2BDCA

Porcine pancreatic elastase complexed with asn-pro-ile at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA01
3GICB 5FHTA 5GXPA 1D9IA 1UVPA 2ALPA 3M7UA 1TNKA 2HNTF 1HXFH 1ZSKA 1C4Y2 3M3SA 3ZZ9A 2AEIH 5CE1A 1PFXC 2HGTH 2ZEBA 1F7ZA 4CHAC 1QQUA 2ZC9H 3ATIA 1C1PA 1UTLM 4INKA 1ABIH 4I31A 1LVMA 3U69H 1K22H 3BTFE 2BXUH 1JRSA 4ABBA 1B5GH 1TX7A 1P0SH 2PKAB 2QXGA 2WPMS 4H6SB 3ZVBA 3FZDA 4KKDA 1A0HB 3F6UH 1IQIA 4ESTE 2OUAA 1NESE 4OS6A 1TFXA 2PKAA 1KXCA 1BTZA 1GMDG 1DT2A 2VWOA 3MU8A 5DP5A 4WMDA 1RGQA 1H9HE 3FP8E 3R3GB 2VH6A 1GJCB 2OLGA 3ZVGA 1IOEA 1C1VH 1V2NT 3Q3KA 1W0YH 1BHXB 1C1QA 1PPHE 1U6QA 1YKTA 3GY7A 2GZ7A 1ETSH 1V2VT 2JKHA 1O2GH 4B2AA 1AI8H 1NM6A 3PMAB 3SJOA 1YM0A 3GOVB 4ABAA 3MNBA 1SGEE 3SU6A 3PO1C 2AGGX 3KEEA 1DXWA 3MNXA 4IN2A 1O33A 2CN0H 1XVOA 3EA9A 1C2EA 1BRBE 5E0GA 1RXPA 1Z1JA 1SLWB 2ZZUH 1O39A 3DFLA 1BB0B 3A8BA 3E91A 3C1KA 5A8ZA 3EA7A 3DFJA 1C1TA 5IDKA 3PYHA 3A7YA 1O3KA 1FIWA 2WUCA 4K1SA 3RUOA 2G51A 1ZHPA 4GCHF 5IYTA 2BZ6H 1IQGA 2XYAA 2WUBA 2ZECA 4D8NA 4X6PA 1T31A 3MU0A 3ZVCA 2AS9A 3RC6A 1SVPA 4UFEH 1ZHMA 3U9AH 3KF2A 3BG4C 4NIYA 3VFEA 3SI3H 2P95A 1VGCC 1EOJA 4I8LA 1HAXB 3STIA 1BZXE 5ABWA 3TH4H 4CHAB 2H9HA 2QXIA 1QTFA 4FUCA 3LOXA 1SGTA 1LQEA 1DDJA 1W12U 2KAIB 2PUQH 4ZROA 1YPLH 1GMHF 1EASA 1A3EH 4NA7A 1O3GA 3OYPA 2BY8X 2BDHA 3H5CB 1E38B 2IPHA 4Z6AH 3SU2A 3A81A 4JZIA 3P92A 4B73A 4DURA 3E1XB 2W5EA 4XFQA 3O8BA 1W10U 2BD4A 1QGFA 5FPTA 5C5NA 3UTUH 1HYLA 5GCHG 2WPKS 3QGNB 2G8TA 5CMXH 4X8SH 1FJSA 2H1UA 2PV9B 4Q7XA 2BD3A 1EZUC 3GDSA 2BVSH 3VEQB 2FTMA 1GJ7B 1CU1A 1EAUA 5JBBS 1SC8U 1ELFA 5HXFA 1NT1A 4XE4A 2O8MA 2XTTB 4SGBE 3SGQE 1J9CH 1N6XA 2PGQB 2B0FA 2NU0E 5HM2A 3UWJH 1KLJH 5AFZH 5GPIB 4A1XA 1AFQC 1MU8B 3TJNA 4CRBA 4LK4A 4XBDA 2ZFTA 1G2LA 1NRSH 1V2UT 5A2MH 1ZJDA 2F9VA 1G3BA 3MH4A 4JCNA 5L2ZH 1CT0E 3RLWH 1MD7A 4DT7B 2LNCA 1GBIA 3DHKH 3LGVA 1C2MA 1DOJA 1O3JA 3VGCC 3A7WA 4TWYA 3FFGA 1THSH 1BJVA 3E8LA 4GVUA 4JZFH 4AOQA 2BD9A 1BDAA 3RXGA 2SNWA 1QURH 4LXBH 1HPGA 4RN6A 5T3HA 4ISOA 1Z1IA 1IQLA 2AFQB 1XUGA 2HWLB 1O38A 3LJJA 3LU9B 1O5BB 4KTCA 3GCTF 2UUYA 1WUNH 3CS7A 2J94A 1LDTT 2QGRA 1TX8A 1GMCG 4OS7A 1MH0A 1GBTA 1ZSLA 4FUEA 1IAUA 3QN7A 2G4UA 1TRYA 1O2WA 4F4OC 1LTOA 1GG6C 2A2QH 4TPIZ 3UNRA 1QCPA 2FIRH 3ODDA 3FANA 4J2YB 1FIZA 3D65E 5DP7A 1J8AA 1OP8A 4FUDA 2DUCA 1HLTH 3RM2H 1LQDB 1SGPE 2A7CA 3PLPA 2O8UA 5FX6A 1TMTH 1L2EA 2PR3A 1GBHA 2SGPE 1SFQB 5DJ7A 1GL1A 3N7OA 4B71A 1JBUH 2EC9H 1FQ3A 3FVFB 2WPLS 5A0CA 1ELVA 3MYWA 4X6OA 3F9HA 1BTXA 3EAJA 1D3DB 1AFQB 1FN8A 3BTHE 2ODQA 4DG4A 4U2WA 4ZXXH 4ABJA 5FBEA 5FCKA 1AD8H 5K7RA 2P59A 1VJAU 3U8RH 1DLEA 3RU4D 3TJUA 2DE8A 3RXOA 2ZTXA 3IG6B 1V2PT 5DG6A 1Y3YA 1VCPA 2GX4A 4MPXA 2CHAB 2BTCE 1XMNB 1C2DA 2FLRH 3A7ZA 4Q7ZA 1GJAB 1V2OT 4CR5A 5TJXA 2EI7A 1ELEE 2ZGBH 4UFGH 3TITA 3QK1A 2BY9X 1BBRH 7GCHG 2CMYA 4WF8A 3M5NA 3B23B 1GBAA 4I8KA 3RXPA 1EOLA 2A5AA 1C1OA 2QF3A 2ZGHA 2GT7A 5EODA 1WV7H 1UTJA 2C8XB 1HAIH 1WYKA 3MNCA 2A1DB 