2QA9E

Crystal structure of the second tetrahedral intermediates of sgpb at ph 4.2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin-B
publication title 1.2A-resolution crystal structures reveal the second tetrahedral intermediates of streptogrisin B (SGPB).
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qa9E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qa9E01
1UTQA 2BD3A 3SJ8A 1PPGE 1AFQB 2UWLA 3P92A 4AYYB 2OC7A 4YM9A 5AVDA 3PB1E 1FQ3A 1O33A 3E0PB 2XCNA 4CREA 4GAWA 2Z3CA 1PQ8A 5BPEA 2ZO3H 3SGAE 4ASHA 5FCKA 2WV5A 1O32A 3UNQA 2FESH 2BX4A 1O37A 1X7AC 2CMYA 3ATIA 1GHWH 3U8RH 1FUJA 4NA8A 4E7NA 2HVXA 1JIMA 1TGBA 1DWDH 3KQCA 3F9GA 1EB1H 1F5RA 1PPBH 1ZTJA 2ZHFH 4AG2A 1F7ZA 3LGTA 1EP6A 3D62A 2FOHA 1P3EA 1FY4A 1WYKA 2QAAA 3LJJA 4X0WU 3SBKA 4Y0ZE 4MDSA 4OS4A 3F9FA 4Y0YE 2Y81A 3B23B 4U2WA 1AFQC 4MNVA 3A7TA 1W14U 2AMQA 5FHTA 2JH5D 6GCHG 1SSXA 4ZKSU 1A61H 2CF8H 2Q1JA 3RXBA 1JWTA 3A80A 1XKBC 2FPZA 1UVPA 2BQWB 3QO6A 1FAXA 2I6SA 1FZZA 3NKKA 5C1XA 3SJKA 1Q3XA 5DJ7A 4DG4A 1MMJN 2STAE 1EAXA 1T32A 3TNSA 1UCYK 2NU1E 2WPJS 3ZVCA 1A5IA 1H9HE 4MNXA 2GD4B 3BEIB 1SQOA 2Q6GA 1MD8A 1FNIA 3H7TA 3K9XB 5DP3A 4BTIB 1FY1A 1P03A 1Z7KA 5HXFA 4BAOB 1HPGA 1N6XA 1C5QA 2HRVA 5ESBA 3SHAH 4RKJB 4H4FA 4ZHAA 4Z6AH 2XC4A 3SV2H 1H9IE 2A4GA 3GDVA 5GDSH 1DICA 2F83A 1TBZH 1IQLA 2HNTF 2WPLS 5K0HA 1O2NA 4TWWA 4YLQH 2BVSH 1GHAF 4A5TS 2FOFA 1LMWB 5DP8A 5C3NA 4DGJA 1AY6H 1U6QA 4X2WA 4ABBA 1O30A 3IWMA 1OWDA 3GCTF 3T2NA 1TA2A 3A8BA 1J9CH 1ELCA 3GY5A 4ABFA 1T8OA 2G52A 3A8AA 3SU0A 5HM9A 4X1PU 3A83A 3FVFB 2JKHA 3BV9B 2IPHA 1QBNA 3T62A 4KTSA 4K2YA 2V6NA 3SNCA 4JZ1A 3GCHB 1T8MA 1H9LB 2PFEA 4TPIZ 4X6MA 4CRCA 1BTHH 4NIXA 1RIWB 3O8BA 4X1NU 2FO9A 1O2UA 1HDTH 5GWZA 3K6YA 1K1MA 1F0TA 1KIGH 4IN2A 4OS1A 1O5AB 4TY6A 4B2CA 3Q76A 2BDAA 1HIAA 3BTHE 1OP8A 5EODA 3O8RA 1P02A 2FOAA 3M35A 1ANCA 3NUMA 4JZEH 1SL3A 1YPLH 2GCTB 4B1TA 3Q77A 2PSYA 5EQQA 4X1RU 3GYMA 3GDUA 4FXGH 4O97A 4YOGA 5FCRA 3HKJB 2EI6A 4KP0A 1UTNA 1UMAH 4OS7A 1Y5AT 4FUBA 4CRGA 1C4U2 3V13A 3EE0B 3GCHC 1O2VA 3RU4T 3GY8A 3F1SB 1RIWC 1NO9H 4ZKRU 1L1NA 5TJXA 4BAHB 4ABHA 3BG8A 4AB8A 1V2LT 4BOHA 2VVVA 2C90B 4GUXA 1C1SA 3UWIA 3UNRA 1E38B 2W3IA 4UFDH 1D3QB 4LXBH 5DGJA 1QURH 2ZDAH 1TPPA 1C5UA 1IQNA 3JZ1B 3RXGA 1BCUH 1A0LA 2KAIB 1AHTH 1EPTA 2CN0H 3L3TA 4AFSA 1HAOH 2GCTC 5BRRE 4CRBA 3MHWU 1XUFA 1IAUA 1NROH 1GDUA 3MTYA 1WBGB 1NY22 2GZ8A 1LVYA 2VVCA 1V2PT 1D3TB 4DY7B 4YZUA 1EATA 3RC5A 1Q31A 1G3EA 2QCYA 1ABIH 3TH3H 4X8TH 1C5MD 1OWIA 2VNTA 4AG1A 4B2BA 2BD7A 1QBVH 4ZXXH 1G3CA 2GT7A 3RXEA 3ZZAA 1JOUB 1FXYA 1GBTA 3ZZ4A 1V2MT 1NC6A 1TYNA 2BXTH 1AMHA 1TX6A 3MO9A 1SVPA 3A7VA 5GPIB 2GDDA 2Y80A 2FDAA 2A31A 1GJAB 1QRWA 1SLWB 2A4RA 3U1IB 2NU4E 1FY3A 5J4QA 1MZDA 2BLVA 1Y3YA 1TGCA 1LDTT 3P17H 2ANWA 3HK6B 1ABJH 1LVOA 3V12A 2NU3E 1GMHF 5EW1H 3RXHA 1ZR0A 4DT7B 1QB9A 3NCLA 1GI8B 2BD9A 2FOBA 4ZUHA 1UTJA 4KTCA 1E36B 1K1JA 1G36A 1ZMLA 1Y8TA 2Y6TA 1EJMA 2OC8A 4FUIA 2F9VA 2ZQ1A 2XBWA 2FYRA 1ZYOA 2Q6DA 2BXUH 5ESTE 2BHGA 2XWAA 1MKWK 1ID5H 6CHAB 4YT7H 2OXSA 1QRXA 1V2ST 1UK3A 1B7XB 1GJ8B 2GP9B 3ZYEA 4CRAA 1UJ1A 3MH4A 4NFFA 4FVDA 3T25A 3ATKA 1G2MA 4NWKA 1NFUA 2BY8X 4I32A 3RXKA 1CU1A 1PYTD 2ZU2A 2UUYA 1GHAG 2ZPQA 4B2AA 1ZSLA 3M5OA 1O2YA 2BD5A 3OYPA 1B0EA 1T4UH 1O36A 1L1JA 3MU0A 4A6LA 5FAHA 3ZYDA 1MU8B 1SR5C 1T8LA 4MLFB 3SU2A 1Z1IA 1HNEE 1E34B 1OWEA 4O9VA 5FBIA 1A4WH 3UTUH 6CHAC 3BN9A 2OCVB 5L30H 3TJNA 3SV6A 2FP7B 3RXOA 4ABIA 1SGRE 3N7OA 2TRMA 4HTCH 2GKVE 1IQFA 3RUOA 2WPMS 3LT3A 1GBIA 1LKBA 4Y11E 3E6PH 1P04A 1B5GH 1O5GH 2BQ6B 1HAZB 2TBSA 4D9RA 1LHEH 1P2QA 1M9UA 1BMAA 1YPJH 3MU5A 3ZZ7A 2BDBA 4AFUA 1XM1A 1KXFA 2ANYA 2ZDNA 5E0JA 1MQ6A 3FZDA 1K9OE 3PO1B 3UOPA 4ABEA 4CRFA 4X2VA 3U8TH 1E35B 1EZUC 3M3VA 7GCHF 1SQAA 2ZTYA 4GHTA 8GCHF 1KLTA 1OX1A 1GI3A 1YPHE 1L4DA 3VEQB 2J94A 2I6QA 1EAWA 1IQGA 3O8CA 2H6MA 3FFGA 3D49H 1RS0A 2R9PA 2FXRA 1GJ9B 1NFYA 1VITF 2C8YB 3RM2H 1OKXA 1TGNA 1C4V2 1GVKB 1Z1JA 3TVJB 2ZPSA 3DHKH 1UO6A 3RLYH 2XBVA 3STJA 4B74A 4K5ZA 2ZDVH 3F6UH 1C5PA 1YF4A 3QN7A 1PYTC 2WINI 2KAIA 1O3AA 1HAGE 2ZDLA 1OWHA 2HNTC 4NG9H 1XXDA 4Q7ZA 4Q80A 2BVRH 1NU9A 4Z0KA 2FS9A 1ELEE 1QA7A 3PO1C 1V2OT 2FLBH 2BOKA 2C8WB 2FOMB 1O3FA 2QXGA 1HFDA 1SLUB 1PPHE 3BSQA 2GTBA 4A92A 1E0FD 3PV4A 1C1MA 1GBCA 1AD8H 1D9IA 2PHBA 4X2XA 4Y6DA 4ZAEA 2P3UB 3UR6A 1IQJA 2XC5A 1LVBA 1V2QT 2ZFQH 1O2WA 1K1OA 1V2RT 1ZJDA 1GHYH 2BQ7B 1XVMA 3A85A 2ZDMA 5EPNA 2ZFSA 3SU1A 1H4WA 4D9QA 3K6ZA 1BZXE 5C1YA 3TH4H 5K7RA 2VINA 2R3YA 1YM0A 3LU9B 2H5DA 3G01A 2BDYA 3TJUA 1RTLA 3UUZA 2F91A 3MO6A 3EQ0H 1DANH 1FPHH 1O2GH 2OINA 2TGDA 1UTKA 1C2DA 2GX4A 1KLJH 3RC4A 2C8XB 1AE8H 3ZZ6A 4AGKA 5A8ZA 1ELFA 3QK1A 1GBHA 1GMHG 1SB1H 1P01A 1CGHA 1YKTA 4CH2B 2J95A 2PTNA 2GZ7A 1DWBH 1MCTA 2Z9GA 1GI1A 2GZ9A 5H4IB 2Z3EA 3A82A 4IMQA 1V3XA 1O3LA 4B71A 8LPRA 2A7CA 4I31A 1PPCE 3GCOA 2BZ6H 3A88A 2FOCA 2VIOA 2H1UA 2DUCA 4WJG2 1EZQA 3DT0H 2J34A 1C2KA 1A0HB 2A32A 3CP7A 1OSSA 2FOGA 2H9EH 4WMEA 2ZC9H 2D1JA 4X2YA 3AW1A 4B75A 4MVNA 5C67A 5A0CA 1XMNB 3GICB 4OS2A 1B0FA 1NESE 5JBBS 2QC2A 4JMYA 1DLEA 1TRNA 2AS9A 2PGBB 4GHQA 3F9HA 1CVWH 3M5NA 