2BDCA

Porcine pancreatic elastase complexed with asn-pro-ile at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA01
3RXOA 3SV7A 3ZVFA 2BLQA 1QRWA 1BTPA 3M5MA 1J9CH 2BY5X 2FI4E 4B76A 3LC5A 1FY1A 4AORA 1C1SA 2A7CA 4FVBA 3EAJA 3MNCA 3NXPA 4E06H 2NU4E 1V2NT 5F6MA 2Y82A 1DUEA 4DW2U 1Y59T 2TGDA 1H9HE 3GY3A 4YLUA 3RXSA 1HAGE 3ZZCA 4A5TS 4AG1A 2ANKH 1EPTC 3UNRA 2VJ1A 2SGEE 2FOAA 2O8MA 1O3OA 4WMDA 3LPRA 1UTJA 1ZSKA 2GT7A 5J4QA 2P8OC 1MKXH 2ZHFH 1GJ6A 2A4RA 2WPIS 1LVBA 1WBGB 3DT0H 3DHKH 2BXUH 3SNDA 4B2AA 4YM9A 1O3CA 2HOBA 6LPRA 3ESTA 3RXQA 1TOCB 1GMCF 4CRDA 1O38A 2FOGA 1GHAG 4JYUH 3RU4E 1DY9A 1AZZA 3GDUA 3SI4H 3GOVB 2BDYA 1KXAA 2PUQH 1GDNA 3LOXA 2SGPE 1S81A 1SVPA 5TCAA 3P17H 1Q31A 1ELGA 1YPKH 1NZQH 1HAXB 5C2ZA 4K3JA 1TPSA 1WAYB 2Z94A 1YPHC 2C4FH 4K8YA 2J9NA 2ZDKA 1GMHF 1AWHB 4NWKA 5EGMA 1PPFE 4ZKOU 4FUHA 1NFUA 4JCNA 3SUGA 2J38A 1C1PA 4DG4A 1LPZB 1GBHA 4I8GA 1HNEE 1NRRH 3M3VA 1O34A 1BRBE 1TGNA 1FJSA 1JIRA 3T28A 6CHAC 3PO1B 3UQOA 3A80A 1CQQA 3RXPA 2IJOB 1FN8A 4LZ4B 1OYQA 4INKA 1N1LA 4YOJA 3QZRA 2BQWB 1O2VA 5GCHG 2ZEBA 4MNYA 1H9IE 3RLYH 1WSSH 2F9UA 2ZZUH 3M5OA 8GCHF 4X6MA 2VIQA 3RXVA 1O2KA 2GCHG 5LPRA 4YOGA 1O36A 4MVNA 1QIXB 1DVAH 1GJ9B 1GVZA 1ETTH 2BDCA 1IQMA 1FY8E 5DP7A 1LHFH 1ZTLA 2ZFQH 2ZHQH 2WUBA 1K21H 2P3TB 3SNEA 2R3YA 2ZFFH 1V3XA 2GMTB 3BIUH 1HIAB 1NRSH 1O2JA 2QF3A 2B5TB 1K1NA 1W11U 1PQ5A 2LNCA 3LC3A 2Q6FA 4ZKRU 1TOMH 1XUJA 2VWMA 1S82A 1BUIA 3MYWA 3TIUA 2ASUB 2VH6A 5JBBS 1SG8B 2UUJB 3P92A 3E91A 2BDGA 1O39A 1FIZA 1Z8RA 3LIWA 4GCHF 4GPGA 1BMMH 1W10U 1QQUA 5EXMA 1W7XH 2Z6BD 4BNRA 1C5SA 1H9LB 2FESH 3B9FH 3RXGA 1ZOMA 2ZU5A 1UTQA 2BOHB 1S5SA 1ZYOA 2F9OA 2V3HH 1GJDB 1EATA 2VWOA 2AFQB 3QLPH 1MZAA 1YPHE 3K2UA 1GBAA 2JH0D 3TJNA 1ANCA 1T32A 1MAYA 1ZRBA 5ESTE 5EPNA 1O3BA 1SGIB 1SL3A 2OC1A 5C20A 4A7IB 3LH3A 2Z9IA 1BBRK 1T7CA 4NA7A 2GKVE 2CXVA 4Q7YA 2NU1E 5EG4A 3A8CA 2IN2A 5FPYA 3S9AA 4Q7ZA 3TH3H 2FP7B 1AHTH 1TPOA 4Y0ZE 4YT6H 1W8BH 4ZH8A 3OY6U 3M3SA 1ESBA 2QGRA 1DY8A 3SU2A 1SPJA 1RXPA 5GJ4B 1NRPH 2HGTH 1LVOA 4K5ZA 2BDIA 1BRUP 1O37A 3LH1A 3RC4A 1XUIA 3MO9A 1DE7H 2PFEA 1Z6JH 2FX6A 1GG6B 1GBKA 5SGAE 4RKOB 1NU7B 1OXGA 4I7YH 3ZVEA 1GVKB 2Y7XA 4DT7B 1F0RA 1C5YB 1FAXA 1OS8A 1ELCA 1EZQA 4E05H 1XUGA 1QBOA 5BPEA 3SGAE 4I8KA 4KP0A 2G55A 4HFPB 4WH8A 1WTHD 4QT8C 2QF0A 1B0EA 1FAKH 4XFQA 3PTBA 1A46H 5C1UA 1TRMA 2ZO3H 3ZVBA 3ZVGA 1TGCA 5HGGA 4CRCA 2DE8A 1O0DH 3BG4B 4FU8A 3RMNH 1DUAA 4IS5A 1GHWH 1O2RA 1TALA 1QR3E 3ENSB 1ZPBA 3HGPA 4MTBA 2JKHA 2V0BA 4ABJA 1HIAA 4YZUA 3HKJB 1J16A 2FYRA 1V2JT 2XCNA 1DITH 2JH6D 4D7GA 1MTUA 1AE8H 4ABBA 1A4WH 2EA3A 2ZDVH 4CHAC 4TWWA 2BX3A 4K2YA 2QV1A 1C5LH 1OPHB 1YCPM 2ZHEH 1ZJKA 2AEIH 3PWCA 3U8OH 3D23A 4AFSA 1BTZA 3MU5A 3EA8A 3RXHA 4CR9A 4FUFA 1O35A 1XMNB 1F0TA 4JYTA 5JBTA 3RXRA 1XX9A 1C1OA 3UWJH 1YBWA 1V2LT 1NC6A 1RRKA 1GHBG 1S0QA 1C5XB 1K9OE 4INLA 2Y7ZA 3K9XB 5JYIA 1SOZA 3SNCA 2G00A 4TYDA 4OS4A 4X8SH 1C1RA 3UR9A 3ITIA 3RXDA 4AYYB 3MU4A 1C5TA 4TY7A 2CMYA 3SJIA 3PWBA 1VITG 1VJAU 6GCHG 3H7TA 1Y3UA 3KQEA 3NUMA 3FANA 2F91A 4Y8XA 3KL6A 1TBRH 5LH8A 1V2MT 4UFFH 1FI8A 3A7ZA 3P8FA 1BA8B 1JMOH 2DE9A 7KMEH 2AIQA 1LHGH 1O3KA 4X1PU 4GAWA 3S9CA 1SHYA 1OKXA 2ZCLP 3KHVA 4ZXXH 3P95A 3DA9B 3GCHB 5T6DA 1BQYA 4MPVA 1GBIA 2OLGA 3F9HA 3ZZ3A 1QRZA 3GY5A 3MOCA 3GCTF 1HFDA 1MUEB 4ISIH 4UEHH 1DX5M 4NSYA 5E0HA 1Z6EA 4AOQA 1M9UA 1O2ZA 2QN5T 1SB1H 5DP4A 3ATLA 1EQ9A 1SGNE 2BMGB 2FDAA 2C8ZB 1O2GH 1QRXA 2WINI 1P10A 4K1SA 3QZQA 2A2XH 2GCTB 2VIWA 1BTXA 3RM0H 4SGAE 1GBTA 4JZDH 1P2IA 1C2KA 2H2ZA 2ZU2A 1UVOA 2B0FA 2BD4A 5F8TA 4NIYA 4MQAA 1V2PT 1NT1A 2BYAX 1SBWA 8LPRA 1ZHMA 3QK1A 1UMAH 2P93A 5DP8A 1LKAA 4U01A 3TLOA 5GDSH 4THNH 1BMNH 1P2JA 3K65B 2THFB 1TBZH 5DK1A 3PMHB 2JH5D 3SQEE 3RMMH 1KYNA 3JZ1B 1MD7A 2C90B 3SU0A 4JYVH 3KQBA 1EZXC 1N8OC 2A45B 3GY6A 4UE7H 4YO9A 3OU0A 1FN6A 2BXTH 1Z7KA 1OSSA 1UCYK 1L1JA 2AGGX 1JRTA 2OINA 2FOCA 1EOLA 3TJVA 4IN1A 3VGCC 3E90B 4B75A 2BTCE 1Z71A 1OWJA 1P8VC 4X2WA 3VPKA 3S69A 4XBDA 2Z9LA 5DP9A 1EUFA 1T4UH 4DGJA 1Z1IA 1ORFA 3RXBA 5CE1A 2O9QA 3A82A 3TK9A 1IQFA 2A1DB 2ZFRH 2TGPZ 5ABWA 1ID5H 4ZMAH 3RXIA 2H5CA 2YNAA 5EW1H 1IQNA 1OP0A 4TPIZ 1OWDA 2C3SA 1ANEA 1T31A 1L1NA 3VXFH 4DCDA 3PLKA 1DLKB 1NFYA 3C1KA 7LPRA 1A7SA 2CJIA 4AX9H 2BY8X 1G3BA 1UTPA 2STBE 3O8RA 1C1MA 4U30A 2FO9A 3V7TA 1GJ8B 4I32A 1Y5BT 1WOFA 1QURH 2OUAA 1BDAA 4AGKA 3SV2H 1AQ7A 5LGOA 4I8JA 4X1QU 1L4ZA 4M7GA 5AFZH 2HPPH 8KME2 2O8LA 1HBTH 1FQ3A 4MPUA 2Z3DA 2BDBA 7GCHF 3DD2H 3W94A 1EB1H 4IBLH 1C5VA 2PKSC 2FS9A 1K1OA 3FVFB 5IYTA 5TJXA 4B1TA 1GJ4H 1K1MA 1KXDA 1W2KH 2FWWA 1V2WT 5C1YA 1K2I1 3RXAA 3Q76A 1V2QT 1EZUC 4NFFA 2NWNA 1QY6A 1SSXA 1TABE 1THRH 1GDQA 2A4GA 1U6QA 4NZLA 5DP3A 4Y79A 2OC7A 5GPIB 2G51A 3SBKA 4KTSA 4NSVA 2VH0A 1AKSB 1NS3A 2HPQH 4AB8A 4X2VA 1ABJH 4IC6A 3STIA 2AH4X 2I6SA 2KAIB 1P57B 1XUHA 1P2MA 1V2OT 5I46H 4O3UA 2ZCKP 1HV7A 2YNBA 3MH6A 1BB0B 1CBWB 2W3IA 4CH8B 3UPEA 2GVFA 2PSYA 7ESTE 1A0HB 5JB8S 1C2HA 2G52A 1THSH 3GICB 2Y5FA 1AN1E 3A89A 1A61H 2H5DA 3MFJA 1O5EH 1TX7A 3RU4D 4B73A 1VGCB 2ODPA 3A7VA 2R0KA 1P09A 1AVGH 5A09A 1BBRH 1BT7A 