3RMLH 4GUXA 1Y3WA 3HKIB 3RXBA 2HVXA 1HAOH 3SZNA 1A5IA 1A1RA 4E7RG 1PPEE 2ZG0H 2ZI2H 4B2CA 1OPHB 2FMJA 1KY9A 4GAWA 1IQKA 1BTUA 4NFFA 3QUMP 2GGVB 1P2OA 1AVXA 1SPJA 2NU2E 3DA9B 1O2YA 1Z8JB 2PFEA 1C1UH 1YPJH 1QA0A 4BTTB 4X2XA 2AMPA 3U8OH 4IGDA 4TPYA 3S0NA 1DWDH 4GSOA 2CXVA 4GHQA 4NSVA 4YLUA 1HAZB 1ZGVA 4B74A 1EJAA 3SJKA 4BXWA 1XVMA 6GCHG 2FYQA 2ANWA 1QB1A 1EPTA 1RJXB 1SLUB 1OWDA 3QO6A 3TNTA 3ZVEA 4O3TA 2J2UA 2J4IA 4CR9A 6CHAC 4A7IB 3D62A 1P8VC 3SJ9A 1XUIA 2JH0D 1AIXH 2VIDA 2BX4A 4BAHB 2R3UA 5JYIA 1BJUA 3PB1E 1CGHA 1WCZA 2VVVA 1XUFA 3P70B 3S7HB 1IHSH 3D49H 3QZQA 1S6FA 2QIQA 5B6OA 3LH1A 3BN9A 1KYNA 1V2ST 5FXLA 1GDNA 1C5OH 1LHDH 2V35A 3URDA 1P03A 1EZQA 1W8BH 4FUIA 2WPJS 3T25A 4AORA 1V2JT 2ZFRH 5T6FA 1UVOA 4YOIA 1G3EA 4WXVA 3WY8A 2ZDNA 2GCTC 2FOAA 1TOMH 4YZUA 1XKBC 3SHCH 1K21H 1O2LA 3TNSA 3SV2H 3GCHC 1SGIB 2ZDMA 4CRCA 3V13A 3DD2H 4XSKU 1XKAC 1DWCH 4ZHAA 2J9NA 1HV7A 1V2QT 1P57B 1ZR0A 3UUZA 1E37B 5C67A 1IQJA 3UR9A 1HIAA 1UCYE 1HJ9A 2OXSA 3O8CA 1OS8A 1NY22 4DY7B 4ZKRU 1W2KH 1P9SA 3SBKA 2R2MB 2ZU1A 3AW0A 1O2NA 1D6WA 3LDXH 1AKSA 1SGFG 1O32A 1UTNA 2G4TA 3RXTA 1N6YA 3BEFB 3ZZBA 2ZU4A 1YCPK 1SL3A 3MH6A 5ESTE 2UUFB 3RXUA 1TA2A 1UTMA 3KCGH 3SV9A 1PQAA 1B0FA 4IMQA 1S6HA 2UUJB 2I6SA 2KAIA 3LIWA 1N8OC 1HFDA 2Z3EA 5JDUB 4UD9H 4D9QA 5HM9A 4IC5A 3GYMA 3Q77A 2FOHA 4KTSA 1FPHH 1NRNH 1CT2E 1MTNB 2ZU5A 3BTDE 2ZWLH 4ZHMU 2XWAA 1MKWK 4Y0YE 5AVDA 3TK9A 4BXSA 2H2ZA 2CHAC 3ODFA 5C1YA 2PW8H 1SGNE 1H8IH 1O3OA 2ZDVH 1ZMNA 1CHOF 1KXBA 1ZTLA 2Q6FA 1HIAB 3TJVA 2H9TH 2ZHQH 3UFAA 1LO6A 1SB1H 1S81A 2R0KA 1J15A 2SGQE 2Z9GA 2F9NA 3QDZB 3MFJA 1F2SE 1GHXH 1T8NA 1C5UA 2A0QB 2FI3E 1P2JA 8GCHG 1P2QA 2ZCLP 1VITH 1Z8GA 1AHTH 3KHVA 1HAPH 2GV6A 3GCNA 2BD7A 2ZPQA 3BTGE 3E3TA 4CRDA 1L0ZA 4GHTA 2ZHFH 1MCTA 1BTPA 3E0PB 2XC0A 2Y82A 2Z9KA 1V3XA 1FI8A 2ULLA 1HAYB 3RLYH 6GCHF 1D4PB 4LOYH 1AGJA 4DW2U 3UR6A 1TIOA 4NWKA 2ZHEH 2Q6DA 2TBSA 4UEHH 1UCYH 2ZDAH 2ZGCA 2Y80A 3RXRA 3BTKE 2VGCB 3DT0H 1GBMA 3PM3A 5SGAE 3SU4A 3V7TA 1BBRK 1GJDB 1OX1A 1P05A 4X1RU 2A4GA 4X6NA 1RRKA 2Z9LA 1FNIA 3SUFA 4Q80A 1K1PA 3B8JA 1T8LA 3KIDU 4YOGA 4ZKNU 1THRH 3AASA 3EYDA 4YOJA 1ID5H 1ELCA 4CRGA 3VXFH 3QWCH 1QBOA 6CHAB 1GHVH 4KP0A 1OOKB 1ESBA 3P8OA 3Q76A 4WY3A 3MTYA 3K65B 3RXFA 1GI3A 3OTJE 5GDSH 2GDEH 1NN6A 3SN8A 1ANEA 1C5QA 2C8WB 3R0FA 1M9UA 3BTTE 3JZ1B 4H6TA 4X8VH 2R0LA 5A0BA 4CBOA 2Z3DA 4Y7AA 3UIRA 1TONA 4NZQA 1Z6EA 4XBCA 1DANH 3ZVDA 3QTVH 2BQWB 5T6GA 4NIWA 4A92A 1ABJH 2P8OB 3K6YA 4KGAA 4CRFA 5E8EH 1TGNA 3QGJA 1CBWC 1QB9A 5AFYH 2XNIA 4IS5A 4IBLH 1NRRH 1MTVA 4HFPB 1LHCH 3SJIA 3PLKA 1TQ7B 1ARCA 2XWBI 4DGJA 2V6NA 2ZDLA 3ZZAA 1W13U 1EAXA 3FZZA 4K69A 1DLKB 4ZH8A 4A6LA 2EA3A 2ZGXH 2GDDA 1SFIA 4Q7YA 2UWLA 2ZA5A 3TIUA 1AQ7A 3P8GA 2A2XH 3VB7A 1C2LA 1YC0A 1NU7B 1D3PB 1IQFA 4OGYA 3U98H 1Z71A 2OP9A 2QXHA 1W14U 3GISB 3RC4A 1DITH 1EP5A 4AFZA 1DUEA 2C93B 1K1IA 3QX5H 4ISNA 3S9BA 3A8DA 2ANYA 3RMOH 3PMBB 1EQ9A 2A5KA 2ZTYA 4AFSA 1V2WT 6ESTA 2F9PA 