2BDCA

Porcine pancreatic elastase complexed with asn-pro-ile at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA01
1MTUA 1FJSA 3GCHC 3KQEA 1C1RA 3T27A 3MNCA 1BZXE 3SU0A 1BTXA 7GCHG 4AFSA 4E7NA 1TNKA 2C90B 3TGKE 5DK1A 4FUEA 2J34A 2BDAA 1SGYE 3JZ2B 1B7XB 1THPB 3KCGH 1ZJKA 2RA0A 2KAIB 3O8CA 1MAXA 4Y6DA 5L2ZH 4AORA 4KELA 3UNQA 1FMGA 4UD9H 1ZZZA 2ILNA 1ELEE 1NRQH 1YPMH 4DCDA 4H42U 1L2EA 2GT8A 3K6ZA 1SGFG 1SLXB 5FCKA 1E0FD 4B71A 2HWLB 1KSNA 1DS2E 1P11E 1UK4A 4CRDA 2RG3A 2SGEE 3ZZAA 1EAIA 1YPHC 1V2WT 2ZDNA 4XBBA 5DP3A 3LGYA 4K1EA 1MQ6A 3ENSB 5DP6A 1SLWB 1F92A 2BOHB 2QGRA 3K9XB 4ZKRU 3RXOA 1PPFE 1WYKA 1PPEE 3G01A 3ZZ9A 4ASHA 1O30A 2ALPA 3EA7A 3ZVAA 2AH4X 1BRBE 1O5GH 4AYYB 4NA7A 2F9BH 2BY9X 2ODYB 3MO6A 2XW9A 2VWLA 4A92A 1DUEA 2TGAA 5EPYA 5CMXH 2TRMA 2Q6FA 1YPHE 3OX7U 1AZZA 1UVTH 3SU1A 3HGNA 1ZMNA 2BLQA 1D3QB 1KXCA 2VINA 4MTBA 2FI4E 4I32A 3LKWA 1TLDA 2ULLA 2IJOB 5C20A 2BD5A 3MH7A 4A6LA 1TMUH 4ABEA 1TBRH 3SUGA 3M3SA 3W94A 4UONA 1IHSH 1P2IA 2FWWA 2G5VA 4U2WA 2ZF0H 1TBZH 1BRAA 2OCVB 1A5GH 1KY9A 3EQ0H 2ZCHP 3TVJB 1PQ8A 1GVLA 2Z9GA 1JOUB 2ZFTA 2P59A 3PWBA 1NM6A 1FPCH 2PLXA 3ATMA 3PTBA 3ZVBA 2QXHA 3RXUA 3O8BA 5GJ4B 3UR9A 1B0EA 1NRNH 3STIA 2LNCA 3TJUA 1O3PB 2XYAA 1B5GH 2WPMS 3P92A 1FAKH 5FX5A 2SGQE 1MBQA 3PLKA 2C4FH 2OQUA 1BTPA 2ZPRA 3V3MA 1XKBC 5I46H 5BRRE 3F9GA 3SJOA 2EI6A 1GBCA 2VIVA 2CJIA 3F9EA 1CQQA 2A4GA 2VGCC 6CHAC 2ZHQH 4BNRA 4CRCA 1TFXA 4XE4A 2ALVA 1C4U2 1WU1A 4TPIZ 3AW1A 2QY0B 2SNVA 1TX7A 3Q76A 1ORFA 2QA9E 4UFFH 2QIQA 5JBBS 1GJ7B 1BHXB 3KQCA 1BBRE 3E6PH 1MMJN 1SVPA 1IQNA 3A8BA 3DD2H 2STAE 2SGFE 4H4FA 3MI4A 3SQHE 2Y80A 1O2QA 2H1UA 1NPMA 1ZRBA 1IQMA 1CA0B 3SUFA 1O2NA 1P10A 3BG8A 3M5NA 4D7FA 5EXNA 1WCZA 1LTOA 2ZU4A 2ZZUH 3SZNA 1T7CA 1KYNA 5HMAA 2I6SA 2PKSC 4AFQA 2Z9KA 5LGOA 3UQOA 3P17H 3KN2A 1GDUA 3A89A 1XKAC 1KLTA 1EQ9A 1MD8A 4A1TA 3ZYEA 2OC7A 5DP4A 1SI5H 2A2XH 2ZHEH 1NROH 4MLFB 4TPYA 1Y3XA 3UWIA 1XUIA 4UFGH 1A3EH 1CVWH 1XUJA 1KLIH 4WH6A 2BHGA 2VH6A 4K2YA 2FOAA 1KXAA 4DT7B 1C2KA 3B8JA 1GBFA 4OS5A 5CHAC 3SORA 3C1KA 1SFQB 4BAHB 1O34A 2H9TH 1AWFH 4NIVA 5ABWA 1O2SA 1O2MA 2CHAC 1RD3B 2W7UA 3ESTA 4XSKU 4LOYH 1O2VA 3C27B 1A3BH 3MYWA 1TMBH 3S9CA 1TGBA 1LHFH 2C8ZB 1HNEE 2FOBA 2VWNA 1V2MT 1UHBA 5IYTA 2VIWA 1DFPA 2HOBA 3E16B 1O31A 1ZPBA 2M5TA 4YT6H 4FUHA 4YZUA 1G32B 3E0PB 3RXSA 3KNXA 5C1XA 2ZCLP 3EE0B 1A5IA 4E06H 1TNIA 3UUZA 2P94A 2SGDE 3OTJE 1VITF 3QZRA 1FV9A 2ZNKH 1F5LA 1K28D 1GMCF 1OWKA 2Z9LA 2PUXB 2XCNA 2WUCA 7LPRA 1IQKA 3RC4A 4B73A 1ELTA 1LVOA 4YT7H 3OYPA 3RUOA 3A87A 3MMGA 1GBLA 1KTTB 2RA3A 5E0JA 2XC4A 1LCYA 2SGPE 3KHVA 4ABIA 1O2KA 2Z3DA 3MFJA 2AGEX 1PQ7A 1M9UA 1N8OC 2SGAA 1UTQA 1UVUH 3PV4A 2UUKB 3PYHA 1BIOA 1A7SA 1ZPCA 1LHGH 3PMHB 4X1PU 1MU6B 1DLEA 2FO9A 1E36B 2CF9H 1E37B 1O3HA 1QL7A 1GCTB 2NU1E 1HAVB 1MKWH 4MDSA 3RU4E 4UFDH 2YNAA 1O2WA 4ZXXH 3UPEA 2BLVA 3LGTA 1QJ1B 4ZUHA 1SHHB 1K1LA 1GHAG 2JETC 2NWNA 2VWMA 4B75A 4O3UA 1RTKA 3TNSA 3P8NA 1ABIH 3QN7A 4RKJB 2H2ZA 2HALA 2GMTC 8GCHG 1P01A 4FVBA 5FXLA 2YNBA 4U01A 2FI3E 3VXEH 1GJCB 1C2JA 3SN8A 1F2SE 3L3TA 5C2ZA 1P2KA 1HB0B 5IDKA 2R3UA 1THSH 5A8ZA 1C2FA 5HM9A 1EZSC 1UTPA 3KQBA 3VB4A 1GVKB 2XBYA 4CHAB 1B0FA 1X7AC 4Y0ZE 5EG4A 1MZAA 1QJ7B 1Z8JB 1ZTLA 1C5ZB 1AKSB 2YOLA 3FP8E 8LPRA 3OSYA 1NU7B 3PLBA 1HCGA 1TNLA 1LKBA 2HNTE 1A5HA 2G8TA 1S81A 4M7GA 2AFQB 2BYAX 1RIWB 1H8IH 1LO6A 2AMQA 2TGDA 4Q7YA 2BZAA 2THFB 3RXKA 3NWUA 1N6YA 4BTTB 4GLYA 2WPLS 3MO3A 2VIQA 3M61U 2R2MB 3NCLA 2P8OB 2DUCA 1FIZA 1D3DB 3UWJH 4DVAU 1WQSA 1EP6A 1EAUA 2FYQA 2GVFA 1TA6A 1SFIA 1DE7H 1GJ5H 4GSOA 3S0NA 1C5YB 1H4WA 4X8TH 1KDQA 3TJNA 2BDIA 4K69A 3D65E 3UOPA 1O3LA 3Q3XA 1C5QA 1C5PA 2O8WA 1L1JA 1NS3A 1VGCB 1ZSLA 1O2TA 2G4TA 1S6HA 4ABAA 4WF8A 5GXPA 1SQOA 3SU3A 1TPPA 2ZC9H 4BANB 2ZKSA 1CGHA 4JZFH 1MKWK 3PO1B 2BY5X 4FUBA 1L1GA 4X1QU 4TY6A 3RXVA 3TJOA 2DE9A 1XMNB 2QXIA 1TNGA 4VGCB 1BTWA 2OC0A 7KMEH 1UCYH 2FYRA 5C3NA 1O2ZA 3HK6B 1K22H 1UTJA 5A0CA 1AHTH 1K1PA 3ZZ7A 3ZZCA 1ZMLA 1ZSKA 1AWHB 1HAOH 1AFQB 1ETRH 1PQAA 1CE5A 3TK6A 1W8BH 3ATIA 1RGQA 1C5LH 4I8HA 1EUFA 2PKAA 1UVSH 4UFEH 2GX4A 1BJUA 1TBQH 4HTCH 1CBWB 1NFYA 1F5KU 3A8AA 3QGNB 1P03A 1C2MA 1VZQH 3BTDE 4X2YA 1EJNA 3RMNH 4GVUA 4NFFA 1P2OA 3KIDU 1W3CA 5DP8A 1DXPA 1V6DA 5LH8A 1AN1E 3UR6A 3P6ZB 2FM2A 3SI4H 2P3UB 2ODPA 1AQ7A 2ZG0H 1GHXH 4FUDA 3SJ9A 3M7UA 1LHDH 2JKHA 1QY6A 3DA9B 4NIYA 2BQWB 4WJG2 2OC8A 1EZQA 2BD7A 4X1SU 3GY7A 1C1SA 1TONA 1ZHMA 3ZVEA 4DW2U 4H6TA 3AVZA 3GY2A 4FUGA 2FDAA 3SNBA 4YO9A 3RMLH 4AFUA 1UK2A 3HK3B 1F0TA 1Z1IA 3GDUA 1YPLH 1Y3YA 3P8FA 4CH8B 3BV9B 3M5LA 2V6NA 2W5EA 1O37A 2GV6A 5F03A 4TY7A 5G4BA 1CA0C 1UO6A 4IC6A 2K1QA 3BF6H 2Z3CA 4JK6A 4NIWA 5ESTE 2FZZA 3BTME 2OC1A 1C5OH 2PTCE 1FPHH 2O9QA 1T8OA 2G00A 1LKAA 1ARCA 2UWPA 3SGAE 3B23B 2UWOA 1EPTB 2WPKS 4UE7H 7GCHF 3LH1A 5AVDA 1Y59T 3TIUA 1YPKH 1O38A 1THRH 2Z3EA 5A8YA 1GI4A 3A7VA 3RXAA 4Y11E 2VU8E 1UCYK 4CRBA 3TH4H 1FONA 3BTFE 1MAYA 2AGGX 3SUDA 3BTWE 2GDEH 3A81A 2GZ9A 3IG6B 2GD4B 2ANYA 1J8AA 4X0WU 5EQQA 5T6GA 2GTBA 1XXFA 1LVYA 3A86A 2PW8H 1GVZA 2ZQ2A 1IQJA 1DICA 1XUFA 5DO4H 1YPGH 3SJ8A 