2QAAA 1C5ZB 1SGEE 4LK4A 1TX8A 2CF9H 4X6NA 1DXPA 3UNQA 1O5GH 1P9SA 3EQ0H 4H4FA 3L33A 2W7SA 2Z9KA 1TIOA 5DGJA 1UVPA 4XOJA 2SGDE 3QO6A 4ZROA 2PKAB 1TPAE 2BD7A 2O8UA 3ELAH 4JZEH 3UR6A 5L30H 1F5LA 1YPMH 3URDA 4X1RU 1V2VT 3O8CA 1G2LA 4LXBH 2UUYA 3SHAH 1UJ1A 4OS2A 3OYPA 1RS0A 4HTCH 1QGFA 1SGFG 2XW9A 1PYTC 5K0HA 1GJ5H 1P0SH 3I78A 3RXUA 2P3FH 3L3TA 5A0AE 3BTFE 2GCHF 3SOSA 1L1GA 1EOJA 4BAKB 1T8OA 2AERH 3SJ9A 5A0CA 1F2SE 4F49A 1GJBB 1CU1A 1MMJN 1YF4A 1OX1A 1G36A 1HRTH 2EI6A 5CMXH 1C5RA 2RCEA 1B5GH 1P2KA 2ZGXH 4XDEA 1Y5UT 2R2WU 4J1YA 1RTLA 2BLOA 3A8AA 3PMBB 1AZ8A 1GI7B 2ANMH 3AVZA 3NZIA 2GZ9A 3TK5A 1O2WA 1ELDE 4D9QA 2IPHA 1G9IE 2BD5A 2FOBA 2OXSA 1JIMA 2FEQH 4IMQA 1W0ZU 2AMDA 2BM2A 3BF6H 5L6NH 4MNWA 5A2MH 3P70B 4GHQA 1PPCE 1ABIH 3LGUA 1CO7E 3O8DA 2LPRA 2NU0E 2FZZA 4F4OC 1IHSH 2BHGA 4XBCA 1HAPH 4J2YB 4R0IA 1HXFH 2FI5E 4XSKU 1AKSA 1C5QA 2STAE 2UWLA 1SLUB 1T8NA 4YT7H 1SGTA 2KAIA 1XXFA 1PPZA 4X8TH 1SQOA 1YYY1 3QGJA 1IQEA 3BG8A 4OGXA 2C93B 1TNLA 4MNXA 1CHOG 5C3NA 1C2GA 3PB1E 2Y5GA 1PPGE 1OP8A 2BD8A 3T5FH 4B2CA 1DWBH 2F9BH 2XBXA 3ODFA 3BTEE 4FVDA 3A83A 1Y8TA 1DXWA 4TWYA 1SGDE 1GG6C 3PTNA 2BZAA 2ZGBH 1QL7A 3ZYDA 1BHXB 5E2OA 1MTVA 1ELVA 1O5FH 1Y3VA 4NGAH 3RLWH 1HJAC 1C5WB 2G81E 1ARBA 3MU8A 2Q6DA 3U9AH 3RMOH 4I8HA 4AFUA 1D3TB 3LGIA 3UREA 3EA7A 1O3JA 1V2RT 5DG6A 2PGBB 1V2KT 1EB2A 3E6PH 2FMJA 1EASA 3M5NA 1UK2A 1E36B 2Z3CA 2SNVA 2I6QA 2PKAA 1HAZB 4AG2A 1LHCH 1Z8JB 1P3CA 2Q1JA 4O9VA 1AIXH 5L2ZH 1TQ7B 1AB9C 2G4TA 1MBMA 2VU8E 1TFXA 3C27B 3T26A 1FPHH 3TNTA 1VCWA 1O3PB 1V2TT 1D3PB 4LZ1H 1GMCG 2BVRH 3SGQE 2ZNKH 1IQGA 2FPZA 1EPTB 3V3MA 3AW1A 1TMUH 3VB4A 2RDLA 1BITA 3SW2B 1C5PA 2BOKA 2ZF0H 4DOQA 3MO3A 5HXFA 5EOKA 1Y5AT 2P8OB 2ZU1A 3BTHE 1C1VH 1RTKA 2ANYA 2XWBI 2A2QH 3IG6B 2ZQ2A 1O3HA 2VINA 1TGTA 5A8ZA 1C2EA 1RFNA 1MCVA 2OCVB 4OS6A 4ZHAA 1O5BB 1F0UA 1YLCA 5CHAC 4PROA 5E0GA 1P01A 1MTWA 1V2ST 3SUFA 1OWKA 3TH2H 3VXEH 4BTUB 1ETSH 3SU4A 1J14A 1GMHG 1F0SA 1CT2E 2QA9E 4O03A 3BTDE 5AHGH 5A0BA 1TQ0B 3KQCA 5AVDA 2SNWA 4OS5A 3VB6A 1TLDA 1C2LA 1FONA 4HI3A 3E0NB 4WXVA 5DO4H 2FOHA 2F83A 2HALA 2CF8H 1QNJA 1P05A 1DOJA 4FUEA 4UFDH 4AGJA 3G01A 3ATWA 3BTGE 3K6ZA 2GV7A 2ZDMA 1UO6A 1YPEH 3LT3A 4OGYA 1C1NA 2H9TH 1TMTH 4VGCC 3TJUA 2GDEH 1SGCA 4NIVA 1GHBF 2PLXA 2ZC9H 1A0LA 1MAXA 1PFXC 3M35A 3RXTA 1EJNA 1YM0A 3ODDA 4A1XA 1CA0C 1EZSC 4IMZA 3N7OA 1QJ6B 2J4IA 3B8JA 6CHAB 4Z0KA 1VITF 4Y11E 1KTSB 1G3CA 2ANWA 1LMWB 5PTPA 1LO6A 2ZI2H 2ZFSA 1NTPA 1LPKB 2J94A 1O3MA 1V6DA 2P16A 3E16B 4IGDA 1GI6A 1YPLH 2F9VA 2CHAC 1C1UH 1KDQB 2WYJA 3U8RH 2AMQA 4I8LA 1GWAA 5HYOA 1D3QB 1DSTA 2ZGHA 3GY2A 1ZSJA 5AF9H 3H7OA 1MH0A 1GJ7B 1ZRKA 2P59A 3ATKA 3HK3B 3M7TA 1ZPCA 3MMGA 1C1WH 3FFGA 3TGKE 2IOTA 1NFWA 2GCTC 1L0ZA 2ZGCA 2OQ5A 1LCYA 3MI4A 1EP5A 3NPSA 4I31A 3AAUA 4JZ1A 1Y3YA 2ZGJA 1MKXK 1EKBB 1P11E 1WV7H 1VZQH 3Q00A 2M5TA 1MTNC 1NPMA 3A7YA 5EODA 3QUMP 1X7AC 1XM1A 3M5LA 5GWZA 1KLTA 1YCPH 1AVWA 5DPAA 4AB9A 1SI5H 1MTSA 1O3LA 1BTYA 3S7HB 1RIWC 2Y81A 1ESAA 1FY4A 4NFEA 2RA0A 1QHRB 1O2UA 1IQIA 2UUKB 4K60A 2PW8H 5T6GA 2ILNA 4ZUHA 4X0WU 4E7RG 1C5NH 1EPTA 2H1UA 3ATMA 1ZJDA 1UVSH 1O3DA 5EQSA 3KNXA 1WQVH 1KLIH 3SJKA 1QTFA 1F5RA 3MH7A 2P3UB 3A7TA 1QJ1B 1IOEA 1FLEE 2QY0B 3RXLA 1E34B 2ZFTA 1MKWH 1A5GH 3SU3A 1MQ6A 3QX5H 2WV4A 4GVUA 4RKJB 3RP2A 3T25A 3U69H 4WVPE 1ANDA 1T8MA 2HVXA 1F5KU 2PR3A 3A7XA 1LQEA 2XXLA 5DJ7A 3RU4T 1AGJA 1PPBH 3P6ZB 1H4WA 1GBEA 1PQ8A 1HJ9A 2GTBA 3R3GB 1BTUA 2A5KA 2J92A 3ZVCA 4ZKNU 1PQAA 2UWOA 2Q6GA 1TNGA 3PYHA 1QJ7B 1BMLA 2BD2A 2TRMA 2TPIZ 1C4U2 4JK6A 1THPB 2WYGA 4ABDA 1C9PA 4ZXYH 5FX6A 1UTKA 2XYAA 1XUKA 3OSYA 2ZU4A 4X2XA 2WPHS 1TA6A 5EPYA 1TONA 3QWCH 1G30B 4YESB 9LPRA 1AI8H 1WYKA 3SNBA 1A5IA 1UTOA 1O33A 1GI9B 1CE5A 1CT4E 1A2CH 1CT0E 4KTCA 5IDKA 1O2IA 3BIVH 2D1JA 1Y3WA 2ZCHP 2PHBA 5B6OA 3TJOA 1EAUA 1DFPA 4GLYA 3EGKH 1TNHA 1HPGA 1GPZA 2ZIQH 3MU0A 4Q7XA 1SFIA 3FP6E 3UNSA 4ABHA 3KF2A 1JWTA 2FYQA 1HAHH 4BAHB 3SV9A 4ESTE 4D7FA 2VVVA 1AFQB 3KCGH 1KDQA 4MPWA 2VNTA 5C67A 1GCTC 1HAVB 2BB4A 1EAWA 1NU9A 2FODA 1LVYA 2ODYB 5JBCS 2V6NA 2VGCC 1IQJA 2PSXA 1DPOA 3VFEA 5E2PA 3UOPA 3UWIA 5DP5A 3GISB 4FU7A 1KSNA 3W95A 4XE4A 1OYTH 1T4VH 4FUIA 2ZQ1A 1FY5A 3GCOA 1RD3B 2XBWA 1O2XA 1ACBE 3PLPA 2Z7FE 3ATIA 4X8UH 3R0FA 1HGTH 2GZ7A 3PMJA 2P94A 1FXYA 3VB3A 5JB9S 1S0RA 3UTUH 4DVAU 2ESTE 3ZZ4A 1Z8GA 1XVOA 2B9LA 1GJCB 1QQ4A 3V12A 1E37B 4CHAB 3M7UA 3BEUA 1VGCC 4ZKSU 3P8OA 4OS7A 1TGSZ 3TGJE 1EXFA 1GI3A 2QXJA 1ZGIA 3B23B 1LPGB 3GY4A 1B7XB 2ZPSA 3DFJA 2GD4B 1O5CB 5LPFA 3BN9A 5GXPA 1DLEA 1KXBA 1WQSA 1UVUH 1TWXB 1GBFA 4NA9H 3QN7A 1QA7A 2CV3A 2FOMB 3V0XA 1LHDH 3HK6B 3SN8A 4Y71A 2J34A 4BOHA 2R3UA 1UTLM 1MQ5A 2FOFA 1RJXB 3BTTE 1O3FA 1JOUB 1C4Y2 1N6XA 3SORA 1ARCA 1GGDB 1C1TA 2D2DA 3GCTG 1BMAA 2UUFB 4FUJA 2VIOA 3RXJA 3ZZ5A 2FS8A 1AU8A 4Y8YA 2ULLA 4MDSA 2FTMA 3T62A 2CN0H 1SGFA 2BY9X 2ZHWH 3T29A 1NESE 2WPLS 4GUXA 4AYVB 2GV6A 3UFAA 1AVXA 5FBIA 5TCCA 1K1PA 1KTTB 4I33A 1MU6B 1O2OA 4K69A 1PJPA 3NK8A 1SQAA 2R0LA 1K1IA 4X6PA 1KY9A 2EEKA 1C9TA 4O97A 2PV9B 3A81A 2XC4A 4ABEA 3GCNA 4DIIH 3S7KB 3T27A 2G4UA 2Z9JA 4JK5A 