3A8BA

Crystal structure of trypsin complexed with (e)-4-((4-bromophenylimino)methyl)benzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8bA02
2HPQH 1K21H 3W94A 1XUGA 2FOEA 2ZECA 4I32A 4IN1A 4JYTA 1IQMA 3BF6H 7GCHF 2AMPA 1MBMA 5A2MH 1MQ5A 2W3KA 2BOKA 4AOQA 1P02A 2O8UA 1P3EA 1BHXF 3MMGA 1NTPA 1LQEA 1V2NT 4X8SH 5E2PA 2G5VA 1V2MT 3LGIA 2AERH 4ABFA 1S82A 3HGPA 1C2HA 1FV9A 5DP3A 1GL0E 2FOMB 1NRNH 3MU1A 2D1JA 1OOKB 1O38A 4CRBA 1QB6A 2XXLA 3A87A 2Z9LA 3LGWA 1C5SA 3F1SB 3UIRA 1WYKA 4K60A 1GHYH 1LVMA 5LGOA 1FNIA 3UR9A 4YZUA 5E8EH 1LTOA 1SFIA 1XVMA 3M5NA 2QN5T 4KGAA 1JRSA 2QYIA 5HM2A 1HLTH 3DHKH 3SW2B 2P95A 2BLVA 3GY3A 3T29A 1ANDA 2V35A 3AW0A 2GCHG 2OC7A 1O2OA 1C1OA 1O2VA 1SLUB 1QRZA 2WPHS 2EI6A 1NO9H 4E06H 2ZDVH 4ABIA 3K65B 2ZHEH 1O37A 1SQTA 5LPEA 1W12U 1F2SE 1LPKB 1IQIA 1Y59T 1QURH 1C2EA 5A09A 3F9FA 2RG3A 1GMCG 4I8KA 1INCA 1P2KA 4JYUH 1HIAB 4BAQB 2UWPA 4JZFH 4I8JA 2STAE 1ETSH 1CT4E 5F6MA 1MUEB 3SU4A 4K1TA 1PPEE 3M37A 1P05A 1EJAA 1ETTH 1S85A 5TCCA 2ZZUH 1KSNA 2FDAA 1TBRH 1GPZA 1FONA 2CHAB 2FXRA 4NZLA 2QC2A 2Z6BD 2ODQA 1SLXB 1C5WB 2QV1A 1HUTH 3D23A 4MG3A 1TGNA 4ZHMU 2HOBA 1RGQA 5DP4A 3LH1A 3RXVA 1HRTH 1ARBA 2FTMA 3ZV8A 4AYYB 3LU9B 2BD3A 5FBIA 4DURA 2FWWA 1KTSB 1MBQA 1VITG 2RA3A 1V2LT 2BX3A 1E0FD 2BXTH 2FZZA 2V3HH 2WPIS 4BOHA 1P3CA 3QZRA 2QA9E 2ZFSA 2ILNA 1P2QA 2G5NA 2P3FH 1QR3E 3RXUA 5HMAA 2BLWA 5EXLA 3JZ2B 3GY8A 4Z0KA 3RXBA 2BXUH 3MH4A 2FEQH 1JIMA 2FESH 4FUGA 1ACBE 2BLOA 3N7OA 1K2I1 2J34A 4X2VA 1C1VH 3O8RA 2A5AA 2J95A 2OLGA 1C1RA 4Q2KA 1YPJH 1TE0A 1DS2E 4ZKNU 2EEKA 1P2MA 4HGCA 1MKXH 1GBHA 3GCTG 3E6PH 2CMYA 2QF3A 1T8NA 3RMMH 4TYDA 1GMDF 2G52A 3A8BA 3QK1A 3LC3A 4UEHH 4UFEH 3ATIA 2GDEH 3ZVBA 1TGBA 3AW1A 3HPTB 3QGNB 2BDIA 1BA8B 3QGJA 1TRMA 3LC5A 1JWTA 1AFEH 5HM9A 2AIPA 3M7QA 5EG4A 2Z9KA 1YCPH 1E37B 1MKXK 1PYTD 2PUXB 4CR5A 2AEIH 4X6NA 1S0RA 1HPGA 2VGCB 4FUJA 1P10A 1FY4A 1YCPM 5I46H 2VIQA 1Y5BT 4TPYA 1O3EA 9LPRA 4ZXYH 3QWCH 4JMYA 1OWDA 3E3TA 5EODA 2BMGB 1AB9B 1N6YA 2FOFA 1P9UA 3MH6A 1ABIH 3DFLA 4B71A 1A4WH 2ZQ1A 2ZU2A 5SGAE 3SQEE 1OWKA 2VB0A 3FVFB 1D6RA 2YNBA 1MD7A 1MCTA 1EAUA 1DFPA 3U8OH 2JKHA 1BTXA 1H9HE 2A2QH 1P12E 3SJOA 5A8XA 4GHQA 2WYGA 4FUHA 4OGYA 5JDUB 4DG4A 5E0GA 2QXJA 3A8DA 2XW9A 5ESTE 1THPB 3SGAE 2A7CA 1RTKA 2FTLE 2ANKH 3TNSA 1ZSKA 1F7ZA 3MI4A 1A7SA 4NIWA 3HKJB 3SV9A 1AWHB 2XNIA 3GCHB 4B1TA 1SGTA 2J2UA 3NK8A 3NCLA 4THNH 3I29A 4Y0ZE 1ZOMA 2WPJS 3SUDA 1PQ8A 2BY8X 2WUBA 2IN2A 1O3HA 1O5BB 4X1PU 1MAYA 1G3BA 4NCYA 5C1UA 1AVXA 1GBEA 1PFXC 1QIXB 2XYAA 3OTJE 1TGTA 1A5IA 2ZGHA 2Z3DA 3GY2A 4K1EA 1QB1A 1EATA 2WINI 5HYOA 1O3AA 1DVAH 1YPGH 1IQEA 4U32A 2H2ZA 3HGNA 2TBSA 2PKSC 5LPRA 3PTNA 3PMBB 1EPTB 1O2LA 2FP7B 1Q31A 2P93A 3VXFH 1GMHG 4A5TS 3SNCA 1WCZA 1YYY1 1YPEH 1DUEA 4CHAB 3P6ZB 2A4QA 1WSSH 5BPEA 3LGUA 5JB8S 1O2HA 3KCGH 3TJNA 1P8VC 3K9XB 1IQLA 3P17H 1A61H 1O2TA 2H6MA 4Q7YA 2P3UB 3ZZ3A 4Y0YE 3PROA 2B8OH 1DOJA 2OBOA 1S6HA 3BTQE 3M35A 1F5LA 2VVVA 1K1IA 2D2DA 4Y8YA 2ZDMA 3RM0H 1IQGA 1HJ9A 3STJA 1XXDA 3VB5A 4DIHH 2BD5A 1ELBA 1NN6A 7ESTE 1PQAA 1UTPA 1P09A 1GBIA 2BVXH 2AGGX 3TJUA 1G2LA 2ULLA 1DXPA 1IQJA 4FU7A 6ESTA 1EZUC 1GJDB 2Y81A 4FVDA 2BY7X 3TGIE 1TPPA 1O3FA 4K69A 4Y8XA 4VGCB 2A2XH 2LNCA 2AS9A 1QQUA 1TNHA 1BMLA 3M7TA 1SMFE 3AVZA 3BIUH 4B75A 1TA2A 3VGCC 1MKWH 4BANB 1V2KT 3ZZ5A 1WBGB 2LPRA 1E36B 4O3UA 3RXOA 1UTNA 1ZPCA 3EA9A 1O2IA 2XBXA 2GT8A 1P06A 3AAUA 4HFPB 2BTCE 1UVUH 3W95A 1DWEH 3TJOA 1LMWB 5FX6A 6GCHF 3RXQA 1A3BH 2ZG0H 1VGCC 4OS7A 1FLEE 2ZWLH 1SGQE 1FXYA 3TVJB 1O5GH 5C1YA 2FS9A 1DANH 4O3TA 4CRDA 2TGTA 2ZP0H 5B6OA 3UQOA 4I33A 1OWJA 4Y79A 1HAPH 1SVPA 1GDNA 1GBAA 2AGEX 2Y7ZA 1J14A 4FUFA 4J2YB 3VEQB 1O3KA 1TONA 1V2UT 4OS6A 4ZMAH 1TALA 3SHAH 1QJ1B 1XM1A 1RS0A 1EJNA 4DOQA 1BBRE 1P0SH 2IJOB 1NESE 4XDEA 5EGMA 4ZKOU 1ZHRA 3TJVA 2DE9A 4D9RA 1MTWA 1XXFA 1SGCA 1P03A 1VZQH 3QTVH 3C27B 1T8MA 4X6MA 1V2WT 1AZ8A 3RXKA 2H5CA 3E91A 2ZFQH 1S5SA 3S7KB 1C5UA 3BV9B 1W11U 4HZHA 4X8UH 1W14U 2HALA 3IG6B 1CHOF 4FUEA 4A92A 4UONA 2OBQA 4U30A 3B8JA 3SNAA 3VFEA 1D6WA 1P2JA 2ZU1A 1C5QA 2ZU3A 2SGAA 3SU3A 1SPJA 1UJ1A 1HAOH 4AG2A 2V6NA 7LPRA 2BY9X 4MNXA 3O8BA 3KQCA 5FPSA 1WTHD 1Z8JB 3KL6A 2FI4E 2PKAB 1EOJA 1K28D 4ABJA 1KXFA 4D7GA 4NIXA 4QT8C 2PWXA 5DK1A 1QRWA 1G3DA 1UHBB 1H8IH 1HAVB 2M5TA 1SGIB 4PROA 1Y8TA 4ISIH 2UUFB 1HBTH 1O2KA 3F9EA 5ABWA 1W10U 2ASUB 1NFXA 1OPHB 4GUXA 2ZU4A 1QL7A 3BN9A 3TGJE 3TITA 2AIQA 1NZQH 1VJ9U 3GCNA 2BQWB 2G4TA 1Z6EA 4H6SB 5DKMA 4TWYA 1Q2WA 4SGBE 1UTQA 1QJ6B 1FPHH 1FIWA 3PM3A 3LONA 5AFYH 3BTHE 3M3SA 3M36A 1TBZH 2PTCE 3GCOA 1O2JA 1MZAA 4HI3A 1J8AA 1O2GH 1ZHPA 4NWLA 1FY8E 1TQ7B 2FOCA 4ZROA 3GY7A 5K0HA 2OC0A 1LO6A 1SOZA 3MWIU 4LK4A 1K1PA 1ELAA 3RU4E 2BVRH 3UFAA 1B7XB 3RXIA 5FPYA 5EQSA 1C1NA 5CMXH 9ESTA 2FM2A 5GCHG 3A89A 5JBBS 1T4UH 4AGJA 3GDUA 4AYVB 1JMOH 3A83A 4ZKSU 4CH2B 3BG4B 1RFNA 1BDAA 4Y11E 3P95A 3RXPA 3E0NB 3D49H 1DWCH 1LVYA 1FAXA 2OC8A 5JB9S 3ATLA 4X8TH 2Y80A 2CV3A 5CHAB 2A4OA 2PGQB 2KAIA 3RXCA 4JZDH 2P3TB 1DSTA 5IYTA 1SBWA 2JH5D 1YP9A 2GV7A 3UNSA 4K8BA 3VB7A 1DXWA 2TRMA 1BJVA 1OP2A 3MU5A 2ZGJA 2GDDA 