3A8BA

Crystal structure of trypsin complexed with (e)-4-((4-bromophenylimino)methyl)benzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA02
1V2QT 4GHQA 3FP7E 1CHOF 1CVWH 2OCVB 2ZA5A 5EQRA 3BTGE 4CR5A 2DE9A 1ZSLA 5E8EH 3ZYEA 4OGYA 1GDQA 1N8OC 1ZJKA 5FCKA 2VWOA 4K60A 1GVLA 1MTWA 2ZDVH 4KTSA 7LPRA 1T8NA 1V2OT 4X1RU 4AB9A 1C1OA 2UUYA 2Y7XA 4OS7A 3LT3A 1O3MA 1Q31A 1ELAA 3L6PA 1SGTA 1UTPA 3OYPA 1O3PB 1IQGA 1G2MA 1KXBA 2OLGA 4THNH 8KME2 3ATLA 3A89A 3M35A 3MOCA 4ABGA 1MMJN 4K69A 1GBAA 2QY0B 1QJ1B 2C8WB 4XBDA 3W95A 1VCWA 3PMJA 2FMJA 1BTHH 2F9BH 2G52A 1ZTKA 4X1NU 1PQAA 1WYKA 2ZI2H 2XYAA 5FCRA 2UWOA 1K1IA 5FPTA 2VWNA 3S7HB 3RU4E 1KLTA 1YLDA 1P57B 3KIDU 1FY5A 2GZ7A 2RCEA 4WF8A 1QIXB 3M3SA 4JMYA 2O8MA 2PLXA 2ZP0H 1GGDC 3M37A 2SGAA 3O8BA 2DUCA 2SGFE 4MPUA 1GG6B 1ZRBA 2GCHG 1OWEA 1DDJA 1BRCE 5DP3A 3SBKA 3KHVA 3PWBA 4UD9H 2CXVA 5E0GA 1UCYE 4NZLA 1Z7KA 1GMCG 1LHFH 1FPCH 1F5LA 2QA9E 1GCDA 1BHXF 1P9UA 1UCYH 4Z6AH 1Z1IA 2JH6D 1J8AA 4XE4A 1PQ8A 1V2KT 2GGVB 5H4IB 1J9CH 2EI8A 3BF6H 1LPGB 4JZFH 2ESTE 4Y0ZE 1K2I1 1MTSA 1ZHMA 2FZZA 2O8UA 3HGNA 3VXEH 4A92A 3KQBA 2G55A 1J14A 3SGAE 3RXAA 4ISIH 4NIXA 3G01A 4A7IB 1GI6A 1GI5A 5FHTA 1TGBA 1GHYH 4R0IA 4BTUB 1HJAB 3T28A 4X6MA 3EQ0H 3RXRA 2VVCA 3VB3A 3SNCA 4RKOB 1HFDA 4CHAC 2ZG0H 2I6SA 1SFIA 3ZVAA 4ZKRU 2GCTB 1FMGA 7GCHF 3LC3A 2GV6A 2A5AA 1P2MA 3RU4D 1XX9A 5GCHG 4BAQB 2BD7A 2FX6A 1LTOA 1QB9A 1XXDA 2UUJB 4J2YB 1DY8A 1DICA 1XMNB 1EJNA 2BMGB 1DX5M 1FI8A 3DHKH 3SJOA 1AVWA 1ESTA 1IQKA 6GCHF 3FZDA 4X1SU 2Y5GA 4TY6A 3NPSA 1UTQA 3LPRA 1GBEA 2A32A 3SU6A 3DUXH 1GHZA 1A7SA 4YOGA 1DWEH 1C5QA 1ID5H 1MTNB 1PFXC 1Z8JB 2BDAA 1HAOH 1Y5AT 2BZAA 1HAIH 3R0FA 3TITA 1ARCA 2FOCA 2BLVA 2QIQA 4YM9A 1NFXA 3SUDA 1ELCA 1GBDA 2J38A 4ZKOU 1DUAA 1A3BH 4HI3A 4NSVA 3AW1A 1IQHA 2J9NA 1UO6A 1XXFA 3HK6B 3KEEA 2Z9KA 4WMFA 1P2OA 4ABBA 4E7NA 3TIUA 5A0CA 1QRWA 2BD3A 1O5EH 2R0KA 4BTIB 1BTXA 3A8DA 4AORA 4CRAA 3ZVEA 1PPEE 4OS5A 5T3HA 4OS2A 1HAZB 3MNBA 1FIWA 3UWIA 4ABDA 1DFPA 1GJ4H 2CHAC 2ZHDA 1Y5UT 3UREA 2W26A 5EQSA 2G00A 1CBWC 1F0TA 1O3HA 4A5TS 1L4ZA 4HGCA 1UTMA 2H6MA 3ESTA 1EAXA 2QAAA 3QDZB 2ZPQA 1C4V2 1GHBG 3KN2A 3L3TA 2ZGBH 5GJ4B 2OINA 5EQQA 1T4VH 2H9TH 1IQEA 2BDCA 1JMOH 1AWHB 2BDHA 1DT2A 5DK1A 5G4BA 3RXVA 4LOYH 3A81A 1HYLA 3GDVA 2BOHB 2R3YA 2V3OH 4WMDA 3SORA 4NWKA 1C1UH 1TFXA 5CHAC 1SQOA 1VITG 2WV5A 4UE7H 1O2QA 1TYNA 5BRRE 1LHCH 3SQHE 1SGFA 4Q2KA 2F3CE 1TMBH 4KTCA 4UONA 2FTMA 5IDKA 4DY7B 2WUBA 4WVPE 4CH8B 3UPEA 4F49A 1BTZA 3VGCB 2HNTC 2Q6FA 1OWDA 1S81A 1C5VA 5AFYH 2Z9IA 3PLBA 1U6QA 2WPLS 1B0EA 1AFQC 1ZZZA 2AERH 2BM2A 2HRVA 4ZHLU 5F8ZA 2C8XB 3EA9A 1IHTH 2ZZUH 3UNSA 3TH4H 3RC5A 1C2GA 3E0NB 1OSSA 4NSYA 2G51A 1T8OA 1C5PA 1THSH 5ETXA 1ACBE 2R3UA 1O3AA 1C2LA 2ZPSA 2NU3E 3KF2A 1IQMA 1BTYA 1KXCA 5A09A 1G3BA 2AGGX 3QGJA 1H9LB 4UDWH 3GY6A 3A7XA 4JYVH 4H6SB 3RXMA 3TPIZ 4XSKU 2BY9X 4YLQH 4ISOA 3BV9B 2BVXH 2BXUH 1SOTA 3RXUA 3MNSA 1NFUA 4ABFA 1G3DA 2I6QA 5DP9A 3SV6A 1AZ8A 3RXTA 3LGUA 1O2KA 4FUBA 3V0XA 1HLTH 1K22H 4YO9A 1GCTB 5DP5A 3T26A 1SGEE 1CQQA 1OP0A 3SJKA 2FDAA 3UIRA 3RXCA 3ZZ6A 1SGDE 1RD3B 1GI3A 1GJCB 4WWYA 4LZ1H 3PROA 1IQLA 2VIDA 4IW4E 2A2XH 2H1UA 1VCQA 2ZGXH 1CA0C 3HGPA 3LIWA 3KGPA 1EOJA 1GPZA 3ZZ7A 4MLFB 1KLIH 2QXGA 1A0LA 4TY7A 3MNXA 1AE8H 4AX9H 4BAOB 3LC5A 2P8OC 3IWMA 1KXDA 4B2AA 3D65E 1UTJA 3BTQE 1O34A 4IS5A 6CHAC 1JOUB 3UQVA 1OWKA 1HCGA 5A0AE 2A4OA 5C1XA 1RRKA 2ZGCA 3BG4C 1LVBA 1GJAB 4AFQA 1E35B 1GHAG 5JYIA 1G36A 2WPKS 3F9HA 3MH7A 2OC7A 5JBTA 1DVAH 1MD8A 4B74A 3A7TA 2B7DH 3P8NA 2G5VA 3P70B 1S6FA 1QBVH 1C5TA 1H9IE 1A5IA 2FOEA 3M3VA 3A7ZA 1BITA 3OX7U 2AYWA 3STIA 2B5TB 1X7AC 2VIQA 2ZDAH 3A82A 4K8BA 1EPTB 1O5CB 1O2NA 3A86A 1FJSA 3OSYA 4WJG2 2PSYA 1O2TA 1G37A 1C2JA 4NZQA 1ESBA 3E1XB 3SV9A 2ANKH 1UTLM 1G30B 1C1VH 1CU1A 3LGIA 2B0FA 1K1MA 1ZMJA 1ZMNA 1UJ1A 1AB9C 1C2DA 2XBWA 5BPEA 4LZ4B 1O2PA 2ANWA 5E0HA 1SB1H 4I7YH 1O3GA 1C5XB 5HMAA 2H9EH 5FXLA 1XUJA 5L2YH 4Y8XA 2UWPA 3TGKE 1NTPA 3T62A 3QWCH 3U8OH 4A6LA 1W3CA 3MO9A 4IN2A 4AFZA 2BDBA 4ZROA 5DP8A 1KIGH 2BDIA 4ABAA 4DIIH 5EW2H 3ZVFA 2AS9A 2R0LA 2VWMA 1TPSA 1ZSJA 3K6ZA 1LVYA 3ODFA 1A5HA 1SPJA 4K3JA 4Y8ZA 1EP5A 3ELAH 3RXDA 4CH2B 1W0ZU 3QGNB 1AQ7A 1QRZA 3AVZA 3ZYDA 4FUFA 1A46H 1SL3A 1LPZB 2FOAA 1QHRB 5JBBS 4NGAH 1OWIA 2SGPE 3S9BA 1WQVH 1LO6A 1KSNA 4E06H 4INLA 1UVOA 5SGAE 4HZHA 3QTVH 3LU9B 1GJDB 1EQ9A 3IG6B 1YPKH 1V2VT 4U2WA 1O5FH 1TRMA 4MPWA 1GGDB 4MTBA 5DP4A 1EZSC 4BAHB 1QFKH 3BTEE 1B5GH 2P3TB 5I46H 2BVSH 2FI5E 1TE0A 1C4Y2 3F9GA 4D76A 4H42U 4ESTE 4O3TA 1SGRE 1TPAE 1W7XH 3KQEA 3SN8A 2THFB 1ETTH 4MNYA 2PW8H 4FVBA 1QCPA 2FM2A 1ELBA 8GCHF 2JKHA 3UR9A 2BVRH 4UFEH 1FY8E 3T2NA 1HAYB 3HPTB 1GBMA 3TNSA 3NXPA 1GBFA 3UFAA 4WXVA 2RA0A 4MPXA 3EA7A 1A2CH 2CN0H 4TPYA 1BA8B 3P92A 4O3UA 2EEKA 5DO4H 1AI8H 1GJ5H 4B1TA 3UOPA 4YOJA 1UHBA 1XVOA 1VJ9U 1O5AB 1NN6A 1JBUH 1FONA 1WOFA 1D9IA 2AMDA 1XKAC 1V3XA 2AFQB 2PTNA 2ZWLH 1TQ7B 2OXSA 1E36B 1TOCB 5E0JA 3GDSA 1H4WA 4K2YA 1ZGIA 4AB8A 4CHAB 4ZKNU 1UK4A 1L1NA 2BOKA 1OXGA 1O0DH 3P17H 3SO3A 3JZ1B 1C4U2 1GDUA 3PTBA 1O3LA 4CRDA 1HAXB 1S0RA 1GHWH 3ZV9A 