3A8BA

Crystal structure of trypsin complexed with (e)-4-((4-bromophenylimino)methyl)benzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA02
8GCHG 2XWAA 1K1IA 2PKAA 2OBOA 5I25A 1MKXK 3BTKE 3BTME 3P95A 1OPHB 4ISIH 3PWBA 4I8GA 4CRBA 5L2ZH 2ZFSA 2QXIA 1O2JA 1EJNA 1S81A 1TYNA 1G30B 2R3UA 1NC6A 4K3JA 1OOKB 2XW9A 3SU6A 3MO6A 3SNAA 3ZZDA 2J4IA 1BIOA 1ARBA 6CHAC 1YCPM 3HGNA 3EDXB 2FTLE 4UD9H 1ANEA 2F83A 3A88A 4DG4A 1EZXC 3K2UA 1GJ6A 1SHYA 1KXBA 4B71A 1MKWH 4O3UA 1FIZA 3LPRA 3UPEA 2Y6TA 5HM2A 2Y7ZA 4F49A 4UFEH 3P17H 4AG2A 1TX8A 4AN7A 2R0LA 3T2NA 2HNTE 4JYUH 5I46H 1GI5A 2UUFB 2FIRH 1ANDA 1Y3XA 1UK4A 5FAHA 1S0RA 2A31A 1HLTH 4Y8YA 1WQVH 4HTCH 2GTBA 4U32A 1CBWC 2NU4E 1TNJA 3DFLA 2Z9IA 1SC8U 1SGFA 3RLYH 1G3CA 3PM3A 2F9PA 4JZDH 4YOJA 1V2ST 2RG3A 3FP6E 3C1KA 1C9TA 1FY1A 3M35A 3QZQA 2PGQB 2Z94A 1UMAH 4O3TA 1PQ7A 2BY7X 1VGCB 1DDJA 1KXEA 1MCTA 1WUNH 1GHZA 1TABE 4XFQA 1LVOA 1LPGB 3HGPA 3HK6B 3BEFB 3U1IB 2GV6A 1GBEA 3RXCA 1O3FA 1L2EA 3UQVA 1Z8GA 4K2YA 2ZDVH 1H9LB 4NSVA 2PKSB 4FUEA 1LMWB 2PHBA 3LJJA 2TGTA 3NXPA 1HYLA 1GWAA 2G51A 3ODFA 1KDQB 5HM9A 2A2QH 3MU5A 5FX5A 1FAXA 1P8VC 2NWNA 1QTFA 4K1SA 1QA0A 1ZHPA 2VH6A 4BOHA 3D62A 2VIWA 3RXSA 1BHXB 1HXFH 3Q77A 4RSPA 1CQQA 1C2FA 1GHXH 2CF9H 2FLBH 3FFGA 4AORA 4ZHAA 1UCYE 1Y3UA 4IGDA 2ZHQH 4WMFA 1K1NA 1L1JA 5E8EH 3VXFH 3P6ZB 1P9SA 3U69H 2C3SA 1C1QA 5A09A 1GCTB 2O8LA 1V2TT 4JYVH 3N7OA 3TK6A 4B74A 1G3DA 2GMTC 2O8UA 3UUZA 5DP6A 4Y8XA 1MAXA 1WYKA 1PPZA 1P12E 3UQOA 3VPKA 2J2UA 1BA8B 3ZVGA 1SG8B 2XBXA 5LPFA 3SI4H 1C4Y2 2J95A 3M5LA 1NO9H 2FYQA 4GPGA 1E36B 3F9GA 1AB9B 1IQNA 3GY8A 1RJXB 1GHWH 3PO1B 1C9PA 2ZHFH 1XXDA 3P8FA 1EP6A 4I32A 3SJIA 1A3EH 2FI3E 3KL6A 1FONA 3F9FA 4B75A 3FVFB 1IQLA 2FX6A 1QQUA 4WXIA 4AZ2B 1DANH 1O2RA 1QBNA 3FZZA 1EJAA 5F8ZA 2LNCA 3AAVA 1ZJDA 3ZZ6A 5FPYA 1BITA 1KXCA 3SV9A 4O9VA 2FZZA 4MNVA 4H6SB 4UFGH 2OP9A 1C5QA 4IW4E 1AE5A 2ZHWH 4AX9H 2BDBA 2BD5A 2BVSH 1HXEH 1GHVH 2VWMA 4FVDA 4A6LA 3UWJH 2GZ8A 1WAYB 2ZQ2A 2GDDA 3MNXA 1DWCH 1C2JA 4CR9A 2A5KA 2AH4X 1AMHA 2Q6FA 1C2IA 2AGIX 1UTLM 1AN1E 1SQOA 4MPVA 4D8NA 1ANCA 1N8OB 5IYTA 3SN8A 1O2KA 1A0LA 1TNGA 4FUHA 2M5TA 2FLRH 4Q7YA 2ANYA 3PMJA 1V2UT 4H6TA 4Y7AA 4OS4A 5FXLA 1DICA 3TJNA 1NRNH 1A0JA 3BTFE 1O5GH 1FQ3A 2EI7A 2AS9A 1GI9B 3UFAA 1MAYA 3HPTB 2C93B 2VIPA 2EA3A 2GMTB 1LPZB 2J34A 1V3XA 4IMZA 5TJXA 2FOHA 1CGHA 5DGJA 3U8RH 3RMLH 1DS2E 2XCFA 1TALA 1FZZA 2ODPA 2C8YB 3ZVBA 8KME2 1BUIA 1QGFA 4SGBE 1K28D 1YLCA 4JCNA 4AGKA 1BRAA 2BLQA 1YPEH 1E0FD 1SLVB 3M61U 1K2I1 3A81A 3BV9B 1BZXE 2BY6X 5EXNA 2Z9JA 2UUKB 6ESTA 1GVKB 4XBDA 1HAVA 1GMCG 1S84A 4AG1A 5DJ7A 5C67A 1KTSB 1HAVB 1AGJA 3U1JB 4DJZB 5CMXH 4LK4A 3VB7A 2ZHDA 2H5CA 1EXFA 5JYIA 1XUIA 1GDNA 4NA8A 3KF2A 2EI6A 4ABFA 3SNCA 1YPKH 3QDZB 1BTWA 2CHAC 2ZHEH 4ZKNU 4GLYA 1C1RA 3K65B 1A5GH 5A0CA 1GMCF 1C1VH 1O2XA 2Y5FA 1E34B 1BBRE 1FY3A 4LZ4B 4X6OA 1MU6B 2CJIA 1YPGH 2SNWA 3A83A 1YYY1 5GXPA 3CS0A 4KKDA 2XYAA 1KXDA 1LDTT 2ZEBA 1B0EA 4FU9A 3RU4E 4B2AA 3PROA 1MQ6A 3CENA 1GCTC 2VWNA 1C1OA 3LH3A 3AW1A 2A4QA 2H9HA 8ESTE 2ZDKA 1KY9A 3LH1A 3E16B 2G55A 1T8NA 3A84A 1O2VA 2FYRA 3U8OH 1VITF 2G5NA 2ZIQH 1P05A 1DLEA 2F91A 1P2QA 1DE7H 1IQKA 3B8JA 4IMQA 1HUTH 2KAIB 3SUEA 4IC5A 3MNCA 4BXWA 1YLDA 2VU8E 1XUJA 3BG4C 3LGVA 1UVTH 2GGVB 1TPAE 4X1SU 4NA9H 3ZYDA 1HIAA 1UK2A 2BY5X 4Y8ZA 4Q80A 1EAIA 1CU1A 2TBSA 4TWWA 5A8XA 2ZU4A 1O2GH 5JBCS 2V3HH 3PB1E 1VGCC 3M36A 3PLKA 2ZNKH 1QNJA 2AMDA 1CT2E 1MKXH 1RTKA 4QT8C 2GKVE 2Z7FE 5AHGH 1QHRB 3S69A 1XVMA 1G37A 2A2XH 3TGIE 2XC0A 1BRCE 1O3PB 3P8OA 5H4IB 3GDSA 1SGFG 3F6UH 1V2VT 2WPJS 1KLIH 3A7TA 3IWMA 1NU7B 2FM2A 4JZIA 1OWKA 2GD4B 5CE1A 4AOQA 2CGAA 1K9OE 2XBWA 2AGGX 3RXTA 3RXLA 3SU1A 4E06H 1ZTLA 3ATIA 2ZCLP 2EEKA 3VXEH 2LPRA 1ETTH 1O2UA 2ZFFH 5T6DA 3U98H 1L4DA 1FMGA 1W7XH 3URCA 1IHSH 1UTJA 3B23B 1AD8H 3KCGH 2DE9A 1C5SA 1C5ZB 4I8LA 4M7GA 1JOUB 1THPB 2FMJA 3SUDA 1K1LA 3SUFA 4GHQA 2XCNA 2ZTXA 2BLWA 4Z0KA 2BXTH 2Q6DA 1MTNC 3BEUA 4E7RG 2F9NA 3MWIU 1HNEE 2ZDNA 3MOCA 1HAOH 2QGRA 2ULLA 1K1OA 2OC8A 3AAUA 3K9XB 4TWYA 3V3MA 4MNXA 1J16A 4Z6AH 2Y5HA 5J4QA 2BD4A 1OKXA 2ZPRA 4GUXA 2OQUA 3ZZ9A 1KTTB 1CA8B 4GCHG 1T4VH 1NTPA 1BBRK 1FLEE 1MBMA 2C4FH 3BTTE 4YT7H 3RXPA 2XBYA 1O30A 1TRMA 3S0NA 4XDEA 3V13A 2QXHA 3WY8A 1DUAA 4X1NU 1K1PA 4ZKRU 3MI4A 1GCDA 3GYMA 2VVCA 1TE0A 1Y5BT 1SOTA 1A5IA 4MPWA 4KTCA 3I29A 1F5LA 1GBBA 3MO9A 1O5DH 4FUGA 1KYNA 3UR6A 5T3HA 1XUGA 2XC5A 3BEIB 3ZVAA 3RXEA 3S9CA 1C1SA 1PJPA 4MNWA 1EZUC 2QV1A 3A7XA 3M7QA 4B76A 5T6FA 5A2MH 1TWXB 1PPFE 3MO3A 1FIWA 4ZROA 1SL3A 1G3EA 1LPKB 3QO6A 1TIOA 4FUIA 1T8MA 1QRXA 5A8YA 4TPYA 1SLWB 4DT7B 3E90B 2TGAA 2Z6BD 2GX4A 3KN2A 2ZFPH 1RTFB 1HRTH 3SNBA 1UHBB 1GG6C 1O5BB 1LHDH 1G2LA 3LONA 1EUFA 2XNIA 3RXHA 1MZDA 3SGQE 1MTWA 2QY0B 4NIVA 2ZZUH 1C5PA 4Y79A 3FP7E 1HV7A 5GDSH 2J94A 2B0FA 2JH5D 2Z9KA 1D3QB 1XX9A 3MHWU 1YF4A 5FCKA 3V0XA 1FI8A 1IHTH 1SGEE 1XM1A 1F0UA 2F9BH 2FWWA 4MPXA 1RXPA 4FUBA 2BDGA 2ZTZA 1HAGE 1W14U 1D6WA 2BDHA 3S7HB 1B0FA 3PLBA 1C5MD 1THRH 3BIUH 1C1TA 6LPRA 5JBTA 2IJOB 4HGCA 1CA0B 1DWBH 1DY8A 3ZZ4A 2ANMH 5JB8S 2BOHB 1D4PB 1GJAB 3L33A 