5DKMA

S. erythraea trypsin michaelis-menten complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
229
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
total genus 59
structure length 229
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA01
5JBBS 1O32A 1GJ7B 2TGPZ 4Y6DA 4DW2U 1C1WH 4GPGA 1VR1H 2C8ZB 3BTQE 1MD7A 2TGTA 5C1UA 1BHXB 2FTMA 4MPVA 2ZQ1A 1ELBA 2JH0D 3E1XB 2Z9JA 1HJ9A 2UUFB 3V7TA 1LVOA 1JXPA 2CHAB 1AFQC 1SGCA 3SNDA 2FPZA 1O2RA 3I78A 1N1LA 2PSXA 3LJJA 4D9RA 5C20A 2XC4A 3M5LA 1Y59T 3BTDE 4TY6A 4ZXYH 1CHOG 2VVCA 3M7TA 3SHCH 2C93B 3U98H 2JETC 2FLBH 2WUBA 1ETRH 1QIXB 3ATKA 2AMDA 1AIXH 1QL9A 2ZO3H 3ZZ5A 1AO5A 2FX6A 4ZKSU 4FU7A 3LGUA 2V0BA 1KTSB 1DX5M 1WV7H 6ESTA 2GV7A 1TAWA 3S9BA 1Y3VA 1J15A 3DUXH 2FOBA 1AZZA 1SOTA 3RC4A 3UWJH 1MKXH 2EI7A 1HUTH 2VIPA 3BG8A 4ZUHA 3P8OA 3LH3A 1C5ZB 1BTWA 3PWBA 2Z3DA 2ZIQH 1Z6JH 3D49H 2ZDAH 2GP9B 2RG3A 1SHHB 1IOEA 1ELGA 3TJUA 5FX6A 1KDQA 1D3DB 3ATIA 2EEKA 3QN7A 3F9HA 2ZU5A 4WXIA 5DPAA 1P2JA 1WQSA 1THRH 1D3PB 4IGDA 2R9PA 1W12U 1MTUA 1G36A 1EAXA 1OS8A 1BTXA 4XBBA 3PLPA 4Y11E 2FDAA 4ABHA 1WAYB 3TGKE 3HGNA 1HB0B 1MMJN 2FOGA 3B9FH 2R3UA 2J94A 5ESBA 2VB0A 1AB9B 2WINI 2FS8A 4ZMAH 2C8YB 4FU9A 3SU4A 4ZXXH 5I25A 1C5OH 2Z7FE 2HNTC 3QLPH 2WYGA 1DWCH 1LKAA 1P01A 1WBGB 4BXSA 2J95A 3A8CA 5FCRA 1T31A 2I6SA 2V35A 1UVTH 4ASHA 1UCYK 2XTTB 3GY2A 3Q76A 2CMYA 5F8TA 3QZRA 2F9VA 2A2XH 3L6PA 5B6OA 3RLWH 2HOBA 1KLIH 1ZOMA 4NA8A 2C4FH 2OBOA 3W94A 3Q77A 5DJ7A 2FI4E 3WY8A 4MDSA 2P59A 3NKKA 2BTCE 3ZZBA 1G3DA 1E37B 1OWHA 2AMQA 2B7DH 2PSYA 5CHAC 3UUZA 4A92A 1ZSJA 1WOFA 1MZDA 4OS7A 3PM3A 3A7WA 4YT7H 1KLTA 3ELAH 1TFXA 4U30A 1O2NA 1LVYA 1EQ9A 1THSH 1OWDA 2VWLA 1F5RA 5E0GA 1TRMA 3RXSA 2F91A 1ACBE 3UFAA 3SU2A 3M7UA 2FP7B 2NU1E 4CRGA 1M9UA 2OP9A 3FP6E 3KGPA 5LPRA 5LPEA 3ZZDA 1OKXA 4AG1A 1D4PB 2J9NA 2XNIA 1C1VH 3VB6A 3ZVDA 2BVSH 3T62A 5GWZA 3KCGH 1GMHF 1V2UT 1SGNE 1KSNA 4A1VA 1DS2E 3BTTE 4JYUH 2ZQ2A 1BMAA 3PO1C 1QTFA 5A8YA 2FOEA 1YCPH 1V2MT 3SW2B 1MKWK 4B76A 1EOLA 1HJAC 4X2XA 2H9EH 2WUCA 2VH6A 1KXDA 1TNHA 3T25A 4Y0YE 1JIRA 1YPLH 2SNWA 6CHAB 1GI9B 1N8OC 1TA2A 3BIUH 4KGAA 2FI3E 1DVAH 2D2DA 1O2GH 1GCDA 3LJOA 1BZXE 3QUMP 4AYVB 4K2YA 2FOHA 2BY5X 4I7YH 1DSUA 4I8JA 1P05A 4X8SH 1QRWA 1ZZZA 1AKSB 1O36A 3U1JB 2GMTB 1N6XA 3BEFB 4H42U 1VITG 1YPGH 3MU5A 1O3PB 2GV6A 1P3CA 1QCPA 1NC6A 3FAOA 3RU4T 4A1TA 2BOHB 1F0RA 2GDDA 4F4OC 1TMTH 1C2DA 1GBLA 4I8LA 2ILNA 2Z9LA 1UK4A 1LVBA 8GCHG 3SU6A 3GY8A 2EI8A 1BRUP 1W7XH 1WYKA 2BXTH 4YLQH 3A8AA 1GMDF 3OY5U 4Z0KA 2QA9E 1VZQH 3RXBA 2GZ7A 1QR3E 1GI5A 4Q7XA 2ZGBH 1SG8B 1C5UA 4J2YB 2P94A 3SJIA 4Y76A 1BOQA 4GCHG 5F8ZA 1WSSH 1ELVA 5FCKA 4ABAA 2OBQA 2BQWB 1OSSA 1ZGIA 3MH5A 1OYTH 3S7KB 3GY3A 1DSTA 3KQBA 5E0JA 4IC6A 4LZ1H 1GBHA 1UHBB 3A7ZA 1CSOE 1GBCA 3D65E 4NCYA 1MUEB 5FBIA 4B74A 4BTTB 3I29A 1A7SA 3GICB 5EOKA 1FY4A 1C4Y2 4TPIZ 4B73A 2HNTF 4IW4E 1KLJH 2ZDKA 5AVDA 1UTPA 3TK5A 2G81E 3BEUA 3M7QA 1GI8B 4BNRA 2H6MA 1FY1A 5FXLA 1AVXA 3NWUA 2F9NA 4WY3A 1UK2A 2GCTC 2PUQH 4JK6A 3UIRA 1WCZA 1TGCA 1V2VT 2QCYA 5DGJA 1EX3A 3SUGA 3VFEA 4CREA 1C2KA 3K9XB 1AU8A 4Y0ZE 4GUXA 1XUFA 1O38A 3GDUA 3FFGA 1XUKA 1WU1A 3LC3A 2XWAA 4TYDA 1SSXA 2BD7A 1UCYE 3EYDA 3KF2A 5C1YA 1C2MA 1K1PA 2C90B 1EASA 5A0BA 3AW1A 3DT0H 3VGCB 1SMFE 2WPJS 1IQNA 2Y80A 1SLXB 1HNEE 8ESTE 1T4UH 3EQ0H 1VCPA 4E05H 1LTOA 1AUJA 2A4QA 1MH0A 3C27B 1AE8H 1O5GH 3BIVH 1T8NA 2Y5HA 3MU4A 3U8RH 2ZU3A 1TMUH 1P2IA 2IJOB 3GCOA 1LDTT 3KN2A 4O9VA 1FDPA 1O3BA 1E38B 1SFIA 3MTYA 1A0LA 1C4U2 1P0SH 3IITA 4Y71A 2J2UA 3UY9A 1QJ7B 1CT4E 2QF3A 1LHEH 5T6DA 2IPHA 3CS0A 1A2CH 1LHCH 2FOAA 1Y5AT 1U6QA 2Z9KA 1UVSH 3PV4A 3TH4H 1XM1A 2GD4B 2XW9A 1TBQH 1EAIA 4NIYA 1O35A 2HPPH 1AN1E 2VVUA 1BIOA 3A8BA 1O3NA 3PTBA 2GX4A 1V2QT 1YPHE 5AFYH 1DDJA 1S83A 3LH1A 3PLKA 1K21H 2Z3EA 4KTCA 1PPHE 3MU0A 1GDQA 1GMCF 1A1RA 1ZRKA 1SOZA 3RMMH 1CE5A 1H8DH 1O5DH 2VINA 3GDSA 1BBRE 3NK8A 1OPHB 2OLGA 1SFQB 1V2ST 2ZCKP 3M3TA 4TWYA 2NWNA 1AKSA 1V6DA 1AZ8A 2RCEA 1GI0A 4B2AA 1ABIH 1QY6A 3LGYA 1EPTB 3RC6A 1P9UA 1LHGH 1FN8A 1NROH 3GY4A 3F1SB 2PHBA 2ZCLP 3RXVA 1GJ5H 2OC0A 1Z1IA 3AAUA 2PGQB 1AB9C 3BV9B 1BA8B 4KP0A 1SVPA 1KXBA 4OGXA 1JBUH 1O2IA 1UTMA 3A87A 1RGQA 3FP7E 1Z1JA 1LPKB 3TK6A 3UWIA 1P8VC 2ZTXA 3FZDA 5BPEA 1K1MA 3E90B 1EOJA 1JOUB 4DG4A 4NSYA 3QWCH 3U1IB 1QB1A 1SQAA 1EUFA 1W2KH 1OWKA 1T4VH 1DE7H 2V6NA 1XUGA 1NRSH 2ZGXH 2ZP0H 3Q3YA 1PJPA 1MAYA 1EAUA 2P3UB 1UHBA 4E06H 1V2OT 1L4ZA 3MWIU 2UUKB 2QC2A 3KIDU 2ZPSA 3FVFB 4X1QU 1AY6H 1O2VA 5FPYA 1ZRBA 1FY8E 3A84A 1BTHH 1NS3A 2DE8A 5JB8S 1A5GH 3IG6B 3FP8E 1EZQA 1SGTA 1C5VA 1HAPH 3ZVAA 2ZDMA 1VITH 1BDAA 4CH8B 1GG6B 3E16B 5C5NA 2VWMA 2BZ6H 4A1XA 5FPTA 1G30B 1BUIA 2F3CE 3LONA 4INHA 1TQ7B 1FNIA 1TGSZ 3RXPA 1V2LT 1HV7A 2G51A 4X8TH 2ULLA 1O2LA 2FWWA 3T26A 5DP8A 1TNGA 3RXTA 1MTVA 2D8WA 2ZU4A 5C1XA 3RXRA 4BTIB 5HM9A 1GHAG 4RSPA 3BEIB 2TRMA 1TB6H 2BDYA 4JZ1A 3NCLA 1Z7KA 4O03A 2HLCA 4DIHH 2O8UA 1EXFA 1SGIB 2P16A 3KNXA 3NZIA 1EJNA 2D1JA 3ZVCA 2RDLA 1DWBH 4DURA 2K1QA 3RXMA 4TWWA 4UD9H 5EXMA 5K7RA 5A2MH 4K1SA 2GT8A 4BANB 1FPHH 1OP8A 1MTSA 3GY7A 1G2LA 3ZYDA 1THPB 