2BDCA

Porcine pancreatic elastase complexed with asn-pro-ile at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA01
2ZFRH 4BAHB 1SQAA 1O2NA 1NRQH 2JETB 5GCHF 2VU8E 1IQHA 1O2RA 1WSSH 3O8RA 4GCHG 4FU7A 1SG8B 1OWIA 1TX6A 3BTTE 3PM3A 4JZEH 4E7NA 3T5FH 3PV4A 1DDJA 1CHOG 2DE9A 1QURH 3GOVB 3QWCH 1C9PA 1FMGA 3RLYH 3TJUA 5HYOA 1BMAA 2QXHA 5HMAA 5DO4H 1HAIH 1PQ5A 2Z9KA 1UTLM 5A0AE 1HAPH 4IS5A 2CMYA 4NA8A 4WH6A 1LQEA 2C93B 3RXUA 3SNEA 1ETTH 3TH3H 1O2ZA 1GI8B 4Q2KA 4NWKA 1QA0A 2HOBA 2C8XB 3JZ1B 1Z8IB 3MMGA 3GY8A 3GCTG 1P03A 5T6GA 1CBWC 3TNSA 3A80A 1SFIA 4Q7YA 3OU0A 2VWNA 1W12U 1RTKA 3RU4E 3ZVEA 1HAVB 1V3XA 1ZSJA 2A7JA 4IGDA 1C1VH 2SFAA 2XC0A 1DUAA 3UUZA 4Q7XA 3TJNA 1WV7H 1V2PT 1LHGH 1V2TT 3GICB 4NZLA 4MPUA 3RXIA 1Z8RA 2ZPQA 3BG4B 3MO9A 1FIWA 3GCNA 3FP7E 1ELAA 4DJZB 2DE8A 5LGOA 3URDA 4MQAA 1OSSA 1QB6A 2GZ7A 5EPYA 1EPTC 1MBQA 1P2JA 2TGAA 5FX5A 1YM0A 2PUQH 1A3BH 3TJOA 3UNQA 1B0EA 2D8WA 4WMEA 2RA0A 1MTUA 1BITA 1EZXC 1P04A 2FESH 1QNJA 2ZDLA 1J17T 4AG2A 4MPXA 1TONA 1IOEA 4AORA 5HM2A 2GMTB 4MPVA 4FU9A 2P93A 4FUDA 1HAZB 3EYDA 3L3TA 2PWXA 2UUFB 2C3SA 5J4SA 1AB9B 4NIYA 4CBNA 5E2PA 4K1EA 7GCHF 5A2MH 1Q31A 3SUEA 4ZXYH 1EJAA 2W7SA 1C5MD 4IN2A 1EJNA 5DP7A 2ALVA 1AFQC 4JYVH 3QTOH 4CRBA 2NU2E 5F8XA 2CHAB 2Y82A 1Y5UT 1TBRH 4DGJA 3PLPA 2ZQ2A 2P16A 2AIPA 3O8BA 3LT3A 2WV4A 1HXFH 2BD4A 3A87A 4DIHH 1O2UA 1NM6A 2WPLS 1KXDA 2WPHS 2XYAA 4A1TA 5DPAA 2ZHEH 1Y3UA 1ZOMA 2PSXA 1PJPA 3P8NA 3M7TA 5SGAE 1G3EA 2GV6A 3TITA 2AMDA 4XDEA 2XBYA 1YGCH 2G4TA 1A1RA 1EB2A 4CH8B 9ESTA 4IMZA 1FY1A 1S81A 1GHAG 3W94A 1V2OT 4KKDA 3LGIA 4K8BA 1HJAB 2BD3A 1TMUH 7GCHG 4XBBA 1A0HB 2B8OH 2XWBI 2R2MB 1SGYE 3E6PH 1SQTA 1TNLA 4ZKRU 1C5NH 1QR3E 1O3IA 2AGIX 1KIGH 3SJOA 3P70B 3ZYEA 2ZECA 2TRMA 3E3TA 2WPIS 1TWXB 4AX9H 1E34B 1V2KT 2YNAA 3MYWA 1RIWC 4I8GA 1DXWA 1FY5A 5JDUB 1NRSH 3V3MA 1AQ7A 1Y3YA 1GHBF 2PKAB 4O97A 7KMEH 1O5CB 1PQAA 5L30H 3KNXA 1TNGA 2C4FH 3BTKE 1Y3XA 1FY8E 2FP7B 2HGTH 2F9VA 5E0GA 4ESTE 2GDEH 4X1PU 2FOAA 1NU7B 2AMQA 1GL1A 1A0JA 1P2QA 1ZZZA 2A32A 2ESTE 1NFXA 3VFEA 3QK1A 4AYVB 4TPIZ 1HAOH 4K5ZA 4JYUH 1W7GH 2Q6FA 3RXFA 3Q77A 1O3EA 1Z7KA 2NU3E 1OP2A 1QA7A 1IQNA 4X1SU 1THRH 3PMJA 1Z8GA 2GCTC 2XRCA 5HM9A 1V2LT 3PO1B 2WYGA 3TPIZ 3V12A 1C1UH 1SGEE 3QZRA 4ABIA 2IJOB 1ANBA 1DVAH 4E7RG 3S0NA 1QL7A 1BT7A 4I32A 1V2RT 1K28D 6LPRA 3SV6A 1NN6A 1OP0A 1TPOA 3LPRA 1OX1A 3I29A 2JKHA 1ELDE 1O2YA 4FXGH 2PV9B 5GJ4B 1SLVB 3RXTA 1TQ7B 1TBQH 2VVUA 3UR6A 2ZF0H 1SLWB 3KQDA 1MCVA 2VGCC 4ZHAA 2PLXA 2QC2A 3RXGA 4DT7B 1TQ0B 1N6XA 4LZ4B 4GUXA 1EPTA 3F9FA 4XSKU 1AZ8A 4ZH8A 1J14A 4ZHLU 3T29A 1ELGA 2H6MA 4SGBE 1G3CA 1SSXA 1GI9B 1P06A 1C5QA 1P3CA 1SGTA 4XE4A 5EQSA 9LPRA 4YZUA 1W10U 1O2QA 8GCHF 4MDSA 5DP6A 1LKAA 3KIDU 1T32A 2RCEA 1P2NA 5EU8A 1C5PA 1TGCA 1K9OE 4UONA 1GBCA 7LPRA 2G8TA 1FI8A 5JYIA 2NU0E 3M7QA 1SGDE 1KDQB 2Z9IA 4UFDH 1GL0E 1SGRE 2FYQA 2YOLA 3RM0H 1EXFA 1C5UA 1NT1A 1YC0A 1K1OA 4OS2A 5A8YA 3S9BA 4NIWA 4NSYA 1L0ZA 5F03A 1SOTA 4ISHH 3PMHB 4ZKOU 2EI8A 2OC1A 4WY3A 5FAHA 4U2WA 1CBWB 3AASA 1THPB 2SGAA 1UVPA 2R2WU 3ITIA 2FI3E 1CA8B 1P2MA 1O38A 1FY3A 1DWCH 4X0WU 2BQWB 1RRKA 2XWAA 4Y8YA 1CVWH 1SR5C 1UVTH 1SL3A 4IMQA 3S9AA 1V2UT 1TIOA 1EZSC 2ZFPH 1BZXE 4Y6DA 2PTNA 1QBNA 5DJ7A 1DPOA 1XVOA 1YPJH 3R3GB 4XBDA 5F8TA 2TGDA 4ISOA 3ATKA 3S9CA 1EPTB 3F9GA 4J2YB 3NPSA 5I25A 3MO3A 2ANWA 1GGDC 3UQOA 2A4GA 4X8TH 4X2XA 3RXEA 1QQ4A 4VGCB 5LPRA 1F5KU 2A45B 4I8JA 2P59A 1HCGA 1O2VA 1O30A 1TX8A 3FAOA 2VVVA 1GJ9B 2A2XH 1AKSA 1OWDA 3ZZ9A 1AN1E 3RUOA 4GPGA 5PTPA 2O8WA 1UMAH 3W95A 4B76A 1O5BB 5GIBA 1O31A 2ZTYA 3MI4A 4OS5A 2NU4E 1P8VC 4YOJA 2H9EH 1AVXA 1DM4B 2QXJA 2HLCA 3HATH 2XBXA 2THFB 5EW2H 2OC8A 1O3PB 1PPCE 1UHBB 2P3TB 7ESTE 4AG1A 2O8UA 4Z0KA 3SU2A 3MHWU 3SJKA 1O3JA 1W14U 1OWJA 1D6WA 1O3MA 4GLYA 1LVBA 2AH4X 4ZUHA 4THNH 5E8EH 3C1KA 3MH5A 1O2XA 5DGJA 3BEFB 1C2DA 3QGJA 1EOJA 1FJSA 1OPHB 3KGPA 4H42U 2H2ZA 1GI6A 1GI3A 2AYWA 1F5RA 4A6LA 1F2SE 1VCWA 1XVMA 1O33A 3TIUA 4INLA 5EGMA 1TOCB 4UFEH 1DXPA 1CT2E 5FHTA 1C2GA 1TNHA 5BPEA 2QY0B 2PKSC 1GDQA 1EQ9A 2ODQA 1GJ5H 1DWBH 1P0SH 1C1WH 3O8DA 3RXOA 1EZQA 4FUBA 2BVSH 1IQFA 3MU1A 4JMYA 2NU1E 4BAKB 1SI5H 3D65E 1TNIA 1BQYA 1OWEA 2GTBA 4YT6H 1JXPA 2EEKA 3UTUH 1DLKB 3A84A 2OLGA 4K1SA 4X1NU 4UFFH 1SVPA 4AYYB 1SFQB 5C5NA 4BAMB 1FPHH 3LC3A 3RXAA 4Y7BA 1ELEE 4PROA 5CMXH 3SORA 5EPNA 1LQDB 3PLKA 3A8BA 2FX6A 2WV5A 1C5TA 3OSYA 3E8LA 1MAXA 3VEQB 2PFEA 1DITH 1UO6A 3ATLA 1UK4A 4NG9H 3UREA 1O2IA 1O32A 3SV9A 3U1JB 1TX7A 4AFQA 2ZP0H 4NZQA 5DP3A 1O3KA 3RXBA 1SPJA 1Y3WA 5GPIB 6GCHG 2A5AA 3U69H 5C2ZA 1GJ7B 1O37A 2Z94A 2FX4A 2TPIZ 2Y7XA 1Z6JH 1ZRKA 4RKJB 3KF2A 3VXEH 2W3KA 3CENA 4NFFA 1C1TA 1QJ1B 4Y71A 3HKIB 3SJ9A 4UD9H 2BZAA 2GCTB 2V3HH 3FP6E 2VJ1A 1NPMA 1RTLA 4I33A 2VVCA 1HAGE 1HLTH 3STIA 1YCPM 2LNCA 1O5GH 5EXMA 2BVRH 1QGFA 4CRFA 4D8NA 2ZCKP 4A1XA 1S85A 5GXPA 1SOZA 5E0HA 3ZV8A 4X6PA 1YYY1 2ZHDA 1VITG 3LGTA 1O3AA 2ZCHP 3SUFA 4Z6AH 1C5XB 3URCA 1QIXB 3SBKA 5EXNA 5DKMA 1GDUA 3TGIE 3SZNA 3NWUA 3E91A 4U01A 3ZYDA 3BV9B 5AVDA 3TU7H 1ELTA 2BHGA 4ABGA 3S7HB 4DCDA 1YKTA 4Q80A 3DFJA 2FI5E 