3LKWA 3ODDA 2BQ6B 1MTUA 1BJUA 4ZHLU 1EATA 4NSYA 1SQTA 3ATLA 1F92A 3QTOH 2JH6D 3TJVA 1HCGA 1YPJH 2JETC 1LVMA 3SGAE 2XWBI 5SGAE 3I78A 1CHGA 1ZMNA 2BYAX 1QCPA 4OS2A 4WF8A 3M7TA 4DIHH 2IOTA 2QCYA 1NFYA 3GCHC 2OC7A 2ILNA 1PPCE 1NN6A 3E0NB 1NY22 1P04A 5ETXA 1Z1IA 2BD9A 4NFEA 4DOQA 4ABHA 5G4BA 1E35B 1SGNE 3LGYA 1P2JA 3RDZA 5JBBS 1AUJA 1UVPA 1TA6A 2PV9B 2UWPA 3W95A 3MU8A 1O31A 3GY3A 4CH2B 5EOKA 4D9QA 1GHAG 3LC5A 2VGCC 4K5ZA 2Y82A 1G3BA 2PKSC 4ZMAH 3RXFA 2G52A 3F1SB 1A0HB 1WCZA 1EX3A 5HYOA 1PPGE 4HFPB 3ITIA 2G5VA 2BMGB 4TPIZ 5HMAA 2ZF0H 3A7YA 4I8KA 2VH0A 1Z71A 3V7TA 1O2TA 1N6XA 1QB6A 1EZQA 2BQ7B 5EQRA 3RXOA 4D7GA 1C5TA 4THNH 1TGNA 4IN2A 1GI0A 3D49H 3H7TA 1GBCA 1J8AA 3TITA 4ABEA 4JK6A 1Y5AT 1OXGA 5DP8A 1O2LA 2VWOA 1DLKB 4TY6A 1IQGA 2P8OC 2SGAA 4WH6A 2O8WA 1M9UA 2QIQA 1AVGH 1TLDA 2ZP0H 3OYPA 3PTBA 1TBRH 2ASUB 4GSOA 4LZ1H 1W8BH 3KQDA 4NZQA 3LGWA 1SMFE 4X6NA 1YCPK 3V12A 1F2SE 1ZMJA 3CP7A 1GGDB 4I33A 3BTWE 1V2NT 4FXGH 2A32A 3VGCC 1GJCB 4JMYA 4MVNA 5E0HA 1NM6A 2PTCE 2H6MA 3ZVDA 1TX6A 4B2CA 5CHAC 1FY4A 4INHA 2HNTC 2XC4A 4ABGA 1U6QA 1KXAA 1IAUA 1GGDC 5E2PA 1GHBG 3EQ0H 1LCYA 3DFJA 3M3VA 1CHOF 1ZTKA 4X2WA 1G9IE 1S0QA 1TBZH 1TNHA 2BDIA 2CV3A 3A7VA 3GY5A 1BTHH 1EPTB 1GHYH 1ABJH 1DM4B 4DIIH 1XUHA 9ESTA 2PKAB 3OY6U 2QA9E 4X2VA 2CMYA 1Z8JB 2GCHG 3S9BA 1AI8H 4AFUA 2XTTB 1ACBE 3CS7A 1NPMA 1CHOG 3QTVH 1GBTA 2HGTH 5EXMA 2R9PA 5E0JA 3E3TA 4FU7A 1SFQB 3UOPA 3RM2H 4A7IB 1C5XB 3ZZBA 1P09A 1EB2A 3SHAH 1L1NA 4D76A 1QURH 2AIPA 1WU1A 2JKHA 1BTXA 4FVBA 3TJUA 5DO4H 1QRWA 4BNRA 1UO6A 2GT7A 2ODQA 2STAE 3A8AA 3DHKH 3DT0H 1Q2WA 4OGXA 4XBCA 1BTUA 2VGCB 4ISNA 4Q7XA 1ARCA 1SGRE 2XBVA 3LGIA 3PV4A 2PUXB 2SFAA 3E6PH 2VVVA 4INLA 1VCQA 4AFQA 4BAHB 2ZG0H 3FZDA 1B5GH 1K1JA 1V2PT 3O8RA 2FOBA 4B73A 3S9AA 1L4ZA 1ZTJA 1EJMA 3QLPH 1C1NA 1GBLA 1GI2A 1QB9A 8LPRA 1BHXF 1FAKH 3M5MA 4Q7ZA 1VCPA 2BVRH 2EI8A 2BX3A 3A8CA 1E37B 2HPPH 4MDSA 2DE8A 4MNYA 1A4WH 3KHVA 3MFJA 3TH2H 3GCOA 2ZCKP 2ZU3A 4Y11E 4ZXXH 1J14A 1BBRH 4BXSA 1P06A 1P0SH 3GICB 2P95A 1CO7E 1DUEA 1CT0E 1T7CA 1EOLA 3GCTF 3E1XB 1AUTC 1PPHE 4BAKB 1O2PA 3VB5A 1Z6EA 2BY8X 2BZ6H 3ZZ3A 1UJ1A 4Y6DA 3S7KB 2C90B 1TPPA 3F9EA 1VJAU 3D65E 3RXIA 1FUJA 3SO3A 1D9IA 1LHFH 1UK3A 3GCNA 1ZR0A 2G4UA 1XMNB 4ZHMU 2HPQH 5K0HA 5C2ZA 3TGJE 1GG6B 1MBQA 2G8TA 4FUFA 5EODA 1S82A 2BXUH 4DCDA 4H4FA 2GCTC 1MU8B 3LGUA 1IQFA 4Q2KA 5C1XA 1HAXB 3TH3H 1DSTA 3HKIB 5GJ4B 4UE7H 2P16A 3NWUA 4X8VH 3QWCH 3LC3A 1B7XB 3LJOA 4X6PA 3SU0A 1LHCH 2W26A 4NA7A 2UWOA 1EPTA 1O2YA 1GJ7B 4UONA 3RC6A 2XXLA 2A4OA 1ZPZA 2C8ZB 2ANKH 2EC9H 3ATWA 1TOMH 1ZHMA 1UTPA 5TCCA 3EAJA 1O5FH 1OS8A 4X1RU 2OCVB 3RXAA 1J15A 3LGTA 3ZV8A 3M3SA 1GPZA 1W12U 1AFQC 2HNTF 2HVXA 1QBVH 4AYYB 5A0BA 1LKAA 3A80A 5AF9H 1P03A 1S6FA 1P01A 1GBIA 1FV9A 3E91A 1A61H 1W10U 4LXBH 1XUKA 3EE0B 4CRGA 1MUEB 1EAXA 4K8YA 4I8HA 4YOIA 1AVXA 1SQAA 1EAUA 5DKMA 2FDAA 1DOJA 3Q3KA 5EU8A 3MH7A 1ELDE 2KAIA 2ZGXH 1NRSH 1O39A 3ENSB 1O5EH 1MZAA 1SPJA 1TA2A 1D3PB 1MKWK 1P2MA 4GVUA 3RU4D 1Z7KA 1F7ZA 3BSQA 2A5AA 3LT3A 2V3OH 4H42U 1QL7A 3TU7H 4IN1A 2ZTYA 1NESE 3IITA 1HIAB 3H7OA 3TVJB 1W7GH 4WXVA 1Y8TA 3RMOH 1FNIA 1C1WH 4O97A 4R0IA 1GBAA 1GHAF 1C5OH 3RUOA 1RGQA 3MNSA 2QN5T 3M5OA 4BAOB 1SGCA 5AVDA 1F0RA 2AERH 3T29A 4OS7A 1YGCH 1EAWA 2ZGHA 3SNEA 5T6GA 1ELFA 5DP3A 1D3DB 1ORFA 2F9UA 1P02A 3JZ2B 2TRMA 3P8GA 4KP0A 1F5RA 2ZC9H 3LIWA 4CREA 1SGYE 1C2HA 2WUCA 5C5OA 2WYJA 3VGCB 1IQMA 1BMMH 2QAAA 2ZCHP 5EPYA 5FHTA 1FXYA 1C2KA 1KXFA 4NWLA 2TIOA 1GMHG 1AVWA 1PPBH 1BRUP 1KLTA 3E8LA 1O32A 1NZQH 3Q3XA 3A89A 1C2EA 5GCHG 3ZZAA 3SGBE 3UY9A 3PLPA 1FPCH 4K1EA 4ISLA 4RKOB 4HZHA 1LHEH 4I31A 5L6NH 2Y5GA 1IQIA 1YPHE 1OYQA 3RXMA 1C2DA 2A5IA 2BM2A 1GMHF 3NZIA 1IQEA 3URDA 1GMDG 1BT7A 4X2YA 1XKAC 2SNVA 4KTUA 1W2KH 2ZDLA 1C1UH 1BRBE 1BB0B 1VR1H 3KIDU 3T26A 1O5CB 1ZGIA 4FU8A 4NFFA 1H9IE 1OX1A 3DA9B 3SOSA 1O3HA 2STBE 1OYTH 2QXJA 1O2ZA 2ZO3H 2A4RA 3FP8E 1Y5UT 1NROH 1C2MA 1OP8A 1OWIA 3ELAH 2A7HA 4BAQB 1TNLA 3TNSA 3SV6A 1SI5H 2AMQA 2FI5E 2ZGJA 4MLFB 3VB3A 3RXGA 2H5DA 2PSYA 4X2XA 3Q76A 4Y76A 3SU5A 2FX4A 2C8WB 4VGCB 1GDQA 4YM9A 2AMPA 1K22H 1X7AC 4J1YA 5JPMH 1GI7B 2P93A 3P92A 1ZRBA 2BLVA 1WOFA 1XKBC 1O2SA 5F8XA 3AASA 4DURA 2F3CE 4U01A 2BD7A 2A0QB 4CRCA 3ZYEA 3T28A 4JYTA 4A1TA 2BD8A 2SGPE 5E0GA 1TFXA 1TRNA 2NU2E 1FPHH 3RXBA 2ZGCA 4SGAE 3BF6H 1O38A 2FOGA 2QC2A 3M37A 1EOJA 1TQ0B 3SI3H 1O5AB 3A85A 2P3TB 3EA8A 2AEIH 2OC1A 2VJ1A 1Z6JH 2QYIA 1ZMLA 1TGBA 4YO9A 4X0WU 3NCLA 1SGQE 2FODA 1CSOE 2Z3DA 4FUCA 3RLWH 1HAHH 1O3LA 1QA7A 1ZSJA 2ZFRH 2Y80A 4AFSA 4K8BA 1FY5A 1DXPA 2Z9LA 4WMDA 1ZGVA 4E7NA 1GVLA 5LGOA 3T25A 2OD3B 4CR5A 3HK3B 1SLXB 2GCHF 2A7JA 2FP7B 2WV5A 1SHHB 2B7DH 1CE5A 1WTHD 2FS9A 2D1JA 1GI1A 1BOQA 2SGDE 1HGTH 1O37A 3B9FH 3H5CB 3MH6A 2R3YA 1C5UA 1QIXB 3GCHB 1P2NA 4BTUB 1H8DH 5BRRE 2ZFQH 1KDQA 2ANWA 4OS6A 1T31A 1SFIA 4AB9A 2W3IA 1V2LT 3ATMA 3ZVFA 1RRKA 4FUDA 4NGAH 4ZH8A 1ZSLA 4X8SH 1W3CA 2WPKS 3GISB 1AKSA 1C4V2 1NRRH 3RU4T 1MH0A 1P3CA 4NG9H 3A7WA 4X8TH 5FPSA 1YKTA 3TGKE 1Y3VA 2ZKSA 5JB9S 2D2DA 1AIXH 3AVZA 2TGDA 3NKKA 1WQSA 2B5TB 5DK1A 5DG6A 1TMUH 1ESAA 