1O3CA 2BDYA 1DXPA 2D8WA 4DCDA 1QL7A 3E6PH 1C5UA 2GKVE 1OWJA 1MUEB 4GUXA 2FOHA 1A5GH 1QB1A 5EXNA 4Q7ZA 1MQ6A 1O5DH 1QJ7B 4XBBA 4X0WU 3GOVB 3RXPA 1C2KA 1OYTH 1FUJA 4X6NA 5GIBA 2VJ1A 1RJXB 3MHWU 4INKA 3S9AA 1EP6A 3DD2H 1TAWA 4ABEA 3BTWE 4NFEA 4X8TH 1Z8IB 2CV3A 2Y80A 1UTKA 1CGIE 9LPRA 1SSXA 2Y6TA 1ETSH 5K0HA 2EC9H 1YPMH 4NWLA 1NRPH 5EXLA 3MO6A 1LQDB 4NA9H 5DKMA 1GI7B 1ZYOA 3A88A 2FEQH 1YLCA 4MDSA 3A85A 2J94A 2XC5A 3B9FH 5JDUB 2ALPA 3ZVBA 1FQ3A 1AHTH 1E37B 4ZHAA 4ABHA 1GL1A 2NU2E 3KQCA 1C5SA 3QN7A 2CHAB 1NPMA 1FIZA 3BEFB 2OQUA 1SGIB 2H9HA 1CBWB 3LGTA 1TNKA 1WAYB 3TVJB 1JRSA 1TPOA 4I33A 1HBTH 1FY4A 1MH0A 2BTCE 2PKSC 1YPJH 2H5CA 1V2UT 2M5TA 3O8DA 1H1BA 3BG8A 4M7GA 1CT4E 2Y5FA 3Q77A 3EA8A 5I25A 2Z3DA 1HAHH 2ZECA 4YOIA 3DFJA 4Q80A 1QTFA 1C2IA 2HPPH 1TBRH 3E0PB 2WPMS 5CHAB 3TH2H 2FI4E 1BJUA 3SOSA 1FAKH 3SI4H 3FANA 3OY5U 2XCNA 2ZCKP 2HGTH 1MBQA 1P2IA 2ODQA 1WV7H 1W2KH 3FP8E 2A7CA 2BX4A 2F9UA 3T25A 1LHGH 1PYTD 4DW2U 2ZEBA 4Y76A 3QX5H 3ZZ8A 4IBLH 3PLKA 4DGJA 1RTKA 2CGAA 5J4QA 2ZO3H 3RXEA 3SNDA 1O2JA 3WY8A 3RXHA 1C9PA 1O2UA 1FV9A 1SHYA 3RP2A 4JK6A 2LPRA 1AFQB 3GCHC 2FXRA 4MNXA 5J4SA 2ANYA 4AZ2B 1D3QB 1AY6H 2UUFB 3DT0H 1ZTLA 2ZCHP 1GI8B 4I8GA 1J15A 4WXIA 5T6GA 1DWBH 1NM6A 3HKJB 1KXEA 2WYGA 1TPPA 3EE0B 3I77A 1O2XA 3ATMA 1G9IE 2ZU5A 3KNXA 4UEHH 1GJBB 4WH8A 3B23B 1MU8B 1GI1A 2D26C 3LDXH 3KQDA 3H7TA 5F03A 1FXYA 1SI5H 1DWDH 1AZZA 2VIWA 3BEUA 5FAHA 4FU9A 2Z9LA 1KLJH 1HAVB 1Y3VA 1QR3E 3SUFA 1RFNA 4E7RG 1PJPA 3U8RH 1TABE 1EPTA 1W8BH 3CENA 4X8UH 1TX6A 3BN9A 1AD8H 1YM0A 3M5LA 5GDSH 4CREA 4B71A 1WBGB 1RTFB 1GBJA 1HXFH 2XTTB 3CP7A 2QF0A 1SGYE 1UCYK 1TNGA 1P06A 1E38B 3ZVDA 2GCHF 4IGDA 1OOKB 4X6PA 1P3EA 2IPHA 1A1RA 1O2LA 4O03A 1G3CA 1QRXA 1UHBB 1V2PT 3O8CA 3S0NA 2CF8H 2STAE 2QCYA 1GMCF 4FU8A 5AFZH 3M5OA 3UNRA 5CMXH 4I31A 1AKSB 1MKXH 1TGCA 1THPB 3RUOA 3S7KB 1DANH 1LMWB 1QNJA 6CHAB 1C1SA 1LCYA 5F8XA 1C1TA 1MD7A 1TONA 1EJAA 3SHAH 5A8YA 4GLYA 2ZGJA 3TLOA 2OP9A 3L33A 4JCNA 3SGBE 4ISNA 3V13A 1F92A 1NRSH 1TIOA 4DOQA 4D8NA 1SBWA 2Y7ZA 3ATIA 4OS4A 1YPHC 5LPFA 4GCHG 2HWLB 1EUFA 1GMDG 2ZDKA 2PUXB 3A80A 3ZZ9A 2STBE 3ITIA 4WY3A 2ZFTA 2GP9B 3HKIB 1BRAA 5FBIA 2WPJS 1G3EA 2YOLA 1HJ8A 4ISHH 5ESBA 3SV8A 2J2UA 1GVKB 1MTVA 5GCHF 3PMHB 1GBCA 2FYQA 3LH1A 1BUIA 3RU4T 1P03A 2XW9A 4A1XA 3RLYH 1W12U 2AIPA 2C8YB 3GISB 1VGCC 1DXWA 2HLCA 4SGBE 4XOJA 3S69A 2BY8X 2ZFSA 1TGSZ 1XUFA 2JH5D 5FPYA 2VWLA 5FBEA 3TK5A 2IN2A 2Y81A 3FVFB 1AGJA 3ZZBA 2AMQA 2ZCLP 2XBVA 3UNQA 1AB9B 1V2RT 3H7OA 2BHGA 5EGMA 3A87A 2W7SA 1HJAC 1NY22 1W11U 2A4GA 2Z94A 1GMHG 1VITH 4J1YA 4DVAU 4RSPA 3M3TA 4AOQA 1GI2A 6LPRA 2GCTC 2VNTA 3U69H 1OKXA 1LHEH 2GMTC 1D6RA 1XUGA 1T4UH 1TLDA 1YPGH 2PV9B 4X1QU 1TBZH 2J4IA 1AMHA 5T6FA 1OX1A 3T5FH 2VGCB 5EG4A 3TNTA 1FZZA 1TWXB 4UFDH 1YKTA 3FAOA 3GY5A 2GD4B 2TGPZ 1UMAH 2QXJA 2Z9GA 3BEIB 3H5CB 3VB4A 2A2QH 2Z3EA 4ZXYH 3QLPH 2YNAA 1E34B 2CJIA 3Q3XA 1FLEE 1V2TT 2VU8E 8ESTE 4Y71A 3SJIA 4BOHA 4JZDH 2XWAA 3SU3A 3TGJE 4TYDA 5CE1A 1C1PA 3UOUA 3QTOH 4AFUA 1GBBA 1SVPA 4AYYB 3GYMA 2NU4E 2A0QB 2P3FH 4MQAA 1Y5BT 1D3DB 2TGDA 1JIRA 3UQOA 3JZ2B 1SLXB 2FIRH 1GHBF 2OTVA 1AVXA 1C1RA 4ASHA 2G5NA 1A3EH 4YESB 2F9OA 4WH6A 2K1QA 1ZLRA 1EATA 4NIVA 2BLOA 4ABIA 1O30A 1YC0A 1C9TA 3LJOA 1C2EA 5B6OA 3UTUH 1ZR0A 2WUCA 3A7WA 3A84A 3V12A 4E05H 1VITF 4GAWA 1P2NA 3GICB 2FYRA 3K6YA 3PO1B 1P02A 2P93A 3SV2H 3BIVH 2VIOA 5IYTA 1RIWC 3RMLH 4NCYA 1HUTH 4B2CA 3D62A 2Y82A 1TMUH 1QBNA 3A7VA 5C3NA 1DY9A 1ZPCA 2PWXA 1C2FA 2SNVA 4AN7A 4KKDA 1P2QA 1BBRE 5A8ZA 1DOJA 1O3KA 4Y8YA 3TK6A 3LJJA 2IOTA 3GDUA 1GBIA 1OWHA 4B76A 7KMEH 1BBRH 3E3TA 4JK5A 3ZZ5A 3RM0H 5AHGH 2ASUB 2FS9A 3SUEA 1Y8TA 1QURH 2BY6X 2ZDLA 2BD9A 1ZMLA 2A7JA 2FOBA 1WUNH 3RXKA 2GT8A 2ZIQH 2A5IA 2PGQB 4DT7B 1NT1A 1TRNA 5T6DA 1FPHH 5DP6A 1ZGVA 4BNRA 4TWYA 1BIOA 3NZIA 1BDAA 1VJAU 1ELVA 1YF4A 1EZUC 5F6MA 3LGWA 2KAIB 3RC6A 3SNBA 1ANEA 1O3IA 1PPHE 2ODPA 1QA7A 3OY6U 3Q3KA 2F83A 1T8MA 4JYTA 1O2IA 1QGFA 1BOQA 1P01A 3BTKE 5AVDA 2QXHA 4BXWA 2JETC 1N8OB 3D49H 2BY5X 3IITA 1O2GH 3I29A 3SU5A 2PHBA 1O39A 3RXQA 3GYLB 3SJ8A 1NC6A 3ZZCA 4NFFA 4AGJA 2QF3A 1O2MA 3QUMP 1WCZA 4X1PU 3T29A 1DS2E 2VH0A 3BTFE 2ZU3A 1SLUB 1L1JA 2FX4A 5LH8A 5C2ZA 1F2SE 1SFQB 5ABWA 1ZSKA 2VB0A 1BCUH 6ESTA 5EPNA 1DITH 3SI3H 3Q76A 1ZRKA 2BQWB 1E0FD 1XM1A 3MU8A 1HXEH 3NWUA 4CBNA 5HGGA 2ZHFH 1CHOG 5GPIB 3TJUA 2QV1A 2PKAA 5HM2A 1CO7E 1Y59T 1O2RA 1ANDA 3GCNA 1GHAF 2SNWA 2XC0A 2WYJA 1GCTC 3GY7A 4ISLA 3SU2A 5C5NA 5A8XA 2OQ5A 4D9RA 4A1VA 1BRUP 1LKBA 4KTUA 1EJMA 3VXFH 4DG4A 1ELTA 2BDGA 4FUEA 1K1NA 1HAVA 2AGIX 2PKSB 5ESTE 1BTUA 3SQEE 3LGVA 2FTLE 2OC8A 3U8TH 3V7TA 2O8LA 1Y3UA 1YPEH 2FLRH 2CF9H 2ZHQH 3SUGA 4BXSA 3ENSB 3PLPA 3QZRA 1S6HA 1TGTA 3SW2B 2PGBB 1IQFA 1O3JA 2VVUA 1V2MT 2AMPA 1K1OA 4X8SH 1S5SA 3MU5A 1ANCA 3BSQA 5C5OA 5K7RA 2GZ9A 2FOMB 2O9QA 2TGTA 4LK4A 3BTHE 2EI6A 4K5ZA 5EU8A 1VZQH 3S9CA 3F1SB 1QL8A 5HYOA 1ABIH 4Y79A 1O3EA 4FUCA 4QT8C 1JWTA 2ZFFH 4XBCA 3TH3H 1W14U 1B0FA 1ZTJA 3EGKH 2AGEX 1EKBB 2BD4A 5LPEA 1QB6A 1JIMA 1KTSB 4CR9A 1AKSA 1ZPBA 1EB1H 1C5OH 1P04A 1Y3YA 3MH4A 2A5KA 2ZFPH 3NK8A 