1P3EA 5C2ZA 3Q3XA 2ZGJA 1G3BA 2WPLS 1HXFH 2A7HA 3PLBA 2QIQA 4K60A 2BLVA 2OINA 3KQCA 2QV1A 1FPCH 1P06A 1CT2E 1O33A 4WWYA 1Y5UT 3SV2H 1MTNC 1QJ6B 3SBKA 1HIAB 2GMTC 1P11E 2F83A 1G9IE 2BY6X 3V3MA 3TNTA 2GCTB 2ZEBA 1BB0B 5TCCA 1DWEH 5FHTA 1LPZB 3EA9A 4OS1A 2PW8H 2H5DA 3EDXB 2P3FH 2BY7X 4ISOA 5T6GA 2SGQE 4CRAA 2QXGA 4YESB 3O8RA 2Q1JA 3GOVB 1BJUA 3UTUH 4GLYA 1QFKH 2PWXA 1E35B 2XRCA 1BBRH 2C8WB 4CR5A 1C1NA 3ZVBA 1MBQA 1L1JA 5EXLA 2VIDA 3KEEA 1NTPA 4DVAU 1HAZB 1MKWH 5HYOA 2P8OB 1HFDA 2H5CA 5GCHG 1H4WA 2FM2A 4YLUA 1EPTA 2ZDLA 1GBEA 6GCHG 1O2MA 1OP0A 3CS7A 2AGIX 3OTJE 1FMGA 1W7GH 4UE7H 4YM9A 5ABWA 3NUMA 1VCQA 3T2NA 3HK3B 4X6MA 3FANA 1TRNA 1IQHA 1EB1H 1FIWA 3GY6A 4R0IA 4MNWA 5EQRA 2PKSB 5HMAA 5A8ZA 3MU8A 4HZHA 1XUHA 1O3CA 3B8JA 1FAXA 3SJ9A 4INKA 1IQMA 4I31A 2Y5FA 1ELAA 2ANYA 4DT7B 1YCPM 3UNSA 5TJXA 1GDUA 3T5FH 1LHDH 2BY9X 3PTNA 4AFQA 4X1SU 4CBOA 1ETTH 1EP6A 3B23B 3MNCA 2SNVA 2EI6A 2G52A 2GZ8A 4ZH8A 1RFNA 3ZZ7A 5EW1H 3STIA 5J4SA 1P2OA 1BMNH 1ESBA 1NRPH 2WV5A 3SI3H 2XC0A 3SU0A 1Y8TA 3N7OA 2UWPA 1DICA 1K1IA 1H1BA 1NM6A 2ALPA 2ZTZA 1QL7A 3G01A 5HM2A 4AYYB 1AWHB 4B2BA 3RXCA 4KTUA 3VGCC 2A32A 1DFPA 1UTLM 2H1UA 3EGKH 1GHBG 5C3NA 3GCHB 4B2CA 4K8BA 2QXJA 3CENA 2Q6GA 4Q2KA 5JBTA 1B7XB 1NT1A 4K5ZA 3GCNA 4MLFB 2AIQA 3HPTB 3UR6A 1SGEE 2ESTE 3NXPA 4FXGH 3LOXA 1FV9A 5EG4A 1YPHC 1AI8H 3S7HB 1VCWA 3A80A 2XBXA 2ZFRH 1NFUA 1SB1H 2QYIA 2G55A 2Q6DA 1SLUB 2FYRA 3K2UA 1OWJA 4HFPB 3UOPA 3SU3A 2FTLE 1C5NH 1O2JA 2YNBA 2FYQA 3KL6A 5GJ4B 2STAE 2A4OA 3PMJA 4A5TS 1XKAC 2CJIA 1Q2WA 3BTKE 5SGAE 4JZFH 3TGIE 4NFFA 1BQYA 1Z8IB 2FS9A 1YC0A 3D23A 1F7ZA 1C5YB 1O3FA 4CR9A 1PPZA 1O5CB 1UTOA 1K9OE 1NRRH 2HALA 3F6UH 1TONA 1GJBB 4ZAEA 3LGIA 2J34A 1HIAA 1QJ1B 4U2WA 4ISNA 1IQKA 3ZZ6A 1NFXA 3P17H 4F49A 4FUEA 2UWOA 1AQ7A 1EZUC 3LDXH 3STJA 1EPTC 3F9FA 2ZZUH 1Y3XA 1GBMA 2BHGA 3P8GA 3MNBA 3UREA 4XSKU 3T27A 5FAHA 4FUHA 1K1JA 4NZLA 3OX7U 2VJ1A 1TIOA 4KTSA 1AWFH 1DM4B 1K2I1 2BX4A 1BBRK 1O2HA 1FI8A 1QQUA 1AD8H 2HRVA 3K6YA 2ZHWH 4GVUA 3MFJA 3QTVH 1KIGH 1SLWB 1TPSA 3QX5H 1EJMA 1SGFA 3P8FA 3UOUA 4FUBA 3ITIA 3NPSA 3A7XA 1MU8B 3BTME 2BLOA 1BJVA 4D7GA 1TA6A 3DFJA 3SQEE 1C2FA 4X1RU 4AOQA 2QF0A 1TNKA 2P3TB 3P70B 1CT0E 2ZI2H 5T6FA 2C8XB 4INLA 2FOMB 2FEQH 1V2KT 2Z9GA 9ESTA 4UEHH 2XXLA 5AHGH 4AB8A 3VXEH 8GCHF 2ZHEH 3GDVA 3UNRA 4YT6H 4AX9H 4YTAA 1ABJH 1BTPA 1ZMNA 1MTNB 4HTCH 1GG6C 3K65B 4I8HA 1KXCA 1G37A 3T28A 1FAKH 9LPRA 2ZU2A 2P93A 4GCHF 1SGYE 3CP7A 1WTHD 1YKTA 2OUAA 1GMHG 3LT3A 1XX9A 4X0WU 4IMZA 3P6ZB 1GJ4H 1A46H 2J92A 1A4WH 3ZZCA 4MNYA 1KY9A 1ZR0A 1CGJE 2ALVA 1GCTC 2BLWA 2ZF0H 2ZFFH 3GY5A 1GI4A 1W3CA 2CGAA 2FLRH 4WXVA 2BYAX 3RM2H 4YOJA 1Z8GA 1RTLA 2UWLA 5A0AE 1O3DA 1C5LH 2ZC9H 1BTYA 2UUYA 4J1YA 2Y7ZA 2OC8A 1S84A 3LIWA 1G3EA 3M5MA 1RRKA 1A5IA 1YP9A 2ZU1A 1C5SA 2BD5A 4X8VH 3BTHE 5JYIA 1GBAA 1HXEH 1KXFA 4Q7YA 1Z8RA 2VH0A 1TMBH 1D6WA 3ZV8A 1NFYA 5EQQA 1LKBA 4X2VA 4WH6A 1AHTH 1MCVA 2R0KA 3PMAB 1TX6A 2BDGA 1ARBA 2HGTH 2A45B 2Z3CA 4UFFH 3SJOA 5DP4A 2VVVA 1XXFA 3EA7A 5JBAS 3BTWE 4TPYA 5FX5A 1GMDG 5CE1A 4MNXA 4KKDA 2TIOA 4UFEH 1DWDH 1F0SA 3BTGE 2BVXH 3ODDA 1AGJA 1UTKA 4JYVH 2FOCA 2V3OH 1O3EA 4FVDA 1LPGB 1SL3A 2BM2A 4DIIH 2RA0A 2BOKA 2ASUB 3D62A 2PTCE 1ZPBA 4NIWA 4RKOB 1UO6A 1UVOA 2O8MA 1OWIA 1PPGE 2R3YA 3O8CA 1D3TB 2ZG0H 2HVXA 3E91A 1CU1A 1PQ8A 1C1UH 1GBKA 5E8EH 3SU1A 2W7UA 4CRCA 2ODPA 1C2HA 1BCUH 4SGAE 3RXGA 3RP2A 1B0EA 2O8TA 3I77A 3MO9A 1C1RA 1PQ7A 3SNCA 2A5IA 1AMHA 1Y5BT 5EW2H 1AVWA 1O2YA 1T7CA 1TYNA 3PYHA 2F9UA 4LOYH 3RMNH 2P8OC 3TNSA 2ZHQH 1QA0A 3EA8A 2KAIB 1O3AA 2QAAA 5GIBA 4ABIA 4NFEA 2G8TA 3L3TA 1YPKH 2SGFE 4UDWH 1GI1A 4TY7A 7GCHF 4IN2A 1KXAA 1PPCE 3U8OH 3DA9B 2I6QA 2PKSC 1QBOA 4K69A 4RKJB 2VIVA 3UR9A 1MZAA 5F6MA 1IQJA 5JBCS 5DK1A 1D6RA 1T8OA 2WPHS 3A86A 4BAHB 1RIWC 2ZTYA 1C5XB 3SV6A 3E6PH 3MHWU 1C5WB 1QB6A 5IDKA 3M61U 3HK6B 1GJAB 2QGRA 3SJKA 3A7VA 5GDSH 1A3EH 4WH8A 4AB9A 2A2QH 4YO9A 4Y7BA 4D7FA 1XMNB 3ATMA 1RD3B 1YYY1 1CGIE 3V13A 1W14U 4AGKA 1C1TA 2BQ6B 1XKBC 2HNTE 4NG9H 3A85A 3A81A 5C5OA 5K0HA 1SPJA 2VIWA 1TPAE 5AFZH 1SQOA 1CHGA 3OU0A 1Z6EA 1B5GH 5DP5A 1NU7B 1FY5A 1O0DH 4D9QA 3GCHC 4LK4A 1IQFA 1FUJA 1P2MA 4AFSA 4ZHLU 1QL8A 3TGJE 1D3QB 1HAGE 4X6OA 1L1NA 3TPIZ 3M5OA 3Q3KA 1XUIA 2W3KA 4X2YA 3S9CA 1HJ8A 3ZYEA 5LPFA 1PPEE 1Y3YA 1N6YA 3PWCA 3TVJB 2AH4X 1ZMLA 2HWLB 4U01A 8KME2 3ZZAA 1F2SE 2PUXB 1EZXC 2OC7A 1OP2A 2Y81A 2WPIS 3K6ZA 1K1OA 1P02A 4FU8A 1BMMH 4JMYA 1ZPZA 3C1KA 2SGDE 1DANH 3M5NA 5E2OA 4XBCA 2WV4A 1A3BH 5DP9A 2HPQH 1AE5A 4WF8A 2AGGX 1TPOA 4IC5A 5BRRE 5E2PA 1QA7A 4O3TA 3ZZ3A 1J9CH 1S85A 3FZZA 4K1EA 2WPKS 4X6PA 1P09A 2O8WA 4IBLH 3SI4H 3KQDA 4X6NA 4WMDA 2ZGCA 1O3GA 1UJ1A 2F9PA 5A8XA 3M3SA 4H4FA 1G2MA 1CGHA 1HAHH 1PYTD 3MU1A 1BITA 1DY8A 1UTJA 3SGAE 4BOHA 2Z9IA 1ESTA 1JRSA 3Q00A 1YPJH 1RS0A 1DUAA 3GCTG 3VXFH 1GCTB 2GCHG 3GISB 3RXKA 3SOSA 3S0NA 5ETXA 1TGTA 3RXEA 3ZV9A 2W7SA 1BT7A 1O31A 1GVLA 1P03A 2AERH 4ESTE 1G32B 2NU0E 3U8TH 3ATWA 1C2JA 1G3CA 2XWBI 5A09A 2F9BH 1J17T 1SGDE 2SGEE 3KHVA 2ZFPH 4AFUA 1S6FA 2CF9H 5FPSA 3OY6U 2PV9B 1Z71A 1XVMA 4MQAA 3A82A 1EATA 4BXWA 2BXUH 3UPEA 