3SUGA 3Q00A 1ANBA 1MMJN 1T4UH 2ZU2A 4X1QU 1HPGA 3STJA 2FI4E 2YNBA 4A1VA 1DPOA 4IS5A 1P3EA 1GJ4H 2C8XB 2YOLA 3PWCA 3SJ8A 1YPMH 2RA0A 1FJSA 2FESH 3UNQA 1BMAA 1V2KT 5EQQA 4YESB 2CXVA 3PMAB 2WINI 1V2WT 3KQBA 4XSKU 1O3KA 3C27B 2FXRA 3RXQA 5E2OA 3Q3YA 5GIBA 1O2OA 1JIRA 1IQHA 2A1DB 1P2KA 1JIMA 4UFFH 3R0FA 1O3OA 4WY3A 1HAPH 4RN6A 2GZ7A 2BY9X 2PTNA 2Z3EA 4ESTE 3SBKA 4CRFA 1W0ZU 4HI3A 3GY7A 1GBFA 1P10A 2SGFE 4DW2U 3IG6B 3SV8A 1HBTH 2Z3CA 1QJ7B 2WPMS 2VVUA 5GWZA 2IN2A 5DPAA 1NT1A 1ZYOA 1C5LH 3MU4A 1ZOMA 1OWEA 3OY5U 1SLUB 5CHAB 1L0ZA 4U30A 1ID5H 4CBOA 2HLCA 1MTNB 1NU9A 3R3GB 3QK1A 5C5NA 1GJ5H 1O36A 1BJVA 2CF8H 7GCHG 1ETSH 4NCYA 3ZVCA 1AZ8A 3SV2H 2GZ9A 1SSXA 3A7ZA 1ZLRA 1DFPA 3GDUA 2ZDAH 2A4GA 1AZZA 1K1MA 2OTVA 2XRCA 1EZSC 4AYVB 3DD2H 4K60A 1F0SA 2BLOA 4INKA 1V6DA 1O2QA 3A8DA 6GCHG 3P8NA 3OX7U 2O9QA 5FCRA 1TPOA 3KGPA 4DVAU 4RKJB 2RDLA 1EPTC 2BX4A 5EW2H 1SVPA 3TNTA 3M5NA 2H9TH 1ZSKA 2PFEA 1ZZZA 3KQEA 2BB4A 1MD7A 2Q6GA 1W13U 4XBBA 4TYDA 3ZZCA 1O3MA 4JK5A 2OQ5A 3NPSA 1TAWA 1HAZB 2ZQ1A 4XOJA 9LPRA 1YBWA 1UTNA 2W7SA 1OP0A 2G81E 2BDCA 2G4TA 1DVAH 3GCTG 3TH4H 2BD2A 4MPUA 3SQEE 2VWLA 4R8TB 1XXFA 1O3EA 1VJ9U 3L3TA 3OTJE 1GJBB 1WV7H 1TQ7B 1Q3XA 1VCWA 3U8TH 3HATH 2D26C 4ISHH 1W11U 4OS1A 1RS0A 1O2NA 1MQ5A 4ZKOU 4O03A 2G00A 3ESTA 2BD3A 3SJOA 4CHAC 1H4WA 1NRPH 3SJ9A 5PTPA 2P94A 1TOCB 3AW0A 1AWHB 4I8JA 4OGYA 4UFDH 1O3NA 2BDYA 1J9CH 1SOZA 5DP7A 1D6RA 3SZNA 2WPIS 4AGJA 1T32A 2PUQH 5FX6A 1KSNA 1LQEA 1HJ8A 2VIDA 3QZRA 1HAIH 5EG4A 1O3CA 1O33A 2FTMA 1UTOA 3BG4B 2WV4A 3UOUA 4ABBA 3ZZ7A 4NIWA 6CHAB 2D8WA 1SGPE 1Y3YA 2PR3A 1C5VA 3ZVEA 1PYTD 1FN6A 1RFNA 1ESTA 1DXWA 3GOVB 1N6YA 1AY6H 1SGTA 4YZUA 3L6PA 3EA7A 1G36A 1GVZA 1OWHA 3GY2A 2UWLA 1S5SA 4ZAEA 2V35A 2WYGA 4ISOA 1A3BH 1GBKA 1W0YH 1GHBF 3GY6A 2P3FH 1AFQB 2R2WU 3A86A 2IPHA 3SJKA 3SU3A 1SGDE 1UTMA 1DSUA 1XUFA 5EXLA 1VITH 5IDKA 2FO9A 1A1RA 3GYLB 2RCEA 4Y0ZE 5ABWA 1BMLA 3T5FH 5LPEA 2OXSA 3RMNH 3VB6A 1V2RT 5C20A 2VIOA 1EP5A 2B9LA 1QL9A 4MTBA 1C5RA 1O35A 1YCPH 2OC0A 1O3JA 1V2JT 4X8UH 3U9AH 3OSYA 5GPIB 3UREA 1H1BA 3PMHB 1INCA 4A5TS 3SV7A 2ZWLH 3DUXH 1C5NH 2TPIZ 2NU0E 1UTQA 3SORA 3MU0A 1NS3A 1V2OT 2CHAB 1V2MT 1ZPBA 5L2YH 2B8OH 3G01A 2GDEH 2WPHS 5J4SA 2ZECA 2BTCE 5LH8A 1PPEE 2DUCA 1HJAC 2AFQB 3SW2B 2VB0A 2ZDMA 1HJ9A 1C2GA 1AFEH 3O8BA 1A2CH 3A87A 2GVFA 4Y7BA 2R2MB 4TY7A 3NK8A 4E05H 3MNBA 3UNSA 1ELCA 1UVUH 1G32B 1LO6A 1A5HA 4BTTB 3RXRA 1AWFH 2O8MA 1DY9A 4FUJA 3W94A 1ELGA 1QL8A 5ESBA 3BTHE 4MG3A 4GHTA 4BAMB 1J17T 4YLUA 1P2OA 1BCUH 3GY4A 1TBQH 5GCHF 3MTYA 4UEHH 1TMTH 2FOCA 1S85A 1LKBA 3VFEA 1O3BA 1GI4A 3A82A 1ZHRA 1O3GA 1A46H 4UDWH 4BANB 1GMDF 2YNAA 4B1TA 1CT4E 1GJ8B 8GCHF 2SGEE 1S6HA 3RP2A 4K69A 1UVOA 1TGTA 2P3UB 1LVBA 4MQAA 5HGGA 4WWYA 4WH8A 2AIQA 2HRVA 4VGCC 3UIRA 4I7YH 1P57B 1BTYA 1P11E 1QR3E 4ABDA 1UHBA 2W5EA 2JH0D 3EGKH 1GI8B 1THSH 1O34A 5DP4A 1V2QT 1YP9A 1T8OA 4CH8B 3MH4A 2FEQH 3PYHA 3T27A 1YC0A 3D23A 1PQ8A 2Y7XA 1TX7A 5AFYH 5ESTE 1EQ9A 3RMMH 1JXPA 1QJ6B 4ZXYH 1WBGB 3O8DA 1D3TB 4J2YB 5EQSA 4LOYH 1C1PA 1QJ1B 1Q31A 4KGAA 2PGBB 3EA9A 5LPRA 1TRYA 3KQCA 3FAOA 5DP5A 2VINA 1Y3WA 3F68H 1O2HA 4GAWA 5C1UA 5DP9A 1PYTC 1XVOA 3BIVH 1RIWB 3K6ZA 1GL1A 2J92A 3E0PB 1AU8A 1ELTA 2P8OB 4B2BA 1Z8RA 4KTSA 3PTNA 1JRTA 2FOAA 2OINA 3PMBB 1EASA 2BQWB 1MD8A 1ETRH 2H1UA 4OS5A 1AQ7A 2VIQA 4PROA 1GL0E 1CGJE 5K7RA 2I6SA 2AGEX 2ZGBH 3UNRA 2PW8H 4Y0YE 3ZZ5A 3LOXA 1O2WA 4NIYA 7KMEH 2BZAA 2ALVA 1DT2A 2I6QA 3UTUH 3QGJA 3BN9A 1O3IA 1QRZA 1NFWA 4A1XA 1IOEA 1CGIE 2PWXA 5EGMA 1LQDB 1O3DA 3HKJB 1EB1H 1CVWH 1Z8IB 2ZPSA 1ELVA 1HAYB 3SQHE 5FPTA 2P59A 2A7CA 1DWDH 3FANA 3MYWA 2NU1E 1O2IA 3TK9A 3SU2A 3TLOA 1N1LA 2HOBA 4NIXA 3SU4A 2V6NA 1F5KU 1BTZA 2OUAA 1JMOH 3OU0A 3K6YA 3QUMP 5AFZH 6GCHF 2W7UA 3NUMA 1DX5M 7GCHF 5JDUB 3F9HA 3RXKA 1GI6A 1GI3A 2GP9B 4JZEH 1BMNH 2FOMB 2H2ZA 4ABIA 3RXUA 1HJAB 3QX5H 5TCAA 1H9HE 1TB6H 4AFZA 1QY6A 3ZV9A 2GCTB 4GCHF 2UUJB 3TK5A 2VNTA 1C5WB 1VZQH 2ESTE 1DWEH 3MH5A 5EW1H 1C1MA 4BTIB 2BVXH 3RXJA 4DGJA 2OBQA 1HDTH 2NU3E 2ZFTA 1NRQH 4K1TA 2F9VA 2FOEA 2A45B 3GDVA 1YPLH 5FBIA 1LVYA 1SBWA 1CBWB 1YPHC 4Y71A 4YLQH 1RD3B 3O8CA 1GJ9B 1SGIB 1QBOA 2TGPZ 2W3KA 1BQYA 4ZKSU 4D9RA 3M3TA 1JWTA 1OWJA 1GBJA 1C5YB 3ATKA 4XE4A 3LDXH 4F4OC 2H9EH 4YT6H 1SR5C 4IC6A 2GT8A 4WMEA 1H8IH 1OSSA 4CRAA 5C3NA 4X1PU 1A7SA 3TIUA 1RIWC 1TGCA 2V0BA 2ZPQA 1O3AA 4ABAA 1PQ5A 1FDPA 3RM0H 2BHGA 1T8LA 2O8TA 3BTEE 1YM0A 4WVPE 4NWKA 3TPIZ 5L30H 2BOKA 4ASHA 4NZLA 1OWDA 4ABJA 1MTSA 2VIVA 3VEQB 1ELAA 3RXDA 1TGSZ 1Z1JA 3RC4A 2FS8A 1P9UA 2WUBA 2R0KA 1ELEE 1PFXC 4IBLH 1LTOA 1TMBH 2ZA5A 1HFDA 2Q1JA 4YTAA 2JETB 1MTVA 1K21H 1FY8E 1ZPCA 2Z9GA 4CRDA 1FN8A 2OLGA 1GDUA 1PQAA 5JBAS 1S83A 1LHGH 7ESTE 1QQ4A 3QN7A 4A92A 2QXGA 1AKSB 2QF0A 1TPSA 1UTKA 1BTPA 1RTLA 1VITG 1CA0C 2J38A 1MCVA 4CHAB 4ZUHA 2K1QA 3TJOA 2ZU1A 7LPRA 1O2MA 1C4U2 2GV7A 4WJG2 1NFXA 4CBNA 1TNKA 2AYWA 1QB1A 3RXVA 1ELBA 1EKBB 1GBDA 2BDAA 1QFKH 1F0TA 1P2IA 4JZ1A 5A8ZA 1GBMA 2J9NA 3MMGA 2WPLS 2ZU5A 4KELA 5F8TA 1Y59T 1KLJH 3VB4A 3JZ1B 4YOGA 1O0DH 1SB1H 1E38B 2HWLB 3ZZ8A 1L1GA 4Y10E 2CN0H 2SGQE 1WSSH 5F6MA 1ZJKA 1GBHA 1C2LA 1OP2A 1DITH 1ZRKA 1KIGH 2Y81A 4X6MA 1GJDB 5BPEA 3EYDA 2RA3A 1JRSA 1WTGH 5A0AE 3P70B 5FBEA 3UWIA 3KNXA 4DY7B 1JBUH 3M7UA 2ZI2H 3UR9A 5C1YA 2PSXA 3PO1C 3LU9B 5HXFA 2HALA 1N8OC 1IQJA 3STIA 3QGNB 2UUYA 3BTDE 2PLXA 4U2WA 3BTGE 3I77A 4AB8A 2FPZA 1AE8H 5EPNA 1UCYK 1TNIA 1AB9C 2QF3A 3T62A 2F9OA 3BG8A 1UCYH 1ESBA 1UVSH 2ALPA 3MU1A 4JZFH 3SHCH 3A8BA 2ODYB 1NFUA 3KEEA 3BTQE 1AHTH 1AO5A 1BDAA 2FOFA 3RC5A 1ABIH 5F03A 1HB0B 1G2MA 3SNDA 4D7FA 2THFB 5B6OA 1TONA
