 4M9FA 4AORA 1QNJA 1ZGIA 4Y10E 1AB9C 3WY8A 1X7AC 4E05H 2Q6FA 1TGBA 3URCA 4BXWA 1WSSH 1VCPA 3KNXA 2OBQA 3KYGA 5A2MH 3LGWA 2JIZD 1O5FH 1HYLA 1DWDH 2ZPSA 1ACBE 2BD2A 2GZ8A 2ZFSA 2QXHA 3ZZAA 1MABB 3U98H 1XXFA 1OX1A 2Y5GA 1BJVA 4OS4A 3RXOA 1W11U 1AZ8A 4D9QA 1SGEE 5FX5A 3TH3H 4NFEA 3M61U 5EJ1A 3CS0A 2Y6TA 3PRBA 5JBTA 1UTKA 2DE9A 1EKBB 1PYTC 1NU9A 3MMGA 2CF8H 3I29A 2RA0A 1D6RA 3S9BA 1C9TA 3ZVBA 1KDQB 1JMOH 3ZVGA 3PRDA 2XYAA 2PR3A 5B6LA 4ABDA 1XKBC 2WZQA 1O3LA 2FXRA 5F8XA 1KIGH 5ABWA 3UUZA 1FPCH 5FPSA 4YM9A 1DLKB 1K1PA 1O3FA 2O8TA 1MAXA 1TBQH 2FESH 2ZDKA 3FZZA 3N7OA 1A5HA 2A1DB 1SGYE 3F0PA 3O8DA 1FV9A 1YKTA 1T32A 1QHRB 6GCHG 1QB9A 3UR9A 1CT2E 2WPIS 4MNVA 1PFXC 1OPHB 2OC7A 1EJMA 2EA3A 1MZDA 2BY9X 4K3JA 4R8TB 2AGIX 1BBRE 2BVXH 2VIPA 2Y7XA 1TQ7B 1E38B 3QZQA 4GPGA 1KXCA 1GBJA 1UK3A 2Y80A 2F9OA 1GDUA 2BLQA 1NROH 1KXEA 2BDYA 2BOHB 3LKWA 1HXEH 3SJIA 3KHVA 1TPPA 1BTWA 1XVMA 1AE8H 1SQAA 4UDWH 3GDSA 3K6YA 1MTNC 1DUEA 2P59A 1P10A 1BRCE 3QN7A 3PO1B 3OY6U 4ZXXH 2YOLA 1BDAA 1H1BA 1K1JA 1C2EA 2XXLA 1O3DA 3RM0H 1AGJA 3VB3A 1AKSB 1N8OB 4LZ4B 1KY9A 2J92A 3SU5A 3M5NA 4INLA 2KZ4A 1O5BB 4QT8C 3BIUH 2HOBA 2GCTC 2R2MB 2V6NA 2ZHDA 2ZU2A 2CGAA 4IC6A 2QE7D 2AH4X 4WF8A 2IOTA 1C9PA 4XSKU 3MO6A 2AHME 1OWDA 5JPMH 4GSOA 5TCAA 3ATMA 2OC0A 4ASUD 1YPMH 2OBOA 3H7OA 3SUFA 4DIIH 3KQCA 1SGNE 3UOPA 3LC5A 2VGCB 1C2JA 1DDJA 1TGSZ 2AGEX 5A8YA 4WH8A 3M37A 4Q7YA 1ZMJA 1E1RD 2IPQX 1AFQB 2Y82A 1BITA 1UVOA 9LPRA 8KME2 2GCHF 1IQNA 4DURA 1PPEE 1BMAA 2OQUA 2FOMB 1K28D 1W7GH 2XNDD 1TQ0B 2TGAA 4O97A 3GOVB 4RT1A 1UTLM 1GI8B 3MOCA 4U2WA 1WAYB 3LU9B 2HVXA 2ZEBA 3SI4H 3SV8A 1QQUA 2B9LA 1P2QA 3ZZ8A 1LQEA 1T8OA 5T3HA 1ZRKA 3KQDA 3ZVFA 1IQKA 3RMOH 3RXSA 4F55A 2PUXB 2P3TB 1E34B 1GGDB 1ORFA 3F0OA 1AI8H 3BTDE 1P12E 4JYUH 4MG3A 2V3MA 5FX6A 3RMMH 1GMHF 2V0BA 3SJKA 1QJ7B 3M35A 1DLEA 1NN6A 5CMXH 1O2PA 3TIUA 1F92A 1EAIA 1VITG 2JETC 4A1VA 1MQ6A 2VIDA 3I78A 3UOUA 3TPIZ 4K69A 3BEUA 4NWLA 3BSQA 1C5MD 5CHAC 2I6SA 2ALVA 3U8RH 2TGDA 1WTHD 3S0NA 2HNTC 1GG6B 1UCYK 1AD8H 2CHAB 4ZAEA 1TA2A 1HAYB 3HK3B 1AIXH 4IS5A 1D3QB 3LONA 3MNCA 