5DKMA

S. erythraea trypsin michaelis-menten complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
229
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 59
structure length 229
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA01
1O2WA 4ZHAA 1T8MA 2ODQA 1SL3A 2CF8H 3DA9B 1WTGH 3MNBA 4WMDA 5H4IB 1GHWH 2XBWA 2R3UA 1LMWB 3EA8A 1B5GH 4A5TS 5DO4H 1LO6A 1H1BA 1MTUA 2ZCKP 3S9AA 2W7UA 1SLUB 2PWXA 4X8VH 5F8ZA 1PPHE 4X1SU 1TRNA 1GHAG 1DUEA 1NRPH 2ODYB 3T26A 3SGAE 1THPB 3T27A 5F8XA 1W7XH 4D7FA 5A0CA 1T4UH 1BUIA 1FLEE 3FANA 1KY9A 4JK5A 4YLQH 1PPFE 1RIWB 4ABHA 3EA9A 4AB9A 1GCTB 1K21H 4KTUA 2PKSC 3TPIZ 3EA7A 3MU4A 3TIUA 1EAXA 3S9CA 3P8GA 1DVAH 4X2XA 4Y10E 1H9IE 1OYQA 3L6PA 1P2IA 5I25A 2HVXA 2H1UA 2BDHA 3ENSB 4UFFH 3PMHB 1MQ6A 3OY5U 1GBBA 3Q77A 6LPRA 3QO6A 1KXEA 4MVNA 1AI8H 1W0ZU 1UK3A 2VNTA 5L6NH 5J4SA 3BIVH 2BY9X 1GI2A 1TMUH 1GJDB 3VFEA 1K1JA 2W3IA 1CHOG 5EPYA 4JYUH 1EQ9A 4AB8A 3B9FH 1FN6A 1HJAB 1ZPZA 1BJUA 3DD2H 1KXAA 5LH8A 3MH7A 3GY4A 4KP0A 2GZ8A 3UREA 1P3EA 1ANDA 3A7XA 2TGDA 1GJ6A 1HCGA 2EC9H 1QJ1B 2XWAA 1K1NA 3RXCA 1ZSLA 2BD7A 4I8KA 3TK5A 1T4VH 3H7OA 4ZMAH 1H9HE 4XOJA 1F0SA 3KEEA 3LIWA 4NFEA 2HNTF 1C5MD 1SGDE 2FX6A 1DFPA 2VVUA 3RXGA 3MOCA 1V3XA 3NPSA 2CMYA 1FPHH 3SQHE 1XMNB 1GWAA 1TX6A 1Y59T 1B0FA 1ELBA 2FOEA 1KLIH 1P9SA 3M36A 3SHAH 4ZKNU 1GBFA 1S5SA 1QB9A 4IGDA 1B7XB 1DT2A 3E90B 2SGFE 4R8TB 4RKOB 3U1JB 9ESTA 1SSXA 2ZTZA 2V3HH 4NGAH 2FO9A 1D6RA 2FTLE 2ZDMA 2PLXA 3M35A 1ZOMA 2WPIS 1ID5H 2ZFRH 1G3EA 1O3MA 2VGCC 1SMFE 2BVSH 2OC0A 1FXYA 7GCHF 1F5LA 1HAVB 1HBTH 2BD4A 1C5OH 1HPGA 1O3PB 2BX4A 3ZZ7A 3FZDA 4HFPB 2ZGHA 2A5AA 3MO9A 1MTWA 2JH6D 2WPHS 1KDQA 4WVPE 1O30A 3GY3A 2PHBA 1GHYH 1NU7B 1WOFA 2AYWA 2UWOA 1K2I1 1DWCH 2VWOA 3FVFB 3M3VA 1UTJA 2DE9A 5DP6A 3RMLH 1C2EA 2VU8E 3T2NA 1GI0A 3FP8E 1O2HA 1ZPCA 4GUXA 1A5IA 1RIWC 1UTMA 3RDZA 1BBRE 2ZA5A 1N8OC 1FY8E 1GCTC 2B9LA 3PTBA 4A6LA 3P8NA 3LONA 3QGJA 4Q7YA 2PUXB 4VGCB 3SU2A 3RXUA 1IQGA 1FPCH 1E0FD 3KQCA 3TJNA 1DLEA 1C1VH 1C1UH 1O34A 3SJ8A 1FY4A 1GDUA 1YYY1 5FAHA 1OWIA 4AFZA 1C1PA 1YCPM 2YNAA 4RKJB 4X8UH 4Y76A 4AFSA 1ESTA 1UVSH 2ZU5A 1ZHMA 1K1PA 4AORA 1P01A 3U69H 2CF9H 1W12U 3T5FH 1YLDA 2WINI 1WUNH 1O38A 1ANBA 4U30A 5CHAB 1EOJA 3RXLA 2Z3CA 4RN6A 1V2VT 2D1JA 1CHGA 4B2BA 1UO6A 1S82A 1O3JA 1GHBF 3E16B 1HLTH 3QK1A 1TYNA 1QTFA 3UY9A 3P8FA 2OP9A 3GCHB 3A7YA 4MNVA 1TA6A 5EU8A 5T6FA 1JXPA 1P3CA 2ZPSA 1GVLA 3SU5A 3SV8A 4IC6A 3BN9A 1GMCF 1GDNA 4I8GA 3AVZA 1A4WH 1ELAA 1NT1A 4K8BA 1TQ7B 1S83A 2OUAA 1L0ZA 1C4V2 3S69A 1ESBA 3IWMA 4WXVA 2D8WA 2GDDA 1HXFH 1K1LA 2Y81A 1CE5A 1YCPH 2UUKB 4FVBA 1AVXA 4AZ2B 5T6DA 4X6NA 1C5XB 1BRUP 4Y0ZE 2HOBA 4MDSA 3UQOA 2ANYA 1SLXB 3BEFB 4BTIB 3TJUA 1C2GA 1TNJA 4BANB 2WPMS 4B74A 4JZ1A 2J34A 4UDWH 2UWLA 1TX8A 7GCHG 1XKBC 3GDUA 1KLTA 1L4ZA 3SJ9A 1YPGH 1C4U2 1MKXK 1DXPA 2QV1A 1O37A 2PTCE 3NK8A 3PMJA 1C1SA 1GJ5H 1QL7A 4A1XA 2YNBA 5JPMH 1C5VA 3PV4A 1HFDA 1HUTH 2BQ6B 2WPKS 2GCHF 2VWLA 1SQTA 2GCTB 6GCHF 1P2JA 3A84A 5BRRE 1RRKA 2TPIZ 5JBBS 4WWYA 3SNEA 1Y3VA 1BQYA 1O5DH 3A86A 1TPSA 3BG8A 1O5AB 4O3UA 4VGCC 3SV7A 5DGJA 1A5HA 8ESTE 4DG4A 1TX7A 3P6ZB 1NC6A 1EJMA 4F49A 3OYPA 3ELAH 1SGYE 2G00A 4UE7H 4K8YA 2FOCA 1OPHB 2NU4E 2BXUH 1C2FA 1CVWH 5DP9A 3CS0A 3Q76A 4YT7H 4KGAA 3E8LA 4YO9A 3T62A 2OBOA 2EI7A 4Q7XA 5FHTA 1Z6JH 3RMNH 1PPZA 3OY6U 3VB7A 1GHBG 2Q6FA 4XDEA 1SR5C 1TE0A 3QWCH 1QBVH 1TMTH 4Q2KA 1AMHA 2BDYA 2ZU2A 1BMMH 1LPKB 1C5TA 1WCZA 1IQKA 1AUTC 3LH1A 3EYDA 2O8UA 1KXCA 2WUCA 3GCHC 3M7TA 4BAKB 1UHBB 5A09A 1AIXH 3RU4D 2BD8A 2Y82A 3PLPA 1VR1H 1C5ZB 3BTHE 3N7OA 1ANEA 3LGIA 1QQUA 1RFNA 1GMCG 1ACBE 1TGSZ 1HGTH 1PFXC 2KAIA 4X1RU 2WYJA 2VIPA 3UOUA 3SORA 5LPRA 5EQSA 1V2PT 5C67A 2ULLA 1C2DA 3RXMA 2EEKA 3UR9A 1ZHPA 3KIDU 3SV9A 1M9UA 3H7TA 1SGTA 3RU4T 2ZG0H 1P10A 1TMBH 1PPEE 3MU0A 1E35B 3UWIA 1EB1H 4XE4A 2AIQA 1UVTH 1QB1A 1ELDE 1TPOA 3L33A 1MQ5A 1WYKA 4WH6A 1UVPA 3BTME 1AHTH 2HALA 2OC8A 3A7ZA 5T3HA 1O2ZA 3SJOA 1GBKA 3GYMA 3ZV8A 3O8BA 1BTHH 2WPJS 4OS1A 1RXPA 3A82A 2BDIA 2SGQE 1BTZA 5T6GA 1C5PA 4MPVA 1SFIA 1V6DA 4JK6A 5EXNA 1DXWA 4AG1A 2R9PA 4NIVA 1GMHF 4D9RA 1A0LA 4GSOA 3KQDA 3HGPA 1HAHH 1IQNA 3MWIU 4YOIA 4I8HA 1EZQA 3NZIA 3PWBA 4SGBE 3AAUA 1Y5UT 2GCHG 1KYNA 2BLVA 2ZKSA 4MNWA 1P2NA 6GCHG 1FIZA 3E1XB 2ZEBA 1FAKH 1O2YA 3RM0H 3EE0B 4BAOB 4DCDA 4ZXYH 1HAOH 5ABWA 2F9OA 3QUMP 1O5CB 4AFQA 1NY22 4H6SB 2OQ5A 3K6ZA 3VEQB 2ZFPH 1V2WT 4M7GA 1PQAA 3GY6A 3U8OH 1TNHA 1YBWA 3D49H 1JIRA 1ZTKA 6ESTA 2ZDVH 3K2UA 1GBJA 1EZUC 2G4TA 1K9OE 3LH3A 1C2KA 1O2PA 2ZCLP 3QN7A 4Q7ZA 1KXDA 4MPUA 3SI3H 2A45B 1C5WB 2VJ1A 4FUHA 1L1NA 1YGCH 5DP8A 2VIQA 2TGPZ 3ATLA 2P16A 1YPHE 3SI4H 2VIVA 1BBRK 2GVFA 1HB0B 1O2LA 2FXRA 2BYAX 4OS5A 5C5OA 4AYYB 1XX9A 1TWXB 1YF4A 3PMBB 4K1TA 2A4RA 5ESTE 1AU8A 4HGCA 1DWBH 1RTFB 1YPHC 2JETB 4Z0KA 1GI3A 4K60A 3TLOA 3C27B 2ZHWH 3GISB 1CGIE 2QN5T 3GICB 3LU9B 1XM1A 3E3TA 1TLDA 3Q3YA 4ZKSU 1ETTH 2OQUA 2ZU3A 1AE5A 4Y71A 1WU1A 5DJ7A 1P02A 3EGKH 1ELFA 3PO1B 5F6MA 2A4OA 1Z7KA 1ZRKA 1FV9A 1V2NT 1LKAA 1BB0B 3FFGA 3RUOA 3U1IB 1S6HA 4X1NU 1O3CA 1SVPA 1Z8GA 4TY7A 1Z1JA 1V2MT 2A1DB 2G81E 5EQQA 