2A4QA 2BLWA 3SHCH 1ETRH 3A83A 1ANBA 5JBCS 2TGAA 1DUEA 2IJOB 3RC4A 2HNTE 3RLWH 4H4FA 2ILNA 1GHVH 3VFEA 1QY6A 1BB0B 1VCPA 1MKWH 1T7CA 5EOKA 3ZZ4A 3GCTF 5C1UA 5GXPA 3MH5A 2A7HA 3MMGA 2Z9JA 4MNWA 4FUDA 5DG6A 2C90B 4ZAEA 2P16A 1OP2A 2D1JA 1J16A 3ATKA 1JRTA 1KDQA 2XCFA 1C2MA 8LPRA 4XDEA 4KELA 3BTDE 2GVFA 5DP7A 4MG3A 1GWAA 5JBAS 4KP0A 3KCGH 1XUHA 1MZAA 1PPGE 3M7TA 1W7GH 3SJ9A 2ZPRA 1C1WH 4OS6A 2GZ8A 1XKBC 1TQ0B 1UTOA 2WINI 4AG1A 5JB8S 4AG2A 1GJ6A 1NU7B 4GVUA 1WU1A 2P59A 1AIXH 1LDTT 9ESTA 7GCHG 1V2NT 1A61H 1KYNA 3GY4A 1S82A 1BJVA 2UUKB 3EDXB 5F8TA 3SNAA 1HRTH 2ZHEH 2W3IA 2RG3A 1BMAA 1ZHRA 1O3NA 2VINA 2PFEA 5EXMA 1SMFE 2C93B 1SOZA 2ZNKH 2Q6DA 1GL0E 2AIQA 3TJVA 1P11E 5C67A 1BMNH 1OYQA 3VEQB 1HIAB 3DA9B 6GCHG 3TJOA 1AO5A 2J34A 4OS1A 4ZHMU 3A8AA 5HXFA 1HAGE 2XRCA 2LNCA 1CGHA 1MAYA 4K1EA 2B9LA 1O36A 2HNTF 4O97A 2Y5HA 3E91A 2FLBH 2F91A 2VVVA 1O3OA 5FX6A 1RXPA 1O2YA 5FPSA 3MNCA 1Q2WA 5A0BA 3MU4A 3UR6A 4YLUA 3PV4A 3RMOH 1UTNA 1CE5A 1MAXA 1BZXE 1MKWK 1FY3A 2WPHS 1JXPA 3LH3A 3MWIU 1IHSH 1QBOA 4FUGA 3RXFA 4B2BA 3ZZ3A 1ABJH 2ANMH 2A45B 4JZEH 2C3SA 3URDA 2R2MB 5LPRA 4Y6DA 2F9VA 1O2HA 4OGXA 4NA8A 2CMYA 4Q7YA 4NIYA 4MVNA 1OP8A 4ZMAH 2ZDMA 3A7YA 3RXIA 2OC1A 3U9AH 1P9SA 1W13U 4X2YA 2BXTH 3TGIE 3PTNA 4H6TA 1VGCB 1BTWA 2ALVA 1IAUA 2J95A 4HFPB 1SHHB 1PQ7A 2PR3A 2GT7A 1O3FA 1S84A 3P95A 3LOXA 4GHTA 1DE7H 2PKAB 4BANB 5AF9H 4X2XA 1FDPA 3R3GB 4Y0YE 2OC0A 2C8ZB 2GDDA 1FAXA 1ZJDA 1V2WT 1Z8GA 1PPFE 1KXFA 1NRRH 4MPVA 1HDTH 5L30H 2V0BA 2VIPA 5L2ZH 2HALA 2C4FH 4MNVA 2TPIZ 3PM3A 4AYVB 1F0UA 3NKKA 2ZFRH 3LONA 1Q3XA 3U98H 2GMTB 1BHXB 2A4RA 4VGCC 3MFJA 4NG9H 1EOLA 4D9QA 2AH4X 4GPGA 4Z0KA 3HK3B 3N7OA 1F5RA 4JYUH 4IC6A 3O8RA 4B73A 3NCLA 4CRCA 4CRFA 2R2WU 3SU0A 3ZV8A 1C5RA 3AASA 3RMMH 4X8VH 2GV7A 3SU4A 3QZQA 2TIOA 5TCAA 1ORFA 2V6NA 1PQ5A 1MCTA 1O3DA 1YYY1 1Z71A 4D7GA 1TB6H 1CA0B 4K1SA 2UWLA 3RXBA 2KAIA 1C5LH 4YZUA 1HAPH 1GHXH 2G8TA 1D6WA 1CA8B 1K9OE 2ZDNA 2R9PA 1G32B 3VB5A 3GY8A 2ZU1A 2Q1JA 1CT2E 1AWFH 1C1MA 4I8HA 2P8OB 2F9PA 1QL9A 3PWCA 4DJZB 4D7FA 1AFEH 3PMAB 1P09A 1NO9H 4CRGA 7ESTE 3STJA 1WSSH 3EYDA 2P3UB 1LVOA 4YT7H 1O2SA 5C20A 1GBKA 1NZQH 3BG4B 3M5NA 1YP9A 2VIVA 2HOBA 1TX7A 4FVDA 3BIUH 1RIWB 2W7UA 1QJ6B 4B75A 3F6UH 3MTYA 1H9HE 5L6NH 2WV4A 3MO3A 1C5NH 1GG6C 1Z8RA 3SV7A 2V3HH 1GBHA 2A1DB 4X2WA 1KDQB 3A8CA 1DSTA 3C27B 5PTPA 1DM4B 1F0SA 2GX4A 3P8FA 2AEIH 4U01A 1PPZA 2GTBA 4Y11E 1TNIA 3E16B 1O5GH 1TRYA 2W3KA 3Q00A 1DPOA 1GI9B 3K2UA 1K21H 1YBWA 3UUZA 5GWZA 4X6OA 1SGNE 2TBSA 2OD3B 1AE5A 1EXFA 2VH6A 3T27A 1FY1A 1GBLA 1O37A 2BD2A 1OPHB 1IOEA 1GI0A 1FNIA 1H8DH 1K1LA 1NESE 2P95A 3RXLA 3TK9A 2FOGA 1A0JA 1YCPH 4ZUHA 1QQUA 5EW1H 1SR5C 3FZZA 4IMQA 1N6XA 4WMEA 1NFYA 1Y3XA 1C5WB 3A8BA 4AFSA 3W94A 3GY2A 1WTGH 2QN5T 3PYHA 2HPQH 1HB0B 1SGCA 1CT0E 3ZVGA 4FUHA 4ZKSU 4IN1A 3U1JB 1V2ST 1YPLH 3ZZAA 1O38A 2JETB 1W10U 1BT7A 1EX3A 1HGTH 1XVMA 2XNIA 3GCOA 2SGDE 1ELEE 3QK1A 1QQ4A 1GBTA 1PPBH 4AGKA 2QC2A 1MKXK 3M5MA 2BD8A 1KTTB 1EZXC 3GY3A 1VR1H 1SG8B 1O2ZA 3URCA 2YNBA 1TNJA 1KXAA 2H5DA 2QXIA 3U1IB 2BZ6H 5JB9S 3M7QA 1P2JA 1TGNA 4Q7XA 1O2OA 1PYTC 3LKWA 1LHDH 2ZC9H 1P12E 3RM2H 2ZKSA 1CGJE 1SGFG 5A2MH 1O5BB 3CS7A 4U32A 4YT6H 2RDLA 1Z6EA 1A0HB 2G81E 4ZXXH 1S83A 2BB4A 1HV7A 2QGRA 1P3CA 5EODA 3MI4A 1AUTC 1EAWA 2Z6BD 1F7ZA 1O2WA 2FP7B 1MTNC 4I8KA 1S85A 2B8OH 3SU1A 3C1KA 3V3MA 2BQ7B 5DGJA 2XBYA 3OU0A 1UVUH 1OS8A 1MU6B 4JZIA 1LVMA 5DPAA 1H8IH 2ZQ2A 5E2OA 1A4WH 3UY9A 3I78A 2ZU2A 2PSXA 2FO9A 4GCHF 1P8VC 4BTTB 4DURA 1ARBA 2FESH 1GMDF 2BQ6B 1ELGA 2ZFQH 2BLQA 1YCPK 3ATWA 2ODYB 1TALA 4FUIA 2F9NA 3M7UA 4LXBH 2Q6GA 2WPIS 2V35A 1CSOE 4R8TB 2Z3CA 3LGYA 1AU8A 1C1NA 2BX3A 4UFGH 4Y10E 1T32A 2XBXA 1UK2A 1W0YH 1TX8A 2ZTYA 2SGEE 5HM9A 1GJ7B 3AW0A 4FXGH 3PMBB 3EAJA 3MU1A 3ODDA 1TNHA 2FPZA 4NA7A 5JPMH 3MH6A 4YTAA 1MTUA 3AAVA 4U30A 4UFFH 1GDNA 3HATH 1C5ZB 2QYIA 1V6DA 2PTCE 2TRMA 1O32A 2NU0E 1WQSA 4ZH8A 4TPIZ 1TA6A 1SQAA 3K65B 1UK3A 4INHA 2FOFA 1L4DA 1SQTA 1RGQA 1ELFA 1L2EA 1MCVA 1NROH 1XUIA 2NU1E 4FUJA 1GMHF 4I32A 3FP6E 3RMNH 1SGPE 3QO6A 1HIAA 1CHGA 3CS0A 1Y3WA 2FWWA 1K28D 1C1QA 1QA0A 2FI3E 1IQIA 3DFLA 2Z7FE 3SGQE 1WTHD 3TU7H 2BY7X 4PROA 1BRBE 4I8LA 3RXJA 2OBOA 1D4PB 1YGCH 3D23A 8GCHG 3PB1E 1ZPZA 1IQJA 3Q3YA 1L0ZA 4K8YA 1EAUA 1ESAA 1O2VA 1P05A 4CRBA 2OUAA 3M36A 1SLVB 3VGCC 1J17T 4DIHH 1THRH 4CBOA 1DWCH 1SC8U 1T8LA 2P94A 5E2PA 1INCA 1LKAA 1UVPA 5LGOA 1DSUA 2G4UA 1ELDE 2H2ZA 1NS3A 2HVXA 3SZNA 4Y7AA 1XUKA 1NRNH 2PUQH 1GI4A 1AN1E 3TJNA 3BTME 1GJ8B 4FU7A 1TNLA 1ZHPA 1NFWA 1Z6JH 3KL6A 3F9FA 1N1LA 1RTLA 3OTJE 2FS8A 4HTCH 1C5MD 2EI7A 1ZOMA 3BTTE 1P0SH 4RN6A 1HNEE 2VGCC 3GCTG 3P8OA 2ZTXA 1HPGA 4NIWA 1DLEA 5FX5A 5EPYA 1LQEA 1TA2A 1BMLA 2XWBI 2GDEH 4TWWA 3VB6A 2JH0D 1BBRK 2O8WA 1FN8A 4O9VA 2OBQA 1F5KU 2DE8A 1Z1JA 1D3TB 3RDZA 1TBQH 2ZGHA 3NUMA 3E90B 3P6ZB 3MU0A 1SLWB 3UWJH 1FN6A 1BQYA 4BAKB 3F68H 2SFAA 2ZQ1A 1KY9A 1MZDA 2ULLA 3VB7A 1O35A 2EA3A 1RS0A 4I8JA 3RXSA 1K1JA 1UVTH 2O8TA 1B7XB 1D3PB 1MBMA 1AVGH 1YCPM 2NWNA 1O33A 1K1PA 1T31A 1C2HA 1SGQE 1EB2A 3ZVCA 3F9EA 1O3BA 4JZ1A 4KGAA 1N6YA 1F0RA 5TCCA 1IQNA 4ABJA 3FFGA 1BTPA 2W5EA 1M9UA 2BYAX 2A31A 2D2DA 2XXLA 5TJXA 3PO1C 4RKJB 3RXOA 4IC5A 3SNEA 4F4OC 2FODA 3P8GA 1G2LA 1YPHE 1NRQH 2BD5A 1C5YB 4SGAE 3B8JA 2RA3A 1L1GA 1O31A 5DJ7A 1MQ5A 1EAIA 1V2LT 1GVZA 1TOMH 4GSOA 1HJ9A 1EASA 1LPKB 3AAUA 1EPTC 4BAMB 3ZZDA 3GCHB 4X2VA 4K1TA 2ZU4A 1NU9A 2J92A 3M61U 1P2KA 3E8LA 1EZQA 1P10A 4XFQA 2ZHWH 4Y7BA 1DLKB 4IMZA 1S0QA 1V2JT 1TMTH 2ZTZA 2SGQE 3K9XB 5C1YA 1UVSH 2XC4A 2G4TA 2ZF0H 4A1TA 4VGCB 3MYWA 1BMMH 3VPKA 3RXGA 1GJ9B 1AUJA 1PPCE