4WMDA 4DY7B 4YLUA 1QCPA 4D9QA 4ABHA 3JZ1B 2XWAA 1GJAB 1CT2E 3RXHA 3A7YA 3E1XB 3KGPA 2O8MA 4FU9A 2Q1JA 1BITA 2F83A 2ZDKA 4AFZA 3DFLA 3SGQE 3LJJA 1TABE 3FZDA 5F8XA 2ZA5A 1ANCA 1GHBG 1AZ8A 2FI5E 2OP9A 3V7TA 2GZ8A 2OBOA 5L2YH 3QTOH 1DSUA 1S83A 1O3MA 2Y5FA 1GGDB 5JDUB 1O3NA 1NFUA 2ODQA 1V3XA 3FFGA 1GMHG 1V2UT 3AAUA 1QA0A 2FOGA 1OOKB 1ZMJA 1DOJA 1Z71A 2W3KA 2BD2A 4NSYA 3VB3A 3SNAA 4I8LA 2W7SA 2JH5D 4H6SB 2B8OH 1HUTH 2F9VA 5GWZA 1GDQA 1DVAH 1O3JA 1NN6A 1WTHD 1HV7A 3RXPA 2ZEBA 2F91A 5C1YA 1W7GH 3T26A 1TX6A 3GY5A 1ZJDA 4K8BA 1O2XA 1C5RA 1OP0A 1W0ZU 1GBDA 1HJ9A 4I31A 5DJ7A 1YPJH 1KXFA 3LOXA 1YP9A 2PFEA 1WAYB 1PPGE 1CGIE 1FN8A 1OWHA 3UNSA 1F0RA 3QZQA 1QR3E 2TBSA 1CHOG 2A5KA 1GCTC 2R0LA 4ZH8A 3KEEA 5J4SA 2ZCKP 4ABGA 1HBTH 1G3DA 2A4OA 1FY3A 1C1NA 3T25A 2QXJA 3A85A 5DKMA 4WXIA 3BEUA 5C5OA 1GBAA 4JZIA 2A2QH 4X8SH 4LK4A 2Y5GA 3UREA 2Y81A 1DX5M 2BD3A 3BTQE 1C4V2 1GJ4H 1UTNA 3PMBB 1BUIA 1GBIA 3SV8A 3O8RA 1HGTH 3MHWU 2PTNA 1QBVH 2EI7A 3TITA 3OY6U 1P9UA 4MPXA 1J15A 1TA2A 1AIXH 1OWIA 1T8LA 3MNXA 1OWEA 2R0KA 1CT0E 4CHAC 1LPGB 2J4IA 4Y7AA 3SU2A 1P04A 2CN0H 1P57B 1EXFA 1Y3UA 3E3TA 1UHBB 4IN1A 4WMFA 1HIAA 1C5XB 1NTPA 1DM4B 1AE8H 3ZZ4A 1AUJA 3T28A 1O2IA 2XBXA 1EAWA 2BY6X 3SQEE 1HXEH 4YM9A 4RKOB 1BRCE 1TX8A 3PROA 4NSVA 2XC0A 4D76A 4CR9A 1RIWC 4OS2A 1T4VH 1YLDA 4KTCA 2C3SA 3EGKH 4K3JA 3CENA 2PSXA 4ZXYH 3TH3H 3ZZ6A 5L30H 3AASA 4YOJA 2P8OC 3CS0A 5FCRA 1K1MA 1SG8B 5HYOA 1BTZA 3V13A 1HAHH 4X2VA 1ETSH 5CE1A 1F5RA 1E38B 4DOQA 5F6MA 1ZPZA 3MOCA 1SGRE 2D8WA 1WSSH 2ZU3A 2XNIA 5F8TA 2A7JA 3TPIZ 2LPRA 1C9PA 6GCHG 2KAIA 2ZWLH 1AGJA 4X8VH 2TIOA 3IITA 1PJPA 4RN6A 3GY4A 1H1BA 2I6QA 1VGCC 1Y8TA 2B9LA 9LPRA 1GJDB 4Z6AH 1O3EA 3OY5U 1QTFA 1MKXH 1TRYA 2NU2E 4DGJA 1SGTA 1HAGE 3PO1C 3MTYA 1MD7A 3ODFA 1PYTC 4LZ4B 1W7XH 2XCFA 4GAWA 4ISNA 4VGCC 5AFZH 3TGJE 3EDXB 2F9PA 1G3EA 3RM2H 2ZHDA 1N6XA 3RDZA 4DIHH 4FUFA 2SNWA 1RTLA 1BTYA 3I78A 1GHWH 1AFQC 1D9IA 5EW1H 3L6PA 1CO7E 2ZIQH 5FX6A 4ISHH 3U98H 2ANWA 3M3VA 2AIPA 1QIXB 1SPJA 2D2DA 1CBWC 1LDTT 2ASUB 1CGJE 2VIOA 1A0LA 1VJ9U 1BA8B 4CBNA 2QYIA 3HATH 1C2LA 1V2QT 4NIXA 3S7HB 1QBNA 4JCNA 5AF9H 1GMDG 1SSXA 1WV7H 1O32A 1GJ9B 3STJA 2W3IA 4FU8A 2XBWA 1ZTKA 3UIRA 2XWBI 5EQRA 3RXFA 1MTNB 1C2EA 1C1VH 4SGAE 4ZHMU 2VWOA 4B2BA 3KQDA 1O3AA 1NFWA 2G51A 5SGAE 2A5IA 1AO5A 1XM1A 3I77A 1DWBH 1UTLM 2ZFSA 1OP2A 2ZTYA 1GJ8B 4TYDA 5C67A 3LH3A 2J9NA 1GHYH 4A5TS 2A4RA 3U8TH 3S9AA 3VB6A 3R3GB 1GHAF 2OTVA 1V2LT 2HVXA 1NFXA 5GPIB 1OX1A 2H9EH 1K1IA 1FY1A 1MZDA 2D1JA 1SGFA 1HDTH 8GCHF 1XUHA 2Q6DA 1YPEH 1V2RT 2BMGB 4BAQB 1V2ST 5JBAS 2BVXH 1A61H 1QRXA 1QGFA 1WOFA 1SOZA 3RXEA 1FDPA 2HRVA 3ATLA 2GGVB 1QA7A 1AD8H 1EJAA 2BDHA 2AGIX 4B74A 1H9HE 2FESH 1KDQB 5E8EH 3NKKA 1INCA 1P0SH 1E35B 2ZGCA 3ZZ8A 1YYY1 2QV1A 3B9FH 2ZI2H 3H5CB 1MKXK 3QDZB 1EPTC 2QCYA 1H8DH 1BQYA 1V2NT 1V2TT 3SV6A 3MNSA 1HYLA 3SBKA 1NRPH 4I33A 1IHTH 1K21H 3MH6A 2G55A 1PPCE 1Z8IB 2WPHS 1O5DH 3OU0A 2F3CE 1GHZA 1W13U 2CXVA 1NRRH 2EEKA 2ZFQH 3MU0A 1O2UA 1OKXA 3K2UA 1D3TB 2BB4A 1TOMH 4ZMAH 3CS7A 1C2DA 1ZTJA 4BTIB 1DDJA 1BJVA 2BXTH 1F0UA 1K1OA 1LPKB 3Q77A 3RXGA 3I29A 1C1TA 1C2IA 5FPSA 3SW2B 1LQDB 1TAWA 4MVNA 2A31A 2ZO3H 3MU1A 2PUQH 4F49A 4JYTA 1QNJA 1O5BB 1F7ZA 1GI8B 2H5CA 3FAOA 1Z1JA 2Q6GA 3D49H 1GGDC 2PSYA 1HAZB 4KGAA 1C1PA 1Q31A 2BLOA 4TWYA 3VB7A 3F9HA 4DURA 1YKTA 4ZKNU 3LGWA 3ZVGA 1TE0A 2Z9JA 2V0BA 3A82A 4Q7XA 1O2OA 1TPOA 3HGPA 3GDSA 3TK9A 2Z9IA 3NXPA 2BX4A 4JK5A 1YBWA 4AG1A 4FUCA 4X6PA 1D4PB 1OPHB 1YC0A 1QL9A 1ACBE 3EAJA 2ZTXA 4IMZA 1O36A 1QHRB 1C1QA 3SU4A 4ESTE 2VJ1A 1CSOE 4NA9H 3VGCB 4YESB 5GIBA 3R0FA 3P8OA 1PPHE 2BY8X 1QJ6B 3O8DA 1IQIA 1GI5A 1PFXC 2WYJA 1P8VC 2GKVE 3TU7H 4JZ1A 1TOCB 4E7RG 1V2VT 3MH4A 3M37A 1NO9H 1FN6A 1A46H 1RJXB 4UEHH 3RXBA 1HRTH 3RLWH 3IWMA 1QQUA 1TB6H 2BDGA 2FODA 5LPEA 2Y5HA 4TWWA 4CRAA 3GCNA 2J95A 1HXFH 2PWXA 3MU5A 1KXEA 1LQEA 2QF0A 4CH2B 5FHTA 3U1JB 3GCTG 4O97A 4NCYA 2BM2A 4ZKOU 2FOEA 3A8DA 3L33A 4X2XA 1ELAA 2FOHA 2ANMH 5JYIA 1SHYA 1DITH 1C1MA 1G3CA 2QF3A 3VFEA 2UWLA 4Q7ZA 1WTGH 1AVWA 1BB0B 1L4DA 3A7TA 1T32A 1HAVA 4X1RU 1S84A 1VR1H 2AIQA 3HKIB 3TNTA 4BOHA 4KP0A 5A09A 1J17T 1ESTA 1KXDA 3VXFH 3RXMA 2A5AA 1O3BA 2AMDA 2B5TB 3UOUA 5EGMA 3VEQB 2QN5T 3LIWA 3PLPA 2ZU2A 4LXBH 2PHBA 1IQEA 2F9OA 1C1OA 1BBRH 1JRTA 2BY7X 2FPZA 2ZGHA 5AHGH 4OS6A 3RMMH 3DHKH 1C5NH 4Y7BA 1XX9A 1JIMA 3RU4D 1ZLRA 5DP9A 4MNYA 3W95A 4Q2KA 3BG4B 1C2HA 1O3FA 3BN9A 1Z6JH 4MQAA 3LC5A 1JIRA 1NY22 1EB1H 2GCHF 2CMYA 2G81E 2VNTA 3SUEA 1ZHRA 2ZU5A 1SC8U 2F9UA 2FTLE 2JH0D 1AB9B 1ID5H 1VCPA 1YLCA 7ESTE 3A88A 2W26A 4Y10E 1FIWA 4XBDA 2WV5A 1N1LA 3BTGE 2ZGXH 5FBEA 2VVCA 1BOQA 2CV3A 5EODA 4KKDA 1P2QA 3LGIA 2PGBB 4HZHA 3NK8A 5EXMA 2FIRH 1S6FA 4OGXA 2OUAA 1GHBF 1TPAE 1T4UH 4MNXA 5E2PA 1EX3A 1ELBA 2HPQH 4DIIH 4FVDA 2FXRA 1JRSA 2EA3A 1C9TA 1UK3A 4X6OA 2OBQA 1GBKA 1BMMH 1AU8A 1SB1H 1ELCA 4ABJA 2UUJB 2R9PA 2C93B 3DUXH 4HI3A 1GMHF 4Q80A 5ESBA 1NT1A 1VCQA 4X6MA 3QWCH 1Z8GA 1O2PA 3TLOA 1GI9B 5A0AE 3ATKA 3V12A 3KF2A 3LC3A 2JH6D 1ANBA 1TMTH 3ZZDA 1EASA 1FY4A 1GBHA 1AE5A 3RC6A 1DPOA 3NUMA 1LVBA 1T8NA 