5G4BA 3SW2B 3A81A 4UEHH 1BTXA 1Y3YA 2VIOA 3LGUA 3P70B 2ASUB 2FEQH 4ESTE 2BLWA 2Z7FE 3D23A 2QXJA 4JYTA 1J15A 2JKHA 2IJOB 8LPRA 4BTUB 1T7CA 2AMPA 1H8DH 1AWHB 1ELCA 1O2RA 4CHAB 1P9UA 2TRMA 3S7KB 2ESTE 4BXWA 1SOTA 1SLWB 1QHRB 3S9BA 1CSOE 5AHGH 1CA0C 1GI5A 1GL1A 3A88A 3K6YA 2ZDLA 1S81A 5TCAA 1LPZB 4CRGA 3SV2H 2J4IA 2C8YB 3TGIE 1O36A 1ETSH 3CENA 1GBDA 5DP4A 4CRAA 1BHXB 3BTEE 1XXFA 8KME2 2ZECA 3BTDE 2NWNA 2PKAB 4YESB 1GMHG 3UWJH 1TNLA 2ZF0H 3AAVA 2FX4A 1BA8B 2QA9E 1BBRH 3STIA 1QJ7B 5DP7A 4I8LA 1CQQA 1GBMA 2XCFA 4XBCA 3SNBA 4K3JA 1O3HA 1MU6B 1FY5A 1SQAA 4ZKOU 4RSPA 2OBQA 5BPEA 1LDTT 1L1JA 1HNEE 3KF2A 2FS9A 3LJOA 4JCNA 4BAMB 2XBYA 4A1TA 4ABJA 5EPNA 3S0NA 2TGAA 1PJPA 1C1MA 1DITH 2ZQ2A 3O8CA 3TNTA 1SGPE 1GG6B 4Y7AA 5EW2H 1U6QA 1UCYE 1DLKB 1GHZA 1VCPA 3PWCA 2Y5GA 1IQHA 3SJIA 1TRYA 3LGYA 2BZAA 3RXJA 4GHTA 1EATA 1EXFA 3A8DA 1O0DH 1EPTB 1O2KA 3LGTA 1N6YA 1BITA 3ZVFA 2PFEA 3ODFA 2PTNA 3PYHA 4YLUA 3MNCA 1CT2E 1MKWK 3Q3XA 1O3IA 4ISNA 2A7HA 3ATIA 1UTOA 1Y8TA 3TK6A 3KHVA 1QCPA 3TJOA 2QF0A 2XNIA 4BTTB 4NZLA 1S0QA 2NU0E 4ABEA 1D6WA 1X7AC 1UK4A 2Z94A 3CP7A 2JETC 2QXHA 3BTTE 1TRMA 1ZMJA 2QY0B 2JH5D 1AZZA 1D3QB 2FDAA 1OWKA 4B2CA 1TNGA 3GY8A 3TITA 1GCDA 5EQRA 1ZJDA 3PLBA 2GT8A 1QY6A 2ZU4A 2D26C 1GJ7B 1ZMNA 2TBSA 2QIQA 4FU8A 4JZDH 3V7TA 1INCA 2ZU1A 3VB6A 1GI6A 1THSH 1S0RA 2VH6A 5DK1A 4D8NA 3HKJB 1MCTA 2PR3A 1HXEH 2G4UA 5HXFA 1LVBA 3OX7U 1O5FH 3H5CB 3RM2H 1G2LA 4B2AA 1L2EA 3Q00A 4KKDA 2RCEA 3A8AA 5FBIA 2QC2A 4CHAC 2ANMH 1TGCA 1UMAH 2TIOA 3DHKH 2BDBA 3ZVCA 3ZZ4A 1BMLA 1GHXH 4WXIA 1MMJN 4XBDA 5JBAS 3RXOA 3MU5A 1DY9A 5JDUB 1GBAA 1QBNA 3BTFE 4E7RG 3M61U 3A83A 3A87A 4IN1A 1O2TA 1MKWH 4AX9H 3BTGE 3RXTA 3SNCA 1FQ3A 1BTUA 1GDQA 2AGEX 2F9VA 2VIDA 4YTAA 1BT7A 3RMOH 5EGMA 1ZGVA 3BEIB 2QXIA 5GCHF 2FODA 4NIYA 3HGNA 1SG8B 1MAYA 2O8TA 4FUGA 2ANKH 1SGFA 4IMZA 1ZTLA 1LVMA 2BDAA 2V0BA 4Z6AH 1SQOA 1YCPK 2Y7ZA 3ZYEA 1UTQA 2AMQA 3OTJE 3KCGH 4K1SA 4FUJA 4U2WA 1TAWA 3C1KA 3BTWE 1A0JA 1OP0A 1V2RT 1TALA 2GD4B 3ZV9A 4A7IB 1GVKB 1NRNH 2FOGA 3HK3B 1IOEA 3W94A 1DM4B 1NRSH 3UUZA 3VXFH 3PM3A 4ISLA 1NN6A 5A8ZA 1SC8U 5HYOA 1RD3B 3EAJA 3ATKA 2Y5HA 3ESTA 2GX4A 4NWLA 5HM2A 1FI8A 3QTOH 4AOQA 1WQVH 4IBLH 3UR6A 3OU0A 3UNSA 1KXBA 4ZHMU 1CU1A 1ANCA 4WMFA 3MNXA 1BOQA 5EODA 2UUYA 1G9IE 1ZSKA 1P03A 1BZXE 4DOQA 1O2GH 1OSSA 1NM6A 4CRFA 1HJ8A 2A2QH 1HJAC 1YPJH 1W11U 4ZH8A 4ABAA 1DSUA 3MO6A 3OSYA 1YPLH 4IW4E 5DPAA 1S85A 1O3DA 1QFKH 1KXFA 4FUBA 3LOXA 1ETRH 1QB6A 2OC1A 1HAGE 4LXBH 2BMGB 4B75A 3TU7H 1CT4E 1GJBB 1ELGA 7KMEH 1C2MA 1LKBA 1T32A 4GAWA 2Q6GA 2HLCA 1OXGA 1F92A 4JMYA 2PGBB 1W13U 1THRH 1HJ9A 2CGAA 5DP3A 1WV7H 3FAOA 1TBRH 7LPRA 3DFLA 3SU4A 4OS2A 4QT8C 2CHAB 1WQSA 2ZFFH 4O3TA 2H9TH 3TH4H 1QBOA 4CBNA 2ZGCA 1VGCB 2ZI2H 3V12A 5DG6A 1GVZA 3ZZ5A 1Y3UA 3ZVAA 2BLOA 5FPYA 3VPKA 1O2JA 1WAYB 4X8TH 1O2QA 4GPGA 5A8YA 3MMGA 1BMNH 4DW2U 1CT0E 4X1PU 1A1RA 4DGJA 5AFZH 1D3PB 1MBMA 2Q1JA 3UIRA 3GYLB 4IN2A 2WV4A 2ZHDA 1AKSB 1NO9H 1BIOA 3B23B 4MPXA 4IMQA 3A8CA 4CRBA 1GBHA 5E0GA 4UFGH 3SU1A 2NU3E 1OOKB 3L3TA 1WSSH 3BIUH 2XC4A 4K69A 1H4WA 3A80A 1T31A 1G37A 5C1XA 4OGXA 2H2ZA 5ESBA 1C5SA 5F03A 1S84A 1K1MA 3O8DA 1GL0E 1V2QT 1HIAB 4U32A 2FZZA 5EXLA 3S7HB 4FU9A 1XVOA 1AGJA 1ABJH 3RP2A 1TGBA 3MFJA 2V35A 4ZUHA 3M5LA 3DFJA 2H9EH 1OX1A 2DUCA 4FXGH 4CREA 3GDSA 1ZR0A 1O3FA 3GY7A 3V0XA 3ZZ3A 1T8OA 4R0IA 3MNSA 5EG4A 1E38B 1MTVA 1SHYA 1EP6A 3QGNB 4TYDA 1IHTH 1DWDH 1C1TA 1FN8A 5JB8S 4BOHA 2AERH 1MTSA 1NESE 1HAZB 1SBWA 5FX6A 4GLYA 5CHAC 4XSKU 2BY8X 2BZ6H 1UCYK 3RXIA 1AQ7A 5E8EH 4OGYA 3ATMA 2SGDE 2W7SA 4B71A 3I29A 4HI3A 2BD3A 1MZAA 2C90B 2THFB 4LOYH 4AYVB 3TGJE 1SB1H 1J16A 2O8MA 3SGBE 1KSNA 2ZZUH 1VCQA 1ZYOA 2RG3A 1SGCA 2FYRA 1A46H 2BXTH 3HATH 3M3SA 1UTPA 2A4QA 1B0EA 1SGFG 1C1QA 3FP6E 2GMTB 2F9PA 1LVOA 1P06A 2ANWA 4Y8XA 1GBCA 2EI8A 5GPIB 1YM0A 3ZVEA 1PQ7A 3TNSA 2BOKA 1TGTA 2A31A 3SUDA 1MBQA 2Y6TA 1HAVA 1K1OA 1EB2A 1O39A 2CHAC 3SNAA 2AGGX 3P92A 2RA0A 8GCHF 2BTCE 1KTSB 3LKWA 1IQJA 2FESH 4WF8A 1EOLA 1VGCC 5AF9H 1J9CH 4ABBA 4PROA 3ZZ6A 1YP9A 2AIPA 2FOMB 2V6NA 3U8TH 3QZRA 1NPMA 1FY1A 1N6XA 3AASA 2Y5FA 1GI4A 4X2YA 3LC5A 1PYTC 1CBWB 1O5EH 3SN8A 2Z9IA 1NRRH 1LQEA 1PPGE 2BVXH 3NUMA 2G55A 2BOHB 1O2XA 1Z8RA 1XUJA 3PB1E 5A0AE 2GGVB 1XKAC 1P8VC 2ZO3H 2Q6DA 4OS6A 1IAUA 1GGDB 2FS8A 1OKXA 4ABDA 3MH5A 1C5LH 1D9IA 1AVWA 4OS4A 3D65E 1UCYH 1NFXA 5E0HA 2STAE 2BY6X 3B8JA 5JBCS 1CO7E 2Z3DA 1P57B 1EZXC 1EJNA 2G5NA 2GCTC 2QAAA 3UQVA 4NIXA 1CGJE 1YKTA 4O97A 1C1NA 1GMDF 1UK2A 3ATWA 3G01A 2P93A 2XC0A 3A7VA 3M7QA 2G5VA 1ZTJA 2QXGA 1A5GH 1DY8A 4FUCA 1CGHA 3IITA 2AS9A 2R2MB 1O2SA 2C93B 5EW1H 2R2WU 1E34B 2H5DA 1G2MA 1W10U 2F9BH 3JZ2B 2XYAA 1DX5M 1H9LB 3ZZDA 3RXQA 3A85A 1ELEE 3MYWA 2QYIA 1ZZZA 4I32A 2GZ9A 2FLBH 2YOLA 2VWMA 1JWTA 1G30B 3QDZB 2FOHA 4FUEA 1RTKA 2CXVA 2BD5A 3RXRA 2P3UB 2B8OH 4MPWA 4GHQA 4JZEH 1F7ZA 1KDQB 3F9GA 2XW9A 5LPFA 2C3SA 2BY7X 5FBEA 2J95A 1EUFA 3SU3A 3U8RH 2WUBA 2XTTB 3MO3A 1F5KU 2OCVB 5GDSH 3ZVGA 1W0YH 2B5TB 1O3GA 1TPAE 4X8SH 1TFXA 1P2OA 2H5CA 2HNTC 1SOZA 1GI7B 2BB4A 5GIBA 4XFQA 1AY6H 3SGQE 2AFQB 1GBEA 2CJIA 1G32B 1LHFH 