chains in the Genus database with same CATH superfamily
1V2QT 4GHQA 3FP7E 1CHOF 1CVWH 2OCVB 2ZA5A 5EQRA 3BTGE 4CR5A 2DE9A 1ZSLA 5E8EH 3ZYEA 4OGYA 1GDQA 1N8OC 1ZJKA 5FCKA 2VWOA 4K60A 1GVLA 1MTWA 2ZDVH 4KTSA 7LPRA 1T8NA 1V2OT 4X1RU 2K8IA 4AB9A 3UAIC 1C1OA 4XRNA 2UUYA 2Y7XA 4OS7A 3LT3A 1O3MA 1Q31A 1ELAA 3L6PA 5C94A 1SGTA 1UTPA 3OYPA 1O3PB 1IQGA 1G2MA 1KXBA 2OLGA 4THNH 8KME2 1YWUA 3ATLA 3A89A 3M35A 3MOCA 4ABGA 1MMJN 4K69A 1GBAA 2QY0B 1QJ1B 2C8WB 4XBDA 3W95A 1VCWA 3PMJA 2FMJA 1BTHH 2F9BH 2G52A 1ZTKA 4X1NU 1PQAA 1WYKA 2ZI2H 2XYAA 5FCRA 2UWOA 1K1IA 2W6ID 5FPTA 2VWNA 3S7HB 3RU4E 1KLTA 1YLDA 1P57B 3OTPA 3KIDU 1FY5A 2GZ7A 2RCEA 4WF8A 5C17A 5KGOA 1QIXB 3M3SA 4JMYA 2O8MA 4RT0A 2PLXA 2ZP0H 1GGDC 3M37A 2SGAA 3O8BA 2DUCA 2SGFE 4MPUA 1GG6B 1ZRBA 2GCHG 4TT3D 1OWEA 1DDJA 1BRCE 5DP3A 3SBKA 3KHVA 3PWBA 4UD9H 2CXVA 5E0GA 1UCYE 4NZLA 1Z7KA 1GMCG 2J97A 1LHFH 1FPCH 1F5LA 2QA9E 1GCDA 1BHXF 1P9UA 1UCYH 4Z6AH 1Z1IA 2JH6D 1J8AA 4XE4A 1PQ8A 1V2KT 2GGVB 5H4IB 1J9CH 2EI8A 3BF6H 1LPGB 4JZFH 2ESTE 4Y0ZE 1K2I1 1MTSA 1ZHMA 2FZZA 2O8UA 3HGNA 3VXEH 4A92A 3KQBA 2G55A 1J14A 3SGAE 3RXAA 4ISIH 4NIXA 3G01A 3F3BA 4A7IB 1GI6A 1GI5A 3F0OA 5FHTA 1TGBA 3OEHD 1GHYH 4R0IA 4BTUB 1HJAB 3T28A 4X6MA 3EQ0H 3RXRA 2VVCA 3VB3A 3SNCA 4RKOB 1HFDA 3DSOA 3UB0A 4CHAC 2ZG0H 2I6SA 1SFIA 3ZVAA 3H09A 4ZKRU 2GCTB 5HKKD 1FMGA 7GCHF 3LC3A 2GV6A 2A5AA 1P2MA 3RU4D 1XX9A 5GCHG 4BAQB 2BD7A 2FX6A 1K0HA 3F2GA 1LTOA 1QB9A 1XXDA 2UUJB 4J2YB 1DY8A 1DICA 1XMNB 1EJNA 2BMGB 1DX5M 1FI8A 2GJGA 3DHKH 3SJOA 1AVWA 1ESTA 1IQKA 6GCHF 3FZDA 4X1SU 2Y5GA 4TY6A 3NPSA 1UTQA 3LPRA 1UW7A 1GBEA 2A32A 3SU6A 2KCOA 3DUXH 1GHZA 1A7SA 4YOGA 1DWEH 1C5QA 1ID5H 1MTNB 1PFXC 1Z8JB 2BDAA 1HAOH 1Y5AT 2BZAA 1HAIH 3R0FA 3TITA 1ARCA 2FOCA 2BLVA 2QIQA 4YM9A 1NFXA 3SUDA 1ELCA 1GBDA 2J38A 4ZKOU 1DUAA 1A3BH 4HI3A 4NSVA 3AW1A 1IQHA 2J9NA 1UO6A 1XXFA 3HK6B 3KEEA 2Z9KA 4WMFA 1P2OA 4ABBA 4E7NA 3TIUA 5A0CA 1QRWA 2BD3A 1O5EH 2R0KA 4BTIB 1BTXA 3A8DA 4AORA 4CRAA 3ZVEA 1PPEE 4OS5A 5T3HA 4OS2A 5EIYA 1HAZB 3MNBA 1FIWA 3UWIA 4ABDA 1DFPA 1GJ4H 2CHAC 2ZHDA 1Y5UT 3UREA 2W26A 5EQSA 2G00A 1CBWC 1F0TA 1O3HA 4A5TS 1L4ZA 4HGCA 1UTMA 2H6MA 3ESTA 1EAXA 2QAAA 3QDZB 2ZPQA 1C4V2 1GHBG 3KN2A 3F2FA 3L3TA 2ZGBH 5GJ4B 2OINA 5EQQA 1T4VH 2H9TH 1IQEA 2BDCA 1JMOH 1AWHB 2BDHA 5C0TA 1DT2A 5DK1A 5G4BA 3RXVA 4LOYH 3A81A 1HYLA 3GDVA 2BOHB 2R3YA 2V3OH 4WMDA 3SORA 3DSGA 4NWKA 1C1UH 1TFXA 5CHAC 1SQOA 1VITG 2WV5A 4UE7H 1O2QA 1TYNA 5BRRE 1LHCH 3SQHE 1SGFA 4Q2KA 2F3CE 1TMBH 4KTCA 4UONA 2FTMA 5IDKA 4DY7B 2WUBA 2KCPA 5KECA 4WVPE 4CH8B 3UPEA 4F49A 1BTZA 3VGCB 2HNTC 2Q6FA 1OWDA 1S81A 3F0PA 1C5VA 5AFYH 2Z9IA 3PLBA 1U6QA 2WPLS 1B0EA 1AFQC 1ZZZA 2AERH 2BM2A 2HRVA 4ZHLU 5F8ZA 2C8XB 3EA9A 1IHTH 2ZZUH 3UNSA 3TH4H 3RC5A 1C2GA 3E0NB 1OSSA 4NSYA 2G51A 3VG8A 1T8OA 1C5PA 1THSH 5ETXA 1ACBE 2R3UA 1O3AA 1C2LA 2ZPSA 2NU3E 3KF2A 1IQMA 1BTYA 1KXCA 5A09A 2K0QA 1G3BA 2AGGX 3QGJA 2J98A 1H9LB 4UDWH 3GY6A 3A7XA 4JYVH 4H6SB 3RXMA 3TPIZ 4XSKU 2BY9X 4YLQH 4ISOA 3BV9B 2BVXH 2BXUH 1SOTA 3RXUA 3MNSA 1NFUA 4ABFA 1G3DA 2I6QA 5DP9A 3SV6A 1AZ8A 3RXTA 3LGUA 1O2KA 4FUBA 3V0XA 1HLTH 1K22H 4YO9A 1GCTB 5DP5A 3T26A 1SGEE 1CQQA 1OP0A 3SJKA 2FDAA 3UIRA 3RXCA 3ZZ6A 1SGDE 1RD3B 1GI3A 1GJCB 4WWYA 4LZ1H 3PROA 1IQLA 2VIDA 4IW4E 2A2XH 2H1UA 1VCQA 2ZGXH 1CA0C 1SKYE 3HGPA 3LIWA 3KGPA 1EOJA 1GPZA 3ZZ7A 4MLFB 1KLIH 2QXGA 1A0LA 4TY7A 3MNXA 1AE8H 4AX9H 4BAOB 3LC5A 2JJ1D 2P8OC 4B6FA 3IWMA 1KXDA 4B2AA 3D65E 3DSPA 1UTJA 3BTQE 1O34A 4IS5A 6CHAC 1JOUB 3UQVA 1OWKA 1HCGA 4Q63A 5A0AE 2A4OA 5C1XA 1RRKA 2ZGCA 3BG4C 1LVBA 1GJAB 4AFQA 1E35B 1GHAG 5JYIA 1G36A 2WPKS 3F9HA 3MH7A 2OC7A 5JBTA 1DVAH 1MD8A 4B74A 3A7TA 2B7DH 3P8NA 2G5VA 3P70B 1S6FA 5DSFA 1QBVH 1C5TA 1H9IE 1A5IA 2FOEA 3M3VA 3A7ZA 1BITA 3OX7U 2AYWA 3STIA 2B5TB 1X7AC 2VIQA 2ZDAH 3A82A 4K8BA 1EPTB 1O5CB 1O2NA 3A86A 1FJSA 3OSYA 4WJG2 2PSYA 1O2TA 1G37A 1C2JA 4NZQA 1ESBA 3E1XB 3SV9A 2ANKH 1UTLM 1G30B 1C1VH 1CU1A 3LGIA 2B0FA 1K1MA 2L74A 1ZMJA 1ZMNA 1COWD 1UJ1A 1AB9C 1C2DA 2XBWA 5BPEA 4LZ4B 1O2PA 2ANWA 5E0HA 1SB1H 4I7YH 1O3GA 1C5XB 5HMAA 2H9EH 5FXLA 1XUJA 5L2YH 4Y8XA 2QF4A 2UWPA 3TGKE 2WHXA 1NTPA 3T62A 3QWCH 3U8OH 4A6LA 1W3CA 3MO9A 4IN2A 4AFZA 2BDBA 4ZROA 5DP8A 1KIGH 2BDIA 4ABAA 4DIIH 5EW2H 3ZVFA 2AS9A 2R0LA 2VWMA 1TPSA 1ZSJA 3K6ZA 1LVYA 3ODFA 1A5HA 1SPJA 3F2HA 4K3JA 1EP5A 3ELAH 4Y8ZA 3RXDA 4CH2B 1W0ZU 3QGNB 1AQ7A 1QRZA 3AVZA 3ZYDA 4FUFA 1A46H 1SL3A 1LPZB 2FOAA 1QHRB 5JBBS 4NGAH 1OWIA 2SGPE 3S9BA 1WQVH 1LO6A 5CHBA 1KSNA 4E06H 4INLA 1UVOA 3PRBA 4HZHA 5SGAE 3QTVH 3LU9B 1GJDB 1EQ9A 3IG6B 1YPKH 