3M3TA 1ARBA 3AW0A 3F68H 2GCHG 4U30A 3S69A 1YGCH 2BDCA 2FMJA 2P3FH 1G30B 3E90B 2TPIZ 3PM3A 1C5WB 2WPIS 4PROA 5A2MH 1GI1A 2VVUA 4CBOA 1O39A 1QB1A 5HXFA 1MTNC 1ABJH 1GPZA 1SGDE 1OWDA 5T6DA 1S82A 4Y71A 4XDEA 1DY8A 3QO6A 3S9BA 1BBRK 1CHOF 2ZPQA 3RXJA 3CP7A 3SOSA 3RXCA 1A4WH 3BTKE 1SQTA 2P16A 1JWTA 1Y5UT 3E8LA 3ZYDA 4AB9A 1W12U 1OYTH 3SU6A 1PQ5A 4YTAA 4GPGA 2ZDVH 3PB1E 5JBTA 4ZROA 1IQLA 1P9SA 1PPZA 5FPTA 1ETTH 1S0QA 2A4QA 3KL6A 1SOTA 4K1SA 4NA8A 1P3EA 2C8WB 3ZVFA 2BD4A 3LJOA 4BAOB 4B76A 1AI8H 4NFEA 2R2WU 2O8UA 3U1IB 1TWXB 1KXBA 2F9NA 3RXIA 1O3GA 5EOKA 1MBMA 1UJ1A 3SJKA 4ZKSU 1AMHA 4K5ZA 1TGNA 4GCHG 1H9LB 1T31A 3VPKA 4MG3A 2ESTE 1PPBH 5LPRA 4JZDH 4Y8XA 1RTFB 3LPRA 1D6WA 1S5SA 4RSPA 2TGPZ 4MNWA 1BDAA 4HFPB 1YCPH 3U8OH 3URDA 4ZHLU 4INKA 1C2GA 3SNEA 4HGCA 4YOIA 1O2RA 1NU9A 1V2JT 3LGUA 1TNHA 3T29A 2BQ7B 4I8GA 5C5NA 2OD3B 1GBTA 3SI3H 1Y5AT 1O33A 2G52A 1OWJA 1ZSJA 3F6UH 3LT3A 3A84A 4KTSA 4ABFA 3K65B 1GBMA 2FOMB 4OS7A 1ELVA 2PV9B 1DY9A 3A7ZA 5J4QA 2VVVA 2ZFRH 3NZIA 5GCHF 4ISOA 4FXGH 1ZGIA 3RXDA 1EPTA 1P2MA 3MU8A 2FLRH 1MH0A 1P3CA 4CREA 1LHCH 4WY3A 2AS9A 4IS5A 1SGPE 4X8UH 3GYMA 6ESTA 5DP5A 4AB8A 5FAHA 1C5TA 5T3HA 3ELAH 4IMQA 6GCHF 1O5EH 2STBE 3M5MA 4DG4A 3BTTE 4LZ1H 2V3HH 1EP5A 1XVMA 4I8JA 3T62A 4A1XA 3E0NB 2BLWA 2WPJS 1G2LA 4MNVA 1ZGVA 4I7YH 4AGJA 1UTMA 1ZHPA 4WXVA 1YM0A 4NWLA 1IQHA 3BIUH 2EI8A 4CRGA 2BTCE 1ELDE 4D7GA 2FTMA 1O3DA 1IOEA 2IPHA 2QC2A 3U8RH 2C8YB 3UNRA 3ITIA 4X6NA 4IGDA 1EKBB 5BPEA 1MTVA 1UCYE 4GUXA 2BVRH 4D9RA 3RM0H 5TCCA 2VIPA 2BDYA 1ELFA 5ETXA 1SLUB 3M7TA 1O2JA 1RXPA 1QRWA 1O5AB 3LDXH 4BTUB 3BEFB 2UUYA 3E91A 4J1YA 5GCHG 1QBOA 5EU8A 4Y8YA 3VGCC 1SGIB 5DP7A 5H4IB 2ZECA 5JBCS 1HJAB 1GMDF 3TGIE 1Z8RA 3QX5H 2B0FA 1GG6B 3LONA 4CRFA 1L4ZA 1DWDH 2CGAA 2QAAA 3P95A 3P8GA 3RU4T 1W2KH 1TRMA 2GDDA 1ELGA 3GYLB 1Q3XA 2P93A 5A0BA 2FOFA 5HM2A 1YCPK 4A1VA 1BMLA 2XC5A 3U69H 1L0ZA 4JZEH 4R0IA 1G9IE 1XXDA 3LGVA 1MU8B 4Z0KA 3UY9A 2ZDAH 1KLJH 1TQ0B 1V2OT 3PTNA 1HLTH 2H6MA 4SGBE 5LPFA 1GJBB 4K8YA 5TJXA 1FUJA 3A80A 1WBGB 3UTUH 3MU4A 4UDWH 1HAXB 3RP2A 2BOKA 4XFQA 3GCOA 2AMPA 1K1NA 1A0HB 1TALA 2ZFPH 1C5VA 1O3CA 3GISB 2VIDA 2UUFB 4Y79A 2EC9H 2Z94A 4ZHAA 1Y3VA 3M5OA 1P12E 2GCTB 2Y6TA 5B6OA 1QFKH 1P09A 3BSQA 1P06A 4Y76A 4YLQH 5DPAA 3M7QA 2ZHFH 1LHEH 2ZGJA 1TGCA 3PWCA 4FUJA 1T8MA 2A45B 3PMJA 4MPWA 3SU5A 1Y3WA 1UTOA 5FPYA 1OP8A 3F1SB 2HGTH 4FUIA 1HAYB 4F4OC 1EB2A 3BG4C 4MPUA 3URCA 1ESAA 1CU1A 1DWCH 1MCVA 1RRKA 3F9FA 2O8TA 1TGSZ 4O3TA 3SJIA 1QQ4A 2C8XB 1IQGA 1FY5A 4JMYA 2CF8H 2A7CA 3FP6E 1AVXA 1AB9C 5JPMH 3FANA 1G37A 1FI8A 2OINA 3GCHB 2GZ7A 3SHCH 1E34B 3UFAA 1SLVB 3N7OA 2BX3A 3SO3A 4I8KA 3FVFB 1ANDA 4JYVH 1UVOA 1TIOA 3P70B 4OGYA 3RXRA 1S0RA 4MPVA 1GCDA 5AFYH 1GBEA 2G5NA 3FZZA 3D23A 2A0QB 1P02A 1IAUA 1OYQA 1IQFA 1UTKA 2ZHWH 1G3BA 3D62A 3QLPH 1TYNA 1BTUA 1W14U 5DG6A 1C1UH 5PTPA 1V2KT 1BMNH 3TJVA 2Z6BD 1HAPH 2OLGA 1NC6A 1OXGA 2PR3A 6LPRA 4AX9H 1G36A 3GY8A 3GICB 3T5FH 8ESTE 1XUKA 3SHAH 3TK5A 4B2CA 1BTHH 2IN2A 3GOVB 2FS9A 2FX4A 5JB8S 3ATWA 2B7DH 5F8ZA 1K2I1 4BXSA 2PKAB 3ZZBA 1JXPA 2VH0A 1TPSA 3DFJA 5E0GA 2R3YA 5TCAA 1MTWA 1GHVH 3RXQA 5FBIA 1D3PB 1GJ6A 2HPPH 2OQ5A 3ZVDA 4E05H 3HPTB 1SGCA 5A8XA 1HJ8A 2NU4E 2A32A 3MH5A 1LMWB 1VITG 1DANH 1J14A 5T6FA 1HAIH 1OSSA 1MUEB 3BTEE 3QK1A 4OS1A 1GWAA 1RS0A 1GMCG 2DE8A 3MNBA 2J2UA 4IBLH 1O2GH 2BD8A 3ZV8A 1JMOH 3HKJB 4R8TB 2HNTC 1DT2A 4INLA 1EOJA 3ZZ3A 1A0JA 4AG2A 5JB9S 2IOTA 1O2YA 5HGGA 1GL0E 3TH2H 2WV4A 2Y7ZA 1SBWA 4IW4E 2ZDMA 1C5SA 1YCPM 4AN7A 1VJAU 4K1TA 5EW2H 1O3IA 1D6RA 1DUAA 3GCTF 1Z6EA 1BCUH 4NZLA 3EA9A 2O8LA 8KME2 4KTUA 5E0HA 4ABDA 1GI2A 1MCTA 1JBUH 3RXLA 3T2NA 2J94A 1W11U 2BXUH 1FZZA 1GL1A 2AEIH 3Q3KA 1GBJA 1SGEE 1EOLA 1O35A 1GBBA 1PYTD 2Z7FE 3EYDA 4O9VA 1HFDA 2VGCB 6CHAB 2RDLA 4ISIH 3K6YA 1YF4A 2A1DB 4GHQA 3GY6A 2XRCA 3ZVCA 2P95A 1TRNA 1C1WH 2BQ6B 2TGTA 1CT4E 1FXYA 2ZQ1A 1P2JA 4ISLA 4AOQA 1SQAA 2SFAA 4X1NU 2A7HA 4Y8ZA 2H9HA 1QRZA 3QUMP 4BAMB 3SNCA 1XUGA 1OS8A 4D8NA 1P2NA 1EZUC 1U6QA 3MWIU 1EATA 5EPNA 3SNDA 1H9IE 1DXWA 1DSTA 1Q2WA 1CA8B 2ZGBH 4K60A 4WH8A 3A83A 2J38A 2PKSB 4J2YB 1BRUP 1KTSB 1TGTA 1AVGH 5C1UA 1KIGH 1SGNE 2QXGA 2G4UA 4INHA 3RC5A 2HNTF 3ZV9A 3A7XA 1ZRKA 2HLCA 1AUTC 2V3OH 1J16A 1F0SA 3M36A 1NRSH 2GT7A 4AYVB 4NWKA 2ZFFH 5I25A 1O0DH 4XBCA 5CHAB 2WINI 4WWYA 3Q3YA 5K0HA 1QB6A 3A8CA 4BAKB 3RLYH 2D26C 2ZTZA 1AY6H 1BMAA 1O5CB 2H5DA 1C5UA 1HPGA 3LU9B 4U32A 2CHAB 2GP9B 4GHTA 1L1NA 1ZR0A 2FEQH 2FOCA 1O5FH 2V35A 3SV2H 1QL8A 3S7KB 1O3OA 2AERH 1GI3A 1O3KA 3BIVH 4XOJA 4OS4A 9ESTA 1SGQE 3QTVH 5EXLA 1Y5BT 2PGQB 2P3TB 1NZQH 1UMAH 1AKSA 1QURH 4BXWA 2RCEA 1MTSA 1HJAC 2FP7B 1A1RA 3RMOH 3GDVA 2J92A 4JYUH 4NG9H 2BVSH 1GG6C 2OXSA 4FU7A 1ZOMA 3VB5A 4NGAH 1W10U 3H7TA 2AYWA 3SV9A 1VITH 4WMEA 3H7OA 4ZAEA 5GDSH 3BTHE 1SR5C 3BEIB 1FNIA 1DWEH 1ESBA 3SGBE 2WYGA 4B2AA 3V0XA 4O03A 1TQ7B 1K1JA 1DLKB 2BZ6H 2ZP0H 3EA8A 2NU3E 1W0YH 2ZU1A 4AGKA 1C5MD 2XTTB 2XXLA 1TNJA 3A7WA 4IC5A 5K7RA 1G2MA 1SL3A 3FP7E 5EQSA 2NU0E 4WVPE 3Q00A 2VB0A 4YOGA 4AZ2B 3DT0H 1FAXA 5DGJA 3U9AH 1K9OE 1N8OB 4QT8C 1RFNA 1NESE 4THNH 3RXTA 1GI0A 1P05A 4ABBA 1BT7A 2ANKH 3M35A 2ZPSA 4CR5A 1WQVH 1EAXA 4X2WA 1UVPA 1FY8E 1O2LA 1GI7B 1ZYOA 4Y0YE 1VCWA 4GCHF 2GCTC 2ZDLA 2XBVA 2JETB 1EZXC 3PMAB 1XVOA 1LPZB 2FLBH 1QB9A 3NPSA 1Z7KA 1HIAB 5L6NH 1SMFE 1AFEH 1GDNA 1V2PT 2GMTB 3MO9A 1J9CH 1O2HA 4B1TA 2FS8A 1EJMA 3QGJA 1ANEA 1GI6A 1S85A 1C4Y2 3ZZ5A 1WUNH 1CHGA 1MQ5A 4IN2A 2GV7A 4A7IB 3UQVA 2Y7XA 3GY3A 2Y82A 1FLEE 4DJZB 2FX6A 2WUBA 1FQ3A 2BDBA 4NZQA 3WY8A 3AAVA 1A2CH 3ODDA 5E2OA 3SV7A 1BHXF 2BD9A 1LVMA