4BANB 2VGCB 1D3QB 1D9IA 1UTQA 3QO6A 3ZZ7A 2HPPH 3S7KB 1NESE 2F9OA 4DVAU 1C2FA 1GHXH 4FU8A 4K60A 5F8ZA 2AS9A 1P11E 1BTXA 4A1VA 1G37A 3OY6U 2ZPSA 2HWLB 3SNDA 4KELA 2J4IA 3RXVA 5DP8A 3QZQA 4WF8A 1IHTH 1UVOA 4ZROA 1DOJA 4F49A 1EAUA 1HAYB 1SC8U 1GHYH 1A5GH 3WY8A 1FUJA 1O3DA 3VPKA 3SJ8A 1E37B 1P02A 3UOUA 4A7IB 2JH5D 1MQ5A 1S6FA 1O2PA 1PFXC 1PPEE 5EQQA 1BTPA 3HKJB 2J38A 2VIWA 5GWZA 2XCNA 3ODDA 4LZ1H 3K6YA 2PTCE 2A31A 2Z7FE 4BXSA 1G30B 3SUGA 3LJOA 3MH4A 1SGPE 1RFNA 1BHXF 1KXFA 1GMDF 2BXTH 5A0CA 3B8JA 3UNRA 1ANDA 4ABAA 2QF0A 4KTSA 5GCHG 3SHCH 4JZDH 1KXAA 1O2OA 1J16A 4YESB 1EAWA 2GCHF 4WJG2 2EI7A 1O3GA 4X1RU 1S5SA 4I7YH 3SV7A 2OC7A 5C3NA 1TBZH 5E0JA 2P8OB 2UWOA 1C5VA 4KGAA 3UWJH 5JPMH 1QFKH 1P09A 2ZEBA 1IQKA 4ZHMU 1NU9A 4B2CA 1W7XH 1V2VT 3ZZCA 2FYRA 1P9UA 1OS8A 1UCYE 2G00A 1Z8JB 4VGCC 5FBIA 3TNTA 4BTTB 1W8BH 3A85A 1W0ZU 3M35A 1AIXH 1GCDA 1GGDB 3V7TA 3QGNB 5FCKA 1T8LA 1XMNB 1XUKA 5T6FA 2P95A 1E0FD 5EW1H 1QRXA 4FVBA 1NY22 1NS3A 4UDWH 5I46H 1MMJN 4JZIA 1LKBA 3KL6A 4KTCA 4OS4A 1P2OA 1UTKA 3ESTA 4X2WA 2GZ8A 5JBCS 1ZR0A 1FIZA 2ZFFH 1QBVH 2PKAA 2TGPZ 2AIQA 3M3SA 4NWLA 3IG6B 4OS6A 4O3TA 3ZZ5A 4MG3A 1MKWK 2P3UB 2YNBA 1N1LA 1P9SA 3BIVH 3MU8A 3UQVA 2BDBA 1TA6A 2O9QA 2W3IA 2H1UA 5FCRA 1RXPA 1Y8TA 1FONA 2FPZA 2ZIQH 3MO6A 1A5HA 2XXLA 3UPEA 3LGWA 2O8LA 3BTHE 4IN1A 4A92A 4UFGH 1VR1H 1CQQA 4HTCH 1F0SA 1E36B 2FOGA 1W11U 1TLDA 2ZWLH 3C27B 1CT0E 1ZTJA 4JCNA 1BTHH 2BY8X 1GJ4H 1BMNH 1TE0A 2A0QB 1ZPZA 1ZJKA 1FAKH 2FIRH 2ZU3A 1G36A 3SGAE 1VCPA 1KSNA 5A8ZA 1AVWA 3NXPA 2ZQ1A 1S6HA 1W2KH 3RXMA 4IC6A 1D4PB 1K1PA 1FAXA 1G3BA 3FFGA 3U8OH 1H8DH 2QYIA 2PKSB 1SGNE 2ZA5A 4E06H 2ZG0H 2VWLA 1T4UH 1UTPA 4Y76A 1F0RA 1OKXA 2XC4A 2Y5FA 2B9LA 2VIOA 5JB9S 1XKBC 4MNXA 4ZKNU 1C2LA 1ZRBA 1EP6A 1EZUC 1GBMA 3HPTB 1GVLA 1GHVH 5HXFA 1QL8A 2LPRA 1Q3XA 4LOYH 5ESBA 3SU3A 1MZDA 3SNCA 1CU1A 1L1GA 1AMHA 2G81E 3K6ZA 4X6MA 3E90B 2F83A 1O2LA 2BZ6H 3V13A 1LHEH 1HXEH 1ZLRA 2F9UA 3BN9A 1LHFH 2B7DH 4TPYA 3Q00A 1ARCA 1PPFE 1ID5H 1A5IA 1XUFA 1EP5A 3PMAB 4ZXXH 1DT2A 1O3LA 1C1RA 4K8YA 1TB6H 3MWIU 2SNVA 3VB7A 1GBFA 1LPKB 1SLUB 2IPHA 1K1MA 1KDQA 2H5CA 8LPRA 3KHVA 4XFQA 2VWOA 4HGCA 2J9NA 1G2MA 4Y8ZA 1DX5M 4B71A 3SUDA 5JBTA 5JB8S 3AVZA 1GBHA 1IQLA 1ZSKA 3M3TA 3A7VA 2ZGHA 3FP8E 3ZVBA 1GVZA 3ATIA 1C2KA 1QB9A 1ZHPA 1BBRE 1DLEA 1F0UA 2M5TA 3GDVA 1ELVA 1G2LA 3FANA 3VB4A 2V6NA 2ZO3H 2QF3A 2VIQA 1TPSA 1CGJE 2AMPA 4BTIB 2GGVB 1GHBG 4B74A 2P3FH 1TGNA 2BLOA 1N8OC 2VWMA 1H9LB 4FUIA 1UTMA 3M5OA 1ZSLA 3F1SB 3IWMA 4GAWA 1HDTH 1O2HA 2XC5A 3ZZDA 1P01A 2D26C 2FOFA 1RJXB 4X6OA 1AVGH 3PYHA 3KCGH 1C5SA 1GI1A 3SGBE 3ZVDA 3BEIB 3U1IB 2OINA 1DSUA 3A7YA 3TVJB 2RA3A 1KXEA 2ZU2A 1MU6B 5IDKA 5CHAB 1HYLA 2R9PA 1NC6A 2ZNKH 1V2NT 3NK8A 2BY6X 3PTBA 1T8OA 3P92A 4Q7ZA 3STJA 3PB1E 3QN7A 1CT4E 2F9PA 1OYQA 3SV2H 4WVPE 2GP9B 3E0NB 1DSTA 2STBE 2BD2A 3GY4A 1ARBA 1FDPA 3GY6A 2TBSA 5AHGH 3ZZ8A 5T3HA 3NZIA 3D62A 4NGAH 1WU1A 2ZDNA 4HFPB 1FNIA 4DURA 4DG4A 1TA2A 1DY9A 3E1XB 3T28A 5HGGA 3SW2B 1BTWA 2FOHA 2R0KA 1UHBA 1V6DA 1AE5A 3MNXA 1NFWA 4ZAEA 1DWDH 3BTGE 1T8NA 1BOQA 1T8MA 2A2QH 3Q3KA 1PQ8A 1TOMH 3D23A 2J34A 2ZKSA 1GBDA 1GG6B 3GDSA 3M5NA 1L1NA 3BTME 4OS7A 3P8OA 1ZYOA 5TCCA 1D3DB 2QXGA 4GVUA 1FLEE 2PHBA 1FQ3A 8GCHG 3OX7U 3U8RH 1BTZA 2B5TB 2G55A 3LH3A 3V0XA 1PPGE 2HNTC 3HK6B 4K2YA 1CHGA 4GHTA 2FI4E 1H1BA 2P8OC 1O36A 1TGTA 3RMLH 1MCTA 2FTMA 3RMNH 3EQ0H 2OC0A 1EASA 1NTPA 4B73A 1Z1JA 1GI7B 1YPLH 1ABJH 2ANYA 3SV8A 3M5LA 1KY9A 3MNCA 4FUCA 1H4WA 1GJAB 1EAXA 2Q6DA 2BDCA 5C5OA 2ILNA 1JWTA 5FPTA 3BSQA 2V35A 2BDYA 3MNSA 1MU8B 4FUFA 1AWHB 1QRZA 3H7TA 1SGFG 1J8AA 4ABDA 3AAUA 3KQBA 1JMOH 3BTQE 1Y5BT 1CGIE 4ABEA 2ULLA 5IYTA 2GDDA 3SGQE 3UY9A 1C2JA 1NRRH 1D3TB 1SLXB 4WWYA 1TRYA 1YP9A 1YPGH 1UVUH 4GSOA 3RDZA 1TMTH 2FS8A 1K1LA 5FXLA 5DP9A 1P57B 2ANKH 2VINA 3EA7A 2QA9E 1LPZB 2BYAX 5L2YH 1HPGA 2GZ9A 2XBVA 1XX9A 1AZZA 3RXHA 2Z9LA 3GY3A 2ZCLP 3GCOA 2Y80A 1GMHF 3EA8A 5F6MA 1AD8H 1XUIA 2G51A 5E2OA 1IQGA 3M7UA 1BUIA 1MH0A 2GX4A 1RD3B 1SMFE 1TGBA 2G5VA 2R3YA 1DICA 3BF6H 2FO9A 4Y0ZE 1WYKA 4U30A 2BXUH 2EA3A 2ZFTA 1C1MA 1O5FH 4INKA 3MU5A 5JBBS 3GCHB 1HNEE 2SNWA 4JK5A 2GT7A 2VIVA 3PMBB 1QJ7B 5H4IB 1ZHRA 1K1JA 4ZMAH 3A89A 2FODA 3RM2H 4BAOB 1RTFB 1F92A 4WH8A 1XKAC 1VCQA 1KLIH 3UIRA 2FZZA 3RXDA 3SN8A 3LDXH 1NRNH 1C2MA 2BX4A 3L33A 1HBTH 1J9CH 5FPSA 1TALA 3QUMP 1EB1H 1Y59T 2ZHFH 4WXIA 5C1XA 1O3CA 3UR9A 3K9XB 1LTOA 2I6QA 5DG6A 3F9EA 1SGQE 3LGUA 1A4WH 1O3BA 4R0IA 1TPAE 2QGRA 1EUFA 3BTWE 3GY5A 3ZVGA 1LPGB 3A7XA 3LC5A 1PPZA 1HAXB 1XUHA 3M3VA 6ESTA 4O3UA 5FBEA 3MTYA 4M7GA 2Y81A 1UCYK 1WQSA 1DUEA 2O8MA 1CO7E 3QLPH 1EJMA 3TK6A 2STAE 2PW8H 1THSH 2A4QA 2D2DA 2ZTXA 2F91A 4FVDA 1MKWH 3ZV9A 1LVOA 2BOKA 4CHAC 4MNYA 3I77A 1E38B 1TFXA 1C1SA 4ASHA 1GMCF 1WOFA 1O0DH 2BLVA 2AEIH 1C5LH 4F4OC 4O03A 1GBIA 5B6OA 5EG4A 2BQ7B 4MPWA 4OGXA 4OGYA 4YLQH 3DA9B 5AFZH 1BRCE 1PYTD 2J94A 3GDUA 1IAUA 1O35A 1QRWA 1C4U2 2BLWA 1SQOA 1BB0B 5LPFA 1T4VH 3P8GA 2CXVA 3TH4H 1A0LA 2A7CA 2CN0H 1KTSB 3R0FA 4YTAA 4K69A 1UTJA 2V3OH 1HV7A 2H9HA 1ZPBA 1N8OB 2UWLA 4ZKSU 2UUYA 1G9IE 5A0BA 