3A83A 1MUEB 4F49A 1HB0B 2GZ9A 5A09A 5GCHF 4YT7H 3OU0A 5EU8A 1O3CA 1S83A 2B9LA 1MBQA 4AB9A 5GIBA 3AW1A 3T29A 1L4ZA 2Y81A 4KELA 1PQ5A 3GY5A 4YLQH 3SUEA 2VIQA 3BTEE 4JMYA 3P17H 3TGIE 4K5ZA 1EZSC 1GBEA 1QR3E 3ZVFA 2ZU3A 1FY5A 1GJBB 1O2KA 1HJ8A 1UTPA 4X0WU 4NSYA 2IOTA 8LPRA 3K2UA 3Q3XA 1DICA 3LPRA 1CA0B 4RSPA 4AZ2B 1WQVH 2CV3A 1TBZH 2SGAA 4ISHH 3PWBA 4DIIH 1QJ6B 1IQEA 1QL8A 2HNTC 3EQ0H 2FS8A 1N8OB 2FS9A 5I46H 1AUTC 2R3YA 3PMJA 1O2QA 1NZQH 2XCFA 3RU4T 5K0HA 1C2JA 1WOFA 2O8TA 3EA8A 4CRAA 1O2MA 2BD5A 2AIQA 1OWHA 4NZLA 1O3HA 1P09A 1PQ7A 2VVUA 1H1BA 2ZU2A 4FUHA 1SGFA 3MO3A 1AUJA 5DGJA 4FUFA 1C4V2 3KNXA 1BMNH 2VIWA 4X2YA 4OS4A 2VINA 3A8CA 2P3UB 1EXFA 5DP6A 1GVKB 2ILNA 1S0RA 1C9TA 3UOPA 1AU8A 1P3EA 5H4IB 1Y5AT 1KTTB 3M35A 2O8WA 3NZIA 2OCVB 4BOHA 3E0NB 1EAIA 3LC3A 3ATLA 1UHBA 3SORA 5FCRA 5EXMA 3H7TA 2P3FH 1GMDF 1BRAA 1AO5A 1DFPA 5HMAA 1GBCA 2W7UA 1D6RA 2GCHF 1O2OA 2H5DA 1FONA 1AY6H 3TLOA 1O2ZA 4AB8A 2A32A 3M7QA 1DY8A 1F5LA 2JETB 2VWMA 2PSYA 4H42U 1Q31A 1ANDA 3RXLA 1EATA 5FPSA 4LZ4B 2BLQA 2ZQ1A 3BSQA 1ZMLA 1P01A 1LMWB 1FY4A 2BDGA 3PROA 3MI4A 2THFB 5J4SA 4AG1A 3S7KB 3FP7E 5L6NH 1O2VA 2LPRA 1YYY1 3M7TA 4BTUB 1H9LB 2PSXA 5FX5A 1TRNA 1QQ4A 5AF9H 1FY8E 2J95A 2TPIZ 4K1EA 1SGCA 2VNTA 2HPQH 5BPEA 3HGPA 4AGJA 1BTHH 1SLXB 1PPZA 3SQEE 2BQ7B 1ZYOA 1PQ8A 3ITIA 1EJMA 2NU4E 4R0IA 1TLDA 4IW4E 4Y76A 2C8YB 3TK6A 2BVXH 2CF8H 4XBBA 4GLYA 2QA9E 4Y7BA 1HNEE 1O34A 1GBKA 2G81E 1C5TA 4ZUHA 5L30H 1TYNA 4E05H 4NA8A 2BDYA 8ESTE 1A0JA 1SQAA 4THNH 5PTPA 2FDAA 2BY6X 4X1QU 2C3SA 3U1IB 1JRTA 1ZSJA 1MZAA 3PV4A 2ZP0H 2B5TB 2BDAA 5EG4A 4ABIA 2WV5A 1ZRKA 3I77A 1GHYH 4ZAEA 1IQNA 3TGJE 2PUXB 2ZGJA 3RXHA 5DP3A 3GDUA 1CVWH 5GWZA 1VCQA 4X1SU 5CHAB 1A61H 3RXIA 1SGYE 1P2IA 3VB3A 1FZZA 1X7AC 5EQRA 1JMOH 3E16B 3F9GA 4FXGH 1FPCH 1GBJA 1C5VA 1V2LT 2BD2A 3HGNA 3A7XA 3SNBA 6LPRA 2OBOA 4JK6A 2TGPZ 1HAHH 2Z6BD 2FX4A 1NROH 1OWEA 2VU8E 3H7OA 1V2KT 1C5YB 1ZLRA 4GCHG 4Y10E 1K2I1 3RXJA 1H9IE 2EI8A 2SGEE 3UREA 1EPTC 1C5PA 1JOUB 1TMUH 1AE5A 1PJPA 1FMGA 2V3OH 5EQSA 3TH3H 1RIWC 1AVGH 1AKSB 4AFQA 3TGKE 3UPEA 3MO6A 3GY4A 4BAQB 4X2WA 3GY2A 1ARBA 2SNVA 3NK8A 3P8FA 1GBDA 4MQAA 2G5NA 2XBYA 1HRTH 2CGAA 2FOEA 5ETXA 1RS0A 1MZDA 1B7XB 3ZV9A 1EAWA 2W3IA 1BHXF 2F91A 3ZZCA 1AFEH 1TNHA 1VITF 1S0QA 2PKSB 1SSXA 1XUJA 3NCLA 1A5GH 1TQ0B 1O2PA 1P10A 3L3TA 4AX9H 4AYYB 4NFEA 3K9XB 4K2YA 4WXIA 1O30A 1OSSA 1HDTH 1O3LA 2SFAA 1V2MT 1TNGA 1ELTA 3OY5U 1QFKH 1HJAC 4OS1A 4ABHA 1GI2A 2GCHG 1XUHA 1GWAA 3M3TA 1KDQA 1GPZA 1LHEH 1O2SA 2GT8A 4FVBA 1C5ZB 1QL7A 1FN6A 1G3CA 3UQOA 4Y6DA 4BAMB 3RDZA 3A80A 1O5GH 4MNYA 5C1UA 1JXPA 2FESH 1GJ8B 4DCDA 3UQVA 3QTOH 1IQHA 1C5LH 3SOSA 2RA0A 3SV7A 1BCUH 2Q6GA 3URCA 3UOUA 3BG4B 3SGAE 2WPIS 1YPMH 1BQYA 5A0AE 1C2FA 1T4VH 3BV9B 3SNAA 3SUGA 1S5SA 3SQHE 1F0UA 1W0ZU 1K9OE 4VGCB 1O3NA 5T6DA 1LHGH 3BTME 2VIOA 3NXPA 1KXDA 3F1SB 4CREA 4AFUA 4X8UH 2AERH 1UVTH 1BITA 4MDSA 3QLPH 1HAVA 1TBRH 1GMCF 2F83A 4ABDA 2ALVA 1NC6A 3ZZDA 