4IMQA 1GHWH 5L30H 7ESTE 1IQLA 2XC5A 1KYNA 3TJOA 2Z94A 2KAIA 1O5AB 3SGBE 4CBNA 3MNSA 2J38A 1S82A 2OQUA 4GHQA 3SHAH 1O2OA 1NU9A 3RXOA 2A5AA 2XCNA 2OC1A 2ODQA 1HBTH 2H9HA 1GGDB 3M3VA 1ZHRA 4XFQA 1ZJKA 1B0FA 2ODYB 3BN9A 1GPZA 1BTZA 1NRQH 1W11U 4B75A 4E7RG 3SGQE 4ZHMU 5EGMA 1FZZA 1ZHMA 2OQ5A 2ZPRA 1P2KA 4ABGA 1SI5H 2ZNKH 2AEIH 4IS5A 3VPKA 3P8NA 1MD8A 2Y82A 1KXEA 3PB1E 2ZFTA 1P57B 1K1NA 4THNH 1VJAU 5JDUB 3ZVGA 4WVPE 2Z6BD 1W0ZU 4AFZA 3KQEA 5GCHF 2BDHA 1CHOF 6GCHF 3QGJA 4AN7A 1V2TT 2RA3A 4XOJA 3HGPA 1PPBH 4Q7ZA 1O5BB 3V0XA 2CV3A 3RUOA 3ZZ4A 1Q31A 1BRAA 1BRBE 2ZKSA 3JZ1B 2A5KA 1LVMA 1QBVH 4YOGA 3QZQA 4SGBE 3MH6A 1MBMA 1A0HB 1IQEA 4E7NA 2BD8A 3MO6A 3E8LA 2ZCHP 1C9PA 1TNJA 2ZDVH 2H2ZA 2G4UA 2B0FA 2OXSA 4ISHH 3MNXA 3OSYA 4BAOB 1ANCA 3SV8A 5A0CA 3RDZA 1V2PT 3LGWA 5IYTA 1GVZA 3MMGA 1HAIH 3MH4A 3AVZA 2Y5GA 1LO6A 1QGFA 1UMAH 4FUGA 1OX1A 1RIWB 1HAVB 1QNJA 2JH6D 2M5TA 2VIOA 1H9HE 3RXJA 1TBZH 1C5RA 3QK1A 1NESE 2R0LA 2BD4A 3SUFA 3V12A 2CXVA 1WQVH 3SU5A 4Y10E 3LC5A 1GHBF 2XYAA 3ZVEA 1E0FD 4I8KA 2YOLA 3MOCA 4FUJA 3ZVFA 1S81A 1PQAA 1O34A 4AGJA 3BG4B 1GBJA 5DP7A 4B1TA 2FMJA 4NIVA 1O3LA 2A7CA 1VJ9U 2DUCA 1TGNA 2VGCB 1PQ5A 1CBWB 1HAXB 4I33A 1GL0E 5PTPA 1CA0B 3VEQB 2O9QA 4ZKNU 2BDBA 3QO6A 1Y3WA 2H9TH 1GJ9B 1QRXA 3S69A 3SV9A 2NU4E 4X1NU 3UNQA 3TJNA 3LGVA 1SR5C 4ZROA 2TGAA 5T3HA 3SJ8A 3UQOA 2GVFA 1ZPCA 4XDEA 1IHTH 3SN8A 1PPFE 4PROA 2VWNA 1YPMH 1C2GA 2ZHFH 1ZTJA 3RU4E 1QBNA 2PKAB 2VU8E 1OXGA 4K8YA 5GXPA 1MQ5A 1AUTC 5F03A 1ELTA 1DLKB 1SGRE 4CHAB 3TITA 2ZFSA 4R8TB 1TABE 2FIRH 1GJ6A 1QQ4A 2PGBB 1ANEA 3M36A 4NGAH 3O8DA 2EA3A 3U9AH 1MCTA 2EC9H 1Z8JB 1OYQA 2BDIA 2NU3E 5F8XA 2AS9A 1FLEE 1O5FH 1TQ0B 1TBRH 1Q3XA 1O30A 4DCDA 1K22H 2BY8X 3S9AA 4GHTA 2GGVB 1VGCB 5LGOA 4NWKA 4FUFA 1RXPA 2FX4A 4U32A 1CQQA 2AGEX 4O3UA 3TLOA 4CH2B 4OGYA 1IQGA 1HRTH 1YBWA 1GI2A 3AASA 3EE0B 2Q6FA 2W3IA 4X8UH 4VGCC 1AFEH 1ZJDA 2P95A 4XE4A 4JYTA 4DGJA 3A83A 1MU6B 1IQIA 3QDZB 1O3HA 3LGTA 3TJVA 1DLEA 4UFDH 2ANWA 1ELDE 2FESH 1ZHPA 1V2JT 3IWMA 4ZKRU 2IN2A 3L33A 4XBDA 2GTBA 1FXYA 1C2IA 1TX8A 3R3GB 4A7IB 4FUCA 1ARCA 7LPRA 3RMOH 5H4IB 3SNBA 1XXDA 4DY7B 4LZ4B 5DP3A 1TNIA 4JCNA 1NFWA 1DXWA 2A31A 2AMPA 2FO9A 1GJDB 1GHZA 3PMHB 1FJSA 3SUDA 3RXUA 1F0TA 1VITF 1O2ZA 1UTNA 3SNEA 1C1OA 1ZGVA 3PMBB 1GJ8B 2WYJA 1SHYA 1O39A 4BAKB 1GVKB 4WMEA 2ZDNA 1SBWA 3A88A 2BQ7B 5DO4H 1O2WA 3VB7A 3VB4A 1TE0A 4MTBA 3EAJA 1J8AA 1DY9A 1W10U 2B5TB 3ENSB 1SGQE 2BZAA 2XBWA 1UVUH 1HAVA 5LH8A 4YOIA 2SGAA 1GI6A 4OS6A 3ESTA 1IAUA 1L2EA 3HKJB 8LPRA 2ZECA 4KELA 2AFQB 3R0FA 1C5QA 1SLVB 7KMEH 4NIXA 3W95A 2QXIA 1O2KA 1EKBB 2PTNA 1A61H 1LQDB 1MQ6A 2AIPA 4NA9H 3UQVA 1MKXK 3AAVA 1O2XA 3RXAA 1O3OA 5GPIB 1RJXB 1C5TA 4Y8ZA 5CMXH 1J14A 5AF9H 2JKHA 1OWEA 2B8OH 1EAWA 1W8BH 1QRZA 3MH7A 1NPMA 3T29A 1ELCA 3OYPA 1TALA 1EP5A 1AFQB 3VB5A 1C1SA 1C5MD 4Y8XA 1C1PA 2G5NA 2ZHDA 3P95A 2GT7A 4FUIA 4GAWA 1P9SA 4Z6AH 2PKAA 3F9EA 4QT8C 1HYLA 3RXIA 1HGTH 1EJAA 2SGPE 1K1LA 4M7GA 3HKIB 3TH3H 1FQ3A 1GGDC 1HAOH 1RTKA 2JETB 3AW0A 3H7TA 4MNVA 4NSVA 4IN1A 3ZZ9A 1A0JA 2W5EA 1Y3UA 3MI4A 1LQEA 5L2ZH 1GI3A 2J4IA 1BMLA 4RN6A 2ZA5A 2ANKH 4ABEA 1GDNA 4I8GA 4AG2A 4Q80A 1JRTA 3A89A 2R2MB 3BTFE 3U69H 4B71A 1YM0A 1O3KA 2PR3A 4AORA 1WUNH 1P04A 1TX7A 4Y8YA 2FODA 1P10A 2GDEH 3JZ2B 2FI5E 2BMGB 1T8LA 3RXLA 1PFXC 4MPXA 1P2QA 1BTUA 1C1QA 4MPWA 4CRFA 3RLYH 2BDAA 1GHXH 3TU7H 2DE9A 4I32A 1FN6A 1GBDA 1UVPA 4A6LA 2CHAC 4CRBA 1ZYOA 5EPYA 1C2EA 1W0YH 1F92A 3H7OA 2TPIZ 2BB4A 2Y6TA 1O2QA 4OS5A 3SUEA 5HXFA 3URDA 2ZPQA 4GSOA 3TK9A 3HATH 2VIQA 1OOKB 1F5LA 2VWOA 1CO7E 2ZWLH 4JZEH 1C4V2 1L4DA 1HLTH 4ISIH 1TOCB 1NRNH 2ZGHA 1QURH 1NO9H 2LPRA 3RXDA 3SV7A 3RXQA 2NU2E 1DPOA 4YZUA 1ZSLA 1O3JA 1TRYA 1V3XA 2FZZA 1ELFA 4NWLA 2F9OA 4Y79A 3RC5A 1HPGA 5L6NH 1ANBA 3F9GA 1YF4A 5I46H 4ISLA 1PYTC 4H6SB 3BF6H 4WMFA 5JB9S 1C5PA 1QB9A 4LXBH 1JWTA 5DP6A 3URCA 1ELEE 1DUEA 1DITH 1H9IE 3O8BA 1YCPK 4X2WA 3BG4C 1J16A 5E0HA 3RXFA 1D9IA 4WJG2 4Y7AA 3F68H 1JMOH 3M35A 2D26C 4UONA 5DG6A 2BD2A 2VGCC 1GBBA 1CBWC 3E0PB 1TNLA 4VGCB 1CA0C 7GCHG 2FXRA 3MYWA 1T32A 4ABBA 2WPMS 1IHSH 3A7YA 1ZMJA 3E0NB 1MTWA 1P2NA 3SNAA 3DD2H 1O3IA 1HCGA 1O2PA 1W13U 6LPRA 5CHAB 2CF8H 1X7AC 2R2WU 2V3HH 2OCVB 2ZFQH 4DJZB 4BAQB 5EODA 1TWXB 1V2NT 4ABFA 5EQSA 1C9TA 1ID5H 2TBSA 1ESAA 1S6HA 2JH5D 4DOQA 1E34B 1L0ZA 1V2RT 1FONA 3BSQA 1YLCA 1O37A 1ORFA 1FIZA 1GBTA 5FBEA 4K1TA 3H5CB 2THFB 1GMCG 2IOTA 2PFEA 1C1MA 1MAXA 2B9LA 2SFAA 3LKWA 4CHAC 4CRDA 4X1PU 4K3JA 2YNAA 1S0RA 1EB2A 4D76A 1ZLRA 2G4TA 2A4GA 4AZ2B 5J4QA 1LHFH 3BTEE 5EPNA 3MO3A 2O8LA 2G5VA 1RTFB 2LNCA 5HGGA 4ZKOU 1HDTH 1EZSC 2BLQA 5TCAA 1CVWH 3RXHA 3PO1B 2PLXA 1F5KU 1LMWB 1GHYH 1ZTKA 4NA7A 1O2TA 2Y7XA 3GCTF 2A1DB 1CA8B 3ODFA 1E36B 1HJAB 2GCHF 3LU9B 5L2YH 1O5EH 2A7JA 3ATLA 2CN0H 1N8OB 1VGCC 2BX3A 2QY0B 3SQHE 3SZNA 4ABDA 1GHAF 4FUDA 1DT2A 4OS4A 2OTVA 3QTOH 3TH2H 1O3MA 2A0QB 2UUJB 2OD3B 2VNTA 3PROA 1F0UA 2FOFA 3GYMA 1DOJA 1KDQB 1YLDA 4UFGH 1GI7B 1SGPE 2BVRH 3A7TA 1NZQH 4D8NA 2ANMH 2W26A 3P92A 1GWAA 4BAMB 1O2SA 2GZ9A 2C3SA 1SQTA 3SO3A 5G4BA 1AVGH 4HI3A 3RMLH 2AYWA 3M37A 1NY22 3VB3A 4JZDH 3A8DA 3TIUA 1H9LB 1A5HA 2STBE 1O2UA 2BD3A 3RU4D 1TLDA 3ZZ8A 3QGNB 1UK3A 4ZHAA 5EU8A 4BTUB 1HAYB 1V2WT 2XCFA 1P12E 3DFLA 5JPMH 1BRCE 1GHVH 1QHRB 1TGBA 1BHXF 1C2LA 4H6TA 2TGDA 2GKVE 1INCA 1WTGH 1XVOA 1ETSH 4OS2A 5DKMA 1YGCH 4ABJA 2QN5T 4MG3A 1TPPA 3DHKH 1XUJA 4O97A 2G00A 1TOMH 1UCYH 1GBFA 1ZTLA 3SORA 1KTTB 1GJCB 1K28D 1GL1A 4NZQA 2BD9A 1SC8U 4MPUA 1S5SA 2A4RA 6CHAC 4FVBA 3E3TA 1L1GA 5ESTE 5EXNA 4JZIA 1ANDA 1GBIA 1DXPA 1S0QA 1YPEH 1UTQA 3GYLB 4MVNA 1LCYA 3RM0H 4HGCA 1ZSKA 1NN6A 2XBYA 3LPRA 1H8IH 1SGFG 1T8MA 2BDCA 2QXHA 4JK5A 1JIMA 1FY3A 2XBVA 5C67A