2C8WB 2QCYA 2WPKS 4GCHF 2TIOA 1ACBE 2OTVA 1OWHA 1YCPK 2SGFE 3P6ZB 1SHHB 3TLOA 1CHOF 2K1QA 4LXBH 1GJ8B 1GWAA 4ABBA 4NIVA 5CHAC 2Q1JA 2V0BA 4X2YA 1EAIA 4YOGA 3PLBA 2FXRA 4TWYA 3AAVA 1HRTH 4AN7A 1V2QT 1AO5A 2TGTA 1WAYB 1M9UA 1ZMNA 1XXFA 4INHA 3B9FH 5FPYA 2WPJS 1GHZA 2FOMB 2ZDVH 4WMFA 1TRNA 4NA7A 3GCTF 4KTUA 1MBMA 1O3OA 2FM2A 1BA8B 4LK4A 3P95A 3JZ2B 4AZ2B 1L2EA 3CP7A 5AFYH 2EI6A 1V2ST 1G3DA 4NFEA 2XCFA 3M61U 4NA9H 1K1NA 2GD4B 1LO6A 2Z9GA 1C1PA 2C8YB 5JBAS 1W0YH 1IQJA 1MUEB 2G5NA 3ZZ3A 1GG6C 2Z3EA 3HGPA 1QTFA 3I78A 1K2I1 2UUKB 2W5EA 1L4ZA 1S82A 3KEEA 4AB9A 3K2UA 1J15A 1Z6EA 1ZMJA 4Y10E 4BNRA 4K3JA 2ZDAH 2FTLE 5TCAA 1Y3VA 2FWWA 1PQ7A 2QV1A 2ZDKA 3M36A 1D3PB 5C1UA 1BMLA 5ABWA 3LGVA 4J1YA 3ENSB 5TJXA 1ESBA 4IW4E 2ZU4A 3TK9A 1GBAA 1KLTA 3D49H 1SB1H 3RU4D 1JOUB 2VIDA 3DFLA 3UOPA 1NFYA 2HNTE 1AFEH 1BBRK 3P17H 1KXBA 1C5WB 2XTTB 4Y7AA 2BDAA 1QQUA 2BDGA 2Z3CA 2ZFSA 3U98H 1FY4A 1GBTA 4X8UH 1QBOA 3IITA 3SHAH 1C2HA 2FOEA 1MQ6A 1GJBB 4CRDA 4BXWA 3F68H 1GJ6A 1GMDG 4ISLA 5EXLA 4FUHA 4I8HA 4OS1A 3SI4H 2J2UA 3EAJA 3SQHE 1AGJA 4AFUA 2HRVA 1KLJH 1VGCC 2XW9A 2GCHG 3RC4A 1O2SA 1P10A 1MD8A 2A1DB 3EDXB 1B0FA 5A8XA 1GHAF 2OBQA 1O3HA 1YPHC 1MKXK 2ZC9H 2ZPRA 4GHQA 1UJ1A 3SJIA 1BHXB 1VJ9U 1BRUP 1T7CA 4B1TA 4ABJA 4NSVA 2BB4A 2BM2A 1O5EH 2OXSA 1YLDA 3N7OA 2WYJA 1O5DH 3K65B 1C5ZB 4DW2U 3QX5H 3HK3B 4Y0YE 5EODA 4BTUB 4H6SB 4MNWA 2WUCA 4FUJA 2PR3A 2Z3DA 5C20A 1SGIB 1AU8A 3RXPA 1GJDB 3MNBA 1UK3A 1BCUH 1BIOA 4UE7H 4D7GA 1PPHE 2A5IA 2HALA 3GCHC 2F3CE 1TYNA 3UFAA 1FPCH 2WINI 3QDZB 4Y79A 2ZZUH 1ETRH 1O2KA 1EKBB 2SGEE 1WCZA 1RGQA 4H4FA 1O2MA 1FN8A 2RDLA 4TY7A 1HGTH 3SU0A 3A86A 2Y5HA 2CF8H 1XUGA 1DFPA 1Z1IA 3O8CA 2J95A 3ZVAA 1BJUA 2R3UA 2ZGBH 1AUJA 3T27A 1KTTB 2NWNA 3VGCC 1TNJA 4MTBA 1NRPH 3A81A 3LJJA 1YPKH 3PTNA 1DE7H 1HUTH 4IBLH 2A5KA 1ELCA 2W7UA 1A2CH 2ZFQH 3BTFE 3RXSA 1GBLA 2AERH 2AGGX 4RSPA 1O34A 1IHSH 1SGCA 4D76A 1LDTT 1DWEH 1P2KA 4AGKA 3TGJE 4I8KA 3T2NA 1OP8A 1TGSZ 1TAWA 3T26A 1PYTC 3DUXH 5DK1A 4SGAE 1ABIH 5GDSH 1ZGIA 2Z6BD 1GCTB 5FX6A 4E05H 1ELBA 1JBUH 4JK6A 3SU1A 4AB8A 2GT8A 1EATA 4DIIH 6CHAC 1AHTH 1GI5A 3H5CB 1ELFA 4CHAB 5LH8A 4MNVA 4O9VA 2I6SA 2SGPE 5ESTE 3LOXA 1V2MT 1ZTKA 4JZFH 1HFDA 4R8TB 3Q3XA 4AFSA 5J4QA 1C1QA 1B7XB 4YLUA 3RP2A 1AE8H 2BY9X 1GBKA 2CGAA 1ESAA 4JYTA 3TK5A 2WUBA 1ORFA 3A8DA 3ELAH 2H9TH 1HB0B 3GY7A 3ATMA 1VITH 2OCVB 1FXYA 3OTJE 4DY7B 1C4Y2 1MTNB 2ANMH 4CRAA 2CJIA 2FOCA 3TGKE 4H6TA 3PWCA 4YOIA 4X2VA 5A09A 4ABFA 1CA0C 4RKOB 2B0FA 1VZQH 3GYMA 1FV9A 1UTNA 3H7OA 1K21H 1S84A 2KAIA 1CE5A 4YM9A 1A7SA 1HJ9A 1XUJA 1W13U 4FUGA 4XOJA 3RXLA 3FZZA 1SBWA 2W26A 4JZ1A 3U8TH 1GDNA 2QXIA 2AGEX 3A7WA 1UTOA 4BOHA 2XNIA 2BD7A 2JETC 1P05A 1WTHD 1O2JA 2BDHA 5C67A 3UNSA 4WXVA 1NROH 2BQ6B 2FLBH 4I8LA 1JIRA 4KP0A 3RXKA 3DHKH 3ZZ4A 5DP4A 4RN6A 1S83A 1SHYA 5K7RA 2OBOA 3ATWA 3E16B 1F0TA 1H8IH 2GV7A 1UK2A 1MAYA 2PGBB 2G4UA 2J92A 1SGFA 1QJ6B 2A4OA 1LCYA 4AOQA 5DP5A 2ZU5A 1DS2E 1UCYH 2VH6A 4CRGA 1O39A 1OWKA 2IN2A 1BTUA 3DT0H 1A61H 3A82A 1GHWH 1BJVA 5ETXA 1ZGVA 2O8TA 2BVXH 3LONA 3QTVH 8KME2 1QY6A 1WTGH 1C4V2 3TH2H 2ZHQH 3EGKH 1YF4A 2QN5T 1O2GH 2ZHWH 1P12E 2BD5A 4IC5A 2VIPA 1W3CA 1YPEH 2ODYB 2BX3A 5C1YA 4ISNA 3BTDE 1OOKB 1KYNA 3BG4C 1XM1A 3F9HA 3SU4A 1TNKA 3VB3A 1EOLA 2JH0D 3TJVA 2XBWA 3VXFH 3HGNA 1MTVA 1C1NA 1TABE 3AW0A 4FUEA 1JIMA 2KAIB 2SGQE 2Y5GA 3T25A 1YCPH 1AY6H 3SQEE 1P3EA 1ESTA 2ZDMA 1UVSH 1IQEA 1BRBE 1A46H 4D9RA 4CH2B 2A7HA 1YPMH 3M5MA 1C9TA 4Y8XA 1G32B 1QHRB 3NUMA 1NFUA 2C8ZB 3LIWA 3SI3H 2F9BH 1WQVH 2GMTC 1B5GH 3T62A 3Q76A 2FEQH 3OYPA 1C5RA 5LPEA 2BTCE 1TPPA 1IQIA 3EA9A 1HAHH 2VH0A 1L1JA 1VGCB 3P8FA 3VB5A 1AB9C 3LKWA 4X1QU 1LVYA 3NKKA 4K1TA 4CR9A 1H9IE 3A7TA 1BDAA 4MLFB 2C90B 4NIXA 2BY7X 3A88A 2FLRH 3SO3A 1NO9H 1F5LA 2EC9H 2CHAC 3DD2H 1A3EH 1LVMA 4XBCA 2R0LA 2FOBA 2ZGXH 2IOTA 3ZZ6A 4CRCA 1V2WT 2BLQA 2AFQB 1GI2A 3A8CA 3RMMH 4YT7H 1AFQB 2ZI2H 1OXGA 2Y6TA 1BRAA 1ZHMA 1HIAA 1LMWB 3MU4A 1C5YB 4AGJA 2P94A 1YPHE 4B2AA 1DY8A 8ESTE 5L2ZH 2DUCA 4HI3A 3RMOH 3F6UH 1O2WA 1VJAU 2QAAA 1K22H 2ZTZA 4A5TS 5K0HA 1C1OA 1L4DA 2BD9A 2PSYA 1Q2WA 3GISB 3UWIA 1GVKB 1MTWA 3GY2A 3SNAA 1FZZA 1ZPCA 1S0QA 5T6DA 1WUNH 2OP9A 4Y11E 1ZJDA 2PGQB 4X8VH 4DOQA 2JH6D 3ODFA 1AWFH 3KQEA 5EQRA 3OY5U 5BRRE 4D9QA 3CS0A 3ZZBA 1GJCB 1EX3A 1T31A 3NCLA 4B75A 3AW1A 1HJAC 4AFZA 2D1JA 2HPQH 1H9HE 1FN6A 2FDAA 2QIQA 1LHCH 4TWWA 3MU0A 3L6PA 4TYDA 1XXDA 6GCHF 3E0PB 4BAQB 1GBBA 1JRTA 3RXQA 3MFJA 3FVFB 3MH6A 1GMHG 1NZQH 3VGCB 1U6QA 2Y7ZA 1N6YA 1P2IA 2UUJB 3BIUH 1MD7A 1ZTLA 2FS9A 1BBRH 2Z9JA 2HVXA 1ZMLA 3Q3YA 1D6RA 4CBOA 2BY5X 3BEUA 5CE1A 4QT8C 4HZHA 3FZDA 1QB1A 3GYLB 1INCA 2VB0A 1Z71A 3CS7A 3A7ZA 1HJ8A 1AKSB 5AF9H 4YO9A 2BOHB 3M37A 1K1IA 5G4BA 3ZZAA 3RXRA 2ALPA 4ISIH 1QCPA 1GCTC 1RIWB 4MVNA 1CGHA 1LHDH 1GBJA 1O3FA 1VITF 1GBEA 1V2JT 2UWPA 4TY6A 2Q6GA 2F9NA 3U9AH 1Y5AT 2SGDE 3RC6A 4U32A 2GKVE 2ZU1A 2OD3B 1HIAB 2ZGCA 1PPBH 1AUTC 4X6NA 6CHAB 1MKXH 1JRSA 1KXCA 3ZVCA 2A4RA 2VNTA 5EOKA 3A83A 2ZGJA 1C5OH 3G01A 3LH1A 3PO1C 2OQ5A 1ETSH 1O2TA 3RC5A 1S0RA 3LGYA 1F7ZA 3EE0B 3MH7A 3PWBA 1DANH 2ASUB 2BD8A 2RG3A 3BTEE 3RU4T 1WBGB 4ABHA 4I31A 2BDIA 4WMDA 1X7AC 1QL9A 3MOCA 3SNBA 1MTNC 2ODPA 2G52A 2OUAA 3KQCA 2BMGB 1YBWA 1C2IA 4D7FA 3BG8A 2CV3A 4CR5A 3RXCA 4B2BA 2FMJA 1GPZA 1HAVA 1MZAA 1TMBH 3SU5A 4X8SH 1MTSA 3A8AA 2H5DA 1GI0A 1RS0A 3SU6A 1ANCA 1O5AB 3VB6A 1BMMH 1AI8H 5L6NH 1IQMA 1ANEA 2PUXB 3KN2A 3PROA 1CA0B 1GI4A 3B23B 1TRMA 3ZVFA 2HNTF 1GMCG 1E35B 2CF9H 4NCYA 1OYTH 3SOSA 1YLCA 4UEHH 3RLWH 2GVFA 1O3NA 1BTYA 2WPMS 1CSOE 2OQUA 3S69A 1C2EA 4CREA 3LU9B 3RXJA