2LP6A 1DICA 1SGFG 2OK5A 3SGBE 4VGCC 3F2GA 1AFEH 1DM4B 1O3GA 1YBWA 4DJZB 4F48B 1QIXB 5HKKD 1TPAE 1DWCH 2PGQB 3A7ZA 1GPZA 4FUEA 4KTCA 2AIPA 5EW1H 4I8HA 2Z6BD 8ESTE 1WQVH 1LHDH 3HGPA 1Y3YA 1UTOA 1H8HD 2ZU4A 5AFZH 1HCGA 1C4Y2 1WV7H 1C1MA 1TNGA 2YMSD 4ZCNA 1NRNH 4H6TA 1HJAB 1LPKB 4X1QU 3ATLA 1GJBB 1O3OA 1ZHPA 4K1TA 2BB4A 1V6DA 3T62A 1GHAF 5T6DA 1B7XB 3AAUA 3ZZ3A 1PPBH 1QL7A 1C4V2 1O39A 1YPLH 1GI3A 4I8LA 1ZYOA 2FO9A 1GJ7B 1ANDA 1NFYA 2ZGJA 2ZU5A 3V0XA 5A8ZA 5EJZA 2BDAA 2FDAA 6ESTA 1O3NA 2VBCA 1HAVA 1QQ4A 3SW2B 2V3OH 1EASA 2GMTC 1XUKA 2W26A 3RXDA 3RLWH 4Q7ZA 3RU4D 4ACAA 3SU1A 2UWOA 3GYLB 1O2TA 1QRZA 1SMFE 1F2SE 5TJXA 4GLYA 1S0RA 3UQVA 2KCAA 1BRUP 4RN6A 3HKIB 1QBVH 4U30A 1A3BH 4CHAB 4DT7B 1Z8JB 4X1RU 4AFZA 1TBZH 1V2TT 2STAE 5FBEA 2XNIA 1HBTH 4I7YH 2BD3A 1RTFB 3MO9A 1F0SA 2G51A 1XM1A 4YT6H 4H6SB 1HIAB 3U1IB 1EZQA 1TA6A 1CHOF 1GI6A 1Z8IB 4MDSA 1C5LH 2G8TA 2KX4A 1CT4E 1BA8B 1W10U 2JH6D 4ABHA 1YGCH 2EI7A 3QDZB 2TIOA 1ANCA 3UQOA 1D3DB 3ZV9A 3M3TA 4YLUA 3VB6A 1VGCC 3QGNB 3A82A 1V2LT 4Y71A 3RXHA 4ZKOU 4YLQH 3UR6A 3TK5A 1BJUA 2ANWA 3SNDA 4AX9H 1O2VA 2ZQ1A 1BTYA 4X6MA 1IHSH 3MH5A 4X2XA 1UTJA 2QXGA 1OP0A 4MLFB 1TNKA 1O33A 2J95A 2OCVB 1GI7B 1UVTH 2KFWA 1G37A 2BMGB 3MFJA 1O3HA 1WCZA 4NIWA 4XOJA 2BVSH 1N6YA 1YLCA 1GJ4H 4ISIH 1SQOA 4MPUA 3PWCA 2Z9JA 1CT0E 4AG1A 3A7XA 5IDKA 1JWTA 5I25A 5KGOA 1GBKA 2JKHA 1EPTA 3KQBA 3ZZCA 4INHA 3D49H 5BPEA 1IQFA 3ZZ6A 1A4WH 5CE1A 4WH6A 2BQWB 5EIYA 5J4QA 5EG4A 3UWJH 2WUBA 2FLRH 2FOHA 1AN1E 2EQNA 3MH6A 1H9IE 2ZTZA 3ODFA 1DPOA 4WMDA 3KQ5A 5FPTA 4K8YA 1O2YA 3LIWA 2GDDA 1ZTLA 4CH8B 5A8XA 5DP9A 3O8RA 2QXIA 2HNTF 1QURH 1J15A 6CHAB 3MU8A 4ACBA 2K8IA 1ZZZA 1IQJA 2J9NA 1C5ZB 2O8WA 4WMFA 2ESTE 4X8SH 4K60A 5LPEA 4HTCH 2KCOA 2THFB 1L1GA 2WPDD 4B73A 1UTMA 3DA9B 2ZQ2A 4Y76A 1GI5A 1K1OA 2ZDLA 1UCYH 5JBAS 2VNTA 2ZHFH 4IN2A 1C5NH 3ESTA 3ZZBA 1C1QA 1ZMNA 1W0JD 3EA7A 3IG6B 2GCHG 1ZRBA 1QJ6B 1NRPH 3UWIA 4J1YA 1Z1IA 5E0GA 4KKDA 5FXLA 1DANH 4Y7BA 5DSFA 5G4BA 2L74A 4DGJA 3KYFA 1YP9A 3E3TA 2R0KA 1WOFA 4YZUA 1LCYA 1SGCA 2ZTYA 4UD9H 2SGFE 5DJ7A 4X8UH 2F9BH 5LGOA 3NPSA 