3ATMA 5A8ZA 1X7AC 3FAOA 1J17T 1OYQA 3T25A 1EAXA 5HXFA 4MNYA 4BTTB 8KME2 4GVUA 2FLRH 3SZNA 2SNWA 2NU0E 2BX4A 1C1UH 1XUIA 4X2YA 2P94A 1ELEE 3LOXA 4WMEA 1ID5H 3LGVA 2F9BH 3U9AH 3GDVA 1F0RA 2IOTA 5ESBA 3ITIA 4GSOA 4LZ1H 4RKOB 1YPHE 4Y7BA 1BTUA 1XKBC 3S69A 3A7XA 1JXPA 1JBUH 1WQSA 1OXGA 1Q3XA 2JETC 1G32B 2VIWA 2GCTC 2XBWA 1AKSA 2ANYA 3Q00A 4FUIA 1QQ4A 4I8HA 1EB2A 1GGDC 1ZJKA 4K5ZA 1GBFA 2Q6FA 4INLA 4UFDH 1TNJA 1L1NA 2GMTB 3EA8A 3LIWA 1W13U 1ZTKA 4MPWA 3SI3H 4RN6A 3MNBA 1J9CH 1TIOA 1K22H 3PB1E 1SR5C 3KGPA 3O8DA 4MPVA 3RXRA 1FAKH 3P70B 4WF8A 1GDQA 1VR1H 1DM4B 4DW2U 3PWBA 1F92A 2GGVB 1GI9B 4WH6A 1TNIA 4K8YA 3HK6B 3SUFA 2G55A 4Y76A 3MHWU 4IC6A 2Z9IA 1CGHA 1NROH 2ZDLA 2R3UA 2HNTE 4AZ2B 5GXPA 1GCTC 4B76A 3TLOA 1QL8A 1AIXH 2UUJB 1SC8U 3VB3A 3SJKA 3K2UA 4WJG2 2GP9B 4YT7H 1C9PA 1UCYE 1HB0B 2Z3EA 1HAYB 1E35B 3QTOH 2BM2A 1GBCA 1QBNA 1GBDA 4MDSA 3VGCB 4YESB 1C5OH 1O2UA 2SGDE 5FX5A 3SJIA 4E05H 3RXLA 1Z7KA 1YGCH 3PLKA 3R0FA 1V6DA 1CT2E 2ODYB 2QXHA 1GHAF 4NA8A 1T32A 5AF9H 4K3JA 1UK3A 3ZZ8A 2FOHA 2XC5A 3VXEH 3NKKA 3RXJA 1EAIA 1LHGH 3RUOA 3QN7A 4X0WU 2VIOA 1D3PB 4ABAA 4NGAH 1CBWC 3SU0A 4I7YH 1GVLA 2FODA 4JCNA 4CH8B 1SGFG 3M5MA 3ATKA 4GCHG 3HKIB 1YF4A 3RC4A 1O30A 1TPSA 3LGTA 2HGTH 2QY0B 1A0JA 1O2YA 1JOUB 1OX1A 2BOHB 4AFUA 1EXFA 2XWAA 2OQ5A 3ZYDA 1TX8A 1EQ9A 4A1TA 4MNVA 5EW2H 2F9UA 3EE0B 3K6YA 1GCDA 3BTGE 3F68H 4F49A 3TK5A 1DDJA 1LPZB 1FDPA 2J38A 1C4V2 4WWYA 1C4U2 1TMTH 2W5EA 3UQVA 5F8ZA 1CHGA 4DIIH 3F6UH 1O31A 3ENSB 3M5OA 2ZA5A 3TH2H 2DE8A 3V13A 3T5FH 3JZ1B 2HLCA 1Z1IA 3SV2H 3S9BA 3TGKE 1AO5A 2PV9B 1BJUA 3KNXA 5FCRA 5GDSH 3MO9A 1DX5M 1UTLM 1OWEA 1UVSH 1CGIE 1O5EH 2BDAA 3ZVGA 3U8RH 3P92A 5HGGA 3GY4A 3DFJA 4KELA 4MNWA 1GI5A 1BHXB 1SQAA 4IGDA 5C5OA 1TGCA 1YLCA 3RMOH 2GV6A 3KIDU 1CA0B 1EX3A 1G3CA 2VNTA 1AUTC 5CE1A 3SV6A 1AE8H 1H8DH 1W7XH 1LCYA 2FPZA 1W7GH 2FI5E 4RSPA 1RTFB 4AFZA 1DICA 1VCWA 1C1TA 4A7IB 2B0FA 3BTDE 8GCHG 3BG8A 3FANA 2FOBA 2H9TH 1C5YB 1O3OA 4Y71A 2ZDNA 3RXMA 2WUCA 1HAXB 2ZIQH 3GDSA 2BD4A 1C1WH 2RCEA 1QBOA 3DD2H 1MH0A 3EYDA 3KQEA 2BY6X 2OXSA 1OWIA 3RC6A 1NRQH 1RTLA 3A8CA 4Y10E 3S9AA 5FBEA 3RXTA 1SQOA 2PUQH 3EAJA 1ZMJA 1UTOA 1HAHH 3EA7A 1O2PA 1DLEA 1BBRK 1C4Y2 1DT2A 2FYQA 3BSQA 2R0KA 2VWMA 2JH6D 1BT7A 1ZJDA 3QDZB 1IHTH 2RDLA 1SHYA 1C5TA 3GY6A 3RXFA 5PTPA 1V2PT 1K1OA 1UTKA 1GHWH 4CRAA 4YO9A 1TBQH 3BTTE 1OWHA 3RXDA 2G4UA 2FYRA 4ESTE 4NIYA 2Y82A 4IMQA 1P11E 3T26A 3AASA 3C1KA 2EA3A 2PHBA 2V0BA 4E7RG 1AI8H 1MTNB 2WPMS 1C2FA 3OYPA 2ZDAH 2PR3A 5L2YH 4WY3A 2QXIA 5EXNA 3ATWA 4AORA 3EDXB 1C2LA 4B2AA 1P57B 5ETXA 2BDBA 3ZVDA 1G9IE 2GCHF 1A1RA 2BDHA 4UFFH 4XOJA 4BXSA 2J94A 1A2CH 3Q76A 1V2ST 2A4GA 1BRAA 1RJXB 1L4ZA 4ABEA 2ZO3H 4ZUHA 1K1LA 5FPTA 1GMCF 3WY8A 1T7CA 1GJ7B 1DSUA 7KMEH 1F5KU 1W0YH 1GJ4H 5F8XA 4DVAU 1G36A 4BTUB 2BZAA 4IW4E 5DP6A 1O34A 1LKBA 2VINA 3MOCA 3U69H 1FMGA 3A81A 5E2OA 2PTNA 4JYVH 5LH8A 2A0QB 4FXGH 2AFQB 3LJJA 1U6QA 2W7UA 4I8GA 5EPYA 1QB9A 4OGXA 1O3GA 1EAWA 1NS3A 1DY9A 1C1PA 1C2KA 3MNSA 2CF8H 4LOYH 3V12A 3QO6A 1O3NA 4GLYA 5EW1H 2FMJA 1GHBG 3ZYEA 3PYHA 3UREA 4Y7AA 4ZHAA 2ZGCA 2NWNA 1MAXA 4WVPE 1FY3A 1EOLA 2THFB 3UTUH 2O8LA 5DP7A 3E90B 3RU4D 1VITF 3FZDA 1TLDA 1GJ5H 3SUGA 4FUBA 3A85A 1PYTC 1WQVH 1YKTA 2VIDA 3A88A 3BEIB 1HJAC 2ZNKH 1EKBB 1O2NA 4AX9H 3CS7A 1T31A 5EOKA 2G8TA 1F0UA 1BQYA 2AGIX 3EGKH 1HAGE 4I31A 4CR9A 1SI5H 3BTKE 3QUMP 3PO1C 1GCTB 3TK9A 2W26A 2GVFA 1O35A 3ODDA 1H4WA 1CT0E 1AE5A 1ELFA 3PMJA 2P16A 2OCVB 4NSYA 4IBLH 4KTCA 1VJAU 1THRH 7GCHG 4IN2A 3A7YA 3GCTF 2FO9A 4NSVA 1MD8A 4ZH8A 1FY5A 4ISNA 5FHTA 3A7VA 4AFSA 2ZQ2A 2P59A 4MLFB 4BTIB 1RD3B 1WV7H 2C8WB 3CENA 4WXVA 1UVOA 2R3YA 1EB1H 5C2ZA 1CE5A 1AN1E 4DT7B 1C2JA 1GI0A 1YM0A 1O5FH 1TRNA 1Z8GA 3I77A 3RM2H 3HATH 3SORA 2EC9H 2XBVA 2ZGXH 2WPLS 1CBWB 1FQ3A 2Z9GA 2C8XB 4MQAA 4NG9H 3M7UA 1GJ8B 2A31A 2C8ZB 3SU1A 4AN7A 1EASA 4A1VA 1V2RT 2BD7A 4XSKU 1O5DH 1HXEH 4MVNA 1C5MD 5FAHA 3RC5A 3MNCA 4JK5A 4O9VA 1NPMA 5TJXA 2G51A 1TPOA 1PPFE 1ZTJA 3SJ8A 3ZZ4A 1AMHA 1BUIA 1O3CA 1J15A 4H4FA 1O32A 2SGFE 3RMLH 3ESTA 2BQ7B 1LHFH 5DP5A 1ELGA 1WU1A 3RXHA 1OP8A 1SFQB 3A82A 2NU4E 1UCYH 2A5KA 1GDUA 1ZSLA 3S7HB 3TH4H 1A0LA 1KYNA 2VH6A 1BTHH 2GZ8A 3U1JB 2I6QA 2XCFA 1FIZA 3KQDA 1XKAC 3LPRA 2FOGA 1ZRBA 2BYAX 1ETRH 1GI1A 1V2QT 2PW8H 3ZV9A 3A7WA 1KTTB 5A8YA 1ANEA 1NRRH 1IOEA 1NRSH 1TRYA 4YOGA 3M3VA 3SO3A 1IQNA 1C2GA 1OP0A 1KXBA 1THSH 1UCYK 1E34B 1O2SA 1SLVB 3MU4A 2Q6GA 1BMAA 1D3QB 2GD4B 5AFZH 3SBKA 1XUFA 1PPCE 1QNJA 1NT1A 3PV4A 3D62A 3SUEA 1O3JA 1BTYA 1SGEE 1WUNH 2VWLA 3LJOA 3S9CA 3RXSA 1C2MA 2BD9A 1ZZZA 3H7TA 1SGYE 1SLWB 1TMUH 2R2MB 5EQRA 1AZZA 1GMHF 2DUCA 4B74A 1GVZA 3RXGA 1C1SA 3SOSA 4TY6A 1W8BH 1Z1JA 1ELVA 3FP8E 4BAHB 3OU0A 1C5XB 1N8OC 1O33A 2UWOA 3TH3H 1CO7E 5J4SA 2ZKSA 4TWWA 1GI8B 1GG6C 6CHAC 1ZR0A 1KDQA 1N6XA 3A80A 1DWBH 1EPTA 1TPAE 1UK4A 2I6SA 3ODFA 5T3HA 3URCA 4OS4A 2Y5HA 1HDTH 3GCHC 2XWBI 5FCKA 1D3DB 1WOFA 2SNVA 1C2IA 3KEEA 1BRCE 1DE7H 2CXVA 2ZCKP 3CS0A 3DT0H 4KTSA 1MTSA 3A84A 1GMDG 4RKJB 1V2VT 1HCGA 4B2BA 1A0HB 1HAIH 3RP2A 1LDTT 3SI4H 3EQ0H 4CREA 2ANWA 3LKWA 3DUXH 1C1MA 