chains in the Genus database with same CATH superfamily
2ZFRH 4BAHB 1SQAA 1O2NA 1NRQH 2JETB 2RFKC 5GCHF 2VU8E 1IQHA 1O2RA 1WSSH 2KCYA 3O8RA 5C17A 4GCHG 4FU7A 1SG8B 1OWIA 1TX6A 3BTTE 3PM3A 4JZEH 4E7NA 3T5FH 3PV4A 1DDJA 1CHOG 2DE9A 1QURH 3GOVB 4OM9A 3QWCH 1C9PA 1FMGA 3RLYH 3TJUA 5HYOA 1BMAA 2QXHA 5HMAA 5DO4H 1HAIH 1PQ5A 2Z9KA 1UTLM 5A0AE 1HAPH 4IS5A 2CMYA 4NA8A 4WH6A 1LQEA 2C93B 3RXUA 3SNEA 1ETTH 1S6LA 4ACAA 3TH3H 1O2ZA 1GI8B 4Q2KA 4NWKA 1QA0A 2HOBA 2C8XB 3JZ1B 1Z8IB 3MMGA 3GY8A 3GCTG 1P03A 5T6GA 1CBWC 4HG6A 3A80A 3TNSA 1SFIA 4Q7YA 3OU0A 2VWNA 1W12U 1RTKA 3RU4E 3ZVEA 1HAVB 1V3XA 1ZSJA 2A7JA 4IGDA 1C1VH 2SFAA 2XC0A 1DUAA 3UUZA 4Q7XA 3TJNA 1WV7H 1V2PT 1LHGH 1V2TT 3GICB 3OEHD 4MPUA 4NZLA 3RXIA 1Z8RA 2ZPQA 3BG4B 3MO9A 1FIWA 1UW7A 3GCNA 3FP7E 1ELAA 4DJZB 2DE8A 5LGOA 3URDA 4MQAA 1OSSA 1QB6A 2GZ7A 3UB0A 5EPYA 1EPTC 1MBQA 1P2JA 2TGAA 5FX5A 1YM0A 2PUQH 1A3BH 3TJOA 3UNQA 1B0EA 2D8WA 4WMEA 2RA0A 5F53A 1MTUA 1BITA 1EZXC 1P04A 2FESH 1QNJA 2WSSD 1J17T 2ZDLA 4AG2A 4MPXA 1TONA 1IOEA 4AORA 5HM2A 2GMTB 4MPVA 4FU9A 2P93A 4FUDA 1HAZB 3EYDA 1OHHD 3L3TA 2PWXA 2UUFB 2C3SA 5J4SA 1AB9B 4NIYA 4CBNA 5E2PA 4K1EA 7GCHF 5A2MH 1Q31A 3SUEA 4ZXYH 1EJAA 2W7SA 1C5MD 4IN2A 1EJNA 5DP7A 2ALVA 1AFQC 4JYVH 3QTOH 4CRBA 2NU2E 5F8XA 2CHAB 2Y82A 1Y5UT 1TBRH 4DGJA 3PLPA 2ZQ2A 2P16A 2AIPA 3O8BA 3LT3A 2WV4A 5C0UA 1HXFH 2BD4A 3A87A 4DIHH 1SQRA 1O2UA 1NM6A 2WPLS 1KXDA 2WPHS 2XYAA 4A1TA 5DPAA 2ZHEH 4Q4LA 1Y3UA 1ZOMA 2PSXA 1PJPA 2WPDD 3P8NA 3M7TA 5SGAE 1G3EA 2GV6A 3TITA 2AMDA 4XDEA 2XBYA 1YGCH 4ACBA 2G4TA 1A1RA 1EB2A 4CH8B 9ESTA 4IMZA 1FY1A 1S81A 1GHAG 3W94A 1V2OT 4KKDA 3LGIA 4K8BA 1HJAB 2BD3A 1TMUH 7GCHG 4XBBA 2LELA 1A0HB 2B8OH 2XWBI 2R2MB 1SGYE 5EJZA 3E6PH 1SQTA 1TNLA 4ZKRU 1C5NH 1QR3E 1O3IA 2AGIX 1KIGH 3SJOA 3P70B 3ZYEA 2ZECA 2TRMA 3E3TA 2WPIS 1TWXB 4AX9H 1E34B 1V2KT 2YNAA 3MYWA 1VKYA 1RIWC 4I8GA 1DXWA 1FY5A 5JDUB 1NRSH 3V3MA 1AQ7A 4I86A 1Y3YA 1GHBF 2PKAB 4O97A 7KMEH 1O5CB 1PQAA 5L30H 3KNXA 1TNGA 2C4FH 3BTKE 1Y3XA 1FY8E 2FP7B 2HGTH 2F9VA 5E0GA 4ESTE 2GDEH 4X1PU 2FOAA 1NU7B 2AMQA 1GL1A 1A0JA 1P2QA 1ZZZA 2A32A 2ESTE 1NFXA 3VFEA 3QK1A 1E1QD 4AYVB 4TPIZ 1HAOH 4K5ZA 4JYUH 1W7GH 2Q6FA 4RI0A 3RXFA 3Q77A 1O3EA 1Z7KA 2NU3E 1OP2A 1QA7A 1IQNA 4X1SU 1THRH 3PMJA 1Z8GA 2GCTC 2XRCA 5IK2D 5HM9A 1V2LT 1COWD 3PO1B 2WYGA 3TPIZ 3V12A 1C1UH 1SGEE 3QZRA 4ABIA 5HKKD 2IJOB 1ANBA 1DVAH 4E7RG 3S0NA 1QL7A 1BT7A 4I32A 1V2RT 1K28D 6LPRA 3SV6A 1NN6A 1OP0A 1TPOA 3LPRA 1OX1A 3I29A 2JKHA 2EQNA 1ELDE 1O2YA 4FXGH 3CNRA 2PV9B 5GJ4B 5CDFE 1SLVB 3RXTA 1TQ7B 1TBQH 2VVUA 3UR6A 3WWFA 2ZF0H 1SLWB 3KQDA 1MCVA 2VGCC 4ZHAA 2PLXA 2QC2A 3RXGA 4DT7B 1TQ0B 1N6XA 4LZ4B 4GUXA 1EPTA 3F9FA 4XSKU 1AZ8A 4ZH8A 1J14A 4ZHLU 3T29A 1ELGA 2H6MA 4SGBE 1G3CA 1SSXA 1GI9B 1P06A 1C5QA 1P3CA 1SGTA 4XE4A 5EQSA 9LPRA 4YZUA 1W10U 1O2QA 8GCHF 4MDSA 5DP6A 1LKAA 3KIDU 1T32A 2RCEA 1P2NA 5EU8A 1C5PA 1TGCA 1K9OE 4UONA 1GBCA 7LPRA 2G8TA 1FI8A 5HIYA 5JYIA 2NU0E 3M7QA 1SGDE 1KDQB 2Z9IA 4UFDH 1GL0E 1SGRE 2FYQA 2YOLA 3RM0H 1EXFA 1C5UA 1NT1A 1YC0A 1K1OA 4OS2A 5A8YA 3S9BA 4NIWA 4NSYA 5KGOA 1L0ZA 5F03A 1SOTA 3MQKC 4ISHH 3PMHB 4ZKOU 2EI8A 2OC1A 4WY3A 5FAHA 4U2WA 1CBWB 3AASA 1THPB 2SGAA 3U28C 1UVPA 2R2WU 3ITIA 2FI3E 1CA8B 1P2MA 1O38A 1FY3A 1DWCH 4X0WU 2BQWB 1RRKA 2XWAA 4Y8YA 1CVWH 1SR5C 1UVTH 1SL3A 4IMQA 3S9AA 1V2UT 1TIOA 1EZSC 2ZFPH 1BZXE 4Y6DA 2LP6A 2PTNA 1QBNA 5DJ7A 1DPOA 1XVOA 1YPJH 3R3GB 4XBDA 5F8TA 2TGDA 4ISOA 3ATKA 3S9CA 1EPTB 3F9GA 4J2YB 3NPSA 5I25A 3MO3A 2ANWA 1GGDC 4FOUC 3UQOA 2A4GA 4X8TH 4X2XA 3RXEA 1QQ4A 4VGCB 5LPRA 1F5KU 2A45B 4I8JA 2P59A 1HCGA 1O2VA 1O30A 1TX8A 3FAOA 2VVVA 1GJ9B 2A2XH 1AKSA 1OWDA 3ZZ9A 1AN1E 3RUOA 5C0TA 4GPGA 5PTPA 2O8WA 2KZ4A 1UMAH 3W95A 4B76A 1O5BB 5GIBA 1O31A 2ZTYA 3MI4A 4OS5A 2NU4E 1P8VC 4YOJA 2H9EH 1AVXA 1DM4B 2QXJA 2HLCA 3HATH 2XBXA 2THFB 5EW2H 2OC8A 1O3PB 1PPCE 3W1EA 1UHBB 2P3TB 7ESTE 4AG1A 2O8UA 4Z0KA 3SU2A 3MHWU 3SJKA 1O3JA 1W14U 2W6JD 1OWJA 1D6WA 1O3MA 3F2HA 1LVBA 2AH4X 4GLYA 4ZUHA 4THNH 5E8EH 3C1KA 3MH5A 1O2XA 5DGJA 3BEFB 1C2DA 3QGJA 1EOJA 1FJSA 1OPHB 3KGPA 4H42U 2H2ZA 3DSOA 1GI6A 1GI3A 2AYWA 1F5RA 4A6LA 1F2SE 1VCWA 1XVMA 1O33A 3TIUA 4INLA 5EGMA 1TOCB 4UFEH 1DXPA 1CT2E 5FHTA 3FKSD 1C2GA 1TNHA 5BPEA 2K8IA 2QY0B 2PKSC 1GDQA 1EQ9A 2ODQA 1GJ5H 1DWBH 1P0SH 1C1WH 3O8DA 3RXOA 1EZQA 4FUBA 2BVSH 1IQFA 3MU1A 4JMYA 2NU1E 4BAKB 1SI5H 3D65E 1TNIA 1BQYA 1OWEA 2GTBA 4YT6H 1JXPA 2EEKA 3UTUH 1DLKB 3A84A 2OLGA 4K1SA 4X1NU 4TT3D 4UFFH 1SVPA 4AYYB 1SFQB 5C5NA 4BAMB 1FPHH 3LC3A 3RXAA 4Y7BA 1ELEE 4PROA 5CMXH 3SORA 5EPNA 1LQDB 3PLKA 3A8BA 