1HXEH 1BJVA 4U2WA 1G3EA 1SOTA 4SGBE 3STJA 2HNTF 1MZDA 1VITH 4DIHH 1GHAF 2J2UA 1NO9H 2EI7A 1IQKA 2BDHA 2ZTYA 1HAVA 1WTGH 2ODQA 2FOEA 1FDPA 1TB6H 1NN6A 2TIOA 1C2MA 3ZVDA 2BX4A 3M37A 2QXGA 1GHXH 1FNIA 4BAQB 1SLVB 1ELEE 1MU8B 1D3DB 3A86A 2SGAA 5C1XA 1GCDA 3PO1C 3ZZBA 2PTCE 1HCGA 3ZV8A 5FPTA 1O5DH 1GMDG 3FZDA 4WXIA 3AW0A 4NIXA 1TMBH 5FX5A 2WV5A 2AS9A 4FU9A 3ZV9A 1QL9A 1NRQH 1ZMLA 1CGJE 4DY7B 2A7HA 4B71A 3UOUA 3VGCB 4ABIA 5ESBA 4AZ2B 3TPIZ 1AWFH 1GI0A 3M61U 2QXHA 4ISHH 1EJMA 1IQLA 3VB7A 3EYDA 1GI8B 1E35B 1QB6A 1GBJA 2GGVB 4BTIB 2SGFE 5GCHF 4D76A 1E38B 2GMTC 3BEFB 1HB0B 3LONA 2JETB 1O2YA 3PROA 3SV8A 1S6FA 1AD8H 3SQHE 4D9RA 2AYWA 3LDXH 7GCHG 3BV9B 3OY5U 5EXLA 1DS2E 5FBEA 5L2YH 1FZZA 1GBMA 3V13A 1O3IA 4X6OA 2GT8A 2G5VA 5FCKA 1P3EA 1AUTC 1F92A 2FX4A 1S83A 2OQUA 2H9EH 2ZECA 1J17T 3TH4H 3LKWA 2WPJS 1ZLRA 1C2DA 3U1IB 3FZZA 2BVSH 3M3TA 2A4OA 4O3TA 3SNAA 1PYTD 1P04A 2A4QA 3A88A 3FP7E 1HYLA 2PKSB 2TBSA 3TGIE 4FUDA 2D26C 1K1LA 4IN2A 1ZR0A 4ABFA 1O5AB 1O2QA 2ZWLH 1TBQH 2ZKSA 3MNBA 1BZXE 2HRVA 1P2NA 1JBUH 1S6HA 1HAYB 1GHZA 2HWLB 3A87A 5C5NA 2OC0A 1NY22 2J95A 1O2MA 1XKAC 3GYLB 2ZPQA 1VCPA 3Q77A 4MPXA 1EAXA 4UDWH 3QDZB 3QTVH 3MU1A 4JZFH 2D8WA 4NA8A 4H6TA 5ETXA 3TK6A 2QYIA 2XNIA 3GY7A 1BBRE 1Z8IB 2BZ6H 1C2JA 2A32A 4Y76A 1Q3XA 4RN6A 1D6WA 4UD9H 4UFGH 3VB5A 4FUCA 1GL0E 1DANH 3RXMA 2FLRH 1ANBA 1QBNA 4H42U 2FIRH 2XC0A 2ZTZA 2XBVA 3MHWU 4OS1A 4UFEH 4WJG2 3TVJB 3A8BA 1EP6A 4NG9H 3GY8A 5EW2H 2W26A 4ABGA 1AE5A 1A3EH 2V3OH 2ZDLA 5FPSA 1C2IA 2GP9B 5I25A 4Z6AH 4CRBA 1TA2A 1Q2WA 2A5IA 3ZZAA 1ZMNA 1YLDA 4UONA 1QA0A 4AFQA 3A7WA 3HKIB 3I29A 2ZFPH 1OWIA 3CS0A 5EQRA 2RG3A 1UHBB 3BG4C 5J4SA 2P95A 3F68H 1O2TA 1AO5A 5K7RA 1SC8U 1O2SA 4Q2KA 1P02A 3SU6A 4X2YA 1HUTH 2H6MA 2SGQE 4ISNA 3P8NA 1A0JA 3I77A 3F1SB 3SHCH 5HMAA 2B8OH 2A31A 2AGEX 1QFKH 5DKMA 2EI8A 2ZTXA 1O2LA 2W7UA 3MNXA 4KGAA 4TPYA 3LGVA 2F3CE 1ZMJA 3ZZDA 3RC6A 5JBAS 1B0FA 1QL8A 2Z3EA 4ABAA 3L6PA 1O3GA 1DICA 1JRSA 1ZSLA 3RC5A 4IW4E 1D4PB 1LVMA 1TNIA 2WUCA 4H6SB 5E8EH 1O3EA 4IC5A 1G32B 1C4V2 1O30A 2A5AA 3LJJA 3FAOA 4BXSA 2H9HA 2VWNA 2G5NA 1V2UT 1UCYH 2Y6TA 2B7DH 4BXWA 3MWIU 1DSUA 2F9PA 2W3KA 3LGYA 2VIPA 3S9BA 4X8VH 3SU1A 3K6YA 2OBOA 2OP9A 2ZP0H 5JPMH 1XXDA 5FCRA 8ESTE 2QXIA 4KELA 3FP8E 1CVWH 2QC2A 1C5OH 1GI1A 1IAUA 1YC0A 3D62A 1C5UA 1L4DA 8GCHG 3HATH 1O32A 2WPMS 3NWUA 3KEEA 3SO3A 3F6UH 1G2MA 1DDJA 2FXRA 1W14U 2NU3E 4NZQA 3VEQB 2CGAA 3GCHC 6GCHF 2YOLA 3GDSA 1BTHH 1A3BH 4XBBA 3M7QA 1L2EA 2BVXH 1FUJA 2FM2A 2AMPA 4E7NA 4KKDA 4NIWA 2GDDA 2PGQB 3EE0B 2AGIX 1ZTKA 2HNTC 1AY6H 1QB1A 1YPGH 3RUOA 4HZHA 4Y7BA 4A1TA 3LJOA 4K8BA 4Q80A 5GIBA 4TY6A 3Q3YA 2GX4A 3MTYA 3ZVAA 1A1RA 1HJAB 2BY7X 3QTOH 1AMHA 1XVMA 4FUGA 2ALVA 5H4IB 1J15A 1DWCH 1LHEH 1AFQC 1WCZA 2DUCA 1BHXF 3KGPA 4GCHG 1UVTH 1P06A 4ISOA 2NU2E 1NROH 1P2OA 1PQ7A 5F8ZA 4WF8A 4CREA 1C5MD 3O8BA 1C1QA 2VVUA 4AFZA 3LGWA 1AB9B 1W13U 1VR1H 3AASA 5EQQA 1S85A 2FTLE 1UHBA 2C8WB 4DJZB 1O3AA 3BTKE 3KN2A 3AAVA 3QGNB 3EDXB 4WY3A 2PTNA 2WPKS 4WMFA 3TNSA 3PM3A 4ISLA 5E0JA 1SGRE 3A85A 3GYMA 3ZZ9A 1H8IH 4DURA 1KXEA 3U98H 2GZ8A 1OWHA 1SGQE 1TRNA 3PLBA 1K22H 4BAMB 2Y80A 3F9FA 1UK3A 4CR5A 1CGHA 1NFXA 4R8TB 3NCLA 3E8LA 1P2QA 1EAIA 1GBBA 1P9UA 4MG3A 5C5OA 1KXCA 4ZAEA 5CHAB 1QB9A 1QCPA 2XBYA 1UCYE 5G4BA 2SFAA 4YLQH 5T6FA 3UY9A 1YGCH 3SU5A 3ZYEA 1ZTJA 1W3CA 1LTOA 1DM4B 3HPTB 1ELTA 3WY8A 1SGPE 4ASHA 1K1JA 5FXLA 1HLTH 1SLXB 2QIQA 1OOKB 3UQVA 3DFLA 5EU8A 4A92A 1W12U 1ZPZA 1F7ZA 4GHTA 2QCYA 1O2HA 3IWMA 1TRYA 2BLVA 2PWXA 2O8WA 4A1VA 1DT2A 1ELFA 3E0PB 1A5HA 1NM6A 4CRGA 1W0YH 1HJ8A 3F9GA 1J8AA 1FV9A 5A8XA 4WMEA 4B2BA 3ZZ7A 1XUFA 1MCTA 1NRNH 1GL1A 1GGDC 4VGCB 5BRRE 2PUXB 4CRFA 2ZU3A 4Y8ZA 1XKBC 2HNTE 1EX3A 4YOIA 5HM2A 3OX7U 2Y5HA 3PV4A 3SUEA 1KXFA 1GI2A 1CA0B 1SQTA 1GI4A 2OC8A 3P8GA 1TE0A 4NCYA 4ZHMU 3GDVA 1PPEE 2FI3E 1GBCA 3BTWE 3CS7A 1Z1JA 4WH6A 2BQ7B 3MNSA 4YTAA 1H1BA 1AUJA 2A7JA 3CENA 3RDZA 3RXFA 1ELAA 1T8LA 1YP9A 5FAHA 2OBQA 2C8XB 3SGBE 1G37A 1IHTH 6ESTA 2CHAB 1FPCH 1GBLA 1BRCE 3U8TH 3RMLH 1KLJH 1FIWA 2EC9H 4CRAA 1O2PA 3SJ8A 3E3TA 1LDTT 1YKTA 1SHHB 2BD3A 1P03A 1ETRH 4JMYA 1CSOE 3HGNA 2AIPA 3KIDU 1TAWA 2F9NA 3BTQE 3D65E 2OD3B 1SMFE 2BDAA 3BEIB 4MNVA 4BTTB 1MD8A 3RXCA 4X1NU 5F8XA 3SUDA 1PPHE 1W7GH 1OP2A 1GHVH 1TNJA 1TNKA 2BD9A 1SR5C 3Q3KA 1MTNB 2FLBH 1CBWC 3URCA 3A8DA 1TPPA 2BQ6B 2R9PA 1TYNA 4CH2B 3S0NA 2ZPRA 4INHA 1YPJH 1Y3XA 1O31A 2G8TA 1RIWB 5JDUB 1BOQA 4AN7A 5A8YA 1DWEH 2TGTA 3PMAB 2XTTB 1TGBA 2O8TA 5FHTA 1CHGA 2UWPA 2XWAA 1O2NA 2ZDNA 3SZNA 1CGIE 2RA3A 1FMGA 4BAOB 3NKKA 2HLCA 1LKBA 3LU9B 1IQHA 1GBDA 3A84A 4MLFB 4RSPA 2W5EA 3H5CB 1HDTH 3RM2H 1ZHRA 1UTNA 4Y0YE 3ZZ6A 1GHYH 1G3DA 1GMDF 1VJ9U 3T2NA 1WUNH 2ZG0H 2ZDAH 2XCFA 4Y7AA 1FY3A 1C2FA 1RGQA 1BTWA 2JETC 1UTMA 1UK4A 2VVCA 1O3NA 1ESTA 1OWEA 1SGYE 1H8DH 3EA9A 4FUBA 3IITA 2ZA5A 3D49H 5AFYH 1DWDH 3MO6A 9ESTA 5LPEA 3Q3XA 3SI3H 4NWLA 1P12E 1ZHPA 4HGCA 3M36A 5HM9A 1LQDB 3BTME 2VB0A 1GI5A 2TGAA 2XC5A 2C8YB 5EXNA 1CA8B 4CBNA 1EJAA 1RTFB 3U1JB 1BRAA 2R2MB 3F9EA 5DP6A 1BIOA 3TU7H 5T3HA 3TITA 1KIGH 5F03A 3SJOA 1GVLA 4FXGH 1YCPK 2ALPA 1BJUA 1INCA 1N6YA 1GCTB 1ELBA 1ZGVA 1AFEH 1SFQB 4ZHLU 4Y6DA 4WWYA 2ZHDA 2VIDA 4LOYH 2V35A 1ZZZA 4Y10E 2VGCB 4GSOA 3DUXH 3SV6A 2VWLA 3KQDA 2A0QB 4JZIA 3MH4A 3RXKA 4K1EA 1MBQA 1GDUA 3JZ2B 2BLWA 1K28D 2BY6X 3LGTA 3UIRA 4A6LA 1N8OB 4KTUA 1BCUH 3CP7A 4BANB 2K1QA 1HAOH 1MKWK 4K1TA 4CBOA 2OTVA 3MH5A 4D8NA 1TX6A 2Z9GA 3OTJE 1D9IA 3RXEA 3E1XB 2XRCA 3ZZ8A 1JXPA 1GJAB 3UUZA 1VCQA 1SLWB 4B74A 4X1SU 1CHOF 1D6RA 2VIVA 4U32A 3BSQA 1E0FD 1HAIH 1S84A 1QBVH 1WU1A
