4OS1A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk601 (bicyclic 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os1A01
1BMMH 2WUBA 3ZVAA 1K1NA 2PKSB 2D1JA 2FS9A 2VH6A 2G4TA 3CS0A 4FU9A 1FAKH 1T31A 1ANCA 1UCYK 3A80A 4FUDA 1EAIA 2A2XH 5DP8A 1O2YA 1YPHC 2ZDLA 1Y59T 1KXFA 4WMDA 2A32A 2SNVA 1UTOA 1PQ8A 1SGFA 4GSOA 5IYTA 4Z0KA 2OC1A 1O5AB 1OX1A 4Z6AH 2A2QH 2FM2A 3N7OA 3UR6A 1ZJKA 1G3DA 3SUFA 1EASA 1V2UT 1SGPE 4KGAA 4Y6DA 5DP9A 1BTYA 4ABJA 5F6MA 4I8KA 4NSVA 4X0WU 1CHOF 1HAPH 1ELTA 2JH5D 1SGRE 1HB0B 4H6SB 1GG6C 3RXOA 3S9BA 2ZDVH 2CF8H 1TWXB 2A45B 2AMPA 3TJUA 3TGIE 4B2BA 1O3MA 2P3UB 5I25A 1QL8A 3VGCC 1BQYA 1CU1A 3PLKA 5A2MH 1LKBA 2G52A 3HK6B 4OS5A 2XBWA 5EW1H 1NU9A 1IQEA 4YT7H 1AY6H 1TE0A 2A4RA 1HIAB 2J94A 1N6XA 1F0RA 2ODQA 2ZHDA 1TGBA 3DFLA 1LPKB 2J34A 2AH4X 3A7ZA 1DT2A 1INCA 1C5VA 3BEFB 1KIGH 2PUXB 1TPSA 2A7HA 4AFUA 1SGYE 4WJG2 2XBVA 2QN5T 5FPYA 1O3EA 1TNIA 4ISIH 1BRAA 5T6GA 1WTHD 2H9TH 1RS0A 3SJOA 3VB3A 1YC0A 1GI6A 4NWKA 4WXVA 4WMEA 4GPGA 4X2WA 3KQEA 1FLEE 1AE8H 4X1PU 1H9HE 2P93A 2C8WB 1GI7B 5DP3A 1Y3VA 1SC8U 1QA7A 3SQEE 8GCHF 1WCZA 8KME2 1W7XH 1FONA 1SLVB 1UTPA 1AUJA 3HGPA 1G36A 5EXMA 1UK4A 4CH8B 3PB1E 4XOJA 1ESBA 1EZSC 5JYIA 3ZZ7A 3BEIB 1ZHPA 1O2VA 3GY5A 2FZZA 2SFAA 1G9IE 1GGDC 1LKAA 1O34A 5BPEA 3VB5A 2F9PA 3M3TA 1QBOA 1ZSLA 2A31A 3LIWA 1DLKB 1EJNA 1ZPZA 3LH3A 3UWIA 1SSXA 3MU1A 1AFQC 1V2NT 2H1UA 2BQ6B 4CRCA 1O2HA 4CBNA 1AO5A 1GCTB 1YKTA 3FVFB 1PPEE 1TNKA 1TNGA 1C5QA 4MVNA 5ESBA 2R0KA 2FESH 1NS3A 1O5CB 3OU0A 4K60A 4H42U 1XX9A 5DP4A 2J4IA 3KNXA 4X6MA 5IDKA 1KXEA 4ZH8A 1PPFE 4YLQH 1A4WH 1ESTA 1B0FA 4CREA 1HAVA 1AGJA 4AG1A 2ZFTA 2F9UA 1OWIA 1VCQA 2UUYA 2XCNA 2CMYA 2HNTF 2BDCA 3ZV9A 1HAHH 2QA9E 2ANMH 3KHVA 1SGQE 4O9VA 3SO3A 2EA3A 5C3NA 1O2JA 2AS9A 3TH4H 4B1TA 4MNVA 3U8TH 2W3KA 2UWPA 1BMNH 3M5LA 1C4U2 1FJSA 2H6MA 3I29A 2FOBA 2HLCA 5F8TA 1GVLA 2ZFPH 1DUEA 1TNLA 1AI8H 4YOIA 1A5GH 1Z8RA 5PTPA 1WV7H 1PYTD 4ABEA 2UUKB 5SGAE 1ZPBA 3MYWA 5C1UA 1TQ0B 1XUKA 4NA8A 3U8RH 1EB2A 3GY3A 4JMYA 1SGDE 4OS1A 2HWLB 1TRMA 4JZIA 1C2JA 3GDVA 4M7GA 4H6TA 1FI8A 1OOKB 3TLOA 2THFB 1KLTA 1ZYOA 3TH3H 3U1IB 1AVXA 1ZTLA 1IQJA 1O2NA 4TPIZ 2G81E 1C5PA 1O2TA 1JOUB 1TBQH 2C3SA 2ZECA 1D3DB 1THPB 2ZTZA 2BVSH 4BOHA 5DP5A 2FI5E 1BTUA 2BXUH 4CH2B 4BAHB 4K5ZA 3QK1A 1CO7E 2FOFA 5L30H 1ETRH 1YPMH 1QB9A 4YZUA 4NFFA 3L6PA 3V13A 1F0UA 1E0FD 2BLQA 5FHTA 1EKBB 4I7YH 2GD4B 2Z94A 4IC5A 3LOXA 1V2LT 4O3UA 3STJA 1YBWA 3LH1A 1PPGE 1GG6B 4UFDH 3RLYH 1GDUA 1T4UH 1GDQA 1PJPA 3GDSA 3RC4A 3NXPA 4ISOA 4B74A 4A6LA 5E0GA 1AE5A 2R2WU 2CGAA 4ABGA 5LPRA 1IQKA 1NROH 3QDZB 4A5TS 1TGNA 2PSYA 2BX4A 2EEKA 1IQGA 1W8BH 1GBLA 3VGCB 1C2FA 1MTUA 3B8JA 1KDQA 2YNBA 2VWLA 1RTLA 1V2WT 1O3FA 1CSOE 1GJDB 3KCGH 1YF4A 1AB9C 1RJXB 2B7DH 4DIIH 1S0RA 1FY8E 1JRTA 1G2MA 1LQEA 1GBMA 1TA2A 1XKBC 2BYAX 3A88A 1P05A 1S6HA 5CE1A 1AWHB 3LC3A 2FLBH 2FX6A 2GCTC 2WPLS 1KSNA 1ZSJA 3M5MA 3TK6A 1ZLRA 2WPIS 2ZG0H 3A82A 4I33A 2PGBB 3OX7U 4K3JA 1L1NA 2V6NA 4Y8XA 2BZAA 3RXRA 4OS4A 2B5TB 4KTCA 3EAJA 1BIOA 3KQCA 3NZIA 5JBAS 5HMAA 1W2KH 2AYWA 1GBDA 2VIOA 4K1SA 1BJUA 1HLTH 3UTUH 3W95A 4TY7A 1O2QA 2ZP0H 3SJ8A 2XCFA 3A8BA 1RIWC 3ZZDA 2F9OA 4OGYA 1BCUH 1HAVB 2CF9H 4UFFH 1O38A 3GCNA 4NSYA 1GHAG 4U30A 1F92A 1FIWA 3PO1C 1MQ5A 5AVDA 3M3VA 2UUJB 1QJ7B 2WV5A 1GI8B 3L3TA 1GGDB 3TPIZ 6LPRA 5ABWA 3K6ZA 1OWJA 2SGDE 1IQLA 3F68H 3SZNA 4D76A 4CR9A 3SGBE 3EA7A 1AFQB 1T8MA 2Q6FA 1WUNH 3D49H 1BTZA 1BBRE 1O3BA 1S82A 2FI4E 1WAYB 3AAVA 3MH7A 2A7CA 5FBEA 2A4OA 1W7GH 2QF3A 1K1PA 3PMJA 1TALA 2BDGA 1O3AA 1MD8A 1O3LA 3P92A 1A3BH 1SOTA 5G4BA 2ULLA 5TCCA 3MU8A 2FXRA 4ZHLU 1A61H 1SGNE 3T5FH 3ZVCA 4DVAU 1H9LB 4XSKU 1OP8A 2XC0A 1MAXA 2PW8H 4WF8A 1ZHMA 2OD3B 1VCWA 5C5OA 5A8ZA 2GDDA 4UDWH 1P2OA 1NFUA 3ZYEA 1P03A 3SV8A 3LJOA 3TGJE 3URDA 5JBCS 3RU4E 2I6SA 1O3HA 1V2PT 3TH2H 1CGJE 4FU8A 2BY9X 1GBKA 4JYVH 3GYMA 1HGTH 5JPMH 3T26A 1GMCG 1JMOH 1TPAE 4RSPA 5TCAA 3LC5A 4MPWA 2Z9IA 2R3UA 3MHWU 3LKWA 1F5KU 3LT3A 1V2KT 2OINA 1LHCH 2BD4A 1GI2A 1L4DA 4I8LA 2ZGXH 5EXNA 1EZUC 1RRKA 1ACBE 1DLEA 2SGFE 4MPVA 1HPGA 1MBQA 2BXTH 1LDTT 2ZCHP 3A7XA 3OYPA 1O3GA 4OS6A 3SUGA 2FOAA 1UHBA 1PQAA 3SJKA 1KDQB 3TITA 2BZ6H 3SOSA 1SG8B 4Y0ZE 1QCPA 3ENSB 1O3PB 4BAMB 1LCYA 1P06A 1MD7A 4Q7YA 2VU8E 1HIAA 5F8XA 1DSTA 1GVZA 2XWBI 2A5IA 1SLXB 2GZ9A 1DUAA 1C2IA 4NIVA 4MG3A 2ZCLP 1C4Y2 1GI4A 3H7TA 4IS5A 1QL9A 1UVPA 1HYLA 4B76A 4DJZB 1C2KA 1T8LA 2QCYA 1DITH 5DG6A 1IHTH 1HRTH 1ANEA 1C1NA 1DANH 4LZ1H 1O39A 1QBNA 1HAYB 3EDXB 2Y82A 2W3IA 1O3NA 1GI5A 3M7UA 3VXFH 3I77A 2A4GA 2VJ1A 1DY9A 1TLDA 4DIHH 1TX6A 1AB9B 1S85A 3S69A 3ATLA 1C5SA 1GHAF 1NO9H 4UFGH 3BIUH 4OGXA 5C2ZA 1SLWB 2P3TB 3PWCA 1OS8A 4X2VA 1V2ST 3SU6A 3A8AA 1H4WA 4ASHA 1V3XA 4A1XA 1O2WA 2GDEH 1O32A 1QRZA 3S9AA 1WQSA 2P94A 1HAXB 3Q3YA 2GCTB 4NZLA 3ATMA 4IW4E 5FCRA 3TVJB 1CA8B 1QRWA 1E38B 1C1WH 1SMFE 1A0LA 4WMFA 1B0EA 4AZ2B 4Y7BA 3CENA 1MKXK 1ZMJA 2HPQH 4LZ4B 3GCHC 3QGNB 2XC5A 3KL6A 3AW0A 3O8DA 2GT8A 1AKSA 1XUHA 1C5XB 4RN6A 3A81A 1PQ7A 1G30B 4DOQA 4GAWA 3SGQE 4FXGH 2AEIH 1RIWB 3ITIA 3PV4A 3O8CA 1FY1A 2F9VA 3LONA 