2FX6A 2WV5A 1C5TA 2JDID 3OSYA 3E8LA 1MAXA 3VEQB 2PFEA 1DITH 1UO6A 3ATLA 1UK4A 4NG9H 3UREA 1O2IA 1O32A 3SV9A 3SYJA 3U1JB 1TX7A 4AFQA 2ZP0H 4NZQA 5DP3A 1O3KA 3RXBA 1SPJA 1Y3WA 5GPIB 6GCHG 2A5AA 3U69H 5C2ZA 1GJ7B 1O37A 2Z94A 2FX4A 2TPIZ 2Y7XA 1Z6JH 1ZRKA 4RKJB 3KF2A 3VXEH 2W3KA 3CENA 4NFFA 1C1TA 1QJ1B 4Y71A 3HKIB 3SJ9A 4UD9H 2BZAA 2GCTB 2V3HH 3FP6E 2VJ1A 1NPMA 1RTLA 4I33A 2VVCA 1HAGE 1HLTH 3STIA 2KFWA 1YCPM 2LNCA 1O5GH 5EXMA 2BVRH 1QGFA 4CRFA 4D8NA 2ZCKP 4A1XA 1S85A 5GXPA 1SOZA 5E0HA 3ZV8A 4X6PA 1YYY1 2ZHDA 1VITG 3LGTA 1O3AA 2JJ2D 2ZCHP 3SUFA 4Z6AH 1C5XB 3URCA 1QIXB 3SBKA 5EXNA 5DKMA 1GDUA 3TGIE 3SZNA 2V3MA 3NWUA 3E91A 4U01A 3ZYDA 3BV9B 5AVDA 3TU7H 1ELTA 2BHGA 4ABGA 3S7HB 4DCDA 1YKTA 4Q80A 3DFJA 2FI5E 4BANB 2VGCB 1D3QB 1D9IA 1UTQA 3QO6A 3ZZ7A 2KCPA 2HPPH 3S7KB 1NESE 2F9OA 4DVAU 1C2FA 1GHXH 4FU8A 4K60A 5F8ZA 2AS9A 1P11E 1BTXA 4A1VA 1G37A 3OY6U 2ZPSA 2HWLB 3SNDA 4KELA 2J4IA 3RXVA 5DP8A 3QZQA 4WF8A 1IHTH 1UVOA 4ZROA 1DOJA 4F49A 1EAUA 1HAYB 1SC8U 1GHYH 1A5GH 3WY8A 1FUJA 1O3DA 3VPKA 3WW7A 3F2GA 3SJ8A 1E37B 1P02A 3UOUA 4A7IB 2JH5D 1MQ5A 3DSGA 1S6FA 1O2PA 1PFXC 1PPEE 5EQQA 1BTPA 3HKJB 2J38A 2VIWA 5GWZA 2XCNA 3ODDA 4LZ1H 3K6YA 2PTCE 2A31A 2Z7FE 4BXSA 1G30B 3SUGA 3LJOA 3MH4A 1SGPE 1RFNA 1BHXF 1KXFA 1GMDF 2BXTH 5A0CA 3B8JA 3UNRA 1ANDA 4ABAA 2QF0A 4KTSA 5HIZA 5GCHG 3SHCH 4JZDH 1KXAA 1O2OA 1J16A 4YESB 1EAWA 2GCHF 4WJG2 2EI7A 1O3GA 4X1RU 1S5SA 4I7YH 3SV7A 2OC7A 5GNDA 5C3NA 1TBZH 5E0JA 2P8OB 2JJ1D 2UWOA 1C5VA 2IJD1 4KGAA 3UWJH 5JPMH 1QFKH 1P09A 2ZEBA 1IQKA 4ZHMU 1NU9A 4B2CA 1W7XH 1V2VT 3ZZCA 2FYRA 1P9UA 1OS8A 1UCYE 2G00A 1Z8JB 4VGCC 5FBIA 3TNTA 4Q63A 4BTTB 1W8BH 3A85A 1W0ZU 3M35A 1AIXH 1GCDA 1GGDB 1QZ8A 3QGNB 3V7TA 5FCKA 1T8LA 1XMNB 1XUKA 5T6FA 2P95A 2PP6A 1E0FD 5EW1H 1QRXA 4FVBA 1NY22 1NS3A 4UDWH 5I46H 1MMJN 4JZIA 1LKBA 3KL6A 2YMSD 4KTCA 4OS4A 1P2OA 1UTKA 3ESTA 4X2WA 2GZ8A 5JBCS 1ZR0A 1FIZA 2ZFFH 1QBVH 2PKAA 2TGPZ 2AIQA 3M3SA 4NWLA 3IG6B 4OS6A 4O3TA 3ZZ5A 4MG3A 1MKWK 2P3UB 2YNBA 3EE7A 3NRLA 4TSFD 1N1LA 1P9SA 3BIVH 3MU8A 3UQVA 2BDBA 1TA6A 2O9QA 2W3IA 2H1UA 5FCRA 1RXPA 1Y8TA 1FONA 2FPZA 2ZIQH 3FO8D 3MO6A 1A5HA 2XXLA 3UPEA 3LGWA 2O8LA 3BTHE 4IN1A 4A92A 4UFGH 1VR1H 1CQQA 4HTCH 1F0SA 1E36B 2FOGA 1W11U 1TLDA 2ZWLH 3C27B 1CT0E 1ZTJA 4JCNA 1BTHH 2BY8X 1GJ4H 1BMNH 1TE0A 2A0QB 1ZPZA 1ZJKA 1FAKH 2FIRH 2ZU3A 1G36A 3SGAE 1VCPA 1KSNA 5A8ZA 1AVWA 3NXPA 2ZQ1A 1S6HA 1W2KH 3RXMA 4IC6A 1D4PB 1K1PA 1FAXA 1G3BA 3FFGA 3U8OH 1H8DH 2QYIA 2PKSB 1SGNE 3F2FA 2ZA5A 3PRBA 3OE7D 4E06H 2ZG0H 2VWLA 1T4UH 2QE7D 1UTPA 4Y76A 1F0RA 1OKXA 2XC4A 2Y5FA 2B9LA 2VIOA 5JB9S 1XKBC 4MNXA 4ZKNU 2QF5A 1C2LA 1ZRBA 1EP6A 1EZUC 1GBMA 2M2AA 1GVLA 1GHVH 3HPTB 5HXFA 1QL8A 2LPRA 1Q3XA 4LOYH 5ESBA 3SU3A 1MZDA 2CK3D 3SNCA 1CU1A 1L1GA 1AMHA 2G81E 3K6ZA 4X6MA 3E90B 2F83A 1O2LA 2BZ6H 3V13A 1LHEH 1HXEH 2AHME 1ZLRA 2F9UA 3BN9A 1LHFH 2B7DH 4TPYA 3Q00A 1ARCA 1PPFE 1ID5H 1A5IA 1XUFA 1EP5A 3PMAB 4ZXXH 1DT2A 1O3LA 1C1RA 4K8YA 1TB6H 3MWIU 2SNVA 3VB7A 1GBFA 1LPKB 1SLUB 2IPHA 1K1MA 1KDQA 2H5CA 8LPRA 3KHVA 4XFQA 2VWOA 4HGCA 2J9NA 1G2MA 4Y8ZA 1DX5M 4B71A 3SUDA 5JBTA 5JB8S 3AVZA 1GBHA 1IQLA 1ZSKA 1EFRD 3M3TA 3A7VA 2ZGHA 3FP8E 3ZVBA 1GVZA 3ATIA 1C2KA 1QB9A 1ZHPA 2F43B 1BBRE 1DLEA 1F0UA 2M5TA 3GDVA 1ELVA 1G2LA 3FANA 3VB4A 2V6NA 2ZO3H 2QF3A 2VIQA 1TPSA 1CGJE 2AMPA 3H09A 4BTIB 2GGVB 1SKYE 1GHBG 4B74A 2P3FH 1TGNA 2BLOA 1N8OC 2VWMA 1H9LB 4FUIA 1UTMA 5EJLA 3M5OA 1ZSLA 3F1SB 3IWMA 4GAWA 1HDTH 1O2HA 2XC5A 3ZZDA 1P01A 2D26C 2FOFA 1RJXB 4X6OA 1AVGH 3PYHA 3KCGH 1C5SA 1GI1A 3SGBE 3ZVDA 3F3BA 3BEIB 3U1IB 2OINA 1DSUA 3A7YA 3TVJB 2RA3A 1KXEA 2XNDD 2W6ID 2ZU2A 1MU6B 5IDKA 5CHAB 1HYLA 2R9PA 1NC6A 2ZNKH 1V2NT 4XD7D 3NK8A 2BY6X 3PTBA 1T8OA 3P92A 4Q7ZA 3STJA 3PB1E 3QN7A 3FOAA 1CT4E 2F9PA 1OYQA 3SV2H 4WVPE 2GP9B 3E0NB 1DSTA 2WHXA 2STBE 2BD2A 3GY4A 1ARBA 1FDPA 3GY6A 2TBSA 5AHGH 3ZZ8A 5T3HA 3NZIA 3D62A 4NGAH 1WU1A 1NBMD 2ZDNA 4HFPB 1FNIA 4DURA 4DG4A 1TA2A 1DY9A 3E1XB 3T28A 5HGGA 3SW2B 1BTWA 2FOHA 2R0KA 1UHBA 1V6DA 1AE5A 3MNXA 1NFWA 4ZAEA 1DWDH 2V7QD 5B6LA 3BTGE 1T8NA 1BOQA 1T8MA 2A2QH 3Q3KA 1PQ8A 1TOMH 3D23A 2J34A 2ZKSA 1GBDA 1GG6B 3GDSA 3M5NA 1L1NA 3BTME 4OS7A 3P8OA 1ZYOA 3DSPA 5TCCA 1D3DB 2QXGA 4GVUA 1FLEE 2PHBA 1FQ3A 5EJ1A 8GCHG 3OX7U 3U8RH 1BTZA 2B5TB 2G55A 3LH3A 3V0XA 1PPGE 2HNTC 3HK6B 4K2YA 1CHGA 4GHTA 2FI4E 1H1BA 2P8OC 1O36A 1TGTA 3RMLH 1MCTA 2FTMA 3PRDA 3RMNH 3EQ0H 2YMSC 2OC0A 1EASA 1NTPA 4B73A 1Z1JA 1GI7B 1YPLH 1ABJH 2ANYA 3SV8A 3M5LA 1KY9A 3MNCA 4FUCA 1H4WA 5CHBA 1GJAB 1EAXA 3SZEA 2Q6DA 2BDCA 5C5OA 2ILNA 1JWTA 5FPTA 3BSQA 2V35A 2BDYA 5KECA 3MNSA 1MU8B 4FUFA 1AWHB 1QRZA 3H7TA 1SGFG 1J8AA 4ABDA 3AAUA 3KQBA 1JMOH 3BTQE 1Y5BT 1CGIE 4ABEA 2ULLA 5IYTA 3OFND 2GDDA 3SGQE 3UY9A 1C2JA 1NRRH 1D3TB 1SLXB 4WWYA 2KX4A 1TRYA 1YP9A 1YPGH 1UVUH 4GSOA 3RDZA 1TMTH 2FS8A 1K1LA 5FXLA 5DP9A 1P57B 2ANKH 2VINA 3EA7A 2QA9E 1LPZB 2BYAX 3FN8A 4FETA 5L2YH 1HPGA 2GZ9A 2XBVA 1XX9A 1AZZA 3RXHA 2Z9LA 3GY3A 2ZCLP 3GCOA 2Y80A 1GMHF 3EA8A 5F6MA 1AD8H 1XUIA 2G51A 5E2OA 1IQGA 3M7UA 1BUIA 1MH0A 2GX4A 1RD3B 1SMFE 1TGBA 