1L0ZA 1G37A 1LHFH 2VWOA 4GPGA 1DVAH 1BJUA 2PV9B 5JDUB 1WUNH 2BOHB 1LPKB 4WWYA 1S85A 4MPVA 2TGAA 4YO9A 4THNH 2F9OA 2ZGCA 1GJ6A 1JXPA 4ISIH 5FPSA 3SUDA 5G4BA 1BRUP 2VVUA 2ILNA 2RG3A 2ZKSA 3M3TA 1W3CA 4IS5A 4X1QU 4CR9A 2SGFE 1C5ZB 1EAIA 1NZQH 1Z71A 3AVZA 1P2IA 2Z9LA 1JRSA 3AASA 2BDIA 5LGOA 4LZ4B 3EA7A 1NRRH 4A7IB 1C2FA 2SGAA 3ZVAA 2ZF0H 4NSVA 2IJOB 1GCTB 2AGIX 7GCHG 3BIUH 2ANMH 4ZMAH 1O2RA 3LIWA 1Y3UA 2PR3A 1GWAA 5EXNA 8GCHG 1Z8GA 1P3CA 1O2SA 1O5EH 3SQEE 1GJ7B 4CRDA 5GXPA 3SV9A 3PWCA 4IC5A 3SHCH 2O8MA 1GBLA 2PUQH 2AYWA 5FPTA 1C2GA 1VITG 4INLA 5GCHF 1YCPM 5EQRA 5IYTA 1SGFG 1AKSB 1ZHRA 1V2UT 1AUTC 1SGYE 1VZQH 4X8SH 1FAKH 3U1JB 4OGYA 2A7JA 2F9UA 3RMNH 2WPHS 5JBCS 3QDZB 3BTFE 1ESAA 2OLGA 2Z9JA 3TLOA 5JBTA 4ZROA 1P9UA 2XW9A 1GJBB 1T4VH 1O2IA 5CE1A 4NSYA 1GCTC 1JIRA 2DE9A 4FUGA 1CSOE 2FI5E 1W0ZU 2PWXA 4NZQA 3FZZA 2PW8H 1UTOA 4ABAA 1KYNA 3LGVA 3SV8A 1WU1A 4BNRA 1TNKA 1EZXC 3EDXB 1E37B 3OU0A 3TGJE 2BDCA 3SUEA 2R3UA 1VITH 4MG3A 1BUIA 1Y3WA 1N1LA 4DCDA 1S0RA 2ODPA 1TQ7B 4U32A 5TCAA 1BTXA 1O2ZA 4O3TA 2FIRH 1Y5BT 1KXEA 1Q2WA 2EI7A 2ALPA 3SUFA 1HJAB 5C1UA 4MPXA 2QF3A 1TB6H 1QL8A 3GY4A 1D4PB 2ANKH 3RXFA 1EB2A 1GJ4H 1BA8B 2WYJA 2G81E 3I77A 1HGTH 2ODYB 1D3DB 1GVLA 3B9FH 3K2UA 6LPRA 1BIOA 1PQAA 4K8BA 1EAUA 2EI8A 1S82A 2YNBA 1YLDA 4I8LA 1FPCH 2EEKA 2AGEX 1C5OH 1W2KH 2BDHA 4A1TA 1MTSA 1V2JT 3ZZ3A 4AX9H 1TAWA 2OBQA 1UCYH 4XE4A 3SU3A 1KDQB 3KF2A 1QNJA 2Z94A 3SW2B 1GBDA 1BRAA 1SGCA 4IMZA 3RM0H 2PKSB 1P2KA 1HJAC 1TPAE 1YLCA 5F03A 3LC3A 1K21H 3A7XA 3LH3A 2O8TA 1C2EA 2BMGB 1HYLA 3HGPA 2FTMA 2QA9E 1ZPBA 4X6OA 3RXDA 3RXQA 3SO3A 1YCPH 1W8BH 3FP7E 1GI9B 2SGDE 3ODDA 1O2KA 1DDJA 3RU4D 2TGTA 4BAKB 1IHSH 1WOFA 2UUJB 1BOQA 1VR1H 5EXLA 1FJSA 3OY5U 3AAUA 1OS8A 1CT2E 1Z6EA 1O3IA 3MH7A 1O2TA 1TNLA 1TBRH 3P8GA 2O8UA 2ZGBH 2ZU3A 1AUJA 2A7HA 2B7DH 2G8TA 1XUJA 3ODFA 1K28D 1DWEH 1O3JA 1ZPZA 2PKSC 3A81A 1MUEB 1MTNB 1H8DH 4TWYA 2R0KA 1GBEA 5FX5A 4ESTE 4CBNA 1NM6A 3TNTA 1SHYA 4WH8A 1SI5H 3E0NB 4H6SB 2BM2A 1TPSA 2VWLA 5C20A 2ZP0H 2Y82A 1ARBA 2OP9A 4BTUB 1TALA 3MMGA 3RP2A 4GVUA 5DP4A 3SZNA 3KIDU 2ZG0H 3RMMH 4ZXYH 3ZVGA 2UWOA 1GCDA 2NWNA 2VIWA 4ZKOU 1NRPH 3LGUA 5AHGH 4ABJA 1C1RA 2OTVA 1TMBH 1TOCB 2XYAA 3SORA 3KL6A 4J1YA 2P95A 5EXMA 4ABDA 1YBWA 3MNBA 4AB9A 1MTNC 3IITA 4WH6A 1FY8E 2CHAB 4YOJA 3MU4A 4F49A 2ZZUH 2UUFB 4NWLA 2CGAA 1KXBA 2XWBI 5GCHG 1XKAC 1GBBA 2G00A 2ZHEH 1TE0A 3LOXA 4DVAU 5DP5A 3AAVA 3HATH 1WQSA 1Z8RA 2ZFRH 1P57B 2AMPA 2XCFA 1KY9A 5J4SA 1BHXF 1SGEE 3L33A 2CF9H 3RLWH 8ESTE 1P11E 1GBMA 2RDLA 3PLKA 3SNEA 5FXLA 3UQOA 2P8OB 1WCZA 2W3KA 1DSUA 1C2LA 1GI2A 2XXLA 2A4QA 3E1XB 1ZPCA 1AB9B 5AFZH 1Z8JB 4FUEA 1SGFA 1QIXB 2CHAC 3ENSB 3RXPA 4FU8A 5HYOA 1QJ1B 5JBAS 4I33A 1ESBA 5A8XA 3AW0A 2HGTH 2J9NA 1BDAA 5JB9S 1GG6B 2G4UA 3SU6A 3SN8A 4UFGH 3M36A 1ELBA 2C93B 3SU5A 1LHDH 2AIPA 2O8WA 5DKMA 1RRKA 4H42U 3R3GB 3OY6U 1DPOA 4FUJA 4UD9H 3MNSA 3LKWA 2YOLA 2A2QH 3E8LA 4I8KA 4FUHA 1QJ7B 1BBRH 1GL0E 1ZRKA 3VB3A 1O0DH 5JB8S 1G30B 1ANBA 1QL7A 1WTGH 5LPFA 3VXEH 3KQBA 1C5RA 2W26A 2OD3B 2ZGHA 1GMDF 3SOSA 1L2EA 1ZZZA 1C5TA 1MQ5A 2ZA5A 1UVUH 1DUEA 1HAXB 1YPEH 4YLUA 1AB9C 4FU7A 2ZCHP 5DG6A 4NZLA 4HI3A 1THPB 2BY6X 2PLXA 3U69H 3UPEA 1EJNA 1TONA 1SLVB 1GG6C 4INKA 4DW2U 1BQYA 2IOTA 4O3UA 2ZFTA 3GDSA 5TCCA 4NIYA 1ZRBA 2B8OH 2DE8A 1HAYB 4HZHA 1BTPA 3ZVFA 5C5OA 4XOJA 1OPHB 3QUMP 4A1VA 3ATWA 1SPJA 4Y8XA 5DP6A 1QY6A 1PQ5A 1MKWH 2GDEH 3RXVA 2JH0D 2G55A 2K1QA 4DIHH 1G2LA 5F8ZA 5HMAA 1D3PB 4NA7A 3QGNB 4X6PA 1PPZA 5T6DA 1BT7A 3TGKE 4IN1A 1DM4B 3A86A 5I25A 1Y59T 2A5IA 2AFQB 1J16A 3NZIA 4NCYA 3Q00A 2FX6A 1IOEA 3SGBE 3MNCA 1O3KA 1SBWA 1AWFH 1O2PA 1LPGB 1TPOA 4NFEA 1SGIB 1FMGA 3GY7A 3RXJA 1THSH 2XRCA 1HAPH 3MNXA 1C1NA 2ZIQH 1AZ8A 5F6MA 4AFQA 5A0AE 1VGCB 2ZI2H 3V7TA 2A5KA 1MU6B 1MAXA 1P2MA 2GT8A 1Y5UT 1TMTH 1CHGA 1VJ9U 4R8TB 1KSNA 2P93A 1F0SA 1P2OA 5C2ZA 4ISOA 4UEHH 5CMXH 2P16A 4CHAB 1ACBE 2BY5X 3RXMA 5FPYA 1GMCF 3DFJA 3BF6H 9ESTA 2Z7FE 1YYY1 3FANA 2WV4A 3BEUA 4NIWA 3SI3H 3P8FA 4KELA 1HXFH 3LDXH 1K1IA 4WXVA 3RXIA 1UVTH 3LJOA 1GL1A 2BZAA 3PMBB 5I46H 2FODA 2W7SA 4HGCA 1LHGH 3M3SA 1VGCC 1C9PA 2FX4A 2WUBA 3HGNA 3O8DA 2WUCA 3VGCB 2BD4A 1TOMH 1O3PB 1UK2A 4AFZA 4FUFA 3E3TA 1C5WB 2ZDKA 4NGAH 1K1NA 2HOBA 3TK5A 1HJ8A 3JZ2B 3PWBA 1A0JA 4CHAC 2F9NA 1XVOA 1DLKB 1S83A 7LPRA 5L6NH 2THFB 3MFJA 4H6TA 3BTTE 5JYIA 1GHBF 2SGPE 1O31A 3MU8A 1ZHMA 3QWCH 4Q7YA 3FP8E 3A87A 1SFQB 2Y5HA 1NRQH 1O2OA 3KGPA 4UE7H 3SNAA 3A84A 4XFQA 2OC0A 3LGYA 2JETB 3EA9A 1ZTLA 3UIRA 1BTWA 1HAVB 1BMNH 1O2MA 3NK8A 4X1SU 3C1KA 4NA9H 2ESTE 4ZH8A 3GYLB 3VGCC 1J8AA 1GI6A 3ESTA 3TH2H 1C2MA 8KME2 4UFFH 2BDGA 2GV7A 3P6ZB 1O3MA 1TMUH 2F9BH 1K22H 1C1VH 3URDA 3VB5A 3BTWE 5FX6A 1XX9A 3ZZCA 2J38A 1DUAA 2V35A 4DOQA 1RGQA 4K3JA 4AYVB 1J14A 2QN5T 1F0RA 3CS7A 1ZSKA 1OYTH 4Y7AA 1BHXB 1GMDG 3RU4E 4K1TA 3SUGA 1O2XA 2A1DB 1JBUH 2BY9X 2JETC 3SQHE 4DJZB 5LPRA 3M7TA 1TQ0B 3QZQA 1O5CB 1AN1E 1MKXK 1C4Y2 2FYQA 2Y5GA 1G32B 1O3EA 3NPSA 1ZTKA 3RMLH 3T5FH 3QLPH 1ARCA 2AH4X 3RXAA 3EYDA 2ZWLH 4JYUH 7ESTE 5T6GA 4ZHLU 1A5GH 2ZHQH 1S84A 4KKDA 3RXLA 1LPZB 2ZHDA 4D76A 4LK4A 1V6DA 5L2ZH 2TIOA 