1V2VT 4U2WA 1WDIA 1O5FH 1TRMA 4MPWA 1GGDB 4MTBA 5DP4A 1EZSC 1NBME 4BAHB 1QFKH 3BTEE 1B5GH 2P3TB 5I46H 2BVSH 2FI5E 1TE0A 1C4Y2 3F9GA 4D76A 4H42U 4ESTE 4O3TA 1SGRE 1TPAE 1W7XH 3KQEA 3SN8A 2THFB 1ETTH 3OE7D 4MNYA 2PW8H 4FVBA 1QCPA 2FM2A 1ELBA 8GCHF 2JJ2D 2JKHA 3UR9A 2BVRH 4UFEH 1FY8E 3T2NA 1HAYB 1MABB 1GBMA 3HPTB 3NXPA 3TNSA 1GBFA 3UFAA 2J98B 4WXVA 2RA0A 3N7EA 4MPXA 2EQNA 3EA7A 1A2CH 2CN0H 4TPYA 1BA8B 3P92A 4O3UA 2EEKA 5DO4H 1AI8H 1GJ5H 4B1TA 3UOPA 4YOJA 1UHBA 1XVOA 1VJ9U 1O5AB 1NN6A 1JBUH 1FONA 1WOFA 1D9IA 2AMDA 1XKAC 1V3XA 2AFQB 2PTNA 2ZWLH 1TQ7B 2OXSA 1E36B 1TOCB 5E0JA 3GDSA 1H4WA 4K2YA 1ZGIA 4AB8A 4CHAB 4ZKNU 1UK4A 2XNDD 1L1NA 2BOKA 1OXGA 1O0DH 3OFND 3P17H 3SO3A 3JZ1B 1C4U2 1GDUA 3PTBA 1O3LA 4CRDA 1HAXB 1S0RA 1GHWH 3ZV9A 1O3CA 2BDYA 1DXPA 2D8WA 4DCDA 1QL7A 3E6PH 1C5UA 2GKVE 1OWJA 2KCYA 1MUEB 4GUXA 2FOHA 1A5GH 1QB1A 2PP6A 1NBMD 5EXNA 4Q7ZA 1MQ6A 1O5DH 1QJ7B 4XBBA 4X0WU 3GOVB 3RXPA 1C2KA 1OYTH 1FUJA 4X6NA 5GIBA 2VJ1A 1RJXB 3MHWU 4INKA 3S9AA 1EP6A 3DD2H 1TAWA 4ABEA 3BTWE 4NFEA 4X8TH 1Z8IB 2CV3A 2Y80A 1UTKA 1CGIE 9LPRA 1SSXA 2Y6TA 1ETSH 5K0HA 2EC9H 1YPMH 4NWLA 1NRPH 5EXLA 3MO6A 1LQDB 4NA9H 5DKMA 1GI7B 1ZYOA 3A88A 1H8ED 2FEQH 1YLCA 4MDSA 3A85A 2J94A 2XC5A 3B9FH 5JDUB 2ALPA 3ZVBA 1FQ3A 1AHTH 1E37B 4P00A 4ZHAA 4ABHA 1GL1A 2NU2E 3KQCA 1C5SA 3QN7A 1OHHD 2CHAB 1NPMA 1FIZA 3BEFB 2OQUA 1H8HD 1SGIB 2H9HA 1CBWB 3LGTA 1TNKA 1WAYB 3TVJB 5CDFE 1JRSA 1TPOA 4I33A 1HBTH 1FY4A 1MH0A 2BTCE 2PKSC 1YPJH 5FL7D 2H5CA 1V2UT 2M5TA 3O8DA 1H1BA 3BG8A 4M7GA 1CT4E 2Y5FA 3Q77A 3EA8A 5I25A 3FKSD 2Z3DA 1HAHH 2ZECA 4YOIA 3DFJA 4Q80A 1QTFA 4DT4A 1C2IA 2HPPH 1TBRH 3E0PB 2WPMS 5CHAB 3KQ5A 3TH2H 2FI4E 1BJUA 3SOSA 1FAKH 3SI4H 3FANA 3U28C 3OY5U 2XCNA 2ZCKP 2HGTH 1MBQA 1P2IA 2ODQA 1WV7H 1W2KH 3FP8E 2A7CA 2BX4A 2F9UA 3T25A 1LHGH 1PYTD 4DW2U 2ZEBA 4Y76A 3QX5H 3ZZ8A 4IBLH 3PLKA 4DGJA 1RTKA 2CGAA 5J4QA 2KFWA 2ZO3H 3RXEA 3SNDA 1O2JA 2IPQX 3WY8A 3RXHA 1C9PA 1O2UA 2LP6A 1FV9A 1SHYA 4ACAA 3RP2A 4JK6A 2LPRA 1AFQB 3GCHC 2FXRA 4MNXA 5J4SA 2ANYA 4AZ2B 1D3QB 1AY6H 2UUFB 3DT0H 1ZTLA 2ZCHP 1GI8B 4I8GA 1J15A 4WXIA 5T6GA 4ACBA 1DWBH 1NM6A 3HKJB 1KXEA 2WYGA 1TPPA 3EE0B 3I77A 1O2XA 3ATMA 1G9IE 2ZU5A 3KNXA 4UEHH 1GJBB 4WH8A 3B23B 1MU8B 1GI1A 2D26C 3LDXH 3KQDA 3H7TA 4FOUC 5F03A 1FXYA 1SI5H 1DWDH 1AZZA 2VIWA 3BEUA 5FAHA 4FU9A 2Z9LA 1KLJH 1HAVB 1Y3VA 1QR3E 3SUFA 1RFNA 4E7RG 1PJPA 3U8RH 1TABE 1EPTA 1W8BH 3CENA 4X8UH 1KMHB 3W1EA 1TX6A 3BN9A 1AD8H 1YM0A 3M5LA 5GDSH 5GNDA 4CREA 4B71A 1WBGB 1RTFB 1GBJA 1HXFH 2XTTB 3CP7A 2QF0A 3WW7A 1SGYE 1UCYK 1E79D 1TNGA 1P06A 4HG6A 1E38B 3ZVDA 2GCHF 4IGDA 1OOKB 3SZEA 4FETA 4X6PA 1P3EA 2IPHA 1A1RA 1O2LA 4O03A 1G3CA 1QRXA 1UHBB 1V2PT 3O8CA 3S0NA 2CF8H 2STAE 2QCYA 1GMCF 4FU8A 5AFZH 3M5OA 3UNRA 5CMXH 4I31A 1AKSB 1MKXH 3FOAA 1TGCA 1THPB 3RUOA 3S7KB 1DANH 1LMWB 1QNJA 6CHAB 1C1SA 1LCYA 5F8XA 1C1TA 1MD7A 1TONA 1EJAA 3SHAH 5A8YA 2QE7D 4GLYA 2ZGJA 3TLOA 2OP9A 3L33A 4JCNA 3SGBE 4ISNA 3V13A 1F92A 1YY3A 1NRSH 1TIOA 4DOQA 4D8NA 1SBWA 2Y7ZA 3ATIA 4OS4A 1YPHC 5LPFA 4GCHG 2HWLB 1EUFA 1GMDG 2ZDKA 2PUXB 3A80A 3ZZ9A 2STBE 3ITIA 4WY3A 2ZFTA 2GP9B 3HKIB 1BRAA 5FBIA 2WPJS 1G3EA 2YOLA 1HJ8A 4ISHH 5ESBA 3SV8A 2J2UA 1GVKB 1MTVA 5GCHF 3PMHB 1GBCA 2FYQA 3LH1A 1BUIA 3RU4T 2KZ4A 1P03A 2XW9A 4A1XA 3RLYH 1W12U 2AIPA 2C8YB 3GISB 1VGCC 1DXWA 2HLCA 4SGBE 3OAAD 4XOJA 3S69A 2BY8X 2ZFSA 1TGSZ 1XUFA 2JH5D 5FPYA 2VWLA 5FBEA 3TK5A 2IN2A 2WSSD 2Y81A 3FVFB 1AGJA 3ZZBA 2AMQA 2ZCLP 2XBVA 3UNQA 1AB9B 2L6OA 1V2RT 2LELA 3H7OA 3KYGA 2BHGA 5EGMA 2V3MA 3A87A 2W7SA 3OEED 1SQRA 1HJAC 1NY22 1W11U 2A4GA 2Z94A 1GMHG 1VITH 4B6EA 4J1YA 4DVAU 4RSPA 3M3TA 4AOQA 1GI2A 6LPRA 2GCTC 2VNTA 3U69H 1OKXA 1LHEH 2GMTC 1D6RA 1FX0B 1XUGA 1T4UH 1TLDA 1YPGH 2PV9B 1VKYA 4X1QU 1TBZH 2J4IA 1AMHA 5T6FA 1OX1A 3T5FH 2VGCB 5EG4A 3TNTA 1FZZA 1TWXB 4UFDH 1YKTA 3FAOA 3GY5A 2GD4B 2TGPZ 1UMAH 2QXJA 2Z9GA 3BEIB 3H5CB 3VB4A 2A2QH 2Z3EA 4ZXYH 3QLPH 2YNAA 1E34B 2CJIA 3Q3XA 1FLEE 1V2TT 2VU8E 8ESTE 4Y71A 3SJIA 4BOHA 4JZDH 2XWAA 3SU3A 3TGJE 4TYDA 5CE1A 1C1PA 3UOUA 3QTOH 4AFUA 1GBBA 1SVPA 4AYYB 3GYMA 2NU4E 2A0QB 2P3FH 4MQAA 1Y5BT 2HVYB 1D3DB 2TGDA 1JIRA 3UQOA 3JZ2B 1SLXB 2FIRH 1GHBF 2OTVA 1AVXA 1C1RA 4ASHA 2G5NA 1A3EH 4YESB 2F9OA 1S6LA 4WH6A 2K1QA 1ZLRA 1EATA 4NIVA 2BLOA 4ABIA 1O30A 1YC0A 1C9TA 3LJOA 1C2EA 5B6OA 3UTUH 1ZR0A 2WUCA 3A7WA 3A84A 3V12A 4E05H 1VITF 4GAWA 1P2NA 3GICB 2FYRA 3K6YA 3PO1B 1P02A 2P93A 3SV2H 3BIVH 2VIOA 5IYTA 5EJ1A 1RIWC 3RMLH 4NCYA 1HUTH 4B2CA 3D62A 2Y82A 1TMUH 1QBNA 3A7VA 5C3NA 1DY9A 2WZQA 1ZPCA 2PWXA 2IJD1 1C2FA 2SNVA 4AN7A 4KKDA 1P2QA 1BBRE 2JIZD 5A8ZA 1DOJA 1O3KA 4Y8YA 3TK6A 3LJJA 2IOTA 3GDUA 1GBIA 1OWHA 4B76A 7KMEH 1BBRH 3E3TA 4JK5A 3ZZ5A 3RM0H 5AHGH 2ASUB 2FS9A 3SUEA 2YMSC 1Y8TA 1QURH 2BY6X 2ZDLA 2BD9A 1ZMLA 2A7JA 2FOBA 1WUNH 3RXKA 2GT8A 2ZIQH 2A5IA 2PGQB 4DT7B 1NT1A 1TRNA 5T6DA 5C0UA 1FPHH 5DP6A 1ZGVA 4BNRA 4TWYA 1BIOA 3NZIA 1BDAA 1VJAU 1ELVA 1YF4A 1EZUC 5F6MA 3LGWA 2KAIB 3RC6A 3SNBA 1ANEA 1O3IA 1PPHE 2ODPA 1QA7A 3OY6U 3Q3KA 2F83A 1T8MA 4JYTA 1O2IA 4RT1A 1QGFA 1BOQA 3PV5A 1P01A 3BTKE 5AVDA 