chains in the Genus database with same CATH superfamily
5JBBS 1O32A 1GJ7B 2TGPZ 4Y6DA 4DW2U 1C1WH 1VKYA 4GPGA 1VR1H 2C8ZB 3BTQE 5EJZA 1MD7A 2TGTA 5C1UA 1BHXB 2FTMA 4MPVA 2ZQ1A 1ELBA 2JH0D 3E1XB 2Z9JA 4Z1MD 1HJ9A 2UUFB 3V7TA 1LVOA 1JXPA 2CHAB 1AFQC 1SGCA 3SNDA 2FPZA 1O2RA 3I78A 1N1LA 2PSXA 3LJJA 4D9RA 5C20A 2XC4A 3M5LA 2LELA 1Y59T 3BTDE 4TY6A 4ZXYH 1CHOG 2VVCA 3M7TA 3SHCH 2C93B 3U98H 2JETC 2FLBH 2WUBA 1ETRH 1QIXB 3ATKA 2AMDA 1AIXH 1QL9A 2ZO3H 3ZZ5A 1AO5A 2FX6A 4ZKSU 4FU7A 3LGUA 2V0BA 3UAIC 1KTSB 1DX5M 1WV7H 6ESTA 2GV7A 1TAWA 3S9BA 1Y3VA 1J15A 3DUXH 2FOBA 1AZZA 1SOTA 3RC4A 3UWJH 1MKXH 2EI7A 1HUTH 2VIPA 3BG8A 4ZUHA 3P8OA 1E79D 3LH3A 1C5ZB 1BTWA 3PWBA 2Z3DA 2ZIQH 1Z6JH 3D49H 2ZDAH 2GP9B 2RG3A 1SHHB 1IOEA 1ELGA 3TJUA 5FX6A 1KDQA 1D3DB 3ATIA 2EEKA 3QN7A 3F9HA 2ZU5A 4WXIA 5DPAA 1P2JA 1WQSA 1THRH 2V7QD 1D3PB 4IGDA 2R9PA 1W12U 1MTUA 1G36A 1EAXA 1OS8A 1BTXA 4XBBA 3PLPA 4Y11E 2FDAA 4ABHA 1WAYB 3TGKE 3HGNA 1HB0B 1MMJN 2FOGA 3B9FH 2R3UA 2J94A 5ESBA 2VB0A 1AB9B 2WINI 3PRBA 4XD7D 2FS8A 4ZMAH 2C8YB 4FU9A 3SU4A 4ZXXH 5I25A 1C5OH 2Z7FE 2HNTC 3QLPH 2WYGA 1DWCH 1LKAA 1P01A 1WBGB 4BXSA 2J95A 3A8CA 5FCRA 1T31A 2I6SA 2V35A 1UVTH 4ASHA 1UCYK 2XTTB 3GY2A 3Q76A 2CMYA 5F8TA 3QZRA 3VG8A 2F9VA 2A2XH 3L6PA 5B6OA 3RLWH 2HOBA 1KLIH 1ZOMA 4NA8A 2C4FH 2OBOA 3W94A 3Q77A 5DJ7A 2FI4E 3WY8A 4MDSA 2P59A 1OHHD 3NKKA 2YMSD 2BTCE 3ZZBA 1G3DA 1E37B 1OWHA 2AMQA 1YWUA 2B7DH 2PSYA 5CHAC 3UUZA 4A92A 1ZSJA 1WOFA 1MZDA 4OS7A 3PM3A 3A7WA 4YT7H 1KLTA 3ELAH 1TFXA 4U30A 1O2NA 1LVYA 1EQ9A 1THSH 3OFND 1OWDA 2VWLA 1F5RA 5E0GA 1TRMA 3RXSA 2F91A 1ACBE 3UFAA 3SU2A 3M7UA 2FP7B 2IPQX 2NU1E 4CRGA 1M9UA 5KECA 2OP9A 3FP6E 3KGPA 5LPRA 5LPEA 3ZZDA 1OKXA 3F0OA 4AG1A 1D4PB 2J9NA 2XNIA 1C1VH 3VB6A 3ZVDA 2BVSH 3T62A 5GWZA 3KCGH 1GMHF 1V2UT 1SGNE 1KSNA 4A1VA 1DS2E 3BTTE 4JYUH 2ZQ2A 1BMAA 3PO1C 1QTFA 5A8YA 2FOEA 1YCPH 1V2MT 3SW2B 1MKWK 4B76A 1EOLA 1HJAC 4X2XA 2H9EH 2WUCA 2VH6A 1KXDA 1TNHA 3T25A 4Y0YE 1JIRA 1YPLH 2SNWA 6CHAB 1GI9B 1N8OC 1TA2A 3BIUH 4KGAA 2FI3E 1DVAH 2D2DA 1O2GH 1GCDA 3LJOA 1BZXE 3QUMP 4AYVB 4K2YA 2FOHA 2BY5X 4I7YH 1DSUA 4I8JA 1P05A 4X8SH 1QRWA 1ZZZA 1AKSB 1O36A 3U1JB 2GMTB 1N6XA 3BEFB 4H42U 1VITG 1YPGH 3MU5A 1O3PB 2GV6A 1P3CA 1QCPA 1NC6A 3FAOA 3RU4T 2WV9A 4A1TA 2BOHB 1F0RA 2GDDA 4F4OC 1TMTH 1C2DA 1E1RD 1GBLA 4I8LA 2ILNA 2KCYA 2Z9LA 1UK4A 1LVBA 8GCHG 3SU6A 3GY8A 2EI8A 1BRUP 1W7XH 1WYKA 2BXTH 4YLQH 3A8AA 1GMDF 3OY5U 4Z0KA 2QA9E 1VZQH 3RXBA 2GZ7A 1QR3E 1GI5A 4Q7XA 2ZGBH 1SG8B 1C5UA 4J2YB 2P94A 3SJIA 4Y76A 1BOQA 4GCHG 5F8ZA 1WSSH 1ELVA 5FCKA 4ABAA 2OBQA 2BQWB 1OSSA 2M2AA 1ZGIA 3MH5A 1OYTH 3S7KB 3GY3A 1DSTA 3KQBA 5E0JA 4IC6A 1W0JD 4LZ1H 1GBHA 1UHBB 3A7ZA 1CSOE 1GBCA 3D65E 4NCYA 5DN6D 4B6EA 2YMSB 1MUEB 5FBIA 4TSFD 4B74A 4BTTB 3I29A 1A7SA 3GICB 5EOKA 1FY4A 1C4Y2 4TPIZ 4B73A 2HNTF 4IW4E 1KLJH 2ZDKA 5AVDA 1UTPA 3TK5A 2G81E 3BEUA 3M7QA 1GI8B 3MQKC 4BNRA 4Q4LA 2H6MA 1FY1A 2L74A 5FXLA 1AVXA 3NWUA 2LP6A 2F9NA 4WY3A 2PP6A 1UK2A 2GCTC 2PUQH 4JK6A 3UIRA 1WCZA 1TGCA 1V2VT 2QCYA 5DGJA 1EX3A 3SUGA 3VFEA 4CREA 1C2KA 3K9XB 1AU8A 2RFKC 4Y0ZE 4GUXA 1XUFA 1O38A 3GDUA 3FFGA 1XUKA 1WU1A 3LC3A 2XWAA 4TYDA 1SSXA 2BD7A 1UCYE 3EYDA 3KF2A 5C1YA 1C2MA 1K1PA 2C90B 1EASA 5A0BA 3AW1A 3DT0H 3VGCB 1SMFE 2WPJS 1IQNA 2Y80A 1SLXB 1HNEE 8ESTE 1T4UH 3EQ0H 1VCPA 4E05H 1LTOA 1AUJA 2A4QA 4Q63A 1MH0A 3C27B 1AE8H 1O5GH 3BIVH 1T8NA 2Y5HA 3MU4A 3U8RH 2ZU3A 1TMUH 1P2IA 2IJOB 3GCOA 1LDTT 3KN2A 4O9VA 1FDPA 1O3BA 1E38B 1SFIA 5EJLA 3MTYA 1A0LA 1C4U2 1P0SH 3IITA 4Y71A 2J2UA 3UY9A 1QJ7B 1CT4E 2QF3A 1LHEH 5T6DA 2IPHA 3CS0A 4FOUC 1A2CH 1LHCH 2FOAA 1Y5AT 1U6QA 2Z9KA 1UVSH 3PV4A 3TH4H 1XM1A 2GD4B 2XW9A 1TBQH 1EAIA 4NIYA 3H09A 1O35A 2HPPH 1AN1E 2VVUA 1BIOA 3A8BA 1O3NA 3PTBA 2GX4A 1V2QT 1YPHE 5AFYH 1DDJA 1S83A 3LH1A 3PLKA 1K21H 2Z3EA 4KTCA 1PPHE 3MU0A 1GDQA 1GMCF 1A1RA 1ZRKA 3PV2A 1SOZA 3RMMH 1CE5A 1H8DH 1O5DH 2VINA 3GDSA 1BBRE 3NK8A 1OPHB 2OLGA 1SFQB 1V2ST 2ZCKP 3M3TA 4TWYA 2NWNA 1AKSA 1V6DA 1AZ8A 3F0PA 3WW7A 2RCEA 1GI0A 4B2AA 2QF4A 1ABIH 1QY6A 3LGYA 1EPTB 3RC6A 1FX0B 1P9UA 1LHGH 1FN8A 1NROH 3GY4A 3F1SB 2PHBA 3PV5A 2ZCLP 3RXVA 5B6LA 1GJ5H 2OC0A 1Z1IA 3AAUA 2PGQB 1AB9C 3BV9B 1BA8B 4KP0A 1SVPA 1KXBA 4OGXA 1JBUH 1O2IA 1UTMA 3A87A 1RGQA 3FP7E 1Z1JA 1LPKB 3TK6A 3UWIA 1P8VC 2ZTXA 3FZDA 5BPEA 1K1MA 3E90B 1EOJA 1JOUB 4DG4A 4NSYA 3QWCH 3U1IB 1QB1A 1SQAA 1EUFA 1W2KH 1OWKA 2V3MA 1T4VH 1DE7H 2V6NA 1XUGA 1NRSH 2ZGXH 2ZP0H 3Q3YA 1PJPA 1MAYA 1EAUA 2P3UB 1UHBA 4E06H 1V2OT 1L4ZA 3MWIU 2UUKB 