1NY22 1ZRKA 2W7SA 3PO1B 2CV3A 4X8VH 1ANBA 1QRXA 2WPKS 1RGQA 3LGTA 2XC4A 1PQ5A 4FUEA 3SUDA 1P02A 2J38A 1K1OA 5ETXA 1YLCA 3SU3A 1NRRH 1GMCF 2VWOA 1HNEE 1T4VH 6GCHG 3UQOA 1HJ8A 5EQSA 1GPZA 4BAOB 1C2GA 1GHVH 3UWJH 3UPEA 2ILNA 2FMJA 1AVGH 1D3TB 3IG6B 2BD8A 1GHWH 4ZKOU 4JZ1A 3HPTB 4FUJA 3TJOA 1J17T 3F9GA 4YOGA 3FZDA 4MDSA 3SNEA 3T25A 4CRAA 1E35B 3VPKA 3TNSA 2ZGHA 2QYIA 2PSXA 3BF6H 1ELVA 3RU4D 1IOEA 4WWYA 1ZPCA 1Q3XA 3O8RA 1O5BB 4YTAA 1EB1H 3K2UA 1IQNA 3ZZ3A 3VFEA 1GI0A 4WH8A 1UHBB 2V0BA 2Y7XA 1K1MA 3KGPA 3QZRA 2FYRA 3U9AH 1NPMA 1NRSH 3QWCH 4QT8C 3GCTG 1YLDA 4FUFA 1TGSZ 3BTHE 1QJ1B 2Y5GA 1TNJA 2OBOA 5C20A 1LPGB 4ABAA 4D9QA 2HNTE 1MU6B 3UNQA 4NA7A 1P0SH 1EZQA 1A2CH 3SU2A 1GBBA 2H5DA 2TIOA 1ETSH 2SGPE 1TMTH 3HATH 3E3TA 3OTJE 3SU5A 5C67A 1N1LA 1VZQH 1YCPH 1BTWA 7LPRA 2VGCC 1DY8A 1SVPA 3QX5H 3LGVA 1DS2E 1AWFH 2A7JA 1JWTA 5A0AE 1SHHB 4AN7A 1W0YH 4NA9H 1YPJH 5C1YA 3RMLH 7KMEH 3Q3KA 2R2MB 2JH0D 6ESTA 2PGQB 3M36A 4XFQA 2BHGA 1TABE 1K22H 4VGCC 2OCVB 1GDNA 1ZJDA 2EI7A 4YLUA 4BXSA 4K69A 2C93B 1ELAA 1AQ7A 1PPZA 3RXHA 1AN1E 1HV7A 3T62A 3BTDE 2HVXA 3MO9A 1JIMA 3UQVA 1ZOMA 3ZZ8A 3BG4C 1ZGIA 2H9HA 1EX3A 2ZF0H 3LPRA 2M5TA 5F03A 1MKWH 3UNRA 1UJ1A 1P09A 2ZIQH 1C9TA 4DW2U 5AF9H 4X6OA 2J9NA 1GJ8B 3LGIA 1UTMA 1BOQA 3PMHB 1F0SA 1LVYA 1TAWA 1Y3WA 3A84A 4LK4A 2XTTB 2ZFSA 3O8BA 7ESTE 2B8OH 1YPEH 1AKSB 2BDYA 1MTWA 2ALVA 5GXPA 3PTBA 1KLJH 5LH8A 4ABHA 4K8YA 3SQHE 3RMMH 3FZZA 3QO6A 2XBXA 1TA6A 2ZO3H 2R9PA 5JB8S 5DK1A 4UFEH 4XDEA 2VINA 3DA9B 1GJBB 2XYAA 2ASUB 1GBHA 6CHAC 5E2OA 3RM0H 1W10U 1EJMA 4IN1A 1TMUH 2ZPQA 5GJ4B 1ZMLA 4IN2A 2QV1A 4I31A 4R8TB 1UO6A 2QXIA 2WPMS 3P6ZB 2WUCA 1P04A 1XUJA 1HAOH 1TX8A 1GBFA 3PLPA 1YPLH 2O8TA 6GCHF 4GVUA 1ORFA 5EQRA 1AUTC 1G37A 1Y5AT 3TNTA 4HFPB 1YGCH 2FTLE 3GCHB 1P2QA 1E37B 2JETC 1MKXH 1ELDE 4IMQA 3TK5A 4Y11E 2BMGB 4F4OC 3RXMA 4XBCA 3PLBA 2ZQ1A 2O8WA 2H9EH 1FAXA 5F8ZA 4TWWA 3UNSA 2R3YA 3Q77A 1VITG 3RDZA 4B2CA 1WQVH 1THRH 1UCYH 1HUTH 1MUEB 1TPPA 1W13U 2ZEBA 1K9OE 3QGJA 4AGKA 1V6DA 1P2NA 2CJIA 5A8XA 3GCTF 4Y8YA 4CRBA 3DUXH 5EQQA 2BY7X 4GHQA 1HAZB 4FVBA 1F0TA 3ZVGA 1LPZB 2BVXH 2TGPZ 1C5YB 3FFGA 2GZ8A 4RKOB 1VCPA 1GMHG 1BTHH 2ZKSA 4YT6H 2UWOA 1D4PB 1VITH 1P9SA 1XVOA 3M61U 3NCLA 4ZAEA 4ABDA 1CA0C 1O2KA 5K7RA 2RG3A 5HXFA 1IQFA 2OC8A 2FTMA 1KTTB 1SFQB 3ZZ5A 3SI4H 3PYHA 2FOEA 2WPJS 1CQQA 1O0DH 2SGAA 3UOPA 2RCEA 5BRRE 2R0LA 3KN2A 2DUCA 3MNSA 1GBEA 1Q2WA 4UD9H 3SU0A 4NZQA 2QY0B 2BLVA 1EAXA 1MMJN 1BRBE 1ZR0A 1IAUA 1QJ6B 3Q76A 1A1RA 2SGEE 1W12U 4AG2A 1GCDA 2WPHS 2PR3A 1IQMA 3HKIB 1C9PA 5GWZA 2CXVA 3A7VA 3F1SB 1SOZA 2ZHQH 3ODDA 3B23B 2Q6GA 1GBCA 1LHFH 4X2YA 5EU8A 3S7HB 1OWDA 3H7OA 1BMLA 1GI9B 1QBVH 1EOJA 1P12E 3PMBB 1O2PA 1XUFA 1Z8JB 3TGKE 5I46H 2HPPH 3D65E 3S9CA 2B0FA 3HKJB 4R0IA 1BT7A 3NPSA 3VEQB 1QNJA 1QY6A 2VGCB 1D3PB 1LVMA 4YO9A 5FAHA 3SV9A 1ELCA 2SNWA 2VIQA 2FIRH 4VGCB 2ZDMA 3QTVH 4ABFA 2FS8A 1OP2A 3GY2A 1Z1IA 3RXKA 1DWEH 3D62A 3ZVDA 1SGFG 3E16B 2WINI 1QHRB 1RTKA 3OSYA 3TJNA 3A89A 1VGCC 1BA8B 1O2SA 2D26C 3ZZAA 1F7ZA 3GISB 3SV6A 3PTNA 3R0FA 5ESTE 1XVMA 1LMWB 3BG4B 1Z6EA 3P8GA 3TIUA 4I8JA 2EI6A 3M7TA 1MTVA 3BTKE 2VIDA 4X1QU 1RD3B 1FQ3A 2STAE 2ZDNA 1A46H 1YPGH 3M37A 3ZZBA 1OWEA 2Q1JA 2WV4A 1G32B 1SQTA 1QB6A 2C4FH 2OC7A 4NCYA 1ZTKA 5E0HA 3MU0A 4MPUA 1L2EA 1EQ9A 1QIXB 3S0NA 5EG4A 4AGJA 4INHA 3V0XA 2ANKH 1SHYA 4UE7H 3SW2B 2J95A 2F91A 5HGGA 1EP6A 1J9CH 2AGIX 1Y8TA 1CT2E 1QA0A 4UEHH 1DICA 2CHAC 2O8MA 2ZHEH 3RXVA 3GY7A 1GBAA 1YPKH 1UK3A 3RXPA 1VITF 4JCNA 2FOMB 4MPXA 2HGTH 4TPYA 4O03A 2XRCA 1AFEH 4CBOA 9LPRA 1GJ4H 2HOBA 1SGIB 3URCA 1K21H 1C5OH 5CHAC 1TMBH 1H8DH 4MLFB 4UONA 6CHAB 3BTEE 1S5SA 1PPHE 1KXAA 1KLIH 2HALA 3LGYA 1SL3A 2VVVA 2J92A 3T2NA 2PHBA 4JZFH 1B5GH 1GMHF 4MNXA 2D2DA 3C27B 1O3DA 4J1YA 1BJVA 4O97A 1UMAH 4CHAC 1AMHA 2JETB 1NFXA 1S84A 1CVWH 1MQ6A 3A86A 5K0HA 5HM9A 3JZ1B 5TJXA 1GJ9B 3RLWH 3ZVBA 1FY3A 2ZI2H 1V2OT 2EC9H 3ZV8A 2F83A 3BTME 2Z9JA 3P17H 2GGVB 1SBWA 1YPHE 2NU0E 3E8LA 4JK6A 4Y7AA 4Q7ZA 1JRSA 4NFEA 1LVOA 5EODA 3UY9A 1ABJH 4JZDH 2C8YB 1WBGB 1EOLA 2NU3E 4IGDA 3SJIA 3TK9A 5B6OA 2VWMA 5CMXH 1EUFA 1D3QB 2G8TA 2FPZA 4I8HA 1NESE 4THNH 1K1JA 4YOJA 2FYQA 3EGKH 1P2KA 2OBQA 2IJOB 4YM9A 3SGAE 1Z6JH 2SGQE 1ETTH 3SV2H 1JIRA 3M5OA 3P8OA 2G5VA 2FDAA 1UTNA 1UK2A 1OYTH 4RKJB 3RXQA 1BHXB 3QN7A 3ZVFA 1C5TA 2G4UA 4O3TA 3BTGE 1TPOA 3DHKH 2BX3A 1CA0B 1T7CA 2AMDA 2KAIA 4E7NA 4E05H 5T6DA 1U6QA 4AX9H 3BEUA 4AB9A 1CGIE 4MQAA 2ZQ2A 2ANYA 2HRVA 4GUXA 1RTFB 1IQHA 1P57B 1HJAC 3EA8A 1O2UA 1TOMH 3M7QA 2BVRH 4D7FA 2PUQH 4WH6A 2TGAA 2VVUA 3ESTA 2G5NA 5E2PA 1HXEH 3BV9B 4B2AA 1THSH 1OWHA 2Y7ZA 3F9EA 4NIYA 2DE8A 4A1VA 4FUBA 4X2XA 1BRUP 4DY7B 1UVOA 4ZXYH 2BD9A 3UIRA 1EP5A 1NC6A 5EGMA 1BRCE 3M35A 1O35A 1E34B 1T8OA 3BIVH 1PFXC 3GICB 4GCHG 5A0CA 2ZGJA 3MO3A 3SUEA 2BB4A 1XUGA 2IOTA 1F5LA 4Q80A 1NT1A 2OP9A 1Q31A 1VJAU 2PV9B 5DPAA 1Y5UT 2JH6D 5H4IB 3SORA 3MH4A 1O2LA 1O3CA 4WVPE 1P8VC 4WY3A 1ZTJA 4DGJA 5JDUB 3BTTE 1IQIA 1FV9A 1GBIA 1X7AC 4X8UH 3ZZ4A 2G51A 3RXTA 2Z7FE 3GY4A 1DWCH 2BDIA 4ZKRU 2G00A 4A7IB 1K2I1 1FNIA 1QR3E 1B7XB 1GBTA 