3H7OA 2FX6A 1WTGH 2XBYA 4WMDA 4AB9A 3IWMA 4TY7A 5A0AE 1JRTA 1TOCB 1QGFA 1YPHC 1TMBH 4WXIA 2FLBH 3QZQA 4ABHA 1EPTC 4YLQH 1GBKA 4ISHH 1QTFA 1ZRKA 2AMDA 2RA0A 1XUHA 1TABE 4X1QU 2R9PA 5AVDA 3RLYH 1O0DH 3BEUA 2A1DB 1MZDA 1ZMNA 3SN8A 4MTBA 1FZZA 1TQ0B 3B23B 2B9LA 5JBCS 3O8CA 2GZ7A 1FY1A 2PKSB 2CN0H 1L1GA 3AAVA 1ZGIA 1W3CA 4MPUA 1IQFA 2OINA 3QX5H 1AFQC 2W7SA 3VB6A 1A46H 3ZVCA 2GZ9A 1VITH 4DCDA 1ZSJA 3E1XB 1Y3VA 1UVTH 2ALVA 1NC6A 3TU7H 2HVXA 4ABDA 1O2QA 1GL1A 2O8WA 3GYLB 3SNEA 2QIQA 4NA7A 4B73A 4CRCA 2VIPA 1IQHA 1AUJA 1ABJH 4K2YA 2HNTC 1BCUH 4ZXXH 1GI7B 4VGCC 2YOLA 4JZEH 1DUAA 4UDWH 1JIRA 3R3GB 1A5GH 3NUMA 4D9QA 1GBLA 2Y6TA 4JZIA 2TGDA 1A3EH 1GI3A 3FP7E 1GJ6A 2HRVA 2OUAA 4NFEA 3ZVFA 2QGRA 3V7TA 2G81E 3A86A 2C4FH 1NFYA 5DGJA 1GBMA 1B0FA 3MYWA 1GJ9B 4XBBA 3RMNH 2ZFFH 3M61U 1O3IA 3VPKA 3TIUA 2ZI2H 2QXGA 1YPKH 4A1XA 2B7DH 1O3LA 4FUDA 1Y5AT 1O39A 5C20A 1YPLH 3U98H 1FUJA 1O3DA 2UWLA 4KP0A 1YC0A 1QJ7B 1HJAB 3SHCH 1LVOA 3V0XA 1TX7A 2STBE 1UVPA 3SU2A 4ABGA 1O2ZA 4NIVA 2XCNA 1NU9A 1B5GH 3PO1B 1TNGA 1G37A 3D65E 4AG1A 1OKXA 1VGCB 3U8TH 2HPPH 3MTYA 1ELTA 1L0ZA 4BNRA 2PKAA 3SNBA 5A0BA 1LQDB 1MCVA 2UUYA 3PMAB 4F4OC 3BTEE 4A6LA 1QRXA 4WH8A 2Z7FE 1C2DA 2ZTXA 3SU5A 2PSXA 2HWLB 1LPGB 1UHBA 2P8OC 1EZSC 2ZCLP 1HAVA 3UY9A 1QCPA 2J9NA 4XE4A 2R2WU 3ELAH 2A45B 3MU8A 1XVOA 1QL9A 3LDXH 4CRFA 5H4IB 2ZDKA 1C9TA 1QFKH 1L4DA 1F5RA 4JZ1A 3S0NA 1T4VH 3SNDA 2C8YB 1QA7A 3ZZ6A 1P2NA 1GI4A 1AY6H 4X8VH 3SGQE 1QA0A 2NU3E 1CSOE 2EI7A 2VJ1A 1UO6A 3LH3A 1SGFA 1B0EA 1CGJE 1Y3UA 5L30H 1BRBE 5GCHF 3ZZ7A 2ESTE 4FU8A 1ZMLA 1S81A 1NM6A 5EQQA 1GBJA 2O8MA 3E0PB 3T27A 1CVWH 1XMNB 1E38B 4FU9A 1S0QA 2IPHA 1Y3XA 2FOAA 6GCHG 1TB6H 3SV8A 1AGJA 1ZHMA 5DPAA 3ZZCA 2AMQA 1BITA 4GAWA 1AU8A 2ODPA 1SHHB 2F9VA 3F9GA 2VWOA 4H6TA 1BTWA 1ELDE 1P01A 1HGTH 3BTWE 1ANBA 2FI3E 3PTBA 3UOPA 1N1LA 2HNTF 2ZFRH 3L33A 4X2XA 1TAWA 5F03A 3NPSA 4ZHLU 2F9NA 2NU2E 3SGBE 1C5LH 3G01A 2JH0D 2OD3B 3MO3A 8LPRA 1CQQA 1O2RA 1AVWA 5EU8A 1HYLA 1GJBB 2BB4A 2OQUA 3U1IB 2EI8A 4U01A 3TNTA 4UD9H 2ZTZA 4ISLA 1ESAA 2PSYA 1GBBA 1Z8RA 2QF0A 4LXBH 2VU8E 2CF9H 4YT6H 3P8OA 5GIBA 1BBRH 1GHZA 1UK2A 3PLBA 1XUJA 3ZZAA 2WPKS 1K9OE 1DPOA 1OYTH 3GICB 2FX4A 2OTVA 5T6FA 1FJSA 1AHTH 1BMMH 8ESTE 1CHOG 4IC5A 1D9IA 1KLIH 1XUKA 5G4BA 4Q80A 1PQ7A 3A7TA 4OS5A 1DLKB 1HV7A 1O2XA 1O2WA 3P8FA 4X1NU 2F9OA 1AQ7A 3BG4C 4I8LA 3BEFB 4CBOA 3GISB 4CBNA 1BRUP 1P2IA 5T6DA 2ZFPH 2A32A 3A8AA 3OY6U 2BVSH 4B2CA 1HAZB 3T28A 4FUCA 1SGNE 1YCPK 1H9IE 1KIGH 5JPMH 1EP6A 3UWIA 1GJCB 1V2OT 1SGDE 1TNLA 5GPIB 2O8TA 3TPIZ 1PPGE 5CHAC 1FN6A 2XC0A 1DY8A 4R0IA 2ZHFH 2K1QA 4HTCH 2QAAA 1QY6A 1O36A 1V3XA 2BQ6B 1N8OB 3IITA 2OC1A 2ZPSA 2CJIA 4DGJA 2GT7A 3UPEA 4IS5A 1GG6B 6CHAB 2J4IA 5E0HA 1PJPA 3KF2A 5F8TA 1RIWC 2GKVE 1UTJA 3DA9B 1SB1H 1LHCH 1WAYB 4GHTA 1V2TT 1BTZA 2Y7XA 1C5RA 4WMFA 1DITH 3BTME 3LT3A 4IMZA 1Y5UT 5BRRE 1HXFH 2ZCHP 4R8TB 3P8NA 2GX4A 3UR6A 4LZ4B 1BMNH 1HFDA 2A5IA 1P04A 1BIOA 5C5NA 1YBWA 2YNAA 4X6OA 1V2JT 1NU7B 1QBVH 2VIVA 4NA9H 3OSYA 2ZF0H 1TNKA 2ZFTA 1SSXA 2TGPZ 1Z6JH 2D26C 4AB8A 1KDQB 1G30B 3V3MA 1FI8A 1ZPZA 4OS2A 2XRCA 2ALPA 2GMTC 3MFJA 1O3PB 2KAIB 3SV7A 5IDKA 1T8OA 4ZAEA 4DY7B 1Y3YA 3FP6E 3HK3B 1C5NH 5JBTA 2JETB 1P9SA 2GCTB 1Z8IB 1KXEA 1HNEE 4OS1A 1Y3WA 1GGDB 2J92A 3MH5A 1HIAA 3MO6A 3KHVA 1LHEH 1AD8H 4GCHF 4Q7ZA 1VCQA 4SGAE 3SQHE 2BZ6H 1RRKA 1UMAH 1AFQB 4BAOB 1ORFA 3FZZA 4XBDA 2CGAA 1SGPE 5J4QA 3RDZA 1ZGVA 2FIRH 2F3CE 2ZHWH 1CA8B 5T6GA 1SOTA 3PWCA 5I25A 1EJMA 4NZQA 1GI6A 2ZPQA 3E16B 3M5LA 5DP9A 1G2MA 2QCYA 4YOIA 3QLPH 2Z94A 4KTUA 5JBAS 1YPMH 1O5CB 4JK6A 1IAUA 2G00A 4D8NA 1IQKA 2F91A 4MPXA 1BZXE 1MMJN 1TGSZ 2BY5X 1RXPA 2SGEE 3MNXA 1SGRE 1AKSB 1PPBH 1TFXA 1KXCA 4X2WA 3NZIA 1UTMA 1ELCA 1PPZA 2PGBB 1GJAB 2C93B 3LGYA 3RLWH 4H42U 1Z71A 1KLTA 1NY22 1MU6B 1NFUA 1P2OA 2H5DA 2Y5GA 4ABBA 4XFQA 1EZQA 2AYWA 1L2EA 4M7GA 4TPIZ 4Z6AH 1BOQA 2Q1JA 1K1MA 2NU1E 1W2KH 3Q3XA 2A7HA 1GVKB 4YLUA 1OSSA 2AH4X 2R0LA 1MKWK 1EZXC 5DG6A 2CHAC 3ZZBA 4K1SA 4D7FA 1NFWA 3GY5A 4AGKA 1MQ6A 2XC4A 1KLJH 3SU6A 3PMHB 3UOUA 1ZPBA 2GTBA 1ZTLA 2VWNA 1YLDA 5DP8A 2Y5FA 1A5HA 1KXDA 5JYIA 2BDYA 4Y6DA 2Z3CA 3UNRA 8GCHF 1LKAA 1T8LA 4BXWA 4GPGA 4AFQA 4BAMB 3A7ZA 2B5TB 3OY5U 1O3BA 2C3SA 5FXLA 5A0CA 2P8OB 3GYMA 1OS8A 3Q3KA 1D4PB 3BIVH 2V3OH 1ESTA 3E8LA 2O9QA 3B9FH 3ZVAA 1M9UA 2SFAA 4YM9A 2VH0A 3SJ9A 5K7RA 1H9LB 5GJ4B 1LVBA 1GI2A 2D8WA 4X6PA 3CP7A 5DJ7A 1GHXH 2W3IA 1F0TA 1GWAA 3Q77A 3ZVEA 6LPRA 5C67A 5DO4H 3UNQA 3GOVB 4X1RU 3F9HA 4E7NA 1EUFA 4UE7H 2FS8A 4INHA 5E0JA 2BD2A 2C90B 2PFEA 1BB0B 2VVUA 1S6FA 2WV5A 3KN2A 1MU8B 3L3TA 1K1JA 1QHRB 2TPIZ 4FVBA 1BTPA 1GHVH 1GHAG 1TWXB 2A7JA 2VVCA 3Q3YA 2PLXA 3RU4T 3NWUA 2A4RA 3FFGA 4Y8ZA 1ZYOA 1CA0C 1F0SA 3I78A 4INKA 1FPCH 1CU1A 1GBTA 1TYNA 3OX7U 1ESBA 2ZHDA 3URDA 2ZPRA 2ZHQH 1MTUA 2VGCC 1AVGH 2F83A 2SGPE 1C5ZB 4KKDA 2XTTB 4NWKA 4DJZB 3BTFE 1MTVA 1K1NA 1TX6A 5GWZA 3RXAA 4O97A 1C1QA 2WV4A 1EP5A 1L1JA 1AB9C 2ZEBA 1NRPH 4XBCA 1O2MA 2WYJA 3T2NA 2BD8A 4X1SU 1SL3A 3PLPA 5C3NA 3T62A 2H9EH 3MU0A 4O03A 4U2WA 3L6PA 3RXEA 1ANCA 1S83A 1G3EA 2ZTYA 3K6ZA 1PPHE 4BAKB 1S84A 5L6NH 3TK6A 2Q6DA 4UFGH 2BHGA 1LHDH 1AWFH 5LPFA 1ZLRA 1J16A 1PQ5A 3UUZA 2H9HA 2F9PA 2SGQE 1HJ8A 4YTAA 2H1UA 2BDCA 3KQBA 1O5AB 4YOJA 2Z9JA 1XX9A 1GHBF 3H5CB 4ASHA 3VB4A 1C5VA 1W0ZU 2TGAA 5TCAA 4ZKRU 1MTNC 1KY9A 2ZGBH 3NXPA 5L2ZH 2ZU5A 2UUKB 4NFFA 2TIOA 2ZC9H 4ISOA 5EXMA 1TOMH 4J1YA 1O3MA 4Q7XA 5C1XA 2OP9A 2BDGA 5EPNA 1ARCA 3UWJH 3ZZDA 1VCPA 1H1BA 2ANMH 1D3TB 1RIWB 1SG8B 1C5PA 1FN8A 4CRGA 1TA6A 5AHGH 3ZZ9A 3P8GA 4CHAC 3MH7A 2BLQA 1KXAA 3M3TA 4D76A 3STIA 1DWDH 1IHSH