2QXHA 4BXWA 2JETC 1N8OB 3D49H 2BY5X 3IITA 1O2GH 3I29A 3SU5A 2PHBA 1O39A 3RXQA 3GYLB 3SJ8A 1NC6A 1YLNA 3ZZCA 4NFFA 4AGJA 2QF3A 1O2MA 3QUMP 1WCZA 4X1PU 3T29A 1DS2E 2VH0A 3BTFE 2ZU3A 1SLUB 1L1JA 2FX4A 5LH8A 5C2ZA 1F2SE 1SFQB 5ABWA 1ZSKA 2VB0A 1BCUH 6ESTA 5EPNA 1DITH 3SI3H 3Q76A 1ZRKA 2BQWB 1E0FD 1XM1A 3MU8A 1HXEH 5T1VA 3NWUA 4CBNA 5HGGA 2ZHFH 1CHOG 5GPIB 3TJUA 2QV1A 2PKAA 5HM2A 1CO7E 3KYFA 1Y59T 1O2RA 1ANDA 3GCNA 1GHAF 2SNWA 2XC0A 2WYJA 1GCTC 2WV9A 3GY7A 4ISLA 3N7DA 3SU2A 5C5NA 5A8XA 2OQ5A 4RI0A 4ASUD 4D9RA 4A1VA 1BRUP 1LKBA 4KTUA 1EJMA 3VXFH 4DG4A 1ELTA 2BDGA 4FUEA 1K1NA 1HAVA 2AGIX 2PKSB 5ESTE 1BTUA 3SQEE 3LGVA 2FTLE 2OC8A 3U8TH 3V7TA 2O8LA 1Y3UA 1YPEH 2FLRH 2CF9H 2ZHQH 3SUGA 4BXSA 3ENSB 3PLPA 3QZRA 1S6HA 1TGTA 3SW2B 2PGBB 1IQFA 1O3JA 2VVUA 1V2MT 2AMPA 1K1OA 4X8SH 1S5SA 3MU5A 1ANCA 3BSQA 5C5OA 5K7RA 2GZ9A 2FOMB 2O9QA 2TGTA 4LK4A 3BTHE 2EI6A 4K5ZA 5EU8A 1VZQH 3S9CA 3F1SB 1QL8A 5HYOA 1ABIH 4Y79A 1O3EA 4FUCA 4QT8C 1JWTA 2ZFFH 4XBCA 3ZIAD 3TH3H 1W14U 1B0FA 1ZTJA 3EGKH 2AGEX 1EKBB 2BD4A 5LPEA 1QB6A 1JIMA 1KTSB 4CR9A 1AKSA 1QZ8A 1ZPBA 1EB1H 1C5OH 1P04A 1Y3YA 3MH4A 2A5KA 2ZFPH 3NK8A 2A4QA 2BLWA 3SHCH 5EJLA 1ETRH 3A83A 1ANBA 5JBCS 2TGAA 1DUEA 2IJOB 3RC4A 2HNTE 3RLWH 4H4FA 2ILNA 4TSFD 1GHVH 3VFEA 1QY6A 1BB0B 1VCPA 3SYJA 1MKWH 1T7CA 2KCAA 5EOKA 1WXRA 3ZZ4A 3GCTF 5C1UA 5GXPA 3MH5A 5HIYA 2A7HA 3MMGA 2Z9JA 3FN8A 2RFKC 4MNWA 4FUDA 5DG6A 2C90B 4ZAEA 2P16A 3WWFA 1OP2A 2WPDD 2D1JA 1J16A 3ATKA 1JRTA 1KDQA 2XCFA 1E1QD 1C2MA 8LPRA 4XDEA 4KELA 3BTDE 2GVFA 5DP7A 4MG3A 1GWAA 5JBAS 4KP0A 3KCGH 1XUHA 1MZAA 1PPGE 3M7TA 1W7GH 3SJ9A 2ZPRA 1C1WH 4OS6A 2GZ8A 1XKBC 1TQ0B 1UTOA 2WINI 4AG1A 5JB8S 4AG2A 1GJ6A 1NU7B 4GVUA 1WU1A 2P59A 1AIXH 1LDTT 9ESTA 7GCHG 1V2NT 1A61H 1KYNA 3GY4A 1S82A 1BJVA 2UUKB 3EDXB 5F8TA 3SNAA 1HRTH 2ZHEH 2W3IA 2RG3A 1BMAA 1ZHRA 1O3NA 2VINA 2PFEA 5EXMA 1SMFE 2C93B 1SOZA 2ZNKH 2Q6DA 1GL0E 2AIQA 3TJVA 1P11E 5C67A 1BMNH 1OYQA 3VEQB 1HIAB 3DA9B 6GCHG 3TJOA 1AO5A 2J34A 4OS1A 4ZHMU 3A8AA 5HXFA 1HAGE 2XRCA 2LNCA 1CGHA 1MAYA 4K1EA 2B9LA 1O36A 2HNTF 4O97A 2Y5HA 3E91A 2FLBH 2F91A 2VVVA 1O3OA 5FX6A 4F55A 1RXPA 1O2YA 5FPSA 3MNCA 1Q2WA 1W0KD 5A0BA 3MU4A 3UR6A 4YLUA 3PV4A 3RMOH 1UTNA 1CE5A 1MAXA 1BZXE 1MKWK 1FY3A 2WPHS 1JXPA 3LH3A 3MWIU 1IHSH 1QBOA 4FUGA 3RXFA 4B2BA 3ZZ3A 1ABJH 2ANMH 2A45B 4JZEH 2C3SA 3URDA 2R2MB 5LPRA 4Y6DA 2F9VA 1O2HA 4OGXA 4NA8A 2CMYA 4Q7YA 4NIYA 4MVNA 1EFRD 1OP8A 4ZMAH 2ZDMA 3A7YA 3RXIA 2OC1A 3U9AH 1P9SA 1W13U 4X2YA 2BXTH 3TGIE 5F53A 3PTNA 4H6TA 1VGCB 1BTWA 2ALVA 1IAUA 2J95A 2KX4A 4HFPB 1SHHB 1PQ7A 2PR3A 2GT7A 1O3FA 1S84A 3P95A 3LOXA 4YXWD 4GHTA 2QF5A 1DE7H 2PKAB 4BANB 5AF9H 4X2XA 1FDPA 3R3GB 4Y0YE 2OC0A 4Q4LA 2C8ZB 2GDDA 1FAXA 1ZJDA 1V2WT 1Z8GA 1PPFE 1KXFA 1NRRH 4MPVA 1HDTH 5L30H 2V0BA 2VIPA 5L2ZH 2HALA 2C4FH 4MNVA 2TPIZ 3PM3A 4AYVB 3PV2A 1F0UA 3NKKA 2ZFRH 3LONA 1Q3XA 3U98H 2GMTB 1BHXB 2A4RA 4VGCC 3MFJA 4NG9H 1EOLA 4D9QA 2AH4X 4GPGA 4Z0KA 3HK3B 3N7OA 1F5RA 4JYUH 4IC6A 3O8RA 4B73A 3NCLA 4CRCA 4CRFA 2R2WU 3SU0A 3ZV8A 1C5RA 3AASA 3RMMH 4X8VH 2GV7A 2J5UA 3SU4A 3QZQA 2TIOA 5TCAA 4ZCNA 1ORFA 2V6NA 1PQ5A 1MCTA 1O3DA 1YYY1 1Z71A 4D7GA 1TB6H 1CA0B 4K1SA 2UWLA 3RXBA 2KAIA 1C5LH 2V7QD 4YZUA 4P02A 4Z1MD 1HAPH 1GHXH 2G8TA 1D6WA 1CA8B 1K9OE 2ZDNA 2R9PA 1G32B 3VB5A 3GY8A 2YMSD 2ZU1A 2Q1JA 1CT2E 1AWFH 1C1MA 4I8HA 2P8OB 2F9PA 1QL9A 3PWCA 4DJZB 4D7FA 1AFEH 3PMAB 1P09A 1NO9H 4CRGA 7ESTE 3STJA 1WSSH 3EYDA 2P3UB 1LVOA 4YT7H 1O2SA 5C20A 1GBKA 5B6LA 1NZQH 3BG4B 3M5NA 1YP9A 2VIVA 2HOBA 1TX7A 4FVDA 3BIUH 1RIWB 2W7UA 1QJ6B 4B75A 3CNRA 3F6UH 3MTYA 1H9HE 5L6NH 2WV4A 3MO3A 1C5NH 1GG6C 1Z8RA 3SV7A 2V3HH 2KM0A 1GBHA 2A1DB 4X2WA 1KDQB 3A8CA 1DSTA 3C27B 5PTPA 1DM4B 1F0SA 2GX4A 3P8FA 2AEIH 4U01A 1PPZA 2GTBA 4Y11E 5IK2D 1TNIA 2YMSB 3E16B 1O5GH 1TRYA 2W3KA 3Q00A 1DPOA 1GI9B 3K2UA 1K21H 1YBWA 3UUZA 5GWZA 4X6OA 1SGNE 4XD7D 2TBSA 2OD3B 1AE5A 1EXFA 2VH6A 3T27A 1FY1A 1GBLA 1O37A 2BD2A 1OPHB 1IOEA 1GI0A 1FNIA 1H8DH 1K1LA 1NESE 2P95A 3RXLA 3TK9A 2FOGA 1A0JA 1YCPH 4ZUHA 1QQUA 5KEDA 5EW1H 1SR5C 3FZZA 4IMQA 1N6XA 4WMEA 1NFYA 1Y3XA 1C5WB 3A8BA 4AFSA 3EE7A 3W94A 3GY2A 1WTGH 2QN5T 3PYHA 2HPQH 1HB0B 1SGCA 1CT0E 3ZVGA 4FUHA 4ZKSU 4IN1A 3U1JB 1V2ST 1YPLH 3ZZAA 1O38A 2JETB 2EY4C 1W10U 1BT7A 1EX3A 1HGTH 1XVMA 2XNIA 3GCOA 2SGDE 1ELEE 3QK1A 1QQ4A 1GBTA 1PPBH 4AGKA 2QC2A 5HIZA 1MKXK 3M5MA 2BD8A 1KTTB 1EZXC 3GY3A 1VR1H 1SG8B 1O2ZA 3URCA 2YNBA 1TNJA 1KXAA 2H5DA 2QXIA 3U1IB 2BZ6H 5JB9S 3M7QA 1P2JA 1TGNA 4Q7XA 1O2OA 1PYTC 3LKWA 1LHDH 2ZC9H 1P12E 3RM2H 2ZKSA 1CGJE 1SGFG 5A2MH 1O5BB 3CS7A 4U32A 3PRDA 4YT6H 2RDLA 1Z6EA 1A0HB 2G81E 4ZXXH 1S83A 2BB4A 1HV7A 2QGRA 1P3CA 5EODA 3MI4A 1AUTC 1EAWA 2Z6BD 2RDEA 1F7ZA 1O2WA 2FP7B 1MTNC 4I8KA 1S85A 2B8OH 3SU1A 3C1KA 3V3MA 2BQ7B 5DGJA 2XBYA 3OU0A 1UVUH 3N99A 1OS8A 1MU6B 4JZIA 1LVMA 5DPAA 1H8IH 2ZQ2A 5E2OA 1A4WH 3UY9A 3I78A 2ZU2A 2PSXA 2FO9A 4GCHF 1P8VC 4BTTB 4DURA 1ARBA 2FESH 1GMDF 2BQ6B 1ELGA 2ZFQH 2BLQA 1YCPK 3ATWA 2ODYB 1TALA 4FUIA 2F9NA 3M7UA 4LXBH 2Q6GA 2WPIS 2V35A 1CSOE 4R8TB 2Z3CA 3LGYA 1AU8A 1C1NA 2BX3A 4UFGH 