1YP9A 5GJ4B 1C2GA 3OX7U 3ZZ5A 1TRMA 3RC5A 3OY6U 4GPGA 1XXDA 1P2MA 2R2WU 3AAUA 2HALA 2PWXA 3FAOA 3MU4A 4FU9A 3SNDA 3T62A 1JWTA 1Z8IB 2ZFSA 5JBAS 2RA3A 4UONA 1QJ7B 1S82A 4IC6A 3KQBA 3MMGA 1SG8B 1E35B 4K8BA 2WYGA 2GV7A 1CBWB 1TNIA 1TNJA 1ZJKA 3ZVAA 1QL9A 3RXKA 1GI8B 3LT3A 1UVSH 1PPFE 1E36B 4FVDA 3TK5A 1MQ6A 1WAYB 1NFYA 1TE0A 3VB6A 1GGDC 2FEQH 3A84A 1Q3XA 2FOMB 4NIVA 2AIPA 2VWNA 1AE8H 2FOFA 4CBNA 1AVWA 1K28D 4K60A 4JZEH 1AB9C 2GTBA 3LGWA 4LZ1H 1MU6B 3GCOA 1HBTH 1NFXA 1S84A 4O97A 3E90B 1ELGA 1AZ8A 1Z6JH 1C5NH 1K1OA 2QYIA 1EPTB 3ATWA 3A82A 2ZO3H 5E0JA 2O8LA 2FX6A 3D23A 4ZMAH 4B76A 1NFUA 1C1MA 4X1PU 1QRWA 5DP8A 2BLOA 1ANBA 3ZZ7A 1O5DH 1O35A 1BMAA 3LGIA 2ZKSA 1OXGA 1GMHG 2A4OA 3RXMA 1O2TA 1TB6H 4FUJA 1GHAF 4PROA 3S69A 1NRPH 1ZMJA 4RKJB 4X2VA 1YPHC 4BTIB 1GCTB 1P2KA 2AMDA 2VJ1A 4JK5A 3GYLB 1J16A 4FUBA 1MBMA 2BD8A 1K1JA 1RIWB 4RKOB 3T5FH 1CGJE 3LKWA 3S9AA 1GG6B 2ZF0H 3CS0A 1W7XH 1DE7H 3RMNH 5F03A 3T28A 4YM9A 1WTHD 2TRMA 1XXFA 1GHAG 1UCYK 1GHWH 4U01A 2ODYB 3PTBA 4CH2B 3SW2B 4TY7A 2FODA 1O3DA 5LPRA 5LPEA 1ZTKA 1CT4E 1LVOA 3BG8A 3UNQA 3MHWU 2QN5T 2BDIA 4QT8C 2XC5A 5J4QA 1RTKA 1QY6A 4X1NU 1PPBH 4Y11E 1ZZZA 2D8WA 1LVYA 2SGFE 1O5EH 5C5OA 4JZ1A 2P8OC 2A4QA 4MTBA 1D3QB 2Y7ZA 5LGOA 4XDEA 3BF6H 7LPRA 3EGKH 1SGQE 1FY3A 2ASUB 1P2NA 1TPPA 5E0HA 3L6PA 5JB8S 4YTAA 2V3HH 1O3IA 1P04A 2G00A 3PTNA 1TOCB 1O5AB 1DX5M 3EDXB 3FP6E 1G3DA 3PWCA 1AB9B 3GY6A 1AN1E 4O9VA 1JIRA 4MG3A 1DPOA 1HGTH 1SOZA 3C27B 1QIXB 1O2XA 1NS3A 2ZFQH 1Z8RA 1A2CH 1DUAA 2CJIA 2F9UA 2STBE 1BTWA 4FUGA 5FPYA 1ZGIA 1A5HA 1BMLA 1TAWA 1HAGE 1PYTD 1QBNA 2OC1A 1TMBH 2YNAA 4ISLA 1PYTC 1DSTA 1WQSA 2FOGA 2QF0A 4CH8B 1D3TB 1O5FH 1P11E 1MKXH 1KIGH 3VGCB 3PMHB 2ZFFH 1CHOG 3MH7A 3E6PH 4U32A 1TPAE 2ANMH 4I8HA 1LPKB 2W3KA 1YPKH 1OWKA 3BTQE 1F5RA 1KLTA 2DE9A 1BOQA 4Y79A 2C90B 1ZOMA 2Z9IA 1F0TA 3MOCA 4NGAH 3SI4H 1T7CA 4JYVH 3RXVA 3M61U 4NG9H 2AH4X 1CA0C 1EZXC 1F0RA 1L1GA 3ATMA 4ABFA 1C5RA 4UFDH 3T27A 1TNLA 1MKXK 4YESB 2ZCHP 1MTNC 2ZFPH 2Y5HA 1TGCA 2P3TB 2IJOB 4NIXA 4R8TB 4X8TH 1BBRE 1EB2A 7ESTE 5F8XA 4MLFB 3SU0A 1QB6A 1ETTH 1ZHRA 3SU1A 4UFFH 1QRXA 1KSNA 4HTCH 4ABGA 3A8AA 3B9FH 2H9EH 1OP2A 2G55A 2ESTE 2BVRH 1XUKA 1MAYA 3AVZA 3QZRA 2GVFA 3EE0B 1P12E 3ATKA 2BHGA 2BLWA 5JBCS 3M5MA 4K1TA 4MPUA 1TGBA 3T26A 2BY5X 3RXSA 1BRUP 2UWOA 2C4FH 5EW2H 1WSSH 2GZ8A 4Y71A 4INLA 1JIMA 1C1NA 2GCTB 3M37A 3IWMA 1ANCA 3L33A 2D26C 1C2IA 5TCAA 1O2JA 5I25A 4O3UA 2OBQA 1P06A 1QNJA 4WMFA 5F8TA 2GD4B 2BLVA 4I8GA 1ELDE 2AGEX 2AGIX 3UWIA 1MCVA 1MD8A 1GI6A 2FXRA 2FO9A 1MTWA 1UK3A 1P02A 3TVJB 4BNRA 1C2HA 3SV8A 3W94A 1T4UH 3MU5A 4WVPE 4DOQA 1O5CB 2P16A 1CGIE 1C5MD 1GI9B 1ESAA 2XC4A 2Y6TA 3A87A 4Y8XA 2TGTA 2JH5D 2YNBA 1FY1A 5BRRE 2TGAA 1C5XB 2HPPH 2FYRA 2VB0A 2FOBA 2HRVA 1TX6A 1FDPA 2O9QA 1XX9A 3HPTB 3M3VA 2OQ5A 1DM4B 3K6ZA 4XOJA 3A7TA 1DXPA 4K8YA 2TIOA 2ZDKA 1ORFA 1ELAA 3GCTG 1O3EA 3STJA 4FU8A 3GDVA 2BOHB 3KQEA 1GBLA 1O3MA 7KMEH 2HLCA 3RXDA 1FAKH 