chains in the Genus database with same CATH superfamily
3RXOA 3SV7A 3ZVFA 2BLQA 1QRWA 1BTPA 3M5MA 1J9CH 2BY5X 2FI4E 5F53A 4B76A 3LC5A 1FY1A 4AORA 1C1SA 2A7CA 4FVBA 3EAJA 3MNCA 3NXPA 4E06H 2NU4E 1V2NT 5F6MA 2Y82A 1DUEA 4P02A 4DW2U 1Y59T 1E1RD 2TGDA 2IPQX 1H9HE 3GY3A 4YLUA 3RXSA 1HAGE 3ZZCA 4A5TS 4AG1A 2ANKH 1K0HA 1EPTC 3UNRA 2VJ1A 2SGEE 2FOAA 2O8MA 1O3OA 4WMDA 3LPRA 1UTJA 1ZSKA 2GT7A 5J4QA 2P8OC 1MKXH 2ZHFH 4FOUC 1GJ6A 2A4RA 2WPIS 1LVBA 1WBGB 3DT0H 3DHKH 2BXUH 3SNDA 4B2AA 4YM9A 1O3CA 2HOBA 6LPRA 3ESTA 3RXQA 1TOCB 1GMCF 4CRDA 1O38A 2FOGA 1GHAG 4JYUH 3RU4E 1DY9A 1AZZA 3GDUA 3SI4H 3GOVB 2BDYA 4B6EA 1KXAA 2PUQH 1GDNA 3LOXA 2SGPE 3N99A 1S81A 1SVPA 1W0JD 5TCAA 3P17H 1Q31A 1ELGA 1YPKH 1NZQH 1HAXB 5C2ZA 4K3JA 2K0QA 1TPSA 1WAYB 2Z94A 1YPHC 2C4FH 4K8YA 2J9NA 2ZDKA 1GMHF 1AWHB 4NWKA 5EGMA 1PPFE 4ZKOU 4FUHA 1NFUA 4JCNA 1SKYE 3SUGA 2J38A 1C1PA 4DG4A 1LPZB 1GBHA 4I8GA 1HNEE 1NRRH 3M3VA 1O34A 1BRBE 1TGNA 1FJSA 1JIRA 3T28A 6CHAC 3PO1B 3UQOA 3A80A 1CQQA 3RXPA 2IJOB 1FN8A 4LZ4B 1EFRD 1OYQA 1N1LA 4INKA 4YOJA 3QZRA 2BQWB 1O2VA 5GCHG 2ZEBA 4MNYA 4ZCNA 1H9IE 3RLYH 1WSSH 2F9UA 2ZZUH 3M5OA 8GCHF 4X6MA 2VIQA 3RXVA 1O2KA 2GCHG 2QF5A 5LPRA 2RFKC 4YOGA 1O36A 4MVNA 1QIXB 1DVAH 5C94A 1GJ9B 1GVZA 1ETTH 2BDCA 1IQMA 1FY8E 5DP7A 1LHFH 1ZTLA 2ZFQH 2ZHQH 2WUBA 1K21H 2P3TB 3SNEA 2R3YA 2ZFFH 1V3XA 2GMTB 3BIUH 1HIAB 1NRSH 1O2JA 2QF3A 2B5TB 1K1NA 1W11U 1PQ5A 2LNCA 3LC3A 2J5UA 3U28C 2Q6FA 4ZKRU 1TOMH 1XUJA 2VWMA 1S82A 1BUIA 3MYWA 3TIUA 2ASUB 2VH6A 5JBBS 1SG8B 1BMFD 2UUJB 3P92A 3E91A 2BDGA 1O39A 1FIZA 1Z8RA 3LIWA 4GCHF 4GPGA 1BMMH 1W10U 1QQUA 5EXMA 1W7XH 2Z6BD 4BNRA 1C5SA 1H9LB 2FESH 3B9FH 3RXGA 1ZOMA 2ZU5A 1UTQA 2BOHB 1S5SA 1ZYOA 2F9OA 2V3HH 1GJDB 1EATA 2VWOA 2AFQB 3QLPH 1MZAA 1YPHE 3K2UA 1GBAA 2JH0D 3TJNA 1ANCA 1T32A 1MAYA 1ZRBA 5ESTE 5EPNA 1O3BA 1SGIB 1SL3A 2OC1A 5C20A 4A7IB 3LH3A 2Z9IA 1BBRK 1T7CA 4NA7A 2KM0A 2GKVE 2CXVA 4Q7YA 2NU1E 5EG4A 3A8CA 2IN2A 5FPYA 3S9AA 4Q7ZA 3TH3H 5C17A 2FP7B 1AHTH 1TPOA 4Y0ZE 4YT6H 1W8BH 4ZH8A 3OY6U 3M3SA 1ESBA 2QGRA 1DY8A 3SU2A 3GS9A 1SPJA 1RXPA 5GJ4B 1NRPH 2HGTH 1LVOA 4K5ZA 2BDIA 1BRUP 1O37A 3LH1A 3RC4A 2RDEA 4ACAA 1XUIA 3MO9A 4AC9A 1E79D 1DE7H 2PFEA 1Z6JH 2FX6A 1GG6B 1GBKA 5SGAE 4RKOB 1NU7B 1OXGA 4I7YH 3ZVEA 1GVKB 2Y7XA 4DT7B 1F0RA 1UW7A 1H8ED 1C5YB 1FAXA 1OS8A 1ELCA 1EZQA 4E05H 1SQRA 1XUGA 1QBOA 5BPEA 3SGAE 4I8KA 4KP0A 2G55A 4HFPB 4WH8A 1WTHD 4QT8C 2QF0A 1B0EA 4Q4LA 1FAKH 4XFQA 3PTBA 1A46H 5C1UA 3VG8A 1TRMA 2ZO3H 3ZVBA 3ZVGA 1TGCA 5HGGA 4CRCA 1KMHB 2DE8A 1O0DH 3BG4B 4FU8A 3RMNH 1DUAA 4IS5A 1GHWH 1O2RA 1TALA 1QR3E 3ENSB 1ZPBA 3HGPA 4MTBA 2JKHA 2V0BA 4ABJA 1HIAA 4YZUA 3HKJB 1J16A 2FYRA 1V2JT 2XCNA 1DITH 2JH6D 4D7GA 1MTUA 1AE8H 4OM9A 4ABBA 1A4WH 2EA3A 2ZDVH 4CHAC 1WXRA 4TWWA 2BX3A 1FX0B 4K2YA 2QV1A 1C5LH 1OPHB 1YCPM 4F48B 2ZHEH 1ZJKA 2AEIH 3PWCA 3U8OH 3D23A 4AFSA 1BTZA 3MU5A 3EA8A 3RXHA 4CR9A 4FUFA 1O35A 1XMNB 1F0TA 4JYTA 5JBTA 3RXRA 1XX9A 1C1OA 3UWJH 1YBWA 1V2LT 1NC6A 1RRKA 1GHBG 1S0QA 1C5XB 1K9OE 4INLA 2Y7ZA 3K9XB 5JYIA 1SOZA 3SNCA 2G00A 4TYDA 4OS4A 4X8SH 1C1RA 3UR9A 3ITIA 3RXDA 4AYYB 3MU4A 1C5TA 4TY7A 2CMYA 3SJIA 3PWBA 1VITG 1VJAU 6GCHG 3H7TA 1NBME 1Y3UA 3KQEA 3NUMA 3FANA 2F91A 4Y8XA 3KL6A 1TBRH 3FN8A 5LH8A 1V2MT 4UFFH 1FI8A 3A7ZA 3P8FA 1BA8B 3H09A 1JMOH 2DE9A 7KMEH 2AIQA 1LHGH 1O3KA 4X1PU 4GAWA 3S9CA 1SHYA 1OKXA 2ZCLP 3KHVA 4ZXXH 3P95A 3DA9B 3GCHB 5T6DA 1BQYA 4MPVA 1GBIA 5HKKD 2OLGA 3F9HA 3ZZ3A 1QRZA 3GY5A 3MOCA 3GCTF 1HFDA 1MUEB 4ISIH 4UEHH 1DX5M 4NSYA 5E0HA 2GJGA 1Z6EA 4AOQA 1M9UA 1O2ZA 2QN5T 1SB1H 5DP4A 3ATLA 1EQ9A 1SGNE 2BMGB 2FDAA 2C8ZB 1O2GH 1QRXA 2WINI 1P10A 4K1SA 3QZQA 2A2XH 2GCTB 2VIWA 1BTXA 3RM0H 4SGAE 2KZ4A 1GBTA 4JZDH 5T1VA 1P2IA 1C2KA 2H2ZA 2ZU2A 1UVOA 2B0FA 2BD4A 5F8TA 4NIYA 4MQAA 1V2PT 3OFND 1NT1A 2BYAX 1SBWA 8LPRA 1ZHMA 3QK1A 1UMAH 2P93A 5DP8A 1LKAA 4U01A 3TLOA 5GDSH 4THNH 1BMNH 1P2JA 3K65B 2THFB 1TBZH 5DK1A 3PMHB 2JH5D 3SQEE 3RMMH 1KYNA 3JZ1B 1MD7A 2C90B 2JIZD 3SU0A 4JYVH 3KQBA 1EZXC 1N8OC 2A45B 3GY6A 4UE7H 4YO9A 3OU0A 1FN6A 2BXTH 1Z7KA 1OSSA 1UCYK 1L1JA 2AGGX 1JRTA 2OINA 2FOCA 1EOLA 3TJVA 4IN1A 3VGCC 3E90B 4B75A 3OEED 2BTCE 1Z71A 1OWJA 1P8VC 4X2WA 3VPKA 3S69A 4XBDA 2OK5A 2Z9LA 5DP9A 1EUFA 1T4UH 4DGJA 1Z1IA 1ORFA 3RXBA 5CE1A 2O9QA 3A82A 3TK9A 1IQFA 2A1DB 5IK2D 2ZFRH 2TGPZ 5ABWA 1ID5H 4ZMAH 3RXIA 2H5CA 2YNAA 2J97A 5EW1H 1IQNA 1OP0A 4TPIZ 1OWDA 2C3SA 1ANEA 1T31A 1L1NA 1YWUA 3VXFH 3PLKA 4DCDA 1DLKB 1NFYA 3C1KA 7LPRA 1A7SA 2CJIA 4AX9H 2BY8X 1G3BA 1UTPA 2STBE 3O8RA 1C1MA 4U30A 2FO9A 3V7TA 1GJ8B 1YLNA 4I32A 1Y5BT 1WOFA 