chains in the Genus database with same CATH superfamily
8GCHG 2XWAA 1K1IA 2PKAA 2OBOA 5I25A 1MKXK 3BTKE 3BTME 3P95A 1OPHB 4ISIH 3PWBA 4I8GA 4CRBA 5L2ZH 2ZFSA 2QXIA 1O2JA 1EJNA 1S81A 1TYNA 1G30B 2R3UA 3DSPA 4Q63A 1NC6A 4K3JA 1OOKB 2XW9A 3SU6A 3MO6A 3SNAA 3ZZDA 2J4IA 1BIOA 1ARBA 6CHAC 1YCPM 3HGNA 3EDXB 2KCYA 2FTLE 4UD9H 1ANEA 2F83A 3A88A 4DG4A 1EZXC 3K2UA 1GJ6A 1SHYA 1KXBA 4B71A 1MKWH 4O3UA 1FIZA 2WHXA 3LPRA 3UPEA 2Y6TA 5HM2A 2Y7ZA 4F49A 4UFEH 3P17H 4AG2A 1COWD 1TX8A 4AN7A 2R0LA 3T2NA 2HNTE 4TSFD 4JYUH 5I46H 1GI5A 4I86A 2UUFB 2FIRH 1ANDA 1Y3XA 1UK4A 5FAHA 3OEED 1S0RA 2A31A 1HLTH 4Y8YA 3WWBA 1WQVH 2XOKD 4HTCH 2GTBA 3OFND 4U32A 1CBWC 2NU4E 3WW7A 1TNJA 3DFLA 2Z9IA 1YLNA 4FOUC 1SC8U 1SGFA 3RLYH 1G3CA 3PM3A 2F9PA 4JZDH 4YOJA 1V2ST 2RG3A 3FP6E 3C1KA 1C9TA 3FKSD 1FY1A 3M35A 3QZQA 2RFKC 2PGQB 3KQ5A 2Z94A 1UMAH 4O3TA 1PQ7A 2BY7X 1VGCB 1DDJA 1KXEA 1MCTA 1WUNH 1GHZA 1TABE 4XFQA 3UAIC 1LVOA 5DSFA 1LPGB 3HGPA 3HK6B 3BEFB 3U1IB 2GV6A 1GBEA 3RXCA 1O3FA 1L2EA 3UQVA 1Z8GA 4K2YA 2ZDVH 1H9LB 4NSVA 2PKSB 4FUEA 1LMWB 2K8IA 2PHBA 3LJJA 5C0UA 2TGTA 3NXPA 1HYLA 1GWAA 2G51A 3ODFA 1H8ED 1KDQB 5HM9A 2A2QH 3MU5A 5FX5A 1FAXA 1P8VC 2NWNA 1QTFA 4K1SA 1QA0A 1ZHPA 2VH6A 4BOHA 3D62A 2VIWA 3RXSA 1BHXB 1HXFH 3Q77A 4RSPA 1CQQA 1C2FA 1GHXH 2CF9H 2FLBH 3FFGA 4AORA 4ZHAA 1UCYE 1Y3UA 4IGDA 2ZHQH 4WMFA 2KX4A 1K1NA 1L1JA 5E8EH 3VXFH 3P6ZB 1P9SA 3U69H 2C3SA 1C1QA 5A09A 1GCTB 2O8LA 1V2TT 4JYVH 2F4LA 3N7OA 3TK6A 4B74A 1G3DA 2GMTC 2O8UA 3UUZA 5DP6A 4Y8XA 1MAXA 1WYKA 1PPZA 1P12E 3UQOA 3VPKA 1MABB 2J2UA 1BA8B 3ZVGA 3PV2A 1SG8B 2XBXA 5LPFA 3SI4H 1C4Y2 2J95A 3M5LA 1NO9H 2FYQA 4GPGA 1E36B 3F9GA 1AB9B 1IQNA 3GY8A 1RJXB 1GHWH 3PO1B 1C9PA 2ZHFH 1XXDA 3P8FA 1EP6A 4I32A 3SJIA 1A3EH 2FI3E 3KL6A 1FONA 3F9FA 4B75A 3FVFB 1IQLA 2FX6A 1QQUA 4WXIA 1W0KD 4AZ2B 3OAAD 1DANH 1O2RA 1QBNA 3FZZA 1EJAA 5F8ZA 2LNCA 3AAVA 1ZJDA 3ZZ6A 5FPYA 1BITA 1KXCA 3SV9A 4O9VA 2FZZA 4MNVA 4H6SB 4UFGH 2OP9A 1C5QA 4IW4E 1AE5A 2ZHWH 4AX9H 2BDBA 2BD5A 2BVSH 1HXEH 1GHVH 2VWMA 4FVDA 4A6LA 3UWJH 2GZ8A 1WAYB 2ZQ2A 5GNDA 2GDDA 3MNXA 1DWCH 1C2JA 4CR9A 2A5KA 2AH4X 1AMHA 2Q6FA 1C2IA 2AGIX 1UTLM 1AN1E 1SQOA 4MPVA 4D8NA 1ANCA 1N8OB 5IYTA 3SN8A 1O2KA 1H8HD 1A0LA 1TNGA 4FUHA 2M5TA 2FLRH 4Q7YA 2ANYA 3PMJA 1V2UT 4H6TA 4Y7AA 4OS4A 5FXLA 1DICA 3TJNA 1NRNH 1A0JA 3BTFE 1O5GH 2V3MA 1FQ3A 2JIZD 2EI7A 2VBCA 2AS9A 5T1VA 1GI9B 3UFAA 1MAYA 3HPTB 2C93B 2VIPA 2EA3A 2GMTB 1LPZB 2J34A 1V3XA 4XD7D 4IMZA 5TJXA 2FOHA 1CGHA 5DGJA 3U8RH 3RMLH 1DS2E 2XCFA 1TALA 2JJ1D 1FZZA 2ODPA 2C8YB 3MQKC 3ZVBA 8KME2 1BUIA 1QGFA 4SGBE 1K28D 1YLCA 4JCNA 4AGKA 1BRAA 2BLQA 1YPEH 2WSSD 1E0FD 1SLVB 3M61U 1K2I1 3A81A 3BV9B 5HIYA 1BZXE 2BY6X 5EXNA 2Z9JA 2UUKB 6ESTA 1GVKB 4XBDA 1HAVA 1GMCG 1S84A 2LP6A 4AG1A 5DJ7A 5C67A 1KTSB 1HAVB 1AGJA 3U1JB 4DJZB 5CMXH 4LK4A 2HVYB 3VB7A 2ZHDA 2H5CA 1EXFA 5JYIA 1XUIA 1GDNA 4NA8A 3KF2A 2EI6A 4ABFA 3SNCA 1YPKH 3QDZB 1BTWA 2CHAC 2ZHEH 4ZKNU 4GLYA 2AHME 1C1RA 3K65B 1A5GH 5A0CA 1GMCF 2YMSC 1C1VH 1O2XA 2Y5FA 1E34B 1BBRE 1FY3A 4LZ4B 4X6OA 1MU6B 2HLDD 2CJIA 1YPGH 2SNWA 3A83A 1YYY1 5GXPA 3CS0A 2XNDD 4KKDA 2XYAA 1KXDA 1LDTT 2ZEBA 1B0EA 4FU9A 3RU4E 5F53A 1SKYE 4B2AA 3PROA 1MQ6A 3CENA 1GCTC 2VWNA 1C1OA 3LH3A 3AW1A 2A4QA 2H9HA 8ESTE 2ZDKA 1KY9A 3LH1A 3E16B 2G55A 1T8NA 3A84A 1O2VA 2FYRA 3U8OH 1VITF 2G5NA 2ZIQH 1P05A 1DLEA 2F91A 1P2QA 1DE7H 1IQKA 3B8JA 4IMQA 1HUTH 2KAIB 3SUEA 4IC5A 3MNCA 2J5UA 4BXWA 1YLDA 2VU8E 1XUJA 3BG4C 3LGVA 1UVTH 2GGVB 1TPAE 4X1SU 4NA9H 3ZYDA 1HIAA 1UK2A 2BY5X 4Y8ZA 4Q80A 1EAIA 1CU1A 2TBSA 4TWWA 5A8XA 2ZU4A 1O2GH 5JBCS 2V3HH 3PB1E 1VGCC 3M36A 3PLKA 2ZNKH 1QNJA 2AMDA 1CT2E 1MKXH 1RTKA 4QT8C 2GKVE 2Z7FE 5AHGH 1QHRB 3S69A 1XVMA 1G37A 2A2XH 3TGIE 2XC0A 1BRCE 1O3PB 3P8OA 5H4IB 3GDSA 1SGFG 3F6UH 1V2VT 2WPJS 1KLIH 2KCAA 3A7TA 3IWMA 2YMSB 1NU7B 2FM2A 4JZIA 1OWKA 2GD4B 5CE1A 4AOQA 2CGAA 1K9OE 2XBWA 2AGGX 3RXTA 3RXLA 3SU1A 4E06H 1ZTLA 3ATIA 2ZCLP 2EEKA 4OM9A 3VXEH 2LPRA 1ETTH 1O2UA 2ZFFH 5T6DA 3U98H 1L4DA 1FMGA 1W7XH 3URCA 1IHSH 1UTJA 3B23B 1AD8H 3KCGH 2DE9A 1C5SA 1C5ZB 4I8LA 4M7GA 1JOUB 1THPB 2FMJA 3SUDA 1K1LA 3SUFA 4GHQA 2XCNA 2ZTXA 2BLWA 4Z0KA 2BXTH 3DCLA 2Q6DA 1MTNC 3BEUA 3OEHD 4E7RG 2F9NA 2WZQA 3MWIU 1HNEE 2ZDNA 3MOCA 1HAOH 2QGRA 2ULLA 1K1OA 2OC8A 3AAUA 3K9XB 4TWYA 3V3MA 4MNXA 1J16A 4Z6AH 2Y5HA 5J4QA 2BD4A 1OKXA 2ZPRA 3DSOA 4GUXA 2OQUA 3ZZ9A 1KTTB 1CA8B 4GCHG 1T4VH 1NTPA 1BBRK 1FLEE 1MBMA 2C4FH 3BTTE 4YT7H 3RXPA 2XBYA 1O30A 1TRMA 4TT3D 3WWFA 3S0NA 4XDEA 3V13A 2QXHA 3WY8A 1DUAA 4X1NU 1K1PA 4ZKRU 3MI4A 1GCDA 3GYMA 2VVCA 1TE0A 1Y5BT 