chains in the Genus database with same CATH superfamily
1MTUA 1FJSA 3GCHC 3KQEA 1C1RA 3T27A 3MNCA 1BZXE 3SU0A 1BTXA 7GCHG 4AFSA 4E7NA 1TNKA 2PP6A 2C90B 3TGKE 5DK1A 4FUEA 2J34A 2BDAA 1SGYE 3JZ2B 1B7XB 4B6FA 1THPB 3KCGH 1ZJKA 2RA0A 2KAIB 3O8CA 1MAXA 4Y6DA 5L2ZH 4AORA 4KELA 3UNQA 1FMGA 4UD9H 1ZZZA 2ILNA 1ELEE 1NRQH 1YPMH 4DCDA 4H42U 1L2EA 2GT8A 3K6ZA 1SGFG 1SLXB 5FCKA 1E0FD 4B71A 2HWLB 1KSNA 1DS2E 1P11E 1UK4A 4CRDA 2RG3A 2SGEE 3ZZAA 1EAIA 1YPHC 1V2WT 2ZDNA 4XBBA 5DP3A 3LGYA 4K1EA 1MQ6A 3ENSB 5DP6A 1SLWB 1F92A 2BOHB 1WXRA 2QGRA 3K9XB 4ZKRU 5KGOA 3RXOA 1PPFE 1WYKA 1PPEE 2QF4A 3G01A 3ZZ9A 4ASHA 1O30A 2ALPA 3EA7A 3ZVAA 2AH4X 1BRBE 1O5GH 4AYYB 4NA7A 2F9BH 2BY9X 2ODYB 3MO6A 2XW9A 2VWLA 4A92A 1DUEA 2TGAA 5EPYA 5EJLA 5CMXH 2TRMA 2Q6FA 3UB0A 1YPHE 3OX7U 1AZZA 1UVTH 3SU1A 3HGNA 1ZMNA 2BLQA 1D3QB 1KXCA 2VINA 4MTBA 2FI4E 4I32A 3LKWA 1TLDA 2ULLA 2IJOB 5C20A 2BD5A 3MH7A 4A6LA 1TMUH 4ABEA 1TBRH 3SUGA 3M3SA 3W94A 4UONA 2RFKC 1IHSH 1P2IA 2FWWA 2G5VA 4U2WA 2ZF0H 1TBZH 1BRAA 2OCVB 1A5GH 1KY9A 3EQ0H 2ZCHP 3TVJB 1PQ8A 1GVLA 2Z9GA 1JOUB 2ZFTA 2P59A 3PWBA 1NM6A 1FPCH 2PLXA 3ATMA 3PTBA 3ZVBA 2QXHA 3RXUA 3O8BA 5GJ4B 3UR9A 1B0EA 1NRNH 3STIA 2LNCA 3TJUA 1O3PB 2XYAA 1B5GH 2WPMS 3P92A 1FAKH 5FX5A 2SGQE 1MBQA 3PLKA 1YY3A 2C4FH 2VBCA 2OQUA 1BTPA 2ZPRA 3KYGA 3V3MA 1XKBC 5I46H 5BRRE 3F9GA 3SJOA 2EI6A 1GBCA 2VIVA 2CJIA 3F9EA 1CQQA 2A4GA 3OEHD 2VGCC 6CHAC 5EIYA 2ZHQH 4BNRA 4CRCA 1TFXA 4F55A 3EE7A 4XE4A 2ALVA 1C4U2 1WU1A 4TPIZ 2WV9A 3AW1A 2QY0B 2SNVA 3WWBA 1TX7A 3Q76A 1ORFA 2F43B 2QA9E 4UFFH 2QIQA 5JBBS 1GJ7B 1BHXB 3KQCA 1BBRE 3E6PH 1MMJN 1SVPA 1IQNA 3A8BA 3DD2H 2STAE 2SGFE 4H4FA 3MI4A 3SQHE 2Y80A 4I86A 1O2QA 2H1UA 1NPMA 1ZRBA 1IQMA 1CA0B 3SUFA 1O2NA 1P10A 3BG8A 3M5NA 4D7FA 5EXNA 5IK2D 1WCZA 1LTOA 2ZU4A 2ZZUH 3SZNA 1T7CA 1KYNA 5HMAA 2I6SA 2PKSC 4AFQA 2Z9KA 5LGOA 3UQOA 3P17H 3KN2A 1GDUA 3A89A 1XKAC 4AC9A 1KLTA 2EQNA 1EQ9A 1MD8A 4A1TA 3ZYEA 2OC7A 5DP4A 1SI5H 2A2XH 2ZHEH 1NROH 4MLFB 4TPYA 1Y3XA 3UWIA 1XUIA 4UFGH 1A3EH 1CVWH 3F2FA 1XUJA 3OFND 1KLIH 2LELA 4WH6A 2BHGA 2VH6A 4K2YA 2FOAA 1KXAA 4DT7B 1C2KA 3B8JA 1GBFA 4OS5A 5CHAC 3SORA 3C1KA 1SFQB 2W6JD 1O34A 4BAHB 2H9TH 1AWFH 4NIVA 5ABWA 1O2SA 1O2MA 2CHAC 1RD3B 2W7UA 2RDEA 3ESTA 4XSKU 4LOYH 1O2VA 3C27B 1A3BH 3MYWA 1TMBH 3S9CA 1TGBA 3SYJA 1LHFH 2C8ZB 1HNEE 2FOBA 2VWNA 1V2MT 3VG8A 1UHBA 5IYTA 2VIWA 1DFPA 2HOBA 3E16B 1O31A 1ZPBA 2M5TA 4YT6H 4FUHA 4YZUA 1G32B 3E0PB 3RXSA 3KNXA 2CK3D 5C1XA 2ZCLP 3EE0B 1A5IA 4E06H 1TNIA 3UUZA 2P94A 2SGDE 3OTJE 1VITF 3QZRA 1FV9A 2ZNKH 1F5LA 1K28D 1GMCF 1OWKA 2Z9LA 2PUXB 2XCNA 2WUCA 7LPRA 1IQKA 3RC4A 3OAAD 4B73A 1ELTA 1LVOA 4YT7H 3OYPA 3RUOA 3A87A 3MMGA 4DT4A 1GBLA 1KTTB 2RA3A 5E0JA 2XC4A 1LCYA 2SGPE 3KHVA 4ABIA 1O2KA 2Z3DA 2WPDD 3MFJA 2AGEX 1PQ7A 4ACAA 1M9UA 1N8OC 2SGAA 1UTQA 1UVUH 3PV4A 2UUKB 3PYHA 1BIOA 1A7SA 1ZPCA 1LHGH 3PMHB 4X1PU 5CDFE 1MU6B 1DLEA 2FO9A 1E36B 2CF9H 1E37B 1O3HA 1QL7A 1GCTB 2NU1E 1HAVB 1MKWH 4MDSA 3RU4E 4UFDH 2YNAA 1O2WA 4ZXXH 3UPEA 4Z1MD 2BLVA 3LGTA 5DN6D 1QJ1B 4ZUHA 1SHHB 1K1LA 1GHAG 2JETC 2NWNA 2VWMA 4B75A 4O3UA 1RTKA 2XNDD 3TNSA 3P8NA 1ABIH 3QN7A 4RKJB 2H2ZA 2HALA 2GMTC 8GCHG 1P01A 4FVBA 5FXLA 5T1VA 2YNBA 4U01A 2FI3E 3VXEH 1GJCB 1C2JA 3SN8A 1F2SE 3L3TA 5C2ZA 1P2KA 2WZQA 1HB0B 1NBMD 5IDKA 2R3UA 1THSH 5A8ZA 1C2FA 5HM9A 1EZSC 1UTPA 3KQBA 3VB4A 1GVKB 2XBYA 4CHAB 1B0FA 1X7AC 4Y0ZE 5EG4A 1MZAA 1QJ7B 1Z8JB 1ZTLA 1C5ZB 1AKSB 2YOLA 3FP8E 8LPRA 3OSYA 1NU7B 3PLBA 1HCGA 1TNLA 1LKBA 2HNTE 1A5HA 2G8TA 1S81A 4M7GA 2AFQB 2BYAX 1RIWB 1H8IH 5GNDA 1LO6A 2AMQA 2TGDA 4Q7YA 2BZAA 2THFB 3RXKA 3NWUA 1N6YA 4BTTB 4GLYA 2WPLS 1SQRA 3MO3A 2VIQA 3M61U 2R2MB 3NCLA 2P8OB 2DUCA 1FIZA 1D3DB 3PV5A 3W1EA 3UWJH 4DVAU 1WQSA 1EP6A 1EAUA 2FYQA 2GVFA 1TA6A 1SFIA 1DE7H 1GJ5H 4GSOA 3S0NA 1C5YB 1H4WA 4X8TH 1KDQA 3TJNA 2BDIA 4K69A 3D65E 3UOPA 1O3LA 3Q3XA 1C5QA 3MQKC 1C5PA 1W0JD 1L1JA 1NS3A 2O8WA 3NRLA 1VGCB 1ZSLA 1O2TA 2G4TA 1S6HA 4ABAA 4WF8A 5GXPA 1SQOA 3SU3A 1TPPA 2ZC9H 4BANB 2ZKSA 1CGHA 4JZFH 1MKWK 3PO1B 2BY5X 4FUBA 1L1GA 4X1QU 4TY6A 3RXVA 1WDIA 3TJOA 2DE9A 3DSPA 1XMNB 2QXIA 1TNGA 4VGCB 1BTWA 2OC0A 7KMEH 1BMFD 1UCYH 2FYRA 1H8ED 5C3NA 1O2ZA 3HK6B 1K22H 1UTJA 5A0CA 1AHTH 1K1PA 3ZZ7A 3ZZCA 1ZMLA 1ZSKA 2KM0A 1AWHB 1HAOH 1AFQB 1ETRH 1PQAA 1CE5A 3TK6A 1W8BH 3ATIA 2V7QD 1RGQA 1C5LH 4I8HA 1EUFA 2PKAA 1UVSH 4UFEH 2GX4A 1BJUA 1TBQH 2KCAA 4HTCH 1CBWB 1NFYA 1F5KU 3A8AA 3QGNB 1P03A 1C2MA 1VZQH 3BTDE 4X2YA 1EJNA 3RMNH 4GVUA 4NFFA 1P2OA 3KIDU 1W3CA 5B6LA 5DP8A 1DXPA 1V6DA 5LH8A 1AN1E 3UR6A 1QZ8A 3P6ZB 2FM2A 3SI4H 2P3UB 2ODPA 