1HAGE 4FVDA 4AYVB 1C1TA 1QQ4A 4FUIA 2ZTYA 2P3FH 4A1TA 3GY8A 3ZYDA 1VGCB 3Q3XA 4MNWA 1VJ9U 3NWUA 1FY5A 1TNHA 4D7GA 2JKHA 4MNYA 3SU4A 1TX7A 1KYNA 3ATKA 2LNCA 2GKVE 3F9HA 3FP6E 1GMDG 3IITA 4NG9H 4KTUA 5L2ZH 2BOHB 2B9LA 4DT7B 1DWBH 3T28A 4Q2KA 5EPNA 2A4QA 1GHBG 1GJ7B 1O37A 4JYTA 1C5MD 3P8FA 1UVTH 2ZU2A 4NGAH 1FMGA 2BDBA 1C1OA 1NZQH 1O5FH 4ZKSU 3GOVB 4BAKB 2BLOA 1L1JA 4U32A 5T3HA 1KXCA 3VB7A 1NTPA 4TYDA 5E8EH 3UREA 1Z1JA 4XBDA 1P10A 3MNCA 2ZFQH 5A0BA 2ZU5A 3ATIA 1W0ZU 2OTVA 3MMGA 2ZZUH 1UTKA 2Z9LA 5FBIA 2ZWLH 1ZHRA 1AZ8A 1A0HB 1C1VH 2STBE 2CHAB 2GZ7A 2Y6TA 3SJ9A 3UUZA 5AFYH 3FANA 2NU2E 2GCHG 8ESTE 5JBBS 1XMNB 1P2JA 4ZKNU 2YOLA 3A7YA 1TRYA 2BM2A 2BY6X 1FN6A 1MAYA 1O2XA 5CHAB 1O2MA 4K1TA 1ELFA 2BY8X 3UFAA 1J14A 4LXBH 5A8YA 1ABIH 2ODPA 1C2EA 1C1SA 1XKAC 4ISHH 4BTTB 1XUIA 3I78A 2C8ZB 4FUGA 3E0PB 4FUHA 3ELAH 1YP9A 4JYUH 3RUOA 1ELEE 2NU4E 1AZZA 1CBWC 1HAIH 3MH6A 3T27A 4CHAB 2ZDAH 1WU1A 4ZXXH 2ZU1A 4KELA 2KAIB 4KP0A 1C1UH 2GVFA 1LHDH 2GMTC 4X1NU 3RXLA 3QLPH 3BTQE 4Y71A 5JBTA 2VB0A 4Y76A 4BTIB 1BZXE 1TGCA 2Z3DA 1D6RA 2PWXA 4LOYH 3W94A 4OS2A 3CS7A 1Y5BT 4D8NA 1SGEE 1IHSH 2ZHWH 3GCOA 3C1KA 3M5NA 3ODFA 2AGEX 1J15A 1O33A 1GVKB 1PPBH 4F49A 3GYLB 2ANWA 1GJCB 2V35A 1V2TT 1SLUB 1TOCB 1P2IA 2BDHA 4GCHF 3RXAA 1Z7KA 1C5LH 3BN9A 3RU4T 3SNDA 5C1XA 1DX5M 2PFEA 3AAUA 2UUFB 3G01A 1BBRK 4BXWA 5A09A 2Y5HA 1GI3A 3RXGA 2ZPSA 1ANDA 4HI3A 2K1QA 3MWIU 2G55A 1BITA 1E36B 2FO9A 1V2QT 3BG8A 5EW2H 4GLYA 1P3CA 1ZZZA 1CHGA 1Z71A 1HJAB 1ELGA 2QXHA 4Y8ZA 1YYY1 1O5DH 1S81A 3QUMP 1A0JA 3MNXA 3A85A 1PYTC 2PTCE 2ZNKH 1NRQH 2GTBA 1CE5A 4DG4A 2XWAA 3DFJA 3KF2A 3MU5A 3RC5A 4CRFA 4AOQA 3BTFE 1MTNC 1EAWA 3LJJA 2OQ5A 5GDSH 1MH0A 2XW9A 5L6NH 1XM1A 3BTWE 2FLRH 2TBSA 1TGTA 4X1SU 2C90B 2NU1E 2PKAB 1C1PA 1GBJA 1KTSB 1S0QA 2ZFFH 1QURH 3TJVA 1GMDF 4IC6A 1V2VT 4CR5A 1ZSKA 1O5EH 1V2JT 2OLGA 4ZMAH 1H8IH 1ID5H 2F9NA 3E90B 1EPTC 3A8DA 4J2YB 1ELBA 2BTCE 3NUMA 4XE4A 5EOKA 1GHBF 3QZQA 1O2IA 2I6QA 4DCDA 1TBRH 4XBBA 5E0JA 1KY9A 1QGFA 1S6FA 1TONA 4AFZA 3V3MA 1MCVA 1QTFA 1BTPA 1C1QA 1UTLM 1SPJA 2VH0A 2W5EA 2BD3A 2ZU4A 1BMAA 4ESTE 1MBMA 2IPHA 1CT4E 1ZMNA 2GCHF 2ZFRH 1AU8A 1O3IA 1SGTA 1C1RA 4B73A 1BHXF 2HNTC 4GHTA 3UR9A 1C2HA 1V2MT 1SQOA 4K2YA 1DOJA 1UVSH 4IBLH 3P95A 3RXIA 5L2YH 4K1EA 4FU7A 4A92A 3U1JB 1Z8IB 2VVCA 1T32A 1J16A 2BY5X 3SNCA 1O30A 3WY8A 1EPTA 2OC0A 3P70B 4MTBA 5J4QA 3MFJA 3MI4A 1H9IE 1NRPH 1Y3YA 2XBYA 3PROA 4OS7A 2FEQH 1G3BA 1GWAA 2VNTA 4Q7XA 1QQUA 3A83A 1OWKA 1TFXA 2FWWA 4JZEH 5FX5A 3RC6A 1C2MA 2FOCA 5GCHG 3CP7A 1G2LA 1UCYE 2Y5FA 1GJAB 4ISNA 3GY6A 1EJAA 1OP0A 1DXWA 1WOFA 1P11E 1MTSA 1SFIA 2Z9GA 1LHGH 2Z3EA 2FP7B 3E1XB 3K9XB 4PROA 1C2LA 2XXLA 4X6NA 1A7SA 1DFPA 2BQWB 2P16A 1GI1A 3KIDU 1SGCA 3E6PH 1O2RA 3V7TA 1VR1H 2RA3A 4X8TH 2ZGBH 2BD2A 2ZC9H 2C8XB 5T6FA 1QFKH 1SQAA 1T8NA 3AASA 4TWYA 5DP6A 1FY4A 1S83A 3MNBA 1GJ6A 2XNIA 3U69H 1A5IA 2TGTA 4Y10E 2W26A 2NWNA 1WTGH 1TRNA 3RXEA 1OYQA 2AGGX 1CBWB 3P8NA 1ZRBA 1C5NH 2A5AA 1NFWA 1TB6H 4TY6A 1FN8A 3LDXH 2Y81A 3D23A 3A8CA 1O2OA 3FAOA 2GMTB 2ZCKP 3MOCA 2ALPA 4SGBE 3A7WA 3RXCA 3IWMA 4D9RA 5J4SA 1N8OC 2QF0A 4NIWA 1FIZA 3MH5A 5C5NA 4Y0YE 2QIQA 2P8OC 5EXLA 2GV6A 2Z9KA 4E06H 4ISLA 1Y3XA 4ZHMU 4KKDA 5HYOA 3RXBA 1QB1A 1DE7H 1UTJA 2FODA 3EE0B 1WYKA 3MO6A 2PLXA 1Y3UA 4BTUB 1P9UA 1EZXC 1FXYA 7GCHG 2EI8A 1FDPA 2A0QB 5FPSA 1C5ZB 4H4FA 3EA9A 1BDAA 1SB1H 1HDTH 2OXSA 1L0ZA 1LVBA 2QGRA 4U2WA 1F2SE 3RP2A 4B75A 1BBRH 3RXSA 3HGNA 2A1DB 2PKSC 3RXFA 1ESAA 1GHZA 2AIQA 4YESB 3MU4A 3AVZA 5AFZH 5LGOA 5LPFA 3DT0H 5DGJA 2OUAA 1AHTH 3PMAB 2QC2A 1C4V2 3SI3H 4JK5A 1DSUA 1DWDH 5DJ7A 1NU7B 2ODYB 4B71A 1G3CA 1M9UA 4HZHA 1G3EA 4ZROA 1BUIA 3JZ2B 1NM6A 1MTNB 3S7KB 1AIXH 3FP7E 3RMOH 5JB9S 1W14U 4AB8A 5LPEA 2VWNA 2O9QA 1OXGA 4DURA 2GT7A 3GDUA 3SHAH 3PM3A 2ZDKA 3SBKA 3SNAA 1O2GH 3U8OH 3KQDA 2WYGA 4SGAE 5FPTA 1A5HA 4BANB 1H1BA 2H2ZA 4I32A 3Q00A 1GHYH 2GV7A 4X1RU 2LPRA 1EPTB 3K65B 1O3OA 3VB6A 4X6PA 2FI3E 3SU1A 1K1IA 5AHGH 3F6UH 2F9BH 1UVUH 3LU9B 1CT0E 3A7TA 2Z6BD 3H5CB 1AVWA 1P01A 1FPHH 5FXLA 2QXGA 1W11U 4U01A 1O3JA 1OPHB 8LPRA 2TPIZ 3EQ0H 2QXJA 2FOGA 3LGWA 2J2UA 5GCHF 4ABBA 3BSQA 1HJ9A 2A5KA 3F9FA 1Z8GA 1BB0B 4BAQB 1YM0A 1RXPA 1TBZH 1ZGVA 3STIA 1L4ZA 2ZHFH 2O8UA 1P3EA 3R3GB 1D9IA 1GJ5H 3L33A 3U98H 1FZZA 4Y79A 9ESTA 1NN6A 2P59A 1DM4B 1MCTA 1YCPM 1O2ZA 3OY5U 1YCPK 5EPYA 3RXUA 1W3CA 3TU7H 1FUJA 4KTSA 1A3EH 1MZAA 3AW1A 1DVAH 1CHOG 1V2RT 3ATWA 3SN8A 4AYYB 3RMNH 1O5GH 1LTOA 1O3KA 4INLA 1HCGA 1D6WA 4FUCA 2DE9A 1NRNH 1RFNA 4HGCA 4INKA 1EAUA 3ZZCA 4NIXA 1WSSH 3NKKA 3RXDA 1AD8H 3A87A 3E0NB 1UTQA 2WYJA 2AIPA 2AFQB 4AFSA 4E7RG 4HTCH 4BNRA 3SV7A 1XXDA 1HFDA 1GL1A 2Q6DA 2IN2A 4AFQA 1DPOA 3KEEA 1MZDA 3ZZ9A 3V12A 1QL7A 5DP7A 1O31A 2ESTE 3SHCH 2BD5A 1MKWK 1N6YA 2Y80A 1HBTH 1GHXH 1KXDA 1XXFA 4WXIA 3OY6U 2ZA5A 1C1MA 2D8WA 3T29A 2W7UA 2BDAA 2FOHA 2OQUA 1L1GA 1GL0E 1DXPA 3KQBA 2RDLA 3EYDA 2TGDA 1K28D 3MTYA 3PWBA 1LHEH 1OSSA 1TIOA 2ZTXA 5DKMA 3E91A 4X8SH 3VXEH 1GCTC 3UOUA 3ZZ6A 7GCHF 1F5RA 1JBUH 2RA0A 2VIVA 2TRMA 1HXFH 1LQDB 1TYNA 5FX6A 2BQ7B 1PPCE 1TQ7B 1K1LA 2AERH 2BOKA 2VIPA 1KXBA 4CRGA 1JXPA 1O36A 4ZUHA 2F3CE 2ZPRA 8GCHG 1C5UA 3NK8A 1MU8B 4CRDA 1OKXA 2GP9B 3LGUA 2ZU3A 1N8OB 2BD7A 3RM2H 1DDJA 2GX4A 3RXJA 1NFYA 2O8LA 2ZGCA 5DO4H 1J8AA 2P8OB 2VIWA 4ZHAA 3B9FH 2V3HH 2YNAA 2V3OH 4AORA 1C5RA 1C5WB 1CGHA 2QAAA 4NWLA 1EATA 4I8GA 1SI5H 3FP8E 3QTOH 3SNBA 2H5CA 2Z3CA 3K6YA 2CN0H 1ARBA 1FPCH 5GPIB 1BTXA 1ARCA 3ZVEA 5FCKA 4ABIA 3DD2H 1LO6A 2PKAA 5GIBA 2FX4A 3HK3B 3VB4A 5HM2A 2P95A 3M3SA 1C2DA 2UWLA 1P2MA 1EXFA 1SR5C 2PTNA 4IMZA 2AMQA 4K8BA 2BLWA