2FPZA 3VB4A 4FUIA 1DS2E 1VITF 1UTKA 5A0BA 2Z9KA 2F9NA 1P09A 1JOUB 2Y80A 4ZAEA 3HKIB 1RJXB 4D9QA 2C4FH 2F3CE 8GCHG 3RXAA 7ESTE 5K0HA 2NU1E 5E2PA 3EDXB 4UONA 1FY3A 1VCWA 1O3LA 2RDLA 4X2WA 1AN1E 2ZWLH 3SUFA 4MQAA 5I46H 4FUDA 1K22H 1KLJH 3VGCB 1A7SA 1HV7A 3K65B 2OTVA 1UVUH 3TH3H 4SGAE 3V3MA 1VZQH 4HZHA 2ILNA 1BRAA 6CHAB 1GGDC 1QURH 3LGWA 4Y0YE 1ZPBA 2Z6BD 2CV3A 2A0QB 1QL8A 1EJAA 3ZZ8A 1C2JA 3GDVA 1F0RA 1VJAU 3HPTB 1A0HB 1Y5AT 1Z8IB 3KNXA 2PV9B 4AGJA 3U9AH 3QTVH 1O2UA 1BTWA 3M7UA 1NFUA 4JZIA 2VGCB 1TB6H 4UFEH 3TK9A 4D76A 4NA9H 3UPEA 2IOTA 2UUJB 1GMDG 1GBLA 1Y3XA 4DT7B 1AD8H 3MTYA 3URDA 3VXEH 4I7YH 1IQMA 3SJKA 1MUEB 1LPGB 2AEIH 4BAQB 2ZFQH 2ZTXA 2F91A 3TJVA 2A7JA 2O8LA 4O03A 4ASHA 4X2VA 1LHEH 1GJAB 1QQ4A 5FCRA 4OS7A 1SLVB 4ISOA 1W3CA 1UHBA 3JZ1B 4THNH 1C5YB 4JZFH 4I31A 1O2VA 2WYGA 1Z6EA 3W95A 1NU9A 1TIOA 4Y8ZA 1N8OB 1A2CH 2ALPA 1OYTH 4A92A 2A5KA 2G51A 2Z3EA 4H42U 1P2MA 1D4PB 2ZDNA 3RC4A 3AW1A 5AVDA 2H9HA 4K2YA 1OP8A 4WH8A 2FLRH 4ISIH 2ZPRA 1TNKA 2FI3E 2HPQH 1EAUA 1ZGIA 2OINA 3Q3KA 1FZZA 1F0TA 5F8TA 1IHSH 1BTPA 1TBQH 1BDAA 1FUJA 4WJG2 2R3YA 2R0KA 2PSYA 3PO1C 1DPOA 3KN2A 2PGQB 4KTCA 3RXEA 1MAXA 3DT0H 5J4QA 2CN0H 2FOFA 5C2ZA 1J8AA 4MTBA 2PW8H 1OWHA 3KQEA 1VITG 2SGAA 1HAIH 2O8WA 2ZTYA 2SFAA 9LPRA 1KTTB 1LHGH 3O8RA 1EAIA 2ALVA 2SNWA 2UWPA 2A32A 3SUGA 2OC7A 1GJCB 1TONA 1MZDA 2HPPH 5HMAA 5C1UA 4I33A 2PUQH 5L30H 1D3DB 1O2MA 1EASA 4NSYA 3M5NA 2QCYA 5DKMA 1JRTA 1O3BA 1EP5A 2XBXA 3P8OA 3EQ0H 1PPBH 3BTKE 2IN2A 2ZFTA 2FIRH 3VGCC 2BM2A 3E91A 1HYLA 5JB9S 3RC6A 1DANH 4XBBA 3T28A 2BDGA 2LNCA 3F1SB 1ORFA 1HAXB 3GCTF 3MU1A 6CHAC 5GJ4B 4X6PA 1V2JT 3SZNA 1AE8H 3BV9B 4ZKRU 1UVOA 1ARBA 1CA8B 3NCLA 2VB0A 1NROH 5GXPA 4NIWA 4E05H 4Y6DA 4AG2A 4UD9H 5CE1A 1KIGH 4B73A 1C9TA 2VWNA 4LK4A 1QRWA 2KAIB 2ZPQA 1FJSA 4J1YA 1TOMH 4MLFB 3RXSA 4DIHH 4Y79A 4MNXA 2BHGA 5TJXA 1C5QA 1G36A 3UTUH 3NWUA 1H8IH 1OWEA 4LZ4B 2P8OB 3AW0A 4NZQA 1VJ9U 2XRCA 2HWLB 3A89A 1GG6C 1O3NA 4YZUA 2FTMA 3RXBA 1VITH 1DDJA 3A7TA 4HTCH 2STBE 4Y8YA 4ZHLU 1JRSA 1T8NA 5PTPA 2OD3B 4ABIA 1SGQE 1TA2A 2GV6A 3M5OA 1EPTC 1ABIH 1QNJA 5L2YH 1ZRBA 1BRCE 1C2IA 2WPLS 1FIWA 3BTQE 1QJ6B 2VINA 2GT7A 2EI6A 4Y7BA 4KELA 2I6QA 1WTHD 2BY5X 1EAWA 3ZZ9A 2JH0D 4TPYA 4WMEA 1C4Y2 2AMDA 1BTYA 1V2TT 2FM2A 3LT3A 1TNIA 3KQBA 2OXSA 2NU2E 1C1WH 2ZIQH 4NWKA 4LZ1H 3ZZCA 2ODPA 2Y7XA 2G8TA 5JYIA 5K7RA 1AFQB 2FI5E 1QA7A 1QRXA 1V2KT 3TGKE 1OS8A 2P3TB 1IQEA 2J2UA 3RLYH 2LPRA 4ZROA 4H4FA 1LHDH 5C1YA 1FMGA 4X6OA 3ZVBA 3F68H 5HM9A 2XXLA 1JMOH 5EOKA 4FU7A 2F83A 1ZSJA 3VB5A 1Z71A 2FP7B 5FX5A 1ZMLA 2W26A 4YOGA 1AO5A 5C20A 5AFYH 1V2UT 1O31A 1IQLA 4CH8B 3ZZBA 2FYQA 4IC5A 2ZHEH 3M3TA 1P12E 1C2LA 1EZSC 1W7GH 5EXMA 4DY7B 2PKAA 2ZGJA 1Q2WA 1IQFA 1DICA 3MH4A 1PYTD 3MU8A 3SV6A 4BXSA 4NSVA 2P95A 3P17H 4AFUA 1YPEH 3LJJA 1V2ST 2H6MA 4X0WU 3ITIA 4INKA 2O9QA 1HAYB 1LQDB 3RXVA 1AZ8A 2QF3A 3FP7E 4TWYA 4Y11E 4GVUA 2F9UA 1GBTA 4BAHB 1RTLA 4DURA 3UFAA 1OP2A 2M5TA 1MH0A 3QX5H 1JIMA 3BG4B 4MNYA 3GCTG 2ZDAH 4ABFA 2B0FA 2G52A 1C9PA 1XUHA 4WY3A 3A8BA 2FOBA 1TQ0B 4YOJA 4CRDA 4ISHH 1K28D 3I77A 1ZLRA 2A4GA 2QGRA 2J92A 4A1VA 2SGEE 3SBKA 4CR5A 3PLKA 1EPTA 1O3OA 1OWDA 3WY8A 1O2OA 1QGFA 1DOJA 1QRZA 5GCHG 2P8OC 3T25A 1ESAA 2I6SA 5E2OA 1QL9A 1W2KH 1Z8JB 2D2DA 2ZDKA 1C5NH 2A5IA 1ZJKA 2GTBA 3QZQA 1O3AA 2VVVA 2XC5A 2BDCA 3TH2H 4GCHF 3RXKA 5FPSA 4MG3A 1C2HA 1BHXF 1EKBB 2HRVA 4DJZB 4IS5A 2R0LA 1E37B 4TWWA 1J17T 4DIIH 1O33A 1QIXB 2ZHQH 3BF6H 1P11E 1P2QA 1NTPA 1GI8B 4NA7A 1SGIB 2P59A 2Z9LA 5JBTA 2GP9B 2PSXA 1GI1A 2J9NA 3U98H 1W14U 1TABE 5L2ZH 4E7NA 1XVMA 2XWBI 4K1EA 1GJ9B 1O2NA 1YLCA 1AFEH 1PQ8A 3KL6A 3UOPA 4E06H 1ELVA 1AFQC 1AUJA 1LCYA 1BRBE 2ZC9H 4KTSA 1GJ4H 1YC0A 2Z9GA 1DUAA 1NS3A 1Z1IA 3FZZA 5LGOA 2A2XH 1LTOA 1Y3WA 2WV5A 4TY6A 3K9XB 3SU6A 5IYTA 1O32A 1AVGH 4CRCA 1PQ5A 1G3CA 2BD2A 1ARCA 3SQEE 1FAXA 3TVJB 1FNIA 2BQ7B 1JBUH 3LC3A 5A2MH 1HDTH 2FWWA 2V3OH 2VVCA 1MTNB 5HGGA 4J2YB 4H6TA 5DP5A 2ZGXH 1G3BA 2BLQA 3MH6A 1GJ8B 1DSTA 3URCA 1P04A 3E0NB 5A8XA 4TPIZ 1O5BB 1C1RA 4INLA 4JYVH 2GKVE 1MKXH 3ODDA 3UNRA 4BNRA 3LGVA 3T29A 4F4OC 2J94A 4O9VA 4YT6H 4Q80A 2RA3A 1WBGB 3PMAB 1GI9B 2AGIX 3SO3A 1NFWA 2GZ7A 3BG4C 1UJ1A 1SGNE 5CMXH 1S6FA 1LHCH 1XUIA 1BJVA 1TOCB 5TCCA 2ZGBH 1SI5H 3ZVDA 1SHHB 1AB9B 3HK6B 1LVYA 1TGNA 1W8BH 1FDPA 4B76A 1L4DA 1V2OT 1A3BH 3F6UH 3RMMH 2BQWB 2K1QA 3NKKA 1C5RA 3A7WA 3V13A 3GY5A 3PTNA 1F2SE 4INHA 1T8LA 1C1OA 1GPZA 2BD9A 2C8XB 2XBVA 1CA0B 3D62A 3SNDA 5C5NA 2W5EA 3GOVB 5ETXA 4YM9A 2FI4E 2VH0A 4GCHG 2B7DH 3KGPA 2ZCHP 1C5UA 1MD7A 5B6OA 1D3TB 2ZNKH 2P3FH 1SPJA 1GHAF 2FOAA 2UUFB 3VB3A 5E0JA 1YPKH 3RXDA 4CH2B 4DVAU 1P2KA 1L1GA 1P0SH 3F9FA 4ABGA 4NG9H 4AGKA 1AWFH 3R3GB 3QLPH 3GCOA 1UTLM 3SUEA 3SHCH 4CBOA 3UNQA 1XXDA 4NFFA 3ZYDA 3M5MA 1P05A 2ZFSA 1MCVA 3BSQA 2OLGA 3MHWU 2C8ZB 2ZHFH 2SGPE 3E6PH 4X1QU 2DE8A 2HGTH 1SGRE 2PKSB 1F0UA 2FMJA 1FONA 2BX3A 3I78A 1QR3E 3CS7A 5IDKA 2ZQ1A 1SFQB 2HNTE 1GBIA 2XCNA 4CR9A 1J14A 1MD8A 3PROA 4NCYA 5SGAE 1HRTH 2J38A 2VIWA 1OWJA 3LDXH 1YPMH 2GMTC 1ELTA 1BMAA 3BEUA 3DUXH 3IG6B 4UFDH 3STJA 1MTNC 2A7CA 5FXLA 1TBZH 1CHOF 3RLWH 4B1TA 1N1LA 4K5ZA 1DE7H 1PPCE 3RU4E 1ZHRA 3GY2A 3E0PB 3ZZAA 1XUFA 4ZXXH 1RGQA 3RXPA 2GV7A 1A61H 1AKSA 1SGEE 2W3KA 1Q31A 4AN7A 2AH4X 2P94A 3RC5A 3M37A 2SNVA 3SOSA 1XUKA 4I8JA 1EX3A 1V2LT 1O2IA 3R0FA 1GHVH 1QA0A 1DWEH 1G3DA 1XUGA 1IQIA 2EA3A 3GCNA 1HAPH 1NFYA 1F5RA 1TPPA 1CBWC 1NRQH 1Q3XA 1NZQH 3SU0A 2IPHA 2GDEH 2Z9JA 1O3KA 1UTNA 1Y5BT 1MU8B 3P95A 5LPEA 1HIAA 1AB9C 1O5GH 4FUFA 1O3EA 4FVDA 4D7GA 3F9HA 5FPTA 1A3EH 1E36B 1RS0A 1O35A 2C8WB 2ZP0H 5FCKA 3NXPA 5C3NA 3LPRA 3F9EA 5GWZA 4NA8A 1BCUH 4U01A 3RXFA 2BVRH 4X6MA 1K1IA 3RXHA 2TGTA 3MI4A