1AQ7A 2ZG0H 1GHXH 4FUDA 3SJ9A 3M7UA 1LHDH 2JKHA 1QY6A 3DA9B 4NIYA 2BQWB 4WJG2 2OC8A 1EZQA 2BD7A 4X1SU 3GY7A 1C1SA 1TONA 1ZHMA 3ZVEA 4DW2U 4H6TA 3AVZA 3GY2A 4FUGA 2FDAA 3SNBA 4YO9A 3RMLH 4AFUA 1UK2A 3HK3B 1F0TA 1Z1IA 3GDUA 1YPLH 3UAIC 1Y3YA 3P8FA 4CH8B 3BV9B 3M5LA 2V6NA 2W5EA 1O37A 2GV6A 5F03A 4TY7A 5G4BA 1CA0C 1UO6A 4IC6A 2K1QA 3BF6H 2Z3CA 4JK6A 4NIWA 5ESTE 2FZZA 3BTME 2OC1A 1C5OH 2PTCE 1FPHH 2O9QA 5C17A 1T8OA 2G00A 1LKAA 1ARCA 2UWPA 3SGAE 3B23B 2UWOA 3FOAA 1EPTB 2WPKS 4UE7H 7GCHF 3LH1A 5AVDA 1Y59T 3TIUA 1YPKH 1O38A 1THRH 2Z3EA 5A8YA 1GI4A 3A7VA 3RXAA 4Y11E 2VU8E 2KX4A 1UCYK 4CRBA 3TH4H 1FONA 3BTFE 1MAYA 2AGGX 3SUDA 4M9FA 3BTWE 2GDEH 3A81A 2GZ9A 3IG6B 2GD4B 2ANYA 1J8AA 4X0WU 5EQQA 5T6GA 2GTBA 1XXFA 4RI0A 1LVYA 3A86A 2PW8H 1GVZA 2ZQ2A 1IQJA 1DICA 1XUFA 5DO4H 1YPGH 3SJ8A 4WMDA 4DY7B 4YLUA 1QCPA 4D9QA 2J5UA 4ABHA 3JZ1B 2XWAA 1GJAB 1CT2E 3RXHA 3A7YA 3E1XB 3KGPA 2O8MA 4FU9A 2Q1JA 1BITA 2F83A 2ZDKA 4AFZA 3DFLA 3SGQE 3LJJA 1TABE 3FZDA 5F8XA 2ZA5A 1ANCA 5EJZA 1GHBG 1AZ8A 2FI5E 2OP9A 3V7TA 2GZ8A 2OBOA 5L2YH 3QTOH 1DSUA 1S83A 1O3MA 2Y5FA 1GGDB 5JDUB 1O3NA 1NFUA 2ODQA 1V3XA 3FFGA 1GMHG 1V2UT 5EJ1A 3AAUA 1QA0A 2FOGA 1OOKB 1ZMJA 1DOJA 1Z71A 2W3KA 2BD2A 4NSYA 3VB3A 3SNAA 4I8LA 2W7SA 2JH5D 4H6SB 2B8OH 1HUTH 2F9VA 5GWZA 1GDQA 1DVAH 1O3JA 1KMHB 1NN6A 1WTHD 1HV7A 3RXPA 2ZEBA 2F91A 5C1YA 1W7GH 3T26A 3AK5A 1TX6A 3GY5A 1ZJDA 4K8BA 3N7DA 1O2XA 1C5RA 1OP0A 1W0ZU 1GBDA 1HJ9A 4I31A 1OHHD 5DJ7A 1YPJH 2QE7D 1KXFA 3LOXA 1YP9A 2PFEA 1WAYB 1PPGE 1CGIE 1FN8A 1OWHA 3UNSA 1F0RA 3QZQA 1QR3E 2TBSA 1CHOG 2F4LA 2A5KA 1GCTC 2R0LA 4ZH8A 3KEEA 5J4SA 2ZCKP 3H09A 4ABGA 1HBTH 1G3DA 2A4OA 1FY3A 1C1NA 3T25A 2QXJA 3A85A 5DKMA 4WXIA 3BEUA 5C5OA 1GBAA 4JZIA 2A2QH 4X8SH 4LK4A 2Y5GA 3UREA 2Y81A 1DX5M 2BD3A 2J97A 3BTQE 1C4V2 4OM9A 1GJ4H 1UTNA 3PMBB 1BUIA 1GBIA 3SV8A 3O8RA 1HGTH 3MHWU 2PTNA 1QBVH 2EI7A 3TITA 3OY6U 1P9UA 4MPXA 1J15A 2HVYB 1TA2A 1AIXH 1OWIA 1T8LA 3MNXA 1OWEA 2R0KA 1CT0E 4CHAC 1LPGB 2J4IA 3F2HA 4Y7AA 3SU2A 1P04A 2CN0H 1P57B 1EXFA 1Y3UA 3E3TA 1UHBB 4IN1A 4WMFA 1HIAA 1C5XB 1NTPA 1DM4B 1AE8H 3PRDA 3ZZ4A 1AUJA 3T28A 1O2IA 2XBXA 1EAWA 2BY6X 3SQEE 1HXEH 4YM9A 4RKOB 1BRCE 1TX8A 3PROA 4NSVA 2XC0A 4D76A 4CR9A 1RIWC 4OS2A 1E1QD 1T4VH 1YLDA 4KTCA 2C3SA 3EGKH 4K3JA 3CENA 2PSXA 4ZXYH 3TH3H 3ZZ6A 5L30H 3AASA 4YOJA 2P8OC 3CS0A 5FCRA 2LP6A 1K1MA 1SG8B 5HYOA 1BTZA 3V13A 1HAHH 4X2VA 1ETSH 5CE1A 1F5RA 1E38B 4DOQA 5F6MA 1ZPZA 3MOCA 1SGRE 5C94A 2D8WA 1WSSH 2ZU3A 2XNIA 5F8TA 2A7JA 3TPIZ 2LPRA 1C9PA 6GCHG 2KAIA 2ZWLH 1AGJA 4X8VH 3WW7A 2TIOA 3IITA 1PJPA 3F2GA 3GY4A 4RN6A 1H1BA 2I6QA 1VGCC 1Y8TA 2B9LA 9LPRA 1GJDB 4Z6AH 1O3EA 3OY5U 1QTFA 1MKXH 1TRYA 2NU2E 4DGJA 1SGTA 1HAGE 3PO1C 3MTYA 1MD7A 3ODFA 1PYTC 4LZ4B 1W7XH 3F0PA 2XCFA 4GAWA 4ISNA 4VGCC 5AFZH 3TGJE 3EDXB 4RT1A 2F9PA 1G3EA 3RM2H 2ZHDA 1N6XA 3RDZA 5HKKD 4DIHH 4FUFA 2SNWA 1RTLA 1BTYA 3I78A 1GHWH 1AFQC 1D9IA 5EW1H 3L6PA 1CO7E 2ZIQH 5FX6A 4ISHH 3U98H 2ANWA 3M3VA 2AIPA 1QIXB 1SPJA 2D2DA 1CBWC 1LDTT 2ASUB 1CGJE 2VIOA 1A0LA 1VJ9U 1BA8B 4CBNA 2QYIA 3DCLA 3HATH 1C2LA 1V2QT 4NIXA 3S7HB 1QBNA 4JCNA 4ACBA 5AF9H 1GMDG 1SSXA 1WV7H 1O32A 1GJ9B 3STJA 2W3IA 4FU8A 2XBWA 1ZTKA 3UIRA 2XWBI 5EQRA 3RXFA 1MTNB 1C2EA 1C1VH 4SGAE 4ZHMU 2VWOA 4B2BA 3KQDA 1O3AA 1NFWA 2G51A 5SGAE 2KFWA 2A5IA 1AO5A 1XM1A 3I77A 1DWBH 1UTLM 2ZFSA 1OP2A 2ZTYA 1GJ8B 4TYDA 5C67A 3SZEA 3LH3A 2J9NA 1GHYH 4A5TS 2A4RA 3U8TH 3S9AA 3VB6A 3R3GB 1GHAF 2L6OA 2OTVA 1V2LT 2HVXA 1NFXA 5GPIB 1OX1A 2H9EH 3PV2A 1K1IA 1FY1A 1MZDA 2D1JA 1SGFA 1HDTH 8GCHF 1XUHA 2Q6DA 1YPEH 1V2RT 2BMGB 4BAQB 1V2ST 5JBAS 2BVXH 1A61H 1QRXA 1QGFA 1WOFA 1SOZA 1SKYE 3RXEA 1FDPA 2HRVA 3ATLA 5KECA 2GGVB 1QA7A 1AD8H 1EJAA 2BDHA 2AGIX 4B74A 1H9HE 2FESH 1KDQB 5E8EH 3NKKA 1INCA 1P0SH 1E35B 2ZGCA 3ZZ8A 1YYY1 2QV1A 3B9FH 2ZI2H 3H5CB 1MKXK 3QDZB 1EPTC 2QCYA 1H8DH 1BQYA 1V2NT 1V2TT 3SV6A 3MNSA 1HYLA 3SBKA 1NRPH 4I33A 1IHTH 1K21H 3MH6A 2G55A 1PPCE 1Z8IB 2WPHS 1O5DH 3OU0A 2F3CE 1GHZA 1W13U 2CXVA 1NRRH 2EEKA 2ZFQH 3MU0A 1O2UA 1OKXA 3K2UA 1D3TB 2BB4A 1TOMH 4ZMAH 3CS7A 1C2DA 1ZTJA 2KZ4A 4BTIB 1DDJA 1BJVA 4XRNA 2BXTH 1F0UA 1K1OA 1LPKB 3Q77A 3RXGA 2K0QA 3I29A 1C1TA 1COWD 1C2IA 5FPSA 3SW2B 1LQDB 1TAWA 4MVNA 2A31A 2ZO3H 3MU1A 2PUQH 4F49A 4JYTA 1QNJA 1O5BB 1F7ZA 1GI8B 2H5CA 3FAOA 1Z1JA 2KCYA 2Q6GA 3D49H 1GGDC 2PSYA 1HAZB 4KGAA 1C1PA 1Q31A 2BLOA 4TWYA 3VB7A 3F9HA 4DURA 1YKTA 4ZKNU 3LGWA 3ZVGA 1TE0A 2Z9JA 2V0BA 3A82A 4Q7XA 1O2OA 1TPOA 3HGPA 3GDSA 3TK9A 2Z9IA 3NXPA 2BX4A 4JK5A 1YBWA 4AG1A 4FUCA 4X6PA 1S6LA 1D4PB 1OPHB 1YC0A 2KR7A 1QL9A 1ACBE 3EAJA 2ZTXA 4IMZA 1O36A 1QHRB 1C1QA 3SU4A 4ESTE 4P00A 2VJ1A 1CSOE 4NA9H 3VGCB 4YESB 5GIBA 3R0FA 3P8OA 1PPHE 3PRBA 2BY8X 1QJ6B 3O8DA 1IQIA 1GI5A 1PFXC 2WYJA 1H8HD 1P8VC 2GKVE 3TU7H 4JZ1A 1TOCB 4E7RG 1V2VT 3MH4A 3M37A 1NO9H 1FN6A 1A46H 1RJXB 4UEHH 3RXBA 1HRTH 3RLWH 5C0UA 3IWMA 1QQUA 1TB6H 2BDGA 2FODA 5LPEA 2Y5HA 4TWWA 4CRAA 3GCNA 2J95A 1HXFH 2PWXA 3MU5A 1KXEA 1LQEA 2QF0A 4CH2B 5FHTA 3OE7D 3U1JB 3GCTG 4O97A 4NCYA 2J98A 2BM2A 4ZKOU 2FOEA 3A8DA 3L33A 4X2XA 1ELAA 2FOHA 