1TLDA 1GBFA 2R0LA 1NPMA 4K60A 4Y7BA 2BLOA 1O35A 1ZGVA 4OS5A 4BANB 1GHVH 4IGDA 2Y5FA 1AVGH 1ETRH 2Z6BD 1HXEH 1RTFB 1O3CA 1FI8A 1C2IA 3PROA 1UHBB 1HJ9A 4E7RG 1AU8A 1GJDB 3H7OA 5EU8A 1HB0B 2EC9H 1T7CA 2A0QB 1QB1A 3ZZDA 3PYHA 3D65E 1HIAB 3ZVEA 3BTME 1HV7A 1LKAA 1TRMA 1ELGA 3ZVDA 1AI8H 5CHAB 3S9CA 2ZECA 1GBKA 1V2NT 4XBCA 3D23A 3RXTA 3LGWA 5F8TA 1ZJKA 1TWXB 5EW2H 2FEQH 2B9LA 2OQ5A 2ZFFH 1QGFA 4JYVH 1H8IH 3A89A 9LPRA 1S81A 3BTQE 1BMLA 1EUFA 1QCPA 2H2ZA 2J2UA 3GCNA 4INHA 1ZGIA 2B5TB 1V2VT 4LZ1H 1LQDB 3PTNA 3M7QA 1BBRE 3ZV8A 4UFEH 1XUKA 1O34A 2VH6A 1GMCG 5T3HA 3S9BA 1GJCB 1QFKH 3TPIZ 2A4OA 2OUAA 2BD2A 1TA6A 1UTLM 3BTEE 3OSYA 2ZU1A 4SGAE 4BTTB 1JRTA 4BXSA 2H9TH 4PROA 5IDKA 1CGIE 1IQHA 3S0NA 1EPTB 1A1RA 1K2I1 4I8JA 5CHAC 4BAMB 3E16B 1LTOA 1P10A 3A7YA 3UNSA 4E06H 2AMDA 1DOJA 2VGCB 2ZEBA 3VB4A 1YC0A 1ELVA 4AGJA 3ATMA 3KEEA 1EZSC 2FS8A 1TRYA 5DO4H 1N6YA 4ABGA 1FIWA 1N8OB 2SFAA 1CE5A 1FIZA 2SGQE 1GPZA 2PGQB 4KTUA 2CJIA 2WPKS 4WMFA 1BTYA 4JZDH 1P05A 1P9SA 1GHBG 4VGCB 2QY0B 1HAVA 2FI3E 2XC0A 4Y8YA 4FU9A 4X6NA 1S6HA 3S69A 2RCEA 1T31A 2CV3A 4AZ2B 1IHTH 1QRZA 4ZKNU 3Q3KA 2HLCA 1BRCE 3A7WA 4Y76A 1O2LA 2HPQH 1DS2E 2VJ1A 2PKAB 1P8VC 2TPIZ 1QR3E 1EPTC 2OC1A 3SI4H 1P12E 7KMEH 1NFXA 5B6OA 3P8OA 1AZZA 3T26A 2HNTE 1V2KT 1ZLRA 3BTGE 3VPKA 1TGSZ 4JZFH 1C5XB 1C2HA 2VGCC 3UFAA 2VIDA 5LH8A 2ZU5A 1GI4A 5HGGA 3SJ9A 4O03A 2VWMA 1SQTA 1N8OC 3SU4A 3ATLA 1PQ7A 1YCPK 2F3CE 1HUTH 3UOUA 3TK6A 3EGKH 1SFIA 1FLEE 1RXPA 1RJXB 4VGCC 2ASUB 1GHZA 1UVSH 4WMDA 2H5CA 1KTSB 3QGJA 1SGNE 3A8CA 1W11U 2SNVA 3MO3A 1YPHC 2FOEA 4U30A 4OS6A 4IW4E 1BTZA 1MBQA 1DXWA 1C1UH 4Y8ZA 2J92A 2STBE 2D26C 1UK4A 2UUKB 1CGJE 2TGPZ 3ZV9A 3LGIA 4FUCA 1MBMA 1AIXH 3E91A 2W7UA 1EOJA 1ORFA 1ZMNA 1C5LH 3PTBA 1TX8A 1KXCA 1TIOA 1PPEE 1G9IE 3E90B 1P2NA 5L2YH 1CQQA 1SGQE 1QBOA 2Y7ZA 3M5LA 3DFLA 5A2MH 2D2DA 2XBYA 4TPYA 2QXIA 5DPAA 2XBXA 1EXFA 4ISHH 1D6WA 1SGPE 3H5CB 3ZZ5A 2LNCA 4J2YB 2G51A 2LPRA 4DURA 4JK5A 1ELAA 3M61U 3TIUA 4SGBE 1ZOMA 1MZAA 1RTKA 4WF8A 1O38A 1UHBA 1F0UA 1KXDA 4R0IA 3KQDA 3MU1A 4K69A 3M5MA 1W7GH 2ZQ2A 2ZTZA 3DA9B 1O3HA 1CT0E 4D8NA 3P70B 2Z3DA 1A7SA 3TGIE 1NU7B 4X8UH 5AF9H 3FAOA 1FDPA 1HRTH 2OBOA 1C5SA 2V0BA 4NIVA 5DK1A 1CHOF 3VB6A 1PPFE 2ZNKH 1P0SH 1VCPA 1DT2A 1C1WH 3QZRA 1NS3A 1SGDE 1GDQA 4RN6A 2FM2A 3MH5A 3F68H 2ZCLP 2NU0E 1IQKA 1GI0A 4K8YA 1O39A 4CH8B 2ODQA 2G5VA 4I7YH 3U8OH 3QTVH 1AKSA 2A2XH 1WQVH 2VIVA 3TJVA 5DP9A 2C3SA 3Q3XA 3BG4B 3P8NA 4YOIA 1O2QA 2HPPH 1F2SE 3W95A 1TNJA 1DITH 1O2JA 5E0GA 1MTUA 5ETXA 4YESB 2J4IA 3HPTB 4GLYA 1BRBE 1JMOH 1NRNH 4JCNA 1IQMA 4CBOA 3U98H 1LVMA 4WY3A 1QA0A 3TU7H 1BMMH 2O8LA 3UY9A 3KCGH 4D7GA 1KTTB 5AFYH 2P3TB 2PTCE 3C27B 1ANEA 2Z9IA 1FN8A 1VCQA 6ESTA 4RSPA 1KXAA 5EOKA 1CT4E 3K65B 3RXSA 1CO7E 2QXJA 2ZFPH 1C2JA 1DY9A 4JZIA 3RDZA 1YGCH 3BG4C 2ZPRA 1BBRK 3LC5A 2VWNA 1GBAA 1AQ7A 2PSXA 4BAQB 1DWCH 4E05H 4OGXA 3SGQE 2ULLA 1YP9A 1A46H 1CBWB 1KLIH 1QQUA 4FUDA 2GCHF 1AFEH 1GDNA 3IG6B 4GCHF 2GV6A 1Z6JH 1LCYA 3QX5H 1O5FH 3MI4A 5F8XA 1F5KU 4B73A 2PKAA 5T6FA 3V0XA 3PMAB 1EKBB 1MTWA 1G3BA 3TK9A 1GGDB 3SNDA 1DE7H 1TGTA 1XUIA 2P8OC 1RD3B 5LPEA 5HM2A 1T8NA 2G5NA 5JPMH 2UWPA 3M7UA 1MCVA 1PFXC 1KDQA 1A3EH 1C5VA 1WSSH 1SMFE 4AORA 3SV7A 1W7XH 3A8DA 3CENA 1ESTA 3SNBA 1HAHH 4X8VH 1CBWC 1GJ5H 4ISNA 1DX5M 1TBQH 3PLBA 5SGAE 4MPWA 1CA0B 4LOYH 1HBTH 4IC6A 4MTBA 1WAYB 1DFPA 3GY6A 4MPUA 3UWJH 4TYDA 5E8EH 1OWJA 1ZSJA 3T27A 1GBJA 1OP0A 1O2HA 1GGDC 1MAYA 1MTVA 2BVXH 1K1PA 1SOTA 1ANDA 3KHVA 3S7KB 1S0QA 4FVBA 1BB0B 3MYWA 5DP7A 4XSKU 4M7GA 2Y7XA 1ETSH 3GCTG 1MD7A 3R0FA 4K1SA 1EX3A 5EG4A 2W5EA 1LO6A 3FP6E 2HWLB 1QL9A 4CR5A 2BB4A 1C1PA 1V2TT 1EP5A 3RXRA 1FV9A 3L6PA 3SJIA 1C1TA 1H1BA 1Z8IB 1WV7H 1C5YB 1O5BB 2ALVA 1C5NH 1A2CH 1CA0C 3VXFH 1W0YH 3STIA 1VCWA 1O3BA 2QYIA 3UREA 4YT6H 3BIVH 3DD2H 1P09A 3I29A 3U9AH 4Y71A 2ZCKP 3ZZ8A 1ELTA 1RFNA 3NXPA 1PJPA 1O3GA 5EQSA 4JK6A 2FTLE 3TITA 1BJVA 5C5NA 2F9PA 4XBDA 1UVOA 3BEFB 1LQEA 2FWWA 1CHOG 3DUXH 2RA0A 4ISLA 1MH0A 1AVXA 3T28A 1F92A 2P59A 4F4OC 2M5TA 1W13U 1ETTH 4MNWA 4AN7A 1A5HA 1P2JA 1W10U 2BTCE 3RXUA 4GSOA 4KGAA 1G3DA 1OYQA 3SJOA 1EJAA 1SGTA 1SOZA 1TFXA 1W12U 2QGRA 3CS0A 3T29A 1F5LA 2EA3A 1NRSH 1LHCH 3F9EA 4Y79A 1GHXH 1SC8U 5A09A 1J17T 1S5SA 1XXFA 1C9TA 2FMJA 2BLWA 1HLTH 1EASA 1WTHD 3RXCA 2GMTB 1UCYE 3A7ZA 1FN6A 5E2OA 1OOKB 1AO5A 1BITA 1QJ6B 1OWKA 3LH1A 2O9QA 1QTFA 6GCHF 3S9AA 2HALA 1THRH 1YPKH 1NN6A 1YPGH 2CXVA 3QTOH 1HAIH 4XBBA 2Z9KA 3I78A 2G4TA 2AIQA 1YPMH 2VIPA 4I8GA 5E0HA 4I8HA 2C4FH 1O5DH 3GISB 5EGMA 5A8YA 3KNXA 4YTAA 2QV1A 2ZTXA 1HCGA 3GOVB 1INCA 1C1OA 1AWHB 2VB0A 3MH6A 3VFEA 2ZGJA 3VB7A 4Y10E 1QQ4A 3BTKE 3WY8A 3ELAH 3URCA 2WYGA 2PUXB 1Y3VA 4MNYA 1FY5A 3PLPA 1O3OA 3RC6A 4D7FA 2XTTB 4WVPE 3UQVA 3HKIB 1ELDE 2GMTC 5GJ4B 1A3BH 2SGEE 2D8WA 2GCHG 5EPYA 4GCHG 1TNGA 5ABWA 4JYTA 4B76A 1XUGA 2RA3A 3KN2A 2NU2E 2R2MB 4AOQA 1AGJA 4Q2KA 3LPRA 3EA8A 2FZZA 3W94A 3M37A 1UTMA 4ZHMU 2IN2A 1CA8B 4UONA 1TNIA 2ZGXH 3ZZBA 4XDEA 3KQEA 2AERH 3V3MA 2ZHWH 2B0FA 2VH0A 4BXWA 1DSTA 2P3FH 1AE5A 1L1GA 1V2WT 4Q7XA 2QF0A 3B8JA 5E2PA 1NT1A 4A1XA 1XUHA 1Y3XA 1D6RA 1O3NA 1S6FA 2VIQA 2FLRH 5GIBA 3NWUA 3EAJA 4IBLH 4U01A 1ZHPA 4UDWH 1IQEA 1VJAU 2GGVB 2OQUA 3P95A 5PTPA 2H9HA 2XNIA 3BTDE 3UR9A 1UTPA 2QXHA 3LONA 4TY7A 2Q6FA 3HK3B 4QT8C 2WPIS 1J15A 1P06A 3MWIU 1FONA 1SLXB 1TX7A 2C8ZB 2V3OH 3TJOA 2QIQA 1K1LA 1ZMJA 1NTPA 2YNAA 2ZU4A 1IQIA 1QB6A 2BX3A 1GVZA 3PM3A 3GY2A 2GVFA 1TNHA 3OTJE 1EOLA 2AEIH 1SG8B 3ZVBA 4HFPB 4MQAA 2R2WU 3Q3YA 1MKXH 2BLQA 1TABE 3OX7U 3PMHB 2JH6D 2AGGX 1AVWA 3PMJA 2FI4E 1EQ9A 2BYAX 3GY3A 1SHHB 4WXIA 2P94A 3RMOH 2A5AA 1DY8A 2A45B 2BD8A 1DXPA 1OP2A 1GI5A 2V3HH 4DIIH 4RKOB 1NFWA 3ZZ9A 3S7HB 5A0BA 1GI7B 2VU8E 1BTUA 4K1EA 1QHRB 5FBEA 1L4ZA 3MOCA 1O3DA 2SNWA 1OXGA 2BY7X 3ITIA 1C1QA