chains in the Genus database with same CATH superfamily
2HPQH 1K21H 3W94A 1XUGA 2FOEA 2ZECA 4I32A 4IN1A 4JYTA 1IQMA 3BF6H 7GCHF 2AMPA 1MBMA 5A2MH 1MQ5A 2W3KA 2BOKA 4AOQA 1P02A 2O8UA 3PRDA 2KZ4A 1P3EA 1BHXF 3MMGA 1NTPA 1LQEA 1V2NT 4X8SH 5E2PA 2G5VA 1V2MT 3LGIA 2AERH 4ABFA 1S82A 3HGPA 1C2HA 1FV9A 5DP3A 1GL0E 2FOMB 1NRNH 3MU1A 2D1JA 1OOKB 1O38A 4CRBA 1QB6A 2XXLA 3A87A 2Z9LA 3LGWA 1C5SA 3F1SB 3UIRA 1WYKA 2YMSD 4K60A 1GHYH 1LVMA 5LGOA 1FNIA 3UR9A 4YZUA 5E8EH 1LTOA 1SFIA 1XVMA 3EE7A 3M5NA 2QN5T 4KGAA 1JRSA 2QYIA 5HM2A 1HLTH 2XOKD 3DHKH 3SW2B 2P95A 2BLVA 3GY3A 3T29A 1ANDA 2V35A 3AW0A 2GCHG 2OC7A 1O2OA 1C1OA 1O2VA 1EFRD 1SLUB 1QRZA 2WPHS 4F55A 2EI6A 1NO9H 4E06H 2ZDVH 3AK5A 4ABIA 3K65B 2ZHEH 1O37A 1SQTA 5LPEA 1W12U 1F2SE 1LPKB 1IQIA 1Y59T 1QURH 1C2EA 5A09A 3F9FA 2RG3A 1GMCG 4I8KA 1INCA 1P2KA 4JYUH 1HIAB 4BAQB 2UWPA 4JZFH 2V3MA 4I8JA 2STAE 1ETSH 5HIZA 1CT4E 5F6MA 1MUEB 4RI0A 3SU4A 4K1TA 1PPEE 3M37A 1P05A 1EJAA 1ETTH 1S85A 5TCCA 2ZZUH 1KSNA 4RT0A 2FDAA 1TBRH 1GPZA 1FONA 2CHAB 2FXRA 4NZLA 2QC2A 2Z6BD 2ODQA 1SLXB 1C5WB 2QV1A 1HUTH 3D23A 4MG3A 1TGNA 2AHME 4ZHMU 2HOBA 1RGQA 5DP4A 3LH1A 3RXVA 1HRTH 1ARBA 2FTMA 3ZV8A 4AYYB 3LU9B 2BD3A 5FBIA 4DURA 2FWWA 1KTSB 1MBQA 1VITG 2WSSD 4XD7D 2RA3A 1V2LT 2BX3A 1E0FD 2BXTH 2FZZA 2V3HH 2WPIS 4BOHA 1P3CA 3QZRA 2QA9E 2ZFSA 2ILNA 1P2QA 2G5NA 2P3FH 1QR3E 3RXUA 5HMAA 2BLWA 5EXLA 3JZ2B 3GY8A 4Z0KA 3RXBA 2BXUH 3MH4A 2FEQH 1JIMA 2FESH 4FUGA 1ACBE 2BLOA 1FX0B 3N7OA 1K2I1 2J34A 3GS9A 4X2VA 1C1VH 3O8RA 2A5AA 2J95A 2OLGA 1C1RA 1WXRA 4Q2KA 1YPJH 1TE0A 1DS2E 4ZKNU 5B6LA 2EEKA 1P2MA 4HGCA 1MKXH 1GBHA 3GCTG 3E6PH 2CMYA 2QF3A 1T8NA 3UAIC 3RMMH 4TYDA 1GMDF 2G52A 3A8BA 3QK1A 3LC3A 4UEHH 4UFEH 3ATIA 2GDEH 3ZVBA 1TGBA 3AW1A 3HPTB 3QGNB 2BDIA 1BA8B 3QGJA 1TRMA 3LC5A 1JWTA 1AFEH 5HM9A 2AIPA 1KMHB 3M7QA 5EG4A 2Z9KA 1YCPH 1E37B 1MKXK 1PYTD 2PUXB 4CR5A 2AEIH 4X6NA 1S0RA 1HPGA 2VGCB 4FUJA 1P10A 1FY4A 1YCPM 5I46H 2VIQA 1Y5BT 4TPYA 1VKYA 1O3EA 9LPRA 4ZXYH 3QWCH 4JMYA 1OWDA 3E3TA 5EODA 2BMGB 1AB9B 1N6YA 2FOFA 1P9UA 3MH6A 1ABIH 3DFLA 4B71A 1A4WH 2ZQ1A 2ZU2A 5SGAE 3SQEE 1OWKA 2VB0A 3FVFB 1D6RA 2YNBA 1MD7A 1MCTA 1EAUA 1DFPA 3U8OH 2JKHA 1BTXA 1H9HE 2A2QH 4Q63A 1P12E 4M9FA 3SJOA 5A8XA 5DN6D 4GHQA 2WYGA 4FUHA 4OGYA 5JDUB 2KCYA 4DG4A 5E0GA 2QXJA 3A8DA 2XW9A 5ESTE 1THPB 3SGAE 2A7CA 1RTKA 2FTLE 2ANKH 3TNSA 1ZSKA 1F7ZA 4B6FA 3MI4A 1A7SA 4NIWA 3HKJB 3SV9A 1AWHB 2XNIA 3GCHB 4B1TA 1SGTA 2J2UA 3NK8A 4Z1MD 3NCLA 4THNH 3I29A 4Y0ZE 1ZOMA 2WPJS 3SUDA 1PQ8A 2BY8X 2WUBA 2IN2A 1O3HA 1O5BB 4X1PU 1MAYA 1G3BA 4NCYA 5C1UA 1AVXA 1GBEA 1PFXC 1QIXB 2XYAA 3OTJE 1TGTA 1A5IA 2ZGHA 2Z3DA 3GY2A 4K1EA 1QB1A 1EATA 2WINI 5HYOA 1O3AA 1DVAH 2WV9A 1YPGH 1IQEA 4U32A 2H2ZA 3HGNA 2TBSA 2PKSC 5LPRA 3PTNA 3PMBB 1EPTB 1O2LA 2FP7B 1Q31A 2P93A 3VXFH 1GMHG 4A5TS 3SNCA 1WCZA 1YYY1 1YPEH 1DUEA 4CHAB 3P6ZB 2A4QA 1WSSH 5BPEA 3LGUA 5JB8S 1O2HA 3KCGH 3TJNA 1P8VC 3K9XB 1IQLA 3P17H 1A61H 1O2TA 2H6MA 4Q7YA 2P3UB 3ZZ3A 4Y0YE 3PROA 2B8OH 1DOJA 2OBOA 1S6HA 3BTQE 3M35A 1F5LA 2VVVA 1K1IA 2D2DA 4Y8YA 2ZDMA 3RM0H 1IQGA 1HJ9A 3CNRA 1XXDA 3STJA 3VB5A 4DIHH 2BD5A 1ELBA 1NN6A 7ESTE 1PQAA 1UTPA 1P09A 1GBIA 2BVXH 2AGGX 3TJUA 1G2LA 2ULLA 1DXPA 1IQJA 4FU7A 6ESTA 1EZUC 1GJDB 2Y81A 3F2FA 4FVDA 2BY7X 3TGIE 1TPPA 1O3FA 4K69A 2KX4A 4VGCB 4Y8XA 2A2XH 2LNCA 2AS9A 1QQUA 1TNHA 1BMLA 3M7TA 1SMFE 3AVZA 3BIUH 4B75A 1TA2A 3VGCC 2HLDD 1MKWH 4BANB 1V2KT 3ZZ5A 1WBGB 2LPRA 1E36B 4O3UA 3OFND 1W0JD 3RXOA 1UTNA 1ZPCA 3EA9A 1O2IA 2XBXA 2GT8A 2L6OA 1P06A 3AAUA 4HFPB 2BTCE 1UVUH 3W95A 1DWEH 3TJOA 1LMWB 5FX6A 6GCHF 3RXQA 1A3BH 2ZG0H 1VGCC 4OS7A 1FLEE 2ZWLH 1SGQE 1FXYA 3TVJB 1O5GH 5C1YA 2FS9A 1DANH 4O3TA 4CRDA 2TGTA 2ZP0H 5B6OA 3UQOA 4I33A 1OWJA 4Y79A 1HAPH 1SVPA 2EY4C 1GDNA 1GBAA 2AGEX 2Y7ZA 1J14A 4FUFA 4J2YB 3VEQB 1O3KA 1TONA 1V2UT 4OS6A 4ZMAH 1TALA 3SHAH 1QJ1B 1XM1A 1RS0A 1EJNA 4DOQA 1BBRE 1P0SH 2IJOB 1NESE 4XDEA 5EGMA 4ZKOU 1ZHRA 3TJVA 2DE9A 4D9RA 1MTWA 1XXFA 1SGCA 1P03A 1VZQH 1COWD 3QTVH 3C27B 1T8MA 4X6MA 1E1RD 1V2WT 1AZ8A 3RXKA 2H5CA 3E91A 2ZFQH 1S5SA 3S7KB 1C5UA 3BV9B 1W11U 4HZHA 4X8UH 1W14U 2HALA 3IG6B 1CHOF 4FUEA 4A92A 4UONA 2OBQA 4U30A 3B8JA 3SNAA 3VFEA 1D6WA 1P2JA 2ZU1A 1C5QA 2ZU3A 2SGAA 3SU3A 2J98A 1SPJA 1UJ1A 1HAOH 4AG2A 2V6NA 7LPRA 2BY9X 4MNXA 3O8BA 3KQCA 5FPSA 1WTHD 1Z8JB 3F2GA 3KL6A 2FI4E 2PKAB 1EOJA 1K28D 4ABJA 1KXFA 4D7GA 4NIXA 3F3BA 4QT8C 2PWXA 5DK1A 1QRWA 1G3DA 1UHBB 1H8IH 1HAVB 2M5TA 1SGIB 4PROA 1Y8TA 2W6JD 4ISIH 2UUFB 1HBTH 1O2KA 3F9EA 5ABWA 1W10U 2ASUB 1NFXA 1OPHB 4GUXA 2ZU4A 1QL7A 4YXWD 3BN9A 3TGJE 