chains in the Genus database with same CATH superfamily
1BMMH 2WUBA 3ZVAA 1K1NA 2PKSB 2D1JA 2FS9A 2VH6A 2G4TA 3CS0A 3NRLA 4FU9A 1FAKH 1T31A 1ANCA 1UCYK 3A80A 4FUDA 1EAIA 2A2XH 5DP8A 1O2YA 1YPHC 2ZDLA 1Y59T 1KXFA 4WMDA 2A32A 2SNVA 1UTOA 1PQ8A 1SGFA 4GSOA 5IYTA 4Z0KA 2OC1A 1O5AB 1OX1A 4Z6AH 2A2QH 2FM2A 3N7OA 3UR6A 1ZJKA 1G3DA 3SUFA 3EE7A 3F2HA 1EASA 1V2UT 1SGPE 4KGAA 4Y6DA 5DP9A 1BTYA 4ABJA 5F6MA 4I8KA 4NSVA 4X0WU 1CHOF 1HAPH 1ELTA 2JH5D 1SGRE 1HB0B 4H6SB 1GG6C 3RXOA 5C17A 3S9BA 2ZDVH 2CF8H 1TWXB 2A45B 2AMPA 3TJUA 3TGIE 4B2BA 1O3MA 2P3UB 2F43B 5I25A 1QL8A 3VGCC 1YWUA 1BQYA 1CU1A 3PLKA 5A2MH 1LKBA 2G52A 3HK6B 1BMFD 4OS5A 2J98B 5HKKD 2XBWA 5EW1H 1NU9A 1IQEA 4YT7H 1AY6H 1TE0A 2A4RA 2K8IA 1HIAB 2J94A 1N6XA 1F0RA 2ODQA 4XRNA 2ZHDA 3CNRA 1TGBA 1S6LA 3DFLA 1LPKB 2J34A 3N99A 2AH4X 3A7ZA 1DT2A 1INCA 1C5VA 3BEFB 1KIGH 2PUXB 1TPSA 3N7EA 2A7HA 4AFUA 1SGYE 4RT1A 4WJG2 2XBVA 2QN5T 5FPYA 1O3EA 1TNIA 4ISIH 1BRAA 5T6GA 1WTHD 2H9TH 1E79D 1RS0A 3SJOA 3VB3A 1YC0A 1GI6A 4NWKA 4WXVA 4WMEA 4GPGA 4X2WA 3KQEA 1FLEE 2J5UA 1AE8H 4X1PU 1H9HE 2P93A 2C8WB 1GI7B 5DP3A 1Y3VA 1SC8U 1QA7A 2W6JD 3SQEE 8GCHF 1WCZA 8KME2 1W7XH 1FONA 1SLVB 1UTPA 1AUJA 3HGPA 1G36A 5EXMA 1UK4A 2QF4A 4CH8B 3PB1E 4XOJA 1ESBA 1EZSC 5JYIA 3ZZ7A 3BEIB 1ZHPA 1O2VA 3GY5A 2FZZA 2SFAA 1G9IE 1GGDC 1LKAA 1O34A 5BPEA 3VB5A 2F9PA 3M3TA 1QBOA 1ZSLA 2A31A 3LIWA 1DLKB 1EJNA 1ZPZA 3LH3A 4Q63A 3UWIA 1SSXA 3MU1A 1AFQC 1V2NT 2H1UA 2BQ6B 4CRCA 1O2HA 4CBNA 1AO5A 1GCTB 1YKTA 3FVFB 1PPEE 1TNKA 1TNGA 1C5QA 4MVNA 5ESBA 2R0KA 2FESH 1NS3A 1O5CB 3OU0A 1E1RD 4K60A 4H42U 1XX9A 5DP4A 2J4IA 3KNXA 4X6MA 5IDKA 1KXEA 4ZH8A 1PPFE 4YLQH 1A4WH 1ESTA 1B0FA 4CREA 1HAVA 1AGJA 4AG1A 2ZFTA 2F9UA 1OWIA 1VCQA 2UUYA 2XCNA 2CMYA 2HNTF 2BDCA 3ZV9A 2IPQX 1HAHH 2QA9E 2ANMH 2YMSC 3KHVA 1SGQE 4O9VA 3SO3A 2EA3A 5C3NA 1O2JA 2AS9A 3TH4H 4B1TA 2LP6A 4MNVA 3U8TH 2W3KA 2UWPA 1BMNH 3M5LA 1C4U2 1FJSA 2H6MA 3I29A 2FOBA 2HLCA 5F8TA 1GVLA 2ZFPH 3MQKC 1DUEA 1TNLA 1AI8H 4YOIA 1A5GH 1Z8RA 5PTPA 1WV7H 1PYTD 4ABEA 2UUKB 5SGAE 2WPDD 1ZPBA 3MYWA 5C1UA 1TQ0B 1XUKA 4NA8A 3U8RH 1EB2A 3GY3A 4JMYA 1SGDE 4OS1A 2HWLB 1TRMA 4JZIA 1C2JA 1YY3A 3GDVA 4M7GA 4H6TA 1FI8A 1OOKB 2KM0A 3TLOA 2THFB 1KLTA 1ZYOA 3TH3H 3U1IB 1AVXA 1ZTLA 1IQJA 1O2NA 4TPIZ 2G81E 1C5PA 1O2TA 1JOUB 1TBQH 1WXRA 2C3SA 2ZECA 1D3DB 1THPB 2ZTZA 2BVSH 4BOHA 5DP5A 2FI5E 1BTUA 2BXUH 4CH2B 4BAHB 4K5ZA 3QK1A 1CO7E 2FOFA 5L30H 1ETRH 1YPMH 1QB9A 4YZUA 4NFFA 3L6PA 1SKYE 2JJ2D 1F0UA 3V13A 1E0FD 2BLQA 5FHTA 1EKBB 4I7YH 2GD4B 2Z94A 4IC5A 3LOXA 1V2LT 4O3UA 3KYFA 3STJA 1YBWA 3LH1A 1PPGE 1GG6B 4UFDH 3RLYH 1GDUA 1T4UH 1GDQA 1PJPA 3GDSA 3RC4A 3WW7A 3NXPA 4ISOA 4B74A 1W0JD 4A6LA 3DSGA 5E0GA 1AE5A 2R2WU 2CGAA 4ABGA 5LPRA 1IQKA 1NROH 3QDZB 4A5TS 1TGNA 2PSYA 2BX4A 2EEKA 1IQGA 1W8BH 1GBLA 3VGCB 1C2FA 1MTUA 3B8JA 1KDQA 2YNBA 2VWLA 1RTLA 1V2WT 1O3FA 5IK2D 1CSOE 1GJDB 3KCGH 1YF4A 2WSSD 1AB9C 1RJXB 2B7DH 4DIIH 1S0RA 1FY8E 1JRTA 1G2MA 1LQEA 1GBMA 1TA2A 1XKBC 2BYAX 3A88A 1P05A 1S6HA 5CE1A 5DN6D 1AWHB 3LC3A 2FLBH 2FX6A 4TSFD 2GCTC 2WPLS 1KSNA 1ZSJA 3M5MA 3TK6A 1ZLRA 2WPIS 2ZG0H 3A82A 4I33A 2V7QD 2RDEA 2PGBB 3OX7U 4K3JA 1L1NA 2V6NA 4Y8XA 2BZAA 2GJGA 3RXRA 4OS4A 2B5TB 4KTCA 3EAJA 1BIOA 3KQCA 3NZIA 5JBAS 5HMAA 1W2KH 2AYWA 1GBDA 2VIOA 4K1SA 1BJUA 1HLTH 3UTUH 3W95A 4TY7A 1O2QA 2ZP0H 3SJ8A 2XCFA 3A8BA 1RIWC 3ZZDA 2F9OA 4OGYA 1BCUH 1HAVB 2CF9H 4UFFH 1O38A 3GCNA 4NSYA 1GHAG 4U30A 1F92A 1FIWA 5B6LA 3PO1C 1MQ5A 5AVDA 3M3VA 2UUJB 1QJ7B 2WV5A 1GI8B 3L3TA 1GGDB 3TPIZ 6LPRA 3WWFA 5ABWA 3K6ZA 1OWJA 2SGDE 1IQLA 3F68H 3SZNA 4D76A 4CR9A 3SGBE 3EA7A 1AFQB 2V3MA 1T8MA 2Q6FA 1WUNH 3D49H 1BTZA 1BBRE 3U28C 1O3BA 1S82A 2FI4E 1WAYB 3AAVA 3MH7A 2A7CA 5FBEA 2A4OA 1W7GH 2QF3A 1K1PA 3PMJA 1TALA 2BDGA 1O3AA 1MD8A 1O3LA 3P92A 1A3BH 1SOTA 5G4BA 2ULLA 5TCCA 5KEDA 3MU8A 2FXRA 4ZHLU 1A61H 1SGNE 3T5FH 3ZVCA 4DVAU 1H9LB 4XSKU 1OP8A 2XC0A 1MAXA 2PW8H 4WF8A 1ZHMA 2OD3B 1VCWA 5C5OA 5A8ZA 2GDDA 4UDWH 1P2OA 1NFUA 3ZYEA 1P03A 3SV8A 3LJOA 3TGJE 2YMSB 3URDA 5JBCS 3RU4E 2I6SA 1O3HA 2VBCA 3UB0A 1V2PT 3TH2H 1CGJE 2W6ID 4Q4LA 2HLDD 4FU8A 2BY9X 1GBKA 4JYVH 3GYMA 1HGTH 5JPMH 3UAIC 3T26A 1GMCG 1JMOH 1TPAE 4RSPA 5TCAA 3LC5A 4MPWA 2Z9IA 2R3UA 3MHWU 3LKWA 1F5KU 3LT3A 1V2KT 2OINA 1LHCH 2BD4A 1GI2A 1L4DA 4I8LA 2ZGXH 5EXNA 1EZUC 1RRKA 1ACBE 1DLEA 2SGFE 4MPVA 1HPGA 1MBQA 2BXTH 1LDTT 2ZCHP 3A7XA 3OYPA 1O3GA 4OS6A 5CHBA 3SUGA 2FOAA 1UHBA 3KYGA 1PQAA 1NBME 3SJKA 1KDQB 3TITA 2BZ6H 3SOSA 1SG8B 4Y0ZE 1QCPA 3ENSB 1O3PB 2J98A 4BAMB 1SQRA 1LCYA 1P06A 1MD7A 4Q7YA 2VU8E 1HIAA 5F8XA 