chains in the Genus database with same CATH superfamily
1UTQA 2BD3A 3SJ8A 1PPGE 1AFQB 2UWLA 3P92A 4AYYB 2OC7A 4YM9A 5AVDA 3U28C 3PB1E 1FQ3A 1O33A 3E0PB 2XCNA 4CREA 4GAWA 2Z3CA 1PQ8A 5BPEA 2ZO3H 3SGAE 4ASHA 5FCKA 2WV5A 1O32A 3UNQA 2FESH 2BX4A 1O37A 1X7AC 2CMYA 3ATIA 1GHWH 3U8RH 1FUJA 4NA8A 4E7NA 2HVXA 1JIMA 1TGBA 1DWDH 3KQCA 3F9GA 1EB1H 1F5RA 1PPBH 1ZTJA 2ZHFH 4AG2A 1F7ZA 3LGTA 1EP6A 3D62A 2FOHA 2V3MA 1P3EA 1FY4A 1WYKA 2QAAA 3LJJA 4X0WU 3SBKA 4Y0ZE 4MDSA 2JIZD 4OS4A 3F9FA 4Y0YE 2Y81A 3B23B 4U2WA 1AFQC 4MNVA 2YMSD 3A7TA 1W14U 2AMQA 5FHTA 2JH5D 6GCHG 1SSXA 4ZKSU 1S6LA 1A61H 2CF8H 2Q1JA 3RXBA 1JWTA 3A80A 1XKBC 2FPZA 1UVPA 2BQWB 3QO6A 1FAXA 2I6SA 1FZZA 3NKKA 5C1XA 3SJKA 1Q3XA 5DJ7A 4DG4A 1MMJN 2STAE 1EAXA 1T32A 3TNSA 1UCYK 2NU1E 2WPJS 3ZVCA 1A5IA 1H9HE 4MNXA 2GD4B 3BEIB 1SQOA 2Q6GA 1MD8A 1FNIA 3H7TA 3K9XB 5DP3A 4BTIB 1FY1A 1P03A 1Z7KA 3N99A 5HXFA 4BAOB 1HPGA 1N6XA 1C5QA 2HRVA 3DCLA 5ESBA 3SHAH 4RKJB 4H4FA 4ZHAA 4XRNA 4Z6AH 2XC4A 3SV2H 1H9IE 2A4GA 3GDVA 5GDSH 1DICA 2F83A 1TBZH 1IQLA 2HNTF 2KZ4A 2WPLS 5K0HA 1O2NA 4TWWA 4YLQH 2BVSH 1GHAF 4A5TS 2FOFA 1LMWB 5DP8A 5C3NA 4DGJA 1AY6H 1U6QA 4X2WA 4ABBA 1O30A 3IWMA 1OWDA 3GCTF 3T2NA 1TA2A 3A8BA 3VG8A 1J9CH 1ELCA 3GY5A 4ABFA 1T8OA 2G52A 2K8IA 3A8AA 3SU0A 5HM9A 4X1PU 3A83A 3FVFB 2JKHA 3BV9B 2RFKC 2IPHA 1QBNA 3T62A 4KTSA 4K2YA 2V6NA 3SNCA 4JZ1A 3GCHB 1T8MA 1H9LB 2PFEA 4TPIZ 4X6MA 4CRCA 1BTHH 4NIXA 1RIWB 3O8BA 4X1NU 2FO9A 1O2UA 1HDTH 5GWZA 3K6YA 1K1MA 1F0TA 1KIGH 4IN2A 4OS1A 1O5AB 4TY6A 4B2CA 1H8HD 3Q76A 2BDAA 1HIAA 3BTHE 1OP8A 5EODA 3O8RA 1P02A 2FOAA 3M35A 1ANCA 3NUMA 4JZEH 1SL3A 1YPLH 2GCTB 4B1TA 3Q77A 2PSYA 5EQQA 4X1RU 3GYMA 3GDUA 4FXGH 4O97A 4YOGA 5FCRA 3HKJB 2EI6A 4KP0A 1UTNA 1UMAH 4OS7A 1Y5AT 4FUBA 4CRGA 1C4U2 3SZEA 3V13A 3EE0B 3GCHC 1O2VA 3RU4T 3GY8A 3F1SB 1RIWC 1NO9H 4ZKRU 1FX0B 1L1NA 3WW7A 5TJXA 4BAHB 2EQNA 4ABHA 3BG8A 4AB8A 1V2LT 4BOHA 2VVVA 2C90B 4GUXA 1C1SA 4FETA 3UWIA 3UNRA 1E38B 2W3IA 4UFDH 1D3QB 4LXBH 5DGJA 1QURH 2ZDAH 1TPPA 1C5UA 1IQNA 3JZ1B 3RXGA 1BCUH 1A0LA 2KAIB 1AHTH 1EPTA 2CN0H 3L3TA 4AFSA 1HAOH 2GCTC 5BRRE 4CRBA 3MHWU 1XUFA 1IAUA 1NROH 1GDUA 3MTYA 1WBGB 5B6LA 1NY22 2GZ8A 1LVYA 2VVCA 1V2PT 1D3TB 4DY7B 4YZUA 1EATA 3RC5A 3FO8D 1Q31A 1G3EA 2QCYA 1ABIH 3TH3H 3KQ5A 4X8TH 1C5MD 1OWIA 2VNTA 4AG1A 4B2BA 2BD7A 1QBVH 4ZXXH 1G3CA 2GT7A 3RXEA 3ZZAA 1JOUB 1FXYA 1GBTA 3ZZ4A 1V2MT 1NC6A 1TYNA 2BXTH 1AMHA 1TX6A 3MO9A 1SVPA 1SQRA 3A7VA 5GPIB 2GDDA 2Y80A 2FDAA 2A31A 1GJAB 1QRWA 1SLWB 2A4RA 3U1IB 2NU4E 1FY3A 5J4QA 1MZDA 2BLVA 1Y3YA 2PP6A 1TGCA 1LDTT 3P17H 2ANWA 3HK6B 1ABJH 1LVOA 3V12A 2NU3E 1GMHF 5EW1H 3RXHA 1ZR0A 4DT7B 1QB9A 3NCLA 1GI8B 2BD9A 2FOBA 4ZUHA 1UTJA 4KTCA 1E36B 1K1JA 1G36A 1ZMLA 1Y8TA 2Y6TA 1EJMA 2OC8A 4FUIA 2F9VA 2ZQ1A 2XBWA 2FYRA 3F2GA 1ZYOA 2Q6DA 2BXUH 5ESTE 2BHGA 2XWAA 1MKWK 1ID5H 6CHAB 4YT7H 1QRXA 2OXSA 1V2ST 1UK3A 1B7XB 1GJ8B 2GP9B 2F4LA 3ZYEA 4CRAA 1UJ1A 3MH4A 4NFFA 4FVDA 3T25A 3ATKA 1G2MA 4NWKA 1NFUA 2BY8X 4I32A 3RXKA 1CU1A 1PYTD 2ZU2A 2UUYA 1GHAG 2ZPQA 4B2AA 1ZSLA 3M5OA 1O2YA 2BD5A 3OYPA 1B0EA 1T4UH 1O36A 1L1JA 3MU0A 4A6LA 5FAHA 3ZYDA 1MU8B 1SR5C 1T8LA 4MLFB 1NBMD 3SU2A 1Z1IA 1HNEE 1E34B 1OWEA 4O9VA 5FBIA 4P00A 1A4WH 3UTUH 6CHAC 3BN9A 2OCVB 5L30H 3TJNA 3SV6A 2FP7B 3RXOA 4ABIA 1SGRE 3N7OA 2TRMA 4HTCH 2GKVE 1IQFA 3RUOA 2WPMS 3LT3A 1GBIA 1LKBA 4Y11E 3E6PH 1P04A 1B5GH 1O5GH 3WWBA 2BQ6B 1HAZB 2TBSA 4D9RA 1LHEH 1P2QA 1M9UA 1BMAA 1YPJH 3MU5A 3ZZ7A 2BDBA 4AFUA 1XM1A 1KXFA 2ANYA 2ZDNA 2W6ID 5E0JA 1MQ6A 3FZDA 1K9OE 3PO1B 3UOPA 4ABEA 4CRFA 4X2VA 3U8TH 1E35B 1EZUC 3M3VA 7GCHF 3OAAD 1SQAA 2ZTYA 4GHTA 8GCHF 1KLTA 1OX1A 1GI3A 1YPHE 1L4DA 3VEQB 2J94A 2I6QA 1EAWA 1IQGA 3O8CA 2H6MA 3FFGA 3D49H 2KR7A 1RS0A 2R9PA 2FXRA 1GJ9B 1NFYA 1VITF 2C8YB 3RM2H 1OKXA 1TGNA 1C4V2 1GVKB 1Z1JA 3TVJB 2ZPSA 3DHKH 1UO6A 3RLYH 2XBVA 3STJA 4B74A 4Q63A 4K5ZA 2ZDVH 3F6UH 1C5PA 1YF4A 3QN7A 1PYTC 5GNDA 2WINI 5CHBA 2KAIA 1O3AA 1HAGE 2ZDLA 1OWHA 2HNTC 4NG9H 1XXDA 4Q7ZA 4Q80A 2BVRH 1W0JD 1NU9A 4Z0KA 2FS9A 2WZQA 1ELEE 1QA7A 3PO1C 3FOAA 1V2OT 2FLBH 2BOKA 2C8WB 3KYGA 2FOMB 1O3FA 2QXGA 1HFDA 1SLUB 1PPHE 3BSQA 2GTBA 4A92A 1E0FD 3PV4A 1C1MA 1GBCA 1AD8H 1D9IA 2PHBA 4X2XA 4Y6DA 4ZAEA 2P3UB 1K0HA 3UR6A 1IQJA 2XC5A 1LVBA 1V2QT 2ZFQH 1O2WA 1K1OA 1V2RT 1ZJDA 1GHYH 2BQ7B 1XVMA 3A85A 2ZDMA 5EPNA 4RT1A 2ZFSA 3SU1A 1H4WA 4D9QA 3K6ZA 1BZXE 5C1YA 3TH4H 3PV2A 5K7RA 4TSFD 2VINA 2R3YA 1YM0A 3LU9B 2H5DA 3G01A 