4FUIA 4RKOB 2J4IA 2F4LA 1O35A 2P93A 2FPZA 1FONA 2PUQH 2W6JD 4TSFD 1MCTA 4DCDA 3GY5A 3LDXH 4MNXA 2FTMA 4FUCA 8GCHF 2WINI 1H8IH 4X6PA 5FAHA 1AVGH 1GMHG 3KGPA 1TBRH 1W14U 3GISB 1A1RA 5JYIA 1HLTH 4THNH 1KDQA 4ZMAH 2FS8A 2PGBB 3HK6B 3QWCH 1O2SA 1O5AB 5J4SA 2KCPA 1IOEA 1DXWA 1MTWA 3BTTE 1AUJA 1WTGH 1EZSC 4K8BA 4AYVB 2Q6GA 2Z9IA 2PW8H 1TNJA 2GGVB 5FL7D 4A7IB 4CRCA 1YPHE 2STBE 4K1SA 3E16B 2ZG0H 1TB6H 4YOGA 3SUGA 2ULLA 2FP7B 2BYAX 3QGJA 1B0FA 3ZZDA 2AS9A 1LHCH 1CO7E 5DGJA 1YC0A 2EC9H 1W3CA 1V2NT 4NSVA 1P01A 1DS2E 3GY6A 2Y5FA 4JZ1A 3O8CA 2EI6A 4JMYA 1EJNA 1T4VH 1EJAA 1RTKA 2XCNA 4JZEH 1NTPA 3UPEA 1VCWA 1OKXA 1L1NA 1UK2A 3P70B 4X2WA 3RXMA 3F9EA 3DUXH 3RXEA 9ESTA 5K0HA 1AB9B 1C1TA 5DP8A 3SU2A 1BIOA 1SL3A 5DP4A 2Y81A 2F3CE 2GDEH 4FUFA 3ZVEA 1ARCA 2ZU3A 1OP2A 2WYJA 3A7WA 1E35B 1WXRA 3MTYA 4UONA 4Q4LA 2HLCA 4XD7D 4MQAA 4Y0YE 3RXFA 2GT7A 3BG4C 3M7TA 2C8XB 2AIQA 4DOQA 3K9XB 1O5CB 3RU4E 2BZ6H 3UY9A 1AU8A 1AKSA 4ZHAA 5H4IB 2ODPA 1W8BH 2A4RA 1Y59T 2Z9KA 1DVAH 2A5IA 2ZCKP 3TU7H 3PMJA 1BUIA 2PKSC 1ZHRA 1AZZA 2A4GA 2FTLE 4DG4A 4DW2U 2H2ZA 2O9QA 5FCKA 3AAVA 4ZKNU 1PPHE 3RDZA 3OE7D 1YCPH 4OS1A 2OC8A 2D1JA 2PP6A 2BY8X 3ZIAD 4SGAE 3PTNA 3C27B 1TRYA 1GJCB 2AERH 3SU4A 1K1NA 1DWEH 3FFGA 2J34A 1NZQH 3TGKE 3U1JB 3TLOA 1P2MA 3NXPA 5EW2H 1BBRK 2O8UA 3ENSB 2YNAA 5K7RA 4B71A 1C5WB 3A7VA 4CRAA 1NRQH 4Q63A 3RXAA 3GCOA 3TGIE 1NRSH 1WYKA 2EEKA 5ESBA 4YO9A 1GI9B 3P6ZB 3W94A 5DN6D 1OOKB 3VGCC 1CGJE 1ESAA 1FN6A 2K0QA 3M3VA 4IW4E 2BD9A 4BOHA 2BDHA 1BQYA 4FVDA 3U8TH 2BD5A 1CHOG 1RXPA 3A7YA 2PTCE 5E2OA 2A2XH 1S0QA 2ZFFH 2ZC9H 2G00A 3PMHB 2R9PA 5GDSH 1J9CH 1O5DH 5T6FA 4XBDA 1G2MA 4Y6DA 2OP9A 3BTWE 1RRKA 5EQQA 3F68H 1FY1A 1MQ5A 1MTNB 1P9SA 3A8AA 2GTBA 1IAUA 3PLBA 3L3TA 5L2ZH 1QL8A 1BTZA 1PQ8A 5FPYA 1VZQH 2VIQA 2VINA 3RXBA 2ZIQH 2GV6A 3S9AA 3U28C 1AQ7A 2FOAA 3TJVA 5GWZA 2HWLB 1S83A 2QC2A 2NU0E 2GCTB 2IPHA 2TGPZ 1J8AA 1ELBA 1K9OE 1CSOE 2ZDAH 1SFIA 2UUFB 3E1XB 4CBOA 3P8FA 1KXDA 5EXMA 3T5FH 1O2MA 5T1VA 5TCCA 3NKKA 4MNWA 1E0FD 3E90B 3DFJA 3T27A 2AMQA 4GCHG 1P05A 1DX5M 1L0ZA 1S84A 3I77A 5CHBA 3BTME 