3P6ZB 2FPZA 1VJ9U 5EW1H 1QHRB 2BY7X 4DJZB 2RG3A 4A5TS 2HNTE 1AMHA 2PTCE 1YLDA 1YPGH 1J14A 1O0DH 1O3FA 1DSUA 1ZPCA 2VIVA 1W7GH 2VIPA 4I7YH 1MMJN 3GY3A 2FP7B 3A7VA 4B1TA 1F5KU 4MNWA 2ZTZA 1SBWA 1VCWA 1K1MA 4HI3A 8GCHF 1Y3VA 3LJOA 1TBQH 1G36A 1GI5A 1CQQA 2H5CA 1BT7A 1K1NA 4U30A 3VPKA 2BXTH 1O3PB 1RTFB 1LPZB 5DP4A 4ZHLU 5F8ZA 5JPMH 1LPGB 4WH8A 2GMTC 1Q2WA 5F6MA 2F9BH 2A7HA 1K1LA 2ZCKP 4AN7A 4TWWA 3ZZ3A 1C4U2 4WJG2 4TY6A 4AGKA 2Z94A 4WMEA 4DVAU 1EJNA 2FI5E 3G01A 1MAXA 1GDUA 4IN1A 3W95A 2Y5FA 3TH2H 1TGSZ 2BDBA 3O8DA 2CF9H 2RDLA 1GJ9B 1OWIA 4IMZA 4Y0ZE 1NFWA 1UJ1A 4JYTA 4VGCC 2VWLA 2GKVE 1L1NA 1UO6A 3RXCA 2I6QA 2FOCA 4E7NA 1GJ6A 3NWUA 1EB1H 3P8NA 2A31A 1Y3UA 1O3AA 2BB4A 2J92A 2Z9JA 2D2DA 4UDWH 1ZPBA 1H8DH 2ZNKH 3RP2A 1GHBG 3MWIU 5A8YA 1G32B 2RCEA 2R9PA 1E0FD 1YCPH 1ELBA 3ELAH 1YLCA 2OC8A 3F9EA 4K3JA 2ZHDA 2IN2A 2NWNA 2TGDA 1GHZA 1SGDE 3IITA 4I33A 3RXEA 1TALA 3HKJB 1VGCB 3ZYEA 1GDQA 1KDQB 1O2IA 1PPGE 1ZPZA 2Y5GA 4SGAE 1MKWH 2BYAX 2A45B 3DUXH 1KXEA 4E06H 1GHBF 2W26A 1KLIH 2B8OH 2D1JA 2QCYA 2BMGB 3S9CA 1GI4A 2FTLE 1WTGH 2WPHS 3MU1A 2BX3A 3KN2A 1Y59T 1C1RA 1BIOA 2Q1JA 1O3BA 1F0SA 1PPCE 3M5LA 3V0XA 3A89A 3HK3B 9ESTA 3HK6B 1XM1A 1HJAB 2F9OA 1RTLA 3BIVH 1ESTA 5EPNA 4MNVA 3BTWE 3MH5A 1ZTJA 2PKSC 1GCDA 2QXJA 2FI4E 3ZV8A 2ZQ2A 1UTKA 4MNXA 1MQ5A 4D7GA 1OKXA 2GP9B 1Y8TA 3LH3A 1UTOA 1S85A 3T2NA 1YPEH 3ESTA 1CHGA 1HXEH 1UVUH 3RMMH 4JZDH 1O2HA 4KTUA 4YT6H 1TA6A 2ODPA 3TJOA 2BZAA 2FLBH 1OP0A 2V0BA 3CENA 4ASHA 1KTSB 3ZZ8A 1GI0A 1GI1A 2XBWA 4H4FA 1UMAH 1GBBA 1T32A 2ZPSA 4ABEA 4HZHA 2QC2A 3KQDA 1VZQH 2A5IA 1EX3A 1DY9A 2OQUA 3M36A 4TYDA 2XBVA 4UE7H 1A4WH 2PGBB 1TWXB 3VXEH 5HGGA 1P9UA 5AHGH 1G2MA 2WINI 1NO9H 1A0LA 1B0EA 3LGTA 3UNSA 4D9RA 1TPSA 3VB5A 3ENSB 1L1JA 4ISIH 5LH8A 4Y8YA 1HUTH 1SMFE 3JZ2B 1O31A 2ZIQH 3OSYA 5EOKA 3SU3A 1DVAH 3RM0H 1LCYA 5EPYA 1VR1H 4YO9A 1F92A 1G37A 1G30B 5G4BA 1TPOA 2B7DH 3I78A 2ZPRA 1SOTA 2A7JA 5E2OA 1ZRBA 1GL0E 1VITG 2P94A 2G52A 4AG2A 2NU1E 1YF4A 3BEIB 3UY9A 1DS2E 3BIUH 4MPWA 4OGXA 4WH6A 1C1WH 1TGTA 2FM2A 5ESBA 3RXAA 3MNSA 1T8MA 1GJ4H 2FWWA 1BTYA 1Z7KA 2WYJA 1BUIA 1GJ5H 1MTSA 1NTPA 3SO3A 5DPAA 1FV9A 4Y8ZA 3LGYA 1O37A 1C9PA 2H6MA 1Y5BT 3F68H 1C2KA 2P93A 2UWPA 3SUDA 1CSOE 5EGMA 5C20A 4D76A 1IHTH 1NU9A 1KXFA 1CO7E 1FLEE 5C2ZA 3ZZ4A 3ZZ6A 2VVCA 1T8OA 4B2BA 5EQQA 5TCCA 2A4RA 2UUKB 2XW9A 3ZYDA 3PO1B 3V3MA 1SLVB 2G5VA 3Q00A 2WV4A 3KGPA 1QBVH 5DK1A 2FZZA 1YBWA 1GBFA 2OC7A 3TU7H 4O03A 3HATH 3U1JB 1SHYA 3SGBE 3SHAH 2AMQA 2F3CE 1OWJA 2C8ZB 1A3BH 2BQ6B 1QRZA 3U8TH 1UK2A 1C1SA 2XCNA 3NPSA 1KXAA 1L4DA 1QA7A 3O8RA 5L2YH 2NU3E 3GCHB 4HGCA 2SGDE 4INHA 1EUFA 1SQOA 8KME2 2STAE 3A85A 1FXYA 1C5WB 2GMTB 2Z3CA 1BA8B 1GGDB 3CP7A 4FU7A 3V12A 1SR5C 7GCHF 4X6MA 2OINA 1THPB 1UTQA 4I32A 1BRCE 3SJ8A 1UK4A 5DKMA 2OC0A 1SGRE 3A86A 3GY8A 3KQCA 5E2PA 1UHBB 2EI6A 3LC5A 2YOLA 2J34A 5DO4H 4OS5A 1ETRH 1NPMA 1YPHE 3SU5A 4WWYA 1LHFH 1ACBE 1SHHB 2K1QA 2PLXA 1NRQH 3KL6A 1WBGB 2BM2A 