2BDYA 3TJUA 1RTLA 3UUZA 2F91A 3MO6A 3EQ0H 1DANH 1FPHH 1O2GH 2OINA 2TGDA 2LP6A 1UTKA 2WV9A 1C2DA 2GX4A 4Z1MD 1KLJH 3RC4A 2C8XB 1AE8H 3ZZ6A 4AGKA 5A8ZA 1ELFA 3QK1A 1GBHA 1GMHG 1SB1H 1P01A 1CGHA 1YKTA 4CH2B 2J95A 2PTNA 2GZ7A 1DWBH 1MCTA 2Z9GA 1GI1A 2GZ9A 3F3BA 5H4IB 2Z3EA 3A82A 4IMQA 1V3XA 1O3LA 4B71A 8LPRA 2A7CA 4I31A 3PV5A 1PPCE 3GCOA 2BZ6H 3A88A 2FOCA 2VIOA 2H1UA 2DUCA 4WJG2 1EZQA 3DT0H 2J34A 1C2KA 1A0HB 2A32A 3CP7A 1OSSA 2FOGA 2H9EH 4WMEA 2ZC9H 2D1JA 4X2YA 3AW1A 4B75A 4MVNA 5C67A 5A0CA 1XMNB 3F0OA 3GICB 4OS2A 1B0FA 1NESE 4RT0A 5JBBS 2QC2A 4JMYA 1DLEA 1TRNA 2AS9A 2PGBB 4GHQA 3F9HA 1CVWH 3M5NA 1L0ZA 1G37A 1LHFH 2VWOA 4GPGA 2HVYB 1DVAH 1BJUA 2PV9B 5JDUB 1WUNH 2BOHB 1LPKB 4WWYA 1S85A 4MPVA 2TGAA 4YO9A 4THNH 2F9OA 2ZGCA 1GJ6A 1JXPA 4ISIH 5FPSA 3SUDA 5G4BA 1BRUP 2VVUA 2ILNA 2RG3A 2ZKSA 3M3TA 1W3CA 4IS5A 4X1QU 4CR9A 2SGFE 1C5ZB 1EAIA 1NZQH 1Z71A 3AVZA 1P2IA 2Z9LA 1JRSA 3AASA 2CK3D 4B6FA 2BDIA 5LGOA 4LZ4B 3EA7A 1NRRH 4A7IB 2QE7D 1C2FA 2SGAA 3ZVAA 2ZF0H 4NSVA 2IJOB 1GCTB 2AGIX 7GCHG 3BIUH 2ANMH 4ZMAH 1O2RA 3LIWA 1Y3UA 2PR3A 1GWAA 5EXNA 8GCHG 1Z8GA 1P3CA 1O2SA 1O5EH 3SQEE 1GJ7B 4CRDA 5GXPA 3SV9A 3PWCA 4IC5A 3SHCH 2O8MA 1GBLA 2PUQH 5EJLA 2AYWA 1YLNA 5FPTA 1C2GA 1VITG 4INLA 5GCHF 1YCPM 5EQRA 5IYTA 1SGFG 1AKSB 1ZHRA 1V2UT 1AUTC 1SGYE 1VZQH 4X8SH 3F2FA 1FAKH 3U1JB 4OGYA 2A7JA 2F9UA 3RMNH 2WPHS 5JBCS 3QDZB 3BTFE 1ESAA 2OLGA 2Z9JA 5EJZA 3TLOA 5JBTA 4ZROA 1P9UA 2XW9A 1GJBB 1T4VH 1E1QD 1O2IA 5CE1A 4NSYA 1GCTC 1JIRA 2DE9A 4FUGA 1CSOE 2FI5E 1W0ZU 2PWXA 4NZQA 3FZZA 2PW8H 1UTOA 4ABAA 1KYNA 3LGVA 3SV8A 3ZIAD 1WU1A 4BNRA 5C94A 1TNKA 1EZXC 3EDXB 1E37B 3OU0A 2QF5A 3TGJE 2BDCA 3SUEA 2R3UA 1VITH 4MG3A 1BUIA 1Y3WA 1N1LA 4DCDA 1S0RA 2ODPA 1TQ7B 4U32A 5KEDA 5TCAA 1BTXA 1O2ZA 3WWFA 4O3TA 2FIRH 1Y5BT 1KXEA 1Q2WA 2EI7A 2WPDD 2J97A 2ALPA 3SUFA 1HJAB 5C1UA 4MPXA 2QF3A 1TB6H 1QL8A 3GY4A 1D4PB 2ANKH 3RXFA 3MQKC 1EB2A 1GJ4H 1BA8B 2WYJA 3GS9A 3FKSD 2G81E 3I77A 1HGTH 2ODYB 1D3DB 1GVLA 3B9FH 3K2UA 6LPRA 1BIOA 1PQAA 4K8BA 1EAUA 2EI8A 1S82A 2YNBA 1YLDA 3OEED 4I8LA 1FPCH 2EEKA 2AGEX 1C5OH 1W2KH 2BDHA 4A1TA 1MTSA 1V2JT 3ZZ3A 4AX9H 1TAWA 2OBQA 1UCYH 4XE4A 3SU3A 1KDQB 3KF2A 1QNJA 1SKYE 2Z94A 3SW2B 1GBDA 1BRAA 1SGCA 4IMZA 3RM0H 2PKSB 1P2KA 1HJAC 1TPAE 1YLCA 5F03A 3LC3A 1K21H 3A7XA 3LH3A 2O8TA 1C2EA 1UW7A 2BMGB 1HYLA 3HGPA 2FTMA 2QA9E 2W6JD 1ZPBA 4X6OA 3RXDA 3RXQA 3SO3A 1YCPH 1W8BH 3FP7E 1GI9B 2SGDE 3ODDA 4ACBA 1O2KA 1DDJA 3RU4D 2TGTA 4BAKB 1IHSH 1WOFA 2UUJB 1BOQA 1VR1H 5EXLA 1FJSA 3OY5U 3AAUA 1OS8A 1CT2E 1Z6EA 1O3IA 3DSOA 3MH7A 1O2TA 1TNLA 1TBRH 3P8GA 2O8UA 2ZGBH 2ZU3A 1AUJA 2A7HA 2B7DH 2G8TA 1XUJA 3ODFA 1K28D 1DWEH 1O3JA 1ZPZA 2PKSC 3A81A 1MUEB 1MTNB 1H8DH 4TWYA 2R0KA 1GBEA 5FX5A 4ESTE 4CBNA 3PRBA 1NM6A 3TNTA 1SHYA 4XD7D 4WH8A 3SYJA 1SI5H 3E0NB 4H6SB 2BM2A 1TPSA 2VWLA 5C20A 2ZP0H 2Y82A 4F48B 1ARBA 2OP9A 4BTUB 1TALA 3MMGA 3RP2A 4GVUA 5DP4A 3SZNA 3KIDU 2ZG0H 3RMMH 4ZXYH 3ZVGA 2UWOA 1GCDA 2NWNA 2VIWA 4ZKOU 2LELA 1NRPH 2JJ1D 3LGUA 5AHGH 4ABJA 1C1RA 2OTVA 1TMBH 1TOCB 2M2AA 3UAIC 2XYAA 3SORA 3KL6A 4J1YA 2P95A 5EXMA 4ABDA 1YBWA 3MNBA 1E79D 4AB9A 1MTNC 3IITA 4WH6A 1FY8E 2CHAB 4YOJA 3MU4A 4F49A 2ZZUH 2UUFB 4NWLA 2CGAA 1KXBA 2XWBI 5GCHG 1XKAC 1GBBA 2G00A 2ZHEH 1TE0A 3LOXA 3DSGA 4DVAU 5DP5A 3AAVA 3HATH 1WQSA 1Z8RA 2ZFRH 4DT4A 1P57B 2AMPA 2XCFA 1KY9A 5J4SA 1BHXF 1SGEE 3L33A 2CF9H 3RLWH 8ESTE 1P11E 1GBMA 2RDLA 3PLKA 3N7DA 3SNEA 5FXLA 3UQOA 2P8OB 1WCZA 2W3KA 1DSUA 1C2LA 1GI2A 2XXLA 2A4QA 3E1XB 1ZPCA 1AB9B 5AFZH 1Z8JB 4FUEA 1SGFA 1QIXB 2CHAC 3ENSB 3RXPA 4FU8A 5HYOA 5HIZA 1QJ1B 5JBAS 4I33A 1ESBA 5A8XA 3AW0A 2HGTH 2J9NA 1BDAA 5JB9S 1GG6B 2G4UA 3SU6A 3SN8A 4UFGH 3M36A 1ELBA 2C93B 3SU5A 2L74A 1LHDH 2AIPA 2O8WA 5DKMA 1RRKA 4H42U 3R3GB 3OY6U 1DPOA 4FUJA 4UD9H 3MNSA 3LKWA 2YOLA 2A2QH 3E8LA 4I8KA 4FUHA 1QJ7B 1BBRH 1GL0E 1ZRKA 3VB3A 1O0DH 5JB8S 1G30B 1ANBA 1QL7A 1MABB 1WTGH 5LPFA 3VXEH 3KQBA 1C5RA 2W26A 2OD3B 2ZGHA 1GMDF 3SOSA 1L2EA 1ZZZA 1C5TA 1MQ5A 2ZA5A 1UVUH 1DUEA 1HAXB 1YPEH 4YLUA 1AB9C 4FU7A 2ZCHP 2KCYA 5DG6A 4NZLA 4HI3A 5C17A 5HKKD 1THPB 2BY6X 2PLXA 3U69H 3UPEA 1EJNA 1TONA 1SLVB 1GG6C 4INKA 4DW2U 1BQYA 2IOTA 4O3UA 2ZFTA 3GDSA 5TCCA 4NIYA 1ZRBA 2B8OH 2HLDD 2DE8A 1HAYB 4HZHA 1BTPA 3ZVFA 5C5OA 4XOJA 1OPHB 3QUMP 4A1VA 3ATWA 1SPJA 4Y8XA 5DP6A 4ACAA 2IPQX 1QY6A 1PQ5A 1MKWH 2GDEH 5HIYA 3RXVA 2JH0D 2G55A 5C0UA 2K1QA 4DIHH 2J5UA 1G2LA 5F8ZA 5HMAA 1D3PB 4NA7A 3QGNB 4X6PA 1PPZA 5T6DA 1BT7A 3TGKE 4IN1A 5KECA 1DM4B 3A86A 5I25A 1Y59T 2A5IA 2AFQB 1J16A 3NZIA 4NCYA 3Q00A 2FX6A 1IOEA 3SGBE 3MNCA 1O3KA 1SBWA 1AWFH 1O2PA 1LPGB 1TPOA 4NFEA 3OTPA 1SGIB 1FMGA 3GY7A 3RXJA 1THSH 2VBCA 2XRCA 1HAPH 3MNXA 1C1NA 2ZIQH 1AZ8A 5F6MA 4AFQA 5A0AE 1VGCB 2ZI2H 3V7TA 2A5KA 1MU6B 1MAXA 1P2MA 2GT8A 1Y5UT 5F53A 1TMTH 1CHGA 1VJ9U 4R8TB 1KSNA 2P93A 1F0SA 1P2OA 5C2ZA 4ISOA 4UEHH 5CMXH 2P16A 4CHAB 1ACBE 2BY5X 5FL7D 3RXMA 5FPYA 1GMCF 3DFJA 3BF6H 9ESTA 2Z7FE 1YYY1 3FANA 2WV4A 3BEUA 2J98B 4NIWA 3SI3H 3P8FA 4KELA 1HXFH 3LDXH 1K1IA 4WXVA 3RXIA 1UVTH 3LJOA 1GL1A 2BZAA 3PMBB 5I46H 2FODA 2W7SA 4HGCA 2GJGA 1LHGH 3M3SA 1VGCC 3KYFA 