2QC2A 3KIDU 2ZPSA 3FVFB 4X1QU 1AY6H 1O2VA 5FPYA 1ZRBA 1FY8E 3A84A 1BTHH 1NS3A 2DE8A 5JB8S 1A5GH 3IG6B 3FP8E 1EZQA 1SGTA 1C5VA 1HAPH 3ZVAA 2ZDMA 4F55A 1VITH 1BDAA 2WHXA 1GG6B 3E16B 4CH8B 5C5NA 1BMFD 2VWMA 2BZ6H 4A1XA 5FPTA 1G30B 1BUIA 2F3CE 3LONA 5C0UA 4INHA 1TQ7B 1FNIA 5C94A 1TGSZ 3RXPA 1V2LT 1HV7A 2G51A 4X8TH 2ULLA 1O2LA 2FWWA 3T26A 5DP8A 1TNGA 3RXTA 1MTVA 2D8WA 2ZU4A 5C1XA 3RXRA 4BTIB 5HM9A 1GHAG 4RSPA 3BEIB 2TRMA 1TB6H 2BDYA 4JZ1A 3NCLA 1Z7KA 4O03A 2HLCA 4DIHH 2O8UA 1EXFA 1SGIB 2P16A 3KNXA 3NZIA 1EJNA 2D1JA 3ZVCA 2RDLA 2WSSD 1DWBH 4DURA 2K1QA 3RXMA 4TWWA 4UD9H 5EXMA 5K7RA 5A2MH 4K1SA 2GT8A 4BANB 1FPHH 1OP8A 1MTSA 3GY7A 1G2LA 3ZYDA 1THPB 1P3EA 5FL7D 5C2ZA 3Q3XA 2ZGJA 1G3BA 2WPLS 1HXFH 2A7HA 3PLBA 2QIQA 4K60A 2BLVA 2OINA 3KQCA 2QV1A 1FPCH 1P06A 1CT2E 1O33A 4WWYA 1Y5UT 3SV2H 1MTNC 1QJ6B 3SBKA 1HIAB 2GMTC 1P11E 2F83A 1G9IE 2BY6X 3V3MA 3TNTA 2GCTB 2ZEBA 1BB0B 5TCCA 1DWEH 5FHTA 1WDIA 1LPZB 3EA9A 4OS1A 2PW8H 2H5DA 3EDXB 2P3FH 2BY7X 4ISOA 5T6GA 2SGQE 4CRAA 2QXGA 4YESB 3O8RA 2Q1JA 3GOVB 1BJUA 3UTUH 4GLYA 1QFKH 2PWXA 1E35B 4RT1A 2XRCA 1BBRH 1KMHB 2C8WB 4CR5A 3AK5A 1C1NA 1QZ8A 3ZVBA 1MBQA 1L1JA 5EXLA 2VIDA 3KEEA 1NTPA 4DVAU 1HAZB 1MKWH 5HYOA 2P8OB 1HFDA 2H5CA 5GCHG 1H4WA 2FM2A 4YLUA 1EPTA 2ZDLA 1GBEA 6GCHG 1O2MA 1OP0A 3CS7A 2AGIX 3OTJE 1FMGA 1H8ED 1W7GH 4UE7H 4YM9A 5ABWA 3NUMA 1VCQA 3T2NA 3HK3B 4X6MA 3FANA 1TRNA 1IQHA 1EB1H 1FIWA 2YMSC 2F4LA 3GY6A 4R0IA 4MNWA 5EQRA 2PKSB 5HMAA 5A8ZA 3MU8A 4HZHA 1XUHA 1O3CA 3B8JA 1FAXA 3SJ9A 4INKA 1IQMA 4I31A 2Y5FA 1ELAA 2ANYA 4DT7B 1YCPM 3UNSA 5TJXA 1GDUA 2KCOA 1LHDH 2BY9X 5KGOA 3T5FH 3PTNA 4F48B 4AFQA 4X1SU 4CBOA 1ETTH 1EP6A 3B23B 3MNCA 2SNVA 2EI6A 2G52A 2GZ8A 4ZH8A 1RFNA 3ZZ7A 5EW1H 3STIA 5J4SA 1P2OA 1BMNH 1ESBA 1NRPH 2WV5A 3SI3H 2XC0A 3SU0A 1Y8TA 3N7OA 2UWPA 1DICA 1K1IA 1H1BA 1NM6A 2ALPA 2ZTZA 1QL7A 3G01A 5HM2A 4AYYB 4FETA 1WXRA 1AWHB 4B2BA 3RXCA 4KTUA 3VGCC 2A32A 1DFPA 1UTLM 2H1UA 3EGKH 1GHBG 5C3NA 3GCHB 4B2CA 4K8BA 2QXJA 3CENA 2Q6GA 4Q2KA 5JBTA 1B7XB 2WZQA 1NT1A 4K5ZA 3GCNA 3OAAD 4MLFB 2AIQA 3HPTB 3UR6A 1SGEE 2ESTE 3NXPA 4FXGH 3LOXA 3FN8A 1FV9A 5EG4A 1YPHC 1AI8H 3S7HB 1VCWA 3A80A 2XBXA 2ZFRH 1NFUA 4ASUD 1SB1H 2QYIA 2G55A 2Q6DA 1SLUB 2FYRA 3K2UA 3DSOA 1OWJA 4HFPB 3UOPA 3SU3A 2FTLE 1C5NH 1O2JA 2YNBA 2FYQA 3KL6A 5GJ4B 2STAE 2A4OA 3PMJA 4A5TS 1XKAC 2CJIA 1Q2WA 3BTKE 5SGAE 4JZFH 3TGIE 4NFFA 1BQYA 1Z8IB 2FS9A 1YC0A 3D23A 1F7ZA 1C5YB 1O3FA 4CR9A 1PPZA 1O5CB 1UTOA 1K9OE 2VBCA 1NRRH 2HALA 3F6UH 1TONA 1GJBB 4ZAEA 1NBME 1SQRA 3LGIA 2J34A 1HIAA 1QJ1B 4U2WA 4ISNA 1IQKA 3ZZ6A 1NFXA 3P17H 4F49A 4FUEA 2UWOA 1AQ7A 1EZUC 3LDXH 3STJA 1EPTC 3F9FA 2ZZUH 1Y3XA 1GBMA 2BHGA 3P8GA 3MNBA 4P00A 3UREA 2W6ID 4XSKU 3T27A 5FAHA 4FUHA 1K1JA 4NZLA 3OX7U 2VJ1A 1TIOA 4KTSA 1AWFH 1DM4B 3KYFA 1K2I1 2BX4A 1BBRK 1O2HA 1FI8A 1QQUA 1AD8H 2HRVA 3K6YA 2ZHWH 4GVUA 3MFJA 3QTVH 1KIGH 1SLWB 1TPSA 3QX5H 1EJMA 1SGFA 3P8FA 3UOUA 4FUBA 3ITIA 3NPSA 3A7XA 1MU8B 3BTME 2BLOA 1BJVA 4D7GA 1TA6A 3DFJA 3SQEE 1C2FA 4X1RU 4AOQA 2QF0A 1TNKA 2HVYB 2P3TB 3P70B 1CT0E 4RI0A 2ZI2H 5T6FA 2C8XB 4INLA 2FOMB 2FEQH 5GNDA 1V2KT 3OTPA 2Z9GA 9ESTA 4UEHH 2XXLA 5AHGH 4AB8A 3VXEH 8GCHF 2ZHEH 3GDVA 3UNRA 4YT6H 4AX9H 4YTAA 1ABJH 1BTPA 1ZMNA 1MTNB 4HTCH 1GG6C 3K65B 4I8HA 1KXCA 1G37A 3T28A 1FAKH 4HG6A 9LPRA 2ZU2A 2P93A 4GCHF 1SGYE 3CP7A 1WTHD 1YKTA 2EY4C 2OUAA 1GMHG 3LT3A 1E1QD 1XX9A 4X0WU 4IMZA 3P6ZB 1GJ4H 1A46H 2J92A 1A4WH 3OEHD 3ZZCA 4MNYA 1KY9A 3DSGA 1ZR0A 1CGJE 2ALVA 1GCTC 2BLWA 2ZF0H 2ZFFH 3GY5A 1GI4A 1W3CA 2CGAA 2FLRH 4WXVA 2BYAX 3RM2H 4YOJA 4AC9A 1Z8GA 1RTLA 2UWLA 5A0AE 1O3DA 1C5LH 2ZC9H 1BTYA 2UUYA 4J1YA 2Y7ZA 2OC8A 5HIZA 1S84A 3LIWA 1G3EA 3M5MA 1RRKA 1A5IA 1YP9A 2ZU1A 1C5SA 2BD5A 4X8VH 3BTHE 5JYIA 1GBAA 1HXEH 1KXFA 4Q7YA 1Z8RA 2VH0A 3WWBA 1TMBH 1D6WA 3ZV8A 1NFYA 3N7DA 5EQQA 1LKBA 4X2VA 3DSPA 4WH6A 1AHTH 1MCVA 2R0KA 3PMAB 2QE7D 1TX6A 2BDGA 1ARBA 3FOAA 2HGTH 2JJ2D 2A45B 2Z3CA 4UFFH 3SJOA 5DP4A 2VVVA 1XXFA 3EA7A 5JBAS 3BTWE 4TPYA 2WPDD 5FX5A 1GMDG 5CE1A 2EQNA 4MNXA 4KKDA 2TIOA 4UFEH 1DWDH 1F0SA 3BTGE 2BVXH 3ODDA 1AGJA 1UTKA 4JYVH 2FOCA 2V3OH 1O3EA 4FVDA 1LPGB 1SL3A 2BM2A 4DIIH 2RA0A 2BOKA 2ASUB 3D62A 2PTCE 1ZPBA 4NIWA 4RKOB 1UO6A 1UVOA 2O8MA 1OWIA 1PPGE 2R3YA 3O8CA 1D3TB 2ZG0H 2HVXA 3E91A 1CU1A 1PQ8A 1C1UH 1GBKA 3FO8D 5E8EH 3SU1A 2W7UA 1K0HA 4CRCA 2ODPA 1C2HA 1BCUH 3EE7A 4SGAE 3RP2A 3RXGA 1B0EA 2O8TA 3I77A 3MO9A 1C1RA 1PQ7A 3SNCA 2A5IA 1AMHA 1Y5BT 3N7EA 1AVWA 5EW2H 1O2YA 1T7CA 1TYNA 3PYHA 2F9UA 4LOYH 3SZEA 3RMNH 2P8OC 3TNSA 2ZHQH 1QA0A 3EA8A 2KM0A 2KAIB 1O3AA 2QAAA 5GIBA 4ABIA 4NFEA 2G8TA 3L3TA 1YPKH 2SGFE 4UDWH 1GI1A 4TY7A 7GCHF 4IN2A 1KXAA 1PPCE 3U8OH 3DA9B 2I6QA 2PKSC 1QBOA 4K69A 4RKJB 2VIVA 3UR9A 4ZCNA 1MZAA 5F6MA 1IQJA 5JBCS 5DK1A 1D6RA 1T8OA 2WPHS 3A86A 4BAHB 1RIWC 2ZTYA 1C5XB 3SV6A 3E6PH 3MHWU 1C5WB 1QB6A 2CK3D 3M61U 5IDKA 3HK6B 1GJAB 2QGRA 3SJKA 3A7VA 5GDSH 1A3EH 4WH8A 4AB9A 2A2QH 4YO9A 4Y7BA 4D7FA 1XMNB 3ATMA 4ACBA 1RD3B 4TT3D 1YYY1 1CGIE 3V13A 1W14U 4AGKA 1C1TA 2KZ4A 2BQ6B 1XKBC 1W0KD 2HNTE 3A85A 3A81A 4NG9H 5C5OA 5K0HA 1SPJA 2VIWA 