3TITA 2AIQA 1NZQH 1VJ9U 3GCNA 2BQWB 2G4TA 1Z6EA 4H6SB 5DKMA 4TWYA 1Q2WA 4SGBE 1UTQA 1QJ6B 1FPHH 1FIWA 3PM3A 5KECA 3LONA 5AFYH 3BTHE 3M3SA 3M36A 1TBZH 2PTCE 3GCOA 1O2JA 1MZAA 4HI3A 1J8AA 1O2GH 1ZHPA 4NWLA 1FY8E 1TQ7B 2FOCA 3DSOA 4ZROA 3GY7A 5K0HA 2OC0A 1LO6A 1SOZA 3MWIU 4LK4A 1K1PA 3FOAA 1ELAA 3RU4E 2BVRH 3UFAA 1B7XB 3RXIA 5FPYA 5EQSA 1C1NA 5HIYA 5CMXH 2FM2A 9ESTA 4XRNA 5GCHG 3A89A 5JBBS 1T4UH 4DT4A 4AGJA 3GDUA 4AYVB 1JMOH 3A83A 4ZKSU 3ZIAD 4CH2B 3BG4B 1RFNA 1BDAA 4Y11E 3P95A 3RXPA 3E0NB 3D49H 1DWCH 1LVYA 1FAXA 2OC8A 5JB9S 3ATLA 4X8TH 2Y80A 2CV3A 5CHAB 2A4OA 2PGQB 2KAIA 3RXCA 4JZDH 2P3TB 1DSTA 1WDIA 5IYTA 1SBWA 2KM0A 2JH5D 1YP9A 2GV7A 3UNSA 4K8BA 3VB7A 1DXWA 2VBCA 2TRMA 1BJVA 3OAAD 1OP2A 3MU5A 2ZGJA 2GDDA 3ATMA 5A8ZA 1X7AC 3FAOA 1J17T 1OYQA 3T25A 1EAXA 5HXFA 4MNYA 4BTTB 8KME2 4GVUA 2FLRH 3SZNA 2SNWA 2NU0E 2BX4A 1C1UH 1XUIA 4X2YA 2P94A 1ELEE 4ACBA 3LOXA 4WMEA 1ID5H 3LGVA 2F9BH 3U9AH 3GDVA 1F0RA 2IOTA 5ESBA 3ITIA 4GSOA 4LZ1H 4RKOB 1YPHE 4Y7BA 1BTUA 1XKBC 3S69A 3A7XA 1JXPA 1JBUH 1WQSA 1OXGA 1Q3XA 2JETC 1G32B 2VIWA 2GCTC 2XBWA 1AKSA 2ANYA 3Q00A 4FUIA 1QQ4A 4I8HA 1EB2A 1GGDC 1ZJKA 4K5ZA 1GBFA 2Q6FA 4INLA 4UFDH 1TNJA 1L1NA 2EQNA 2GMTB 3EA8A 3LIWA 1W13U 1ZTKA 4MPWA 3SI3H 4RN6A 1SQRA 3MNBA 1J9CH 1TIOA 1K22H 3WWBA 3PB1E 1SR5C 3KGPA 3O8DA 4MPVA 3RXRA 1FAKH 3P70B 4WF8A 1GDQA 1VR1H 1DM4B 4DW2U 3PWBA 1F92A 2GGVB 1GI9B 4WH6A 1TNIA 4K8YA 3HK6B 3SUFA 2G55A 4Y76A 3VG8A 3W1EA 3MHWU 3N7DA 4IC6A 2Z9IA 1CGHA 1NROH 2ZDLA 2R3UA 2HNTE 4AZ2B 5GXPA 1GCTC 4B76A 3TLOA 1QL8A 2WHXA 1AIXH 2UUJB 3DSPA 1SC8U 3VB3A 3SJKA 3K2UA 4WJG2 2GP9B 4YT7H 1C9PA 1UCYE 1HB0B 2Z3EA 1HAYB 1E35B 3QTOH 2BM2A 1GBCA 1QBNA 1GBDA 4MDSA 3VGCB 4YESB 1C5OH 1O2UA 2SGDE 5FX5A 3SJIA 4E05H 3OE7D 3RXLA 1Z7KA 1YGCH 3PLKA 3R0FA 1V6DA 1CT2E 2ODYB 2QXHA 3PV2A 1GHAF 4NA8A 1T32A 5AF9H 4K3JA 1UK3A 3ZZ8A 2FOHA 2XC5A 3VXEH 3NKKA 3RXJA 1EAIA 1LHGH 3RUOA 3QN7A 4X0WU 2VIOA 1D3PB 4ABAA 4NGAH 1CBWC 3SU0A 4I7YH 1GVLA 2FODA 4JCNA 4CH8B 1SGFG 3M5MA 3ATKA 4GCHG 3HKIB 1YF4A 2M2AA 3RC4A 1O30A 1TPSA 3LGTA 2HGTH 2QY0B 5DSFA 5EJLA 1A0JA 1O2YA 1JOUB 1OX1A 2BOHB 4AFUA 1EXFA 2XWAA 2OQ5A 3ZYDA 1TX8A 1EQ9A 4A1TA 4MNVA 5EW2H 2F9UA 2JDID 3EE0B 3K6YA 1GCDA 3BTGE 3F68H 4F49A 3TK5A 2QF4A 1DDJA 1LPZB 1FDPA 2J38A 1C4V2 4WWYA 1C4U2 1TMTH 2W5EA 3DSGA 3UQVA 5F8ZA 1CHGA 4DIIH 3F6UH 1O31A 3ENSB 2KCOA 4FETA 3DCLA 3M5OA 2ZA5A 3TH2H 2DE8A 3V13A 2K8IA 3T5FH 3JZ1B 2HLCA 1Z1IA 3SV2H 3S9BA 3TGKE 1AO5A 2PV9B 1BJUA 3KNXA 5FCRA 5GDSH 1UW7A 3MO9A 1DX5M 1UTLM 1OWEA 1UVSH 1CGIE 1O5EH 2BDAA 3ZVGA 3U8RH 3P92A 5HGGA 3GY4A 3DFJA 4KELA 4MNWA 1GI5A 1BHXB 1SQAA 4IGDA 5C5OA 1TGCA 1YLCA 3RMOH 2GV6A 2RFKC 3KIDU 1CA0B 1EX3A 1G3CA 2VNTA 1AUTC 5CE1A 3SV6A 1AE8H 1H8DH 1W7XH 2YMSC 1LCYA 2FPZA 1W7GH 2FI5E 4RSPA 1RTFB 4AFZA 1DICA 1VCWA 1C1TA 4A7IB 2B0FA 3BTDE 8GCHG 3BG8A 3FANA 2FOBA 2H9TH 1C5YB 1O3OA 4Y71A 2ZDNA 3RXMA 2WUCA 1HAXB 2ZIQH 3GDSA 2BD4A 1C1WH 2RCEA 1QBOA 3DD2H 1MH0A 5EJZA 4FOUC 3EYDA 3KQEA 2BY6X 2OXSA 1OWIA 3RC6A 5EJ1A 1NRQH 1RTLA 3A8CA 4Y10E 3S9AA 5FBEA 3RXTA 5C0UA 1SQOA 2PUQH 3EAJA 2JIZD 1ZMJA 1UTOA 1HAHH 3EA7A 2PP6A 1O2PA 1DLEA 1BBRK 1C4Y2 1DT2A 2FYQA 3BSQA 2R0KA 2VWMA 2JH6D 1BT7A 1ZJDA 3QDZB 1IHTH 2RDLA 1W0KD 1SHYA 1C5TA 3GY6A 3RXFA 5PTPA 1V2PT 1K1OA 1UTKA 1GHWH 4CRAA 4YO9A 1TBQH 3BTTE 1OWHA 3RXDA 1H8HD 2G4UA 2FYRA 4AC9A 4ESTE 4NIYA 2Y82A 4IMQA 1K0HA 1P11E 3T26A 3AASA 3C1KA 2EA3A 2PHBA 2V0BA 4E7RG 1AI8H 1MTNB 2WPMS 1C2FA 3OYPA 2ZDAH 2PR3A 5L2YH 4WY3A 2QXIA 5EXNA 3ATWA 4AORA 3EDXB 1C2LA 4B2AA 1P57B 5ETXA 2BDBA 3ZVDA 1G9IE 2GCHF 1A1RA 2BDHA 4UFFH 4XOJA 5CHBA 4BXSA 2J94A 1A2CH 3OEHD 3Q76A 1V2ST 2A4GA 1BRAA 1RJXB 1L4ZA 4ABEA 2ZO3H 4ZUHA 2WPDD 1K1LA 5FPTA 1GMCF 2KCAA 3WY8A 1T7CA 1GJ7B 1DSUA 7KMEH 1F5KU 1W0YH 1GJ4H 5F8XA 4DVAU 1G36A 4BTUB 2BZAA 4IW4E 5DP6A 1O34A 1LKBA 2VINA 3MOCA 3U69H 1FMGA 3A81A 5E2OA 2PTNA 4JYVH 5LH8A 2A0QB 4FXGH 2AFQB 3LJJA 1U6QA 2W7UA 4I8GA 5EPYA 1QB9A 4OGXA 1O3GA 1EAWA 1NS3A 1DY9A 1C1PA 1C2KA 3MNSA 2CF8H 4LOYH 3V12A 3QO6A 1O3NA 4GLYA 5EW1H 2FMJA 1GHBG 3ZYEA 3PYHA 2QE7D 3UREA 4Y7AA 4ZHAA 2ZGCA 2NWNA 1MAXA 4WVPE 1FY3A 1EOLA 2THFB 3UTUH 2O8LA 5DP7A 3E90B 3RU4D 1VITF 3FZDA 1TLDA 1GJ5H 3SUGA 4FUBA 3A85A 1PYTC 1WQVH 1YKTA 2VIDA 3A88A 3BEIB 1HJAC 2ZNKH 1EKBB 1O2NA 4AX9H 3CS7A 1T31A 5EOKA 2G8TA 1F0UA 1BQYA 2AGIX 3EGKH 1HAGE 4I31A 4CR9A 1SI5H 3BTKE 3QUMP 3PO1C 1GCTB 3TK9A 2W26A 2GVFA 1O35A 3ODDA 1H4WA 1CT0E 1AE5A 1ELFA 3PMJA 2P16A 2OCVB 4NSYA 4P00A 5C0TA 2J97A 4IBLH 4KTCA 1VJAU 1THRH 7GCHG 4IN2A 3A7YA 2KFWA 3GCTF 2FO9A 4NSVA 1MD8A 4ZH8A 1FY5A 4ISNA 5FHTA 3A7VA 4AFSA 2ZQ2A 2P59A 4MLFB 4BTIB 1RD3B 1WV7H 2C8WB 3CENA 4WXVA 1UVOA 2R3YA 1EB1H 5C2ZA 1CE5A 1AN1E 4DT7B 1C2JA 1GI0A 1YM0A 1O5FH 1TRNA 1Z8GA 3I77A 3RM2H 3HATH 3SORA 2EC9H 2XBVA 2ZGXH 2WPLS 1CBWB 1FQ3A 2Z9GA 2C8XB 4MQAA 4NG9H 3M7UA 1GJ8B 2A31A 2C8ZB 3SU1A 4AN7A 1EASA 4A1VA 1V2RT 2BD7A 4XSKU 1O5DH 1HXEH 4MVNA 1C5MD 5FAHA 3SYJA 3RC5A 3MNCA 4JK5A 4O9VA 1NPMA 5TJXA 2G51A 1TPOA 1PPFE 1ZTJA 3SJ8A 3ZZ4A 4P02A 1AMHA 1BUIA 1O3CA 1J15A 4H4FA 1O32A 2SGFE 