1C9PA 2FX4A 2WUBA 3HGNA 3O8DA 2WUCA 3VGCB 2BD4A 1TOMH 1O3PB 1UK2A 4AFZA 4FUFA 3E3TA 1C5WB 2ZDKA 4NGAH 1K1NA 2HOBA 3TK5A 1HJ8A 3JZ2B 3PWBA 1A0JA 1COWD 4CHAC 2F9NA 2IJD1 1XVOA 1DLKB 1S83A 7LPRA 5L6NH 2THFB 3MFJA 4H6TA 3BTTE 5JYIA 1GHBF 2SGPE 1O31A 3MU8A 1ZHMA 3QWCH 4Q7YA 3FP8E 3A87A 1SFQB 2Y5HA 1NRQH 1O2OA 3KGPA 4UE7H 3SNAA 3A84A 4XFQA 2OC0A 3LGYA 2JETB 3EA9A 1ZTLA 3UIRA 1BTWA 1HAVB 1BMNH 1O2MA 3NK8A 4X1SU 3C1KA 4NA9H 2ESTE 4ZH8A 3GYLB 3VGCC 1J8AA 1GI6A 3ESTA 3TH2H 4ZCNA 1C2MA 8KME2 4UFFH 2BDGA 1W0KD 2GV7A 3P6ZB 1O3MA 1TMUH 2F9BH 1K22H 1C1VH 3URDA 3VB5A 3BTWE 5FX6A 1XX9A 3ZZCA 2J38A 1DUAA 2V35A 4DOQA 1RGQA 4K3JA 4AYVB 1J14A 2QN5T 1F0RA 3CS7A 1ZSKA 1OYTH 4Y7AA 4F55A 5CDFE 3OFND 3H09A 1BHXB 1GMDG 3RU4E 4K1TA 3SUGA 1O2XA 2A1DB 1JBUH 2BY9X 2JETC 3SQHE 4DJZB 5LPRA 3M7TA 1TQ0B 3QZQA 1O5CB 1AN1E 4I86A 1MKXK 1C4Y2 2FYQA 2Y5GA 1G32B 1O3EA 3NPSA 1ZTKA 3RMLH 3T5FH 3QLPH 1ARCA 2AH4X 3RXAA 3EYDA 2ZWLH 4JYUH 7ESTE 5T6GA 4ZHLU 1A5GH 2ZHQH 1S84A 4KKDA 3RXLA 1LPZB 2ZHDA 4D76A 4LK4A 1V6DA 5L2ZH 2TIOA 1TLDA 1GBFA 2R0LA 1NPMA 4K60A 4Y7BA 2BLOA 1O35A 1ZGVA 4OS5A 4BANB 1GHVH 4IGDA 2Y5FA 1AVGH 1ETRH 1YY3A 2Z6BD 1HXEH 1RTFB 1O3CA 1FI8A 5DN6D 4P02A 1C2IA 3PROA 1UHBB 1HJ9A 4E7RG 1AU8A 1GJDB 4FOUC 3H7OA 4OM9A 5EU8A 1HB0B 2EC9H 1T7CA 2A0QB 2JDID 1QB1A 2V7QD 3ZZDA 1QZ8A 3PYHA 3D65E 1HIAB 3ZVEA 3BTME 1HV7A 1LKAA 1TRMA 1ELGA 3ZVDA 1AI8H 5CHAB 3S9CA 2ZECA 1GBKA 1V2NT 4XBCA 3D23A 3RXTA 3LGWA 5F8TA 1ZJKA 1TWXB 5EW2H 2FEQH 2B9LA 2OQ5A 2ZFFH 1QGFA 4JYVH 1H8IH 3A89A 9LPRA 1S81A 3BTQE 1BMLA 1EUFA 1QCPA 2H2ZA 2J2UA 3GCNA 4INHA 1ZGIA 2B5TB 1V2VT 4LZ1H 1LQDB 3PTNA 3M7QA 1BBRE 3ZV8A 4UFEH 1XUKA 1O34A 2VH6A 1GMCG 5T3HA 3S9BA 1GJCB 1QFKH 3TPIZ 2A4OA 2OUAA 2BD2A 1TA6A 1UTLM 3BTEE 3OSYA 2ZU1A 4SGAE 4BTTB 1JRTA 4BXSA 2H9TH 4PROA 2WSSD 5IDKA 1CGIE 1IQHA 3S0NA 1EPTB 1A1RA 1K2I1 4I8JA 5CHAC 4BAMB 2RDEA 3E16B 1LTOA 1P10A 3A7YA 3UNSA 4E06H 2AMDA 1DOJA 2VGCB 2ZEBA 3VB4A 1YC0A 1ELVA 4AGJA 3ATMA 3KEEA 1EZSC 2FS8A 4B6EA 1TRYA 5DO4H 1N6YA 4ABGA 1FIWA 1N8OB 2SFAA 1CE5A 1FIZA 2SGQE 1GPZA 2PGQB 4KTUA 2CJIA 2WPKS 4WMFA 1BTYA 4JZDH 1P05A 1P9SA 1GHBG 4VGCB 2QY0B 1HAVA 2FI3E 2XC0A 4Y8YA 4FU9A 4X6NA 1S6HA 3S69A 2RCEA 1T31A 5C0TA 2CV3A 4M9FA 4AZ2B 1IHTH 1QRZA 4ZKNU 3Q3KA 2HLCA 1BRCE 3A7WA 4Y76A 1O2LA 2HPQH 1DS2E 2VJ1A 2PKAB 1P8VC 2TPIZ 1QR3E 1EPTC 2OC1A 3SI4H 1P12E 7KMEH 1NFXA 5B6OA 3P8OA 1AZZA 3T26A 2HNTE 1V2KT 1ZLRA 2XOKD 3BTGE 3VPKA 1TGSZ 4JZFH 1C5XB 1C2HA 2VGCC 3UFAA 2VIDA 5LH8A 2ZU5A 1GI4A 5HGGA 3SJ9A 4O03A 2VWMA 1NBME 1SQTA 2YMSB 1N8OC 3SU4A 3ATLA 1PQ7A 1YCPK 2F3CE 1HUTH 3UOUA 3TK6A 3EGKH 1SFIA 1FLEE 1RXPA 1RJXB 3CNRA 4VGCC 2ASUB 1GHZA 1UVSH 4Q4LA 4WMDA 2L6OA 2H5CA 1KTSB 3QGJA 1SGNE 3A8CA 1W11U 2SNVA 3MO3A 1YPHC 2FOEA 4U30A 4OS6A 4IW4E 1BTZA 1MBQA 1DXWA 1C1UH 4Y8ZA 2J92A 2STBE 2D26C 1UK4A 2XNDD 2UUKB 1CGJE 2TGPZ 3ZV9A 3LGIA 4FUCA 1MBMA 1AIXH 3E91A 2W7UA 1EOJA 1ORFA 1ZMNA 1C5LH 3PTBA 1TX8A 1KXCA 1TIOA 1PPEE 1G9IE 3E90B 1P2NA 5L2YH 1CQQA 1SGQE 1QBOA 2Y7ZA 3M5LA 3DFLA 5A2MH 2D2DA 2XBYA 2WHXA 2QXIA 4TPYA 5DPAA 2YMSC 2XBXA 1EXFA 4ISHH 1D6WA 1SGPE 3H5CB 3ZZ5A 2LNCA 4J2YB 2G51A 2LPRA 4DURA 4JK5A 1ELAA 3M61U 3TIUA 4SGBE 1ZOMA 1MZAA 1RTKA 2EY4C 1O38A 1UHBA 4WF8A 1F0UA 1KXDA 4R0IA 3KQDA 3MU1A 4K69A 1VKYA 3OEHD 3M5MA 1W7GH 2ZQ2A 2ZTZA 3DA9B 1O3HA 1CT0E 4D8NA 3P70B 2Z3DA 1A7SA 3TGIE 1NU7B 4X8UH 5AF9H 3FAOA 1FDPA 1HRTH 2OBOA 1C5SA 2V0BA 3FN8A 4NIVA 1CHOF 5DK1A 1PPFE 2ZNKH 1P0SH 3VB6A 1VCPA 1DT2A 1C1WH 3QZRA 1NS3A 1SGDE 1GDQA 2KM0A 2FM2A 4RN6A 1BMFD 2KCPA 3MH5A 3F68H 2ZCLP 2NU0E 1IQKA 1GI0A 4K8YA 1O39A 4CH8B 2ODQA 2G5VA 1EFRD 4I7YH 3U8OH 3QTVH 1AKSA 2A2XH 1WQVH 2VIVA 3TJVA 3N7EA 2C3SA 3Q3XA 4ASUD 3BG4B 3UB0A 5DP9A 1WDIA 3P8NA 4YOIA 1O2QA 2HPPH 1F2SE 3W95A 1TNJA 1DITH 1O2JA 5E0GA 1MTUA 5ETXA 4YESB 2J4IA 3HPTB 4GLYA 1BRBE 1JMOH 1NRNH 4JCNA 1IQMA 4CBOA 3U98H 1LVMA 4WY3A 1QA0A 3TU7H 1BMMH 2O8LA 3UY9A 3KCGH 4D7GA 1KTTB 5AFYH 3NRLA 2P3TB 2PTCE 3C27B 1ANEA 2Z9IA 1FN8A 1VCQA 6ESTA 4RSPA 1KXAA 5EOKA 1CT4E 3K65B 3RXSA 1CO7E 2QXJA 2ZFPH 1C2JA 1DY9A 4JZIA 3RDZA 3AK5A 1YGCH 3BG4C 2ZPRA 1BBRK 1H8ED 3LC5A 2VWNA 1GBAA 1AQ7A 2PSXA 4BAQB 1DWCH 4E05H 4OGXA 3SGQE 2ULLA 1YP9A 5KGOA 1A46H 1CBWB 1KLIH 1QQUA 4FUDA 2GCHF 1AFEH 1GDNA 3IG6B 4GCHF 2GV6A 1Z6JH 1LCYA 3QX5H 1O5FH 3MI4A 5F8XA 1F5KU 4B73A 2PKAA 5T6FA 3V0XA 3PMAB 1EKBB 1MTWA 1G3BA 3TK9A 1GGDB 3SNDA 1DE7H 1TGTA 2KX4A 5IK2D 1XUIA 2P8OC 1RD3B 5LPEA 5HM2A 5EJ1A 1T8NA 2G5NA 3DSPA 2UWPA 5JPMH 2K0QA 3M7UA 1MCVA 1PFXC 1KDQA 1A3EH 1C5VA 1WSSH 1SMFE 4AORA 3SV7A 1W7XH 3A8DA 3CENA 1ESTA 3SNBA 1HAHH 5T1VA 4X8VH 1CBWC 1GJ5H 4ISNA 1DX5M 1TBQH 3PLBA 5SGAE 4MPWA 1CA0B 4LOYH 1HBTH 4IC6A 4MTBA 1WAYB 1DFPA 3GY6A 4MPUA 3UWJH 4TYDA 1KMHB 5E8EH 1OWJA 1ZSJA 3T27A 1GBJA 1OP0A 1O2HA 1GGDC 1MAYA 1MTVA 2BVXH 3EE7A 4YXWD 1K1PA 1SOTA 1ANDA 3KHVA 5DSFA 3S7KB 1S0QA 4FVBA 1BB0B 3MYWA 5DP7A 4XSKU 4M7GA 2Y7XA 1ETSH 3GCTG 1MD7A 3R0FA 4K1SA 1EX3A 5EG4A 2W5EA 1LO6A 3FP6E 2HWLB 1QL9A 4CR5A 2BB4A 1C1PA 1V2TT 1EP5A 3RXRA 1FV9A 3L6PA 3SJIA 1C1TA 1H1BA 1Z8IB 1WV7H 1C5YB 1O5BB 2ALVA 1E1RD 1C5NH 1A2CH 