1QURH 2OUAA 1BDAA 4AGKA 3SV2H 1AQ7A 5LGOA 4I8JA 4X1QU 1L4ZA 3DCLA 4M7GA 5AFZH 2HPPH 8KME2 2O8LA 4I86A 1HBTH 1FQ3A 4MPUA 2Z3DA 2BDBA 7GCHF 3DD2H 3W94A 1EB1H 4IBLH 1C5VA 2PKSC 2FS9A 1K1OA 3FVFB 5IYTA 5TJXA 4B1TA 1GJ4H 1K1MA 1KXDA 1W2KH 2FWWA 1V2WT 5C1YA 1K2I1 3RXAA 3Q76A 1V2QT 1EZUC 4NFFA 2NWNA 3SZEA 1QY6A 1SSXA 1TABE 1THRH 1GDQA 2A4GA 3CNRA 5EJZA 1U6QA 4NZLA 5DP3A 4Y79A 2OC7A 5GPIB 2G51A 3SBKA 3FOAA 4KTSA 3WWFA 4NSVA 2VH0A 1AKSB 1NS3A 2HPQH 4AB8A 4X2VA 1ABJH 4IC6A 3STIA 2AH4X 2I6SA 2KAIB 1P57B 1XUHA 1P2MA 1V2OT 5I46H 4O3UA 2ZCKP 1HV7A 2YNBA 3MH6A 1BB0B 1CBWB 2W3IA 4CH8B 3UPEA 2GVFA 2PSYA 7ESTE 1A0HB 5JB8S 1C2HA 2G52A 1THSH 3GICB 2Y5FA 1AN1E 3A89A 1A61H 2H5DA 3MFJA 1O5EH 1TX7A 3RU4D 4B73A 1VGCB 2ODPA 3A7VA 2R0KA 1P09A 1AVGH 5A09A 1BBRH 1BT7A 2QAAA 1C5ZB 1SGEE 4LK4A 1TX8A 2CF9H 4X6NA 1DXPA 3UNQA 1O5GH 1P9SA 3EQ0H 4H4FA 3L33A 2W7SA 2Z9KA 1TIOA 5DGJA 1UVPA 4XOJA 2WPDD 2SGDE 3QO6A 4ZROA 2PKAB 1TPAE 2BD7A 2O8UA 3ELAH 4JZEH 3UR6A 5L30H 1F5LA 1YPMH 3URDA 4X1RU 1V2VT 3O8CA 1G2LA 4LXBH 2UUYA 3SHAH 1UJ1A 4OS2A 3OYPA 2YMSB 1RS0A 4HTCH 1QGFA 1SGFG 2XW9A 1PYTC 5K0HA 1GJ5H 1P0SH 3I78A 3RXUA 2P3FH 3L3TA 5A0AE 3OE7D 3BTFE 2GCHF 3SOSA 1L1GA 1EOJA 4BAKB 1T8OA 2AERH 3SJ9A 5A0CA 1F2SE 4F49A 1GJBB 1CU1A 1MMJN 1YF4A 1OX1A 1G36A 5EIYA 3PV2A 1HRTH 2EI6A 5CMXH 1C5RA 2RCEA 1B5GH 1P2KA 2ZGXH 4XDEA 1Y5UT 2R2WU 4J1YA 1RTLA 2BLOA 3A8AA 3F0OA 3PMBB 1AZ8A 1GI7B 2ANMH 3AVZA 3NZIA 2GZ9A 3TK5A 4XRNA 1O2WA 1ELDE 4D9QA 2IPHA 1G9IE 2BD5A 2FOBA 2OXSA 1JIMA 2FEQH 4IMQA 1W0ZU 2AMDA 2BM2A 3BF6H 5L6NH 4MNWA 5A2MH 3P70B 4GHQA 1PPCE 1ABIH 3LGUA 2EQNA 1CO7E 3O8DA 2LPRA 2NU0E 2FZZA 4F4OC 1IHSH 5DSFA 2BHGA 4XBCA 1HAPH 4J2YB 4R0IA 1HXFH 2FI5E 4XSKU 1AKSA 1C5QA 2STAE 2UWLA 1SLUB 1T8NA 1QZ8A 1SGTA 4YT7H 2VBCA 2KAIA 1XXFA 1PPZA 4X8TH 1SQOA 1YYY1 3QGJA 1IQEA 3BG8A 4OGXA 2C93B 3OAAD 1TNLA 4MNXA 1CHOG 5C3NA 1C2GA 3PB1E 2Y5GA 1PPGE 1OP8A 2BD8A 2F43B 3T5FH 4B2CA 1DWBH 2F9BH 2XBXA 3ODFA 3BTEE 4FVDA 3A83A 1Y8TA 1DXWA 4TWYA 1SGDE 1GG6C 3PTNA 2BZAA 2ZGBH 1QL7A 3ZYDA 1BHXB 5E2OA 1MTVA 2W6JD 1ELVA 1O5FH 1Y3VA 4NGAH 3RLWH 1HJAC 1C5WB 2G81E 1ARBA 3MU8A 2Q6DA 3U9AH 3RMOH 4I8HA 4AFUA 1D3TB 3LGIA 3UREA 3EA7A 1O3JA 1V2RT 5DG6A 2PGBB 1V2KT 1EB2A 3E6PH 2FMJA 1EASA 3M5NA 1UK2A 1E36B 2Z3CA 2SNVA 2I6QA 2PKAA 1HAZB 4AG2A 1LHCH 1Z8JB 1P3CA 2Q1JA 4O9VA 1AIXH 5L2ZH 1TQ7B 1AB9C 2G4TA 1MBMA 2VU8E 1TFXA 3C27B 3T26A 1FPHH 3TNTA 1VCWA 1O3PB 1V2TT 2CK3D 1D3PB 4LZ1H 1GMCG 2BVRH 3SGQE 2ZNKH 2QF4A 1IQGA 2FPZA 3F2FA 4F55A 1EPTB 3V3MA 3AW1A 1TMUH 3VB4A 2RDLA 1BITA 3SW2B 1C5PA 2BOKA 2ZF0H 4DOQA 3MO3A 5HXFA 5EOKA 1Y5AT 2P8OB 2ZU1A 3BTHE 1C1VH 1RTKA 2ANYA 2XWBI 2A2QH 3IG6B 3SYJA 2ZQ2A 1O3HA 4ACBA 2VINA 1TGTA 5A8ZA 1C2EA 1RFNA 1MCVA 2OCVB 4OS6A 4ZHAA 1O5BB 1F0UA 1YLCA 5CHAC 4PROA 5E0GA 1P01A 1MTWA 1V2ST 3SUFA 1OWKA 3TH2H 3VXEH 4BTUB 1ETSH 3SU4A 1J14A 1GMHG 1F0SA 1CT2E 2QA9E 4O03A 3BTDE 5AHGH 5A0BA 1TQ0B 3KQCA 5AVDA 2SNWA 4OS5A 3VB6A 5EJLA 1TLDA 1C2LA 1FONA 4HI3A 3E0NB 4WXVA 5DO4H 2FOHA 2F83A 2HALA 2CF8H 1QNJA 1P05A 1DOJA 4FUEA 4UFDH 4AGJA 3G01A 3ATWA 3BTGE 3K6ZA 2GV7A 2ZDMA 1UO6A 1YPEH 3LT3A 4OGYA 1C1NA 2H9TH 3F2GA 5C0TA 1TMTH 4VGCC 3TJUA 2GDEH 1SGCA 4NIVA 1GHBF 2PLXA 1OHHD 2ZC9H 1A0LA 1MAXA 1PFXC 3M35A 3RXTA 1EJNA 1YM0A 3ODDA 4A1XA 1CA0C 1EZSC 4IMZA 3N7OA 1QJ6B 2J4IA 3B8JA 6CHAB 4Z0KA 1VITF 4Y11E 1KTSB 1G3CA 2ANWA 1LMWB 5PTPA 1LO6A 2ZI2H 2ZFSA 1NTPA 1LPKB 2J94A 1O3MA 1V6DA 2P16A 3E16B 4IGDA 1GI6A 1YPLH 2F9VA 2CHAC 1C1UH 1KDQB 2WYJA 3U8RH 2AMQA 4I8LA 1GWAA 5CDFE 5HYOA 1D3QB 1DSTA 2ZGHA 3GY2A 1ZSJA 5AF9H 3H7OA 1NBMD 1MH0A 1GJ7B 1ZRKA 2P59A 3ATKA 3HK3B 3M7TA 1ZPCA 3MMGA 1C1WH 3FFGA 2HLDD 3TGKE 2IOTA 1NFWA 2GCTC 1L0ZA 2ZGCA 2OQ5A 1LCYA 3MI4A 1EP5A 3NPSA 4I31A 3AK5A 3AAUA 4JZ1A 1Y3YA 3OEHD 2ZGJA 1MKXK 1EKBB 1P11E 1WV7H 1VZQH 3Q00A 2M5TA 1MTNC 1NPMA 3A7YA 5EODA 3QUMP 1X7AC 1XM1A 3M5LA 5GWZA 1KLTA 1YCPH 1AVWA 5DPAA 4AB9A 1SI5H 1MTSA 1O3LA 1BTYA 3S7HB 1RIWC 2Y81A 1ESAA 1FY4A 4NFEA 2RA0A 1QHRB 1O2UA 1IQIA 2UUKB 4K60A 2PW8H 5T6GA 2ILNA 4ZUHA 4X0WU 4E7RG 1C5NH 1EPTA 2H1UA 3ATMA 1ZJDA 1UVSH 1O3DA 5EQSA 3KNXA 1WQVH 1KLIH 3SJKA 1QTFA 1F5RA 3MH7A 2P3UB 3A7TA 1QJ1B 1IOEA 1FLEE 2QY0B 3RXLA 1E34B 2ZFTA 4Z1MD 1MKWH 1A5GH 3SU3A 1MQ6A 3QX5H 2WV4A 4GVUA 4RKJB 3RP2A 3T25A 3U69H 4WVPE 1ANDA 1H8HD 1T8MA 2HVXA 1F5KU 2PR3A 3A7XA 1LQEA 2XXLA 5DJ7A 3RU4T 1AGJA 1PPBH 4P00A 3P6ZB 1H4WA 1GBEA 1PQ8A 1HJ9A 2GTBA 3R3GB 3F0PA 1BTUA 1E1QD 2A5KA 2J92A 3ZVCA 4ZKNU 1PQAA 2UWOA 2PP6A 3KYGA 2Q6GA 4RI0A 1TNGA 3PYHA 1QJ7B 1BMLA 2BD2A 2TRMA 5KGOA 2TPIZ 1C4U2 4JK6A 1THPB 2WYGA 4ABDA 1C9PA 4ZXYH 5FX6A 1UTKA 2XYAA 4FETA 1XUKA 3OSYA 2ZU4A 5EJ1A 4X2XA 2WPHS 1TA6A 3NRLA 5EPYA 1TONA 3QWCH 1G30B 4YESB 9LPRA 1AI8H 1WYKA 3SNBA 1A5IA 1UTOA 1O33A 1GI9B 1CE5A 1CT4E 1A2CH 1CT0E 4KTCA 5IDKA 1O2IA 4RT0A 5CHBA 3BIVH 2D1JA 1Y3WA 2ZCHP 2PHBA 5B6OA 2LELA 3TJOA 1EAUA 1DFPA 4GLYA 3EGKH 1TNHA 1HPGA 1GPZA 2ZIQH 3MU0A 4Q7XA 1SFIA 3FP6E 3UNSA 4ABHA 3KF2A 1JWTA 2FYQA 1HAHH 4BAHB 3SV9A 4ESTE 4D7FA 2VVVA 1AFQB 3KCGH 1KDQA 4MPWA 2VNTA 5C67A 1GCTC 