2ANMH 5JYIA 1SHYA 1DITH 1C1MA 1G3CA 2QF3A 3VFEA 2UWLA 4Q7ZA 1WTGH 1AVWA 1BB0B 1E79D 1L4DA 3A7TA 1T32A 1HAVA 4X1RU 1S84A 1VR1H 3FN8A 2AIQA 3HKIB 3TNTA 4BOHA 4KP0A 5A09A 1J17T 1ESTA 1KXDA 3VXFH 3RXMA 2A5AA 1O3BA 2AMDA 2B5TB 3UOUA 4TSFD 5EGMA 3VEQB 2QN5T 3LIWA 3PLPA 2ZU2A 4LXBH 2PHBA 1IQEA 2F9OA 1C1OA 3GS9A 1BBRH 1JRTA 2BY7X 2FPZA 2ZGHA 5AHGH 4OS6A 3RMMH 3DHKH 1C5NH 4Y7BA 1XX9A 1JIMA 3RU4D 1ZLRA 5DP9A 4MNYA 3W95A 4Q2KA 3BG4B 1C2HA 1O3FA 3BN9A 1Z6JH 4MQAA 3LC5A 1JIRA 1NY22 1EB1H 2GCHF 2CMYA 2G81E 2VNTA 3SUEA 1ZHRA 2ZU5A 1SC8U 2F9UA 2FTLE 2JH0D 1AB9B 1ID5H 1VCPA 1YLCA 7ESTE 3A88A 2W26A 4Y10E 1FIWA 4XBDA 2WV5A 1N1LA 3BTGE 2ZGXH 5FBEA 2VVCA 4F48B 1BOQA 2CV3A 5EODA 4KKDA 1P2QA 3LGIA 2PGBB 4HZHA 3NK8A 5EXMA 2FIRH 1S6FA 4OGXA 2OUAA 1GHBF 1TPAE 1T4UH 4MNXA 5E2PA 1EX3A 1ELBA 2HPQH 4DIIH 2AHME 4FVDA 2FXRA 1JRSA 2EA3A 1C9TA 1UK3A 4X6OA 2OBQA 1GBKA 1BMMH 1AU8A 1SB1H 2L74A 1ELCA 4ABJA 2UUJB 2R9PA 2C93B 5C0TA 3DUXH 4HI3A 1GMHF 4Q80A 5ESBA 1NT1A 1VCQA 4X6MA 3QWCH 1Z8GA 1O2PA 3TLOA 1GI9B 5A0AE 2WSSD 3ATKA 3V12A 3KF2A 3LC3A 2JH6D 1ANBA 1TMTH 3ZZDA 1EASA 1FY4A 1GBHA 1AE5A 3RC6A 1DPOA 3NUMA 1LVBA 1T8NA 3M3TA 1ARBA 3AW0A 3F68H 2GCHG 4U30A 3S69A 1YGCH 2BDCA 2FMJA 2P3FH 1G30B 3E90B 2TPIZ 3PM3A 1C5WB 2WPIS 4PROA 5A2MH 1GI1A 2VVUA 4CBOA 1O39A 2IPQX 1W0KD 4YXWD 1QB1A 5HXFA 1MTNC 1ABJH 1GPZA 1SGDE 1OWDA 5T6DA 1S82A 4Y71A 4XDEA 3KQ5A 1DY8A 3QO6A 3S9BA 1BBRK 1CHOF 2ZPQA 3RXJA 1YWUA 3CP7A 2KCOA 3SOSA 3RXCA 1A4WH 3BTKE 1SQTA 1JWTA 1Y5UT 2P16A 3E8LA 3ZYDA 4AB9A 1W12U 1OYTH 3SU6A 1PQ5A 4YTAA 4GPGA 2ZDVH 3PB1E 5JBTA 4ZROA 1IQLA 1P9SA 1PPZA 5FPTA 1ETTH 1S0QA 2A4QA 3KL6A 1SOTA 4K1SA 4NA8A 2K8IA 1P3EA 2C8WB 3ZVFA 2BD4A 3LJOA 4BAOB 4B76A 1AI8H 4NFEA 2R2WU 2O8UA 3U1IB 1TWXB 3WWFA 1KXBA 1UW7A 2F9NA 2YMSD 3RXIA 1O3GA 5EOKA 1MBMA 1UJ1A 3SJKA 4ZKSU 1AMHA 4K5ZA 4FOUC 1TGNA 4GCHG 1H9LB 1T31A 3VPKA 4MG3A 2ESTE 1PPBH 5LPRA 2JIZD 4JZDH 4Y8XA 3F0OA 1RTFB 3LPRA 1D6WA 1S5SA 4RSPA 2TGPZ 4MNWA 1BDAA 4HFPB 1YCPH 3U8OH 3URDA 4ZHLU 4INKA 1C2GA 3SNEA 4HGCA 4YOIA 4P02A 1O2RA 1NU9A 1V2JT 3LGUA 1TNHA 5CHBA 3T29A 2BQ7B 4I8GA 5C5NA 2OD3B 1GBTA 3SI3H 1Y5AT 1O33A 2G52A 1OWJA 1ZSJA 3F6UH 3LT3A 3A84A 4KTSA 4ABFA 3K65B 1GBMA 2FOMB 4OS7A 1ELVA 2PV9B 1DY9A 3A7ZA 5J4QA 2VVVA 2ZFRH 3NZIA 5GCHF 4ISOA 4FXGH 1ZGIA 3RXDA 2YMSB 1EPTA 1P2MA 3MU8A 2FLRH 2GJGA 1MH0A 1P3CA 4CREA 1LHCH 4WY3A 2AS9A 4IS5A 1SGPE 4X8UH 3GYMA 6ESTA 5DP5A 4AB8A 5FAHA 1C5TA 5T3HA 3ELAH 4IMQA 6GCHF 1O5EH 2STBE 3M5MA 4DG4A 3BTTE 4LZ1H 2V3HH 1EP5A 1XVMA 4I8JA 3T62A 4A1XA 3E0NB 2BLWA 2WPJS 1G2LA 4MNVA 1ZGVA 4I7YH 4AGJA 4Q4LA 1UTMA 1ZHPA 4WXVA 1YM0A 4B6EA 4NWLA 1IQHA 3BIUH 2EI8A 4CRGA 2BTCE 1ELDE 4D7GA 2FTMA 1O3DA 1IOEA 2IPHA 2M2AA 2QC2A 3U8RH 2C8YB 3UNRA 3ITIA 4X6NA 4IGDA 1EKBB 5BPEA 1MTVA 1UCYE 2JJ1D 4GUXA 2BVRH 4ZCNA 2W6ID 4D9RA 3RM0H 5TCCA 2VIPA 2BDYA 1ELFA 5ETXA 1SLUB 3M7TA 1O2JA 1RXPA 1QRWA 1O5AB 3LDXH 4BTUB 3BEFB 1MABB 2UUYA 3E91A 4J1YA 5GCHG 1QBOA 5EU8A 4Y8YA 1E1RD 3VGCC 1SGIB 5DP7A 5H4IB 2ZECA 5JBCS 1HJAB 1GMDF 3TGIE 1Z8RA 3QX5H 2B0FA 1GG6B 3LONA 4CRFA 1L4ZA 1DWDH 4Q63A 2CGAA 2QAAA 3P95A 3FKSD 3P8GA 3RU4T 1W2KH 1TRMA 2GDDA 1ELGA 3GYLB 1Q3XA 2P93A 5A0BA 2FOFA 5HM2A 4XD7D 1YCPK 4A1VA 5F53A 1BMLA 2XC5A 3U69H 1L0ZA 4JZEH 4R0IA 1G9IE 1XXDA 3LGVA 1VKYA 1MU8B 4Z0KA 3UY9A 1NBME 2ZDAH 1KLJH 1TQ0B 1V2OT 3PTNA 1HLTH 2H6MA 2IJD1 4SGBE 5LPFA 1GJBB 4K8YA 5TJXA 1FUJA 3A80A 1WBGB 3UTUH 3MU4A 4UDWH 1HAXB 3RP2A 2BOKA 4XFQA 3GCOA 2AMPA 1K1NA 1A0HB 1TALA 2ZFPH 1C5VA 1O3CA 3GISB 2VIDA 2UUFB 4Y79A 2EC9H 2Z94A 4ZHAA 1Y3VA 3M5OA 1P12E 2GCTB 2Y6TA 5B6OA 1QFKH 1P09A 3BSQA 1P06A 4Y76A 4YLQH 5DPAA 3M7QA 2ZHFH 1LHEH 2ZGJA 1TGCA 3PWCA 4FUJA 1T8MA 2A45B 3PMJA 4MPWA 3SU5A 1Y3WA 1UTOA 5FPYA 1OP8A 3F1SB 2HGTH 4FUIA 1HAYB 4F4OC 1EB2A 3BG4C 4MPUA 3URCA 1ESAA 1CU1A 1DWCH 1MCVA 1RRKA 3F9FA 2O8TA 1TGSZ 4O3TA 3CNRA 2QF5A 3SJIA 1QQ4A 2C8XB 1YLNA 1IQGA 1FY5A 4JMYA 2CF8H 2A7CA 3FP6E 1AVXA 1AB9C 5JPMH 3FANA 1G37A 1FI8A 2OINA 3GCHB 2GZ7A 3ZIAD 3SHCH 1E34B 3UFAA 1SLVB 3N7OA 2BX3A 3SO3A 4I8KA 3FVFB 1ANDA 1K0HA 4JYVH 1UVOA 1TIOA 3P70B 1FX0B 4OGYA 3RXRA 1S0RA 4MPVA 1GCDA 5AFYH 1GBEA 2G5NA 3FZZA 3D23A 2A0QB 1P02A 1IAUA 1OYQA 3F3BA 1IQFA 1UTKA 2ZHWH 1G3BA 3D62A 3QLPH 1TYNA 1BTUA 1W14U 4ASUD 5DG6A 1C1UH 2V3MA 1V2KT 5PTPA 2KCPA 1BMNH 3TJVA 2Z6BD 1HAPH 2OLGA 1NC6A 5HIYA 1OXGA 2PR3A 6LPRA 4AX9H 1G36A 3GY8A 3GICB 3T5FH 8ESTE 1XUKA 3SHAH 2HLDD 3TK5A 4B2CA 3U28C 1BTHH 2IN2A 2J98B 3GOVB 2FS9A 2FX4A 3OEED 2XOKD 5JB8S 5KEDA 3ATWA 2B7DH 5F8ZA 1K2I1 4BXSA 2PKAB 3ZZBA 1JXPA 2VH0A 1TPSA 3DFJA 5E0GA 2R3YA 5TCAA 1MTWA 1GHVH 3RXQA 5FBIA 1D3PB 1GJ6A 2HPPH 2OQ5A 3ZVDA 4E05H 3HPTB 1SGCA 5A8XA 1HJ8A 2NU4E 5HIZA 2A32A 3MH5A 1LMWB 1VITG 1DANH 1J14A 5T6FA 1HAIH 1OSSA 1MUEB 3BTEE 3QK1A 4OS1A 1GWAA 1RS0A 1GMCG 2DE8A 3MNBA 2OK5A 2J2UA 4IBLH 1O2GH 2BD8A 3ZV8A 1JMOH 3HKJB 4R8TB 2HNTC 1DT2A 4INLA 1EOJA 3ZZ3A 1A0JA 4AG2A 5JB9S 2IOTA 1O2YA 5HGGA 1GL0E 3TH2H 2WV4A 2Y7ZA 1SBWA 4IW4E 2ZDMA 1C5SA 1YCPM 4AN7A 1VJAU 4K1TA 5EW2H 1O3IA 1D6RA 1DUAA 3GCTF 1Z6EA 1BCUH 4NZLA 