1TPAE 5EIYA 5AFZH 1SQOA 1CHGA 3OU0A 1Z6EA 1B5GH 5DP5A 1NU7B 1FY5A 1O0DH 4D9QA 3GCHC 4LK4A 1IQFA 1FUJA 1P2MA 4AFSA 4ZHLU 1QL8A 3TGJE 1D3QB 1HAGE 3F2FA 4X6OA 1L1NA 3TPIZ 3M5OA 3Q3KA 1XUIA 2W3KA 4X2YA 3S9CA 1HJ8A 3ZYEA 5LPFA 1PPEE 1Y3YA 1N6YA 3PWCA 3TVJB 2AH4X 1ZMLA 2HWLB 4U01A 8KME2 3ZZAA 1F2SE 2PUXB 2KFWA 2K0QA 1EZXC 2OC7A 1OP2A 2Y81A 2WPIS 3K6ZA 1K1OA 1P02A 4FU8A 1BMMH 4JMYA 1ZPZA 3C1KA 2SGDE 1DANH 3M5NA 5E2OA 4XBCA 2WV4A 1A3BH 5DP9A 2HPQH 1AE5A 4WF8A 2AGGX 1TPOA 4IC5A 5BRRE 5E2PA 5HIYA 1QA7A 4O3TA 3ZZ3A 1J9CH 1S85A 3FZZA 4K1EA 2WPKS 4X6PA 1P09A 2O8WA 4IBLH 3SI4H 3KQDA 4X6NA 4WMDA 2ZGCA 1O3GA 4DT4A 1UJ1A 2F9PA 5A8XA 3M3SA 4H4FA 1G2MA 1CGHA 1HAHH 1PYTD 3MU1A 5HKKD 1BITA 1DY8A 1UTJA 3SGAE 4BOHA 2Z9IA 1ESTA 1JRSA 3Q00A 1YPJH 1RS0A 1DUAA 3GCTG 3VXFH 1GCTB 2GCHG 3GISB 3RXKA 3SOSA 3S0NA 5ETXA 1TGTA 2KX4A 3RXEA 3ZV9A 2W7SA 1BT7A 1O31A 1GVLA 1P03A 2AERH 4ESTE 1G32B 5DSFA 2NU0E 3U8TH 3ATWA 1C2JA 1G3CA 2XWBI 5A09A 2F9BH 1J17T 1SGDE 2SGEE 3KHVA 2ZFPH 4AFUA 1S6FA 2CF9H 5FPSA 3OY6U 2PV9B 1Z71A 1XVMA 4MQAA 3A82A 1EATA 4BXWA 2BXUH 3UPEA 4IMQA 1GHWH 5L30H 7ESTE 1IQLA 2XC5A 1KYNA 3TJOA 2Z94A 4XRNA 2KAIA 4OM9A 1O5AB 3SGBE 4CBNA 3MNSA 5C0TA 2J38A 1S82A 2OQUA 4GHQA 3SHAH 1O2OA 1NU9A 3RXOA 2A5AA 2XCNA 2OC1A 2ODQA 4RT0A 1HBTH 2H9HA 1GGDB 3M3VA 1ZHRA 2W6JD 1ZJKA 4XFQA 1B0FA 2ODYB 3BN9A 1GPZA 1BTZA 2KCAA 1NRQH 1W11U 4B75A 4E7RG 3SGQE 4ZHMU 5EGMA 1FZZA 1ZHMA 2OQ5A 2ZPRA 1P2KA 4ABGA 1SI5H 2ZNKH 2AEIH 3PRDA 4IS5A 3VPKA 3P8NA 1MD8A 2Y82A 2L6OA 1KXEA 3PB1E 2ZFTA 1P57B 1K1NA 4THNH 1VJAU 5JDUB 3ZVGA 4WVPE 2XNDD 2Z6BD 1NBMD 1W0ZU 4AFZA 3KQEA 5GCHF 2HLDD 2BDHA 1CHOF 6GCHF 3QGJA 4AN7A 1V2TT 2RA3A 4XOJA 3HGPA 1PPBH 4Q7ZA 1O5BB 3V0XA 2CV3A 3RUOA 3ZZ4A 1Q31A 1BRAA 1BRBE 2ZKSA 3JZ1B 2A5KA 1LVMA 1QBVH 4YOGA 3QZQA 4SGBE 3MH6A 1MBMA 1A0HB 1IQEA 3KQ5A 4E7NA 2BD8A 3MO6A 4YXWD 3E8LA 2ZCHP 1C9PA 1TNJA 2ZDVH 2H2ZA 2G4UA 2B0FA 2OXSA 4ISHH 3MNXA 3OSYA 4BAOB 1ANCA 3SV8A 5A0CA 3RDZA 1V2PT 3LGWA 5IYTA 1GVZA 3MMGA 1HAIH 3MH4A 3AVZA 2Y5GA 1LO6A 1QGFA 1UMAH 4FUGA 1OX1A 1RIWB 1HAVB 1QNJA 2JH6D 2M5TA 2VIOA 1H9HE 3RXJA 1TBZH 1C5RA 3QK1A 1NESE 2R0LA 2BD4A 3SUFA 3V12A 2CXVA 1WQVH 3SU5A 4Y10E 3LC5A 1GHBF 2XYAA 3ZVEA 1E0FD 4I8KA 2YOLA 3MOCA 4FUJA 3ZVFA 1S81A 1PQAA 1O34A 4AGJA 3BG4B 1GBJA 5DP7A 4B1TA 2FMJA 4NIVA 1O3LA 2A7CA 1VJ9U 2DUCA 1TGNA 2VGCB 1PQ5A 1CBWB 1COWD 1HAXB 4I33A 1GL0E 5PTPA 3U28C 3W1EA 3WWFA 1CA0B 3VEQB 5IK2D 2O9QA 4ZKNU 2BDBA 3QO6A 1Y3WA 2H9TH 1GJ9B 3CNRA 1QRXA 3S69A 3SV9A 2NU4E 4X1NU 3UNQA 3TJNA 3LGVA 1SR5C 4ZROA 2TGAA 3F2GA 5T3HA 3SJ8A 3UQOA 2GVFA 1ZPCA 4XDEA 1IHTH 3SN8A 1PPFE 2JIZD 4PROA 2VWNA 1YPMH 1C2GA 2ZHFH 1YY3A 1ZTJA 3RU4E 1QBNA 2PKAB 2VU8E 1OXGA 4K8YA 5GXPA 1MQ5A 1AUTC 5F03A 1ELTA 1DLKB 1SGRE 4CHAB 3OE7D 3TITA 2ZFSA 4R8TB 1TABE 2FIRH 1GJ6A 5CHBA 1QQ4A 2PGBB 1ANEA 3M36A 2K8IA 4NGAH 3O8DA 2EA3A 3U9AH 3N99A 1MCTA 2EC9H 1Z8JB 1OYQA 2BDIA 2NU3E 5F8XA 2AS9A 1FLEE 1O5FH 1TQ0B 1TBRH 1Q3XA 1O30A 4DCDA 1K22H 2BY8X 3S9AA 4GHTA 2GGVB 1VGCB 5LGOA 4NWKA 4FUFA 1RXPA 2FX4A 4U32A 1CQQA 2AGEX 4O3UA 3TLOA 3FKSD 4CH2B 4OGYA 1IQGA 1HRTH 1YBWA 1GI2A 3AASA 3EE0B 2Q6FA 2W3IA 4X8UH 4VGCC 1AFEH 1ZJDA 2P95A 4XE4A 4JYTA 4DGJA 1EFRD 3A83A 1MU6B 1IQIA 3QDZB 1O3HA 3LGTA 3TJVA 1DLEA 4UFDH 2ANWA 1ELDE 2FESH 1ZHPA 1H8HD 1V2JT 3IWMA 4ZKRU 2IN2A 3UB0A 3L33A 4XBDA 2GTBA 1FXYA 1C2IA 1TX8A 3R3GB 4A7IB 4FUCA 1ARCA 7LPRA 3RMOH 5H4IB 3SNBA 1XXDA 4DY7B 4LZ4B 5DP3A 1TNIA 4JCNA 1NFWA 2J98B 1DXWA 2A31A 2AMPA 2FO9A 1GJDB 1GHZA 3PMHB 1FJSA 2OK5A 3SUDA 1S6LA 3RXUA 1F0TA 1VITF 1O2ZA 1UTNA 3SNEA 1C1OA 1ZGVA 3PMBB 1GJ8B 2WYJA 1SHYA 1O39A 4BAKB 1GVKB 2F43B 4WMEA 2ZDNA 2RDEA 1SBWA 3A88A 2BQ7B 5DO4H 1O2WA 3VB7A 3VB4A 1TE0A 4MTBA 3EAJA 1J8AA 1DY9A 1W10U 2B5TB 3ENSB 1SGQE 2BZAA 2XBWA 1UVUH 1HAVA 5LH8A 4YOIA 2SGAA 3KYGA 1GI6A 4OS6A 3ESTA 1IAUA 1L2EA 3HKJB 8LPRA 2ZECA 3OEED 4KELA 2AFQB 3R0FA 1C5QA 1UW7A 1SLVB 7KMEH 4NIXA 3W95A 2QXIA 1O2KA 3NRLA 1EKBB 2PTNA 1A61H 1LQDB 1MQ6A 2GJGA 2AIPA 4NA9H 3UQVA 1MKXK 3AAVA 1O2XA 3RXAA 1O3OA 5GPIB 1RJXB 1C5TA 4Y8ZA 5CMXH 1J14A 5AF9H 2JKHA 1OWEA 2B8OH 2KR7A 1EAWA 1W8BH 1QRZA 3MH7A 1NPMA 3T29A 1ELCA 3OYPA 1TALA 1EP5A 1AFQB 3VB5A 1C1SA 1C5MD 2AHME 4Y8XA 2IJD1 1C1PA 2G5NA 2ZHDA 3GS9A 3P95A 2GT7A 2QF5A 4FUIA 4GAWA 1P9SA 4Z6AH 2PKAA 3F9EA 4QT8C 1HYLA 3RXIA 1HGTH 1EJAA 2SGPE 1K1LA 4M7GA 3HKIB 3TH3H 1FQ3A 1GGDC 1HAOH 5T1VA 1RTKA 2JETB 3AW0A 3H7TA 4MNVA 4NSVA 4IN1A 3ZZ9A 5F53A 1A0JA 2W5EA 1Y3UA 3MI4A 1LQEA 5L2ZH 1GI3A 2J4IA 1BMLA 4RN6A 2ZA5A 5CDFE 2ANKH 4ABEA 1GDNA 4I86A 4I8GA 4AG2A 4Q80A 1JRTA 3A89A 2R2MB 3BTFE 3U69H 4B71A 1YM0A 1O3KA 2PR3A 4AORA 1WUNH 1P04A 1TX7A 4Y8YA 2FODA 2J97A 1P10A 2GDEH 3JZ2B 4M9FA 1SKYE 2FI5E 2BMGB 1T8LA 3RXLA 1PFXC 4MPXA 1P2QA 1BTUA 5KEDA 1C1QA 4MPWA 4CRFA 3RLYH 2BDAA 1GHXH 3TU7H 2DE9A 4I32A 1FN6A 1GBDA 1UVPA 4A6LA 2CHAC 4CRBA 1ZYOA 5EPYA 1C2EA 1W0YH 1F92A 3H7OA 2TPIZ 2BB4A 2Y6TA 1O2QA 4OS5A 3SUEA 5HXFA 4B6FA 3URDA 2ZPQA 4GSOA 3TK9A 3HATH 2VIQA 1OOKB 1F5LA 2J5UA 2VWOA 1CO7E 2ZWLH 4JZEH 1C4V2 1L4DA 1HLTH 4ISIH 1TOCB 1NRNH 2ZGHA 1QURH 1NO9H 