4Y10E 1T32A 2XBXA 1UK2A 1W0YH 1TX8A 2ZTYA 2SGEE 5HM9A 1GJ7B 4I86A 3AW0A 4FXGH 3PMBB 3EAJA 3MU1A 3ODDA 1TNHA 2FPZA 4NA7A 5JPMH 3MH6A 4YTAA 1MTUA 1W0JD 3AAVA 4U30A 4UFFH 1GDNA 3HATH 1C5ZB 2QYIA 1V6DA 2PTCE 2TRMA 1O32A 2NU0E 1WQSA 4ZH8A 4TPIZ 1TA6A 1SQAA 3K65B 1UK3A 4INHA 2FOFA 1L4DA 1SQTA 1RGQA 1ELFA 1L2EA 2F43B 1MCVA 1NROH 1XUIA 2NU1E 4FUJA 1GMHF 4I32A 3FP6E 3RMNH 1SGPE 3QO6A 1HIAA 1CHGA 3CS0A 1Y3WA 2FWWA 4M9FA 1K28D 2HLDD 2VBCA 1C1QA 1QA0A 2FI3E 1IQIA 3DFLA 2Z7FE 3SGQE 1WTHD 3TU7H 2BY7X 4PROA 1BRBE 4I8LA 3RXJA 2OBOA 1D4PB 1YGCH 2KR7A 3D23A 8GCHG 2M2AA 3PB1E 1ZPZA 1IQJA 3Q3YA 1L0ZA 4K8YA 5DN6D 3MQKC 1EAUA 1ESAA 1O2VA 1P05A 4CRBA 2OUAA 3M36A 1SLVB 3VGCC 1J17T 4DIHH 1THRH 2AHME 4CBOA 1DWCH 1SC8U 3FO8D 2OK5A 1T8LA 2P94A 5E2PA 1INCA 1LKAA 1UVPA 5LGOA 1DSUA 2G4UA 1ELDE 2JDID 2H2ZA 1NS3A 2HVXA 3SZNA 3GS9A 4Y7AA 1XUKA 1NRNH 2PUQH 4OM9A 1GI4A 1AN1E 3TJNA 3BTME 1GJ8B 4FU7A 1TNLA 1ZHPA 1NFWA 1Z6JH 3KL6A 3F9FA 1N1LA 1RTLA 3OTJE 2FS8A 4HTCH 1C5MD 2EI7A 1ZOMA 3BTTE 2XOKD 1P0SH 4RN6A 1HNEE 2VGCC 3GCTG 3P8OA 2ZTXA 1HPGA 4NIWA 1DLEA 5FX5A 5EPYA 1LQEA 1TA2A 1BMLA 2XWBI 2GDEH 4TWWA 3VB6A 2JH0D 1BBRK 2O8WA 1FN8A 4O9VA 2OBQA 1F5KU 2DE8A 1Z1JA 3NRLA 1D3TB 3RDZA 1TBQH 2ZGHA 3NUMA 3E90B 3P6ZB 3MU0A 1SLWB 3UWJH 1FN6A 3WWBA 1BQYA 2W6JD 4BAKB 3F68H 2SFAA 2ZQ1A 2CK3D 1KY9A 1MZDA 2ULLA 3VB7A 1O35A 2EA3A 1RS0A 4I8JA 3RXSA 1E1RD 1K1JA 1UVTH 2O8TA 3DCLA 1B7XB 1D3PB 1MBMA 1AVGH 1YCPM 2NWNA 1O33A 1K1PA 1T31A 1C2HA 1SGQE 1EB2A 3ZVCA 3F9EA 1O3BA 4JZ1A 4KGAA 1N6YA 1F0RA 5TCCA 1IQNA 4ABJA 3FFGA 1BTPA 2W5EA 1M9UA 2BYAX 2A31A 2D2DA 2F4LA 2XXLA 3PO1C 5TJXA 4RKJB 3RXOA 4IC5A 3SNEA 4F4OC 3AK5A 2FODA 3P8GA 1G2LA 1YPHE 1NRQH 2BD5A 1C5YB 4SGAE 3B8JA 2RA3A 1L1GA 5EJZA 1O31A 5DJ7A 1MQ5A 1EAIA 1V2LT 1GVZA 1TOMH 4GSOA 4F48B 1HJ9A 1EASA 1LPKB 3AAUA 1EPTC 4BAMB 3ZZDA 4AC9A 3GCHB 4X2VA 4K1TA 2ZU4A 1NU9A 1BMFD 2J92A 3M61U 1P2KA 3E8LA 1EZQA 1P10A 4XFQA 2ZHWH 4Y7BA 1DLKB 4IMZA 1S0QA 1V2JT 1TMTH 2ZTZA 2SGQE 3K9XB 5C1YA 1UVSH 2XC4A 2G4TA 2ZF0H 4A1TA 4VGCB 3MYWA 1BMMH 3VPKA 3RXGA 1GJ9B 1AUJA 1PPCE
chains in the Genus database with same CATH topology
1V2QT 4GHQA 3FP7E 1CHOF 1CVWH 2OCVB 2ZA5A 5EQRA 3BTGE 4CR5A 2DE9A 1ZSLA 5E8EH 3ZYEA 4OGYA 1GDQA 1N8OC 1ZJKA 5FCKA 2VWOA 4K60A 1GVLA 1MTWA 2ZDVH 4KTSA 7LPRA 1T8NA 1V2OT 4X1RU 4AB9A 1C1OA 2UUYA 2Y7XA 4OS7A 3LT3A 1O3MA 1Q31A 1ELAA 3L6PA 1SGTA 1UTPA 3OYPA 1O3PB 1IQGA 1G2MA 1KXBA 2OLGA 4THNH 8KME2 3ATLA 3A89A 3M35A 3MOCA 4ABGA 1MMJN 4K69A 1GBAA 2QY0B 1QJ1B 2C8WB 4XBDA 3W95A 1VCWA 3PMJA 2FMJA 1BTHH 2F9BH 2G52A 1ZTKA 4X1NU 1PQAA 1WYKA 2ZI2H 2XYAA 5FCRA 2UWOA 1K1IA 5FPTA 2VWNA 3S7HB 3RU4E 1KLTA 1YLDA 1P57B 3KIDU 1FY5A 2GZ7A 2RCEA 4WF8A 1QIXB 3M3SA 4JMYA 2O8MA 2PLXA 2ZP0H 1GGDC 3M37A 2SGAA 3O8BA 2DUCA 2SGFE 4MPUA 1GG6B 1ZRBA 2GCHG 1OWEA 1DDJA 1BRCE 5DP3A 3SBKA 3KHVA 3PWBA 4UD9H 2CXVA 5E0GA 1UCYE 4NZLA 1Z7KA 1GMCG 1LHFH 1FPCH 1F5LA 2QA9E 1GCDA 1BHXF 1P9UA 1UCYH 4Z6AH 1Z1IA 2JH6D 1J8AA 4XE4A 1PQ8A 1V2KT 2GGVB 5H4IB 1J9CH 2EI8A 3BF6H 1LPGB 4JZFH 2ESTE 4Y0ZE 1K2I1 1MTSA 1ZHMA 2FZZA 2O8UA 3HGNA 3VXEH 4A92A 3KQBA 2G55A 1J14A 3SGAE 3RXAA 4ISIH 4NIXA 3G01A 4A7IB 1GI6A 1GI5A 5FHTA 1TGBA 1GHYH 4R0IA 4BTUB 1HJAB 3T28A 4X6MA 3EQ0H 3RXRA 2VVCA 3VB3A 3SNCA 4RKOB 1HFDA 4CHAC 2ZG0H 2I6SA 1SFIA 3ZVAA 4ZKRU 2GCTB 1FMGA 7GCHF 3LC3A 2GV6A 2A5AA 1P2MA 3RU4D 1XX9A 5GCHG 4BAQB 2BD7A 2FX6A 1LTOA 1QB9A 1XXDA 2UUJB 4J2YB 1DY8A 1DICA 1XMNB 1EJNA 2BMGB 1DX5M 1FI8A 3DHKH 3SJOA 1AVWA 1ESTA 1IQKA 6GCHF 3FZDA 4X1SU 2Y5GA 4TY6A 3NPSA 1UTQA 3LPRA 1GBEA 2A32A 3SU6A 3DUXH 1GHZA 1A7SA 4YOGA 1DWEH 1C5QA 1ID5H 1MTNB 1PFXC 1Z8JB 2BDAA 1HAOH 1Y5AT 2BZAA 1HAIH 3R0FA 3TITA 1ARCA 2FOCA 2BLVA 2QIQA 4YM9A 1NFXA 3SUDA 1ELCA 1GBDA 2J38A 4ZKOU 1DUAA 1A3BH 4HI3A 4NSVA 3AW1A 1IQHA 2J9NA 1UO6A 1XXFA 3HK6B 3KEEA 2Z9KA 4WMFA 1P2OA 4ABBA 4E7NA 3TIUA 5A0CA 1QRWA 2BD3A 1O5EH 2R0KA 4BTIB 1BTXA 3A8DA 4AORA 4CRAA 3ZVEA 1PPEE 4OS5A 5T3HA 4OS2A 1HAZB 3MNBA 1FIWA 3UWIA 4ABDA 1DFPA 1GJ4H 2CHAC 2ZHDA 1Y5UT 3UREA 2W26A 5EQSA 2G00A 1CBWC 1F0TA 1O3HA 4A5TS 1L4ZA 4HGCA 1UTMA 2H6MA 3ESTA 1EAXA 2QAAA 3QDZB 2ZPQA 1C4V2 1GHBG 3KN2A 3L3TA 2ZGBH 5GJ4B 2OINA 5EQQA 1T4VH 2H9TH 1IQEA 2BDCA 1JMOH 1AWHB 2BDHA 1DT2A 5DK1A 5G4BA 3RXVA 4LOYH 3A81A 1HYLA 3GDVA 2BOHB 2R3YA 2V3OH 4WMDA 3SORA 4NWKA 1C1UH 1TFXA 5CHAC 1SQOA 1VITG 2WV5A 4UE7H 1O2QA 1TYNA 5BRRE 1LHCH 3SQHE 1SGFA 4Q2KA 2F3CE 1TMBH 4KTCA 4UONA 2FTMA 5IDKA 4DY7B 2WUBA 4WVPE 4CH8B 3UPEA 4F49A 1BTZA 3VGCB 2HNTC 2Q6FA 1OWDA 1S81A 1C5VA 5AFYH 2Z9IA 3PLBA 1U6QA 2WPLS 1B0EA 1AFQC 1ZZZA 2AERH 2BM2A 2HRVA 4ZHLU 5F8ZA 2C8XB 3EA9A 1IHTH 2ZZUH 3UNSA 3TH4H 3RC5A 1C2GA 3E0NB 1OSSA 4NSYA 2G51A 1T8OA 1C5PA 1THSH 5ETXA 1ACBE 2R3UA 1O3AA 1C2LA 2ZPSA 2NU3E 3KF2A 1IQMA 1BTYA 1KXCA 5A09A 1G3BA 2AGGX 3QGJA 1H9LB 4UDWH 3GY6A 3A7XA 4JYVH 4H6SB 3RXMA 3TPIZ 4XSKU 2BY9X 4YLQH 4ISOA 3BV9B 2BVXH 2BXUH 1SOTA 3RXUA 3MNSA 1NFUA 4ABFA 1G3DA 2I6QA 5DP9A 3SV6A 1AZ8A 3RXTA 3LGUA 1O2KA 4FUBA 3V0XA 1HLTH 1K22H 4YO9A 1GCTB 5DP5A 3T26A 1SGEE 1CQQA 1OP0A 3SJKA 2FDAA 3UIRA 