2G5VA 2R3YA 1DICA 3BF6H 2FO9A 4Y0ZE 1WYKA 4U30A 2BXUH 2EA3A 2ZFTA 1C1MA 1O5FH 4INKA 3MU5A 5JBBS 3GCHB 1HNEE 2SNWA 4JK5A 2GT7A 2VIVA 3PMBB 1QJ7B 5H4IB 1ZHRA 1K1JA 4ZMAH 3A89A 2FODA 2F4LA 3RM2H 4BAOB 1RTFB 1F92A 4WH8A 1XKAC 1VCQA 1KLIH 3UIRA 2FZZA 3RXDA 3SN8A 3LDXH 1NRNH 1C2MA 2BX4A 3L33A 1HBTH 1J9CH 5FPSA 1TALA 3QUMP 1EB1H 1Y59T 2ZHFH 4WXIA 5C1XA 1O3CA 3UR9A 3K9XB 1LTOA 2I6QA 5KEDA 5DG6A 3F9EA 3PV5A 1SGQE 3LGUA 2KCOA 1A4WH 1O3BA 4R0IA 1TPAE 2QGRA 1EUFA 3BTWE 3GY5A 3ZVGA 1LPGB 3A7XA 3LC5A 1PPZA 1HAXB 1XUHA 3M3VA 6ESTA 4O3UA 5FBEA 3MTYA 4M7GA 2Y81A 1UCYK 1WQSA 1DUEA 2JIZD 2O8MA 1CO7E 3QLPH 1EJMA 3TK6A 2STAE 2PW8H 1THSH 2A4QA 2D2DA 2ZTXA 1E79D 2F91A 4FVDA 1MKWH 3ZV9A 1KMHB 1LVOA 2BOKA 4CHAC 4MNYA 3I77A 1E38B 1TFXA 1C1SA 4ASHA 1GMCF 1E1RD 1WOFA 1O0DH 2BLVA 2AEIH 1C5LH 4F4OC 4O03A 1GBIA 5B6OA 5EG4A 2BQ7B 4MPWA 4OGXA 4OGYA 4YLQH 3DA9B 5AFZH 1BRCE 1PYTD 2J94A 3GDUA 1IAUA 1O35A 1QRWA 1C4U2 2BLWA 1SQOA 4DT4A 1BB0B 5LPFA 1T4VH 3P8GA 2CXVA 3TH4H 1A0LA 2A7CA 2CN0H 1KTSB 3R0FA 4YTAA 4K69A 1UTJA 2V3OH 1HV7A 2H9HA 1ZPBA 1N8OB 2UWLA 4ZKSU 2UUYA 1G9IE 5A0BA 2C8WB 2QCYA 2WPKS 4GCHF 2TIOA 1ACBE 2OTVA 1OWHA 1YCPK 2SGFE 3DCLA 3P6ZB 1SHHB 3TLOA 1CHOF 2K1QA 4LXBH 1GJ8B 1GWAA 4ABBA 2EY4C 4NIVA 5CHAC 2Q1JA 2V0BA 4X2YA 1EAIA 4YOGA 3PLBA 2FXRA 4TWYA 3AAVA 1HRTH 4AN7A 1V2QT 1AO5A 2TGTA 1WAYB 1M9UA 1ZMNA 1XXFA 4INHA 3B9FH 5FPYA 2WPJS 1GHZA 2FOMB 2ZDVH 4WMFA 1TRNA 4NA7A 3GCTF 4KTUA 1MBMA 1O3OA 2FM2A 1BA8B 4LK4A 3P95A 3JZ2B 3F0OA 4AZ2B 1MABB 1L2EA 3CP7A 5AFYH 2EI6A 1V2ST 1G3DA 3OEED 2QF4A 2XCFA 4NFEA 3M61U 4NA9H 1K1NA 2GD4B 1LO6A 4B6EA 2Z9GA 5DN6D 1C1PA 2C8YB 1BMFD 5JBAS 1W0YH 1IQJA 1MUEB 2G5NA 3ZZ3A 1GG6C 2Z3EA 3HGPA 1QTFA 3I78A 1K2I1 3ZIAD 2UUKB 2W5EA 1L4ZA 1S82A 3KEEA 4AB9A 3K2UA 1J15A 1Z6EA 1ZMJA 4Y10E 4BNRA 4K3JA 2ZDAH 2FTLE 2L74A 5TCAA 1Y3VA 2FWWA 1PQ7A 4ZCNA 2QV1A 2ZDKA 3M36A 1D3PB 2XOKD 5C1UA 2KR7A 1BMLA 5ABWA 3LGVA 4J1YA 3ENSB 5TJXA 1ESBA 4IW4E 2ZU4A 3TK9A 1GBAA 1KLTA 3D49H 1SB1H 3RU4D 1JOUB 2K0QA 2YMSB 2VIDA 3DFLA 3UOPA 1NFYA 2HNTE 1AFEH 1BBRK 3P17H 1KXBA 1C5WB 2XTTB 4Y7AA 2BDAA 1QQUA 2BDGA 2Z3CA 2ZFSA 3U98H 1FY4A 1GBTA 4X8UH 1QBOA 3IITA 3SHAH 1C2HA 2FOEA 1MQ6A 1GJBB 4CRDA 4BXWA 3F68H 1GJ6A 1GMDG 4ISLA 1H8ED 5EXLA 4FUHA 4I8HA 4OS1A 3SI4H 2J2UA 3EAJA 3SQHE 1AGJA 4AFUA 2HRVA 1KLJH 1VGCC 2XW9A 2GCHG 3RC4A 1O2SA 1P10A 1MD8A 2J97A 2A1DB 3EDXB 1B0FA 5A8XA 1GHAF 2OBQA 1O3HA 1YPHC 1MKXK 2ZC9H 2ZPRA 4GHQA 1UJ1A 3GS9A 3SJIA 5T1VA 1BHXB 1VJ9U 1BRUP 1T7CA 4B1TA 4ABJA 4NSVA 2BB4A 2BM2A 3UAIC 1O5EH 2OXSA 1YLDA 3OAAD 3N7OA 2WYJA 1O5DH 3K65B 1C5ZB 4DW2U 3QX5H 2J98A 3HK3B 4B6FA 4Y0YE 5EODA 4BTUB 3KYGA 4H6SB 2WUCA 4FUJA 4MNWA 3WWBA 2PR3A 2Z3DA 5C20A 1SGIB 1K0HA 1AU8A 3RXPA 1GJDB 3MNBA 1UK3A 1BCUH 1BIOA 4UE7H 4D7GA 1PPHE 2A5IA 2HALA 3GCHC 2F3CE 2KM0A 1TYNA 3UFAA 1FPCH 2WINI 3QDZB 4Y79A 2ZZUH 1ETRH 1O2KA 4ASUD 1EKBB 2SGEE 1WCZA 1RGQA 4H4FA 1O2MA 1W0KD 1FN8A 2RDLA 5DSFA 4TY7A 1HGTH 2J5UA 3SU0A 3A86A 2Y5HA 2CF8H 1XUGA 1DFPA 1Z1IA 3O8CA 2J95A 3ZVAA 1BJUA 2R3UA 2ZGBH 1AUJA 3T27A 1KTTB 2NWNA 4P02A 3VGCC 1TNJA 4MTBA 2WZQA 1NRPH 3A81A 3LJJA 1YPKH 3PTNA 1DE7H 1WXRA 1HUTH 4IBLH 2A5KA 1ELCA 2W7UA 1A2CH 2ZFQH 3BTFE 3RXSA 1GBLA 2AERH 2AGGX 4RSPA 1O34A 1IHSH 1SGCA 4D76A 1LDTT 1DWEH 1P2KA 4AGKA 5C94A 3TGJE 4I8KA 3T2NA 1OP8A 1TGSZ 1TAWA 3T26A 1PYTC 3F0PA 3DUXH 5DK1A 4SGAE 1ABIH 5GDSH 1ZGIA 2Z6BD 1GCTB 5FX6A 4YXWD 4E05H 1ELBA 1JBUH 4JK6A 3SU1A 4AB8A 2GT8A 1EATA 4DIIH 2J98B 6CHAC 1AHTH 1GI5A 3H5CB 4F55A 1ELFA 4CHAB 5LH8A 4MNVA 4O9VA 2I6SA 2SGPE 5ESTE 3VG8A 3LOXA 1V2MT 1ZTKA 4JZFH 1HFDA 4R8TB 3Q3XA 4AFSA 5J4QA 1C1QA 1B7XB 4YLUA 3RP2A 1AE8H 2BY9X 1GBKA 2CGAA 3KYFA 1ESAA 3AK5A 4JYTA 3TK5A 2WUBA 1ORFA 3A8DA 3ELAH 2H9TH 1HB0B 3GY7A 3ATMA 1VITH 2OCVB 1FXYA 3OTJE 4DY7B 1C4Y2 1MTNB 2ANMH 4CRAA 2CJIA 2FOCA 3TGKE 4H6TA 3PWCA 4YOIA 4X2VA 5A09A 4ABFA 1YLNA 1CA0C 4RKOB 2B0FA 1VZQH 3GYMA 1FV9A 1UTNA 3H7OA 1K21H 1S84A 2KAIA 1CE5A 4YM9A 1A7SA 4Z1MD 1HJ9A 1XUJA 1W13U 4FUGA 4XOJA 3RXLA 2OK5A 3FZZA 1SBWA 2W26A 4JZ1A 3U8TH 1GDNA 4AC9A 2QXIA 2AGEX 3A7WA 1UTOA 4BOHA 2XNIA 2BD7A 2JETC 1P05A 1WTHD 1O2JA 2BDHA 5C67A 3UNSA 4WXVA 1NROH 2BQ6B 2FLBH 1NBME 4I8LA 1JIRA 4KP0A 3RXKA 3DHKH 3ZZ4A 5DP4A 4RN6A 1S83A 1SHYA 2GJGA 2OBOA 5K7RA 3ATWA 3E16B 1F0TA 1H8IH 2GV7A 1UK2A 1MAYA 2PGBB 2G4UA 2J92A 1SGFA 1QJ6B 2A4OA 1LCYA 4AOQA 5DP5A 2ZU5A 1DS2E 1UCYH 2VH6A 4CRGA 1O39A 1OWKA 2IN2A 1BTUA 3DT0H 1A61H 3A82A 1GHWH 1BJVA 1YY3A 5ETXA 1ZGVA 2O8TA 2BVXH 3LONA 3QTVH 8KME2 1QY6A 1WTGH 1C4V2 3TH2H 2ZHQH 3EGKH 1YF4A 2QN5T 1O2GH 2ZHWH 1P12E 2BD5A 4IC5A 2VIPA 1W3CA 1YPEH 2ODYB 2BX3A 5C1YA 4ISNA 3BTDE 1OOKB 1KYNA 2RDEA 3BG4C 1XM1A 3N7DA 3F9HA 3SU4A 1TNKA 3VB3A 1EOLA 2JH0D 3TJVA 2XBWA 3VXFH 3HGNA 1MTVA 1C1NA 1TABE 3AW0A 4FUEA 1JIMA 2KAIB 2SGQE 2Y5GA 3T25A 1YWUA 1YCPH 1AY6H 3SQEE 1P3EA 1ESTA 2ZDMA 1UVSH 1IQEA 1BRBE 1A46H 4D9RA 4CH2B 2A7HA 1YPMH 3M5MA 1C9TA 4Y8XA 1G32B 1QHRB 3NUMA 1NFUA 2C8ZB 3LIWA 3SI3H 2F9BH 1WQVH 2GMTC 1B5GH 3T62A 3Q76A 2FEQH 3OYPA 1C5RA 5LPEA 2BTCE 1TPPA 1IQIA 3EA9A 1HAHH 