2M2AA 1DSTA 1GVZA 2XWBI 2A5IA 1SLXB 2GZ9A 1DUAA 1C2IA 4NIVA 4MG3A 2ZCLP 1C4Y2 1GI4A 3H7TA 5KECA 4IS5A 1QL9A 1UVPA 1HYLA 4B76A 4DJZB 1C2KA 1T8LA 2QCYA 1DITH 5DG6A 1IHTH 3DSOA 1HRTH 1ANEA 1C1NA 1DANH 4LZ1H 1O39A 1QBNA 1HAYB 3EDXB 2Y82A 2W3IA 1O3NA 1GI5A 3M7UA 3VXFH 3I77A 2A4GA 2VJ1A 1DY9A 1TLDA 4DIHH 1TX6A 1AB9B 1S85A 3S69A 3ATLA 1C5SA 1GHAF 1NO9H 4UFGH 3BIUH 4OGXA 5C2ZA 1SLWB 2P3TB 4OM9A 3PWCA 1OS8A 4X2VA 1V2ST 3SU6A 3A8AA 1H4WA 4ASHA 1V3XA 3OAAD 4A1XA 1O2WA 2GDEH 1O32A 1QRZA 3S9AA 1WQSA 2P94A 1HAXB 3Q3YA 2GCTB 4NZLA 3ATMA 4IW4E 5FCRA 3TVJB 1CA8B 1QRWA 1E38B 1C1WH 1E1QD 1SMFE 1A0LA 4WMFA 1B0EA 4AZ2B 1MABB 4Y7BA 4ZCNA 3OE7D 3CENA 1MKXK 1ZMJA 2HPQH 4LZ4B 3GCHC 3QGNB 2XC5A 3KL6A 3AW0A 3O8DA 2GT8A 1AKSA 1XUHA 1C5XB 4RN6A 3A81A 1PQ7A 1G30B 4DOQA 4GAWA 3SGQE 4FXGH 2AEIH 1RIWB 3ITIA 3PV4A 3O8CA 1FY1A 2F9VA 3LONA 1NY22 1ZRKA 2W7SA 3PO1B 5KGOA 2CV3A 4X8VH 1ANBA 1QRXA 2WPKS 1RGQA 3LGTA 2XC4A 1PQ5A 4FUEA 3SUDA 1P02A 2J38A 5EJ1A 2F4LA 1K1OA 5C0UA 5ETXA 1YLCA 3SU3A 1NRRH 1GMCF 2VWOA 1HNEE 1T4VH 6GCHG 3UQOA 3ZIAD 1HJ8A 5EQSA 1GPZA 4BAOB 1C2GA 1GHVH 3UWJH 3UPEA 2ILNA 2FMJA 1AVGH 1D3TB 3IG6B 2BD8A 1GHWH 4ZKOU 4JZ1A 3HPTB 4FUJA 3TJOA 1J17T 3F9GA 4YOGA 3FZDA 4MDSA 3SNEA 3T25A 4CRAA 1E35B 3VPKA 3TNSA 2ZGHA 2QYIA 2PSXA 3BF6H 1ELVA 3RU4D 1IOEA 4WWYA 1ZPCA 1Q3XA 3O8RA 1O5BB 4YTAA 1EB1H 3K2UA 1IQNA 3ZZ3A 3VFEA 1GI0A 4WH8A 1UHBB 2V0BA 3H09A 2Y7XA 1K1MA 3KGPA 3QZRA 2FYRA 3U9AH 1NPMA 1NRSH 3QWCH 4QT8C 3GCTG 1YLDA 4FUFA 1TGSZ 3BTHE 1QJ1B 2Y5GA 1TNJA 2OBOA 5C20A 5CDFE 1LPGB 4ABAA 4D9QA 2HNTE 1MU6B 3UNQA 4NA7A 1P0SH 1EZQA 1A2CH 3SU2A 1GBBA 2WZQA 4YXWD 1QZ8A 2H5DA 2TIOA 5FL7D 5C0TA 2KCOA 1ETSH 2SGPE 1TMTH 3HATH 3E3TA 3OTJE 1W0KD 3SU5A 5C67A 1N1LA 1VZQH 1YCPH 1NBMD 1BTWA 7LPRA 2VGCC 1DY8A 1SVPA 3QX5H 3LGVA 1DS2E 1AWFH 2A7JA 1JWTA 5A0AE 1SHHB 4AN7A 1W0YH 4NA9H 1YPJH 5C1YA 3RMLH 7KMEH 3Q3KA 2R2MB 2JH0D 6ESTA 2PGQB 3M36A 4XFQA 2BHGA 1TABE 1K22H 4VGCC 2OCVB 1GDNA 1ZJDA 2EI7A 2JIZD 4YLUA 4BXSA 4K69A 2C93B 1ELAA 1AQ7A 1PPZA 3RXHA 1AN1E 1HV7A 3T62A 3BTDE 2HVXA 3MO9A 1JIMA 3UQVA 1ZOMA 3ZZ8A 3BG4C 1ZGIA 2H9HA 1EX3A 2ZF0H 3LPRA 2M5TA 5F03A 1MKWH 3UNRA 2XNDD 1UJ1A 4P00A 2JDID 1P09A 2ZIQH 1C9TA 4DW2U 5AF9H 4X6OA 2J9NA 1GJ8B 3LGIA 1UTMA 1BOQA 1FX0B 3PMHB 1F0SA 1LVYA 1KMHB 4RT0A 1TAWA 1Y3WA 3A84A 4LK4A 2XTTB 2ZFSA 3O8BA 7ESTE 2B8OH 1YPEH 1AKSB 2BDYA 1MTWA 2ALVA 5GXPA 3PTBA 1KLJH 5LH8A 4ABHA 4K8YA 3SQHE 3F2GA 3RMMH 3FZZA 3QO6A 2XBXA 1TA6A 2ZO3H 2R9PA 4DT4A 5JB8S 5DK1A 4UFEH 4XDEA 2VINA 3DA9B 1GJBB 2XYAA 2ASUB 1GBHA 6CHAC 5E2OA 3RM0H 1W10U 1EJMA 4IN1A 1TMUH 2ZPQA 5GJ4B 1ZMLA 4IN2A 2QV1A 4I31A 4R8TB 1UO6A 2QXIA 2WPMS 3P6ZB 2WUCA 1P04A 1XUJA 1HAOH 1TX8A 1OHHD 1GBFA 3PLPA 1YPLH 2O8TA 6GCHF 4GVUA 1ORFA 5EQRA 1AUTC 1G37A 1Y5AT 3TNTA 4HFPB 1YGCH 2FTLE 3GCHB 1P2QA 1E37B 2JETC 1MKXH 1ELDE 4IMQA 3TK5A 4Y11E 2BMGB 4F4OC 3RXMA 4XBCA 3PLBA 2ZQ1A 2O8WA 2H9EH 1FAXA 5F8ZA 4TWWA 1VKYA 3UNSA 2R3YA 3Q77A 1VITG 3RDZA 4B2CA 1WQVH 1THRH 1UCYH 1HUTH 1MUEB 1TPPA 1W13U 2ZEBA 1K9OE 3N7DA 3QGJA 4AGKA 1V6DA 1P2NA 2CJIA 5A8XA 3GCTF 4Y8YA 4CRBA 3DUXH 3PV5A 5EQQA 2BY7X 4GHQA 1HAZB 4FVBA 1F0TA 3ZVGA 1LPZB 2BVXH 2TGPZ 1C5YB 3FFGA 2GZ8A 4RKOB 1VCPA 1H8ED 1GMHG 1BTHH 2ZKSA 4YT6H 2UWOA 1D4PB 1VITH 1P9SA 1XVOA 3M61U 3NCLA 4ZAEA 4ABDA 1CA0C 1O2KA 5K7RA 2RG3A 5HXFA 2YMSD 1IQFA 2OC8A 2FTMA 1KTTB 1SFQB 3ZZ5A 3SI4H 3PYHA 2FOEA 2WPJS 1CQQA 1O0DH 2SGAA 3UOPA 2RCEA 5BRRE 2R0LA 3KN2A 2DUCA 3MNSA 1GBEA 1Q2WA 4UD9H 3SU0A 4NZQA 2QY0B 2BLVA 1EAXA 1MMJN 1BRBE 1ZR0A 1IAUA 1QJ6B 3Q76A 1A1RA 2SGEE 1W12U 4AG2A 1GCDA 2WPHS 2PR3A 1IQMA 3OTPA 3HKIB 1C9PA 4HG6A 5GWZA 2CXVA 2QE7D 3A7VA 3F1SB 1SOZA 2ZHQH 3ODDA 3B23B 2Q6GA 1GBCA 1LHFH 4X2YA 5EU8A 3S7HB 1OWDA 5T1VA 3H7OA 1BMLA 3SYJA 1GI9B 1QBVH 2JJ1D 1EOJA 1P12E 3PMBB 1O2PA 1XUFA 3FOAA 1Z8JB 3TGKE 5I46H 2HPPH 3D65E 3S9CA 2B0FA 3HKJB 4R0IA 1BT7A 3NPSA 3VEQB 1QNJA 1QY6A 2VGCB 1D3PB 1LVMA 4YO9A 5FAHA 3SV9A 1ELCA 2SNWA 2VIQA 2FIRH 4VGCB 2ZDMA 3QTVH 4ABFA 2FS8A 1OP2A 3GY2A 1Z1IA 3RXKA 1DWEH 3D62A 3ZVDA 1SGFG 3E16B 2WINI 1QHRB 1RTKA 3OSYA 3TJNA 3A89A 1VGCC 1BA8B 1O2SA 2D26C 3ZZAA 1F7ZA 3GISB 3SV6A 3PTNA 3R0FA 5ESTE 1XVMA 1LMWB 3BG4B 1Z6EA 3P8GA 3TIUA 4I8JA 2EI6A 3M7TA 1MTVA 3BTKE 2VIDA 4X1QU 1RD3B 1FQ3A 2STAE 3OFND 2ZDNA 1A46H 4F55A 1YPGH 3M37A 3ZZBA 1OWEA 3DCLA 2Q1JA 2WV4A 1G32B 1SQTA 1QB6A 2C4FH 2OC7A 4NCYA 1ZTKA 5E0HA 3MU0A 4MPUA 1L2EA 1EQ9A 1QIXB 3S0NA 5EG4A 4AGJA 4INHA 3V0XA 2ANKH 1SHYA 4UE7H 3SW2B 3FKSD 2J95A 2F91A 5HGGA 1EP6A 1J9CH 2AGIX 1Y8TA 1CT2E 1QA0A 4UEHH 1DICA 2CHAC 2O8MA 2ZHEH 3RXVA 3GY7A 1GBAA 1YPKH 1UK3A 3RXPA 1VITF 4JCNA 2FOMB 4MPXA 2HGTH 4TPYA 4O03A 2XRCA 1AFEH 4CBOA 9LPRA 1GJ4H 2HOBA 1SGIB 3URCA 1K21H 1C5OH 5CHAC 1TMBH 1H8DH 4MLFB 4UONA 6CHAB 3BTEE 1S5SA 1PPHE 1KXAA 1KLIH 2HALA 3LGYA 1SL3A 2VVVA 2J92A 3T2NA 2PHBA 4JZFH 1B5GH 1GMHF 4MNXA 2K0QA 2D2DA 3C27B 1O3DA 4J1YA 4P02A 1BJVA 4O97A 1UMAH 4CHAC 1AMHA 2JETB 1NFXA 1S84A 1CVWH 1MQ6A 3A86A 5K0HA 5HM9A 3JZ1B 5TJXA 1GJ9B 3RLWH 3ZVBA 5EJLA 1FY3A 2ZI2H 1V2OT 2EC9H 3ZV8A 2F83A 3BTME 