1CA0C 3VXFH 1W0YH 3STIA 1VCWA 1O3BA 2QYIA 3UREA 4YT6H 3BIVH 3DD2H 1P09A 3I29A 3U9AH 4Y71A 2ZCKP 3ZZ8A 1ELTA 1RFNA 3NXPA 1PJPA 1YWUA 1O3GA 5EQSA 2AHME 4JK6A 2FTLE 3TITA 1BJVA 5C5NA 2F9PA 4XBDA 1UVOA 3BEFB 1LQEA 2FWWA 1CHOG 3DUXH 2RA0A 4ISLA 1MH0A 1AVXA 3T28A 1F92A 2P59A 4F4OC 2M5TA 1W13U 1ETTH 4MNWA 4AN7A 1A5HA 1P2JA 1W10U 2BTCE 3RXUA 4GSOA 4KGAA 1G3DA 1OYQA 3SJOA 1EJAA 1SGTA 1SOZA 1TFXA 1W12U 2QGRA 3CS0A 3T29A 1F5LA 2EA3A 1NRSH 1LHCH 3F9EA 4Y79A 1GHXH 1SC8U 5A09A 1J17T 1S5SA 1XXFA 2F43B 1C9TA 2FMJA 2BLWA 1HLTH 1EASA 1WTHD 3RXCA 2GMTB 1UCYE 3A7ZA 1FN6A 5E2OA 1OOKB 1AO5A 1BITA 1QJ6B 2JJ2D 1OWKA 4TT3D 3LH1A 2O9QA 1QTFA 6GCHF 3S9AA 2HALA 1THRH 1YPKH 1NN6A 1YPGH 2CXVA 3QTOH 1HAIH 4XBBA 2Z9KA 3I78A 2G4TA 2AIQA 1YPMH 3OE7D 2KCAA 2VIPA 4I8GA 5E0HA 4I8HA 2C4FH 1O5DH 3F0PA 3GISB 5EGMA 5A8YA 3KNXA 4YTAA 2QV1A 2ZTXA 1HCGA 1OHHD 3GOVB 1INCA 1C1OA 1AWHB 2VB0A 3MH6A 1WXRA 3VFEA 2ZGJA 3VB7A 4Y10E 3W1EA 1QQ4A 3BTKE 3WY8A 3ELAH 3URCA 2WYGA 2PUXB 1Y3VA 4MNYA 1FY5A 3PLPA 1O3OA 3RC6A 3PRDA 4D7FA 2XTTB 4WVPE 3UQVA 3HKIB 1ELDE 2GMTC 5GJ4B 1A3BH 2SGEE 2D8WA 2GCHG 5EPYA 4GCHG 1TNGA 5ABWA 4JYTA 4B76A 1XUGA 2RA3A 3KN2A 4RI0A 2NU2E 2R2MB 4AOQA 1AGJA 4Q2KA 3LPRA 3EA8A 2FZZA 3W94A 3M37A 1UTMA 4ZHMU 2IN2A 1CA8B 4UONA 1TNIA 2ZGXH 3ZZBA 4XDEA 3KQEA 2AERH 3V3MA 2ZHWH 2B0FA 2VH0A 4BXWA 1DSTA 2P3FH 1AE5A 1L1GA 1V2WT 4Q7XA 2QF0A 3B8JA 5E2PA 1NT1A 4A1XA 1XUHA 1Y3XA 1D6RA 4AC9A 1O3NA 1S6FA 2VIQA 2FLRH 5GIBA 3NWUA 3EAJA 2KCOA 4IBLH 4U01A 1ZHPA 4UDWH 1IQEA 1VJAU 2GGVB 2OQUA 3P95A 5PTPA 2H9HA 2XNIA 3BTDE 3UR9A 1UTPA 2QXHA 3LONA 4TY7A 2Q6FA 3HK3B 4QT8C 2WPIS 1J15A 1P06A 3MWIU 1FONA 1SLXB 1TX7A 2C8ZB 2V3OH 3TJOA 2QIQA 1K1LA 1ZMJA 1NTPA 2YNAA 2ZU4A 1IQIA 1QB6A 2BX3A 1GVZA 3PM3A 3GY2A 2GVFA 1TNHA 3OTJE 1EOLA 2AEIH 1SG8B 3ZVBA 4HFPB 4MQAA 2R2WU 3Q3YA 1MKXH 2BLQA 1TABE 3OX7U 3PMHB 2JH6D 2AGGX 1AVWA 3PMJA 2FI4E 1EQ9A 2BYAX 3GY3A 1SHHB 4WXIA 2P94A 4HG6A 3RMOH 2A5AA 1DY8A 2KFWA 2A45B 2BD8A 1DXPA 1OP2A 2OK5A 1GI5A 3F2HA 2V3HH 4DIIH 4RKOB 1NFWA 2QF4A 3ZZ9A 3S7HB 5A0BA 1GI7B 2VU8E 1BTUA 4K1EA 1QHRB 5FBEA 5EIYA 1L4ZA 3MOCA 1O3DA 2SNWA 1OXGA 2BY7X 3ITIA 1C1QA 2J98A
chains in the Genus database with same CATH topology
1UTQA 2BD3A 3SJ8A 1PPGE 1AFQB 2UWLA 3P92A 4AYYB 2OC7A 4YM9A 5AVDA 3PB1E 1FQ3A 1O33A 3E0PB 2XCNA 4CREA 4GAWA 2Z3CA 1PQ8A 5BPEA 2ZO3H 3SGAE 4ASHA 5FCKA 2WV5A 1O32A 3UNQA 2FESH 2BX4A 1O37A 1X7AC 2CMYA 3ATIA 1GHWH 3U8RH 1FUJA 4NA8A 4E7NA 2HVXA 1JIMA 1TGBA 1DWDH 3KQCA 3F9GA 1EB1H 1F5RA 1PPBH 1ZTJA 2ZHFH 4AG2A 1F7ZA 3LGTA 1EP6A 3D62A 2FOHA 1P3EA 1FY4A 1WYKA 2QAAA 3LJJA 4X0WU 3SBKA 4Y0ZE 4MDSA 4OS4A 3F9FA 4Y0YE 2Y81A 3B23B 4U2WA 1AFQC 4MNVA 3A7TA 1W14U 2AMQA 5FHTA 2JH5D 6GCHG 1SSXA 4ZKSU 1A61H 2CF8H 2Q1JA 3RXBA 1JWTA 3A80A 1XKBC 2FPZA 1UVPA 2BQWB 3QO6A 1FAXA 2I6SA 1FZZA 3NKKA 5C1XA 3SJKA 1Q3XA 5DJ7A 4DG4A 1MMJN 2STAE 1EAXA 1T32A 3TNSA 1UCYK 2NU1E 2WPJS 3ZVCA 1A5IA 1H9HE 4MNXA 2GD4B 3BEIB 1SQOA 2Q6GA 1MD8A 1FNIA 3H7TA 3K9XB 5DP3A 4BTIB 1FY1A 1P03A 1Z7KA 5HXFA 4BAOB 1HPGA 1N6XA 1C5QA 2HRVA 5ESBA 3SHAH 4RKJB 4H4FA 4ZHAA 4Z6AH 2XC4A 3SV2H 1H9IE 2A4GA 3GDVA 5GDSH 1DICA 2F83A 1TBZH 1IQLA 2HNTF 2WPLS 5K0HA 1O2NA 4TWWA 4YLQH 2BVSH 1GHAF 4A5TS 2FOFA 1LMWB 5DP8A 5C3NA 4DGJA 1AY6H 1U6QA 4X2WA 4ABBA 1O30A 3IWMA 1OWDA 3GCTF 3T2NA 1TA2A 3A8BA 1J9CH 1ELCA 3GY5A 4ABFA 1T8OA 2G52A 3A8AA 3SU0A 5HM9A 4X1PU 3A83A 3FVFB 2JKHA 3BV9B 2IPHA 1QBNA 3T62A 4KTSA 4K2YA 2V6NA 3SNCA 4JZ1A 3GCHB 1T8MA 1H9LB 2PFEA 4TPIZ 4X6MA 4CRCA 1BTHH 4NIXA 1RIWB 3O8BA 4X1NU 2FO9A 1O2UA 1HDTH 5GWZA 3K6YA 1K1MA 1F0TA 1KIGH 4IN2A 4OS1A 1O5AB 4TY6A 4B2CA 3Q76A 2BDAA 1HIAA 3BTHE 1OP8A 5EODA 3O8RA 1P02A 2FOAA 3M35A 1ANCA 3NUMA 4JZEH 1SL3A 1YPLH 2GCTB 4B1TA 3Q77A 2PSYA 5EQQA 4X1RU 3GYMA 3GDUA 4FXGH 4O97A 4YOGA 5FCRA 3HKJB 2EI6A 4KP0A 1UTNA 1UMAH 4OS7A 1Y5AT 4FUBA 4CRGA 1C4U2 3V13A 3EE0B 3GCHC 1O2VA 3RU4T 3GY8A 3F1SB 1RIWC 1NO9H 4ZKRU 1L1NA 5TJXA 4BAHB 4ABHA 3BG8A 4AB8A 1V2LT 4BOHA 2VVVA 2C90B 4GUXA 1C1SA 3UWIA 3UNRA 1E38B 2W3IA 4UFDH 1D3QB 4LXBH 5DGJA 1QURH 2ZDAH 1TPPA 1C5UA 1IQNA 3JZ1B 3RXGA 1BCUH 1A0LA 2KAIB 1AHTH 1EPTA 2CN0H 3L3TA 4AFSA 1HAOH 2GCTC 5BRRE 4CRBA 3MHWU 1XUFA 1IAUA 1NROH 1GDUA 3MTYA 1WBGB 1NY22 2GZ8A 1LVYA 2VVCA 1V2PT 1D3TB 4DY7B 4YZUA 1EATA 3RC5A 1Q31A 1G3EA 2QCYA 1ABIH 3TH3H 4X8TH 1C5MD 1OWIA 2VNTA 4AG1A 4B2BA 2BD7A 1QBVH 4ZXXH 1G3CA 2GT7A 3RXEA 3ZZAA 1JOUB 1FXYA 1GBTA 3ZZ4A 1V2MT 1NC6A 1TYNA 2BXTH 1AMHA 1TX6A 3MO9A 1SVPA 3A7VA 5GPIB 2GDDA 2Y80A 2FDAA 2A31A 1GJAB 1QRWA 1SLWB 2A4RA 3U1IB 2NU4E 1FY3A 5J4QA 1MZDA 2BLVA 1Y3YA 1TGCA 1LDTT 3P17H 2ANWA 3HK6B 1ABJH 1LVOA 3V12A 2NU3E 1GMHF 5EW1H 3RXHA 1ZR0A 4DT7B 1QB9A 3NCLA 1GI8B 2BD9A 2FOBA 4ZUHA 1UTJA 4KTCA 1E36B 1K1JA 1G36A 1ZMLA 1Y8TA 2Y6TA 1EJMA 2OC8A 4FUIA 2F9VA 2ZQ1A 2XBWA 2FYRA 1ZYOA 2Q6DA 2BXUH 5ESTE 2BHGA 2XWAA 1MKWK 1ID5H 6CHAB 4YT7H 2OXSA 1QRXA 1V2ST 1UK3A 1B7XB 1GJ8B 2GP9B 3ZYEA 4CRAA 1UJ1A 3MH4A 4NFFA 4FVDA 3T25A 3ATKA 1G2MA 4NWKA 1NFUA 2BY8X 4I32A 3RXKA 1CU1A 1PYTD 2ZU2A 2UUYA 1GHAG 2ZPQA 4B2AA 1ZSLA 3M5OA 1O2YA 2BD5A 3OYPA 1B0EA 1T4UH 