3W1EA 4FUBA 1ZR0A 3RXCA 1OSSA 2LPRA 1O2WA 1OWIA 1OYQA 3S69A 2XBYA 1HB0B 1P09A 1D9IA 2KR7A 4ABFA 1C1SA 4X6OA 1HAIH 1QFKH 2ZGXH 4OM9A 4ABGA 4HG6A 1QBOA 4WJG2 1FN8A 1GBAA 1SGFA 4ISLA 5C17A 3A8DA 1O2OA 1H9HE 1GJAB 1PPFE 3MQKC 4JYVH 1NC6A 3SORA 3BTKE 1TNIA 3U69H 3ZVAA 4AFQA 2OXSA 4I8GA 1ETSH 4UE7H 4I31A 1O3PB 5EQSA 1Q2WA 1YY3A 3E0PB 1O3AA 3LGIA 4MPWA 1C5RA 1ABIH 2H1UA 2FOEA 4Y7AA 1Y3XA 2ZO3H 2TPIZ 1SOTA 1C5PA 2XC5A 4Y8XA 2XOKD 2Z9LA 4BTIB 3S9CA 1NRRH 1C2IA 2JETB 4NIXA 1C5OH 1RD3B 3GCNA 3SUDA 2BLWA 2VVCA 2FX6A 5ETXA 1GDQA 5GXPA 3EYDA 5CHAB 2SGPE 1UMAH 2J38A 1BRBE 2PSYA 3GYMA 4AB9A 2W7SA 2FOGA 1Z6EA 1PPCE 2PSXA 3ZVDA 3VB7A 4HGCA 1IQMA 2KAIB 4JYTA 3P8OA 4ZH8A 1G32B 3K2UA 2C8ZB 4OS2A 1CBWC 4OS5A 3F9GA 7GCHF 3FN8A 3RC4A 8GCHG 1M9UA 1ZTJA 4VGCB 2C8YB 5JBCS 2JJ1D 3OAAD 3KEEA 1E79D 5C0UA 1FDPA 4ISOA 2P16A 1DE7H 3OX7U 1BMFD 1P06A 1QGFA 4FU7A 2UWLA 2VH0A 4IMZA 1PJPA 4LZ1H 1O3CA 2UUJB 3PLKA 2CF9H 2W3IA 1MD7A 3NCLA 1GJ5H 1MKWH 1NM6A 1OWJA 3F1SB 3Q00A 2GZ7A 2ZNKH 1W12U 3BTQE 4E06H 1MKXH 5F8TA 1TPOA 2A2QH 2P94A 3LGYA 1NFXA 3H09A 1F0TA 4WY3A 2A31A 1OWEA 4ZKSU 2PV9B 4X1SU 2O8MA 4KTSA 4UFFH 3M7UA 4YESB 5HMAA 2BX4A 3N7DA 1W7XH 2JH0D 3KL6A 2ZFPH 3EE7A 1ZPZA 3MNSA 5DO4H 2V3HH 1AWFH 1E36B 1ETRH 1C5XB 5F8ZA 3RXTA 2VGCC 1MH0A 2GMTB 3RXQA 3HPTB 2J98A 5HYOA 1A5GH 1ZJDA 1F0UA 2H9HA 3LPRA 1AFQC 1MU8B 4FUDA 3RXVA 1Y5AT 1O2RA 4Y8ZA 4DT4A 3LGTA 3SQEE 2OINA 4NWKA 5A09A 2PFEA 2FOCA 5LPFA 2QY0B 4O3TA 5F53A 1A0HB 3CENA 4Y8YA 1O34A 5C94A 1MZAA 1RGQA 3ATIA 2PKAA 4B74A 1EP6A 1GI1A 4RKJB 1TNLA 4WMEA 3RXIA 2QGRA 5GPIB 2VIVA 1ZSKA 3T28A 1N1LA 1KLIH 4XE4A 2A5KA 1O38A 5B6OA 3SJ9A 4JZDH 3F2HA 1O0DH 5LPRA 3OFND 2D2DA 3A88A 1SC8U 4ISNA 3RU4T 3M3SA 4XBBA 4K2YA 3VXEH 1ELCA 3M5LA 3UB0A 3VXFH 5L2YH 4ABJA 2UUYA 1THSH 2FYRA 1VKYA 2BOKA 3DD2H 1YLDA 1FX0B 1PYTD 2AMDA 4CRBA 1VGCB 2F83A 1FY3A 3MH4A 1UJ1A 3RXGA 3GCHC 1FQ3A 4B6FA 1P2NA 3CS7A 1FUJA 1O2UA 1HPGA 1HUTH 2F9PA 2VVVA 3EQ0H 3JZ2B 3BTFE 1TNHA 1XKAC 4BAKB 4WVPE 1ZGVA 1QB1A 3MI4A 1TMTH 1Y3WA 5HM2A 3P95A 3PWBA 4GHQA 2ZFTA 4YOIA 5BRRE 1PQAA 3SU3A 1MTUA 5JB9S 