1SOTA 1A5IA 4MPWA 4KTCA 3I29A 1F5LA 1GBBA 4Q4LA 3MO9A 2KM0A 3F2FA 2KFWA 1O5DH 4FUGA 1KYNA 3UR6A 5T3HA 1XUGA 2XC5A 2IPQX 3BEIB 3ZVAA 3RXEA 3S9CA 1C1SA 1PJPA 4MNWA 1EZUC 2QV1A 3A7XA 3M7QA 4B76A 5T6FA 5A2MH 4RI0A 1TWXB 3EE7A 1PPFE 3MO3A 1FIWA 4ZROA 1SL3A 1G3EA 1LPKB 3QO6A 1TIOA 4FUIA 1T8MA 1QRXA 5A8YA 4TPYA 1SLWB 4DT7B 3E90B 2TGAA 2Z6BD 2GX4A 4ASUD 3KN2A 2ZFPH 1RTFB 1HRTH 3SNBA 1UHBB 1GG6C 1O5BB 1LHDH 1G2LA 3LONA 1EUFA 2XNIA 3RXHA 4AC9A 1MZDA 3SGQE 1MTWA 2QY0B 4NIVA 2ZZUH 1C5PA 4Y79A 3FP7E 1HV7A 5GDSH 2J94A 2B0FA 2JH5D 2Z9KA 1D3QB 1XX9A 3MHWU 1YF4A 5FCKA 3V0XA 1FI8A 1IHTH 1SGEE 1XM1A 1F0UA 2F9BH 2FWWA 4MPXA 1RXPA 4FUBA 5EJZA 2BDGA 2ZTZA 1HAGE 1W14U 1D6WA 2BDHA 3S7HB 1B0FA 3PLBA 1C5MD 1THRH 3BIUH 5B6LA 1C1TA 6LPRA 5JBTA 2IJOB 4HGCA 1CA0B 1DWBH 1DY8A 3ZZ4A 2ANMH 5JB8S 2BOHB 1D4PB 1GJAB 3L33A 3LKWA 3ODDA 2BQ6B 1FX0B 1MTUA 1BJUA 4ZHLU 2J98A 1EATA 4NSYA 1SQTA 5KEDA 4RT1A 3ATLA 1F92A 3QTOH 2JH6D 3TJVA 1HCGA 1YPJH 2JETC 3PV5A 1LVMA 3SGAE 2XWBI 5SGAE 3I78A 3FO8D 1CHGA 1ZMNA 2BYAX 1QCPA 4OS2A 4WF8A 3M7TA 4DIHH 2IOTA 2QCYA 1NFYA 3GCHC 2OC7A 2ILNA 1PPCE 3U28C 1NN6A 3E0NB 1NY22 1P04A 5ETXA 1Z1IA 2BD9A 4NFEA 4DOQA 4ABHA 5G4BA 1E35B 1SGNE 3LGYA 1P2JA 3RDZA 5JBBS 1AUJA 1UVPA 3OTPA 1TA6A 2PV9B 2UWPA 3W95A 3MU8A 1O31A 3GY3A 4CH2B 5EOKA 2RDEA 4D9QA 1GHAG 3LC5A 2VGCC 4K5ZA 2Y82A 1G3BA 2PKSC 4ZMAH 3RXFA 2G52A 3F1SB 1A0HB 1WCZA 1EX3A 5HYOA 1PPGE 4HFPB 3ITIA 2G5VA 2BMGB 4TPIZ 5HMAA 3FN8A 3VG8A 2ZF0H 3A7YA 4I8KA 5EIYA 4B6EA 2VH0A 1Z71A 3V7TA 1O2TA 1N6XA 1QB6A 1EZQA 2BQ7B 5EQRA 3RXOA 4D7GA 1C5TA 4THNH 1TGNA 4IN2A 1GI0A 3D49H 3H7TA 1GBCA 1J8AA 3TITA 4ABEA 4JK6A 1Y5AT 1KMHB 1OXGA 5DP8A 1O2LA 2VWOA 1DLKB 4TY6A 1IQGA 2P8OC 2SGAA 4WH6A 2O8WA 1M9UA 2QIQA 1AVGH 1TLDA 2ZP0H 3OYPA 3PTBA 1TBRH 2ASUB 4GSOA 4LZ1H 1W8BH 3KQDA 4NZQA 2EY4C 3LGWA 1SMFE 4X6NA 1S6LA 1YCPK 3V12A 1F2SE 1ZMJA 3CP7A 1GGDB 4I33A 2V7QD 3BTWE 1V2NT 4FXGH 2A32A 3VGCC 1GJCB 4JMYA 4MVNA 5E0HA 1NM6A 2PTCE 2H6MA 3ZVDA 1TX6A 4B2CA 5CHAC 1FY4A 4INHA 2HNTC 3FOAA 2XC4A 4ABGA 1U6QA 1KXAA 1IAUA 1GGDC 5E2PA 1GHBG 3EQ0H 3PRDA 1LCYA 3DFJA 3M3VA 1CHOF 1NBMD 1ZTKA 4X2WA 3ZIAD 1G9IE 1S0QA 2KZ4A 3OE7D 1TBZH 1TNHA 2BDIA 2CV3A 3A7VA 3GY5A 1BTHH 1EPTB 1GHYH 1ABJH 1DM4B 4DIIH 1E1QD 1XUHA 9ESTA 2PKAB 3OY6U 2QA9E 4X2VA 2CMYA 1Z8JB 2GCHG 3S9BA 2L6OA 1AI8H 4AFUA 2XTTB 1ACBE 3CS7A 1NPMA 1CHOG 3QTVH 1GBTA 2HGTH 5EXMA 2R9PA 5E0JA 3E3TA 4FU7A 1E1RD 1SFQB 3UOPA 3RM2H 4A7IB 1C5XB 3ZZBA 1P09A 1EB2A 3SHAH 1L1NA 4D76A 3PRBA 1QURH 2AIPA 1WU1A 2JKHA 1BTXA 4FVBA 3TJUA 5DO4H 1QRWA 4BNRA 1UO6A 2GT7A 2ODQA 2STAE 3A8AA 3DHKH 3DT0H 1Q2WA 4OGXA 4XBCA 1BTUA 2GJGA 2VGCB 4ISNA 4Q7XA 1ARCA 1SGRE 2XBVA 3LGIA 3PV4A 2PUXB 2SFAA 3E6PH 2VVVA 4INLA 1VCQA 4AFQA 4BAHB 2ZG0H 3AK5A 3FZDA 1B5GH 1K1JA 1V2PT 3O8RA 2FOBA 4B6FA 4B73A 3S9AA 1SQRA 1L4ZA 1ZTJA 1EJMA 3QLPH 1C1NA 1GBLA 1GI2A 1QB9A 8LPRA 1BHXF 1FAKH 3M5MA 4Q7ZA 1VCPA 2BVRH 2EI8A 2BX3A 3A8CA 1E37B 2HPPH 4MDSA 2DE8A 4MNYA 1A4WH 3KHVA 3MFJA 3TH2H 3GCOA 2ZCKP 2ZU3A 4Y11E 4ZXXH 1J14A 1BBRH 4BXSA 1P06A 1P0SH 3GICB 2P95A 1CO7E 1QZ8A 1WDIA 1DUEA 5C94A 1CT0E 1T7CA 1EOLA 3GCTF 3E1XB 1AUTC 1PPHE 4BAKB 1O2PA 3VB5A 1Z6EA 2BY8X 2BZ6H 3F2GA 3ZZ3A 1UJ1A 4Y6DA 3S7KB 2C90B 1TPPA 3F9EA 1VJAU 3D65E 3RXIA 1FUJA 3SO3A 1D9IA 1LHFH 1UK3A 3GCNA 1ZR0A 2G4UA 1XMNB 3F0PA 4ZHMU 2HPQH 5K0HA 5C2ZA 3TGJE 1GG6B 1MBQA 2G8TA 4FUFA 5EODA 1S82A 2BXUH 4DCDA 4H4FA 2GCTC 1MU8B 3LGUA 1IQFA 4Q2KA 5C1XA 1HAXB 3TH3H 1DSTA 3HKIB 5GJ4B 4UE7H 2P16A 3NWUA 4X8VH 3QWCH 3LC3A 1B7XB 3LJOA 4X6PA 3SU0A 1LHCH 5FL7D 2W26A 4NA7A 2UWOA 1EPTA 1O2YA 1GJ7B 4UONA 3RC6A 2XXLA 2A4OA 1ZPZA 2C8ZB 3N7EA 2ANKH 2EC9H 3ATWA 1TOMH 1ZHMA 1UTPA 3N7DA 5TCCA 3EAJA 1O5FH 1OS8A 4X1RU 2JJ2D 2OCVB 3RXAA 1J15A 3LGTA 3ZV8A 3M3SA 1GPZA 1W12U 1AFQC 2HNTF 2HVXA 1QBVH 4AYYB 5A0BA 1LKAA 3A80A 5AF9H 1P03A 1S6FA 1P01A 1GBIA 1FV9A 3E91A 1A61H 1W10U 4LXBH 1XUKA 3EE0B 4CRGA 1MUEB 1EAXA 4K8YA 4I8HA 4YOIA 1AVXA 1SQAA 1EAUA 5DKMA 2FDAA 1DOJA 3Q3KA 5EU8A 3MH7A 1ELDE 2KAIA 2ZGXH 1NRSH 1O39A 3ENSB 1O5EH 1MZAA 1SPJA 1TA2A 1D3PB 4P00A 1MKWK 1P2MA 4GVUA 3RU4D 1Z7KA 1F7ZA 3BSQA 2A5AA 3LT3A 2V3OH 4H42U 1QL7A 3TU7H 4IN1A 2ZTYA 1NESE 3IITA 2QF4A 1HIAB 3H7OA 3TVJB 1W7GH 4WXVA 1Y8TA 3RMOH 1FNIA 1C1WH 4O97A 4R0IA 4RT0A 1GBAA 1GHAF 1C5OH 3RUOA 5EJ1A 1RGQA 3MNSA 2QN5T 3M5OA 4BAOB 1SGCA 5AVDA 1F0RA 2AERH 3T29A 4OS7A 1YGCH 1EAWA 2ZGHA 3SNEA 5T6GA 1ELFA 5DP3A 1D3DB 1ORFA 2F9UA 1P02A 3JZ2B 2EQNA 4P02A 2TRMA 3P8GA 4KP0A 1F5RA 2ZC9H 3LIWA 4CREA 1SGYE 1C2HA 2WUCA 5C5OA 2WYJA 3VGCB 1IQMA 1BMMH 2QAAA 2ZCHP 5EPYA 5FHTA 1FXYA 1C2KA 1KXFA 4NWLA 2TIOA 1GMHG 1AVWA 1PPBH 1BRUP 1KLTA 3E8LA 1O32A 1NZQH 3Q3XA 3A89A 1C2EA 5GCHG 3ZZAA 3NRLA 2KCPA 3SGBE 3UY9A 3PLPA 1FPCH 4K1EA 4ISLA 4RKOB 4HZHA 1LHEH 4I31A 5L6NH 2Y5GA 1IQIA 1YPHE 1OYQA 3RXMA 1C2DA 2A5IA 2BM2A 1GMHF 3NZIA 1IQEA 3URDA 1GMDG 1BT7A 4X2YA 1XKAC 2SNVA 4KTUA 1W2KH 2ZDLA 1C1UH 1BRBE 1BB0B 1VR1H 3KIDU 3T26A 1O5CB 1ZGIA 4FU8A 4NFFA 1H9IE 1OX1A 3DA9B 3SOSA 1O3HA 2STBE 2L74A 1OYTH 2QXJA 1O2ZA 2ZO3H 2A4RA 3FP8E 1Y5UT 1NROH 1C2MA 1OP8A 