1MTUA 4BANB 3TPIZ 2PTNA 4MPVA 2JETC 1A7SA 4JYUH 2QY0B 1P3CA 3AAVA 1LKBA 1SQTA 4D7FA 1SI5H 1GCTC 5JBTA 2XRCA 4M7GA 1HAVB 1RFNA 2OTVA 1V6DA 1Y5UT 2PHBA 1N1LA 3LGUA 5EXLA 1V2RT 2Y7XA 5A8XA 3SV6A 1OYQA 1RD3B 2Z7FE 4ZKOU 2W7SA 2M5TA 5LPFA 1AZZA 5HYOA 4A1VA 5EXNA 1DWEH 9LPRA 4Z0KA 2QV1A 1EKBB 2OD3B 1GI7B 2QAAA 3RXQA 5C1XA 2XXLA 1GVLA 1FAXA 4DIHH 1INCA 4AYVB 2VH0A 1EP6A 4MVNA 3A88A 3F9FA 3SNEA 2JH6D 1H4WA 5DP9A 1G9IE 2J38A 3Q3YA 1YGCH 1O2UA 3M5OA 5JB9S 5C3NA 3BEUA 3NKKA 1BMMH 4BAKB 4ZXYH 2XBXA 4I8JA 1YCPM 3RU4E 1AWFH 2BOKA 3I29A 1Y3XA 3LONA 4NWLA 3SNCA 5FBIA 1TABE 4J1YA 2ANKH 1V2TT 4B75A 1WU1A 3MO9A 1W3CA 3PLBA 4A1TA 3P95A 2AYWA 1CE5A 1IQMA 3NUMA 5FAHA 4ZKSU 1GVZA 2HOBA 1AWHB 5CHAC 1CA8B 2VGCC 1O36A 1A46H 4BAOB 1LKAA 4NCYA 4OS2A 4Q2KA 3VB4A 1OYTH 1C5SA 1O2RA 1J17T 1LVBA 4NA9H 1FUJA 2BDCA 2EEKA 1W11U 1E34B 2ZHWH 1DWBH 1QJ1B 1HCGA
chains in the Genus database with same CATH superfamily
3F2FA 3GICB 5FHTA 5GXPA 1D9IA 1UVPA 2ALPA 3M7UA 1TNKA 2HNTF 1HXFH 1ZSKA 1C4Y2 3M3SA 3ZZ9A 2AEIH 5CE1A 1PFXC 2HGTH 2ZEBA 1F7ZA 4CHAC 1QQUA 2ZC9H 3ATIA 1C1PA 1UTLM 4INKA 1ABIH 4I31A 1LVMA 3U69H 1K22H 3BTFE 2BXUH 1JRSA 4ABBA 1B5GH 1TX7A 1P0SH 3OAAD 2PKAB 2QXGA 2WPMS 4H6SB 3ZVBA 3FZDA 4KKDA 1A0HB 3F6UH 4P00A 1IQIA 4ESTE 2OUAA 1NESE 4OS6A 1TFXA 2PKAA 1KXCA 1BTZA 1GMDG 1DT2A 2VWOA 3MU8A 5DP5A 4WMDA 1RGQA 1H9HE 3FP8E 3R3GB 2VH6A 1GJCB 2OLGA 2W6ID 3ZVGA 1IOEA 1C1VH 1V2NT 3Q3KA 1W0YH 1BHXB 1C1QA 1PPHE 1U6QA 4YXWD 1YKTA 3GY7A 2GZ7A 1ETSH 1V2VT 2JKHA 1O2GH 4B2AA 1AI8H 1NM6A 3PMAB 3SJOA 1YM0A 3GOVB 4ABAA 3MNBA 1SGEE 3SU6A 3PO1C 2AGGX 3KEEA 1DXWA 3MNXA 4IN2A 1O33A 2CN0H 1XVOA 3EA9A 1C2EA 1BRBE 5E0GA 1RXPA 1Z1JA 1SLWB 2ZZUH 1O39A 3DFLA 1BB0B 3A8BA 3E91A 3C1KA 5A8ZA 3EA7A 3DFJA 1C1TA 2VBCA 3PYHA 5IDKA 3A7YA 1O3KA 1FIWA 2WUCA 4K1SA 3RUOA 2G51A 2YMSD 1NBME 1ZHPA 4GCHF 5IYTA 2BZ6H 1IQGA 2QE7D 2XYAA 2WUBA 2LELA 2ZECA 4D8NA 4X6PA 1T31A 3MU0A 3ZVCA 2AS9A 3RC6A 5C17A 1SVPA 4UFEH 1ZHMA 3U9AH 3KF2A 3BG4C 4NIYA 3VFEA 2AHME 3SI3H 2P95A 1VGCC 1EOJA 4I8LA 1HAXB 3STIA 1BZXE 5ABWA 3TH4H 4CHAB 2H9HA 2QXIA 1QTFA 4FUCA 3LOXA 1SGTA 1LQEA 1DDJA 1W12U 2KAIB 2PUQH 3KYGA 4ZROA 1YPLH 1GMHF 1EASA 4RT0A 1A3EH 4NA7A 1O3GA 3OYPA 2BY8X 2BDHA 3H5CB 1E38B 2IPHA 4Z6AH 3SU2A 3A81A 4JZIA 3P92A 4B73A 4DURA 3E1XB 2W5EA 4XFQA 3O8BA 1W10U 3FOAA 2BD4A 1QGFA 5FPTA 2YMSC 5C5NA 3UTUH 1H8ED 1HYLA 5GCHG 2WPKS 3QGNB 2G8TA 5C0TA 5CMXH 4X8SH 1FJSA 2H1UA 2PV9B 4Q7XA 2BD3A 1EZUC 3GDSA 2BVSH 2EQNA 3VEQB 2FTMA 1GJ7B 1CU1A 1EAUA 1NBMD 5JBBS 1SC8U 1ELFA 5HXFA 1NT1A 4XE4A 2O8MA 2XTTB 4SGBE 3SGQE 1J9CH 1N6XA 2PGQB 2B0FA 2NU0E 5HM2A 3UWJH 1KLJH 5AFZH 5GPIB 4A1XA 1AFQC 1MU8B 3TJNA 3DSPA 4CRBA 4LK4A 4XBDA 2ZFTA 1G2LA 1NRSH 1V2UT 5EJLA 5A2MH 1ZJDA 2F9VA 1G3BA 3MH4A 4JCNA 5L2ZH 1CT0E 3RLWH 1MD7A 4DT7B 2JIZD 2LNCA 1GBIA 3DHKH 3LGVA 1C2MA 1DOJA 1O3JA 3VGCC 3A7WA 1VKYA 4TWYA 3UAIC 3FFGA 1THSH 1BJVA 3E8LA 4GVUA 4JZFH 4AOQA 2BD9A 1BDAA 3RXGA 2SNWA 