1HAVB 2BB4A 1EAWA 1NU9A 2FODA 1LVYA 2ODYB 5JBCS 2V6NA 2VGCC 1IQJA 2PSXA 1DPOA 3VFEA 5E2PA 3UOPA 3UWIA 5DP5A 3GISB 4FU7A 1KSNA 3W95A 4XE4A 1OYTH 1T4VH 4FUIA 2ZQ1A 1FY5A 3GCOA 1RD3B 2XBWA 1O2XA 1ACBE 3PLPA 2Z7FE 1W0KD 3ATIA 4X8UH 3R0FA 1HGTH 2GZ7A 3PMJA 2P94A 1FXYA 3VB3A 5JB9S 1S0RA 3UTUH 4DVAU 2ESTE 3ZZ4A 1Z8GA 1XVOA 2B9LA 2L6OA 1GJCB 1QQ4A 3V12A 1E37B 4CHAB 3M7UA 3BEUA 1VGCC 4ZKSU 3P8OA 4OS7A 1TGSZ 3TGJE 1EXFA 1GI3A 2QXJA 1ZGIA 3B23B 3PV5A 1LPGB 3GY4A 1B7XB 2ZPSA 3DFJA 2GD4B 1O5CB 5LPFA 3BN9A 2XOKD 5GXPA 1DLEA 1KXBA 1WQSA 1UVUH 1TWXB 1GBFA 4NA9H 3QN7A 1QA7A 2CV3A 2FOMB 3V0XA 1LHDH 3HK6B 3SN8A 4Y71A 2J34A 4BOHA 2R3UA 1UTLM 5KEDA 1MQ5A 2FOFA 1RJXB 3BTTE 1O3FA 1JOUB 1C4Y2 2J98A 1N6XA 3SORA 1ARCA 2YMSC 1GGDB 1C1TA 2D2DA 3GCTG 1BMAA 5KECA 2UUFB 4FUJA 2VIOA 3RXJA 3ZZ5A 2FS8A 1AU8A 4Y8YA 2ULLA 4MDSA 2FTMA 3T62A 2CN0H 1SGFA 2BY9X 2ZHWH 3T29A 1NESE 2WPLS 4GUXA 4AYVB 2GV6A 3UFAA 1AVXA 5FBIA 5TCCA 1K1PA 1KTTB 4I33A 1MU6B 1O2OA 4K69A 1PJPA 3NK8A 1SQAA 2R0LA 1K1IA 5B6LA 4X6PA 1KY9A 2EEKA 1C9TA 4O97A 2PV9B 3A81A 2XC4A 4ABEA 3GCNA 4DIIH 3S7KB 3T27A 2G4UA 2HVYB 2Z9JA 4JK5A 1HXEH 1BJVA 4U2WA 1G3EA 1SOTA 4SGBE 3STJA 2HNTF 1MZDA 1VITH 4DIHH 1GHAF 2JJ1D 1NO9H 2EI7A 1IQKA 2BDHA 2J2UA 2ZTYA 2IJD1 1HAVA 1WTGH 2ODQA 2FOEA 1FDPA 1TB6H 1NN6A 2TIOA 1C2MA 3ZVDA 2BX4A 3M37A 2QXGA 1GHXH 1FNIA 4BAQB 1SLVB 1ELEE 1MU8B 1D3DB 3A86A 2SGAA 5C1XA 1GCDA 3PO1C 3ZZBA 2PTCE 1HCGA 3ZV8A 5FPTA 1O5DH 1GMDG 3FZDA 4WXIA 3AW0A 4NIXA 1TMBH 1MABB 5FX5A 2WV5A 2KR7A 2AS9A 4FU9A 3ZV9A 1QL9A 2V7QD 1NRQH 1ZMLA 1CGJE 4DY7B 2A7HA 4B71A 3UOUA 3VGCB 4ABIA 5ESBA 4AZ2B 3TPIZ 2LP6A 1AWFH 1GI0A 3M61U 2QXHA 4ISHH 1EJMA 1IQLA 3VB7A 3EYDA 1GI8B 1E35B 1QB6A 2QE7D 1GBJA 2GGVB 4BTIB 2SGFE 5GCHF 4D76A 1E38B 2GMTC 3BEFB 3KYFA 1HB0B 3LONA 2JETB 1O2YA 3UAIC 3PROA 3SV8A 3FKSD 1S6FA 1AD8H 3SQHE 3N7EA 4D9RA 2AYWA 3LDXH 7GCHG 3BV9B 3OY5U 5EXLA 1DS2E 5FBEA 5L2YH 1FZZA 1GBMA 3V13A 1O3IA 4X6OA 2GT8A 2G5VA 5FCKA 1P3EA 1AUTC 1S6LA 1F92A 2KCYA 2FX4A 1S83A 1COWD 2OQUA 2H9EH 2ZECA 1J17T 3TH4H 3LKWA 2WPJS 1ZLRA 1C2DA 3U1IB 3FZZA 2BVSH 3M3TA 2A4OA 4O3TA 3SNAA 1PYTD 1P04A 2A4QA 3A88A 3FP7E 1HYLA 2PKSB 2TBSA 3TGIE 4FUDA 2D26C 3W1EA 1K1LA 4IN2A 1ZR0A 4ABFA 1O5AB 1O2QA 2ZWLH 1TBQH 2ZKSA 3MNBA 4Q63A 1BZXE 2HRVA 1P2NA 1JBUH 1S6HA 1HAYB 1GHZA 2HWLB 3A87A 5C5NA 2OC0A 1NY22 2J95A 1O2MA 1XKAC 3GYLB 2ZPQA 1VCPA 3Q77A 4B6FA 4MPXA 1EAXA 4UDWH 3DSPA 3QDZB 3QTVH 3MU1A 4JZFH 2D8WA 4NA8A 4H6TA 5ETXA 3TK6A 2QYIA 2XNIA 3GY7A 1BBRE 1Z8IB 2BZ6H 2JDID 1C2JA 2A32A 4Y76A 1Q3XA 4RN6A 1D6WA 3DSGA 4UD9H 4UFGH 3VB5A 4FUCA 3UB0A 1GL0E 1DANH 3RXMA 2FLRH 1ANBA 1QBNA 4H42U 2FIRH 4RT1A 2XC0A 2ZTZA 2XBVA 3MHWU 4OS1A 4UFEH 4WJG2 3TVJB 3A8BA 1EP6A 4NG9H 3GY8A 5EW2H 2W26A 4ABGA 1AE5A 1A3EH 2V3OH 2ZDLA 5FPSA 1C2IA 2GP9B 5I25A 4Z6AH 4CRBA 1TA2A 1Q2WA 2A5IA 3ZZAA 1YY3A 1ZMNA 1YLDA 4TT3D 4UONA 1QA0A 4AFQA 3A7WA 3HKIB 3I29A 2ZFPH 1OWIA 3CS0A 5EQRA 2RG3A 1UHBB 3BG4C 5J4SA 2P95A 3F68H 1O2TA 1AO5A 5K7RA 1SC8U 1O2SA 4Q2KA 1P02A 2WZQA 3SU6A 4X2YA 1HUTH 2H6MA 2SGQE 4ISNA 3P8NA 1A0JA 3I77A 3F1SB 3SHCH 5HMAA 2B8OH 2A31A 2AGEX 1QFKH 5DKMA 2EI8A 2ZTXA 1O2LA 2W7UA 3MNXA 4KGAA 4TPYA 3LGVA 2F3CE 1ZMJA 3ZZDA 2V3MA 3RC6A 5JBAS 1B0FA 1QL8A 2Z3EA 4ABAA 3L6PA 1O3GA 1DICA 3KQ5A 1JRSA 1ZSLA 3RC5A 1VKYA 1D4PB 4IW4E 1LVMA 1TNIA 2WUCA 4H6SB 5E8EH 1O3EA 4IC5A 1G32B 5DN6D 1C4V2 1O30A 2A5AA 3LJJA 3FAOA 4BXSA 2H9HA 2VWNA 2G5NA 1V2UT 1UCYH 2Y6TA 2B7DH 4BXWA 3MWIU 1DSUA 2F9PA 3WW7A 2W3KA 3LGYA 2VIPA 3S9BA 4X8VH 3SU1A 3K6YA 2KFWA 2OBOA 2OP9A 2ZP0H 5JPMH 1XXDA 5FCRA 8ESTE 2QXIA 4KELA 3FP8E 1CVWH 2QC2A 1C5OH 1GI1A 1IAUA 1YC0A 3D62A 1C5UA 1L4DA 8GCHG 3HATH 1O32A 2WPMS 3NWUA 3KEEA 3SO3A 3F6UH 1G2MA 1DDJA 2FXRA 1W14U 2NU3E 4NZQA 3VEQB 2CGAA 3GCHC 6GCHF 2YOLA 3GDSA 1BTHH 1A3BH 4XBBA 3M7QA 1L2EA 2BVXH 1FUJA 2FM2A 3MQKC 2AMPA 4E7NA 4KKDA 4NIWA 2GDDA 2PGQB 3EE0B 2AGIX 1ZTKA 2HNTC 1AY6H 3PRDA 1QB1A 1YPGH 3RUOA 4HZHA 4Y7BA 4A1TA 3LJOA 4K8BA 4Q80A 5GIBA 4TY6A 2KCPA 3Q3YA 2GX4A 3MTYA 3ZVAA 1A1RA 1HJAB 2BY7X 3QTOH 1AMHA 1XVMA 4FUGA 2ALVA 5H4IB 1J15A 1DWCH 1LHEH 1AFQC 1WCZA 2DUCA 1BHXF 3KGPA 4GCHG 1UVTH 1P06A 4ISOA 2NU2E 1NROH 1P2OA 1PQ7A 5F8ZA 4WF8A 4CREA 1C5MD 2KCOA 2AHME 2M2AA 3O8BA 1C1QA 2VVUA 3FO8D 4AFZA 3LGWA 1AB9B 1W13U 2XNDD 1VR1H 3F2HA 3AASA 5EQQA 1S85A 2FTLE 1UHBA 2C8WB 4DJZB 1O3AA 3BTKE 3KN2A 3AAVA 3QGNB 3EDXB 4WY3A 2PTNA 2WPKS 4WMFA 3TNSA 3PM3A 4ISLA 5E0JA 1SGRE 3A85A 3GYMA 3ZZ9A 1H8IH 4DURA 1KXEA 3U98H 2GZ8A 1OWHA 1SGQE 1TRNA 3PLBA 1K22H 4BAMB 2Y80A 3F9FA 1UK3A 4CR5A 1CGHA 1NFXA 4R8TB 3NCLA 3E8LA 1P2QA 1EAIA 1GBBA 1P9UA 4MG3A 5C5OA 1KXCA 4ZAEA 5CHAB 1QB9A 1QCPA 2JJ2D 2XBYA 1UCYE 5G4BA 5C0UA 2SFAA 4YLQH 5T6FA 3UY9A 1YGCH 3SU5A 3ZYEA 1ZTJA 1W3CA 1LTOA 2J98B 1DM4B 3HPTB 1ELTA 3WY8A 1SGPE 4ASHA 1K1JA 5FXLA 1HLTH 1SLXB 2QIQA 1OOKB 4XD7D 3UQVA 3DFLA 5EU8A 4A92A 3WWBA 1W12U 4ASUD 1ZPZA 1F7ZA 4GHTA 2QCYA 1O2HA 3IWMA 1TRYA 2BLVA 2PWXA 2O8WA 4A1VA 1DT2A 1ELFA 3E0PB 1A5HA 1NM6A 4CRGA 1W0YH 1HJ8A 3F9GA 1J8AA 1FV9A 5A8XA 4WMEA 4B2BA 3ZZ7A 1XUFA 1MCTA 