1OWIA 3ELAH 2A7HA 4BAQB 1TNLA 3TNSA 3SV6A 1SI5H 2AMQA 2FI5E 2ZGJA 4MLFB 3VB3A 3RXGA 2H5DA 2PSYA 4X2XA 3Q76A 4Y76A 3SU5A 2FX4A 2C8WB 4VGCB 1GDQA 4YM9A 2AMPA 1K22H 1X7AC 4J1YA 5JPMH 5C0TA 1GI7B 2P93A 3P92A 1ZRBA 2BLVA 1WOFA 1XKBC 1O2SA 1YWUA 5F8XA 3AASA 4DURA 2F3CE 4U01A 2BD7A 2A0QB 4CRCA 4YXWD 3ZYEA 3T28A 4JYTA 4A1TA 2BD8A 2SGPE 5E0GA 1TFXA 1TRNA 2NU2E 1FPHH 3RXBA 2ZGCA 4SGAE 3BF6H 1O38A 2FOGA 2QC2A 3M37A 1EOJA 1TQ0B 3SI3H 1O5AB 3A85A 2P3TB 3EA8A 4F55A 2AEIH 2OC1A 2VJ1A 1YY3A 1Z6JH 2QYIA 1ZMLA 1TGBA 4YO9A 4X0WU 3NCLA 1SGQE 2FODA 1CSOE 2Z3DA 4FUCA 3RLWH 1HAHH 4HG6A 1O3LA 1QA7A 1ZSJA 2ZFRH 2Y80A 4AFSA 4K8BA 1FY5A 1DXPA 2Z9LA 4WMDA 1ZGVA 4E7NA 1GVLA 5LGOA 3T25A 2OD3B 4CR5A 3HK3B 1SLXB 2GCHF 2A7JA 2M2AA 1SHHB 2B7DH 1CE5A 1WTHD 2FP7B 2WV5A 2FS9A 2D1JA 1GI1A 1BOQA 2SGDE 1HGTH 1O37A 3B9FH 3H5CB 4ZCNA 3MH6A 2R3YA 1C5UA 1QIXB 3GCHB 1P2NA 4BTUB 1H8DH 5BRRE 2ZFQH 1KDQA 2KCOA 2ANWA 4OS6A 1T31A 1SFIA 4AB9A 2W3IA 1V2LT 3ATMA 3ZVFA 1RRKA 4FUDA 4NGAH 4ZH8A 1ZSLA 3KYFA 4X8SH 1W3CA 2WPKS 3GISB 1AKSA 1C4V2 1NRRH 3RU4T 1MH0A 1P3CA 4NG9H 3A7WA 4X8TH 5FPSA 1YKTA 3TGKE 1Y3VA 2ZKSA 5JB9S 2D2DA 1AIXH 3AVZA 2TGDA 3NKKA 1WQSA 2B5TB 5CDFE 5DK1A 5DG6A 1TMUH 1ESAA 1K0HA 3SUGA 3Q00A 1ANBA 1MMJN 1T4UH 2ZU2A 4X1QU 1HPGA 3STJA 2FI4E 1BMFD 2YNBA 4A1VA 1DPOA 4IS5A 1P3EA 1GJ4H 2C8XB 2YOLA 3PWCA 3SJ8A 1YPMH 2RA0A 1FJSA 2FESH 3UNQA 1BMAA 1V2KT 5EQQA 4YESB 2CXVA 3PMAB 2WINI 1V2WT 3KQBA 4XSKU 1O3KA 3C27B 2FXRA 3RXQA 5E2OA 3Q3YA 5GIBA 1O2OA 1JIRA 1IQHA 2A1DB 1P2KA 4FETA 3N99A 1JIMA 4UFFH 3R0FA 1O3OA 4WY3A 1HAPH 4RN6A 2GZ7A 2KR7A 3SYJA 2BY9X 2PTNA 2Z3EA 4ESTE 3SBKA 4CRFA 1W0ZU 4HI3A 3GY7A 1GBFA 1P10A 2SGFE 4DW2U 3IG6B 3SV8A 1HBTH 2Z3CA 1QJ7B 2WPMS 2VVUA 5GWZA 2IN2A 5EJLA 5DPAA 1NT1A 1ZYOA 1C5LH 3MU4A 1ZOMA 1OWEA 3OY5U 1SLUB 5CHAB 1L0ZA 4U30A 1ID5H 4CBOA 2HLCA 1MTNB 1NU9A 3R3GB 3QK1A 5C5NA 1GJ5H 2J97A 1O36A 1BJVA 2CF8H 7GCHG 1ETSH 4NCYA 3ZVCA 1AZ8A 3SV2H 2GZ9A 1SSXA 3A7ZA 1ZLRA 1DFPA 3GDUA 2ZDAH 2A4GA 1AZZA 1K1MA 2OTVA 5C17A 2XRCA 1EZSC 4AYVB 3DD2H 4K60A 1F0SA 2BLOA 4INKA 1V6DA 1O2QA 3A8DA 6GCHG 3P8NA 3OX7U 2O9QA 5FCRA 1TPOA 3KGPA 4DVAU 4RKJB 2RDLA 1EPTC 2BX4A 5EW2H 1SVPA 3TNTA 3M5NA 2H9TH 1ZSKA 2PFEA 1ZZZA 3KQEA 2BB4A 1MD7A 2Q6GA 1W13U 4XBBA 4TYDA 3ZZCA 1O3MA 4JK5A 2OQ5A 3NPSA 1TAWA 1HAZB 2ZQ1A 4XOJA 9LPRA 1YBWA 1UTNA 2W7SA 1OP0A 2G81E 2G4TA 2BDCA 1DVAH 3GCTG 3TH4H 1UW7A 2BD2A 4MPUA 3SQEE 2VWLA 4R8TB 1XXFA 1O3EA 1VJ9U 3L3TA 3OTJE 1GJBB 1WV7H 1TQ7B 1Q3XA 1VCWA 3U8TH 3HATH 2D26C 4ISHH 1W11U 4OS1A 3W1EA 1RS0A 1O2NA 1MQ5A 4ZKOU 4O03A 2G00A 3ESTA 2BD3A 3SJOA 4CHAC 1H4WA 1NRPH 3SJ9A 5PTPA 2P94A 1TOCB 3AW0A 1AWHB 4I8JA 4OGYA 4UFDH 1O3NA 5KECA 2BDYA 1J9CH 1SOZA 5DP7A 1D6RA 3SZNA 2WPIS 4AGJA 1T32A 2PUQH 5FX6A 1KSNA 1LQEA 1HJ8A 2VIDA 3QZRA 1HAIH 5EG4A 1O3CA 1O33A 2FTMA 1UTOA 3BG4B 2WV4A 3UOUA 4ABBA 3ZZ7A 4NIWA 6CHAB 2D8WA 1SGPE 1Y3YA 2PR3A 1C5VA 3ZVEA 1PYTD 1FN6A 4XRNA 1RFNA 1ESTA 1DXWA 3GOVB 1N6YA 1AY6H 1SGTA 4YZUA 3L6PA 3EA7A 1G36A 1GVZA 1OWHA 3GY2A 2UWLA 1S5SA 4ZAEA 1WXRA 2V35A 2WYGA 4ISOA 1A3BH 1GBKA 1W0YH 1GHBF 3GY6A 2P3FH 4ACAA 1AFQB 2R2WU 3A86A 2IPHA 3GS9A 3SJKA 3SU3A 2W6JD 1SGDE 1UTMA 1DSUA 1XUFA 5EXLA 1VITH 5IDKA 2FO9A 2K0QA 1A1RA 3GYLB 2RCEA 4Y0ZE 5ABWA 1BMLA 3T5FH 5LPEA 2OXSA 3RMNH 3VB6A 1V2RT 5C20A 2VIOA 1EP5A 2B9LA 1QL9A 4MTBA 1C5RA 1O35A 2F43B 1YCPH 2OC0A 1O3JA 1V2JT 4X8UH 3U9AH 1NBME 3OSYA 3CNRA 5GPIB 3UREA 1H1BA 3PMHB 1INCA 4A5TS 3SV7A 2ZWLH 3DUXH 1C5NH 2TPIZ 2NU0E 1UTQA 3SORA 3MU0A 1NS3A 1V2OT 2CHAB 1V2MT 1ZPBA 5L2YH 2B8OH 2LELA 3G01A 2GDEH 2WPHS 5J4SA 2ZECA 2BTCE 5LH8A 1PPEE 2DUCA 1HJAC 2AFQB 3SW2B 3DSGA 2VB0A 3F3BA 2ZDMA 1HJ9A 1C2GA 1AFEH 3O8BA 1A2CH 3A87A 2GVFA 4Y7BA 2R2MB 4TY7A 3NK8A 4E05H 3MNBA 3UNSA 1ELCA 1UVUH 1G32B 1LO6A 1A5HA 4BTTB 3RXRA 1AWFH 2O8MA 1DY9A 2WV9A 4FUJA 3W94A 1ELGA 1QL8A 5ESBA 3BTHE 4MG3A 4GHTA 4BAMB 1J17T 4YLUA 1P2OA 1BCUH 3GY4A 1TBQH 5GCHF 3H09A 3MTYA 4UEHH 1TMTH 2FOCA 1S85A 1LKBA 3VFEA 1O3BA 1GI4A 3A82A 1ZHRA 1O3GA 1A46H 4UDWH 4BANB 1GMDF 2YNAA 4B1TA 1CT4E 1GJ8B 3SZEA 8GCHF 2SGEE 1S6HA 3RP2A 4K69A 1VKYA 1UVOA 1TGTA 2P3UB 1LVBA 4MQAA 5HGGA 4WWYA 4WH8A 2AIQA 2HRVA 4VGCC 3UIRA 4I7YH 1P57B 1BTYA 1P11E 1QR3E 4ABDA 1UHBA 2W5EA 2JH0D 3EGKH 1GI8B 1THSH 1O34A 5DP4A 1V2QT 1YP9A 1T8OA 4CH8B 3MH4A 2FEQH 3PYHA 3T27A 1YC0A 3D23A 1PQ8A 2Y7XA 1TX7A 5AFYH 5ESTE 1EQ9A 3RMMH 1JXPA 1QJ6B 4ZXYH 1WBGB 3O8DA 2CK3D 1D3TB 4J2YB 5EQSA 4LOYH 1C1PA 1QJ1B 1Q31A 4KGAA 2PGBB 3EA9A 5LPRA 1TRYA 3KQCA 3FAOA 5DP5A 5HIZA 2VINA 1Y3WA 3F68H 1O2HA 3F2HA 4GAWA 5C1UA 5DP9A 1PYTC 1XVOA 3BIVH 1RIWB 3F0OA 3K6ZA 1GL1A 2J92A 3E0PB 1AU8A 1ELTA 2P8OB 4B2BA 1Z8RA 4KTSA 3PTNA 1JRTA 2FOAA 2OINA 3PMBB 1EASA 2BQWB 1MD8A 2OK5A 1ETRH 2H1UA 4OS5A 1AQ7A 2VIQA 4PROA 1GL0E 1CGJE 5K7RA 2I6SA 2AGEX 2ZGBH 3UNRA 2PW8H 4Y0YE 3ZZ5A 3LOXA 1O2WA 4NIYA 7KMEH 2BZAA 2ALVA 1DT2A 2I6QA 3UTUH 3QGJA 3BN9A 1O3IA 1QRZA 1NFWA 4A1XA 1IOEA 1CGIE 2PWXA 5EGMA 1LQDB 1O3DA 3HKJB 1EB1H 1CVWH 1Z8IB 2ZPSA 4Z1MD 1ELVA 1HAYB 3SQHE 5FPTA 2P59A 2A7CA 1DWDH 2YMSD 3FANA 3MYWA 2NU1E 1O2IA 