3RMLH 3ESTA 2BQ7B 1LHFH 5DP5A 1ELGA 1WU1A 3RXHA 1OP8A 1SFQB 3A82A 2NU4E 1UCYH 2A5KA 1GDUA 2LELA 1ZSLA 3S7HB 3TH4H 1A0LA 1KYNA 2VH6A 1BTHH 2GZ8A 3U1JB 2I6QA 2XCFA 1FIZA 3KQDA 1XKAC 3LPRA 2FOGA 1ZRBA 2BYAX 1ETRH 1GI1A 3MQKC 3UB0A 1V2QT 2PW8H 3ZV9A 5C94A 3A7WA 1KTTB 5A8YA 1ANEA 1NRRH 1IOEA 1NRSH 1TRYA 4YOGA 3M3VA 3SO3A 1IQNA 1C2GA 1OP0A 1KXBA 1THSH 1UCYK 1E34B 1O2SA 1SLVB 3MU4A 2Q6GA 1BMAA 1D3QB 2GD4B 2J5UA 5AFZH 3SBKA 1XUFA 1PPCE 1QNJA 1NT1A 3PV4A 3D62A 4B6EA 3SUEA 1O3JA 1BTYA 1SGEE 1WUNH 2VWLA 3LJOA 3S9CA 3RXSA 1C2MA 2BD9A 1ZZZA 3H7TA 1SGYE 1SLWB 1TMUH 2YMSB 2R2MB 1SKYE 5EQRA 2JJ2D 1AZZA 1GMHF 2DUCA 4F48B 4B74A 1GVZA 3RXGA 1C1SA 3SOSA 5HKKD 4TY6A 1W8BH 1Z1JA 1ELVA 3FP8E 4BAHB 3OU0A 1C5XB 1N8OC 1O33A 3H09A 2UWOA 3TH3H 1CO7E 5J4SA 2ZKSA 4TWWA 1GI8B 1GG6C 6CHAC 1ZR0A 1KDQA 1N6XA 3A80A 1DWBH 1EPTA 1TPAE 1UK4A 2I6SA 3ODFA 5T3HA 3URCA 4OS4A 2Y5HA 1HDTH 3GCHC 2XWBI 5FCKA 1D3DB 1WOFA 2SNVA 1C2IA 3KEEA 2F4LA 1BRCE 1DE7H 2CXVA 2ZCKP 3CS0A 3DT0H 4KTSA 1MTSA 3A84A 1GMDG 4RKJB 1V2VT 1HCGA 4B2BA 1A0HB 1HAIH 3RP2A 1LDTT 3SI4H 3EQ0H 4CREA 2ANWA 3LKWA 3DUXH 1C1MA 3H7OA 2FX6A 1BMFD 1WTGH 2XBYA 4WMDA 4AB9A 3IWMA 4TY7A 2WZQA 5A0AE 1JRTA 1TOCB 1QGFA 1YPHC 1TMBH 4WXIA 2FLBH 3QZQA 4ABHA 1EPTC 4YLQH 1GBKA 4ISHH 1QTFA 1ZRKA 2AMDA 2RA0A 1XUHA 1TABE 4X1QU 2R9PA 5AVDA 3RLYH 1O0DH 3BEUA 2A1DB 1MZDA 1ZMNA 3SN8A 4MTBA 1FZZA 1TQ0B 3B23B 2B9LA 5JBCS 3O8CA 2GZ7A 1FY1A 2PKSB 2CN0H 1L1GA 3FKSD 3AAVA 1ZGIA 1W3CA 4MPUA 1IQFA 2OINA 3QX5H 1AFQC 2W7SA 3VB6A 2IPQX 1A46H 3ZVCA 2GZ9A 1VITH 4DCDA 1ZSJA 3E1XB 1Y3VA 1UVTH 2ALVA 1MABB 1NC6A 3TU7H 3U28C 1E79D 2HVXA 4ABDA 1O2QA 1GL1A 2O8WA 3GYLB 3SNEA 4OM9A 2QIQA 4NA7A 4B73A 4CRCA 2VIPA 1IQHA 1AUJA 1ABJH 4K2YA 2HNTC 1BCUH 4ZXXH 1GI7B 4VGCC 3OEED 1NBME 2YOLA 4JZEH 1DUAA 4UDWH 1JIRA 3R3GB 1A5GH 3NUMA 4D9QA 1GBLA 2Y6TA 4JZIA 2TGDA 1A3EH 1GI3A 5KEDA 3FP7E 1GJ6A 2HRVA 2OUAA 4NFEA 3ZVFA 2QGRA 3V7TA 2G81E 3A86A 2C4FH 1NFYA 5DGJA 1GBMA 1B0FA 3MYWA 1GJ9B 4XBBA 3RMNH 2ZFFH 3M61U 1O3IA 2V7QD 3TIUA 2ZI2H 3VPKA 2QXGA 1YPKH 4A1XA 2B7DH 1O3LA 4FUDA 1Y5AT 1O39A 5C20A 1YPLH 3U98H 1FUJA 1O3DA 2UWLA 4KP0A 1YC0A 1QJ7B 1HJAB 3SHCH 1LVOA 3V0XA 1TX7A 2STBE 1UVPA 2L74A 3SU2A 4ABGA 1O2ZA 4NIVA 2XCNA 1NU9A 1B5GH 4TSFD 3PO1B 1TNGA 1G37A 3D65E 4AG1A 1OKXA 2F43B 1VGCB 2QF5A 3U8TH 2HPPH 3MTYA 2XNDD 1ELTA 1L0ZA 4BNRA 2PKAA 3SNBA 5A0BA 1LQDB 1MCVA 2UUYA 3PMAB 3PV5A 4F4OC 3BTEE 4A6LA 1QRXA 4WH8A 2Z7FE 1C2DA 2ZTXA 3SU5A 2PSXA 2HWLB 1LPGB 1UHBA 2P8OC 1EZSC 2ZCLP 1HAVA 3UY9A 1QCPA 2J9NA 4XE4A 2R2WU 3ELAH 2A45B 3MU8A 1XVOA 3F0PA 1QL9A 3LDXH 2GJGA 4CRFA 5H4IB 2ZDKA 1C9TA 1QFKH 1L4DA 1F5RA 4ACAA 4JZ1A 3S0NA 1T4VH 3SNDA 2C8YB 1QA7A 3ZZ6A 1P2NA 1GI4A 1AY6H 4X8VH 3SGQE 1QA0A 2NU3E 1CSOE 2EI7A 2VJ1A 4HG6A 1UO6A 3LH3A 5FL7D 1SGFA 1B0EA 1CGJE 1Y3UA 5L30H 1BRBE 5GCHF 3ZZ7A 2ESTE 4FU8A 1ZMLA 1S81A 1NM6A 5EQQA 1GBJA 2O8MA 3E0PB 3T27A 3F0OA 1CVWH 1XMNB 1E38B 4FU9A 1S0QA 2IPHA 1Y3XA 2FOAA 6GCHG 1YWUA 1TB6H 3SV8A 1AGJA 1ZHMA 5DPAA 3ZZCA 2AMQA 1BITA 4GAWA 1AU8A 2ODPA 1SHHB 2F9VA 3F9GA 2VWOA 4H6TA 1BTWA 1ELDE 1P01A 1HGTH 3BTWE 1S6LA 1ANBA 4I86A 2FI3E 3PTBA 3UOPA 1N1LA 2HNTF 2ZFRH 3L33A 4X2XA 1TAWA 5F03A 3NPSA 4ZHLU 2F9NA 2NU2E 3SGBE 1C5LH 3G01A 2JH0D 2OD3B 3MO3A 8LPRA 1CQQA 1O2RA 1AVWA 5EU8A 1HYLA 1GJBB 2BB4A 2OQUA 3U1IB 2EI8A 4U01A 3TNTA 4UD9H 2ZTZA 4ISLA 2OK5A 1ESAA 2PSYA 2J98B 1GBBA 1Z8RA 2QF0A 4LXBH 2IJD1 2VU8E 2CF9H 3F2HA 3P8OA 4YT6H 5GIBA 1BBRH 3NRLA 1GHZA 1UK2A 3PLBA 1XUJA 3ZZAA 5IK2D 2WPKS 1K9OE 1DPOA 1OYTH 3GICB 2FX4A 2OTVA 5T6FA 1FJSA 4RT1A 5F53A 1AHTH 1BMMH 8ESTE 1CHOG 4IC5A 1D9IA 1KLIH 3SZEA 1XUKA 5G4BA 4Q80A 1PQ7A 3A7TA 4OS5A 1DLKB 1HV7A 5T1VA 1O2XA 1O2WA 3P8FA 4X1NU 2F9OA 1AQ7A 3BG4C 4I8LA 3BEFB 4CBOA 3GISB 4CBNA 1BRUP 1P2IA 5T6DA 2ZFPH 2A32A 3A8AA 3OY6U 2BVSH 4B2CA 1HAZB 3T28A 4FUCA 1SGNE 1YCPK 1H9IE 1KIGH 5JPMH 1EP6A 3UWIA 1GJCB 1V2OT 1SGDE 1TNLA 5GPIB 2O8TA 3TPIZ 1PPGE 5CHAC 1FN6A 2XC0A 1DY8A 4R0IA 2ZHFH 2K1QA 4HTCH 2QAAA 1H8ED 1QY6A 1O36A 1V3XA 2BQ6B 1N8OB 3IITA 2OC1A 2ZPSA 2CJIA 4DGJA 2GT7A 3UPEA 4IS5A 1GG6B 6CHAB 2J4IA 5E0HA 1PJPA 3KF2A 5F8TA 1RIWC 2GKVE 1UTJA 2LP6A 3DA9B 1SB1H 1LHCH 1WAYB 4GHTA 1V2TT 1BTZA 2Y7XA 5CDFE 1C5RA 4WMFA 1DITH 3BTME 3LT3A 4IMZA 1Y5UT 5BRRE 1HXFH 1YLNA 2ZCHP 4R8TB 3P8NA 2GX4A 3UR6A 4LZ4B 1BMNH 1HFDA 2A5IA 1P04A 1YY3A 3OTPA 1BIOA 5C5NA 1YBWA 2YNAA 4X6OA 1V2JT 2RDEA 1NU7B 1QBVH 2VIVA 4NA9H 5KGOA 3OSYA 2ZF0H 1TNKA 2ZFTA 1SSXA 2TGPZ 3N7EA 1Z6JH 2D26C 4Q4LA 4AB8A 1KDQB 1G30B 2JJ1D 3WW7A 3V3MA 1FI8A 1ZPZA 4OS2A 2XRCA 2ALPA 2GMTC 3MFJA 1O3PB 2KAIB 3SV7A 5IDKA 1T8OA 4ZAEA 4DY7B 1Y3YA 3FP6E 3HK3B 1C5NH 5JBTA 2JETB 1P9SA 2GCTB 1Z8IB 1KXEA 1HNEE 4OS1A 1Y3WA 1GGDB 2J92A 3MH5A 1HIAA 3MO6A 3KHVA 1LHEH 1AD8H 4GCHF 4Q7ZA 1VCQA 4SGAE 3SQHE 2BZ6H 1RRKA 1UMAH 1AFQB 4BAOB 1ORFA 3FZZA 2CK3D 4XBDA 2CGAA 1SGPE 5J4QA 3RDZA 1ZGVA 2FIRH 2F3CE 2ZHWH 1CA8B 5C17A 5T6GA 1SOTA 3PWCA 5I25A 1EJMA 4NZQA 1GI6A 2ZPQA 3E16B 3M5LA 5DP9A 1G2MA 2QCYA 4YOIA 3QLPH 2Z94A 4KTUA 5JBAS 1YPMH 1O5CB 4JK6A 1IAUA 2G00A 4D8NA 1IQKA 2F91A 4MPXA 