chains in the Genus database with same CATH superfamily
1O2WA 4ZHAA 2VBCA 1T8MA 2ODQA 1SL3A 2CF8H 3DA9B 1WTGH 3MNBA 4WMDA 5H4IB 1GHWH 2XBWA 2R3UA 1LMWB 3EA8A 1B5GH 4A5TS 5DO4H 1LO6A 1H1BA 1MTUA 2ZCKP 3DSGA 3S9AA 2W7UA 1SLUB 2PWXA 4X8VH 5F8ZA 1PPHE 4X1SU 2LELA 1TRNA 1GHAG 1DUEA 1NRPH 2ODYB 3T26A 3SGAE 1THPB 3T27A 1COWD 5F8XA 1W7XH 4D7FA 5A0CA 1T4UH 1BUIA 1FLEE 5KGOA 3FANA 1KY9A 4JK5A 4YLQH 1PPFE 1RIWB 4ABHA 3EA9A 2J98B 4AB9A 1GCTB 1K21H 4KTUA 2PKSC 3TPIZ 3EA7A 3MU4A 2F4LA 3TIUA 1EAXA 3S9CA 3P8GA 1DVAH 4X2XA 4Y10E 1H9IE 1OYQA 3L6PA 1P2IA 2WZQA 5I25A 2HVXA 2H1UA 2BDHA 3ENSB 4UFFH 3PMHB 1MQ6A 3OY5U 1GBBA 3Q77A 6LPRA 3KYGA 3QO6A 1KXEA 4MVNA 1AI8H 1W0ZU 1UK3A 2VNTA 3F2GA 5L6NH 2KCYA 5J4SA 3BIVH 2BY9X 1GI2A 1TMUH 1GJDB 3VFEA 1K1JA 2W3IA 1CHOG 5EPYA 4JYUH 1EQ9A 4AB8A 3B9FH 1FN6A 1HJAB 1ZPZA 1BJUA 3DD2H 1KXAA 5LH8A 3MH7A 3GY4A 2KX4A 2GZ8A 4KP0A 1P3EA 3UREA 1ANDA 1KMHB 3A7XA 2TGDA 1GJ6A 2PP6A 1HCGA 2EC9H 1QJ1B 2XWAA 4YXWD 1K1NA 3RXCA 1ZSLA 2BD7A 4I8KA 3TK5A 1T4VH 3H7OA 4ZMAH 1H9HE 4Z1MD 4XOJA 1F0SA 3KEEA 3LIWA 4NFEA 2HNTF 1C5MD 1SGDE 2FX6A 1DFPA 2VVUA 3RXGA 3MOCA 1V3XA 3NPSA 2CMYA 1FPHH 3SQHE 1XMNB 1GWAA 1TX6A 1Y59T 1B0FA 1ELBA 2FOEA 1KLIH 1P9SA 2YMSD 3M36A 3SHAH 4ZKNU 1GBFA 1S5SA 1QB9A 4IGDA 1K0HA 1B7XB 5EJZA 1DT2A 3E90B 2SGFE 3OEHD 4R8TB 4RKOB 3U1JB 9ESTA 1SSXA 2ZTZA 2V3HH 4NGAH 2FO9A 1D6RA 2FTLE 2ZDMA 2PLXA 3M35A 1ZOMA 2WPIS 1ID5H 2ZFRH 1G3EA 1O3MA 2VGCC 1SMFE 2BVSH 2OC0A 1FXYA 7GCHF 1F5LA 1HAVB 1HBTH 2BD4A 5C0TA 1C5OH 1HPGA 1O3PB 2BX4A 3ZZ7A 3FZDA 2JJ1D 4HFPB 2ZGHA 2A5AA 3MO9A 1MTWA 2JH6D 2WPHS 1FX0B 1KDQA 4WVPE 1O30A 3GY3A 2PHBA 1GHYH 1NU7B 1WOFA 2AYWA 2UWOA 1K2I1 1DWCH 2VWOA 3FVFB 3M3VA 1UTJA 2DE9A 5DP6A 3RMLH 1WXRA 1C2EA 2VU8E 3T2NA 1GI0A 3FP8E 1O2HA 1ZPCA 4GUXA 1A5IA 1RIWC 1UTMA 3RDZA 1BBRE 2ZA5A 1N8OC 1FY8E 1GCTC 2B9LA 3PTBA 4A6LA 3P8NA 3LONA 3QGJA 4Q7YA 2PUXB 4VGCB 3SU2A 3RXUA 1IQGA 1FPCH 1E0FD 3KQCA 3TJNA 1DLEA 1C1VH 1C1UH 1O34A 3SJ8A 1FY4A 1GDUA 1YYY1 5FAHA 1OWIA 4AFZA 1C1PA 1YCPM 2YNAA 4RKJB 4X8UH 4FETA 4Y76A 4AFSA 1ESTA 1UVSH 2ZU5A 1ZHMA 1K1PA 4AORA 1P01A 3U69H 1S6LA 2CF9H 1W12U 3T5FH 1YLDA 2WINI 1WUNH 1O38A 1ANBA 4U30A 5CHAB 1EOJA 3RXLA 2Z3CA 4RN6A 1V2VT 2D1JA 1CHGA 4B2BA 1UO6A 3N7DA 1S82A 1O3JA 1GHBF 3E16B 1HLTH 3QK1A 1TYNA 1QTFA 3UY9A 3P8FA 2OP9A 3GCHB 3A7YA 4MNVA 1TA6A 5EU8A 5T6FA 1JXPA 1P3CA 3PRBA 2ZPSA 1GVLA 3SU5A 3SV8A 4IC6A 3BN9A 1GMCF 1GDNA 4I8GA 3AVZA 1A4WH 1ELAA 1NT1A 4K8BA 1TQ7B 1S83A 2OUAA 1L0ZA 1C4V2 3S69A 1ESBA 3IWMA 4WXVA 2D8WA 2GDDA 1HXFH 1K1LA 2Y81A 1CE5A 3KYFA 1YCPH 2UUKB 4FVBA 1AVXA 1YY3A 4AZ2B 5T6DA 4F55A 4X6NA 1C5XB 1BRUP 4Y0ZE 2HOBA 4MDSA 3UQOA 2ANYA 1SLXB 3BEFB 4BTIB 3TJUA 1C2GA 1TNJA 4BANB 2WPMS 4B74A 4JZ1A 4XRNA 2J34A 4UDWH 2UWLA 1TX8A 7GCHG 1XKBC 3GDUA 1KLTA 1L4ZA 3SJ9A 1YPGH 1C4U2 1MKXK 1DXPA 2QV1A 1O37A 2PTCE 3NK8A 3PMJA 1C1SA 1GJ5H 1QL7A 4A1XA 2YNBA 4Q63A 4XD7D 5JPMH 1C5VA 2K8IA 3PV4A 4TT3D 1HFDA 1HUTH 2BQ6B 2WPKS 2GCHF 2VWLA 1SQTA 2GCTB 6GCHF 1P2JA 3A84A 5BRRE 1RRKA 2TPIZ 5JBBS 4WWYA 3SNEA 1Y3VA 1BQYA 1O5DH 2HLDD 3A86A 2JIZD 1TPSA 3BG8A 1O5AB 4O3UA 4VGCC 3SV7A 5DGJA 1A5HA 8ESTE 4DG4A 1TX7A 3P6ZB 1NC6A 1EJMA 4F49A 3OYPA 3ELAH 5C94A 1SGYE 2G00A 4UE7H 4K8YA 2FOCA 1OPHB 2NU4E 2BXUH 1C2FA 1CVWH 5DP9A 3CS0A 3Q76A 2QF5A 4TSFD 4YT7H 4KGAA 3E8LA 4YO9A 3T62A 2OBOA 2EI7A 4Q7XA 5FHTA 1Z6JH 3RMNH 1PPZA 3OY6U 5T1VA 3VB7A 1GHBG 2Q6FA 4XDEA 3F0OA 1SR5C 1TE0A 3QWCH 1QBVH 1TMTH 4Q2KA 1AMHA 2BDYA 2ZU2A 1BMMH 1LPKB 1C5TA 1WCZA 1IQKA 1AUTC 3LH1A 1SQRA 3EYDA 2O8UA 1KXCA 2WUCA 3F3BA 3GCHC 3M7TA 4BAKB 1UHBB 5A09A 1AIXH 3RU4D 2BD8A 2Y82A 3PLPA 1VR1H 1C5ZB 3BTHE 3N7OA 1ANEA 3LGIA 1QQUA 1RFNA 3SYJA 1GMCG 1ACBE 1TGSZ 1HGTH 1PFXC 2KAIA 4X1RU 2WYJA 2VIPA 3UOUA 3SORA 5LPRA 5EQSA 1V2PT 5C67A 1NBME 2ULLA 1C2DA 3RXMA 2EEKA 3UR9A 1ZHPA 3KIDU 3SV9A 1M9UA 3H7TA 1SGTA 3RU4T 2ZG0H 1P10A 1TMBH 1PPEE 3MU0A 1E35B 3UWIA 1EB1H 4XE4A 2AIQA 1UVTH 1QB1A 2KR7A 1ELDE 1TPOA 3L33A 1MQ5A 1WYKA 4WH6A 5F53A 1UVPA 3BTME 1AHTH 2HALA 2OC8A 3A7ZA 5T3HA 1O2ZA 3SJOA 1GBKA 3GYMA 3ZV8A 3O8BA 1BTHH 2WPJS 4OS1A 1RXPA 3A82A 2BDIA 2SGQE 1BTZA 5T6GA 2JJ2D 1C5PA 4MPVA 1SFIA 1V6DA 4JK6A 5EXNA 1DXWA 3FKSD 4B6FA 4AG1A 2R9PA 4NIVA 1GMHF 4D9RA 1A0LA 4GSOA 3KQDA 3HGPA 1HAHH 1IQNA 3MWIU 4YOIA 4I8HA 1EZQA 3NZIA 3OFND 3PWBA 4SGBE 3AAUA 1Y5UT 2GCHG 1KYNA 2BLVA 2ZKSA 4MNWA 1P2NA 6GCHG 1FIZA 3E1XB 2ZEBA 1FAKH 1O2YA 3RM0H 3EE0B 4BAOB 4DCDA 4ZXYH 1HAOH 5ABWA 2F9OA 3QUMP 1O5CB 4AFQA 1NY22 4H6SB 2OQ5A 3K6ZA 3VEQB 