1O36A 1L1JA 3MU0A 4A6LA 5FAHA 3ZYDA 1MU8B 1SR5C 1T8LA 4MLFB 3SU2A 1Z1IA 1HNEE 1E34B 1OWEA 4O9VA 5FBIA 1A4WH 3UTUH 6CHAC 3BN9A 2OCVB 5L30H 3TJNA 3SV6A 2FP7B 3RXOA 4ABIA 1SGRE 3N7OA 2TRMA 4HTCH 2GKVE 1IQFA 3RUOA 2WPMS 3LT3A 1GBIA 1LKBA 4Y11E 3E6PH 1P04A 1B5GH 1O5GH 2BQ6B 1HAZB 2TBSA 4D9RA 1LHEH 1P2QA 1M9UA 1BMAA 1YPJH 3MU5A 3ZZ7A 2BDBA 4AFUA 1XM1A 1KXFA 2ANYA 2ZDNA 5E0JA 1MQ6A 3FZDA 1K9OE 3PO1B 3UOPA 4ABEA 4CRFA 4X2VA 3U8TH 1E35B 1EZUC 3M3VA 7GCHF 1SQAA 2ZTYA 4GHTA 8GCHF 1KLTA 1OX1A 1GI3A 1YPHE 1L4DA 3VEQB 2J94A 2I6QA 1EAWA 1IQGA 3O8CA 2H6MA 3FFGA 3D49H 1RS0A 2R9PA 2FXRA 1GJ9B 1NFYA 1VITF 2C8YB 3RM2H 1OKXA 1TGNA 1C4V2 1GVKB 1Z1JA 3TVJB 2ZPSA 3DHKH 1UO6A 3RLYH 2XBVA 3STJA 4B74A 4K5ZA 2ZDVH 3F6UH 1C5PA 1YF4A 3QN7A 1PYTC 2WINI 2KAIA 1O3AA 1HAGE 2ZDLA 1OWHA 2HNTC 4NG9H 1XXDA 4Q7ZA 4Q80A 2BVRH 1NU9A 4Z0KA 2FS9A 1ELEE 1QA7A 3PO1C 1V2OT 2FLBH 2BOKA 2C8WB 2FOMB 1O3FA 2QXGA 1HFDA 1SLUB 1PPHE 3BSQA 2GTBA 4A92A 1E0FD 3PV4A 1C1MA 1GBCA 1AD8H 1D9IA 2PHBA 4X2XA 4Y6DA 4ZAEA 2P3UB 3UR6A 1IQJA 2XC5A 1LVBA 1V2QT 2ZFQH 1O2WA 1K1OA 1V2RT 1ZJDA 1GHYH 2BQ7B 1XVMA 3A85A 2ZDMA 5EPNA 2ZFSA 3SU1A 1H4WA 4D9QA 3K6ZA 1BZXE 5C1YA 3TH4H 5K7RA 2VINA 2R3YA 1YM0A 3LU9B 2H5DA 3G01A 2BDYA 3TJUA 1RTLA 3UUZA 2F91A 3MO6A 3EQ0H 1DANH 1FPHH 1O2GH 2OINA 2TGDA 1UTKA 1C2DA 2GX4A 1KLJH 3RC4A 2C8XB 1AE8H 3ZZ6A 4AGKA 5A8ZA 1ELFA 3QK1A 1GBHA 1GMHG 1SB1H 1P01A 1CGHA 1YKTA 4CH2B 2J95A 2PTNA 2GZ7A 1DWBH 1MCTA 2Z9GA 1GI1A 2GZ9A 5H4IB 2Z3EA 3A82A 4IMQA 1V3XA 1O3LA 4B71A 8LPRA 2A7CA 4I31A 1PPCE 3GCOA 2BZ6H 3A88A 2FOCA 2VIOA 2H1UA 2DUCA 4WJG2 1EZQA 3DT0H 2J34A 1C2KA 1A0HB 2A32A 3CP7A 1OSSA 2FOGA 2H9EH 4WMEA 2ZC9H 2D1JA 4X2YA 3AW1A 4B75A 4MVNA 5C67A 5A0CA 1XMNB 3GICB 4OS2A 1B0FA 1NESE 5JBBS 2QC2A 4JMYA 1DLEA 1TRNA 2AS9A 2PGBB 4GHQA 3F9HA 1CVWH 3M5NA 1L0ZA 1G37A 1LHFH 2VWOA 4GPGA 1DVAH 1BJUA 2PV9B 5JDUB 1WUNH 2BOHB 1LPKB 4WWYA 1S85A 4MPVA 2TGAA 4YO9A 4THNH 2F9OA 2ZGCA 1GJ6A 1JXPA 4ISIH 5FPSA 3SUDA 5G4BA 1BRUP 2VVUA 2ILNA 2RG3A 2ZKSA 3M3TA 1W3CA 4IS5A 4X1QU 4CR9A 2SGFE 1C5ZB 1EAIA 1NZQH 1Z71A 3AVZA 1P2IA 2Z9LA 1JRSA 3AASA 2BDIA 5LGOA 4LZ4B 3EA7A 1NRRH 4A7IB 1C2FA 2SGAA 3ZVAA 2ZF0H 4NSVA 2IJOB 1GCTB 2AGIX 7GCHG 3BIUH 2ANMH 4ZMAH 1O2RA 3LIWA 1Y3UA 2PR3A 1GWAA 5EXNA 8GCHG 1Z8GA 1P3CA 1O2SA 1O5EH 3SQEE 1GJ7B 4CRDA 5GXPA 3SV9A 3PWCA 4IC5A 3SHCH 2O8MA 1GBLA 2PUQH 2AYWA 5FPTA 1C2GA 1VITG 4INLA 5GCHF 1YCPM 5EQRA 5IYTA 1SGFG 1AKSB 1ZHRA 1V2UT 1AUTC 1SGYE 1VZQH 4X8SH 1FAKH 3U1JB 4OGYA 2A7JA 2F9UA 3RMNH 2WPHS 5JBCS 3QDZB 3BTFE 1ESAA 2OLGA 2Z9JA 3TLOA 5JBTA 4ZROA 1P9UA 2XW9A 1GJBB 1T4VH 1O2IA 5CE1A 4NSYA 1GCTC 1JIRA 2DE9A 4FUGA 1CSOE 2FI5E 1W0ZU 2PWXA 4NZQA 3FZZA 2PW8H 1UTOA 4ABAA 1KYNA 3LGVA 3SV8A 1WU1A 4BNRA 1TNKA 1EZXC 3EDXB 1E37B 3OU0A 3TGJE 2BDCA 3SUEA 2R3UA 1VITH 4MG3A 1BUIA 1Y3WA 1N1LA 4DCDA 1S0RA 2ODPA 1TQ7B 4U32A 5TCAA 1BTXA 1O2ZA 4O3TA 2FIRH 1Y5BT 1KXEA 1Q2WA 2EI7A 2ALPA 3SUFA 1HJAB 5C1UA 4MPXA 2QF3A 1TB6H 1QL8A 3GY4A 1D4PB 2ANKH 3RXFA 1EB2A 1GJ4H 1BA8B 2WYJA 2G81E 3I77A 1HGTH 2ODYB 1D3DB 1GVLA 3B9FH 3K2UA 6LPRA 1BIOA 1PQAA 4K8BA 1EAUA 2EI8A 1S82A 2YNBA 1YLDA 4I8LA 1FPCH 2EEKA 2AGEX 1C5OH 1W2KH 2BDHA 4A1TA 1MTSA 1V2JT 3ZZ3A 4AX9H 1TAWA 2OBQA 1UCYH 4XE4A 3SU3A 1KDQB 3KF2A 1QNJA 2Z94A 3SW2B 1GBDA 1BRAA 1SGCA 4IMZA 3RM0H 2PKSB 1P2KA 1HJAC 1TPAE 1YLCA 5F03A 3LC3A 1K21H 3A7XA 3LH3A 2O8TA 1C2EA 2BMGB 1HYLA 3HGPA 2FTMA 2QA9E 1ZPBA 4X6OA 3RXDA 3RXQA 3SO3A 1YCPH 1W8BH 3FP7E 1GI9B 2SGDE 3ODDA 1O2KA 1DDJA 3RU4D 2TGTA 4BAKB 1IHSH 1WOFA 2UUJB 1BOQA 1VR1H 5EXLA 1FJSA 3OY5U 3AAUA 1OS8A 1CT2E 1Z6EA 1O3IA 3MH7A 1O2TA 1TNLA 1TBRH 3P8GA 2O8UA 2ZGBH 2ZU3A 1AUJA 2A7HA 2B7DH 2G8TA 1XUJA 3ODFA 1K28D 1DWEH 1O3JA 1ZPZA 2PKSC 3A81A 1MUEB 1MTNB 1H8DH 4TWYA 2R0KA 1GBEA 5FX5A 4ESTE 4CBNA 1NM6A 3TNTA 1SHYA 4WH8A 1SI5H 3E0NB 4H6SB 2BM2A 1TPSA 2VWLA 5C20A 2ZP0H 2Y82A 1ARBA 2OP9A 4BTUB 1TALA 3MMGA 3RP2A 4GVUA 5DP4A 3SZNA 3KIDU 2ZG0H 3RMMH 4ZXYH 3ZVGA 2UWOA 1GCDA 2NWNA 2VIWA 4ZKOU 1NRPH 3LGUA 5AHGH 4ABJA 1C1RA 2OTVA 1TMBH 1TOCB 2XYAA 3SORA 3KL6A 4J1YA 2P95A 5EXMA 4ABDA 1YBWA 3MNBA 4AB9A 1MTNC 3IITA 4WH6A 1FY8E 2CHAB 4YOJA 3MU4A 4F49A 2ZZUH 2UUFB 4NWLA 2CGAA 1KXBA 2XWBI 5GCHG 1XKAC 1GBBA 2G00A 2ZHEH 1TE0A 3LOXA 4DVAU 5DP5A 3AAVA 3HATH 1WQSA 1Z8RA 2ZFRH 1P57B 2AMPA 2XCFA 1KY9A 5J4SA 1BHXF 1SGEE 3L33A 2CF9H 3RLWH 8ESTE 1P11E 1GBMA 2RDLA 3PLKA 3SNEA 5FXLA 3UQOA 2P8OB 1WCZA 2W3KA 1DSUA 1C2LA 1GI2A 2XXLA 2A4QA 3E1XB 1ZPCA 1AB9B 5AFZH 1Z8JB 4FUEA 1SGFA 1QIXB 2CHAC 3ENSB 3RXPA 4FU8A 5HYOA 1QJ1B 5JBAS 4I33A 1ESBA 5A8XA 3AW0A 2HGTH 2J9NA 1BDAA 5JB9S 1GG6B 2G4UA 3SU6A 3SN8A 4UFGH 3M36A 1ELBA 2C93B 3SU5A 1LHDH 2AIPA 2O8WA 5DKMA 1RRKA 4H42U 3R3GB 3OY6U 1DPOA 4FUJA 4UD9H 3MNSA 3LKWA 2YOLA 2A2QH 3E8LA 4I8KA 4FUHA 1QJ7B 1BBRH 1GL0E 1ZRKA 3VB3A 1O0DH 5JB8S 1G30B 1ANBA 1QL7A 1WTGH 5LPFA 3VXEH 3KQBA 1C5RA 2W26A 2OD3B 2ZGHA 1GMDF 3SOSA 1L2EA 1ZZZA 1C5TA 1MQ5A 2ZA5A 1UVUH 1DUEA 1HAXB 1YPEH 4YLUA 1AB9C 4FU7A 2ZCHP 5DG6A 4NZLA 4HI3A 1THPB 2BY6X 2PLXA 3U69H 3UPEA 1EJNA 1TONA 1SLVB 1GG6C 4INKA 4DW2U 1BQYA 2IOTA 4O3UA 2ZFTA 3GDSA 5TCCA