1NRNH 1GL1A 1GGDC 4VGCB 5BRRE 2PUXB 4CRFA 2ZU3A 4DT4A 4Y8ZA 1XKBC 2HNTE 1EX3A 4YOIA 5HM2A 3OX7U 2Y5HA 3PV4A 3PRBA 3SUEA 1KXFA 1GI2A 1CA0B 1SQTA 1GI4A 2OC8A 3P8GA 1TE0A 4NCYA 4ZHMU 3GDVA 1PPEE 2FI3E 1GBCA 3BTWE 3CS7A 1Z1JA 2W6ID 4WH6A 2BQ7B 3MNSA 4YTAA 1H1BA 1AUJA 2A7JA 3CENA 3RDZA 3RXFA 1ELAA 1T8LA 1YP9A 5FAHA 2OBQA 2C8XB 3SGBE 1G37A 1IHTH 6ESTA 2CHAB 1FPCH 1GBLA 1BRCE 3U8TH 3RMLH 1KLJH 1FIWA 2EC9H 4CRAA 1O2PA 3SJ8A 3E3TA 1LDTT 1YKTA 1SHHB 2BD3A 1P03A 1ETRH 4JMYA 1CSOE 3HGNA 2AIPA 3DSOA 3KIDU 5FL7D 1TAWA 2F9NA 3BTQE 3D65E 2OD3B 1SMFE 2BDAA 3BEIB 4MNVA 4BTTB 1MD8A 3RXCA 4X1NU 2K8IA 5F8XA 3SUDA 1PPHE 1W7GH 1OP2A 1GHVH 1TNJA 1TNKA 2BD9A 1SR5C 3Q3KA 3EE7A 1MTNB 2FLBH 1CBWC 2KCAA 3URCA 4YXWD 3A8DA 1TPPA 3OTPA 2BQ6B 2R9PA 1TYNA 4TSFD 4CH2B 3S0NA 2ZPRA 4INHA 1YPJH 1Y3XA 1O31A 2G8TA 1RIWB 5JDUB 1BOQA 4AN7A 5A8YA 1DWEH 2F4LA 2TGTA 3PMAB 2XTTB 1TGBA 2O8TA 5FHTA 1CHGA 2UWPA 2XWAA 1O2NA 2ZDNA 4M9FA 2KX4A 3SZNA 1CGIE 2RA3A 1FMGA 4BAOB 3NKKA 2HLCA 1LKBA 3LU9B 1IQHA 1GBDA 3A84A 4MLFB 4RSPA 2W5EA 3H5CB 1HDTH 3RM2H 1ZHRA 1UTNA 4Y0YE 3ZZ6A 1GHYH 1G3DA 1GMDF 3ZIAD 1VJ9U 3T2NA 1WUNH 2ZG0H 2ZDAH 2XCFA 4Y7AA 5HIYA 1FY3A 1C2FA 1RGQA 1BTWA 2JETC 1UTMA 1UK4A 2VVCA 1O3NA 1ESTA 1OWEA 1SGYE 1H8DH 3EA9A 4FUBA 3IITA 2WSSD 2ZA5A 3D49H 5GNDA 5AFYH 1DWDH 3MO6A 9ESTA 5LPEA 3Q3XA 3SI3H 4NWLA 1P12E 1ZHPA 4HGCA 3M36A 5HM9A 1LQDB 3BTME 2VB0A 1GI5A 2TGAA 2XC5A 2C8YB 5EXNA 1CA8B 2YMSD 4CBNA 1EJAA 1RTFB 3U1JB 1BRAA 2R2MB 4HG6A 3F9EA 5DP6A 1BIOA 3TU7H 5HIZA 5T3HA 3N7DA 3TITA 1KIGH 5F03A 3SJOA 1GVLA 4FXGH 1YCPK 2ALPA 1BJUA 1INCA 1N6YA 1GCTB 1ELBA 1ZGVA 1AFEH 1SFQB 4ZHLU 4Y6DA 4WWYA 2ZHDA 3F3BA 2VIDA 4LOYH 2V35A 1ZZZA 4Y10E 2VGCB 4GSOA 3DUXH 3SV6A 2L74A 2VWLA 3KQDA 2A0QB 4JZIA 3MH4A 3RXKA 4K1EA 1MBQA 1GDUA 3JZ2B 2BLWA 1K28D 2BY6X 3LGTA 3UIRA 4A6LA 1N8OB 4KTUA 1BCUH 3CP7A 4BANB 2K1QA 1HAOH 1MKWK 4K1TA 4CBOA 2OTVA 3MH5A 4D8NA 1TX6A 2Z9GA 3OTJE 2EY4C 1D9IA 3RXEA 3E1XB 2WV9A 2XRCA 3ZZ8A 1JXPA 2WHXA 1GJAB 3UUZA 1VCQA 1SLWB 4B74A 4X1SU 1CHOF 1D6RA 2VIVA 4U32A 3BSQA 1E0FD 1WDIA 1HAIH 1S84A 1QBVH 1WU1A
chains in the Genus database with same CATH topology
3RXOA 3SV7A 3ZVFA 2BLQA 1QRWA 1BTPA 3M5MA 1J9CH 2BY5X 2FI4E 4B76A 3LC5A 1FY1A 4AORA 1C1SA 2A7CA 4FVBA 3EAJA 3MNCA 3NXPA 4E06H 2NU4E 1V2NT 5F6MA 2Y82A 1DUEA 4DW2U 1Y59T 2TGDA 1H9HE 3GY3A 4YLUA 3RXSA 1HAGE 3ZZCA 4A5TS 4AG1A 2ANKH 1EPTC 3UNRA 2VJ1A 2SGEE 2FOAA 2O8MA 1O3OA 4WMDA 3LPRA 1UTJA 1ZSKA 2GT7A 5J4QA 2P8OC 1MKXH 2ZHFH 1GJ6A 2A4RA 2WPIS 1LVBA 1WBGB 3DT0H 3DHKH 2BXUH 3SNDA 4B2AA 4YM9A 1O3CA 2HOBA 6LPRA 3ESTA 3RXQA 1TOCB 1GMCF 4CRDA 1O38A 2FOGA 1GHAG 4JYUH 3RU4E 1DY9A 1AZZA 3GDUA 3SI4H 3GOVB 2BDYA 1KXAA 2PUQH 1GDNA 3LOXA 2SGPE 1S81A 1SVPA 5TCAA 3P17H 1Q31A 1ELGA 1YPKH 1NZQH 1HAXB 5C2ZA 4K3JA 1TPSA 1WAYB 2Z94A 1YPHC 2C4FH 4K8YA 2J9NA 2ZDKA 1GMHF 1AWHB 4NWKA 5EGMA 1PPFE 4ZKOU 4FUHA 1NFUA 4JCNA 3SUGA 2J38A 1C1PA 4DG4A 1LPZB 1GBHA 4I8GA 1HNEE 1NRRH 3M3VA 1O34A 1BRBE 1TGNA 1FJSA 1JIRA 3T28A 6CHAC 3PO1B 3UQOA 3A80A 1CQQA 3RXPA 2IJOB 1FN8A 4LZ4B 1OYQA 4INKA 1N1LA 4YOJA 3QZRA 2BQWB 1O2VA 5GCHG 2ZEBA 4MNYA 1H9IE 3RLYH 1WSSH 2F9UA 2ZZUH 3M5OA 8GCHF 4X6MA 2VIQA 3RXVA 1O2KA 2GCHG 5LPRA 4YOGA 1O36A 4MVNA 1QIXB 1DVAH 1GJ9B 1GVZA 1ETTH 2BDCA 1IQMA 1FY8E 5DP7A 1LHFH 1ZTLA 2ZFQH 2ZHQH 2WUBA 1K21H 2P3TB 3SNEA 2R3YA 2ZFFH 1V3XA 2GMTB 3BIUH 1HIAB 1NRSH 1O2JA 2QF3A 2B5TB 1K1NA 1W11U 1PQ5A 2LNCA 3LC3A 2Q6FA 4ZKRU 1TOMH 1XUJA 2VWMA 1S82A 1BUIA 3MYWA 3TIUA 2ASUB 2VH6A 5JBBS 1SG8B 2UUJB 3P92A 3E91A 2BDGA 1O39A 1FIZA 1Z8RA 3LIWA 4GCHF 4GPGA 1BMMH 1W10U 1QQUA 5EXMA 1W7XH 2Z6BD 4BNRA 1C5SA 1H9LB 2FESH 3B9FH 3RXGA 1ZOMA 2ZU5A 1UTQA 2BOHB 1S5SA 1ZYOA 2F9OA 2V3HH 1GJDB 1EATA 2VWOA 2AFQB 3QLPH 1MZAA 1YPHE 3K2UA 1GBAA 2JH0D 3TJNA 1ANCA 1T32A 1MAYA 1ZRBA 5ESTE 5EPNA 1O3BA 1SGIB 1SL3A 2OC1A 5C20A 4A7IB 3LH3A 2Z9IA 1BBRK 1T7CA 4NA7A 2GKVE 2CXVA 4Q7YA 2NU1E 5EG4A 3A8CA 2IN2A 5FPYA 3S9AA 4Q7ZA 3TH3H 2FP7B 1AHTH 1TPOA 4Y0ZE 4YT6H 1W8BH 4ZH8A 3OY6U 3M3SA 1ESBA 2QGRA 1DY8A 3SU2A 1SPJA 1RXPA 5GJ4B 1NRPH 2HGTH 1LVOA 4K5ZA 2BDIA 1BRUP 1O37A 3LH1A 3RC4A 1XUIA 3MO9A 1DE7H 2PFEA 1Z6JH 2FX6A 1GG6B 1GBKA 5SGAE 4RKOB 1NU7B 1OXGA 4I7YH 3ZVEA 1GVKB 2Y7XA 4DT7B 1F0RA 1C5YB 1FAXA 1OS8A 1ELCA 1EZQA 4E05H 1XUGA 1QBOA 5BPEA 3SGAE 4I8KA 4KP0A 2G55A 4HFPB 4WH8A 1WTHD 4QT8C 2QF0A 1B0EA 1FAKH 4XFQA 3PTBA 1A46H 5C1UA 1TRMA 2ZO3H 3ZVBA 3ZVGA 1TGCA 5HGGA 4CRCA 2DE8A 1O0DH 3BG4B 4FU8A 3RMNH 1DUAA 4IS5A 1GHWH 1O2RA 1TALA 1QR3E 3ENSB 1ZPBA 3HGPA 4MTBA 2JKHA 2V0BA 4ABJA 1HIAA 4YZUA 3HKJB 1J16A 2FYRA 1V2JT 2XCNA 1DITH 2JH6D 4D7GA 1MTUA 1AE8H 4ABBA 1A4WH 2EA3A 2ZDVH 4CHAC 4TWWA 2BX3A 4K2YA 2QV1A 1C5LH 1OPHB 1YCPM 2ZHEH 1ZJKA 2AEIH 3PWCA 3U8OH 3D23A 4AFSA 1BTZA 3MU5A 3EA8A 3RXHA 4CR9A 4FUFA 1O35A 1XMNB 1F0TA 4JYTA 5JBTA 3RXRA 1XX9A 1C1OA 3UWJH 1YBWA 1V2LT 1NC6A 1RRKA 1GHBG 1S0QA 1C5XB 1K9OE 4INLA 2Y7ZA 3K9XB 5JYIA 1SOZA 3SNCA 2G00A 4TYDA 4OS4A 4X8SH 1C1RA 3UR9A 3ITIA 3RXDA 4AYYB 3MU4A 1C5TA 4TY7A 2CMYA 3SJIA 3PWBA 1VITG 1VJAU 6GCHG 3H7TA 1Y3UA 3KQEA 3NUMA 