3TK9A 3SU2A 3TLOA 1N1LA 2HOBA 4NIXA 3SU4A 2V6NA 1F5KU 1BTZA 2OUAA 1JMOH 3OU0A 3UB0A 3K6YA 3QUMP 2W6ID 5AFZH 6GCHF 2W7UA 3NUMA 1DX5M 7GCHF 5JDUB 3F9HA 3RXKA 1GI6A 1GI3A 2GP9B 4JZEH 1BMNH 2FOMB 2H2ZA 4ABIA 3RXUA 1HJAB 2QE7D 3QX5H 5TCAA 1H9HE 1TB6H 4AFZA 1QY6A 3ZV9A 2GCTB 4GCHF 2JDID 2UUJB 3TK5A 2VNTA 1C5WB 1VZQH 2ESTE 1DWEH 3MH5A 4M9FA 5EW1H 1C1MA 4BTIB 2BVXH 3RXJA 4DGJA 2OBQA 1HDTH 2NU3E 2ZFTA 1NRQH 4K1TA 2F9VA 5KGOA 2FOEA 2A45B 3GDVA 1YPLH 5FBIA 1LVYA 1SBWA 1CBWB 1YPHC 4Y71A 4YLQH 1RD3B 3O8CA 1GJ9B 1SGIB 1QBOA 2TGPZ 2W3KA 1BQYA 4ZKSU 4D9RA 3M3TA 1JWTA 1OWJA 1GBJA 1C5YB 3ATKA 3KYGA 4XE4A 5IK2D 3LDXH 4F4OC 2H9EH 4YT6H 1SR5C 1W0JD 4IC6A 2GT8A 4WMEA 1H8IH 2PP6A 1OSSA 4CRAA 5C3NA 4X1PU 1A7SA 3TIUA 1RIWC 1TGCA 2V0BA 2ZPQA 1O3AA 4ABAA 1PQ5A 1FDPA 3RM0H 2BHGA 1T8LA 2O8TA 3BTEE 1YM0A 4WVPE 4NWKA 3TPIZ 5L30H 2BOKA 4ASHA 4ACBA 4NZLA 1OWDA 4ABJA 1MTSA 2VIVA 3VEQB 1ELAA 3RXDA 1TGSZ 1EFRD 1Z1JA 3RC4A 2FS8A 1P9UA 2WUBA 2R0KA 1ELEE 1PFXC 4IBLH 1LTOA 1TMBH 2ZA5A 1HFDA 2Q1JA 4YTAA 2JETB 1MTVA 1K21H 1FY8E 1ZPCA 2Z9GA 4CRDA 1FN8A 2OLGA 1GDUA 1PQAA 5JBAS 2WPDD 1S83A 1LHGH 7ESTE 1E79D 1QQ4A 3QN7A 4A92A 2QXGA 1AKSB 2QF0A 1TPSA 1UTKA 1BTPA 1RTLA 1VITG 1CA0C 2J38A 1MCVA 4CHAB 4ZUHA 2K1QA 3TJOA 4F48B 2ZU1A 7LPRA 1O2MA 1C4U2 2GV7A 4WJG2 1NFXA 4CBNA 1TNKA 2AYWA 1QB1A 3RXVA 1ELBA 1EKBB 1GBDA 2BDAA 1QFKH 1F0TA 1P2IA 4JZ1A 5A8ZA 1GBMA 2J9NA 3MMGA 2WPLS 2ZU5A 4KELA 5F8TA 1Y59T 1KLJH 3VB4A 3JZ1B 4YOGA 1O0DH 1SB1H 1E38B 2HWLB 3ZZ8A 5DN6D 1L1GA 1OHHD 4Y10E 2CN0H 2SGQE 1WSSH 5F6MA 1ZJKA 1GBHA 1C2LA 1OP2A 2IJD1 1DITH 1ZRKA 1KIGH 2Y81A 4X6MA 1GJDB 5BPEA 3EYDA 2RA3A 1JRSA 1WTGH 5A0AE 3P70B 5FBEA 3UWIA 3KNXA 4DY7B 1JBUH 3M7UA 2ZI2H 3UR9A 5C1YA 2PSXA 3PO1C 3LU9B 5HXFA 2HALA 1N8OC 1IQJA 2QF5A 5CHBA 4DT4A 3STIA 3QGNB 2UUYA 3BTDE 2PLXA 4U2WA 3BTGE 3I77A 4AB8A 2FPZA 1AE8H 2J98B 5EPNA 1UCYK 1TNIA 1AB9C 2QF3A 3T62A 2F9OA 3BG8A 5HKKD 1UCYH 1ESBA 1UVSH 2ALPA 3MU1A 4JZFH 3SHCH 3A8BA 2ODYB 1NFUA 3KEEA 3BTQE 1AHTH 1AO5A 1BDAA 2FOFA 3RC5A 1ABIH 5F03A 1HB0B 1G2MA 3SNDA 4D7FA 2THFB 5B6OA 1TONA
chains in the Genus database with same CATH topology
8GCHG 2XWAA 1K1IA 2PKAA 2OBOA 5I25A 1MKXK 3BTKE 3BTME 3P95A 1OPHB 4ISIH 3PWBA 4I8GA 4CRBA 5L2ZH 2ZFSA 2QXIA 1O2JA 1EJNA 1S81A 1TYNA 1G30B 2R3UA 1NC6A 4K3JA 1OOKB 2XW9A 3SU6A 3MO6A 3SNAA 3ZZDA 2J4IA 1BIOA 1ARBA 6CHAC 1YCPM 3HGNA 3EDXB 2FTLE 4UD9H 1ANEA 2F83A 3A88A 4DG4A 1EZXC 3K2UA 1GJ6A 1SHYA 1KXBA 4B71A 1MKWH 4O3UA 1FIZA 3LPRA 3UPEA 2Y6TA 5HM2A 2Y7ZA 4F49A 4UFEH 3P17H 4AG2A 1TX8A 4AN7A 2R0LA 3T2NA 2HNTE 4JYUH 5I46H 1GI5A 2UUFB 2FIRH 1ANDA 1Y3XA 1UK4A 5FAHA 1S0RA 2A31A 1HLTH 4Y8YA 1WQVH 4HTCH 2GTBA 4U32A 1CBWC 2NU4E 1TNJA 3DFLA 2Z9IA 1SC8U 1SGFA 3RLYH 1G3CA 3PM3A 2F9PA 4JZDH 4YOJA 1V2ST 2RG3A 3FP6E 3C1KA 1C9TA 1FY1A 3M35A 3QZQA 2PGQB 2Z94A 1UMAH 4O3TA 1PQ7A 2BY7X 1VGCB 1DDJA 1KXEA 1MCTA 1WUNH 1GHZA 1TABE 4XFQA 1LVOA 1LPGB 3HGPA 3HK6B 3BEFB 3U1IB 2GV6A 1GBEA 3RXCA 1O3FA 1L2EA 3UQVA 1Z8GA 4K2YA 2ZDVH 1H9LB 4NSVA 2PKSB 4FUEA 1LMWB 2PHBA 3LJJA 2TGTA 3NXPA 1HYLA 1GWAA 2G51A 3ODFA 1KDQB 5HM9A 2A2QH 3MU5A 5FX5A 1FAXA 1P8VC 2NWNA 1QTFA 4K1SA 1QA0A 1ZHPA 2VH6A 4BOHA 3D62A 2VIWA 3RXSA 1BHXB 1HXFH 3Q77A 4RSPA 1CQQA 1C2FA 1GHXH 2CF9H 2FLBH 3FFGA 4AORA 4ZHAA 1UCYE 1Y3UA 4IGDA 2ZHQH 4WMFA 1K1NA 1L1JA 5E8EH 3VXFH 3P6ZB 1P9SA 3U69H 2C3SA 1C1QA 5A09A 1GCTB 2O8LA 1V2TT 4JYVH 3N7OA 3TK6A 4B74A 1G3DA 2GMTC 2O8UA 3UUZA 5DP6A 4Y8XA 1MAXA 1WYKA 1PPZA 1P12E 3UQOA 3VPKA 2J2UA 1BA8B 3ZVGA 1SG8B 2XBXA 5LPFA 3SI4H 1C4Y2 2J95A 3M5LA 1NO9H 2FYQA 4GPGA 1E36B 3F9GA 1AB9B 1IQNA 3GY8A 1RJXB 1GHWH 3PO1B 1C9PA 2ZHFH 1XXDA 3P8FA 1EP6A 4I32A 3SJIA 1A3EH 2FI3E 3KL6A 1FONA 3F9FA 4B75A 3FVFB 1IQLA 2FX6A 1QQUA 4WXIA 4AZ2B 1DANH 1O2RA 1QBNA 3FZZA 1EJAA 5F8ZA 2LNCA 3AAVA 1ZJDA 3ZZ6A 5FPYA 1BITA 1KXCA 3SV9A 4O9VA 2FZZA 4MNVA 4H6SB 4UFGH 2OP9A 1C5QA 4IW4E 1AE5A 2ZHWH 4AX9H 2BDBA 2BD5A 2BVSH 1HXEH 1GHVH 2VWMA 4FVDA 4A6LA 3UWJH 2GZ8A 1WAYB 2ZQ2A 2GDDA 3MNXA 1DWCH 1C2JA 4CR9A 2A5KA 2AH4X 1AMHA 2Q6FA 1C2IA 2AGIX 1UTLM 1AN1E 1SQOA 4MPVA 4D8NA 1ANCA 1N8OB 5IYTA 3SN8A 1O2KA 1A0LA 1TNGA 4FUHA 2M5TA 2FLRH 4Q7YA 2ANYA 3PMJA 1V2UT 4H6TA 4Y7AA 4OS4A 5FXLA 1DICA 3TJNA 1NRNH 1A0JA 3BTFE 1O5GH 1FQ3A 2EI7A 2AS9A 1GI9B 3UFAA 1MAYA 3HPTB 2C93B 2VIPA 2EA3A 2GMTB 1LPZB 2J34A 1V3XA 4IMZA 5TJXA 2FOHA 1CGHA 5DGJA 3U8RH 3RMLH 1DS2E 2XCFA 1TALA 1FZZA 2ODPA 2C8YB 3ZVBA 8KME2 1BUIA 1QGFA 4SGBE 1K28D 1YLCA 4JCNA 4AGKA 1BRAA 2BLQA 1YPEH 1E0FD 1SLVB 3M61U 1K2I1 3A81A 3BV9B 1BZXE 2BY6X 5EXNA 2Z9JA 2UUKB 6ESTA 1GVKB 4XBDA 1HAVA 1GMCG 1S84A 4AG1A 5DJ7A 5C67A 1KTSB 1HAVB 1AGJA 3U1JB 4DJZB 5CMXH 4LK4A 3VB7A 2ZHDA 2H5CA 1EXFA 5JYIA 1XUIA 1GDNA 4NA8A 3KF2A 2EI6A 4ABFA 3SNCA 1YPKH 3QDZB 1BTWA 2CHAC 2ZHEH 4ZKNU 4GLYA 1C1RA 3K65B 1A5GH 5A0CA 1GMCF 1C1VH 1O2XA 2Y5FA 1E34B 1BBRE 1FY3A 4LZ4B 4X6OA 1MU6B 2CJIA 1YPGH 2SNWA 3A83A 1YYY1 5GXPA 3CS0A 4KKDA 2XYAA 1KXDA 1LDTT 2ZEBA 1B0EA 4FU9A 3RU4E 4B2AA 3PROA 1MQ6A 3CENA 1GCTC 2VWNA 1C1OA 3LH3A 3AW1A 2A4QA 2H9HA 8ESTE 2ZDKA 1KY9A 3LH1A 3E16B 