1BZXE 1MMJN 1TGSZ 2BY5X 1RXPA 2SGEE 3MNXA 1SGRE 1AKSB 1PPBH 1TFXA 1KXCA 4X2WA 3NZIA 1UTMA 1ELCA 1PPZA 2PGBB 1GJAB 2C93B 3LGYA 3RLWH 4H42U 1Z71A 1KLTA 1NY22 1MU6B 1NFUA 1P2OA 2H5DA 2Y5GA 3KYFA 4ABBA 4XFQA 1EZQA 2AYWA 1L2EA 4M7GA 4TPIZ 4Z6AH 1BOQA 2Q1JA 2W6ID 1K1MA 2NU1E 1W2KH 3Q3XA 2A7HA 1GVKB 4YLUA 1OSSA 2AH4X 2R0LA 1MKWK 1EZXC 5DG6A 2CHAC 2HVYB 3ZZBA 4K1SA 4D7FA 1NFWA 3GY5A 4AGKA 1MQ6A 2XC4A 1KLJH 3SU6A 3PMHB 3UOUA 1ZPBA 2GTBA 1ZTLA 2VWNA 1YLDA 5DP8A 2Y5FA 1A5HA 1KXDA 5JYIA 2BDYA 4Y6DA 2Z3CA 3UNRA 3WWFA 8GCHF 1LKAA 1T8LA 4BXWA 4GPGA 4AFQA 4BAMB 3A7ZA 2B5TB 3OY5U 1O3BA 2C3SA 5FXLA 5A0CA 2P8OB 3GYMA 1OS8A 3Q3KA 1D4PB 3BIVH 2V3OH 1ESTA 1E1QD 3E8LA 3FN8A 2O9QA 3B9FH 3ZVAA 1M9UA 2SFAA 4YM9A 2VH0A 3SJ9A 5K7RA 1H9LB 5GJ4B 1LVBA 1GI2A 2D8WA 4X6PA 3CP7A 1OHHD 5DJ7A 1GHXH 2W3IA 1F0TA 1GWAA 3Q77A 3ZVEA 6LPRA 5C67A 5DO4H 3UNQA 3GOVB 4X1RU 3F9HA 4E7NA 1EUFA 4UE7H 2FS8A 4INHA 5E0JA 2BD2A 2C90B 2PFEA 1BB0B 2VVUA 1S6FA 2WV5A 1NBMD 3KN2A 1MU8B 3L3TA 1K1JA 1QHRB 2TPIZ 4FVBA 1BTPA 1GHVH 1GHAG 1TWXB 2A7JA 2VVCA 3Q3YA 2PLXA 3RU4T 3NWUA 2A4RA 3FFGA 4Y8ZA 1ZYOA 1CA0C 1F0SA 3I78A 4INKA 1FPCH 1CU1A 1GBTA 1TYNA 3OX7U 4ASUD 1ESBA 2ZHDA 3URDA 2ZPRA 2ZHQH 1MTUA 2VGCC 1AVGH 2F83A 2SGPE 1C5ZB 4KKDA 2XTTB 4NWKA 4DJZB 4TT3D 3BTFE 1MTVA 1K1NA 1TX6A 5GWZA 3RXAA 4O97A 5EIYA 1C1QA 2WV4A 1EP5A 1L1JA 1AB9C 2ZEBA 1NRPH 4ZCNA 4XBCA 1O2MA 2WYJA 3T2NA 2BD8A 4X1SU 1SL3A 3PLPA 5C3NA 3T62A 2H9EH 3MU0A 4O03A 4U2WA 3L6PA 3PRBA 3RXEA 1ANCA 1S83A 1G3EA 2ZTYA 3K6ZA 1PPHE 4BAKB 1S84A 5L6NH 3TK6A 2Q6DA 4UFGH 2BHGA 1LHDH 1AWFH 2K0QA 2KR7A 5LPFA 1ZLRA 1J16A 1PQ5A 3UUZA 2KCPA 1QZ8A 2H9HA 3KQ5A 2F9PA 2SGQE 1HJ8A 4YTAA 2H1UA 3KYGA 2BDCA 3KQBA 1O5AB 4YOJA 2Z9JA 1XX9A 1GHBF 3H5CB 4ASHA 3VB4A 1C5VA 1W0ZU 2TGAA 5GNDA 5TCAA 4ZKRU 1MTNC 1KY9A 2ZGBH 3NXPA 3N99A 5L2ZH 2ZU5A 2UUKB 4NFFA 2TIOA 2ZC9H 4ISOA 5EXMA 1TOMH 4J1YA 1O3MA 4Q7XA 5C1XA 2OP9A 2BDGA 5EPNA 1ARCA 3UWJH 3ZZDA 1VCPA 1H1BA 2ANMH 1D3TB 1RIWB 1SG8B 1C5PA 1FN8A 4CRGA 1TA6A 5AHGH 3ZZ9A 3P8GA 4CHAC 3MH7A 2BLQA 1KXAA 3M3TA 4D76A 3STIA 3FO8D 1DWDH 1IHSH
chains in the Genus database with same CATH topology
2HPQH 1K21H 3W94A 1XUGA 2FOEA 2ZECA 4I32A 4IN1A 4JYTA 1IQMA 3BF6H 7GCHF 2AMPA 1MBMA 5A2MH 1MQ5A 2W3KA 2BOKA 4AOQA 1P02A 2O8UA 1P3EA 1BHXF 3MMGA 1NTPA 1LQEA 1V2NT 4X8SH 5E2PA 2G5VA 1V2MT 3LGIA 2AERH 4ABFA 1S82A 3HGPA 1C2HA 1FV9A 5DP3A 1GL0E 2FOMB 1NRNH 3MU1A 2D1JA 1OOKB 1O38A 4CRBA 1QB6A 2XXLA 3A87A 2Z9LA 3LGWA 1C5SA 3F1SB 3UIRA 1WYKA 4K60A 1GHYH 1LVMA 5LGOA 1FNIA 3UR9A 4YZUA 5E8EH 1LTOA 1SFIA 1XVMA 3M5NA 2QN5T 4KGAA 1JRSA 2QYIA 5HM2A 1HLTH 3DHKH 3SW2B 2P95A 2BLVA 3GY3A 3T29A 1ANDA 2V35A 3AW0A 2GCHG 2OC7A 1O2OA 1C1OA 1O2VA 1SLUB 1QRZA 2WPHS 2EI6A 1NO9H 4E06H 2ZDVH 4ABIA 3K65B 2ZHEH 1O37A 1SQTA 5LPEA 1W12U 1F2SE 1LPKB 1IQIA 1Y59T 1QURH 1C2EA 5A09A 3F9FA 2RG3A 1GMCG 4I8KA 1INCA 1P2KA 4JYUH 1HIAB 4BAQB 2UWPA 4JZFH 4I8JA 2STAE 1ETSH 1CT4E 5F6MA 1MUEB 3SU4A 4K1TA 1PPEE 3M37A 1P05A 1EJAA 1ETTH 1S85A 5TCCA 2ZZUH 1KSNA 2FDAA 1TBRH 1GPZA 1FONA 2CHAB 2FXRA 4NZLA 2QC2A 2Z6BD 2ODQA 1SLXB 1C5WB 2QV1A 1HUTH 3D23A 4MG3A 1TGNA 4ZHMU 2HOBA 1RGQA 5DP4A 3LH1A 3RXVA 1HRTH 1ARBA 2FTMA 3ZV8A 4AYYB 3LU9B 2BD3A 5FBIA 4DURA 2FWWA 1KTSB 1MBQA 1VITG 2RA3A 1V2LT 2BX3A 1E0FD 2BXTH 2FZZA 2V3HH 2WPIS 4BOHA 1P3CA 3QZRA 2QA9E 2ZFSA 2ILNA 1P2QA 2G5NA 2P3FH 1QR3E 3RXUA 5HMAA 2BLWA 5EXLA 3JZ2B 3GY8A 4Z0KA 3RXBA 2BXUH 3MH4A 2FEQH 1JIMA 2FESH 4FUGA 1ACBE 2BLOA 3N7OA 1K2I1 2J34A 4X2VA 1C1VH 3O8RA 2A5AA 2J95A 2OLGA 1C1RA 4Q2KA 1YPJH 1TE0A 1DS2E 4ZKNU 2EEKA 1P2MA 4HGCA 1MKXH 1GBHA 3GCTG 3E6PH 2CMYA 2QF3A 1T8NA 3RMMH 4TYDA 1GMDF 2G52A 3A8BA 3QK1A 3LC3A 4UEHH 4UFEH 3ATIA 2GDEH 3ZVBA 1TGBA 3AW1A 3HPTB 3QGNB 2BDIA 1BA8B 3QGJA 1TRMA 3LC5A 1JWTA 1AFEH 5HM9A 2AIPA 3M7QA 5EG4A 2Z9KA 1YCPH 1E37B 1MKXK 1PYTD 2PUXB 4CR5A 2AEIH 4X6NA 1S0RA 1HPGA 2VGCB 4FUJA 1P10A 1FY4A 1YCPM 5I46H 2VIQA 1Y5BT 4TPYA 1O3EA 9LPRA 4ZXYH 3QWCH 4JMYA 1OWDA 3E3TA 5EODA 2BMGB 1AB9B 1N6YA 2FOFA 1P9UA 3MH6A 1ABIH 3DFLA 4B71A 1A4WH 2ZQ1A 2ZU2A 5SGAE 3SQEE 1OWKA 2VB0A 3FVFB 1D6RA 2YNBA 1MD7A 1MCTA 1EAUA 1DFPA 3U8OH 2JKHA 1BTXA 1H9HE 2A2QH 1P12E 3SJOA 5A8XA 4GHQA 2WYGA 4FUHA 4OGYA 5JDUB 4DG4A 5E0GA 2QXJA 3A8DA 2XW9A 5ESTE 1THPB 3SGAE 2A7CA 1RTKA 2FTLE 2ANKH 3TNSA 1ZSKA 1F7ZA 3MI4A 1A7SA 4NIWA 3HKJB 3SV9A 1AWHB 2XNIA 3GCHB 4B1TA 1SGTA 2J2UA 3NK8A 3NCLA 4THNH 3I29A 4Y0ZE 1ZOMA 2WPJS 3SUDA 1PQ8A 2BY8X 2WUBA 2IN2A 1O3HA 1O5BB 4X1PU 1MAYA 1G3BA 4NCYA 5C1UA 1AVXA 1GBEA 1PFXC 1QIXB 2XYAA 3OTJE 1TGTA 1A5IA 2ZGHA 2Z3DA 3GY2A 4K1EA 1QB1A 1EATA 2WINI 5HYOA 1O3AA 1DVAH 1YPGH 1IQEA 4U32A 2H2ZA 3HGNA 2TBSA 2PKSC 5LPRA 3PTNA 3PMBB 1EPTB 1O2LA 2FP7B 1Q31A 2P93A 3VXFH 1GMHG 4A5TS 3SNCA 1WCZA 1YYY1 1YPEH 1DUEA 4CHAB 3P6ZB 2A4QA 1WSSH 5BPEA 3LGUA 5JB8S 1O2HA 3KCGH 3TJNA 1P8VC 3K9XB 1IQLA 3P17H 1A61H 1O2TA 2H6MA 4Q7YA 2P3UB 3ZZ3A 4Y0YE 3PROA 2B8OH 1DOJA 2OBOA 1S6HA 3BTQE 3M35A 1F5LA 2VVVA 1K1IA 2D2DA 4Y8YA 2ZDMA 3RM0H 1IQGA 1HJ9A 3STJA 1XXDA 3VB5A 4DIHH 2BD5A 1ELBA 1NN6A 7ESTE 1PQAA 1UTPA 1P09A 1GBIA 