2ZFPH 1V2WT 4M7GA 1PQAA 3GY6A 3U8OH 1TNHA 1YBWA 3D49H 1JIRA 1ZTKA 6ESTA 2ZDVH 3K2UA 1GBJA 1EZUC 2G4TA 1K9OE 3LH3A 1C2KA 1O2PA 2ZCLP 3QN7A 4Q7ZA 1KXDA 4MPUA 3SI3H 2A45B 1C5WB 2VJ1A 4FUHA 1L1NA 1YGCH 5DP8A 2VIQA 2TGPZ 2W6JD 3ATLA 2P16A 1YPHE 3SI4H 4ZCNA 2VIVA 1BBRK 2GVFA 1HB0B 1O2LA 2FXRA 2BYAX 4OS5A 5C5OA 4AYYB 1XX9A 1TWXB 1YF4A 3PMBB 4K1TA 2A4RA 5ESTE 1AU8A 4HGCA 1DWBH 1RTFB 1YPHC 2JETB 4Z0KA 1GI3A 4K60A 3TLOA 3WWBA 3C27B 2ZHWH 3GISB 1CGIE 2QN5T 3GICB 3LU9B 1XM1A 3E3TA 1TLDA 3Q3YA 4ZKSU 1ETTH 2OQUA 2ZU3A 1AE5A 4Y71A 1WU1A 5DJ7A 1P02A 3EGKH 1ELFA 3PO1B 5F6MA 2A4OA 1Z7KA 1ZRKA 1FV9A 1V2NT 1LKAA 1BB0B 3FFGA 3RUOA 3U1IB 1S6HA 4X1NU 1O3CA 1SVPA 1Z8GA 4TY7A 1Z1JA 3PRDA 1V2MT 2A1DB 2G81E 5EQQA 5G4BA 3SW2B 3A81A 4UEHH 1BTXA 1Y3YA 2VIOA 3LGUA 3P70B 2ASUB 2FEQH 4ESTE 2BLWA 2Z7FE 3D23A 4RI0A 2QXJA 4JYTA 1QZ8A 1J15A 2JKHA 2IJOB 8LPRA 4BTUB 1EFRD 1T7CA 2AMPA 1H8DH 1AWHB 1ELCA 1O2RA 3F2FA 4CHAB 1H8HD 1P9UA 2TRMA 3S7KB 2ESTE 4BXWA 1SOTA 1SLWB 1QHRB 3S9BA 1CSOE 5AHGH 1CA0C 1GI5A 1GL1A 3A88A 3K6YA 2ZDLA 1S81A 3H09A 5TCAA 1LPZB 4CRGA 3SV2H 2J4IA 2C8YB 3TGIE 1O36A 1ETSH 3CENA 1GBDA 5DP4A 4CRAA 1H8ED 1BHXB 3BTEE 1XXFA 8KME2 2ZECA 3BTDE 2NWNA 2PKAB 4YESB 1GMHG 3UWJH 1TNLA 2ZF0H 3AAVA 2FX4A 1BA8B 2QA9E 1BBRH 3STIA 1QJ7B 5DP7A 4I8LA 1CQQA 1GBMA 1WDIA 2XCFA 4XBCA 3SNBA 4K3JA 1O3HA 1MU6B 1FY5A 1SQAA 4ZKOU 4RSPA 2OBQA 5BPEA 1LDTT 1L1JA 1HNEE 3KF2A 2FS9A 3LJOA 4JCNA 2J97A 4BAMB 2XBYA 4A1TA 4ABJA 5EPNA 3S0NA 2TGAA 1PJPA 1C1MA 1DITH 2ZQ2A 3O8CA 3TNTA 1SGPE 1GG6B 4Y7AA 5EW2H 1U6QA 1UCYE 1DLKB 1GHZA 1VCPA 3PWCA 2Y5GA 1IQHA 3SJIA 1TRYA 3LGYA 2BZAA 3RXJA 4GHTA 1EATA 1EXFA 3A8DA 1O0DH 1EPTB 1O2KA 3LGTA 4P02A 1N6YA 1BITA 3ZVFA 2PFEA 3ODFA 2PTNA 3PYHA 4YLUA 3MNCA 3UAIC 1CT2E 1MKWK 3Q3XA 1O3IA 4ISNA 2A7HA 3ATIA 1UTOA 1Y8TA 2RFKC 3TK6A 3KHVA 1QCPA 3TJOA 2QF0A 2XNIA 4BTTB 4NZLA 1S0QA 2NU0E 4ABEA 1D6WA 1X7AC 1UK4A 2Z94A 3CP7A 2JETC 2QXHA 3BTTE 1TRMA 4F48B 1ZMJA 2QY0B 2JH5D 1AZZA 1D3QB 2FDAA 1OWKA 4B2CA 1TNGA 3GY8A 3TITA 1GCDA 5EQRA 1ZJDA 3PLBA 2GT8A 1QY6A 2ZU4A 2D26C 1GJ7B 1ZMNA 2TBSA 2QIQA 4FU8A 4JZDH 3V7TA 1INCA 2ZU1A 3VB6A 1GI6A 1THSH 1S0RA 2VH6A 5DK1A 4D8NA 3HKJB 1MCTA 2PR3A 1HXEH 2G4UA 5HXFA 1LVBA 3OX7U 1E1QD 1O5FH 3H5CB 3RM2H 3SZEA 1G2LA 4B2AA 1L2EA 3Q00A 4KKDA 2RCEA 3A8AA 5FBIA 2QC2A 4CHAC 2ANMH 1TGCA 1UMAH 2TIOA 3DHKH 2BDBA 3ZVCA 3ZZ4A 1BMLA 1GHXH 4WXIA 1MMJN 4XBDA 5JBAS 3RXOA 3MU5A 1DY9A 5JDUB 1GBAA 1QBNA 3BTFE 4E7RG 3M61U 3A83A 3A87A 4IN1A 1O2TA 1MKWH 4AX9H 3BTGE 3RXTA 3SNCA 2YMSB 3ZIAD 1FQ3A 1BTUA 1GDQA 2AGEX 2F9VA 2VIDA 4YTAA 1BT7A 3RMOH 5EGMA 1ZGVA 3BEIB 2QXIA 5GCHF 2FODA 4NIYA 2F43B 3HGNA 1SG8B 1MAYA 2O8TA 2W6ID 4FUGA 2ANKH 1SGFA 4IMZA 1ZTLA 1LVMA 2BDAA 2V0BA 4Z6AH 1SQOA 1YCPK 2Y7ZA 3ZYEA 1UTQA 2AMQA 3OTJE 3KCGH 4K1SA 4FUJA 4U2WA 1TAWA 4M9FA 3C1KA 3BTWE 1A0JA 1OP0A 1V2RT 1TALA 2GD4B 3ZV9A 4A7IB 1GVKB 1NRNH 2FOGA 3HK3B 1IOEA 3W94A 1DM4B 1NRSH 3UUZA 3VXFH 3PM3A 4ISLA 1NN6A 5A8ZA 1SC8U 5HYOA 1RD3B 3EAJA 3ATKA 2Y5HA 3ESTA 2GX4A 4NWLA 5HM2A 1FI8A 3QTOH 2EY4C 4AOQA 1WQVH 4IBLH 2KM0A 3UR6A 3OU0A 3UNSA 1KXBA 4ZHMU 1CU1A 1ANCA 4WMFA 3MNXA 1BOQA 5EODA 2UUYA 1G9IE 1ZSKA 1P03A 1OHHD 1BZXE 4DOQA 1O2GH 3N7EA 1OSSA 1NM6A 1W0JD 4CRFA 1HJ8A 2A2QH 1HJAC 1YPJH 1W11U 4ZH8A 4ABAA 1DSUA 4OM9A 3MO6A 3OSYA 1YPLH 4IW4E 5DPAA 1S85A 1O3DA 1QFKH 1KXFA 4FUBA 3LOXA 1ETRH 1QB6A 2OC1A 1HAGE 4LXBH 2BMGB 4B75A 3TU7H 1CT4E 1GJBB 1ELGA 2V7QD 7KMEH 1C2MA 1LKBA 1T32A 4GAWA 2Q6GA 2HLCA 1OXGA 1F92A 4JMYA 2PGBB 1W13U 1THRH 5HIZA 1HJ9A 1NBMD 2CGAA 5DP3A 1WV7H 3FAOA 1TBRH 7LPRA 3DFLA 3SU4A 4OS2A 4QT8C 2CHAB 1WQSA 2ZFFH 4O3TA 2H9TH 3TH4H 1QBOA 4CBNA 2ZGCA 1VGCB 2ZI2H 3V12A 5DG6A 1GVZA 3ZZ5A 1Y3UA 3ZVAA 2BLOA 5FPYA 3VPKA 1O2JA 1WAYB 4X8TH 3OTPA 1O2QA 3EE7A 4GPGA 5A8YA 3MMGA 1BMNH 4DW2U 1CT0E 4X1PU 1A1RA 4DGJA 5AFZH 1D3PB 1MBMA 2J98A 2Q1JA 3UIRA 3GYLB 4IN2A 2JDID 2WV4A 2ZHDA 1AKSB 2YMSC 1NO9H 1BIOA 3B23B 4MPXA 4IMQA 3PV5A 3A8CA 4CRBA 1GBHA 5E0GA 4UFGH 3SU1A 2NU3E 1OOKB 3L3TA 3WWFA 1WSSH 3BIUH 2XC4A 4K69A 1H4WA 3A80A 1T31A 1G37A 5C1XA 4OGXA 2H2ZA 5ESBA 1C5SA 5F03A 3FN8A 1S84A 1K1MA 3O8DA 1GL0E 1V2QT 1HIAB 4U32A 2FZZA 5EXLA 3S7HB 4FU9A 1XVOA 1AGJA 1ABJH 3RP2A 1TGBA 3MFJA 2V35A 4ZUHA 3M5LA 3DFJA 2H9EH 1OX1A 2DUCA 4FXGH 4CREA 3GDSA 1ZR0A 1O3FA 5CHBA 3GY7A 3V0XA 3ZZ3A 1T8OA 4R0IA 3MNSA 5EG4A 1E38B 1MTVA 1SHYA 1EP6A 2GJGA 3QGNB 4TYDA 1IHTH 1DWDH 1C1TA 1FN8A 5JB8S 3VG8A 4BOHA 2AERH 1MTSA 3NRLA 1NESE 1HAZB 1SBWA 5FX6A 4GLYA 5CHAC 4XSKU 2BY8X 2BZ6H 1UCYK 3RXIA 1AQ7A 5E8EH 4OGYA 3ATMA 2SGDE 2W7SA 4B71A 3I29A 4HI3A 2BD3A 1MZAA 2C90B 2THFB 4LOYH 4AYVB 3DCLA 3TGJE 1SB1H 1J16A 2O8MA 3SGBE 1KSNA 2ZZUH 1VCQA 1ZYOA 2RG3A 1SGCA 2FYRA 1A46H 2BXTH 3HATH 3M3SA 1UTPA 2A4QA 1B0EA 1SGFG 1C1QA 3FP6E 2GMTB 2F9PA 1LVOA 1P06A 2ANWA 4Y8XA 1GBCA 2EI8A 5GPIB 1YM0A 3ZVEA 3OE7D 1PQ7A 3TNSA 2BOKA 1TGTA 3DSOA 2A31A 3SUDA 1MBQA 2Y6TA 1HAVA 1K1OA 1EB2A 1O39A 2CHAC 3SNAA 2AGGX 3P92A 3F0PA 2RA0A 8GCHF 2BTCE 1KTSB 3LKWA 1IQJA 2FESH 4WF8A 1EOLA 1VGCC 4I86A 5AF9H 1J9CH 4ABBA 4PROA 3ZZ6A 1YP9A 2AIPA 3FO8D 2FOMB 