3EA9A 2O8LA 8KME2 4KTUA 5E0HA 4ABDA 1GI2A 1MCTA 1JBUH 3RXLA 3T2NA 2J94A 1W11U 2BXUH 1FZZA 1GL1A 2AEIH 3Q3KA 1GBJA 1SGEE 1EOLA 1O35A 1GBBA 1PYTD 2Z7FE 3EYDA 4O9VA 1HFDA 2EY4C 2VGCB 6CHAB 2RDLA 4ISIH 3K6YA 1YF4A 2A1DB 4GHQA 3GY6A 2XRCA 3ZVCA 2P95A 1TRNA 1C1WH 2BQ6B 2TGTA 1CT4E 1FXYA 2ZQ1A 1P2JA 4ISLA 4AOQA 1SQAA 2SFAA 4X1NU 2A7HA 4Y8ZA 2H9HA 1QRZA 3QUMP 4BAMB 3SNCA 1XUGA 1OS8A 4D8NA 1P2NA 1EZUC 1U6QA 3MWIU 1EATA 5EPNA 3SNDA 1H9IE 1DXWA 1DSTA 1Q2WA 1CA8B 2ZGBH 4K60A 4WH8A 3A83A 2J38A 2PKSB 3DSGA 4J2YB 1BRUP 2YMSC 1KTSB 1TGTA 1AVGH 5C1UA 1KIGH 1SGNE 2QXGA 2G4UA 4INHA 3N7EA 3RC5A 2HNTF 4RT0A 3ZV9A 3A7XA 1ZRKA 2HLCA 1AUTC 3KYFA 2V3OH 1J16A 1F0SA 3M36A 1NRSH 2GT7A 4AYVB 4NWKA 2ZFFH 5I25A 2JDID 1O0DH 4XBCA 5CHAB 2WINI 4WWYA 3Q3YA 5K0HA 1QB6A 3A8CA 4BAKB 3RLYH 2D26C 2ZTZA 1AY6H 1BMAA 1O5CB 2H5DA 1C5UA 1HPGA 3LU9B 4U32A 2CHAB 2GP9B 4GHTA 1L1NA 1ZR0A 2FEQH 2FOCA 1O5FH 2V35A 3SV2H 1QL8A 3S7KB 1O3OA 2AERH 1GI3A 1O3KA 3BIVH 4XOJA 4HG6A 4OS4A 9ESTA 1SGQE 3QTVH 5EXLA 1Y5BT 2PGQB 2P3TB 1NZQH 1UMAH 1AKSA 1QURH 4BXWA 2RCEA 1MTSA 1HJAC 2FP7B 1EFRD 1A1RA 3RMOH 3GDVA 2J92A 4JYUH 4NG9H 2BVSH 1GG6C 2OXSA 4FU7A 1ZOMA 3VB5A 4NGAH 1W10U 3H7TA 2AYWA 3SV9A 1VITH 4WMEA 3H7OA 4ZAEA 5GDSH 3BTHE 1SR5C 3BEIB 1FNIA 1DWEH 1ESBA 3SGBE 2WYGA 4B2AA 5DSFA 3V0XA 4O03A 1TQ7B 1K1JA 1DLKB 2BZ6H 3DSOA 2ZP0H 3EA8A 2NU3E 1W0YH 2ZU1A 5FL7D 4AGKA 1C5MD 2XTTB 2XXLA 1TNJA 3A7WA 4IC5A 5K7RA 1G2MA 1SL3A 3FP7E 5EQSA 2NU0E 4WVPE 3Q00A 2VB0A 2WHXA 4YOGA 4AZ2B 3DT0H 4FETA 1FAXA 5DGJA 3U9AH 1K9OE 1N8OB 4QT8C 1RFNA 1NESE 4THNH 3RXTA 1GI0A 1P05A 4ABBA 1BT7A 2ANKH 3M35A 2ZPSA 4CR5A 1WQVH 1EAXA 4X2WA 1UVPA 1FY8E 1O2LA 1GI7B 1ZYOA 4Y0YE 1VCWA 4GCHF 2GCTC 2ZDLA 3FO8D 2XBVA 2JETB 3N99A 1EZXC 3PMAB 1XVOA 1LPZB 2FLBH 1QB9A 3NPSA 4TT3D 1Z7KA 2JJ2D 1HIAB 5L6NH 1SMFE 1AFEH 1GDNA 2GMTB 1V2PT 3MO9A 1J9CH 1O2HA 4B1TA 2FS8A 1EJMA 3QGJA 1ANEA 1GI6A 1S85A 1C4Y2 3ZZ5A 1WUNH 1CHGA 1MQ5A 4IN2A 2GV7A 4A7IB 3UQVA 2Y7XA 3GY3A 2Y82A 1FLEE 4DJZB 2FX6A 2WUBA 1FQ3A 3OTPA 2BDBA 4NZQA 3WY8A 3AAVA 1A2CH 3ODDA 5E2OA 3SV7A 1BHXF 2BD9A 1LVMA
chains in the Genus database with same CATH topology
1MTUA 1FJSA 3GCHC 3KQEA 1C1RA 3T27A 3MNCA 1BZXE 3SU0A 1BTXA 7GCHG 4AFSA 4E7NA 1TNKA 2C90B 3TGKE 5DK1A 4FUEA 2J34A 2BDAA 1SGYE 3JZ2B 1B7XB 1THPB 3KCGH 1ZJKA 2RA0A 2KAIB 3O8CA 1MAXA 4Y6DA 5L2ZH 4AORA 4KELA 3UNQA 1FMGA 4UD9H 1ZZZA 2ILNA 1ELEE 1NRQH 1YPMH 4DCDA 4H42U 1L2EA 2GT8A 3K6ZA 1SGFG 1SLXB 5FCKA 1E0FD 4B71A 2HWLB 1KSNA 1DS2E 1P11E 1UK4A 4CRDA 2RG3A 2SGEE 3ZZAA 1EAIA 1YPHC 1V2WT 2ZDNA 4XBBA 5DP3A 3LGYA 4K1EA 1MQ6A 3ENSB 5DP6A 1SLWB 1F92A 2BOHB 2QGRA 3K9XB 4ZKRU 3RXOA 1PPFE 1WYKA 1PPEE 3G01A 3ZZ9A 4ASHA 1O30A 2ALPA 3EA7A 3ZVAA 2AH4X 1BRBE 1O5GH 4AYYB 4NA7A 2F9BH 2BY9X 2ODYB 3MO6A 2XW9A 2VWLA 4A92A 1DUEA 2TGAA 5EPYA 5CMXH 2TRMA 2Q6FA 1YPHE 3OX7U 1AZZA 1UVTH 3SU1A 3HGNA 1ZMNA 2BLQA 1D3QB 1KXCA 2VINA 4MTBA 2FI4E 4I32A 3LKWA 1TLDA 2ULLA 2IJOB 5C20A 2BD5A 3MH7A 4A6LA 1TMUH 4ABEA 1TBRH 3SUGA 3M3SA 3W94A 4UONA 1IHSH 1P2IA 2FWWA 2G5VA 4U2WA 2ZF0H 1TBZH 1BRAA 2OCVB 1A5GH 1KY9A 3EQ0H 2ZCHP 3TVJB 1PQ8A 1GVLA 2Z9GA 1JOUB 2ZFTA 2P59A 3PWBA 1NM6A 1FPCH 2PLXA 3ATMA 3PTBA 3ZVBA 2QXHA 3RXUA 3O8BA 5GJ4B 3UR9A 1B0EA 1NRNH 3STIA 2LNCA 3TJUA 1O3PB 2XYAA 1B5GH 2WPMS 3P92A 1FAKH 5FX5A 2SGQE 1MBQA 3PLKA 2C4FH 2OQUA 1BTPA 2ZPRA 3V3MA 1XKBC 5I46H 5BRRE 3F9GA 3SJOA 2EI6A 1GBCA 2VIVA 2CJIA 3F9EA 1CQQA 2A4GA 2VGCC 6CHAC 2ZHQH 4BNRA 4CRCA 1TFXA 4XE4A 2ALVA 1C4U2 1WU1A 4TPIZ 3AW1A 2QY0B 2SNVA 1TX7A 3Q76A 1ORFA 2QA9E 4UFFH 2QIQA 5JBBS 1GJ7B 1BHXB 3KQCA 1BBRE 3E6PH 1MMJN 1SVPA 1IQNA 3A8BA 3DD2H 2STAE 2SGFE 4H4FA 3MI4A 3SQHE 2Y80A 1O2QA 2H1UA 1NPMA 1ZRBA 1IQMA 1CA0B 3SUFA 1O2NA 1P10A 3BG8A 3M5NA 4D7FA 5EXNA 1WCZA 1LTOA 2ZU4A 2ZZUH 3SZNA 1T7CA 1KYNA 5HMAA 2I6SA 2PKSC 4AFQA 2Z9KA 5LGOA 3UQOA 3P17H 3KN2A 1GDUA 3A89A 1XKAC 1KLTA 1EQ9A 1MD8A 4A1TA 3ZYEA 2OC7A 5DP4A 1SI5H 2A2XH 2ZHEH 1NROH 4MLFB 4TPYA 1Y3XA 3UWIA 1XUIA 4UFGH 1A3EH 1CVWH 1XUJA 1KLIH 4WH6A 2BHGA 2VH6A 4K2YA 2FOAA 1KXAA 4DT7B 1C2KA 3B8JA 1GBFA 4OS5A 5CHAC 3SORA 3C1KA 1SFQB 4BAHB 1O34A 2H9TH 1AWFH 4NIVA 5ABWA 1O2SA 1O2MA 2CHAC 1RD3B 2W7UA 3ESTA 4XSKU 4LOYH 1O2VA 3C27B 1A3BH 3MYWA 1TMBH 3S9CA 1TGBA 1LHFH 2C8ZB 1HNEE 2FOBA 2VWNA 1V2MT 1UHBA 5IYTA 2VIWA 1DFPA 2HOBA 3E16B 1O31A 1ZPBA 2M5TA 4YT6H 4FUHA 4YZUA 1G32B 3E0PB 3RXSA 3KNXA 5C1XA 2ZCLP 3EE0B 1A5IA 4E06H 1TNIA 3UUZA 2P94A 2SGDE 3OTJE 1VITF 3QZRA 1FV9A 2ZNKH 1F5LA 1K28D 1GMCF 1OWKA 2Z9LA 2PUXB 2XCNA 2WUCA 7LPRA 1IQKA 3RC4A 4B73A 1ELTA 1LVOA 4YT7H 3OYPA 3RUOA 3A87A 3MMGA 1GBLA 1KTTB 2RA3A 5E0JA 2XC4A 1LCYA 2SGPE 3KHVA 4ABIA 1O2KA 2Z3DA 3MFJA 2AGEX 1PQ7A 1M9UA 1N8OC 2SGAA 1UTQA 1UVUH 3PV4A 2UUKB 3PYHA 1BIOA 1A7SA 1ZPCA 1LHGH 3PMHB 4X1PU 1MU6B 1DLEA 2FO9A 1E36B 2CF9H 1E37B 1O3HA 1QL7A 1GCTB 2NU1E 1HAVB 1MKWH 4MDSA 3RU4E 4UFDH 2YNAA 1O2WA 4ZXXH 3UPEA 2BLVA 3LGTA 1QJ1B 4ZUHA 1SHHB 1K1LA 1GHAG 2JETC 2NWNA 2VWMA 4B75A 4O3UA 1RTKA 3TNSA 3P8NA 1ABIH 3QN7A 4RKJB 2H2ZA 2HALA 2GMTC 8GCHG 1P01A 4FVBA 5FXLA 2YNBA 4U01A 2FI3E 