2BVXH 2AGGX 3TJUA 1G2LA 2ULLA 1DXPA 1IQJA 4FU7A 6ESTA 1EZUC 1GJDB 2Y81A 4FVDA 2BY7X 3TGIE 1TPPA 1O3FA 4K69A 4Y8XA 4VGCB 2A2XH 2LNCA 2AS9A 1QQUA 1TNHA 1BMLA 3M7TA 1SMFE 3AVZA 3BIUH 4B75A 1TA2A 3VGCC 1MKWH 4BANB 1V2KT 3ZZ5A 1WBGB 2LPRA 1E36B 4O3UA 3RXOA 1UTNA 1ZPCA 3EA9A 1O2IA 2XBXA 2GT8A 1P06A 3AAUA 4HFPB 2BTCE 1UVUH 3W95A 1DWEH 3TJOA 1LMWB 5FX6A 6GCHF 3RXQA 1A3BH 2ZG0H 1VGCC 4OS7A 1FLEE 2ZWLH 1SGQE 1FXYA 3TVJB 1O5GH 5C1YA 2FS9A 1DANH 4O3TA 4CRDA 2TGTA 2ZP0H 5B6OA 3UQOA 4I33A 1OWJA 4Y79A 1HAPH 1SVPA 1GDNA 1GBAA 2AGEX 2Y7ZA 1J14A 4FUFA 4J2YB 3VEQB 1O3KA 1TONA 1V2UT 4OS6A 4ZMAH 1TALA 3SHAH 1QJ1B 1XM1A 1RS0A 1EJNA 4DOQA 1BBRE 1P0SH 2IJOB 1NESE 4XDEA 5EGMA 4ZKOU 1ZHRA 3TJVA 2DE9A 4D9RA 1MTWA 1XXFA 1SGCA 1P03A 1VZQH 3QTVH 3C27B 1T8MA 4X6MA 1V2WT 1AZ8A 3RXKA 2H5CA 3E91A 2ZFQH 1S5SA 3S7KB 1C5UA 3BV9B 1W11U 4HZHA 4X8UH 1W14U 2HALA 3IG6B 1CHOF 4FUEA 4A92A 4UONA 2OBQA 4U30A 3B8JA 3SNAA 3VFEA 1D6WA 1P2JA 2ZU1A 1C5QA 2ZU3A 2SGAA 3SU3A 1SPJA 1UJ1A 1HAOH 4AG2A 2V6NA 7LPRA 2BY9X 4MNXA 3O8BA 3KQCA 5FPSA 1WTHD 1Z8JB 3KL6A 2FI4E 2PKAB 1EOJA 1K28D 4ABJA 1KXFA 4D7GA 4NIXA 4QT8C 2PWXA 5DK1A 1QRWA 1G3DA 1UHBB 1H8IH 1HAVB 2M5TA 1SGIB 4PROA 1Y8TA 4ISIH 2UUFB 1HBTH 1O2KA 3F9EA 5ABWA 1W10U 2ASUB 1NFXA 1OPHB 4GUXA 2ZU4A 1QL7A 3BN9A 3TGJE 3TITA 2AIQA 1NZQH 1VJ9U 3GCNA 2BQWB 2G4TA 1Z6EA 4H6SB 5DKMA 4TWYA 1Q2WA 4SGBE 1UTQA 1QJ6B 1FPHH 1FIWA 3PM3A 3LONA 5AFYH 3BTHE 3M3SA 3M36A 1TBZH 2PTCE 3GCOA 1O2JA 1MZAA 4HI3A 1J8AA 1O2GH 1ZHPA 4NWLA 1FY8E 1TQ7B 2FOCA 4ZROA 3GY7A 5K0HA 2OC0A 1LO6A 1SOZA 3MWIU 4LK4A 1K1PA 1ELAA 3RU4E 2BVRH 3UFAA 1B7XB 3RXIA 5FPYA 5EQSA 1C1NA 5CMXH 9ESTA 2FM2A 5GCHG 3A89A 5JBBS 1T4UH 4AGJA 3GDUA 4AYVB 1JMOH 3A83A 4ZKSU 4CH2B 3BG4B 1RFNA 1BDAA 4Y11E 3P95A 3RXPA 3E0NB 3D49H 1DWCH 1LVYA 1FAXA 2OC8A 5JB9S 3ATLA 4X8TH 2Y80A 2CV3A 5CHAB 2A4OA 2PGQB 2KAIA 3RXCA 4JZDH 2P3TB 1DSTA 5IYTA 1SBWA 2JH5D 1YP9A 2GV7A 3UNSA 4K8BA 3VB7A 1DXWA 2TRMA 1BJVA 1OP2A 3MU5A 2ZGJA 2GDDA 3ATMA 5A8ZA 1X7AC 3FAOA 1J17T 1OYQA 3T25A 1EAXA 5HXFA 4MNYA 4BTTB 8KME2 4GVUA 2FLRH 3SZNA 2SNWA 2NU0E 2BX4A 1C1UH 1XUIA 4X2YA 2P94A 1ELEE 3LOXA 4WMEA 1ID5H 3LGVA 2F9BH 3U9AH 3GDVA 1F0RA 2IOTA 5ESBA 3ITIA 4GSOA 4LZ1H 4RKOB 1YPHE 4Y7BA 1BTUA 1XKBC 3S69A 3A7XA 1JXPA 1JBUH 1WQSA 1OXGA 1Q3XA 2JETC 1G32B 2VIWA 2GCTC 2XBWA 1AKSA 2ANYA 3Q00A 4FUIA 1QQ4A 4I8HA 1EB2A 1GGDC 1ZJKA 4K5ZA 1GBFA 2Q6FA 4INLA 4UFDH 1TNJA 1L1NA 2GMTB 3EA8A 3LIWA 1W13U 1ZTKA 4MPWA 3SI3H 4RN6A 3MNBA 1J9CH 1TIOA 1K22H 3PB1E 1SR5C 3KGPA 3O8DA 4MPVA 3RXRA 1FAKH 3P70B 4WF8A 1GDQA 1VR1H 1DM4B 4DW2U 3PWBA 1F92A 2GGVB 1GI9B 4WH6A 1TNIA 4K8YA 3HK6B 3SUFA 2G55A 4Y76A 3MHWU 4IC6A 2Z9IA 1CGHA 1NROH 2ZDLA 2R3UA 2HNTE 4AZ2B 5GXPA 1GCTC 4B76A 3TLOA 1QL8A 1AIXH 2UUJB 1SC8U 3VB3A 3SJKA 3K2UA 4WJG2 2GP9B 4YT7H 1C9PA 1UCYE 1HB0B 2Z3EA 1HAYB 1E35B 3QTOH 2BM2A 1GBCA 1QBNA 1GBDA 4MDSA 3VGCB 4YESB 1C5OH 1O2UA 2SGDE 5FX5A 3SJIA 4E05H 3RXLA 1Z7KA 1YGCH 3PLKA 3R0FA 1V6DA 1CT2E 2ODYB 2QXHA 1GHAF 4NA8A 1T32A 5AF9H 4K3JA 1UK3A 3ZZ8A 2FOHA 2XC5A 3VXEH 3NKKA 3RXJA 1EAIA 1LHGH 3RUOA 3QN7A 4X0WU 2VIOA 1D3PB 4ABAA 4NGAH 1CBWC 3SU0A 4I7YH 1GVLA 2FODA 4JCNA 4CH8B 1SGFG 3M5MA 3ATKA 4GCHG 3HKIB 1YF4A 3RC4A 1O30A 1TPSA 3LGTA 2HGTH 2QY0B 1A0JA 1O2YA 1JOUB 1OX1A 2BOHB 4AFUA 1EXFA 2XWAA 2OQ5A 3ZYDA 1TX8A 1EQ9A 4A1TA 4MNVA 5EW2H 2F9UA 3EE0B 3K6YA 1GCDA 3BTGE 3F68H 4F49A 3TK5A 1DDJA 1LPZB 1FDPA 2J38A 1C4V2 4WWYA 1C4U2 1TMTH 2W5EA 3UQVA 5F8ZA 1CHGA 4DIIH 3F6UH 1O31A 3ENSB 3M5OA 2ZA5A 3TH2H 2DE8A 3V13A 3T5FH 3JZ1B 2HLCA 1Z1IA 3SV2H 3S9BA 3TGKE 1AO5A 2PV9B 1BJUA 3KNXA 5FCRA 5GDSH 3MO9A 1DX5M 1UTLM 1OWEA 1UVSH 1CGIE 1O5EH 2BDAA 3ZVGA 3U8RH 3P92A 5HGGA 3GY4A 3DFJA 4KELA 4MNWA 1GI5A 1BHXB 1SQAA 4IGDA 5C5OA 1TGCA 1YLCA 3RMOH 2GV6A 3KIDU 1CA0B 1EX3A 1G3CA 2VNTA 1AUTC 5CE1A 3SV6A 1AE8H 1H8DH 1W7XH 1LCYA 2FPZA 1W7GH 2FI5E 4RSPA 1RTFB 4AFZA 1DICA 1VCWA 1C1TA 4A7IB 2B0FA 3BTDE 8GCHG 3BG8A 3FANA 2FOBA 2H9TH 1C5YB 1O3OA 4Y71A 2ZDNA 3RXMA 2WUCA 1HAXB 2ZIQH 3GDSA 2BD4A 1C1WH 2RCEA 1QBOA 3DD2H 1MH0A 3EYDA 3KQEA 2BY6X 2OXSA 1OWIA 3RC6A 1NRQH 1RTLA 3A8CA 4Y10E 3S9AA 5FBEA 3RXTA 1SQOA 2PUQH 3EAJA 1ZMJA 1UTOA 1HAHH 3EA7A 1O2PA 1DLEA 1BBRK 1C4Y2 1DT2A 2FYQA 3BSQA 2R0KA 2VWMA 2JH6D 1BT7A 1ZJDA 3QDZB 1IHTH 2RDLA 1SHYA 1C5TA 3GY6A 3RXFA 5PTPA 1V2PT 1K1OA 1UTKA 1GHWH 4CRAA 4YO9A 1TBQH 3BTTE 1OWHA 3RXDA 2G4UA 2FYRA 4ESTE 4NIYA 2Y82A 4IMQA 1P11E 3T26A 3AASA 3C1KA 2EA3A 2PHBA 2V0BA 4E7RG 1AI8H 1MTNB 2WPMS 1C2FA 3OYPA 2ZDAH 2PR3A 5L2YH 4WY3A 2QXIA 5EXNA 3ATWA 4AORA 3EDXB 1C2LA 4B2AA 1P57B 5ETXA 2BDBA 3ZVDA 1G9IE 2GCHF 1A1RA 2BDHA 4UFFH 4XOJA 4BXSA 2J94A 1A2CH 3Q76A 1V2ST 2A4GA 1BRAA 1RJXB 1L4ZA 4ABEA 2ZO3H 4ZUHA 1K1LA 5FPTA 1GMCF 3WY8A 1T7CA 1GJ7B 1DSUA 7KMEH 1F5KU 1W0YH 1GJ4H 5F8XA 4DVAU 1G36A 4BTUB 2BZAA 4IW4E 5DP6A 1O34A 1LKBA 2VINA 3MOCA 3U69H 1FMGA 3A81A 5E2OA 2PTNA 4JYVH 5LH8A 2A0QB 4FXGH 2AFQB 3LJJA 1U6QA 2W7UA 4I8GA 5EPYA 1QB9A 4OGXA 1O3GA 1EAWA 1NS3A 1DY9A 1C1PA 1C2KA 3MNSA 2CF8H 4LOYH 3V12A 3QO6A 1O3NA 4GLYA 5EW1H 2FMJA 1GHBG 3ZYEA 3PYHA 3UREA