2Z9JA 3P17H 2GGVB 1SBWA 1YPHE 2NU0E 3E8LA 2QF5A 4JK6A 4Y7AA 4Q7ZA 1JRSA 4NFEA 1LVOA 5EODA 3UY9A 1ABJH 4JZDH 2C8YB 1WBGB 1EOLA 2NU3E 4IGDA 3SJIA 3TK9A 5B6OA 2VWMA 5CMXH 1EUFA 1D3QB 2G8TA 2FPZA 4I8HA 1NESE 4THNH 1K1JA 4YOJA 2FYQA 3DSPA 3EGKH 1P2KA 2OBQA 2IJOB 2WV9A 4YM9A 3SGAE 1Z6JH 2KCAA 2SGQE 1ETTH 3SV2H 1JIRA 3M5OA 3P8OA 2G5VA 2FDAA 1UTNA 1UK2A 1OYTH 4RKJB 3RXQA 1BHXB 3QN7A 3ZVFA 3F2FA 1C5TA 4B6FA 2G4UA 4O3TA 3BTGE 1TPOA 3DHKH 2BX3A 1CA0B 1T7CA 2AMDA 2KAIA 4E7NA 4E05H 2KX4A 5T6DA 1U6QA 4AX9H 3BEUA 4AB9A 1CGIE 4MQAA 2ZQ2A 2ANYA 2HRVA 4GUXA 1RTFB 1IQHA 1P57B 1HJAC 3EA8A 1O2UA 1TOMH 3M7QA 5C94A 2BVRH 4D7FA 2PUQH 4WH6A 2TGAA 2VVUA 3ESTA 2G5NA 5E2PA 1HXEH 3BV9B 4B2AA 1THSH 1OWHA 2Y7ZA 3F9EA 4NIYA 5F53A 2DE8A 4A1VA 4FUBA 4X2XA 1BRUP 4DY7B 1UVOA 4ZXYH 2BD9A 3UIRA 1EP5A 1EFRD 1NC6A 5EGMA 1BRCE 3M35A 1O35A 1E34B 1T8OA 3BIVH 1PFXC 3GICB 4GCHG 5A0CA 2ZGJA 3MO3A 3SUEA 2BB4A 1XUGA 2IOTA 1F5LA 4Q80A 1NT1A 1Q31A 2OP9A 1VJAU 2PV9B 5DPAA 1Y5UT 2JH6D 5H4IB 3SORA 3MH4A 1O2LA 1O3CA 4WVPE 1P8VC 4WY3A 1ZTJA 4DGJA 5JDUB 3BTTE 1IQIA 1FV9A 1GBIA 1X7AC 4X8UH 3ZZ4A 2G51A 3RXTA 2Z7FE 3GY4A 1DWCH 2BDIA 4ZKRU 2G00A 4A7IB 1K2I1 1FNIA 1QR3E 1B7XB 1GBTA 1HAGE 4FVDA 4AYVB 1C1TA 1QQ4A 4FUIA 2ZTYA 2P3FH 4A1TA 3GY8A 3ZYDA 1VGCB 3Q3XA 4MNWA 1VJ9U 3NWUA 1FY5A 1TNHA 4D7GA 2JKHA 4MNYA 3SU4A 1TX7A 1KYNA 3F0OA 3ATKA 2LNCA 2GKVE 3F9HA 3FP6E 2RFKC 1GMDG 3IITA 4NG9H 4KTUA 5L2ZH 3W1EA 2BOHB 2B9LA 2WHXA 4DT7B 1DWBH 3T28A 4Q2KA 5EPNA 2A4QA 1GHBG 1GJ7B 1O37A 4JYTA 1C5MD 1H8HD 3P8FA 1UVTH 2ZU2A 4NGAH 1FMGA 2BDBA 1C1OA 1NZQH 1O5FH 4ZKSU 3GOVB 4BAKB 2BLOA 1L1JA 4U32A 5T3HA 1KXCA 3VB7A 1NTPA 4TYDA 5E8EH 3UREA 1Z1JA 4XBDA 1P10A 3MNCA 2ZFQH 5A0BA 2XOKD 2ZU5A 3ATIA 1W0ZU 2OTVA 3MMGA 2ZZUH 1UTKA 4M9FA 2Z9LA 5FBIA 2ZWLH 1ZHRA 1AZ8A 1A0HB 1C1VH 2STBE 2CHAB 2GZ7A 2Y6TA 3SJ9A 3UUZA 5AFYH 3GS9A 3FANA 2NU2E 2GCHG 8ESTE 5JBBS 1XMNB 1P2JA 4ZKNU 2YOLA 3A7YA 1TRYA 2BM2A 2BY6X 1FN6A 1MAYA 1O2XA 5CHAB 1O2MA 2KCPA 4K1TA 1ELFA 2BY8X 3UFAA 1J14A 4LXBH 5A8YA 1ABIH 2ODPA 1C2EA 1C1SA 1XKAC 4ISHH 4BTTB 1XUIA 3I78A 2C8ZB 4FUGA 3E0PB 4FUHA 3ELAH 1YP9A 2CK3D 4JYUH 3RUOA 1ELEE 2NU4E 1AZZA 1CBWC 1HAIH 3MH6A 3PRBA 3FN8A 3T27A 3PRDA 4CHAB 2ZDAH 1WU1A 4ZXXH 2ZU1A 4KELA 2KAIB 4KP0A 1C1UH 2GVFA 1LHDH 1K0HA 2GMTC 4X1NU 3RXLA 3QLPH 3BTQE 4Y71A 5JBTA 2VB0A 4Y76A 4BTIB 4F48B 1BZXE 1TGCA 2Z3DA 1D6RA 2PWXA 4LOYH 3W94A 4OS2A 3KQ5A 3CS7A 1Y5BT 4D8NA 1SGEE 1IHSH 2ZHWH 3GCOA 4ACBA 3C1KA 3M5NA 2AHME 3ODFA 2AGEX 1J15A 1O33A 1GVKB 1PPBH 4F49A 3GYLB 2ANWA 1GJCB 2V35A 1V2TT 1SLUB 1TOCB 1P2IA 2BDHA 4GCHF 3RXAA 1Z7KA 1C5LH 3BN9A 4FETA 3RU4T 3SNDA 1DX5M 2PFEA 5C1XA 3AAUA 2UUFB 3G01A 1BBRK 4BXWA 5A09A 2Y5HA 1GI3A 3RXGA 2ZPSA 1ANDA 4HI3A 2K1QA 3MWIU 2G55A 1BITA 1E36B 2FO9A 1V2QT 3BG8A 5EW2H 1YLNA 4GLYA 1P3CA 1ZZZA 1CHGA 1Z71A 1HJAB 1ELGA 2QXHA 4Y8ZA 2OK5A 1YYY1 1O5DH 1S81A 3QUMP 1A0JA 3MNXA 3A85A 1PYTC 2PTCE 2ZNKH 1NRQH 2GTBA 2PP6A 1CE5A 4DG4A 2XWAA 3DFJA 3KF2A 3MU5A 3RC5A 4CRFA 4AOQA 4ASUD 3BTFE 1MTNC 1EAWA 3LJJA 2OQ5A 4B6EA 5GDSH 1MH0A 2XW9A 5L6NH 1XM1A 3BTWE 3FO8D 2FLRH 2TBSA 1TGTA 4X1SU 2C90B 2NU1E 2PKAB 3OEHD 1C1PA 1GBJA 1KTSB 1S0QA 2ZFFH 1QURH 3TJVA 1GMDF 4IC6A 1V2VT 4CR5A 1ZSKA 1O5EH 1V2JT 2OLGA 4ZMAH 1H8IH 1ID5H 2F9NA 3E90B 3VG8A 1EPTC 3A8DA 4J2YB 1ELBA 2BTCE 3NUMA 4XE4A 5EOKA 1GHBF 3QZQA 1O2IA 2I6QA 4DCDA 1TBRH 4XBBA 2EY4C 5E0JA 1KY9A 1QGFA 1S6FA 1TONA 4AFZA 3V3MA 1MCVA 5HIZA 1QTFA 1BTPA 1C1QA 1UTLM 1SPJA 2VH0A 2W5EA 2BD3A 2ZU4A 1BMAA 4ESTE 1MBMA 2IPHA 1CT4E 4FOUC 1ZMNA 5DSFA 2GCHF 2ZFRH 1AU8A 1O3IA 1SGTA 1C1RA 4B73A 2L74A 1BHXF 2HNTC 4GHTA 3UR9A 1C2HA 1V2MT 1SQOA 4K2YA 1DOJA 1UVSH 4IBLH 3P95A 3RXIA 5L2YH 4K1EA 4FU7A 4A92A 3U1JB 1Z8IB 2VVCA 1T32A 1J16A 2BY5X 3SNCA 1O30A 3WY8A 1EPTA 2OC0A 3P70B 4MTBA 5J4QA 3MFJA 3MI4A 1H9IE 1NRPH 1Y3YA 2XBYA 3PROA 4OS7A 2FEQH 1G3BA 1GWAA 2VNTA 4Q7XA 1QQUA 3A83A 1OWKA 1TFXA 2FWWA 4JZEH 5FX5A 3RC6A 1C2MA 2FOCA 5GCHG 3CP7A 1G2LA 1UCYE 2Y5FA 1GJAB 4ISNA 3GY6A 1EJAA 1OP0A 1DXWA 1WOFA 1P11E 2KFWA 1MTSA 1SFIA 2Z9GA 1LHGH 2Z3EA 3PV2A 2FP7B 3E1XB 3K9XB 4PROA 1C2LA 2XXLA 4X6NA 1A7SA 1DFPA 2BQWB 2P16A 1GI1A 3KIDU 1SGCA 3E6PH 1O2RA 3V7TA 1VR1H 2RA3A 4X8TH 5EIYA 2ZGBH 2BD2A 2ZC9H 2C8XB 5T6FA 1QFKH 1SQAA 1T8NA 3AASA 4TWYA 5DP6A 1FY4A 1S83A 3MNBA 1GJ6A 4Z1MD 2XNIA 3U69H 1A5IA 2TGTA 4Y10E 2W26A 2NWNA 1WTGH 1TRNA 3RXEA 4TT3D 1OYQA 2AGGX 2IJD1 1CBWB 3P8NA 3WWBA 1ZRBA 1C5NH 2A5AA 1NFWA 2KZ4A 1TB6H 4TY6A 1FN8A 3LDXH 2KR7A 2Y81A 3D23A 3A8CA 1O2OA 3FAOA 2GMTB 2ZCKP 3MOCA 2ALPA 4SGBE 3A7WA 3RXCA 3IWMA 4D9RA 5J4SA 4I86A 1N8OC 2QF0A 4NIWA 1FIZA 3MH5A 5C5NA 4Y0YE 2QIQA 2P8OC 5EXLA 2GV6A 2Z9KA 4E06H 4ISLA 1Y3XA 4ZHMU 4KKDA 5HYOA 3RXBA 1QB1A 1DE7H 1UTJA 2FODA 3EE0B 1WYKA 5HIYA 3MO6A 2PLXA 1Y3UA 4BTUB 1P9UA 1EZXC 1FXYA 7GCHG 2EI8A 1FDPA 2A0QB 5FPSA 1C5ZB 4H4FA 3EA9A 1BDAA 1SB1H 1HDTH 2OXSA 1L0ZA 1LVBA 2QGRA 4U2WA 1F2SE 3RP2A 4B75A 1BBRH 3RXSA 3HGNA 2A1DB 2PKSC 3RXFA 1ESAA 1GHZA 2AIQA 4YESB 3MU4A 3AVZA 5AFZH 5LGOA 5LPFA 3DT0H 5DGJA 3F3BA 2OUAA 1AHTH 3PMAB 2QC2A 1C4V2 3SI3H 