2LPRA 3RXDA 3SV7A 3RXQA 2NU2E 1DPOA 4YZUA 1ZSLA 1O3JA 1TRYA 1V3XA 2FZZA 2J98A 1ELFA 4NWLA 2F9OA 4Y79A 3RC5A 1HPGA 5L6NH 1ANBA 3F9GA 1YF4A 5I46H 4ISLA 1PYTC 4H6SB 3BF6H 4WMFA 5JB9S 1C5PA 1QB9A 4LXBH 1JWTA 5DP6A 3URCA 1ELEE 4P02A 1DUEA 1DITH 1H9IE 3O8BA 1YCPK 4X2WA 3BG4C 1J16A 5E0HA 3RXFA 1D9IA 4WJG2 4Y7AA 3F68H 1JMOH 3M35A 2D26C 4UONA 5DG6A 2BD2A 2VGCC 1GBBA 1CBWC 3E0PB 1TNLA 4VGCB 1CA0C 7GCHG 2FXRA 3MYWA 1T32A 4ABBA 2JDID 1IHSH 2WPMS 2JJ1D 3A7YA 1ZMJA 3E0NB 1MTWA 1P2NA 3SNAA 3DD2H 1O3IA 1HCGA 1O2PA 1W13U 3DCLA 5CHAB 6LPRA 2CF8H 1X7AC 2R2WU 2V3HH 2OCVB 2ZFQH 4DJZB 4BAQB 5EODA 1TWXB 1V2NT 4ABFA 5EQSA 1C9TA 1ID5H 2TBSA 1ESAA 1S6HA 2JH5D 4DOQA 1E34B 1L0ZA 1V2RT 1FONA 3BSQA 1YLCA 1O37A 1ORFA 1FIZA 1GBTA 5FBEA 4K1TA 3H5CB 2THFB 1GMCG 4ACAA 2IOTA 2PFEA 1C1MA 1MAXA 2B9LA 2SFAA 3LKWA 4CHAC 4CRDA 4X1PU 4K3JA 2YNAA 1S0RA 1EB2A 4D76A 1ZLRA 2G4TA 2A4GA 3SYJA 4AZ2B 5J4QA 1LHFH 3BTEE 5EPNA 3MO3A 2O8LA 2G5VA 1RTFB 2LNCA 5HGGA 4ZKOU 1HDTH 1EZSC 2BLQA 5TCAA 1CVWH 3RXHA 3PO1B 2PLXA 1F5KU 1LMWB 5C17A 1GHYH 1ZTKA 4NA7A 1O2TA 2Y7XA 3GCTF 2A1DB 1CA8B 3ODFA 1E36B 1HJAB 2GCHF 3LU9B 2XOKD 5L2YH 1O5EH 2A7JA 3ATLA 2CN0H 1N8OB 1VGCC 2BX3A 2QY0B 3SQHE 3SZNA 4ABDA 1GHAF 4FUDA 1DT2A 4OS4A 2OTVA 3QTOH 3TH2H 1O3MA 2A0QB 2UUJB 1YLNA 2OD3B 2VNTA 3PROA 1F0UA 2FOFA 3GYMA 1DOJA 1KDQB 1YLDA 4UFGH 1GI7B 1SGPE 2BVRH 3A7TA 1NZQH 4D8NA 2ANMH 2W26A 3P92A 1GWAA 3F2HA 1O2SA 2GZ9A 4BAMB 2C3SA 1SQTA 3SO3A 5G4BA 1AVGH 4HI3A 3RMLH 2AYWA 3M37A 1NY22 3VB3A 4JZDH 3F3BA 3A8DA 3TIUA 1H9LB 1A5HA 2STBE 5EJ1A 1O2UA 2BD3A 3RU4D 1TLDA 3ZZ8A 3QGNB 1UK3A 4ZHAA 5EU8A 4BTUB 1HAYB 1V2WT 2XCFA 1P12E 3DFLA 5JPMH 1BRCE 1GHVH 1QHRB 1TGBA 1BHXF 1C2LA 4H6TA 2TGDA 2GKVE 1INCA 1WTGH 1XVOA 1ETSH 4OS2A 5DKMA 1YGCH 4ABJA 2QN5T 4MG3A 1TPPA 3DHKH 1XUJA 4O97A 2G00A 1TOMH 1UCYH 1GBFA 1ZTLA 3SORA 1KTTB 1GJCB 1K28D 1GL1A 4NZQA 2BD9A 1SC8U 4MPUA 1S5SA 2A4RA 6CHAC 4FVBA 1MABB 3E3TA 1L1GA 2KCPA 5ESTE 5EXNA 4JZIA 1ANDA 1GBIA 1DXPA 1S0QA 1YPEH 1UTQA 3GYLB 4MVNA 1LCYA 3RM0H 4HGCA 1ZSKA 1NN6A 2XBYA 3LPRA 1H8IH 1SGFG 3ZIAD 1T8MA 2BDCA 2QXHA 4JK5A 1JIMA 1FY3A 2XBVA 5C67A
chains in the Genus database with same CATH topology
5JBBS 1O32A 1GJ7B 2TGPZ 4Y6DA 4DW2U 1C1WH 4GPGA 1VR1H 2C8ZB 3BTQE 1MD7A 2TGTA 5C1UA 1BHXB 2FTMA 4MPVA 2ZQ1A 1ELBA 2JH0D 3E1XB 2Z9JA 1HJ9A 2UUFB 3V7TA 1LVOA 1JXPA 2CHAB 1AFQC 1SGCA 3SNDA 2FPZA 1O2RA 3I78A 1N1LA 2PSXA 3LJJA 4D9RA 5C20A 2XC4A 3M5LA 1Y59T 3BTDE 4TY6A 4ZXYH 1CHOG 2VVCA 3M7TA 3SHCH 2C93B 3U98H 2JETC 2FLBH 2WUBA 1ETRH 1QIXB 3ATKA 2AMDA 1AIXH 1QL9A 2ZO3H 3ZZ5A 1AO5A 2FX6A 4ZKSU 4FU7A 3LGUA 2V0BA 1KTSB 1DX5M 1WV7H 6ESTA 2GV7A 1TAWA 3S9BA 1Y3VA 1J15A 3DUXH 2FOBA 1AZZA 1SOTA 3RC4A 3UWJH 1MKXH 2EI7A 1HUTH 2VIPA 3BG8A 4ZUHA 3P8OA 3LH3A 1C5ZB 1BTWA 3PWBA 2Z3DA 2ZIQH 1Z6JH 3D49H 2ZDAH 2GP9B 2RG3A 1SHHB 1IOEA 1ELGA 3TJUA 5FX6A 1KDQA 1D3DB 3ATIA 2EEKA 3QN7A 3F9HA 2ZU5A 4WXIA 5DPAA 1P2JA 1WQSA 1THRH 1D3PB 4IGDA 2R9PA 1W12U 1MTUA 1G36A 1EAXA 1OS8A 1BTXA 4XBBA 3PLPA 4Y11E 2FDAA 4ABHA 1WAYB 3TGKE 3HGNA 1HB0B 1MMJN 2FOGA 3B9FH 2R3UA 2J94A 5ESBA 2VB0A 1AB9B 2WINI 2FS8A 4ZMAH 2C8YB 4FU9A 3SU4A 4ZXXH 5I25A 1C5OH 2Z7FE 2HNTC 3QLPH 2WYGA 1DWCH 1LKAA 1P01A 1WBGB 4BXSA 2J95A 3A8CA 5FCRA 1T31A 2I6SA 2V35A 1UVTH 4ASHA 1UCYK 2XTTB 3GY2A 3Q76A 2CMYA 5F8TA 3QZRA 2F9VA 2A2XH 3L6PA 5B6OA 3RLWH 2HOBA 1KLIH 1ZOMA 4NA8A 2C4FH 2OBOA 3W94A 3Q77A 5DJ7A 2FI4E 3WY8A 4MDSA 2P59A 3NKKA 2BTCE 3ZZBA 1G3DA 1E37B 1OWHA 2AMQA 2B7DH 2PSYA 5CHAC 3UUZA 4A92A 1ZSJA 1WOFA 1MZDA 4OS7A 3PM3A 3A7WA 4YT7H 1KLTA 3ELAH 1TFXA 4U30A 1O2NA 1LVYA 1EQ9A 1THSH 1OWDA 2VWLA 1F5RA 5E0GA 1TRMA 3RXSA 2F91A 1ACBE 3UFAA 3SU2A 3M7UA 2FP7B 2NU1E 4CRGA 1M9UA 2OP9A 3FP6E 3KGPA 5LPRA 5LPEA 3ZZDA 1OKXA 4AG1A 1D4PB 2J9NA 2XNIA 1C1VH 3VB6A 3ZVDA 2BVSH 3T62A 5GWZA 3KCGH 1GMHF 1V2UT 1SGNE 1KSNA 4A1VA 1DS2E 3BTTE 4JYUH 2ZQ2A 1BMAA 3PO1C 1QTFA 5A8YA 2FOEA 1YCPH 1V2MT 3SW2B 1MKWK 4B76A 1EOLA 1HJAC 4X2XA 2H9EH 2WUCA 2VH6A 1KXDA 1TNHA 3T25A 4Y0YE 1JIRA 1YPLH 2SNWA 6CHAB 1GI9B 1N8OC 1TA2A 3BIUH 4KGAA 2FI3E 1DVAH 2D2DA 1O2GH 1GCDA 3LJOA 1BZXE 3QUMP 4AYVB 4K2YA 2FOHA 2BY5X 4I7YH 1DSUA 4I8JA 1P05A 4X8SH 1QRWA 1ZZZA 1AKSB 1O36A 3U1JB 2GMTB 1N6XA 3BEFB 4H42U 1VITG 1YPGH 3MU5A 1O3PB 2GV6A 1P3CA 1QCPA 1NC6A 3FAOA 3RU4T 4A1TA 2BOHB 1F0RA 2GDDA 4F4OC 1TMTH 1C2DA 1GBLA 4I8LA 2ILNA 2Z9LA 1UK4A 1LVBA 8GCHG 3SU6A 3GY8A 2EI8A 1BRUP 1W7XH 1WYKA 2BXTH 4YLQH 3A8AA 1GMDF 3OY5U 4Z0KA 2QA9E 1VZQH 3RXBA 2GZ7A 1QR3E 1GI5A 4Q7XA 2ZGBH 1SG8B 1C5UA 4J2YB 2P94A 3SJIA 4Y76A 1BOQA 4GCHG 5F8ZA 1WSSH 1ELVA 5FCKA 4ABAA 2OBQA 2BQWB 1OSSA 1ZGIA 3MH5A 1OYTH 3S7KB 3GY3A 1DSTA 3KQBA 5E0JA 4IC6A 4LZ1H 1GBHA 1UHBB 3A7ZA 1CSOE 1GBCA 3D65E 4NCYA 1MUEB 5FBIA 4B74A 4BTTB 3I29A 1A7SA 3GICB 5EOKA 1FY4A 1C4Y2 4TPIZ 4B73A 2HNTF 4IW4E 1KLJH 2ZDKA 5AVDA 1UTPA 3TK5A 2G81E 3BEUA 3M7QA 1GI8B 4BNRA 2H6MA 1FY1A 5FXLA 1AVXA 3NWUA 2F9NA 4WY3A 1UK2A 2GCTC 2PUQH 4JK6A 3UIRA 1WCZA 1TGCA 1V2VT 2QCYA 5DGJA 1EX3A 3SUGA 3VFEA 4CREA 1C2KA 3K9XB 1AU8A 4Y0ZE 4GUXA 1XUFA 1O38A 3GDUA 3FFGA 1XUKA 1WU1A 3LC3A 