2V6NA 3U8TH 3QZRA 1NPMA 1FY1A 1N6XA 2KCOA 4RT0A 3AASA 2Y5FA 1GI4A 4X2YA 3LC5A 1PYTC 1CBWB 1O5EH 3SN8A 2Z9IA 1NRRH 1LQEA 1PPGE 2BVXH 3NUMA 2G55A 2BOHB 1O2XA 1Z8RA 1XUJA 3PB1E 5A0AE 2GGVB 1XKAC 5KEDA 1P8VC 2ZO3H 2Q6DA 4OS6A 1IAUA 1GGDB 2FS8A 5DSFA 1OKXA 4ABDA 3MH5A 1C5LH 1D9IA 2WPDD 1AVWA 4OS4A 3D65E 1UCYH 1NFXA 5E0HA 2STAE 2BY6X 3B8JA 5JBCS 1CO7E 2Z3DA 1P57B 1EZXC 1EJNA 2G5NA 2GCTC 2QAAA 3UQVA 4NIXA 1CGJE 1YKTA 4O97A 1C1NA 1GMDF 1UK2A 3ATWA 3G01A 2P93A 2XC0A 3A7VA 3M7QA 2G5VA 1ZTJA 2QXGA 1A5GH 1DY8A 4FUCA 1CGHA 3IITA 2AS9A 2R2MB 1O2SA 2C93B 5EW1H 2R2WU 1E34B 2HVYB 2H5DA 1G2MA 1W10U 2F9BH 3JZ2B 2XYAA 1DX5M 1H9LB 3ZZDA 3RXQA 3A85A 1ELEE 3MYWA 2QYIA 1ZZZA 4I32A 2GZ9A 2LP6A 2FLBH 2YOLA 2VWMA 5FL7D 1JWTA 1G30B 3QDZB 2FOHA 4FUEA 1RTKA 2CXVA 2BD5A 3RXRA 2P3UB 2B8OH 4MPWA 4GHQA 4JZEH 1F7ZA 1KDQB 3F9GA 2XW9A 5LPFA 2C3SA 2BY7X 5FBEA 2J95A 1EUFA 3SU3A 3U8RH 2WUBA 2XTTB 3MO3A 1F5KU 2OCVB 5GDSH 3ZVGA 1W0YH 2B5TB 1O3GA 1TPAE 4X8SH 1TFXA 1P2OA 2H5CA 2HNTC 1SOZA 1GI7B 2BB4A 5DN6D 5GIBA 4XFQA 1AY6H 3SGQE 2AFQB 1GBEA 2CJIA 1G32B 1LHFH 2FPZA 3VB4A 4FUIA 1DS2E 1VITF 4Q4LA 1UTKA 5A0BA 2Z9KA 2F9NA 1P09A 1JOUB 2Y80A 4ZAEA 3HKIB 1RJXB 4D9QA 2C4FH 2F3CE 8GCHG 3AK5A 3RXAA 7ESTE 5K0HA 2NU1E 5E2PA 3EDXB 4UONA 1FY3A 1SKYE 1VCWA 1O3LA 2RDLA 4X2WA 1AN1E 2ZWLH 3SUFA 4MQAA 5I46H 4FUDA 1K22H 1KLJH 3VGCB 1A7SA 1HV7A 3K65B 2OTVA 1UVUH 3TH3H 4SGAE 2KFWA 3KQ5A 3V3MA 1VZQH 4HZHA 2ILNA 1BRAA 6CHAB 2K0QA 1GGDC 1QURH 3LGWA 4Y0YE 1ZPBA 2Z6BD 2CV3A 2A0QB 1QL8A 1EJAA 3ZZ8A 1C2JA 3GDVA 1F0RA 1MABB 1VJAU 3HPTB 1A0HB 1Y5AT 1Z8IB 3KNXA 2PV9B 1W0KD 3U9AH 4AGJA 3QTVH 1O2UA 1BTWA 3M7UA 1NFUA 4JZIA 2VGCB 1TB6H 4UFEH 3TK9A 4D76A 4NA9H 3UPEA 2IOTA 2UUJB 1GMDG 1GBLA 1E1RD 1Y3XA 2RDEA 4DT7B 1AD8H 3MTYA 3URDA 3VXEH 4I7YH 1IQMA 3SJKA 1MUEB 1LPGB 2AEIH 4BAQB 2ZFQH 5CDFE 2ZTXA 2F91A 3TJVA 2A7JA 2O8LA 4O03A 4ASHA 4X2VA 1LHEH 1GJAB 1QQ4A 5FCRA 4OS7A 1SLVB 4ISOA 1W3CA 1UHBA 3JZ1B 4THNH 1C5YB 4JZFH 4I31A 1O2VA 2WYGA 1Z6EA 3W95A 1NU9A 1TIOA 4Y8ZA 1N8OB 1A2CH 2ALPA 3WW7A 1OYTH 4A92A 2A5KA 2G51A 2Z3EA 4H42U 1P2MA 1D4PB 2ZDNA 3RC4A 3AW1A 2KZ4A 5AVDA 2H9HA 4K2YA 1OP8A 4WH8A 2FLRH 4ISIH 2ZPRA 4ACBA 1TNKA 2FI3E 2HPQH 1EAUA 1ZGIA 2OINA 3Q3KA 1FZZA 1F0TA 5F8TA 1IHSH 1BTPA 1TBQH 1BDAA 1FUJA 4WJG2 2R3YA 2R0KA 2PSYA 3PO1C 1DPOA 3KN2A 2PGQB 4KTCA 3RXEA 1MAXA 3DT0H 5J4QA 2CN0H 2FOFA 5C2ZA 1J8AA 4MTBA 2PW8H 1OWHA 3KQEA 1VITG 2SGAA 1HAIH 2O8WA 2ZTYA 2SFAA 9LPRA 1KTTB 1LHGH 3O8RA 1EAIA 1UW7A 2ALVA 2SNWA 2UWPA 5EIYA 2A32A 3SUGA 2OC7A 1GJCB 1TONA 1MZDA 2HPPH 5HMAA 5C1UA 4I33A 2PUQH 4RT1A 2IPQX 5L30H 2QF4A 1D3DB 1O2MA 1EASA 4NSYA 3M5NA 2QCYA 5DKMA 1JRTA 1O3BA 1EP5A 2XBXA 3P8OA 3EQ0H 1PPBH 3BTKE 2L74A 2IN2A 2ZFTA 2FIRH 3VGCC 2BM2A 3E91A 1HYLA 5JB9S 3RC6A 1DANH 4XBBA 3T28A 2BDGA 2LNCA 3F1SB 1ORFA 1HAXB 3GCTF 3MU1A 6CHAC 5GJ4B 4X6PA 1V2JT 3SZNA 1AE8H 3BV9B 4ZKRU 1UVOA 1ARBA 1CA8B 3NCLA 2VB0A 1NROH 5GXPA 4NIWA 4E05H 4Y6DA 4AG2A 4UD9H 5CE1A 1KIGH 4B73A 1C9TA 2VWNA 4LK4A 1QRWA 2KAIB 2ZPQA 1FJSA 4J1YA 1TOMH 4MLFB 3RXSA 4DIHH 4Y79A 4MNXA 2BHGA 5TJXA 1C5QA 1G36A 3GS9A 3NWUA 3UTUH 1H8IH 1OWEA 5IK2D 4LZ4B 2P8OB 3AW0A 4NZQA 1VJ9U 2XRCA 2HWLB 3A89A 1GG6C 1O3NA 4YZUA 2FTMA 3RXBA 1VITH 1DDJA 3A7TA 4HTCH 2STBE 4Y8YA 3PV2A 4ZHLU 1JRSA 1T8NA 5PTPA 2OD3B 4ABIA 1SGQE 1TA2A 1YLNA 2GV6A 1EPTC 3M5OA 1ABIH 1QNJA 5HKKD 1ZRBA 5L2YH 1BRCE 1C2IA 2WPLS 1FIWA 3BTQE 1QJ6B 2VINA 2GT7A 2EI6A 4Y7BA 4KELA 2I6QA 1WTHD 2BY5X 1EAWA 3ZZ9A 2JH0D 4TPYA 4WMEA 1C4Y2 2AMDA 1BTYA 1V2TT 3DSPA 2FM2A 3LT3A 1TNIA 3KQBA 2OXSA 2NU2E 1C1WH 2ZIQH 4NWKA 4LZ1H 3ZZCA 2ODPA 4ASUD 2Y7XA 2G8TA 5JYIA 5K7RA 1AFQB 2FI5E 1QA7A 4HG6A 1QRXA 1V2KT 3TGKE 1OS8A 2P3TB 1IQEA 2J2UA 3RLYH 2LPRA 4ZROA 4H4FA 1LHDH 5C1YA 1FMGA 4X6OA 3ZVBA 3F68H 5HM9A 2XXLA 1JMOH 5EOKA 4FU7A 2F83A 1ZSJA 3VB5A 1Z71A 2FP7B 2WV9A 3CNRA 5FX5A 1ZMLA 2W26A 4YOGA 1AO5A 5C20A 5AFYH 1V2UT 1O31A 1IQLA 4CH8B 3ZZBA 2FYQA 3OEED 4IC5A 2ZHEH 3M3TA 1P12E 1C2LA 1EZSC 1W7GH 5EXMA 4DY7B 2PKAA 2ZGJA 1Q2WA 1IQFA 1DICA 3MH4A 1PYTD 3MU8A 3SV6A 4BXSA 4NSVA 2P95A 3P17H 4AFUA 1YPEH 3LJJA 1V2ST 2H6MA 4AC9A 4X0WU 3ITIA 4INKA 2O9QA 1HAYB 1LQDB 3RXVA 1AZ8A 2QF3A 3FP7E 4TWYA 4Y11E 4GVUA 2F9UA 1GBTA 4BAHB 1RTLA 4DURA 3UFAA 1OP2A 2M5TA 1MH0A 3QX5H 1JIMA 3BG4B 4MNYA 3GCTG 2ZDAH 4ABFA 2B0FA 2G52A 1C9PA 1XUHA 4WY3A 3A8BA 2FOBA 1TQ0B 2V3MA 4YOJA 4CRDA 4ISHH 4P00A 1K28D 3I77A 1ZLRA 2A4GA 2QGRA 2J92A 4A1VA 2SGEE 3SBKA 4CR5A 3PLKA 1EPTA 1O3OA 1OWDA 3WY8A 1O2OA 1QGFA 1DOJA 1QRZA 5GCHG 1YWUA 2P8OC 3FOAA 3T25A 1ESAA 2I6SA 5E2OA 1QL9A 1W2KH 1Z8JB 2D2DA 2ZDKA 1C5NH 2A5IA 1ZJKA 2GTBA 3QZQA 1O3AA 2VVVA 2XC5A 2BDCA 3TH2H 4GCHF 3RXKA 5FPSA 4MG3A 2OK5A 1C2HA 2XNDD 1BHXF 1EKBB 2HRVA 4DJZB 4IS5A 2R0LA 1E37B 4TWWA 1J17T 4DIIH 1O33A 1QIXB 2ZHQH 3BF6H 1P11E 1P2QA 1NTPA 1GI8B 4NA7A 1SGIB 1VKYA 2P59A 2Z9LA 3N99A 2GP9B 5JBTA 2PSXA 1GI1A 2J9NA 3U98H 1W14U 1TABE 5L2ZH 4E7NA 1XVMA 2XWBI 4K1EA 1GJ9B 2EQNA 1O2NA 1YLCA 2WHXA 1AFEH 1PQ8A 3KL6A 5C0UA 3UOPA 4E06H 1ELVA 1AFQC 1AUJA 1LCYA 1BRBE 2ZC9H 4KTSA 1GJ4H 1YC0A 2Z9GA 1DUAA 1NS3A 