5AFYH 2LELA 4P00A 1HAOH 1OP8A 3TNTA 4IC5A 4INKA 2ASUB 3BTGE 4UEHH 4A1TA 2WV4A 4FVBA 1KMHB 2ZHEH 1A0LA 4B75A 2SNVA 1YM0A 1O5GH 1UTPA 4AZ2B 3SHAH 1Z71A 1ELDE 1QA0A 3QO6A 1W0ZU 3MNBA 2AGGX 1ZSJA 3UFAA 5EU8A 1AUTC 2XC0A 1TE0A 1AO5A 2A45B 1A3EH 1DT2A 1GVLA 3TVJB 1P2KA 1RIWC 1ZHMA 3EAJA 4Z6AH 2H9TH 3VG8A 4FUHA 1IQIA 4AC9A 2NU2E 1HAXB 3SNBA 1KYNA 1UHBB 1IHTH 3PROA 1ZTKA 4F4OC 1G9IE 1XUIA 1CA0C
chains in the Genus database with same CATH topology
1QY6A 3OY5U 1AY6H 1LVMA 2Y5HA 5C1XA 2RG3A 1P11E 1O36A 1C1NA 3FAOA 4J2YB 3ZV8A 1BB0B 1S5SA 1NPMA 1P04A 2ZI2H 1LQDB 4GCHF 4TPYA 1P02A 3K65B 1RTLA 2VWLA 2XW9A 4KELA 1EATA 1H8DH 4XFQA 1BOQA 1G3BA 2H9EH 3A80A 4GUXA 1JRSA 2FWWA 5C5NA 5EXNA 1FIWA 1W13U 1UO6A 2C90B 6LPRA 2ANKH 1AVXA 3F6UH 3M36A 5EODA 1AVWA 4YOJA 2BDCA 1P8VC 3SV9A 1XUJA 3SUEA 3EGKH 1C2FA 2CV3A 3IITA 1A46H 1T4UH 3NUMA 3GICB 1VJAU 1MBQA 3M5MA 3Q3KA 2HRVA 4ISHH 3UREA 5HM9A 2HALA 5DP5A 3STIA 2FOBA 5L30H 2A5AA 2BVRH 4NA9H 1GWAA 3ELAH 1U6QA 1YYY1 1S6HA 1NFWA 1ABJH 1HFDA 1SG8B 2FX4A 3MU1A 1TONA 1GJ6A 1THPB 2P3FH 4ASHA 2GX4A 1Z8RA 1GBBA 1BMLA 1O3IA 1C1UH 1G36A 7LPRA 4R0IA 1GI4A 1D4PB 1ANBA 2VWOA 2XTTB 3DT0H 1A5IA 1O2LA 4HFPB 1O32A 1YPGH 1F5LA 2SFAA 3PLPA 4IN1A 4NA7A 1F7ZA 4CH2B 4CRDA 1O2GH 5F03A 1C5QA 3SHCH 4CRFA 7GCHG 4YTAA 1DY9A 3A83A 2FODA 3T2NA 1SVPA 3LC3A 3MH7A 4Q80A 4IGDA 2B0FA 3U9AH 5DP6A 1QA7A 1O2QA 1XUFA 1INCA 3S7KB 5E0JA 1KLJH 2RCEA 3FANA 1YPEH 5AF9H 3LGUA 1CQQA 1VR1H 1BTUA 3A89A 2F91A 2OC1A 2PTNA 2QN5T 2ILNA 1C1WH 1QRXA 3ATKA 4X2YA 3AASA 3E8LA 3GY7A 2GKVE 3E0NB 2AMPA 3QUMP 3BF6H 1UVSH 5DKMA 3W95A 3V3MA 4OS6A 3BG4B 1LVOA 2TGTA 1FIZA 1EXFA 2OTVA 3BEIB 2A7CA 1GBMA 2QIQA 1VCQA 3E6PH 1ZPCA 2AFQB 2GZ9A 3MO3A 4AB8A 3UNRA 1O30A 2FIRH 1EAUA 1LPGB 3KN2A 4B2AA 1P57B 2PKSB 1FJSA 2FOFA 3ODDA 3RXKA 5EOKA 4ABEA 1GCTC 3SJ8A 5L6NH 1BZXE 3MYWA 1GHYH 2P95A 2UUKB 2HGTH 1GBIA 1HAGE 4FXGH 1G30B 1EOLA 4NIYA 3B8JA 2JH5D 3RLYH 3PTBA 1MBMA 3IWMA 2D26C 5GCHF 3A7TA 3BV9B 1UK4A 4CRGA 4F49A 5C3NA 5A0AE 2WUCA 2ZGCA 3MU4A 1J17T 1A7SA 2ZZUH 2G4TA 3NZIA 1XXDA 1C2DA 3MHWU 1HNEE 5E0HA 