2XWAA 4TYDA 1SSXA 2BD7A 1UCYE 3EYDA 3KF2A 5C1YA 1C2MA 1K1PA 2C90B 1EASA 5A0BA 3AW1A 3DT0H 3VGCB 1SMFE 2WPJS 1IQNA 2Y80A 1SLXB 1HNEE 8ESTE 1T4UH 3EQ0H 1VCPA 4E05H 1LTOA 1AUJA 2A4QA 1MH0A 3C27B 1AE8H 1O5GH 3BIVH 1T8NA 2Y5HA 3MU4A 3U8RH 2ZU3A 1TMUH 1P2IA 2IJOB 3GCOA 1LDTT 3KN2A 4O9VA 1FDPA 1O3BA 1E38B 1SFIA 3MTYA 1A0LA 1C4U2 1P0SH 3IITA 4Y71A 2J2UA 3UY9A 1QJ7B 1CT4E 2QF3A 1LHEH 5T6DA 2IPHA 3CS0A 1A2CH 1LHCH 2FOAA 1Y5AT 1U6QA 2Z9KA 1UVSH 3PV4A 3TH4H 1XM1A 2GD4B 2XW9A 1TBQH 1EAIA 4NIYA 1O35A 2HPPH 1AN1E 2VVUA 1BIOA 3A8BA 1O3NA 3PTBA 2GX4A 1V2QT 1YPHE 5AFYH 1DDJA 1S83A 3LH1A 3PLKA 1K21H 2Z3EA 4KTCA 1PPHE 3MU0A 1GDQA 1GMCF 1A1RA 1ZRKA 1SOZA 3RMMH 1CE5A 1H8DH 1O5DH 2VINA 3GDSA 1BBRE 3NK8A 1OPHB 2OLGA 1SFQB 1V2ST 2ZCKP 3M3TA 4TWYA 2NWNA 1AKSA 1V6DA 1AZ8A 2RCEA 1GI0A 4B2AA 1ABIH 1QY6A 3LGYA 1EPTB 3RC6A 1P9UA 1LHGH 1FN8A 1NROH 3GY4A 3F1SB 2PHBA 2ZCLP 3RXVA 1GJ5H 2OC0A 1Z1IA 3AAUA 2PGQB 1AB9C 3BV9B 1BA8B 4KP0A 1SVPA 1KXBA 4OGXA 1JBUH 1O2IA 1UTMA 3A87A 1RGQA 3FP7E 1Z1JA 1LPKB 3TK6A 3UWIA 1P8VC 2ZTXA 3FZDA 5BPEA 1K1MA 3E90B 1EOJA 1JOUB 4DG4A 4NSYA 3QWCH 3U1IB 1QB1A 1SQAA 1EUFA 1W2KH 1OWKA 1T4VH 1DE7H 2V6NA 1XUGA 1NRSH 2ZGXH 2ZP0H 3Q3YA 1PJPA 1MAYA 1EAUA 2P3UB 1UHBA 4E06H 1V2OT 1L4ZA 3MWIU 2UUKB 2QC2A 3KIDU 2ZPSA 3FVFB 4X1QU 1AY6H 1O2VA 5FPYA 1ZRBA 1FY8E 3A84A 1BTHH 1NS3A 2DE8A 5JB8S 1A5GH 3IG6B 3FP8E 1EZQA 1SGTA 1C5VA 1HAPH 3ZVAA 2ZDMA 1VITH 1BDAA 4CH8B 1GG6B 3E16B 5C5NA 2VWMA 2BZ6H 4A1XA 5FPTA 1G30B 1BUIA 2F3CE 3LONA 4INHA 1TQ7B 1FNIA 1TGSZ 3RXPA 1V2LT 1HV7A 2G51A 4X8TH 2ULLA 1O2LA 2FWWA 3T26A 5DP8A 1TNGA 3RXTA 1MTVA 2D8WA 2ZU4A 5C1XA 3RXRA 4BTIB 5HM9A 1GHAG 4RSPA 3BEIB 2TRMA 1TB6H 2BDYA 4JZ1A 3NCLA 1Z7KA 4O03A 2HLCA 4DIHH 2O8UA 1EXFA 1SGIB 2P16A 3KNXA 3NZIA 1EJNA 2D1JA 3ZVCA 2RDLA 1DWBH 4DURA 2K1QA 3RXMA 4TWWA 4UD9H 5EXMA 5K7RA 5A2MH 4K1SA 2GT8A 4BANB 1FPHH 1OP8A 1MTSA 3GY7A 1G2LA 3ZYDA 1THPB 1P3EA 5C2ZA 3Q3XA 2ZGJA 1G3BA 2WPLS 1HXFH 2A7HA 3PLBA 2QIQA 4K60A 2BLVA 2OINA 3KQCA 2QV1A 1FPCH 1P06A 1CT2E 1O33A 4WWYA 1Y5UT 3SV2H 1MTNC 1QJ6B 3SBKA 1HIAB 2GMTC 1P11E 2F83A 1G9IE 2BY6X 3V3MA 3TNTA 2GCTB 2ZEBA 1BB0B 5TCCA 1DWEH 5FHTA 1LPZB 3EA9A 4OS1A 2PW8H 2H5DA 3EDXB 2P3FH 2BY7X 4ISOA 5T6GA 2SGQE 4CRAA 2QXGA 4YESB 3O8RA 2Q1JA 3GOVB 1BJUA 3UTUH 4GLYA 1QFKH 2PWXA 1E35B 2XRCA 1BBRH 2C8WB 4CR5A 1C1NA 3ZVBA 1MBQA 1L1JA 5EXLA 2VIDA 3KEEA 1NTPA 4DVAU 1HAZB 1MKWH 5HYOA 2P8OB 1HFDA 2H5CA 5GCHG 1H4WA 2FM2A 4YLUA 1EPTA 2ZDLA 1GBEA 6GCHG 1O2MA 1OP0A 3CS7A 2AGIX 3OTJE 1FMGA 1W7GH 4UE7H 4YM9A 5ABWA 3NUMA 1VCQA 3T2NA 3HK3B 4X6MA 3FANA 1TRNA 1IQHA 1EB1H 1FIWA 3GY6A 4R0IA 4MNWA 5EQRA 2PKSB 5HMAA 5A8ZA 3MU8A 4HZHA 1XUHA 1O3CA 3B8JA 1FAXA 3SJ9A 4INKA 1IQMA 4I31A 2Y5FA 1ELAA 2ANYA 4DT7B 1YCPM 3UNSA 5TJXA 1GDUA 3T5FH 1LHDH 2BY9X 3PTNA 4AFQA 4X1SU 4CBOA 1ETTH 1EP6A 3B23B 3MNCA 2SNVA 2EI6A 2G52A 2GZ8A 4ZH8A 1RFNA 3ZZ7A 5EW1H 3STIA 5J4SA 1P2OA 1BMNH 1ESBA 1NRPH 2WV5A 3SI3H 2XC0A 3SU0A 1Y8TA 3N7OA 2UWPA 1DICA 1K1IA 1H1BA 1NM6A 2ALPA 2ZTZA 1QL7A 3G01A 5HM2A 4AYYB 1AWHB 4B2BA 3RXCA 4KTUA 3VGCC 2A32A 1DFPA 1UTLM 2H1UA 3EGKH 1GHBG 5C3NA 3GCHB 4B2CA 4K8BA 2QXJA 3CENA 2Q6GA 4Q2KA 5JBTA 1B7XB 1NT1A 4K5ZA 3GCNA 4MLFB 2AIQA 3HPTB 3UR6A 1SGEE 2ESTE 3NXPA 4FXGH 3LOXA 1FV9A 5EG4A 1YPHC 1AI8H 3S7HB 1VCWA 3A80A 2XBXA 2ZFRH 1NFUA 1SB1H 2QYIA 2G55A 2Q6DA 1SLUB 2FYRA 3K2UA 1OWJA 4HFPB 3UOPA 3SU3A 2FTLE 1C5NH 1O2JA 2YNBA 2FYQA 3KL6A 5GJ4B 2STAE 2A4OA 3PMJA 4A5TS 1XKAC 2CJIA 1Q2WA 3BTKE 5SGAE 4JZFH 3TGIE 4NFFA 1BQYA 1Z8IB 2FS9A 1YC0A 3D23A 1F7ZA 1C5YB 1O3FA 4CR9A 1PPZA 1O5CB 1UTOA 1K9OE 1NRRH 2HALA 3F6UH 1TONA 1GJBB 4ZAEA 3LGIA 2J34A 1HIAA 1QJ1B 4U2WA 4ISNA 1IQKA 3ZZ6A 1NFXA 3P17H 4F49A 4FUEA 2UWOA 1AQ7A 1EZUC 3LDXH 3STJA 1EPTC 3F9FA 2ZZUH 1Y3XA 1GBMA 2BHGA 3P8GA 3MNBA 3UREA 4XSKU 3T27A 5FAHA 4FUHA 1K1JA 4NZLA 3OX7U 2VJ1A 1TIOA 4KTSA 1AWFH 1DM4B 1K2I1 2BX4A 1BBRK 1O2HA 1FI8A 1QQUA 1AD8H 2HRVA 3K6YA 2ZHWH 4GVUA 3MFJA 3QTVH 1KIGH 1SLWB 1TPSA 3QX5H 1EJMA 1SGFA 3P8FA 3UOUA 4FUBA 3ITIA 3NPSA 3A7XA 1MU8B 3BTME 2BLOA 1BJVA 4D7GA 1TA6A 3DFJA 3SQEE 1C2FA 4X1RU 4AOQA 2QF0A 1TNKA 2P3TB 3P70B 1CT0E 2ZI2H 5T6FA 2C8XB 4INLA 2FOMB 2FEQH 1V2KT 2Z9GA 9ESTA 4UEHH 2XXLA 5AHGH 4AB8A 3VXEH 8GCHF 2ZHEH 3GDVA 3UNRA 4YT6H 4AX9H 4YTAA 1ABJH 1BTPA 1ZMNA 1MTNB 4HTCH 1GG6C 3K65B 4I8HA 1KXCA 1G37A 3T28A 1FAKH 9LPRA 2ZU2A 2P93A 4GCHF 1SGYE 3CP7A 1WTHD 1YKTA 2OUAA 1GMHG 3LT3A 1XX9A 4X0WU 4IMZA 3P6ZB 1GJ4H 1A46H 2J92A 1A4WH 3ZZCA 4MNYA 1KY9A 1ZR0A 1CGJE 2ALVA 1GCTC 2BLWA 2ZF0H 2ZFFH 3GY5A 1GI4A 1W3CA 2CGAA 2FLRH 4WXVA 2BYAX 3RM2H 4YOJA 1Z8GA 1RTLA 2UWLA 5A0AE 1O3DA 1C5LH 2ZC9H 1BTYA 2UUYA 4J1YA 2Y7ZA 2OC8A 1S84A 3LIWA 1G3EA 3M5MA 1RRKA 1A5IA 1YP9A 2ZU1A 1C5SA 2BD5A 4X8VH 3BTHE 5JYIA 1GBAA 1HXEH 1KXFA 4Q7YA 1Z8RA 2VH0A 1TMBH 1D6WA 3ZV8A 1NFYA 5EQQA 1LKBA 4X2VA 4WH6A 1AHTH 1MCVA 2R0KA 3PMAB 1TX6A 2BDGA 1ARBA 2HGTH 2A45B 2Z3CA 4UFFH 3SJOA 5DP4A 2VVVA 1XXFA 3EA7A 5JBAS 3BTWE 4TPYA 5FX5A 1GMDG 5CE1A 4MNXA 4KKDA 2TIOA 4UFEH 1DWDH 1F0SA 3BTGE 2BVXH 3ODDA 1AGJA 1UTKA 4JYVH 2FOCA 2V3OH 1O3EA 4FVDA 1LPGB