1Z1IA 3FZZA 5LGOA 5KECA 2A2XH 1LTOA 1Y3WA 2WV5A 4TY6A 3K9XB 3SU6A 5IYTA 1O32A 5EJ1A 2CK3D 1AVGH 4CRCA 1PQ5A 1G3CA 2BD2A 1ARCA 3SQEE 1FAXA 3TVJB 1FNIA 2BQ7B 1JBUH 4ACAA 3LC3A 5A2MH 1HDTH 4DT4A 2FWWA 2V3OH 2VVCA 1MTNB 5HGGA 4FOUC 4J2YB 4H6TA 5DP5A 2ZGXH 1G3BA 2BLQA 3MH6A 1GJ8B 1DSTA 3URCA 1P04A 2AHME 3E0NB 5A8XA 4TPIZ 1O5BB 1C1RA 4INLA 4JYVH 2GKVE 1MKXH 3ODDA 3UNRA 4BNRA 3LGVA 3T29A 4F4OC 2J94A 4O9VA 4YT6H 4Q80A 2RA3A 1WBGB 2KCAA 3PMAB 1GI9B 2AGIX 3SO3A 1NFWA 3W1EA 2GZ7A 3BG4C 1UJ1A 1SGNE 5CMXH 1S6FA 1LHCH 1XUIA 1BJVA 1TOCB 5TCCA 2ZGBH 1SI5H 3ZVDA 1SHHB 2IJD1 1AB9B 3HK6B 1LVYA 1TGNA 1W8BH 1FDPA 4B76A 1L4DA 1V2OT 1A3BH 3F6UH 3RMMH 2BQWB 2K1QA 3NKKA 1C5RA 3A7WA 3V13A 3U28C 3GY5A 3PTNA 1F2SE 4INHA 1T8LA 1C1OA 1GPZA 2BD9A 2XOKD 5EJLA 2C8XB 2XBVA 1CA0B 3D62A 3SNDA 5C5NA 3F2HA 2W5EA 3GOVB 5ETXA 4YM9A 2FI4E 2VH0A 4GCHG 2B7DH 3KGPA 2ZCHP 1C5UA 1MD7A 5B6OA 1D3TB 2ZNKH 2P3FH 1SPJA 1GHAF 5B6LA 2FOAA 2UUFB 3VB3A 5E0JA 1YPKH 3RXDA 4CH2B 4DVAU 1P2KA 1L1GA 1P0SH 3F9FA 4ABGA 4NG9H 4AGKA 1AWFH 3R3GB 3QLPH 3GCOA 1UTLM 3SUEA 3SHCH 4CBOA 3UNQA 5GNDA 1XXDA 4NFFA 3ZYDA 3M5MA 1P05A 2ZFSA 1MCVA 3BSQA 2OLGA 3MHWU 2C8ZB 1BMFD 2SGPE 2ZHFH 2WSSD 3E6PH 4X1QU 2DE8A 2HGTH 1SGRE 2PKSB 1F0UA 2FMJA 1FONA 2BX3A 3I78A 1QR3E 3CS7A 5IDKA 2ZQ1A 1SFQB 2HNTE 1GBIA 2XCNA 4CR9A 1J14A 1MD8A 2QE7D 3PROA 4NCYA 1HRTH 5SGAE 2J38A 2VIWA 1OWJA 3LDXH 2L6OA 1YPMH 2GMTC 1ELTA 1BMAA 3BEUA 3DUXH 3IG6B 4UFDH 3STJA 1MTNC 2A7CA 5FXLA 1TBZH 1CHOF 3RLWH 4B1TA 1N1LA 4K5ZA 1DE7H 1PPCE 3RU4E 3MQKC 1ZHRA 3GY2A 3E0PB 3ZZAA 1XUFA 4ZXXH 1RGQA 3RXPA 2GV7A 1A61H 1AKSA 1SGEE 2W3KA 1Q31A 4AN7A 3OAAD 2AH4X 2P94A 3RC5A 3M37A 3UB0A 2SNVA 3SOSA 1XUKA 4I8JA 1EX3A 1V2LT 1O2IA 3R0FA 1GHVH 1QA0A 1DWEH 1G3DA 1XUGA 1IQIA 2EA3A 3GCNA 1HAPH 1NFYA 1F5RA 1TPPA 2M2AA 1CBWC 1NRQH 1Q3XA 1NZQH 3SU0A 2IPHA 2GDEH 2Z9JA 1O3KA 1UTNA 1Y5BT 2KCPA 1MU8B 3P95A 5LPEA 2J5UA 1HIAA 1AB9C 1O5GH 4FUFA 1O3EA 4FVDA 4D7GA 3F9HA 5FPTA 1A3EH 1E36B 1RS0A 1O35A 2C8WB 2ZP0H 5C17A 5FCKA 3NXPA 5C3NA 3LPRA 3F9EA 5GWZA 5HIYA 4NA8A 4B6EA 1BCUH 4U01A 3RXFA 2BVRH 1E79D 4X6MA 1K1IA 3RXHA 2TGTA 3MI4A
chains in the Genus database with same CATH topology
1O2WA 4ZHAA 1T8MA 2ODQA 1SL3A 2CF8H 3DA9B 1WTGH 3MNBA 4WMDA 5H4IB 1GHWH 2XBWA 2R3UA 1LMWB 3EA8A 1B5GH 4A5TS 5DO4H 1LO6A 1H1BA 1MTUA 2ZCKP 3S9AA 2W7UA 1SLUB 2PWXA 4X8VH 5F8ZA 1PPHE 4X1SU 1TRNA 1GHAG 1DUEA 1NRPH 2ODYB 3T26A 3SGAE 1THPB 3T27A 5F8XA 1W7XH 4D7FA 5A0CA 1T4UH 1BUIA 1FLEE 3FANA 1KY9A 4JK5A 4YLQH 1PPFE 1RIWB 4ABHA 3EA9A 4AB9A 1GCTB 1K21H 4KTUA 2PKSC 3TPIZ 3EA7A 3MU4A 3TIUA 1EAXA 3S9CA 3P8GA 1DVAH 4X2XA 4Y10E 1H9IE 1OYQA 3L6PA 1P2IA 5I25A 2HVXA 2H1UA 2BDHA 3ENSB 4UFFH 3PMHB 1MQ6A 3OY5U 1GBBA 3Q77A 6LPRA 3QO6A 1KXEA 4MVNA 1AI8H 1W0ZU 1UK3A 2VNTA 5L6NH 5J4SA 3BIVH 2BY9X 1GI2A 1TMUH 1GJDB 3VFEA 1K1JA 2W3IA 1CHOG 5EPYA 4JYUH 1EQ9A 4AB8A 3B9FH 1FN6A 1HJAB 1ZPZA 1BJUA 3DD2H 1KXAA 5LH8A 3MH7A 3GY4A 4KP0A 2GZ8A 3UREA 1P3EA 1ANDA 3A7XA 2TGDA 1GJ6A 1HCGA 2EC9H 1QJ1B 2XWAA 1K1NA 3RXCA 1ZSLA 2BD7A 4I8KA 3TK5A 1T4VH 3H7OA 4ZMAH 1H9HE 4XOJA 1F0SA 3KEEA 3LIWA 4NFEA 2HNTF 1C5MD 1SGDE 2FX6A 1DFPA 2VVUA 3RXGA 3MOCA 1V3XA 3NPSA 2CMYA 1FPHH 3SQHE 1XMNB 1GWAA 1TX6A 1Y59T 1B0FA 1ELBA 2FOEA 1KLIH 1P9SA 3M36A 3SHAH 4ZKNU 1GBFA 1S5SA 1QB9A 4IGDA 1B7XB 1DT2A 3E90B 2SGFE 4R8TB 4RKOB 3U1JB 9ESTA 1SSXA 2ZTZA 2V3HH 4NGAH 2FO9A 1D6RA 2FTLE 2ZDMA 2PLXA 3M35A 1ZOMA 2WPIS 1ID5H 2ZFRH 1G3EA 1O3MA 2VGCC 1SMFE 2BVSH 2OC0A 1FXYA 7GCHF 1F5LA 1HAVB 1HBTH 2BD4A 1C5OH 1HPGA 1O3PB 2BX4A 3ZZ7A 3FZDA 4HFPB 2ZGHA 2A5AA 3MO9A 1MTWA 2JH6D 2WPHS 1KDQA 4WVPE 1O30A 3GY3A 2PHBA 1GHYH 1NU7B 1WOFA 2AYWA 2UWOA 1K2I1 1DWCH 2VWOA 3FVFB 3M3VA 1UTJA 2DE9A 5DP6A 3RMLH 1C2EA 2VU8E 3T2NA 1GI0A 3FP8E 1O2HA 1ZPCA 4GUXA 1A5IA 1RIWC 1UTMA 3RDZA 1BBRE 2ZA5A 1N8OC 1FY8E 1GCTC 2B9LA 3PTBA 4A6LA 3P8NA 3LONA 3QGJA 4Q7YA 2PUXB 4VGCB 3SU2A 3RXUA 1IQGA 1FPCH 1E0FD 3KQCA 3TJNA 1DLEA 1C1VH 1C1UH 1O34A 3SJ8A 1FY4A 1GDUA 1YYY1 5FAHA 1OWIA 4AFZA 1C1PA 1YCPM 2YNAA 4RKJB 4X8UH 4Y76A 4AFSA 1ESTA 1UVSH 2ZU5A 1ZHMA 1K1PA 4AORA 1P01A 3U69H 2CF9H 1W12U 3T5FH 1YLDA 2WINI 1WUNH 1O38A 1ANBA 4U30A 5CHAB 1EOJA 3RXLA 2Z3CA 4RN6A 1V2VT 2D1JA 1CHGA 4B2BA 1UO6A 1S82A 1O3JA 1GHBF 3E16B 1HLTH 3QK1A 1TYNA 1QTFA 3UY9A 3P8FA 2OP9A 3GCHB 3A7YA 4MNVA 1TA6A 5EU8A 5T6FA 1JXPA 1P3CA 2ZPSA 1GVLA 3SU5A 3SV8A 4IC6A 3BN9A 1GMCF 1GDNA 4I8GA 3AVZA 1A4WH 1ELAA 1NT1A 4K8BA 1TQ7B 1S83A 2OUAA 1L0ZA 1C4V2 3S69A 1ESBA 3IWMA 4WXVA 2D8WA 2GDDA 1HXFH 1K1LA 2Y81A 1CE5A 1YCPH 2UUKB 4FVBA 1AVXA 4AZ2B 5T6DA 4X6NA 1C5XB 1BRUP 4Y0ZE 2HOBA 4MDSA 3UQOA 2ANYA 1SLXB 3BEFB 4BTIB 3TJUA 1C2GA 1TNJA 4BANB 2WPMS 4B74A 4JZ1A 2J34A 4UDWH 2UWLA 1TX8A 7GCHG 1XKBC 3GDUA 1KLTA 1L4ZA 3SJ9A 1YPGH 1C4U2 1MKXK 1DXPA 2QV1A 1O37A 2PTCE 3NK8A 3PMJA 1C1SA 1GJ5H 1QL7A 4A1XA 2YNBA 5JPMH 1C5VA 3PV4A 1HFDA 1HUTH 2BQ6B 2WPKS 2GCHF 2VWLA 1SQTA 2GCTB 6GCHF 1P2JA 3A84A 5BRRE 1RRKA 2TPIZ 5JBBS 4WWYA 3SNEA 1Y3VA 1BQYA 1O5DH 3A86A 1TPSA 3BG8A 1O5AB 4O3UA 4VGCC 3SV7A 5DGJA 1A5HA 8ESTE 4DG4A 1TX7A 3P6ZB 1NC6A 1EJMA 4F49A 