4JK5A 1DSUA 1DWDH 5DJ7A 1NU7B 2ODYB 4B71A 1G3CA 1M9UA 4HZHA 1G3EA 4ZROA 1BUIA 3JZ2B 1NM6A 1MTNB 3S7KB 1AIXH 3FP7E 1WDIA 3RMOH 5JB9S 1W14U 4AB8A 5LPEA 2VWNA 2O9QA 4RI0A 1OXGA 4DURA 2GT7A 3GDUA 3OEED 3SHAH 3PM3A 2ZDKA 3SBKA 3SNAA 1O2GH 5GNDA 3U8OH 3KQDA 2WYGA 4SGAE 1COWD 5FPTA 1A5HA 4BANB 1H1BA 2H2ZA 3F0PA 4I32A 3Q00A 1GHYH 2GV7A 4X1RU 2LPRA 1EPTB 3K65B 1O3OA 2KCYA 3VB6A 4X6PA 2FI3E 3SU1A 1K1IA 5AHGH 1UW7A 3F6UH 2F9BH 1UVUH 3LU9B 1CT0E 3A7TA 2Z6BD 3H5CB 1AVWA 1P01A 1FPHH 5FXLA 2QXGA 1W11U 4U01A 1O3JA 1OPHB 2J97A 8LPRA 2TPIZ 3EQ0H 2QXJA 2FOGA 2EQNA 3LGWA 2J2UA 5GCHF 4ABBA 3BSQA 1HJ9A 2A5KA 3F9FA 1Z8GA 1BB0B 4BAQB 1YM0A 1RXPA 1TBZH 1ZGVA 2LELA 3STIA 1L4ZA 2ZHFH 2O8UA 1P3EA 3R3GB 1D9IA 1GJ5H 3L33A 3U98H 1FZZA 4Y79A 9ESTA 1NN6A 2P59A 1DM4B 1MCTA 1YCPM 3SZEA 1O2ZA 3OY5U 1YCPK 5EPYA 3RXUA 1W3CA 3TU7H 1FUJA 4KTSA 1A3EH 1MZAA 3AW1A 1DVAH 1CHOG 1V2RT 3ATWA 3SN8A 4AYYB 2L6OA 3RMNH 1O5GH 1LTOA 1O3KA 4INLA 1HCGA 1D6WA 4FUCA 2DE9A 1NRNH 1RFNA 4HGCA 4INKA 1EAUA 3ZZCA 4NIXA 1WSSH 3NKKA 3RXDA 1AD8H 3A87A 3E0NB 1UTQA 2WYJA 2AIPA 2AFQB 4AFSA 4E7RG 5EJZA 4HTCH 4BNRA 3SV7A 1XXDA 4AC9A 1HFDA 1GL1A 2Q6DA 2IN2A 4AFQA 1DPOA 3KEEA 1MZDA 3ZZ9A 3V12A 1QL7A 5DP7A 1O31A 2ESTE 3SHCH 2BD5A 1MKWK 1N6YA 2Y80A 1HBTH 1GHXH 1KXDA 1XXFA 4WXIA 3OY6U 2ZA5A 1C1MA 2D8WA 3T29A 2W7UA 2BDAA 2FOHA 2OQUA 1L1GA 1GL0E 4XD7D 1DXPA 3KQBA 2RDLA 3EYDA 2TGDA 1K28D 3MTYA 3PWBA 3AK5A 1LHEH 1OSSA 1TIOA 2ZTXA 5DKMA 3E91A 4X8SH 3VXEH 1GCTC 3UOUA 3ZZ6A 7GCHF 1F5RA 1JBUH 2RA0A 2VIVA 2TRMA 1HXFH 1LQDB 1TYNA 5FX6A 2BQ7B 1PPCE 1TQ7B 1K1LA 2AERH 2BOKA 2VIPA 1KXBA 4CRGA 1JXPA 1O36A 4ZUHA 2F3CE 2ZPRA 8GCHG 1C5UA 3NK8A 1MU8B 4CRDA 1OKXA 2GP9B 3LGUA 2HVYB 2ZU3A 1N8OB 2BD7A 4ACAA 3RM2H 1DDJA 2GX4A 3RXJA 1NFYA 2O8LA 2ZGCA 5DO4H 1J8AA 2P8OB 2VIWA 4ZHAA 3B9FH 2V3HH 2YNAA 2V3OH 4AORA 1C5RA 1C5WB 1CGHA 2QAAA 4NWLA 1EATA 4I8GA 1SI5H 3FP8E 3QTOH 3SNBA 2H5CA 2Z3CA 3K6YA 2CN0H 1ARBA 1FPCH 5GPIB 1BTXA 1ARCA 3ZVEA 5FCKA 4ABIA 3DD2H 1LO6A 2PKAA 5GIBA 2FX4A 3HK3B 3VB4A 5HM2A 2P95A 3M3SA 1C2DA 2UWLA 1P2MA 1EXFA 1SR5C 2PTNA 4IMZA 2AMQA 4K8BA 2BLWA
chains in the Genus database with same CATH topology
1BMMH 2WUBA 3ZVAA 1K1NA 2PKSB 2D1JA 2FS9A 2VH6A 2G4TA 3CS0A 4FU9A 1FAKH 1T31A 1ANCA 1UCYK 3A80A 4FUDA 1EAIA 2A2XH 5DP8A 1O2YA 1YPHC 2ZDLA 1Y59T 1KXFA 4WMDA 2A32A 2SNVA 1UTOA 1PQ8A 1SGFA 4GSOA 5IYTA 4Z0KA 2OC1A 1O5AB 1OX1A 4Z6AH 2A2QH 2FM2A 3N7OA 3UR6A 1ZJKA 1G3DA 3SUFA 1EASA 1V2UT 1SGPE 4KGAA 4Y6DA 5DP9A 1BTYA 4ABJA 5F6MA 4I8KA 4NSVA 4X0WU 1CHOF 1HAPH 1ELTA 2JH5D 1SGRE 1HB0B 4H6SB 1GG6C 3RXOA 3S9BA 2ZDVH 2CF8H 1TWXB 2A45B 2AMPA 3TJUA 3TGIE 4B2BA 1O3MA 2P3UB 5I25A 1QL8A 3VGCC 1BQYA 1CU1A 3PLKA 5A2MH 1LKBA 2G52A 3HK6B 4OS5A 2XBWA 5EW1H 1NU9A 1IQEA 4YT7H 1AY6H 1TE0A 2A4RA 1HIAB 2J94A 1N6XA 1F0RA 2ODQA 2ZHDA 1TGBA 3DFLA 1LPKB 2J34A 2AH4X 3A7ZA 1DT2A 1INCA 1C5VA 3BEFB 1KIGH 2PUXB 1TPSA 2A7HA 4AFUA 1SGYE 4WJG2 2XBVA 2QN5T 5FPYA 1O3EA 1TNIA 4ISIH 1BRAA 5T6GA 1WTHD 2H9TH 1RS0A 3SJOA 3VB3A 1YC0A 1GI6A 4NWKA 4WXVA 4WMEA 4GPGA 4X2WA 3KQEA 1FLEE 1AE8H 4X1PU 1H9HE 2P93A 2C8WB 1GI7B 5DP3A 1Y3VA 1SC8U 1QA7A 3SQEE 8GCHF 1WCZA 8KME2 1W7XH 1FONA 1SLVB 1UTPA 1AUJA 3HGPA 1G36A 5EXMA 1UK4A 4CH8B 3PB1E 4XOJA 1ESBA 1EZSC 5JYIA 3ZZ7A 3BEIB 1ZHPA 1O2VA 3GY5A 2FZZA 2SFAA 1G9IE 1GGDC 1LKAA 1O34A 5BPEA 3VB5A 2F9PA 3M3TA 1QBOA 1ZSLA 2A31A 3LIWA 1DLKB 1EJNA 1ZPZA 3LH3A 3UWIA 1SSXA 3MU1A 1AFQC 1V2NT 2H1UA 2BQ6B 4CRCA 1O2HA 4CBNA 1AO5A 1GCTB 1YKTA 3FVFB 1PPEE 1TNKA 1TNGA 1C5QA 4MVNA 5ESBA 2R0KA 2FESH 1NS3A 1O5CB 3OU0A 4K60A 4H42U 1XX9A 5DP4A 2J4IA 3KNXA 4X6MA 5IDKA 1KXEA 4ZH8A 1PPFE 4YLQH 1A4WH 1ESTA 1B0FA 4CREA 1HAVA 1AGJA 4AG1A 2ZFTA 2F9UA 1OWIA 1VCQA 2UUYA 2XCNA 2CMYA 2HNTF 2BDCA 3ZV9A 1HAHH 2QA9E 2ANMH 3KHVA 1SGQE 4O9VA 3SO3A 2EA3A 5C3NA 1O2JA 2AS9A 3TH4H 4B1TA 4MNVA 3U8TH 2W3KA 2UWPA 1BMNH 3M5LA 1C4U2 1FJSA 2H6MA 3I29A 2FOBA 2HLCA 5F8TA 1GVLA 2ZFPH 1DUEA 1TNLA 1AI8H 4YOIA 1A5GH 1Z8RA 5PTPA 1WV7H 1PYTD 4ABEA 2UUKB 5SGAE 1ZPBA 3MYWA 5C1UA 1TQ0B 1XUKA 4NA8A 3U8RH 1EB2A 3GY3A 4JMYA 1SGDE 4OS1A 2HWLB 1TRMA 4JZIA 1C2JA 3GDVA 4M7GA 4H6TA 1FI8A 1OOKB 3TLOA 2THFB 1KLTA 1ZYOA 3TH3H 3U1IB 1AVXA 1ZTLA 1IQJA 1O2NA 4TPIZ 2G81E 1C5PA 1O2TA 1JOUB 1TBQH 2C3SA 2ZECA 1D3DB 1THPB 2ZTZA 2BVSH 4BOHA 5DP5A 2FI5E 1BTUA 2BXUH 4CH2B 4BAHB 4K5ZA 3QK1A 1CO7E 2FOFA 5L30H 1ETRH 1YPMH 1QB9A 4YZUA 4NFFA 3L6PA 3V13A 1F0UA 1E0FD 2BLQA 5FHTA 1EKBB 4I7YH 2GD4B 2Z94A 4IC5A 3LOXA 1V2LT 4O3UA 3STJA 1YBWA 3LH1A 1PPGE 1GG6B 4UFDH 3RLYH 1GDUA 1T4UH 1GDQA 1PJPA 3GDSA 3RC4A 3NXPA 4ISOA 4B74A 4A6LA 5E0GA 1AE5A 2R2WU 2CGAA 4ABGA 5LPRA 1IQKA 1NROH 3QDZB 4A5TS 1TGNA 2PSYA 2BX4A 2EEKA 1IQGA 1W8BH 1GBLA 3VGCB 1C2FA 1MTUA 3B8JA 1KDQA 2YNBA 2VWLA 1RTLA 1V2WT 1O3FA 1CSOE 1GJDB 3KCGH 1YF4A 1AB9C 1RJXB 2B7DH 4DIIH 1S0RA 1FY8E 1JRTA 1G2MA 1LQEA 1GBMA 1TA2A 1XKBC 2BYAX 3A88A 1P05A 1S6HA 5CE1A 1AWHB 3LC3A 2FLBH 2FX6A 2GCTC 2WPLS 1KSNA 1ZSJA 3M5MA 3TK6A 1ZLRA 2WPIS 2ZG0H 3A82A 4I33A 2PGBB 3OX7U 4K3JA 1L1NA 2V6NA 4Y8XA 2BZAA 3RXRA 4OS4A 2B5TB 4KTCA 3EAJA 