3BTEE 3ZVCA 5JBBS 3ZZ7A 1EX3A 4CR9A 1WU1A 1P2OA 3A8CA 3VGCB 2TRMA 3OTJE 1V2ST 2R2WU 4D8NA 2XBWA 1Y8TA 5C1YA 2P8OC 3PB1E 2ZFRH 1SFQB 4Q2KA 1O31A 4MPXA 4JZIA 2FZZA 2ZKSA 1MCVA 5C2ZA 1KSNA 3SQHE 1TGNA 1JXPA 1EAXA 1C5UA 2ZPRA 1QTFA 1LVYA 1SLWB 1GVZA 5A0BA 5DG6A 1ARBA 1TMBH 1P3CA 3RXLA 3GY2A 4KGAA 3SOSA 4A6LA 3QX5H 3SGQE 1UVUH 3T29A 5C20A 3G01A 1O5EH 1GHXH 2VJ1A 3TITA 3FP8E 2F9NA 1EZUC 2KAIA 4MTBA 1P9UA 4GVUA 1JRTA 1O37A 1GL1A 1K21H 3TNSA 5JDUB 2SGDE 2CN0H 1K1IA 1YPHC 4JZFH 2WPLS 5PTPA 1QL9A 1OWKA 3RMNH 3D62A 2RDLA 2GV7A 2OD3B 1GHBF 3TGJE 2O8LA 1F0RA 4D7FA 4O9VA 4BAHB 3BN9A 2BM2A 1IQHA 2BXTH 1T31A 4FUGA 3MU5A 3BIVH 2XWAA 1TOMH 1Z1JA 1O2ZA 4Y11E 1EPTC 5EPNA 1HV7A 4MPVA 1DOJA 1OWHA 3LGVA 1LHGH 1O3KA 4ZHLU 1SGDE 3OYPA 2ZWLH 1O2HA 4K5ZA 2FYQA 1HRTH 1W0YH 2OLGA 1BMNH 2WV5A 4Q7XA 3HGNA 2ZDVH 4CR5A 1BT7A 3VB4A 3RM2H 3NK8A 1GBEA 2ODQA 2ZDMA 2ZCLP 1GJ8B 4NSYA 1FAXA 1GBTA 1QRWA 1TAWA 5C1UA 1TRMA 3R3GB 4K1EA 1BHXB 3MNXA 5AVDA 2FEQH 5GJ4B 2QAAA 1P03A 1DWBH 1GMCG 1CGIE 2R3YA 5DP7A 1UTNA 1HAZB 1LKAA 4AGKA 4BAQB 4X6NA 3VFEA 1L4ZA 1O2XA 3SU6A 1EP5A 3RXUA 3OU0A 2BQ6B 1HJ8A 3ZZ9A 5I46H 4A1XA 3F9HA 4BTTB 3R0FA 1QCPA 1G2LA 2UWPA 2ZPQA 3T25A 4YT7H 3VB5A 3SBKA 2H5CA 1DFPA 1BCUH 1EZXC 3F9FA 4BAOB 1S81A 5DK1A 4TWYA 4KTUA 1SHYA 1TALA 3BTHE 1CA8B 3V12A 1CBWB 2GD4B 1L1JA 5E8EH 2QYIA 4MVNA 4HZHA 2WPJS 3HKJB 3QTOH 4OS7A 3BEFB 2ZP0H 1ELFA 1FXYA 2ALPA 4Y0ZE 1CHGA 2HNTE 4A92A 4LK4A 4ZHMU 4NIVA 2ZHQH 1EB1H 1GHZA 1L2EA 1EAWA 1MU6B 2VWNA 1L4DA 1JIMA 1T8LA 1Y3VA 2HPQH 1EOJA 1XMNB 2ZCHP 1LKBA 5EGMA 1EB2A 1GCDA 1RS0A 3A86A 1P2IA 2C4FH 3HATH 4B2BA 3S7HB 4BTUB 1KXFA 4HI3A 1ETTH 3SNEA 1GMDG 2H6MA 1DSTA 2BY5X 3E91A 4NA8A 1A2CH 4UFEH 3ATWA 1K22H 1CGHA 1Y5BT 3V7TA 1ESBA 2VVUA 3T26A 3PM3A 2BY6X 1SSXA 1NT1A 1V2QT 2K1QA 1C5YB 3PYHA 1HIAA 3A8BA 1SQTA 2B8OH 5LH8A 1C2GA 2BDBA 1Z6JH 1THRH 2A32A 1S82A 1TGCA 1GVKB 1V2RT 1XUGA 3A85A 1BTHH 1AE5A 2XC4A 5JB8S 3RC5A 2WYGA 3URDA 3PO1C 3UNQA 1O2KA 1C1VH 1O3JA 3K6ZA 3H5CB 1DUAA 1V2JT 5C67A 2DE8A 3SI3H 2J2UA 1N8OC 2XCFA 4D7GA 1D3TB 3GCTF 4FU9A 4Y79A 1XUHA 1KXBA 2VIWA 