3OYPA 3ELAH 1SGYE 2G00A 4UE7H 4K8YA 2FOCA 1OPHB 2NU4E 2BXUH 1C2FA 1CVWH 5DP9A 3CS0A 3Q76A 4YT7H 4KGAA 3E8LA 4YO9A 3T62A 2OBOA 2EI7A 4Q7XA 5FHTA 1Z6JH 3RMNH 1PPZA 3OY6U 3VB7A 1GHBG 2Q6FA 4XDEA 1SR5C 1TE0A 3QWCH 1QBVH 1TMTH 4Q2KA 1AMHA 2BDYA 2ZU2A 1BMMH 1LPKB 1C5TA 1WCZA 1IQKA 1AUTC 3LH1A 3EYDA 2O8UA 1KXCA 2WUCA 3GCHC 3M7TA 4BAKB 1UHBB 5A09A 1AIXH 3RU4D 2BD8A 2Y82A 3PLPA 1VR1H 1C5ZB 3BTHE 3N7OA 1ANEA 3LGIA 1QQUA 1RFNA 1GMCG 1ACBE 1TGSZ 1HGTH 1PFXC 2KAIA 4X1RU 2WYJA 2VIPA 3UOUA 3SORA 5LPRA 5EQSA 1V2PT 5C67A 2ULLA 1C2DA 3RXMA 2EEKA 3UR9A 1ZHPA 3KIDU 3SV9A 1M9UA 3H7TA 1SGTA 3RU4T 2ZG0H 1P10A 1TMBH 1PPEE 3MU0A 1E35B 3UWIA 1EB1H 4XE4A 2AIQA 1UVTH 1QB1A 1ELDE 1TPOA 3L33A 1MQ5A 1WYKA 4WH6A 1UVPA 3BTME 1AHTH 2HALA 2OC8A 3A7ZA 5T3HA 1O2ZA 3SJOA 1GBKA 3GYMA 3ZV8A 3O8BA 1BTHH 2WPJS 4OS1A 1RXPA 3A82A 2BDIA 2SGQE 1BTZA 5T6GA 1C5PA 4MPVA 1SFIA 1V6DA 4JK6A 5EXNA 1DXWA 4AG1A 2R9PA 4NIVA 1GMHF 4D9RA 1A0LA 4GSOA 3KQDA 3HGPA 1HAHH 1IQNA 3MWIU 4YOIA 4I8HA 1EZQA 3NZIA 3PWBA 4SGBE 3AAUA 1Y5UT 2GCHG 1KYNA 2BLVA 2ZKSA 4MNWA 1P2NA 6GCHG 1FIZA 3E1XB 2ZEBA 1FAKH 1O2YA 3RM0H 3EE0B 4BAOB 4DCDA 4ZXYH 1HAOH 5ABWA 2F9OA 3QUMP 1O5CB 4AFQA 1NY22 4H6SB 2OQ5A 3K6ZA 3VEQB 2ZFPH 1V2WT 4M7GA 1PQAA 3GY6A 3U8OH 1TNHA 1YBWA 3D49H 1JIRA 1ZTKA 6ESTA 2ZDVH 3K2UA 1GBJA 1EZUC 2G4TA 1K9OE 3LH3A 1C2KA 1O2PA 2ZCLP 3QN7A 4Q7ZA 1KXDA 4MPUA 3SI3H 2A45B 1C5WB 2VJ1A 4FUHA 1L1NA 1YGCH 5DP8A 2VIQA 2TGPZ 3ATLA 2P16A 1YPHE 3SI4H 2VIVA 1BBRK 2GVFA 1HB0B 1O2LA 2FXRA 2BYAX 4OS5A 5C5OA 4AYYB 1XX9A 1TWXB 1YF4A 3PMBB 4K1TA 2A4RA 5ESTE 1AU8A 4HGCA 1DWBH 1RTFB 1YPHC 2JETB 4Z0KA 1GI3A 4K60A 3TLOA 3C27B 2ZHWH 3GISB 1CGIE 2QN5T 3GICB 3LU9B 1XM1A 3E3TA 1TLDA 3Q3YA 4ZKSU 1ETTH 2OQUA 2ZU3A 1AE5A 4Y71A 1WU1A 5DJ7A 1P02A 3EGKH 1ELFA 3PO1B 5F6MA 2A4OA 1Z7KA 1ZRKA 1FV9A 1V2NT 1LKAA 1BB0B 3FFGA 3RUOA 3U1IB 1S6HA 4X1NU 1O3CA 1SVPA 1Z8GA 4TY7A 1Z1JA 1V2MT 2A1DB 2G81E 5EQQA 5G4BA 3SW2B 3A81A 4UEHH 1BTXA 1Y3YA 2VIOA 3LGUA 3P70B 2ASUB 2FEQH 4ESTE 2BLWA 2Z7FE 3D23A 2QXJA 4JYTA 1J15A 2JKHA 2IJOB 8LPRA 4BTUB 1T7CA 2AMPA 1H8DH 1AWHB 1ELCA 1O2RA 4CHAB 1P9UA 2TRMA 3S7KB 2ESTE 4BXWA 1SOTA 1SLWB 1QHRB 3S9BA 1CSOE 5AHGH 1CA0C 1GI5A 1GL1A 3A88A 3K6YA 2ZDLA 1S81A 5TCAA 1LPZB 4CRGA 3SV2H 2J4IA 2C8YB 3TGIE 1O36A 1ETSH 3CENA 1GBDA 5DP4A 4CRAA 1BHXB 3BTEE 1XXFA 8KME2 2ZECA 3BTDE 2NWNA 2PKAB 4YESB 1GMHG 3UWJH 1TNLA 2ZF0H 3AAVA 2FX4A 1BA8B 2QA9E 1BBRH 3STIA 1QJ7B 5DP7A 4I8LA 1CQQA 1GBMA 2XCFA 4XBCA 3SNBA 4K3JA 1O3HA 1MU6B 1FY5A 1SQAA 4ZKOU 4RSPA 2OBQA 5BPEA 1LDTT 1L1JA 1HNEE 3KF2A 2FS9A 3LJOA 4JCNA 4BAMB 2XBYA 4A1TA 4ABJA 5EPNA 3S0NA 2TGAA 1PJPA 1C1MA 1DITH 2ZQ2A 3O8CA 3TNTA 1SGPE 1GG6B 4Y7AA 5EW2H 1U6QA 1UCYE 1DLKB 1GHZA 1VCPA 3PWCA 2Y5GA 1IQHA 3SJIA 1TRYA 3LGYA 2BZAA 3RXJA 4GHTA 1EATA 1EXFA 3A8DA 1O0DH 1EPTB 1O2KA 3LGTA 1N6YA 1BITA 3ZVFA 2PFEA 3ODFA 2PTNA 3PYHA 4YLUA 3MNCA 1CT2E 1MKWK 3Q3XA 1O3IA 4ISNA 2A7HA 3ATIA 1UTOA 1Y8TA 3TK6A 3KHVA 1QCPA 3TJOA 2QF0A 2XNIA 4BTTB 4NZLA 1S0QA 2NU0E 4ABEA 1D6WA 1X7AC 1UK4A 2Z94A 3CP7A 2JETC 2QXHA 3BTTE 1TRMA 1ZMJA 2QY0B 2JH5D 1AZZA 1D3QB 2FDAA 1OWKA 4B2CA 1TNGA 3GY8A 3TITA 1GCDA 5EQRA 1ZJDA 3PLBA 2GT8A 1QY6A 2ZU4A 2D26C 1GJ7B 1ZMNA 2TBSA 2QIQA 4FU8A 4JZDH 3V7TA 1INCA 2ZU1A 3VB6A 1GI6A 1THSH 1S0RA 2VH6A 5DK1A 4D8NA 3HKJB 1MCTA 2PR3A 1HXEH 2G4UA 5HXFA 1LVBA 3OX7U 1O5FH 3H5CB 3RM2H 1G2LA 4B2AA 1L2EA 3Q00A 4KKDA 2RCEA 3A8AA 5FBIA 2QC2A 4CHAC 2ANMH 1TGCA 1UMAH 2TIOA 3DHKH 2BDBA 3ZVCA 3ZZ4A 1BMLA 1GHXH 4WXIA 1MMJN 4XBDA 5JBAS 3RXOA 3MU5A 1DY9A 5JDUB 1GBAA 1QBNA 3BTFE 4E7RG 3M61U 3A83A 3A87A 4IN1A 1O2TA 1MKWH 4AX9H 3BTGE 3RXTA 3SNCA 1FQ3A 1BTUA 1GDQA 2AGEX 2F9VA 2VIDA 4YTAA 1BT7A 3RMOH 5EGMA 1ZGVA 3BEIB 2QXIA 5GCHF 2FODA 4NIYA 3HGNA 1SG8B 1MAYA 2O8TA 4FUGA 2ANKH 1SGFA 4IMZA 1ZTLA 1LVMA 2BDAA 2V0BA 4Z6AH 1SQOA 1YCPK 2Y7ZA 3ZYEA 1UTQA 2AMQA 3OTJE 3KCGH 4K1SA 4FUJA 4U2WA 1TAWA 3C1KA 3BTWE 1A0JA 1OP0A 1V2RT 1TALA 2GD4B 3ZV9A 4A7IB 1GVKB 1NRNH 2FOGA 3HK3B 1IOEA 3W94A 1DM4B 1NRSH 3UUZA 3VXFH 3PM3A 4ISLA 1NN6A 5A8ZA 1SC8U 5HYOA 1RD3B 3EAJA 3ATKA 2Y5HA 3ESTA 2GX4A 4NWLA 5HM2A 1FI8A 3QTOH 4AOQA 1WQVH 4IBLH 3UR6A 3OU0A 3UNSA 1KXBA 4ZHMU 1CU1A 1ANCA 4WMFA 3MNXA 1BOQA 5EODA 2UUYA 1G9IE 1ZSKA 1P03A 1BZXE 4DOQA 1O2GH 1OSSA 1NM6A 4CRFA 1HJ8A 2A2QH 1HJAC 1YPJH 1W11U 4ZH8A 4ABAA 1DSUA 3MO6A 3OSYA 1YPLH 4IW4E 5DPAA 1S85A 1O3DA 1QFKH 1KXFA 4FUBA 3LOXA 1ETRH 1QB6A 2OC1A 1HAGE 4LXBH 2BMGB 4B75A 3TU7H 1CT4E 1GJBB 1ELGA 7KMEH 1C2MA 1LKBA 1T32A 4GAWA 2Q6GA 2HLCA 1OXGA 1F92A 4JMYA 2PGBB 1W13U 1THRH 1HJ9A 2CGAA 5DP3A 1WV7H 3FAOA 1TBRH 7LPRA 3DFLA 3SU4A 4OS2A 4QT8C 2CHAB 1WQSA 2ZFFH 4O3TA 2H9TH 3TH4H 1QBOA 4CBNA 2ZGCA 1VGCB 2ZI2H 3V12A 5DG6A 1GVZA 3ZZ5A 1Y3UA 3ZVAA 2BLOA 5FPYA 3VPKA 1O2JA 1WAYB 4X8TH 1O2QA 4GPGA 5A8YA 3MMGA 1BMNH 4DW2U 1CT0E 4X1PU 1A1RA 4DGJA 5AFZH 1D3PB 1MBMA 2Q1JA 3UIRA 3GYLB 4IN2A 2WV4A 2ZHDA 1AKSB 1NO9H 1BIOA 3B23B 4MPXA 4IMQA 3A8CA 4CRBA 1GBHA 5E0GA 4UFGH 3SU1A 2NU3E 1OOKB 3L3TA 1WSSH 3BIUH 2XC4A 4K69A 1H4WA 3A80A 1T31A 1G37A 5C1XA 4OGXA 2H2ZA 5ESBA 1C5SA 5F03A 1S84A 1K1MA