2G55A 1T8NA 3A84A 1O2VA 2FYRA 3U8OH 1VITF 2G5NA 2ZIQH 1P05A 1DLEA 2F91A 1P2QA 1DE7H 1IQKA 3B8JA 4IMQA 1HUTH 2KAIB 3SUEA 4IC5A 3MNCA 4BXWA 1YLDA 2VU8E 1XUJA 3BG4C 3LGVA 1UVTH 2GGVB 1TPAE 4X1SU 4NA9H 3ZYDA 1HIAA 1UK2A 2BY5X 4Y8ZA 4Q80A 1EAIA 1CU1A 2TBSA 4TWWA 5A8XA 2ZU4A 1O2GH 5JBCS 2V3HH 3PB1E 1VGCC 3M36A 3PLKA 2ZNKH 1QNJA 2AMDA 1CT2E 1MKXH 1RTKA 4QT8C 2GKVE 2Z7FE 5AHGH 1QHRB 3S69A 1XVMA 1G37A 2A2XH 3TGIE 2XC0A 1BRCE 1O3PB 3P8OA 5H4IB 3GDSA 1SGFG 3F6UH 1V2VT 2WPJS 1KLIH 3A7TA 3IWMA 1NU7B 2FM2A 4JZIA 1OWKA 2GD4B 5CE1A 4AOQA 2CGAA 1K9OE 2XBWA 2AGGX 3RXTA 3RXLA 3SU1A 4E06H 1ZTLA 3ATIA 2ZCLP 2EEKA 3VXEH 2LPRA 1ETTH 1O2UA 2ZFFH 5T6DA 3U98H 1L4DA 1FMGA 1W7XH 3URCA 1IHSH 1UTJA 3B23B 1AD8H 3KCGH 2DE9A 1C5SA 1C5ZB 4I8LA 4M7GA 1JOUB 1THPB 2FMJA 3SUDA 1K1LA 3SUFA 4GHQA 2XCNA 2ZTXA 2BLWA 4Z0KA 2BXTH 2Q6DA 1MTNC 3BEUA 4E7RG 2F9NA 3MWIU 1HNEE 2ZDNA 3MOCA 1HAOH 2QGRA 2ULLA 1K1OA 2OC8A 3AAUA 3K9XB 4TWYA 3V3MA 4MNXA 1J16A 4Z6AH 2Y5HA 5J4QA 2BD4A 1OKXA 2ZPRA 4GUXA 2OQUA 3ZZ9A 1KTTB 1CA8B 4GCHG 1T4VH 1NTPA 1BBRK 1FLEE 1MBMA 2C4FH 3BTTE 4YT7H 3RXPA 2XBYA 1O30A 1TRMA 3S0NA 4XDEA 3V13A 2QXHA 3WY8A 1DUAA 4X1NU 1K1PA 4ZKRU 3MI4A 1GCDA 3GYMA 2VVCA 1TE0A 1Y5BT 1SOTA 1A5IA 4MPWA 4KTCA 3I29A 1F5LA 1GBBA 3MO9A 1O5DH 4FUGA 1KYNA 3UR6A 5T3HA 1XUGA 2XC5A 3BEIB 3ZVAA 3RXEA 3S9CA 1C1SA 1PJPA 4MNWA 1EZUC 2QV1A 3A7XA 3M7QA 4B76A 5T6FA 5A2MH 1TWXB 1PPFE 3MO3A 1FIWA 4ZROA 1SL3A 1G3EA 1LPKB 3QO6A 1TIOA 4FUIA 1T8MA 1QRXA 5A8YA 4TPYA 1SLWB 4DT7B 3E90B 2TGAA 2Z6BD 2GX4A 3KN2A 2ZFPH 1RTFB 1HRTH 3SNBA 1UHBB 1GG6C 1O5BB 1LHDH 1G2LA 3LONA 1EUFA 2XNIA 3RXHA 1MZDA 3SGQE 1MTWA 2QY0B 4NIVA 2ZZUH 1C5PA 4Y79A 3FP7E 1HV7A 5GDSH 2J94A 2B0FA 2JH5D 2Z9KA 1D3QB 1XX9A 3MHWU 1YF4A 5FCKA 3V0XA 1FI8A 1IHTH 1SGEE 1XM1A 1F0UA 2F9BH 2FWWA 4MPXA 1RXPA 4FUBA 2BDGA 2ZTZA 1HAGE 1W14U 1D6WA 2BDHA 3S7HB 1B0FA 3PLBA 1C5MD 1THRH 3BIUH 1C1TA 6LPRA 5JBTA 2IJOB 4HGCA 1CA0B 1DWBH 1DY8A 3ZZ4A 2ANMH 5JB8S 2BOHB 1D4PB 1GJAB 3L33A 3LKWA 3ODDA 2BQ6B 1MTUA 1BJUA 4ZHLU 1EATA 4NSYA 1SQTA 3ATLA 1F92A 3QTOH 2JH6D 3TJVA 1HCGA 1YPJH 2JETC 1LVMA 3SGAE 2XWBI 5SGAE 3I78A 1CHGA 1ZMNA 2BYAX 1QCPA 4OS2A 4WF8A 3M7TA 4DIHH 2IOTA 2QCYA 1NFYA 3GCHC 2OC7A 2ILNA 1PPCE 1NN6A 3E0NB 1NY22 1P04A 5ETXA 1Z1IA 2BD9A 4NFEA 4DOQA 4ABHA 5G4BA 1E35B 1SGNE 3LGYA 1P2JA 3RDZA 5JBBS 1AUJA 1UVPA 1TA6A 2PV9B 2UWPA 3W95A 3MU8A 1O31A 3GY3A 4CH2B 5EOKA 4D9QA 1GHAG 3LC5A 2VGCC 4K5ZA 2Y82A 1G3BA 2PKSC 4ZMAH 3RXFA 2G52A 3F1SB 1A0HB 1WCZA 1EX3A 5HYOA 1PPGE 4HFPB 3ITIA 2G5VA 2BMGB 4TPIZ 5HMAA 2ZF0H 3A7YA 4I8KA 2VH0A 1Z71A 3V7TA 1O2TA 1N6XA 1QB6A 1EZQA 2BQ7B 5EQRA 3RXOA 4D7GA 1C5TA 4THNH 1TGNA 4IN2A 1GI0A 3D49H 3H7TA 1GBCA 1J8AA 3TITA 4ABEA 4JK6A 1Y5AT 1OXGA 5DP8A 1O2LA 2VWOA 1DLKB 4TY6A 1IQGA 2P8OC 2SGAA 4WH6A 2O8WA 1M9UA 2QIQA 1AVGH 1TLDA 2ZP0H 3OYPA 3PTBA 1TBRH 2ASUB 4GSOA 4LZ1H 1W8BH 3KQDA 4NZQA 3LGWA 1SMFE 4X6NA 1YCPK 3V12A 1F2SE 1ZMJA 3CP7A 1GGDB 4I33A 3BTWE 1V2NT 4FXGH 2A32A 3VGCC 1GJCB 4JMYA 4MVNA 5E0HA 1NM6A 2PTCE 2H6MA 3ZVDA 1TX6A 4B2CA 5CHAC 1FY4A 4INHA 2HNTC 2XC4A 4ABGA 1U6QA 1KXAA 1IAUA 1GGDC 5E2PA 1GHBG 3EQ0H 1LCYA 3DFJA 3M3VA 1CHOF 1ZTKA 4X2WA 1G9IE 1S0QA 1TBZH 1TNHA 2BDIA 2CV3A 3A7VA 3GY5A 1BTHH 1EPTB 1GHYH 1ABJH 1DM4B 4DIIH 1XUHA 9ESTA 2PKAB 3OY6U 2QA9E 4X2VA 2CMYA 1Z8JB 2GCHG 3S9BA 1AI8H 4AFUA 2XTTB 1ACBE 3CS7A 1NPMA 1CHOG 3QTVH 1GBTA 2HGTH 5EXMA 2R9PA 5E0JA 3E3TA 4FU7A 1SFQB 3UOPA 3RM2H 4A7IB 1C5XB 3ZZBA 1P09A 1EB2A 3SHAH 1L1NA 4D76A 1QURH 2AIPA 1WU1A 2JKHA 1BTXA 4FVBA 3TJUA 5DO4H 1QRWA 4BNRA 1UO6A 2GT7A 2ODQA 2STAE 3A8AA 3DHKH 3DT0H 1Q2WA 4OGXA 4XBCA 1BTUA 2VGCB 4ISNA 4Q7XA 1ARCA 1SGRE 2XBVA 3LGIA 3PV4A 2PUXB 2SFAA 3E6PH 2VVVA 4INLA 1VCQA 4AFQA 4BAHB 2ZG0H 3FZDA 1B5GH 1K1JA 1V2PT 3O8RA 2FOBA 4B73A 3S9AA 1L4ZA 1ZTJA 1EJMA 3QLPH 1C1NA 1GBLA 1GI2A 1QB9A 8LPRA 1BHXF 1FAKH 3M5MA 4Q7ZA 1VCPA 2BVRH 2EI8A 2BX3A 3A8CA 1E37B 2HPPH 4MDSA 2DE8A 4MNYA 1A4WH 3KHVA 3MFJA 3TH2H 3GCOA 2ZCKP 2ZU3A 4Y11E 4ZXXH 1J14A 1BBRH 4BXSA 1P06A 1P0SH 3GICB 2P95A 1CO7E 1DUEA 1CT0E 1T7CA 1EOLA 3GCTF 3E1XB 1AUTC 1PPHE 4BAKB 1O2PA 3VB5A 1Z6EA 2BY8X 2BZ6H 3ZZ3A 1UJ1A 4Y6DA 3S7KB 2C90B 1TPPA 3F9EA 1VJAU 3D65E 3RXIA 1FUJA 3SO3A 1D9IA 1LHFH 1UK3A 3GCNA 1ZR0A 2G4UA 1XMNB 4ZHMU 2HPQH 5K0HA 5C2ZA 3TGJE 1GG6B 1MBQA 2G8TA 4FUFA 5EODA 1S82A 2BXUH 4DCDA 4H4FA 2GCTC 1MU8B 3LGUA 1IQFA 4Q2KA 5C1XA 1HAXB 3TH3H 1DSTA 3HKIB 5GJ4B 4UE7H 2P16A 3NWUA 4X8VH 3QWCH 3LC3A 1B7XB 3LJOA 4X6PA 3SU0A 1LHCH 2W26A 4NA7A 2UWOA 1EPTA 1O2YA 1GJ7B 4UONA 3RC6A 2XXLA 2A4OA 1ZPZA 2C8ZB 2ANKH 2EC9H 3ATWA 1TOMH 1ZHMA 1UTPA 5TCCA 3EAJA 1O5FH 1OS8A 4X1RU 2OCVB 3RXAA 1J15A 3LGTA 3ZV8A 3M3SA 1GPZA 1W12U 1AFQC 2HNTF 2HVXA 1QBVH 4AYYB 5A0BA 1LKAA 3A80A 5AF9H 1P03A 1S6FA 1P01A 1GBIA 1FV9A 3E91A 1A61H 1W10U 4LXBH 1XUKA 3EE0B 4CRGA 1MUEB 1EAXA 4K8YA 4I8HA 4YOIA 1AVXA 1SQAA 1EAUA 5DKMA 2FDAA 1DOJA 3Q3KA 5EU8A 3MH7A 1ELDE 2KAIA 2ZGXH 1NRSH 1O39A 3ENSB 1O5EH 1MZAA 1SPJA 1TA2A 1D3PB 1MKWK 1P2MA 4GVUA 3RU4D 1Z7KA 1F7ZA 3BSQA 2A5AA 3LT3A 2V3OH 4H42U 1QL7A 3TU7H 4IN1A 2ZTYA 1NESE