3FANA 2F91A 4Y8XA 3KL6A 1TBRH 5LH8A 1V2MT 4UFFH 1FI8A 3A7ZA 3P8FA 1BA8B 1JMOH 2DE9A 7KMEH 2AIQA 1LHGH 1O3KA 4X1PU 4GAWA 3S9CA 1SHYA 1OKXA 2ZCLP 3KHVA 4ZXXH 3P95A 3DA9B 3GCHB 5T6DA 1BQYA 4MPVA 1GBIA 2OLGA 3F9HA 3ZZ3A 1QRZA 3GY5A 3MOCA 3GCTF 1HFDA 1MUEB 4ISIH 4UEHH 1DX5M 4NSYA 5E0HA 1Z6EA 4AOQA 1M9UA 1O2ZA 2QN5T 1SB1H 5DP4A 3ATLA 1EQ9A 1SGNE 2BMGB 2FDAA 2C8ZB 1O2GH 1QRXA 2WINI 1P10A 4K1SA 3QZQA 2A2XH 2GCTB 2VIWA 1BTXA 3RM0H 4SGAE 1GBTA 4JZDH 1P2IA 1C2KA 2H2ZA 2ZU2A 1UVOA 2B0FA 2BD4A 5F8TA 4NIYA 4MQAA 1V2PT 1NT1A 2BYAX 1SBWA 8LPRA 1ZHMA 3QK1A 1UMAH 2P93A 5DP8A 1LKAA 4U01A 3TLOA 5GDSH 4THNH 1BMNH 1P2JA 3K65B 2THFB 1TBZH 5DK1A 3PMHB 2JH5D 3SQEE 3RMMH 1KYNA 3JZ1B 1MD7A 2C90B 3SU0A 4JYVH 3KQBA 1EZXC 1N8OC 2A45B 3GY6A 4UE7H 4YO9A 3OU0A 1FN6A 2BXTH 1Z7KA 1OSSA 1UCYK 1L1JA 2AGGX 1JRTA 2OINA 2FOCA 1EOLA 3TJVA 4IN1A 3VGCC 3E90B 4B75A 2BTCE 1Z71A 1OWJA 1P8VC 4X2WA 3VPKA 3S69A 4XBDA 2Z9LA 5DP9A 1EUFA 1T4UH 4DGJA 1Z1IA 1ORFA 3RXBA 5CE1A 2O9QA 3A82A 3TK9A 1IQFA 2A1DB 2ZFRH 2TGPZ 5ABWA 1ID5H 4ZMAH 3RXIA 2H5CA 2YNAA 5EW1H 1IQNA 1OP0A 4TPIZ 1OWDA 2C3SA 1ANEA 1T31A 1L1NA 3VXFH 4DCDA 3PLKA 1DLKB 1NFYA 3C1KA 7LPRA 1A7SA 2CJIA 4AX9H 2BY8X 1G3BA 1UTPA 2STBE 3O8RA 1C1MA 4U30A 2FO9A 3V7TA 1GJ8B 4I32A 1Y5BT 1WOFA 1QURH 2OUAA 1BDAA 4AGKA 3SV2H 1AQ7A 5LGOA 4I8JA 4X1QU 1L4ZA 4M7GA 5AFZH 2HPPH 8KME2 2O8LA 1HBTH 1FQ3A 4MPUA 2Z3DA 2BDBA 7GCHF 3DD2H 3W94A 1EB1H 4IBLH 1C5VA 2PKSC 2FS9A 1K1OA 3FVFB 5IYTA 5TJXA 4B1TA 1GJ4H 1K1MA 1KXDA 1W2KH 2FWWA 1V2WT 5C1YA 1K2I1 3RXAA 3Q76A 1V2QT 1EZUC 4NFFA 2NWNA 1QY6A 1SSXA 1TABE 1THRH 1GDQA 2A4GA 1U6QA 4NZLA 5DP3A 4Y79A 2OC7A 5GPIB 2G51A 3SBKA 4KTSA 4NSVA 2VH0A 1AKSB 1NS3A 2HPQH 4AB8A 4X2VA 1ABJH 4IC6A 3STIA 2AH4X 2I6SA 2KAIB 1P57B 1XUHA 1P2MA 1V2OT 5I46H 4O3UA 2ZCKP 1HV7A 2YNBA 3MH6A 1BB0B 1CBWB 2W3IA 4CH8B 3UPEA 2GVFA 2PSYA 7ESTE 1A0HB 5JB8S 1C2HA 2G52A 1THSH 3GICB 2Y5FA 1AN1E 3A89A 1A61H 2H5DA 3MFJA 1O5EH 1TX7A 3RU4D 4B73A 1VGCB 2ODPA 3A7VA 2R0KA 1P09A 1AVGH 5A09A 1BBRH 1BT7A 2QAAA 1C5ZB 1SGEE 4LK4A 1TX8A 2CF9H 4X6NA 1DXPA 3UNQA 1O5GH 1P9SA 3EQ0H 4H4FA 3L33A 2W7SA 2Z9KA 1TIOA 5DGJA 1UVPA 4XOJA 2SGDE 3QO6A 4ZROA 2PKAB 1TPAE 2BD7A 2O8UA 3ELAH 4JZEH 3UR6A 5L30H 1F5LA 1YPMH 3URDA 4X1RU 1V2VT 3O8CA 1G2LA 4LXBH 2UUYA 3SHAH 1UJ1A 4OS2A 3OYPA 1RS0A 4HTCH 1QGFA 1SGFG 2XW9A 1PYTC 5K0HA 1GJ5H 1P0SH 3I78A 3RXUA 2P3FH 3L3TA 5A0AE 3BTFE 2GCHF 3SOSA 1L1GA 1EOJA 4BAKB 1T8OA 2AERH 3SJ9A 5A0CA 1F2SE 4F49A 1GJBB 1CU1A 1MMJN 1YF4A 1OX1A 1G36A 1HRTH 2EI6A 5CMXH 1C5RA 2RCEA 1B5GH 1P2KA 2ZGXH 4XDEA 1Y5UT 2R2WU 4J1YA 1RTLA 2BLOA 3A8AA 3PMBB 1AZ8A 1GI7B 2ANMH 3AVZA 3NZIA 2GZ9A 3TK5A 1O2WA 1ELDE 4D9QA 2IPHA 1G9IE 2BD5A 2FOBA 2OXSA 1JIMA 2FEQH 4IMQA 1W0ZU 2AMDA 2BM2A 3BF6H 5L6NH 4MNWA 5A2MH 3P70B 4GHQA 1PPCE 1ABIH 3LGUA 1CO7E 3O8DA 2LPRA 2NU0E 2FZZA 4F4OC 1IHSH 2BHGA 4XBCA 1HAPH 4J2YB 4R0IA 1HXFH 2FI5E 4XSKU 1AKSA 1C5QA 2STAE 2UWLA 1SLUB 1T8NA 4YT7H 1SGTA 2KAIA 1XXFA 1PPZA 4X8TH 1SQOA 1YYY1 3QGJA 1IQEA 3BG8A 4OGXA 2C93B 1TNLA 4MNXA 1CHOG 5C3NA 1C2GA 3PB1E 2Y5GA 1PPGE 1OP8A 2BD8A 3T5FH 4B2CA 1DWBH 2F9BH 2XBXA 3ODFA 3BTEE 4FVDA 3A83A 1Y8TA 1DXWA 4TWYA 1SGDE 1GG6C 3PTNA 2BZAA 2ZGBH 1QL7A 3ZYDA 1BHXB 5E2OA 1MTVA 1ELVA 1O5FH 1Y3VA 4NGAH 3RLWH 1HJAC 1C5WB 2G81E 1ARBA 3MU8A 2Q6DA 3U9AH 3RMOH 4I8HA 4AFUA 1D3TB 3LGIA 3UREA 3EA7A 1O3JA 1V2RT 5DG6A 2PGBB 1V2KT 1EB2A 3E6PH 2FMJA 1EASA 3M5NA 1UK2A 1E36B 2Z3CA 2SNVA 2I6QA 2PKAA 1HAZB 4AG2A 1LHCH 1Z8JB 1P3CA 2Q1JA 4O9VA 1AIXH 5L2ZH 1TQ7B 1AB9C 2G4TA 1MBMA 2VU8E 1TFXA 3C27B 3T26A 1FPHH 3TNTA 1VCWA 1O3PB 1V2TT 1D3PB 4LZ1H 1GMCG 2BVRH 3SGQE 2ZNKH 1IQGA 2FPZA 1EPTB 3V3MA 3AW1A 1TMUH 3VB4A 2RDLA 1BITA 3SW2B 1C5PA 2BOKA 2ZF0H 4DOQA 3MO3A 5HXFA 5EOKA 1Y5AT 2P8OB 2ZU1A 3BTHE 1C1VH 1RTKA 2ANYA 2XWBI 2A2QH 3IG6B 2ZQ2A 1O3HA 2VINA 1TGTA 5A8ZA 1C2EA 1RFNA 1MCVA 2OCVB 4OS6A 4ZHAA 1O5BB 1F0UA 1YLCA 5CHAC 4PROA 5E0GA 1P01A 1MTWA 1V2ST 3SUFA 1OWKA 3TH2H 3VXEH 4BTUB 1ETSH 3SU4A 1J14A 1GMHG 1F0SA 1CT2E 2QA9E 4O03A 3BTDE 5AHGH 5A0BA 1TQ0B 3KQCA 5AVDA 2SNWA 4OS5A 3VB6A 1TLDA 1C2LA 1FONA 4HI3A 3E0NB 4WXVA 5DO4H 2FOHA 2F83A 2HALA 2CF8H 1QNJA 1P05A 1DOJA 4FUEA 4UFDH 4AGJA 3G01A 3ATWA 3BTGE 3K6ZA 2GV7A 2ZDMA 1UO6A 1YPEH 3LT3A 4OGYA 1C1NA 2H9TH 1TMTH 4VGCC 3TJUA 2GDEH 1SGCA 4NIVA 1GHBF 2PLXA 2ZC9H 1A0LA 1MAXA 1PFXC 3M35A 3RXTA 1EJNA 1YM0A 3ODDA 4A1XA 1CA0C 1EZSC 4IMZA 3N7OA 1QJ6B 2J4IA 3B8JA 6CHAB 4Z0KA 1VITF 4Y11E 1KTSB 1G3CA 2ANWA 1LMWB 5PTPA 1LO6A 2ZI2H 2ZFSA 1NTPA 1LPKB 2J94A 1O3MA 1V6DA 2P16A 3E16B 4IGDA 1GI6A 1YPLH 2F9VA 2CHAC 1C1UH 1KDQB 2WYJA 3U8RH 2AMQA 4I8LA 1GWAA 5HYOA 1D3QB 1DSTA 2ZGHA 3GY2A 1ZSJA 5AF9H 3H7OA 1MH0A 1GJ7B 1ZRKA 2P59A 3ATKA 3HK3B 3M7TA 1ZPCA 3MMGA 1C1WH 3FFGA 3TGKE 2IOTA 1NFWA 2GCTC 1L0ZA 2ZGCA 2OQ5A 1LCYA 3MI4A 1EP5A 3NPSA 4I31A 3AAUA 4JZ1A 1Y3YA 2ZGJA 1MKXK 1EKBB 1P11E 1WV7H 1VZQH 3Q00A 2M5TA 1MTNC 1NPMA 3A7YA 5EODA 3QUMP 1X7AC 1XM1A 3M5LA 5GWZA 1KLTA 1YCPH 1AVWA 5DPAA 4AB9A 1SI5H 1MTSA 1O3LA 1BTYA 3S7HB 1RIWC 2Y81A 1ESAA 1FY4A 4NFEA 2RA0A 1QHRB 1O2UA 1IQIA 2UUKB