3RXCA 3ZZ6A 1SGDE 1RD3B 1GI3A 1GJCB 4WWYA 4LZ1H 3PROA 1IQLA 2VIDA 4IW4E 2A2XH 2H1UA 1VCQA 2ZGXH 1CA0C 3HGPA 3LIWA 3KGPA 1EOJA 1GPZA 3ZZ7A 4MLFB 1KLIH 2QXGA 1A0LA 4TY7A 3MNXA 1AE8H 4AX9H 4BAOB 3LC5A 2P8OC 3IWMA 1KXDA 4B2AA 3D65E 1UTJA 3BTQE 1O34A 4IS5A 6CHAC 1JOUB 3UQVA 1OWKA 1HCGA 5A0AE 2A4OA 5C1XA 1RRKA 2ZGCA 3BG4C 1LVBA 1GJAB 4AFQA 1E35B 1GHAG 5JYIA 1G36A 2WPKS 3F9HA 3MH7A 2OC7A 5JBTA 1DVAH 1MD8A 4B74A 3A7TA 2B7DH 3P8NA 2G5VA 3P70B 1S6FA 1QBVH 1C5TA 1H9IE 1A5IA 2FOEA 3M3VA 3A7ZA 1BITA 3OX7U 2AYWA 3STIA 2B5TB 1X7AC 2VIQA 2ZDAH 3A82A 4K8BA 1EPTB 1O5CB 1O2NA 3A86A 1FJSA 3OSYA 4WJG2 2PSYA 1O2TA 1G37A 1C2JA 4NZQA 1ESBA 3E1XB 3SV9A 2ANKH 1UTLM 1G30B 1C1VH 1CU1A 3LGIA 2B0FA 1K1MA 1ZMJA 1ZMNA 1UJ1A 1AB9C 1C2DA 2XBWA 5BPEA 4LZ4B 1O2PA 2ANWA 5E0HA 1SB1H 4I7YH 1O3GA 1C5XB 5HMAA 2H9EH 5FXLA 1XUJA 5L2YH 4Y8XA 2UWPA 3TGKE 1NTPA 3T62A 3QWCH 3U8OH 4A6LA 1W3CA 3MO9A 4IN2A 4AFZA 2BDBA 4ZROA 5DP8A 1KIGH 2BDIA 4ABAA 4DIIH 5EW2H 3ZVFA 2AS9A 2R0LA 2VWMA 1TPSA 1ZSJA 3K6ZA 1LVYA 3ODFA 1A5HA 1SPJA 4K3JA 4Y8ZA 1EP5A 3ELAH 3RXDA 4CH2B 1W0ZU 3QGNB 1AQ7A 1QRZA 3AVZA 3ZYDA 4FUFA 1A46H 1SL3A 1LPZB 2FOAA 1QHRB 5JBBS 4NGAH 1OWIA 2SGPE 3S9BA 1WQVH 1LO6A 1KSNA 4E06H 4INLA 1UVOA 5SGAE 4HZHA 3QTVH 3LU9B 1GJDB 1EQ9A 3IG6B 1YPKH 1V2VT 4U2WA 1O5FH 1TRMA 4MPWA 1GGDB 4MTBA 5DP4A 1EZSC 4BAHB 1QFKH 3BTEE 1B5GH 2P3TB 5I46H 2BVSH 2FI5E 1TE0A 1C4Y2 3F9GA 4D76A 4H42U 4ESTE 4O3TA 1SGRE 1TPAE 1W7XH 3KQEA 3SN8A 2THFB 1ETTH 4MNYA 2PW8H 4FVBA 1QCPA 2FM2A 1ELBA 8GCHF 2JKHA 3UR9A 2BVRH 4UFEH 1FY8E 3T2NA 1HAYB 3HPTB 1GBMA 3TNSA 3NXPA 1GBFA 3UFAA 4WXVA 2RA0A 4MPXA 3EA7A 1A2CH 2CN0H 4TPYA 1BA8B 3P92A 4O3UA 2EEKA 5DO4H 1AI8H 1GJ5H 4B1TA 3UOPA 4YOJA 1UHBA 1XVOA 1VJ9U 1O5AB 1NN6A 1JBUH 1FONA 1WOFA 1D9IA 2AMDA 1XKAC 1V3XA 2AFQB 2PTNA 2ZWLH 1TQ7B 2OXSA 1E36B 1TOCB 5E0JA 3GDSA 1H4WA 4K2YA 1ZGIA 4AB8A 4CHAB 4ZKNU 1UK4A 1L1NA 2BOKA 1OXGA 1O0DH 3P17H 3SO3A 3JZ1B 1C4U2 1GDUA 3PTBA 1O3LA 4CRDA 1HAXB 1S0RA 1GHWH 3ZV9A 1O3CA 2BDYA 1DXPA 2D8WA 4DCDA 1QL7A 3E6PH 1C5UA 2GKVE 1OWJA 1MUEB 4GUXA 2FOHA 1A5GH 1QB1A 5EXNA 4Q7ZA 1MQ6A 1O5DH 1QJ7B 4XBBA 4X0WU 3GOVB 3RXPA 1C2KA 1OYTH 1FUJA 4X6NA 5GIBA 2VJ1A 1RJXB 3MHWU 4INKA 3S9AA 1EP6A 3DD2H 1TAWA 4ABEA 3BTWE 4NFEA 4X8TH 1Z8IB 2CV3A 2Y80A 1UTKA 1CGIE 9LPRA 1SSXA 2Y6TA 1ETSH 5K0HA 2EC9H 1YPMH 4NWLA 1NRPH 5EXLA 3MO6A 1LQDB 4NA9H 5DKMA 1GI7B 1ZYOA 3A88A 2FEQH 1YLCA 4MDSA 3A85A 2J94A 2XC5A 3B9FH 5JDUB 2ALPA 3ZVBA 1FQ3A 1AHTH 1E37B 4ZHAA 4ABHA 1GL1A 2NU2E 3KQCA 1C5SA 3QN7A 2CHAB 1NPMA 1FIZA 3BEFB 2OQUA 1SGIB 2H9HA 1CBWB 3LGTA 1TNKA 1WAYB 3TVJB 1JRSA 1TPOA 4I33A 1HBTH 1FY4A 1MH0A 2BTCE 2PKSC 1YPJH 2H5CA 1V2UT 2M5TA 3O8DA 1H1BA 3BG8A 4M7GA 1CT4E 2Y5FA 3Q77A 3EA8A 5I25A 2Z3DA 1HAHH 2ZECA 4YOIA 3DFJA 4Q80A 1QTFA 1C2IA 2HPPH 1TBRH 3E0PB 2WPMS 5CHAB 3TH2H 2FI4E 1BJUA 3SOSA 1FAKH 3SI4H 3FANA 3OY5U 2XCNA 2ZCKP 2HGTH 1MBQA 1P2IA 2ODQA 1WV7H 1W2KH 3FP8E 2A7CA 2BX4A 2F9UA 3T25A 1LHGH 1PYTD 4DW2U 2ZEBA 4Y76A 3QX5H 3ZZ8A 4IBLH 3PLKA 4DGJA 1RTKA 2CGAA 5J4QA 2ZO3H 3RXEA 3SNDA 1O2JA 3WY8A 3RXHA 1C9PA 1O2UA 1FV9A 1SHYA 3RP2A 4JK6A 2LPRA 1AFQB 3GCHC 2FXRA 4MNXA 5J4SA 2ANYA 4AZ2B 1D3QB 1AY6H 2UUFB 3DT0H 1ZTLA 2ZCHP 1GI8B 4I8GA 1J15A 4WXIA 5T6GA 1DWBH 1NM6A 3HKJB 1KXEA 2WYGA 1TPPA 3EE0B 3I77A 1O2XA 3ATMA 1G9IE 2ZU5A 3KNXA 4UEHH 1GJBB 4WH8A 3B23B 1MU8B 1GI1A 2D26C 3LDXH 3KQDA 3H7TA 5F03A 1FXYA 1SI5H 1DWDH 1AZZA 2VIWA 3BEUA 5FAHA 4FU9A 2Z9LA 1KLJH 1HAVB 1Y3VA 1QR3E 3SUFA 1RFNA 4E7RG 1PJPA 3U8RH 1TABE 1EPTA 1W8BH 3CENA 4X8UH 1TX6A 3BN9A 1AD8H 1YM0A 3M5LA 5GDSH 4CREA 4B71A 1WBGB 1RTFB 1GBJA 1HXFH 2XTTB 3CP7A 2QF0A 1SGYE 1UCYK 1TNGA 1P06A 1E38B 3ZVDA 2GCHF 4IGDA 1OOKB 4X6PA 1P3EA 2IPHA 1A1RA 1O2LA 4O03A 1G3CA 1QRXA 1UHBB 1V2PT 3O8CA 3S0NA 2CF8H 2STAE 2QCYA 1GMCF 4FU8A 5AFZH 3M5OA 3UNRA 5CMXH 4I31A 1AKSB 1MKXH 1TGCA 1THPB 3RUOA 3S7KB 1DANH 1LMWB 1QNJA 6CHAB 1C1SA 1LCYA 5F8XA 1C1TA 1MD7A 1TONA 1EJAA 3SHAH 5A8YA 4GLYA 2ZGJA 3TLOA 2OP9A 3L33A 4JCNA 3SGBE 4ISNA 3V13A 1F92A 1NRSH 1TIOA 4DOQA 4D8NA 1SBWA 2Y7ZA 3ATIA 4OS4A 1YPHC 5LPFA 4GCHG 2HWLB 1EUFA 1GMDG 2ZDKA 2PUXB 3A80A 3ZZ9A 2STBE 3ITIA 4WY3A 2ZFTA 2GP9B 3HKIB 1BRAA 5FBIA 2WPJS 1G3EA 2YOLA 1HJ8A 4ISHH 5ESBA 3SV8A 2J2UA 1GVKB 1MTVA 5GCHF 3PMHB 1GBCA 2FYQA 3LH1A 1BUIA 3RU4T 1P03A 2XW9A 4A1XA 3RLYH 1W12U 2AIPA 2C8YB 3GISB 1VGCC 1DXWA 2HLCA 4SGBE 4XOJA 3S69A 2BY8X 2ZFSA 1TGSZ 1XUFA 2JH5D 5FPYA 2VWLA 5FBEA 3TK5A 2IN2A 2Y81A 3FVFB 1AGJA 3ZZBA 2AMQA 2ZCLP 2XBVA 3UNQA 1AB9B 1V2RT 3H7OA 2BHGA 5EGMA 3A87A 2W7SA 1HJAC 1NY22 1W11U 2A4GA 2Z94A 1GMHG 1VITH 4J1YA 4DVAU 4RSPA 3M3TA 4AOQA 1GI2A 6LPRA 2GCTC 2VNTA 3U69H 1OKXA 1LHEH 2GMTC 1D6RA 1XUGA 1T4UH 1TLDA 1YPGH 2PV9B 4X1QU 1TBZH 2J4IA 1AMHA 5T6FA 1OX1A 3T5FH 2VGCB 5EG4A 3TNTA 1FZZA 1TWXB 4UFDH 1YKTA 3FAOA 3GY5A 2GD4B 2TGPZ 1UMAH 2QXJA 2Z9GA 3BEIB 3H5CB 3VB4A 2A2QH 2Z3EA 4ZXYH 3QLPH 2YNAA 1E34B 2CJIA 3Q3XA 1FLEE 1V2TT 2VU8E 8ESTE 4Y71A 3SJIA 4BOHA 4JZDH 2XWAA 3SU3A 3TGJE 4TYDA 5CE1A 1C1PA 3UOUA 3QTOH 4AFUA 1GBBA 1SVPA 4AYYB 3GYMA 2NU4E 2A0QB 2P3FH 4MQAA 1Y5BT