2ZECA 2GT8A 2BD4A 2VB0A 1TRNA 2FM2A 4BAMB 1C5TA 1PPGE 4AN7A 4H42U 3TJUA 1T7CA 2LNCA 1IQLA 1UHBA 3RUOA 1KTTB 3DFLA 1BBRH 1C1RA 2A4OA 2H5DA 1E37B 5GCHG 5GIBA 3TH2H 4ZXYH 3QTVH 4CBNA 1RJXB 1ELVA 1JIRA 1J14A 1NY22 3GCHB 2B7DH 4H4FA 2NU4E 3KQEA 2NU3E 4TY6A 4UFGH 5FHTA 3ZYDA 1HGTH 1ZOMA 1SLUB 3Q76A 1KLTA 3Q77A 2FLBH 1CE5A 1ZMLA 3SJOA 3SO3A 1KXAA 4NZQA 5FBIA 1PPZA 2ZFQH 1DSUA 4OGXA 1YCPM 1SB1H 3STJA 1NESE 3Q3YA 4GAWA 3SV2H 3P92A 1FZZA 1GHVH 2QV1A 1MMJN 2ZTXA 3AW0A 3KCGH 4A5TS 1LHEH 1GGDC 1OS8A 2ZHWH 3A81A 3LJOA 2B5TB 2F9UA 2ZA5A 1FPHH 1XVOA 5FCRA 3GY3A 2OUAA 1CVWH 2CMYA 1Y5UT 1W2KH 1O2IA 1HAPH 1V3XA 4GHTA 2D8WA 1G3EA 1GBDA 3D65E 3NWUA 2HPPH 3LOXA 1GBCA 2PWXA 2FI4E 1FMGA 1SI5H 1G3CA 2IJOB 3OSYA 3VPKA 2YNBA 2Y7ZA 4B76A 1TABE 1TLDA 1GG6C 1K1MA 1NFUA 2BY7X 2W3KA 1Q31A 1TYNA 1BTXA 2CHAC 2M5TA 2DUCA 2ZGHA 2A7HA 3QK1A 1K2I1 1O2NA 1PQ7A 1TGTA 1Y3UA 1SR5C 1NO9H 3RP2A 3SN8A 3KF2A 3SNCA 1TIOA 1NS3A 3CP7A 1GHBG 4MNYA 1RIWB 2R3UA 2NWNA 1F5RA 1UVPA 5AHGH 1UCYE 2ZDNA 2G81E 5EXLA 5IYTA 7ESTE 1VJ9U 1AHTH 3PV4A 4SGBE 1YPJH 3FZDA 1CA0B 4JK5A 4FUJA 4TPIZ 1K1LA 2F9VA 1BHXF 1O3EA 1V2VT 5A0CA 3RXPA 1WQSA 1C2HA 1BRAA 1ELEE 4X0WU 1ESTA 1A0JA 1HXFH 1H9LB 2ANMH 4AFSA 1HJAC 4FU8A 2FS9A 3SGAE 2P3UB 1GHWH 3TH4H 4ABIA 3RXJA 1PQ5A 3DHKH 1B0EA 1C5SA 1IQEA 3BG8A 4BNRA 2CJIA 1ZPBA 3SV7A 3P8GA 1AWHB 1P2JA 1FY5A 1XX9A 1A61H 3LH1A 3C1KA 1VITH 2PHBA 5DP3A 1O3MA 4OGYA 8LPRA 3ZZ4A 3UTUH 1V2MT 1GI0A 3P17H 4BXSA 3PMAB 1TX8A 7KMEH 1FY8E 1YCPK 1LHFH 4NZLA 1C4U2 1V2UT 1LPZB 1KTSB 1WBGB 1GMCF 2BDGA 1BMMH 2G4UA 2BQ7B 4XBCA 1AMHA 3TJNA 2NU1E 3TJOA 4CHAC 1SHHB 2BX3A 1V2KT 1C2MA 4JCNA 3JZ1B 3L6PA 6GCHF 2XBXA 2SGQE 1ANEA 2RA3A 1D3PB 1SPJA 3TK9A 1HDTH 1SLXB 4NCYA 4ESTE 1ZJKA 1C1OA 2FI5E 4I33A 1P0SH 2A7JA 2IN2A 4TYDA 1DXPA 3B23B 2XBVA 1ELTA 1GJ9B 1LVBA 4O3UA 1FLEE 1H4WA 3GDUA 3KIDU 3SV6A 2AYWA 3SNAA 4LXBH 4NG9H 3M7QA 2J94A 2BLVA 1RFNA 2WPKS 2C3SA 1SGQE 2Z3DA 1F5KU 2FI3E 4D9RA 1MTVA 2AEIH 2PLXA 3FP6E 1YF4A 3ZZ5A 2SNWA 2SGEE 2V35A 1SGPE 4B2CA 4TY7A 3L33A 4AOQA 2ZU1A 2PKAB 3H7TA 1O3BA 1MAYA 1FNIA 4NGAH 3UIRA 