2VH0A 1L1JA 1VGCB 3P8FA 3VB5A 1AB9C 3LKWA 4X1QU 1LVYA 3NKKA 4K1TA 4CR9A 1H9IE 3A7TA 3N99A 1BDAA 4MLFB 2C90B 4NIXA 2BY7X 3A88A 2FLRH 3SO3A 1NO9H 1F5LA 2EC9H 2CHAC 3DD2H 1A3EH 1LVMA 4XBCA 2R0LA 2FOBA 2ZGXH 2IOTA 3ZZ6A 4CRCA 1V2WT 2BLQA 2AFQB 1GI2A 3A8CA 3RMMH 4YT7H 1AFQB 2KCAA 2ZI2H 1OXGA 2Y6TA 1BRAA 1ZHMA 1HIAA 1LMWB 3MU4A 1C5YB 4AGJA 2P94A 1YPHE 4B2AA 1DY8A 3KQ5A 8ESTE 5L2ZH 2DUCA 4HI3A 3RMOH 3F6UH 1O2WA 1VJAU 2QAAA 1K22H 2ZTZA 4A5TS 5K0HA 1C1OA 1L4DA 2BD9A 2PSYA 1Q2WA 3GISB 3UWIA 1GVKB 1MTWA 3GY2A 3SNAA 1FZZA 1ZPCA 1S0QA 5T6DA 1WUNH 2OP9A 4Y11E 1ZJDA 2PGQB 4X8VH 4XRNA 4DOQA 2JH6D 3ODFA 1AWFH 3KQEA 5EQRA 3OY5U 5FL7D 5BRRE 4D9QA 3CS0A 3ZZBA 1GJCB 1EX3A 1T31A 3NCLA 4B75A 3AW1A 1HJAC 1WDIA 2D1JA 2HPQH 4AFZA 1H9HE 1FN6A 2FDAA 2QIQA 3PV2A 1LHCH 4TWWA 3MU0A 3L6PA 4TYDA 1XXDA 6GCHF 3E0PB 4BAQB 1GBBA 1JRTA 3RXQA 3N7EA 4P00A 1FX0B 3MFJA 4RT0A 3FVFB 3MH6A 1GMHG 1NZQH 3VGCB 1U6QA 2Y7ZA 1N6YA 1P2IA 5EIYA 2UUJB 3BIUH 1MD7A 1ZTLA 2FS9A 1BBRH 2Z9JA 2HVXA 1ZMLA 3Q3YA 1D6RA 1H8HD 2L6OA 4CBOA 2BY5X 3BEUA 5CE1A 4QT8C 4HZHA 3FZDA 1QB1A 3GYLB 1INCA 2VB0A 1Z71A 3CS7A 3A7ZA 1HJ8A 1AKSB 5AF9H 4YO9A 2BOHB 3M37A 1K1IA 5G4BA 3ZZAA 2HLDD 3RXRA 2ALPA 4ISIH 1QCPA 1GCTC 1RIWB 4MVNA 1CGHA 1LHDH 2WV9A 4RT1A 1GBJA 1O3FA 1VITF 1GBEA 1V2JT 2UWPA 4TY6A 4M9FA 2Q6GA 2F9NA 3U9AH 1Y5AT 2SGDE 3RC6A 4U32A 2GKVE 2ZU1A 2OD3B 1HIAB 2VBCA 2ZGCA 1PPBH 1AUTC 4X6NA 6CHAB 4F48B 1MKXH 1JRSA 1KXCA 3ZVCA 2A4RA 2VNTA 5EOKA 3OTPA 3A83A 2ZGJA 1C5OH 3G01A 1W0JD 3LH1A 3PO1C 2OQ5A 1ETSH 1O2TA 3RC5A 1S0RA 3LGYA 1F7ZA 3EE0B 3MH7A 3PWBA 1DANH 2ASUB 2BD8A 2RG3A 3BTEE 3RU4T 1WBGB 4ABHA 4I31A 2BDIA 4WMDA 1X7AC 1QL9A 3MOCA 3SNBA 1MTNC 2ODPA 2G52A 2OUAA 3KQCA 2BMGB 1YBWA 2HVYB 1C2IA 4D7FA 3BG8A 2CV3A 4CR5A 3RXCA 4B2BA 2FMJA 1GPZA 1HAVA 1MZAA 1TMBH 3SU5A 4X8SH 1MTSA 3A8AA 2H5DA 1GI0A 1RS0A 3SU6A 1ANCA 1O5AB 3VB6A 1BMMH 1AI8H 2IPQX 5L6NH 1IQMA 1ANEA 2PUXB 3KN2A 3PROA 1CA0B 1GI4A 3B23B 1TRMA 3ZVFA 2HNTF 1GMCG 1E35B 2CF9H 4NCYA 1OYTH 3SOSA 1YLCA 4UEHH 3RLWH 2GVFA 1O3NA 1BTYA 2WPMS 1CSOE 2OQUA 3S69A 1C2EA 4CREA 3LU9B 3RXJA
chains in the Genus database with same CATH topology
2ZFRH 4BAHB 1SQAA 1O2NA 1NRQH 2JETB 5GCHF 2VU8E 1IQHA 1O2RA 1WSSH 3O8RA 4GCHG 4FU7A 1SG8B 1OWIA 1TX6A 3BTTE 3PM3A 4JZEH 4E7NA 3T5FH 3PV4A 1DDJA 1CHOG 2DE9A 1QURH 3GOVB 3QWCH 1C9PA 1FMGA 3RLYH 3TJUA 5HYOA 1BMAA 2QXHA 5HMAA 5DO4H 1HAIH 1PQ5A 2Z9KA 1UTLM 5A0AE 1HAPH 4IS5A 2CMYA 4NA8A 4WH6A 1LQEA 2C93B 3RXUA 3SNEA 1ETTH 3TH3H 1O2ZA 1GI8B 4Q2KA 4NWKA 1QA0A 2HOBA 2C8XB 3JZ1B 1Z8IB 3MMGA 3GY8A 3GCTG 1P03A 5T6GA 1CBWC 3TNSA 3A80A 1SFIA 4Q7YA 3OU0A 2VWNA 1W12U 1RTKA 3RU4E 3ZVEA 1HAVB 1V3XA 1ZSJA 2A7JA 4IGDA 1C1VH 2SFAA 2XC0A 1DUAA 3UUZA 4Q7XA 3TJNA 1WV7H 1V2PT 1LHGH 1V2TT 3GICB 4NZLA 4MPUA 3RXIA 1Z8RA 2ZPQA 3BG4B 3MO9A 1FIWA 3GCNA 3FP7E 1ELAA 4DJZB 2DE8A 5LGOA 3URDA 4MQAA 1OSSA 1QB6A 2GZ7A 5EPYA 1EPTC 1MBQA 1P2JA 2TGAA 5FX5A 1YM0A 2PUQH 1A3BH 3TJOA 3UNQA 1B0EA 2D8WA 4WMEA 2RA0A 1MTUA 1BITA 1EZXC 1P04A 2FESH 1QNJA 2ZDLA 1J17T 4AG2A 4MPXA 1TONA 1IOEA 4AORA 5HM2A 2GMTB 4MPVA 4FU9A 2P93A 4FUDA 1HAZB 3EYDA 3L3TA 2PWXA 2UUFB 2C3SA 5J4SA 1AB9B 4NIYA 4CBNA 5E2PA 4K1EA 7GCHF 5A2MH 1Q31A 3SUEA 4ZXYH 1EJAA 2W7SA 1C5MD 4IN2A 1EJNA 5DP7A 2ALVA 1AFQC 4JYVH 3QTOH 4CRBA 2NU2E 5F8XA 2CHAB 2Y82A 1Y5UT 1TBRH 4DGJA 3PLPA 2ZQ2A 2P16A 2AIPA 3O8BA 3LT3A 2WV4A 1HXFH 2BD4A 3A87A 4DIHH 1O2UA 1NM6A 2WPLS 1KXDA 2WPHS 2XYAA 4A1TA 5DPAA 2ZHEH 1Y3UA 1ZOMA 2PSXA 1PJPA 3P8NA 3M7TA 5SGAE 1G3EA 2GV6A 3TITA 2AMDA 4XDEA 2XBYA 1YGCH 2G4TA 1A1RA 1EB2A 4CH8B 9ESTA 4IMZA 1FY1A 1S81A 1GHAG 3W94A 1V2OT 4KKDA 3LGIA 4K8BA 1HJAB 2BD3A 1TMUH 7GCHG 4XBBA 1A0HB 2B8OH 2XWBI 2R2MB 1SGYE 3E6PH 1SQTA 1TNLA 4ZKRU 1C5NH 1QR3E 1O3IA 2AGIX 1KIGH 3SJOA 3P70B 3ZYEA 2ZECA 2TRMA 3E3TA 2WPIS 1TWXB 4AX9H 1E34B 1V2KT 2YNAA 3MYWA 1RIWC 4I8GA 1DXWA 1FY5A 5JDUB 1NRSH 3V3MA 1AQ7A 1Y3YA 1GHBF 2PKAB 4O97A 7KMEH 1O5CB 1PQAA 5L30H 3KNXA 1TNGA 2C4FH 3BTKE 1Y3XA 1FY8E 2FP7B 2HGTH 2F9VA 5E0GA 4ESTE 2GDEH 4X1PU 2FOAA 1NU7B 2AMQA 1GL1A 1A0JA 1P2QA 1ZZZA 2A32A 2ESTE 1NFXA 3VFEA 3QK1A 4AYVB 4TPIZ 1HAOH 4K5ZA 4JYUH 1W7GH 2Q6FA 3RXFA 3Q77A 1O3EA 1Z7KA 2NU3E 1OP2A 1QA7A 1IQNA 4X1SU 1THRH 3PMJA 1Z8GA 2GCTC 2XRCA 5HM9A 1V2LT 3PO1B 2WYGA 3TPIZ 3V12A 1C1UH 1SGEE 3QZRA 4ABIA 2IJOB 1ANBA 1DVAH 4E7RG 3S0NA 1QL7A 1BT7A 4I32A 1V2RT 1K28D 6LPRA 3SV6A 1NN6A 1OP0A 1TPOA 3LPRA 1OX1A 3I29A 2JKHA 1ELDE 1O2YA 4FXGH 2PV9B 5GJ4B 1SLVB 3RXTA 1TQ7B 1TBQH 2VVUA 3UR6A 2ZF0H 1SLWB 3KQDA 1MCVA 2VGCC 4ZHAA 2PLXA 2QC2A 3RXGA 4DT7B 1TQ0B 1N6XA 4LZ4B 4GUXA 1EPTA 3F9FA 4XSKU 1AZ8A 4ZH8A 1J14A 4ZHLU 3T29A 1ELGA 2H6MA 4SGBE 1G3CA 1SSXA 1GI9B 1P06A 1C5QA 1P3CA 1SGTA 4XE4A 5EQSA 9LPRA 4YZUA 1W10U 1O2QA 8GCHF 4MDSA 5DP6A 1LKAA 3KIDU 1T32A 2RCEA 1P2NA 5EU8A 1C5PA 1TGCA 1K9OE 4UONA 1GBCA 7LPRA 2G8TA 1FI8A 5JYIA 2NU0E 3M7QA 1SGDE 1KDQB 2Z9IA 4UFDH 1GL0E 1SGRE 2FYQA 2YOLA 3RM0H 1EXFA 1C5UA 1NT1A 1YC0A 1K1OA 4OS2A 5A8YA 3S9BA 4NIWA 4NSYA 1L0ZA 5F03A 1SOTA 4ISHH 3PMHB 4ZKOU 2EI8A 2OC1A 4WY3A 5FAHA 4U2WA 1CBWB 3AASA 