3VXEH 1GJCB 1C2JA 3SN8A 1F2SE 3L3TA 5C2ZA 1P2KA 1HB0B 5IDKA 2R3UA 1THSH 5A8ZA 1C2FA 5HM9A 1EZSC 1UTPA 3KQBA 3VB4A 1GVKB 2XBYA 4CHAB 1B0FA 1X7AC 4Y0ZE 5EG4A 1MZAA 1QJ7B 1Z8JB 1ZTLA 1C5ZB 1AKSB 2YOLA 3FP8E 8LPRA 3OSYA 1NU7B 3PLBA 1HCGA 1TNLA 1LKBA 2HNTE 1A5HA 2G8TA 1S81A 4M7GA 2AFQB 2BYAX 1RIWB 1H8IH 1LO6A 2AMQA 2TGDA 4Q7YA 2BZAA 2THFB 3RXKA 3NWUA 1N6YA 4BTTB 4GLYA 2WPLS 3MO3A 2VIQA 3M61U 2R2MB 3NCLA 2P8OB 2DUCA 1FIZA 1D3DB 3UWJH 4DVAU 1WQSA 1EP6A 1EAUA 2FYQA 2GVFA 1TA6A 1SFIA 1DE7H 1GJ5H 4GSOA 3S0NA 1C5YB 1H4WA 4X8TH 1KDQA 3TJNA 2BDIA 4K69A 3D65E 3UOPA 1O3LA 3Q3XA 1C5QA 1C5PA 2O8WA 1L1JA 1NS3A 1VGCB 1ZSLA 1O2TA 2G4TA 1S6HA 4ABAA 4WF8A 5GXPA 1SQOA 3SU3A 1TPPA 2ZC9H 4BANB 2ZKSA 1CGHA 4JZFH 1MKWK 3PO1B 2BY5X 4FUBA 1L1GA 4X1QU 4TY6A 3RXVA 3TJOA 2DE9A 1XMNB 2QXIA 1TNGA 4VGCB 1BTWA 2OC0A 7KMEH 1UCYH 2FYRA 5C3NA 1O2ZA 3HK6B 1K22H 1UTJA 5A0CA 1AHTH 1K1PA 3ZZ7A 3ZZCA 1ZMLA 1ZSKA 1AWHB 1HAOH 1AFQB 1ETRH 1PQAA 1CE5A 3TK6A 1W8BH 3ATIA 1RGQA 1C5LH 4I8HA 1EUFA 2PKAA 1UVSH 4UFEH 2GX4A 1BJUA 1TBQH 4HTCH 1CBWB 1NFYA 1F5KU 3A8AA 3QGNB 1P03A 1C2MA 1VZQH 3BTDE 4X2YA 1EJNA 3RMNH 4GVUA 4NFFA 1P2OA 3KIDU 1W3CA 5DP8A 1DXPA 1V6DA 5LH8A 1AN1E 3UR6A 3P6ZB 2FM2A 3SI4H 2P3UB 2ODPA 1AQ7A 2ZG0H 1GHXH 4FUDA 3SJ9A 3M7UA 1LHDH 2JKHA 1QY6A 3DA9B 4NIYA 2BQWB 4WJG2 2OC8A 1EZQA 2BD7A 4X1SU 3GY7A 1C1SA 1TONA 1ZHMA 3ZVEA 4DW2U 4H6TA 3AVZA 3GY2A 4FUGA 2FDAA 3SNBA 4YO9A 3RMLH 4AFUA 1UK2A 3HK3B 1F0TA 1Z1IA 3GDUA 1YPLH 1Y3YA 3P8FA 4CH8B 3BV9B 3M5LA 2V6NA 2W5EA 1O37A 2GV6A 5F03A 4TY7A 5G4BA 1CA0C 1UO6A 4IC6A 2K1QA 3BF6H 2Z3CA 4JK6A 4NIWA 5ESTE 2FZZA 3BTME 2OC1A 1C5OH 2PTCE 1FPHH 2O9QA 1T8OA 2G00A 1LKAA 1ARCA 2UWPA 3SGAE 3B23B 2UWOA 1EPTB 2WPKS 4UE7H 7GCHF 3LH1A 5AVDA 1Y59T 3TIUA 1YPKH 1O38A 1THRH 2Z3EA 5A8YA 1GI4A 3A7VA 3RXAA 4Y11E 2VU8E 1UCYK 4CRBA 3TH4H 1FONA 3BTFE 1MAYA 2AGGX 3SUDA 3BTWE 2GDEH 3A81A 2GZ9A 3IG6B 2GD4B 2ANYA 1J8AA 4X0WU 5EQQA 5T6GA 2GTBA 1XXFA 1LVYA 3A86A 2PW8H 1GVZA 2ZQ2A 1IQJA 1DICA 1XUFA 5DO4H 1YPGH 3SJ8A 4WMDA 4DY7B 4YLUA 1QCPA 4D9QA 4ABHA 3JZ1B 2XWAA 1GJAB 1CT2E 3RXHA 3A7YA 3E1XB 3KGPA 2O8MA 4FU9A 2Q1JA 1BITA 2F83A 2ZDKA 4AFZA 3DFLA 3SGQE 3LJJA 1TABE 3FZDA 5F8XA 2ZA5A 1ANCA 1GHBG 1AZ8A 2FI5E 2OP9A 3V7TA 2GZ8A 2OBOA 5L2YH 3QTOH 1DSUA 1S83A 1O3MA 2Y5FA 1GGDB 5JDUB 1O3NA 1NFUA 2ODQA 1V3XA 3FFGA 1GMHG 1V2UT 3AAUA 1QA0A 2FOGA 1OOKB 1ZMJA 1DOJA 1Z71A 2W3KA 2BD2A 4NSYA 3VB3A 3SNAA 4I8LA 2W7SA 2JH5D 4H6SB 2B8OH 1HUTH 2F9VA 5GWZA 1GDQA 1DVAH 1O3JA 1NN6A 1WTHD 1HV7A 3RXPA 2ZEBA 2F91A 5C1YA 1W7GH 3T26A 1TX6A 3GY5A 1ZJDA 4K8BA 1O2XA 1C5RA 1OP0A 1W0ZU 1GBDA 1HJ9A 4I31A 5DJ7A 1YPJH 1KXFA 3LOXA 1YP9A 2PFEA 1WAYB 1PPGE 1CGIE 1FN8A 1OWHA 3UNSA 1F0RA 3QZQA 1QR3E 2TBSA 1CHOG 2A5KA 1GCTC 2R0LA 4ZH8A 3KEEA 5J4SA 2ZCKP 4ABGA 1HBTH 1G3DA 2A4OA 1FY3A 1C1NA 3T25A 2QXJA 3A85A 5DKMA 4WXIA 3BEUA 5C5OA 1GBAA 4JZIA 2A2QH 4X8SH 4LK4A 2Y5GA 3UREA 2Y81A 1DX5M 2BD3A 3BTQE 1C4V2 1GJ4H 1UTNA 3PMBB 1BUIA 1GBIA 3SV8A 3O8RA 1HGTH 3MHWU 2PTNA 1QBVH 2EI7A 3TITA 3OY6U 1P9UA 4MPXA 1J15A 1TA2A 1AIXH 1OWIA 1T8LA 3MNXA 1OWEA 2R0KA 1CT0E 4CHAC 1LPGB 2J4IA 4Y7AA 3SU2A 1P04A 2CN0H 1P57B 1EXFA 1Y3UA 3E3TA 1UHBB 4IN1A 4WMFA 1HIAA 1C5XB 1NTPA 1DM4B 1AE8H 3ZZ4A 1AUJA 3T28A 1O2IA 2XBXA 1EAWA 2BY6X 3SQEE 1HXEH 4YM9A 4RKOB 1BRCE 1TX8A 3PROA 4NSVA 2XC0A 4D76A 4CR9A 1RIWC 4OS2A 1T4VH 1YLDA 4KTCA 2C3SA 3EGKH 4K3JA 3CENA 2PSXA 4ZXYH 3TH3H 3ZZ6A 5L30H 3AASA 4YOJA 2P8OC 3CS0A 5FCRA 1K1MA 1SG8B 5HYOA 1BTZA 3V13A 1HAHH 4X2VA 1ETSH 5CE1A 1F5RA 1E38B 4DOQA 5F6MA 1ZPZA 3MOCA 1SGRE 2D8WA 1WSSH 2ZU3A 2XNIA 5F8TA 2A7JA 3TPIZ 2LPRA 1C9PA 6GCHG 2KAIA 2ZWLH 1AGJA 4X8VH 2TIOA 3IITA 1PJPA 4RN6A 3GY4A 1H1BA 2I6QA 1VGCC 1Y8TA 2B9LA 9LPRA 1GJDB 4Z6AH 1O3EA 3OY5U 1QTFA 1MKXH 1TRYA 2NU2E 4DGJA 1SGTA 1HAGE 3PO1C 3MTYA 1MD7A 3ODFA 1PYTC 4LZ4B 1W7XH 2XCFA 4GAWA 4ISNA 4VGCC 5AFZH 3TGJE 3EDXB 2F9PA 1G3EA 3RM2H 2ZHDA 1N6XA 3RDZA 4DIHH 4FUFA 2SNWA 1RTLA 1BTYA 3I78A 1GHWH 1AFQC 1D9IA 5EW1H 3L6PA 1CO7E 2ZIQH 5FX6A 4ISHH 3U98H 2ANWA 3M3VA 2AIPA 1QIXB 1SPJA 2D2DA 1CBWC 1LDTT 2ASUB 1CGJE 2VIOA 1A0LA 1VJ9U 1BA8B 4CBNA 2QYIA 3HATH 1C2LA 1V2QT 4NIXA 3S7HB 1QBNA 4JCNA 5AF9H 1GMDG 1SSXA 1WV7H 1O32A 1GJ9B 3STJA 2W3IA 4FU8A 2XBWA 1ZTKA 3UIRA 2XWBI 5EQRA 3RXFA 1MTNB 1C2EA 1C1VH 4SGAE 4ZHMU 2VWOA 4B2BA 3KQDA 1O3AA 1NFWA 2G51A 5SGAE 2A5IA 1AO5A 1XM1A 3I77A 1DWBH 1UTLM 2ZFSA 1OP2A 2ZTYA 1GJ8B 4TYDA 5C67A 3LH3A 2J9NA 1GHYH 4A5TS 2A4RA 3U8TH 3S9AA 3VB6A 3R3GB 1GHAF 2OTVA 1V2LT 2HVXA 1NFXA 5GPIB 1OX1A 2H9EH 1K1IA 1FY1A 1MZDA 2D1JA 1SGFA 1HDTH 8GCHF 1XUHA 2Q6DA 1YPEH 1V2RT 2BMGB 4BAQB 1V2ST 5JBAS 2BVXH 1A61H 1QRXA 1QGFA 1WOFA 1SOZA 3RXEA 1FDPA 2HRVA 3ATLA 2GGVB 1QA7A 1AD8H 1EJAA 2BDHA 2AGIX 4B74A 1H9HE 2FESH 1KDQB 5E8EH 3NKKA 1INCA 1P0SH 1E35B 2ZGCA 3ZZ8A 1YYY1 2QV1A 3B9FH 2ZI2H 3H5CB 1MKXK 3QDZB 1EPTC 2QCYA 1H8DH 1BQYA 1V2NT 1V2TT 3SV6A 3MNSA 1HYLA 3SBKA 1NRPH 4I33A 1IHTH 1K21H 3MH6A 2G55A 1PPCE 1Z8IB 2WPHS 1O5DH 3OU0A 2F3CE 1GHZA 1W13U 2CXVA 1NRRH 2EEKA 2ZFQH 3MU0A 1O2UA 1OKXA 3K2UA 1D3TB 2BB4A 1TOMH 4ZMAH