2VH6A 2ANYA 2XRCA 5F6MA 1D6WA 1TFXA 1TMUH 4AG2A 2G5NA 1ZLRA 1GMDF 1UTQA 1SGRE 5EPYA 1LDTT 2Z3EA 1LTOA 2BTCE 2GP9B 4CREA 1HAVB 2WPHS 1OXGA 1GCTB 1SBWA 3D23A 1C5VA 2Q1JA 2VIOA 4I32A 1N6XA 1QB6A 2VU8E 1C1PA 5HGGA 4TWWA 3V13A 1ID5H 1QJ1B 2Z94A 4D76A 1SLVB 2FMJA 1S85A 1TPSA 4X1NU 5SGAE 1YPKH 1Z7KA 3U8OH 2BHGA 3AVZA 4U01A 2ZGBH 5DPAA 2BD7A 4E7RG 1T8MA 1FY4A 2QA9E 2BZAA 1LMWB 2Z9GA 2Z7FE 3MWIU 3P8NA 4RSPA 4XDEA 1GI2A 1TX7A 3FP7E 3GCTG 2G55A 4I8KA 2QXJA 1TX6A 5EQRA 4AGJA 1DY8A 3EDXB 2ZF0H 1JOUB 4B1TA 2G52A 1FAKH 1C2LA 1S6FA 3LH3A 1ZSLA 6CHAC 3LJJA 1OYTH 5ESTE 2P8OB 2C93B 1QBNA 2ODYB 3EA9A 4IMQA 4I8JA 5C5OA 1WUNH 3ZYEA 1ELGA 4E7NA 1CU1A 4ZKRU 4ZUHA 5E2PA 1P3EA 4O03A 1GBFA 1IQGA 1Q3XA 2I6QA 2QF0A 1MUEB 1GBHA 1EUFA 2BDIA 3RMLH 2OQ5A 4X2VA 3EE0B 3SZNA 5T6GA 1V2OT 2SGAA 2QCYA 1VITF 4PROA 4X8TH 4DY7B 3A84A 1NU7B 2CXVA 2G5VA 1TWXB 4X8VH 3SU0A 1MD8A 2BLOA 1Z8GA 1GJDB 2TBSA 4KP0A 4NFFA 4BANB 2Z3CA 1JBUH 2XWBI 3B9FH 5HXFA 3ITIA 1HAHH 3GDVA 4AYYB 1GBLA 1EQ9A 1HJ9A 2W5EA 1SGIB 1MTSA 1O2JA 2GVFA 3GY4A 4UFDH 4Z0KA 2BD8A 2EI8A 3PMBB 2A4QA 4IBLH 3FVFB 4ZROA 4U32A 4ABBA 1ELAA 3A87A 1J16A 1C2KA 3Q3XA 1B5GH 4X1PU 2BXUH 1QR3E 1V2PT 1EPTB 3EA8A 4M7GA 4DIHH 2A0QB 3VEQB 1GDNA 1T8NA 1V2WT 1GHAG 3AW1A 4WXVA 4AFUA 2R0LA 1GL0E 3TK6A 3LT3A 1MKWK 3O8BA 2WPMS 3RXRA 3UNSA 1MKXK 1DITH 4WWYA 3RC6A 4WXIA 1TOCB 3QZRA 3QLPH 2Q6DA 3M5OA 1SGTA 2C8WB 3GY8A 4DVAU 1BTPA 2W7UA 1FI8A 3MU0A 4LOYH 2VWMA 1G3DA 2QF3A 1LO6A 1SOZA 4JK6A 4ABAA 4AORA 1QNJA 1ZGIA 4Y10E 1AB9C 3WY8A 1X7AC 4E05H 2Q6FA 1TGBA 3URCA 4BXWA 1WSSH 1VCPA 3KNXA 2OBQA 5A2MH 3LGWA 1O5FH 1HYLA 1DWDH 2ZPSA 1ACBE 2BD2A 2GZ8A 2ZFSA 2QXHA 3ZZAA 3U98H 1XXFA 1OX1A 2Y5GA 1BJVA 4OS4A 3RXOA 1W11U 1AZ8A 4D9QA 1SGEE 5FX5A 3TH3H 4NFEA 3M61U 3CS0A 2Y6TA 5JBTA 1UTKA 2DE9A 1EKBB 1PYTC 1NU9A 3MMGA 2CF8H 3I29A 2RA0A 1D6RA 3S9BA 1C9TA 3ZVBA 1KDQB 1JMOH 3ZVGA 2XYAA 2PR3A 4ABDA 1XKBC 1O3LA 2FXRA 5F8XA 1KIGH 5ABWA 3UUZA 1FPCH 5FPSA 4YM9A 1DLKB 1K1PA 1O3FA 2O8TA 1MAXA 1TBQH 2FESH 2ZDKA 3FZZA 3N7OA 1A5HA 2A1DB 1SGYE 3O8DA 1FV9A 1YKTA 1T32A 1QHRB 6GCHG 1QB9A 3UR9A