1BIOA 3KQCA 3NZIA 5JBAS 5HMAA 1W2KH 2AYWA 1GBDA 2VIOA 4K1SA 1BJUA 1HLTH 3UTUH 3W95A 4TY7A 1O2QA 2ZP0H 3SJ8A 2XCFA 3A8BA 1RIWC 3ZZDA 2F9OA 4OGYA 1BCUH 1HAVB 2CF9H 4UFFH 1O38A 3GCNA 4NSYA 1GHAG 4U30A 1F92A 1FIWA 3PO1C 1MQ5A 5AVDA 3M3VA 2UUJB 1QJ7B 2WV5A 1GI8B 3L3TA 1GGDB 3TPIZ 6LPRA 5ABWA 3K6ZA 1OWJA 2SGDE 1IQLA 3F68H 3SZNA 4D76A 4CR9A 3SGBE 3EA7A 1AFQB 1T8MA 2Q6FA 1WUNH 3D49H 1BTZA 1BBRE 1O3BA 1S82A 2FI4E 1WAYB 3AAVA 3MH7A 2A7CA 5FBEA 2A4OA 1W7GH 2QF3A 1K1PA 3PMJA 1TALA 2BDGA 1O3AA 1MD8A 1O3LA 3P92A 1A3BH 1SOTA 5G4BA 2ULLA 5TCCA 3MU8A 2FXRA 4ZHLU 1A61H 1SGNE 3T5FH 3ZVCA 4DVAU 1H9LB 4XSKU 1OP8A 2XC0A 1MAXA 2PW8H 4WF8A 1ZHMA 2OD3B 1VCWA 5C5OA 5A8ZA 2GDDA 4UDWH 1P2OA 1NFUA 3ZYEA 1P03A 3SV8A 3LJOA 3TGJE 3URDA 5JBCS 3RU4E 2I6SA 1O3HA 1V2PT 3TH2H 1CGJE 4FU8A 2BY9X 1GBKA 4JYVH 3GYMA 1HGTH 5JPMH 3T26A 1GMCG 1JMOH 1TPAE 4RSPA 5TCAA 3LC5A 4MPWA 2Z9IA 2R3UA 3MHWU 3LKWA 1F5KU 3LT3A 1V2KT 2OINA 1LHCH 2BD4A 1GI2A 1L4DA 4I8LA 2ZGXH 5EXNA 1EZUC 1RRKA 1ACBE 1DLEA 2SGFE 4MPVA 1HPGA 1MBQA 2BXTH 1LDTT 2ZCHP 3A7XA 3OYPA 1O3GA 4OS6A 3SUGA 2FOAA 1UHBA 1PQAA 3SJKA 1KDQB 3TITA 2BZ6H 3SOSA 1SG8B 4Y0ZE 1QCPA 3ENSB 1O3PB 4BAMB 1LCYA 1P06A 1MD7A 4Q7YA 2VU8E 1HIAA 5F8XA 1DSTA 1GVZA 2XWBI 2A5IA 1SLXB 2GZ9A 1DUAA 1C2IA 4NIVA 4MG3A 2ZCLP 1C4Y2 1GI4A 3H7TA 4IS5A 1QL9A 1UVPA 1HYLA 4B76A 4DJZB 1C2KA 1T8LA 2QCYA 1DITH 5DG6A 1IHTH 1HRTH 1ANEA 1C1NA 1DANH 4LZ1H 1O39A 1QBNA 1HAYB 3EDXB 2Y82A 2W3IA 1O3NA 1GI5A 3M7UA 3VXFH 3I77A 2A4GA 2VJ1A 1DY9A 1TLDA 4DIHH 1TX6A 1AB9B 1S85A 3S69A 3ATLA 1C5SA 1GHAF 1NO9H 4UFGH 3BIUH 4OGXA 5C2ZA 1SLWB 2P3TB 3PWCA 1OS8A 4X2VA 1V2ST 3SU6A 3A8AA 1H4WA 4ASHA 1V3XA 4A1XA 1O2WA 2GDEH 1O32A 1QRZA 3S9AA 1WQSA 2P94A 1HAXB 3Q3YA 2GCTB 4NZLA 3ATMA 4IW4E 5FCRA 3TVJB 1CA8B 1QRWA 1E38B 1C1WH 1SMFE 1A0LA 4WMFA 1B0EA 4AZ2B 4Y7BA 3CENA 1MKXK 1ZMJA 2HPQH 4LZ4B 3GCHC 3QGNB 2XC5A 3KL6A 3AW0A 3O8DA 2GT8A 1AKSA 1XUHA 1C5XB 4RN6A 3A81A 1PQ7A 1G30B 4DOQA 4GAWA 3SGQE 4FXGH 2AEIH 1RIWB 3ITIA 3PV4A 3O8CA 1FY1A 2F9VA 3LONA 1NY22 1ZRKA 2W7SA 3PO1B 2CV3A 4X8VH 1ANBA 1QRXA 2WPKS 1RGQA 3LGTA 2XC4A 1PQ5A 4FUEA 3SUDA 1P02A 2J38A 1K1OA 5ETXA 1YLCA 3SU3A 1NRRH 1GMCF 2VWOA 1HNEE 1T4VH 6GCHG 3UQOA 1HJ8A 5EQSA 1GPZA 4BAOB 1C2GA 1GHVH 3UWJH 3UPEA 2ILNA 2FMJA 1AVGH 1D3TB 3IG6B 2BD8A 1GHWH 4ZKOU 4JZ1A 3HPTB 4FUJA 3TJOA 1J17T 3F9GA 4YOGA 3FZDA 4MDSA 3SNEA 3T25A 4CRAA 1E35B 3VPKA 3TNSA 2ZGHA 2QYIA 2PSXA 3BF6H 1ELVA 3RU4D 1IOEA 4WWYA 1ZPCA 1Q3XA 3O8RA 1O5BB 4YTAA 1EB1H 3K2UA 1IQNA 3ZZ3A 3VFEA 1GI0A 4WH8A 1UHBB 2V0BA 2Y7XA 1K1MA 3KGPA 3QZRA 2FYRA 3U9AH 1NPMA 1NRSH 3QWCH 4QT8C 3GCTG 1YLDA 4FUFA 1TGSZ 3BTHE 1QJ1B 2Y5GA 1TNJA 2OBOA 5C20A 1LPGB 4ABAA 4D9QA 2HNTE 1MU6B 3UNQA 4NA7A 1P0SH 1EZQA 1A2CH 3SU2A 1GBBA 2H5DA 2TIOA 1ETSH 2SGPE 1TMTH 3HATH 3E3TA 3OTJE 3SU5A 5C67A 1N1LA 1VZQH 1YCPH 1BTWA 7LPRA 2VGCC 1DY8A 1SVPA 3QX5H 3LGVA 1DS2E 1AWFH 2A7JA 1JWTA 5A0AE 1SHHB 4AN7A 1W0YH 4NA9H 1YPJH 5C1YA 3RMLH 7KMEH 3Q3KA 2R2MB 2JH0D 6ESTA 2PGQB 3M36A 4XFQA 2BHGA 1TABE 1K22H 4VGCC 2OCVB 1GDNA 1ZJDA 2EI7A 4YLUA 4BXSA 4K69A 2C93B 1ELAA 1AQ7A 1PPZA 3RXHA 1AN1E 1HV7A 3T62A 3BTDE 2HVXA 3MO9A 1JIMA 3UQVA 1ZOMA 3ZZ8A 3BG4C 1ZGIA 2H9HA 1EX3A 2ZF0H 3LPRA 2M5TA 5F03A 1MKWH 3UNRA 1UJ1A 1P09A 2ZIQH 1C9TA 4DW2U 5AF9H 4X6OA 2J9NA 1GJ8B 3LGIA 1UTMA 1BOQA 3PMHB 1F0SA 1LVYA 1TAWA 1Y3WA 3A84A 4LK4A 2XTTB 2ZFSA 3O8BA 7ESTE 2B8OH 1YPEH 1AKSB 2BDYA 1MTWA 2ALVA 5GXPA 3PTBA 1KLJH 5LH8A 4ABHA 4K8YA 3SQHE 3RMMH 3FZZA 3QO6A 2XBXA 1TA6A 2ZO3H 2R9PA 5JB8S 5DK1A 4UFEH 4XDEA 2VINA 3DA9B 1GJBB 2XYAA 2ASUB 1GBHA 6CHAC 5E2OA 3RM0H 1W10U 1EJMA 4IN1A 1TMUH 2ZPQA 5GJ4B 1ZMLA 4IN2A 2QV1A 4I31A 4R8TB 1UO6A 2QXIA 2WPMS 3P6ZB 2WUCA 1P04A 1XUJA 1HAOH 1TX8A 1GBFA 3PLPA 1YPLH 2O8TA 6GCHF 4GVUA 1ORFA 5EQRA 1AUTC 1G37A 1Y5AT 3TNTA 4HFPB 1YGCH 2FTLE 3GCHB 1P2QA 1E37B 2JETC 1MKXH 1ELDE 4IMQA 3TK5A 4Y11E 2BMGB 4F4OC 3RXMA 4XBCA 3PLBA 2ZQ1A 2O8WA 2H9EH 1FAXA 5F8ZA 4TWWA 3UNSA 2R3YA 3Q77A 1VITG 3RDZA 4B2CA 1WQVH 1THRH 1UCYH 1HUTH 1MUEB 1TPPA 1W13U 2ZEBA 1K9OE 3QGJA 4AGKA 1V6DA 1P2NA 2CJIA 5A8XA 3GCTF 4Y8YA 4CRBA 3DUXH 5EQQA 2BY7X 4GHQA 1HAZB 4FVBA 1F0TA 3ZVGA 1LPZB 2BVXH 2TGPZ 1C5YB 3FFGA 2GZ8A 4RKOB 1VCPA 1GMHG 1BTHH 2ZKSA 4YT6H 2UWOA 1D4PB 1VITH 1P9SA 1XVOA 3M61U 3NCLA 4ZAEA 4ABDA 1CA0C 1O2KA 5K7RA 2RG3A 5HXFA 1IQFA 2OC8A 2FTMA 1KTTB 1SFQB 3ZZ5A 3SI4H 3PYHA 2FOEA 2WPJS 1CQQA 1O0DH 2SGAA 3UOPA 2RCEA 5BRRE 2R0LA 3KN2A 2DUCA 3MNSA 1GBEA 1Q2WA 4UD9H 3SU0A 4NZQA 2QY0B 2BLVA 1EAXA 1MMJN 1BRBE 1ZR0A 1IAUA 1QJ6B 3Q76A 1A1RA 2SGEE 1W12U 4AG2A 1GCDA 2WPHS 2PR3A 1IQMA 3HKIB 1C9PA 5GWZA 2CXVA 3A7VA 3F1SB 1SOZA 2ZHQH 3ODDA 3B23B 2Q6GA 1GBCA 1LHFH 4X2YA 5EU8A 3S7HB 1OWDA 3H7OA 1BMLA 1GI9B 1QBVH 1EOJA 1P12E 3PMBB 1O2PA 1XUFA 1Z8JB 3TGKE 5I46H 2HPPH 3D65E 3S9CA 2B0FA 3HKJB 4R0IA 1BT7A 3NPSA 3VEQB 1QNJA 1QY6A 2VGCB 1D3PB 1LVMA 4YO9A 5FAHA 3SV9A 1ELCA 2SNWA 2VIQA 2FIRH 4VGCB 2ZDMA 3QTVH 4ABFA 2FS8A 1OP2A 3GY2A 1Z1IA 3RXKA 1DWEH 3D62A 3ZVDA 1SGFG 3E16B 2WINI 1QHRB 1RTKA 3OSYA 3TJNA 3A89A 1VGCC 1BA8B 1O2SA 2D26C 3ZZAA