1QURH 4LXBH 1HPGA 4RN6A 5GNDA 4ISOA 5T3HA 1Z1IA 3FKSD 1IQLA 2AFQB 1XUGA 2HWLB 1O38A 3LJJA 3LU9B 1O5BB 4KTCA 3GCTF 2UUYA 1WUNH 3CS7A 2J94A 3F2GA 1LDTT 2QGRA 1TX8A 1GMCG 4OS7A 1MH0A 1GBTA 1ZSLA 4FUEA 1IAUA 3QN7A 2G4UA 1TRYA 1O2WA 1YWUA 4F4OC 1LTOA 1GG6C 2A2QH 4TPIZ 3UNRA 1QCPA 2FIRH 3ODDA 3FANA 4J2YB 1FIZA 3D65E 5DP7A 1J8AA 1OP8A 4FUDA 2DUCA 1HLTH 3RM2H 1LQDB 1SGPE 2A7CA 3PLPA 2O8UA 5FX6A 1TMTH 1L2EA 2PR3A 1GBHA 2SGPE 1SFQB 5DJ7A 1GL1A 3N7OA 4B71A 1JBUH 2EC9H 1FQ3A 3FVFB 2WPLS 5A0CA 1ELVA 3MYWA 4X6OA 3F9HA 1BTXA 3EAJA 1D3DB 1AFQB 1FN8A 3BTHE 2ODQA 4DG4A 4U2WA 4ZXXH 4ABJA 5FBEA 5FCKA 1AD8H 5K7RA 2P59A 1VJAU 3U8RH 1DLEA 2IPQX 3RU4D 3TJUA 2DE8A 3RXOA 2ZTXA 3IG6B 1V2PT 5DG6A 1Y3YA 1VCPA 2GX4A 4MPXA 2CHAB 2BTCE 1XMNB 1C2DA 2FLRH 3A7ZA 4Q7ZA 1GJAB 1V2OT 4CR5A 5TJXA 2EI7A 1ELEE 2ZGBH 4UFGH 3TITA 3QK1A 2BY9X 1BBRH 7GCHG 2CMYA 4WF8A 3W1EA 3M5NA 3B23B 1GBAA 4I8KA 3RXPA 1EOLA 2A5AA 1C1OA 2QF3A 2ZGHA 2GT7A 3OE7D 5EODA 1WV7H 1UTJA 2C8XB 1HAIH 1WYKA 3MNCA 2A1DB 3RMLH 4GUXA 1Y3WA 3HKIB 2XNDD 3RXBA 2HVXA 1HAOH 3SZNA 1A5IA 1A1RA 4E7RG 1PPEE 4ACBA 2ZG0H 2ZI2H 4B2CA 1OPHB 2FMJA 1KY9A 4GAWA 1IQKA 1BTUA 4NFFA 3QUMP 2GGVB 1P2OA 4AC9A 1AVXA 1SPJA 2NU2E 3DA9B 1O2YA 1Z8JB 2PFEA 1C1UH 1YPJH 1QA0A 4BTTB 3N99A 4X2XA 2AMPA 3U8OH 4IGDA 2KCYA 4TPYA 3S0NA 1DWDH 4GSOA 2CXVA 4GHQA 4NSVA 4YLUA 1HAZB 1ZGVA 4B74A 1EJAA 4Q4LA 3SJKA 4BXWA 1XVMA 6GCHG 2FYQA 2ANWA 1QB1A 1EPTA 1RJXB 1SLUB 1OWDA 3QO6A 3TNTA 3ZVEA 4O3TA 2J2UA 2J4IA 4CR9A 6CHAC 4A7IB 3D62A 2F4LA 2WV9A 1P8VC 3SJ9A 1XUIA 2JH0D 3WW7A 1AIXH 2VIDA 2BX4A 4BAHB 2R3UA 5JYIA 1BJUA 3PB1E 1CGHA 1WCZA 2VVVA 1XUFA 3P70B 3S7HB 1IHSH 3D49H 3QZQA 1S6FA 2QIQA 5B6OA 3LH1A 3BN9A 1KYNA 1V2ST 5FXLA 1GDNA 1C5OH 1LHDH 2V35A 3URDA 1P03A 2K8IA 1EZQA 1W8BH 4FUIA 2WPJS 3T25A 4AORA 1V2JT 2ZFRH 5T6FA 4F55A 1UVOA 4YOIA 1G3EA 4WXVA 3WY8A 2ZDNA 2GCTC 2FOAA 1TOMH 4YZUA 1XKBC 3SHCH 1K21H 1O2LA 3TNSA 3SV2H 3GCHC 1SGIB 2ZDMA 4CRCA 3V13A 3DD2H 4XSKU 1XKAC 1DWCH 4ZHAA 2J9NA 1HV7A 1V2QT 2HLDD 1P57B 1ZR0A 3UUZA 1E37B 5C67A 1IQJA 3UR9A 1HIAA 1UCYE 1HJ9A 2OXSA 1H8HD 3DCLA 3O8CA 1OS8A 1NY22 4DY7B 4ZKRU 1W2KH 1P9SA 3SBKA 2R2MB 2ZU1A 1E1QD 3AW0A 1O2NA 1D6WA 3LDXH 1AKSA 1SGFG 1O32A 1UTNA 2G4TA 3RXTA 1N6YA 3BEFB 3ZZBA 2ZU4A 1YCPK 1SL3A 3MH6A 5ESTE 2UUFB 3RXUA 1TA2A 1UTMA 3KCGH 3SV9A 1PQAA 1B0FA 4IMQA 1QZ8A 1S6HA 2UUJB 2I6SA 2KAIA 3LIWA 1N8OC 2QF5A 1HFDA 2Z3EA 5JDUB 4UD9H 4D9QA 5HM9A 4IC5A 3GYMA 3Q77A 2FOHA 4KTSA 1FPHH 1NRNH 1CT2E 1MTNB 2ZU5A 3BTDE 2ZWLH 4ZHMU 2XWAA 1MKWK 4Y0YE 5AVDA 3TK9A 4BXSA 2H2ZA 2CHAC 3ODFA 5C1YA 2PW8H 1SGNE 1H8IH 1O3OA 2ZDVH 1ZMNA 1CHOF 1KXBA 4RI0A 1ZTLA 2Q6FA 4RT1A 1HIAB 3TJVA 2H9TH 2ZHQH 3UFAA 1LO6A 1SB1H 1S81A 2R0KA 1J15A 2SGQE 2Z9GA 2F9NA 3QDZB 3MFJA 1F2SE 1GHXH 1T8NA 1C5UA 2A0QB 2FI3E 1P2JA 8GCHG 1P2QA 2ZCLP 1VITH 1Z8GA 1AHTH 2RDEA 3KHVA 2GV6A 1HAPH 3GCNA 2BD7A 2ZPQA 3BTGE 3E3TA 4CRDA 1L0ZA 4GHTA 2ZHFH 1MCTA 1BTPA 3E0PB 2XC0A 2Y82A 2Z9KA 