1THPB 2SGAA 1UVPA 2R2WU 3ITIA 2FI3E 1CA8B 1P2MA 1O38A 1FY3A 1DWCH 4X0WU 2BQWB 1RRKA 2XWAA 4Y8YA 1CVWH 1SR5C 1UVTH 1SL3A 4IMQA 3S9AA 1V2UT 1TIOA 1EZSC 2ZFPH 1BZXE 4Y6DA 2PTNA 1QBNA 5DJ7A 1DPOA 1XVOA 1YPJH 3R3GB 4XBDA 5F8TA 2TGDA 4ISOA 3ATKA 3S9CA 1EPTB 3F9GA 4J2YB 3NPSA 5I25A 3MO3A 2ANWA 1GGDC 3UQOA 2A4GA 4X8TH 4X2XA 3RXEA 1QQ4A 4VGCB 5LPRA 1F5KU 2A45B 4I8JA 2P59A 1HCGA 1O2VA 1O30A 1TX8A 3FAOA 2VVVA 1GJ9B 2A2XH 1AKSA 1OWDA 3ZZ9A 1AN1E 3RUOA 4GPGA 5PTPA 2O8WA 1UMAH 3W95A 4B76A 1O5BB 5GIBA 1O31A 2ZTYA 3MI4A 4OS5A 2NU4E 1P8VC 4YOJA 2H9EH 1AVXA 1DM4B 2QXJA 2HLCA 3HATH 2XBXA 2THFB 5EW2H 2OC8A 1O3PB 1PPCE 1UHBB 2P3TB 7ESTE 4AG1A 2O8UA 4Z0KA 3SU2A 3MHWU 3SJKA 1O3JA 1W14U 1OWJA 1D6WA 1O3MA 4GLYA 1LVBA 2AH4X 4ZUHA 4THNH 5E8EH 3C1KA 3MH5A 1O2XA 5DGJA 3BEFB 1C2DA 3QGJA 1EOJA 1FJSA 1OPHB 3KGPA 4H42U 2H2ZA 1GI6A 1GI3A 2AYWA 1F5RA 4A6LA 1F2SE 1VCWA 1XVMA 1O33A 3TIUA 4INLA 5EGMA 1TOCB 4UFEH 1DXPA 1CT2E 5FHTA 1C2GA 1TNHA 5BPEA 2QY0B 2PKSC 1GDQA 1EQ9A 2ODQA 1GJ5H 1DWBH 1P0SH 1C1WH 3O8DA 3RXOA 1EZQA 4FUBA 2BVSH 1IQFA 3MU1A 4JMYA 2NU1E 4BAKB 1SI5H 3D65E 1TNIA 1BQYA 1OWEA 2GTBA 4YT6H 1JXPA 2EEKA 3UTUH 1DLKB 3A84A 2OLGA 4K1SA 4X1NU 4UFFH 1SVPA 4AYYB 1SFQB 5C5NA 4BAMB 1FPHH 3LC3A 3RXAA 4Y7BA 1ELEE 4PROA 5CMXH 3SORA 5EPNA 1LQDB 3PLKA 3A8BA 2FX6A 2WV5A 1C5TA 3OSYA 3E8LA 1MAXA 3VEQB 2PFEA 1DITH 1UO6A 3ATLA 1UK4A 4NG9H 3UREA 1O2IA 1O32A 3SV9A 3U1JB 1TX7A 4AFQA 2ZP0H 4NZQA 5DP3A 1O3KA 3RXBA 1SPJA 1Y3WA 5GPIB 6GCHG 2A5AA 3U69H 5C2ZA 1GJ7B 1O37A 2Z94A 2FX4A 2TPIZ 2Y7XA 1Z6JH 1ZRKA 4RKJB 3KF2A 3VXEH 2W3KA 3CENA 4NFFA 1C1TA 1QJ1B 4Y71A 3HKIB 3SJ9A 4UD9H 2BZAA 2GCTB 2V3HH 3FP6E 2VJ1A 1NPMA 1RTLA 4I33A 2VVCA 1HAGE 1HLTH 3STIA 1YCPM 2LNCA 1O5GH 5EXMA 2BVRH 1QGFA 4CRFA 4D8NA 2ZCKP 4A1XA 1S85A 5GXPA 1SOZA 5E0HA 3ZV8A 4X6PA 1YYY1 2ZHDA 1VITG 3LGTA 1O3AA 2ZCHP 3SUFA 4Z6AH 1C5XB 3URCA 1QIXB 3SBKA 5EXNA 5DKMA 1GDUA 3TGIE 3SZNA 3NWUA 3E91A 4U01A 3ZYDA 3BV9B 5AVDA 3TU7H 1ELTA 2BHGA 4ABGA 3S7HB 4DCDA 1YKTA 4Q80A 3DFJA 2FI5E 4BANB 2VGCB 1D3QB 1D9IA 1UTQA 3QO6A 3ZZ7A 2HPPH 3S7KB 1NESE 2F9OA 4DVAU 1C2FA 1GHXH 4FU8A 4K60A 5F8ZA 2AS9A 1P11E 1BTXA 4A1VA 1G37A 3OY6U 2ZPSA 2HWLB 3SNDA 4KELA 2J4IA 3RXVA 5DP8A 3QZQA 4WF8A 1IHTH 1UVOA 4ZROA 1DOJA 4F49A 1EAUA 1HAYB 1SC8U 1GHYH 1A5GH 3WY8A 1FUJA 1O3DA 3VPKA 3SJ8A 1E37B 1P02A 3UOUA 4A7IB 2JH5D 1MQ5A 1S6FA 1O2PA 1PFXC 1PPEE 5EQQA 1BTPA 3HKJB 2J38A 2VIWA 5GWZA 2XCNA 3ODDA 4LZ1H 3K6YA 2PTCE 2A31A 2Z7FE 4BXSA 1G30B 3SUGA 3LJOA 3MH4A 1SGPE 1RFNA 1BHXF 1KXFA 1GMDF 2BXTH 5A0CA 3B8JA 3UNRA 1ANDA 4ABAA 2QF0A 4KTSA 5GCHG 3SHCH 4JZDH 1KXAA 1O2OA 1J16A 4YESB 1EAWA 2GCHF 4WJG2 2EI7A 1O3GA 4X1RU 1S5SA 4I7YH 3SV7A 2OC7A 5C3NA 1TBZH 5E0JA 2P8OB 2UWOA 1C5VA 4KGAA 3UWJH 5JPMH 1QFKH 1P09A 2ZEBA 1IQKA 4ZHMU 1NU9A 4B2CA 1W7XH 1V2VT 3ZZCA 2FYRA 1P9UA 1OS8A 1UCYE 2G00A 1Z8JB 4VGCC 5FBIA 3TNTA 4BTTB 1W8BH 3A85A 1W0ZU 3M35A 1AIXH 1GCDA 1GGDB 3V7TA 3QGNB 5FCKA 1T8LA 1XMNB 1XUKA 5T6FA 2P95A 1E0FD 5EW1H 1QRXA 4FVBA 1NY22 1NS3A 4UDWH 5I46H 1MMJN 4JZIA 1LKBA 3KL6A 4KTCA 4OS4A 1P2OA 1UTKA 3ESTA 4X2WA 2GZ8A 5JBCS 1ZR0A 1FIZA 2ZFFH 1QBVH 2PKAA 2TGPZ 2AIQA 3M3SA 4NWLA 3IG6B 4OS6A 4O3TA 3ZZ5A 4MG3A 1MKWK 2P3UB 2YNBA 1N1LA 1P9SA 3BIVH 3MU8A 3UQVA 2BDBA 1TA6A 2O9QA 2W3IA 2H1UA 5FCRA 1RXPA 1Y8TA 1FONA 2FPZA 2ZIQH 3MO6A 1A5HA 2XXLA 3UPEA 3LGWA 2O8LA 3BTHE 4IN1A 4A92A 4UFGH 1VR1H 1CQQA 4HTCH 1F0SA 1E36B 2FOGA 1W11U 1TLDA 2ZWLH 3C27B 1CT0E 1ZTJA 4JCNA 1BTHH 2BY8X 1GJ4H 1BMNH 1TE0A 2A0QB 1ZPZA 1ZJKA 1FAKH 2FIRH 2ZU3A 1G36A 3SGAE 1VCPA 1KSNA 5A8ZA 1AVWA 3NXPA 2ZQ1A 1S6HA 1W2KH 3RXMA 4IC6A 1D4PB 1K1PA 1FAXA 1G3BA 3FFGA 3U8OH 1H8DH 2QYIA 2PKSB 1SGNE 2ZA5A 4E06H 2ZG0H 2VWLA 1T4UH 1UTPA 4Y76A 1F0RA 1OKXA 2XC4A 2Y5FA 2B9LA 2VIOA 5JB9S 1XKBC 4MNXA 4ZKNU 1C2LA 1ZRBA 1EP6A 1EZUC 1GBMA 3HPTB 1GVLA 1GHVH 5HXFA 1QL8A 2LPRA 1Q3XA 4LOYH 5ESBA 3SU3A 1MZDA 3SNCA 1CU1A 1L1GA 1AMHA 2G81E 3K6ZA 4X6MA 3E90B 2F83A 1O2LA 2BZ6H 3V13A 1LHEH 1HXEH 1ZLRA 2F9UA 3BN9A 1LHFH 2B7DH 4TPYA 3Q00A 1ARCA 1PPFE 1ID5H 1A5IA 1XUFA 1EP5A 3PMAB 4ZXXH 1DT2A 1O3LA 1C1RA 4K8YA 1TB6H 3MWIU 2SNVA 3VB7A 1GBFA 1LPKB 1SLUB 2IPHA 1K1MA 1KDQA 2H5CA 8LPRA 3KHVA 4XFQA 2VWOA 4HGCA 2J9NA 1G2MA 4Y8ZA 1DX5M 4B71A 3SUDA 5JBTA 5JB8S 3AVZA 1GBHA 1IQLA 1ZSKA 3M3TA 3A7VA 2ZGHA 3FP8E 3ZVBA 1GVZA 3ATIA 1C2KA 1QB9A 1ZHPA 1BBRE 1DLEA 1F0UA 2M5TA 3GDVA 1ELVA 1G2LA 3FANA 3VB4A 2V6NA 2ZO3H 2QF3A 2VIQA 1TPSA 1CGJE 2AMPA 4BTIB 2GGVB 1GHBG 4B74A 2P3FH 1TGNA 2BLOA 1N8OC 2VWMA 1H9LB 4FUIA 1UTMA 3M5OA 1ZSLA 3F1SB 3IWMA 4GAWA 1HDTH 1O2HA 2XC5A 3ZZDA 1P01A 2D26C 2FOFA 1RJXB 4X6OA 1AVGH 3PYHA 3KCGH 1C5SA 1GI1A 3SGBE 3ZVDA 3BEIB 3U1IB 2OINA 1DSUA 3A7YA 3TVJB 2RA3A 1KXEA 2ZU2A 1MU6B 5IDKA 5CHAB 1HYLA 2R9PA 1NC6A 2ZNKH 1V2NT 3NK8A 2BY6X 3PTBA 1T8OA 3P92A 4Q7ZA 3STJA 3PB1E 3QN7A 1CT4E 2F9PA 1OYQA 3SV2H 4WVPE 2GP9B 3E0NB 1DSTA 2STBE 2BD2A 3GY4A 1ARBA 1FDPA 3GY6A 2TBSA 5AHGH 3ZZ8A 5T3HA 3NZIA 3D62A 4NGAH 1WU1A 2ZDNA 4HFPB 1FNIA 4DURA 4DG4A 1TA2A 1DY9A 3E1XB 3T28A 5HGGA 3SW2B 1BTWA 2FOHA 2R0KA 1UHBA 1V6DA 1AE5A