1V3XA 1FI8A 2ULLA 1HAYB 3RLYH 6GCHF 1D4PB 4LOYH 1AGJA 4DW2U 3UR6A 1TIOA 4NWKA 2ZHEH 2Q6DA 2TBSA 4UEHH 1UCYH 5F53A 2ZDAH 2ZGCA 2Y80A 3RXRA 3BTKE 2VGCB 3DT0H 1GBMA 3PM3A 5SGAE 3SU4A 3V7TA 1BBRK 1GJDB 1OX1A 1P05A 4X1RU 2A4GA 4X6NA 1RRKA 5T1VA 3SYJA 2Z9LA 1FNIA 3SUFA 4Q80A 1K1PA 3B8JA 1T8LA 3KIDU 4YOGA 4ZKNU 1THRH 3AASA 3EYDA 4YOJA 1ID5H 1ELCA 4CRGA 3VXFH 3QWCH 1QBOA 6CHAB 1GHVH 4KP0A 1OOKB 1ESBA 3P8OA 3Q76A 4WY3A 3MTYA 3K65B 3RXFA 1GI3A 3OTJE 5GDSH 2GDEH 1NN6A 3SN8A 1ANEA 1C5QA 2C8WB 3R0FA 4FOUC 1M9UA 3BTTE 3JZ1B 4H6TA 4X8VH 2R0LA 3WWBA 5A0BA 4CBOA 2Z3DA 4Y7AA 3UIRA 1TONA 4NZQA 1Z6EA 4XBCA 1DANH 3ZVDA 3QTVH 2BQWB 5T6GA 4NIWA 4A92A 1ABJH 2P8OB 3K6YA 4KGAA 4CRFA 5E8EH 1TGNA 3QGJA 1CBWC 1QB9A 5AFYH 2XNIA 4IS5A 4IBLH 1NRRH 1MTVA 4HFPB 1LHCH 3SJIA 3PLKA 1TQ7B 1ARCA 2XWBI 4DGJA 2V6NA 4OM9A 2ZDLA 3ZZAA 1W13U 1EAXA 3FZZA 4K69A 4XRNA 1DLKB 4ZH8A 3F3BA 4A6LA 2EA3A 2ZGXH 2GDDA 1SFIA 4Q7YA 2UWLA 2ZA5A 3TIUA 2KR7A 1AQ7A 3P8GA 2A2XH 3VB7A 1C2LA 1YC0A 1NU7B 1D3PB 1IQFA 3FO8D 4OGYA 3U98H 1Z71A 2OP9A 2QXHA 1W14U 3GISB 3RC4A 1DITH 1EP5A 4AFZA 1DUEA 2C93B 1K1IA 3QX5H 4ISNA 3S9BA 3A8DA 2ANYA 3RMOH 3PMBB 1EQ9A 2A5KA 2ZTYA 4AFSA 1V2WT 2J5UA 6ESTA 1WDIA 2F9PA 3A83A 1MUEB 4F49A 1HB0B 2GZ9A 5A09A 5GCHF 2JJ1D 3OU0A 4YT7H 5EU8A 1E79D 1O3CA 1S83A 2B9LA 1MBQA 4AB9A 5GIBA 3AW1A 3T29A 1L4ZA 2Y81A 4KELA 1PQ5A 3GY5A 4YLQH 3SUEA 2VIQA 3BTEE 4JMYA 3OEED 3P17H 3TGIE 5HKKD 4K5ZA 1EZSC 1GBEA 1QR3E 3ZVFA 2ZU3A 1FY5A 2JJ2D 1GJBB 1O2KA 1HJ8A 1UTPA 4X0WU 4NSYA 2IOTA 8LPRA 3K2UA 3Q3XA 1OHHD 1DICA 3LPRA 1CA0B 4RSPA 4AZ2B 1WQVH 2CV3A 1TBZH 2SGAA 4ISHH 3PWBA 4DIIH 1QJ6B 1IQEA 1QL8A 2HNTC 3EQ0H 2FS8A 1N8OB 2FS9A 5I46H 1AUTC 2R3YA 2W6JD 3PMJA 1O2QA 1NZQH 2L6OA 2XCFA 3RU4T 1C2JA 3WWFA 5K0HA 1WOFA 2O8TA 3EA8A 3PRDA 4CRAA 1O2MA 2BD5A 2AIQA 1OWHA 4NZLA 3UB0A 1O3HA 1P09A 1PQ7A 2VVUA 1H1BA 2ZU2A 4FUHA 1SGFA 3MO3A 1AUJA 5DGJA 4FUFA 1C4V2 3KNXA 1BMNH 2VIWA 4X2YA 4OS4A 2VINA 3A8CA 2P3UB 1EXFA 5DP6A 4Z1MD 1GVKB 2ILNA 1S0RA 1C9TA 3UOPA 1AU8A 4TT3D 1P3EA 5H4IB 1Y5AT 1KTTB 1YY3A 3M35A 2O8WA 3NZIA 2OCVB 4BOHA 3E0NB 3CNRA 1EAIA 3LC3A 3ATLA 1UHBA 3SORA 5FCRA 2KX4A 5EXMA 3H7TA 2P3FH 1GMDF 1BRAA 1AO5A 1DFPA 5HMAA 1GBCA 2W7UA 1D6RA 3PRBA 2GCHF 1O2OA 2H5DA 1FONA 1AY6H 3TLOA 1O2ZA 4AB8A 2A32A 3M7QA 1DY8A 1F5LA 2JETB 5EJZA 2WHXA 2VWMA 2PSYA 4H42U 1Q31A 1ANDA 3RXLA 1EATA 5FPSA 4LZ4B 2BLQA 2ZQ1A 1W0KD 3BSQA 1ZMLA 1P01A 1LMWB 1FY4A 2BDGA 3PROA 3MI4A 2THFB 5J4SA 4AG1A 3S7KB 3FP7E 5L6NH 1O2VA 2LPRA 1YYY1 3M7TA 4BTUB 1H9LB 2PSXA 5FX5A 1TRNA 1QQ4A 5AF9H 1FY8E 2J95A 2TPIZ 4K1EA 1SGCA 2VNTA 2HPQH 5BPEA 3HGPA 4AGJA 1BTHH 1SLXB 1PPZA 2M2AA 3SQEE 2BQ7B 1ZYOA 1PQ8A 3ITIA 1EJMA 3F0OA 2NU4E 4R0IA 1TLDA 4IW4E 4Y76A 2C8YB 3TK6A 2BVXH 2CF8H 4XBBA 4GLYA 2QA9E 4Y7BA 1HNEE 1O34A 1GBKA 2G81E 1C5TA 4ZUHA 5L30H 1TYNA 1E1RD 4E05H 4NA8A 2BDYA 8ESTE 1A0JA 1SQAA 4THNH 5PTPA 2FDAA 2BY6X 4X1QU 2C3SA 3U1IB 1JRTA 1ZSJA 1MZAA 3PV4A 2ZP0H 2B5TB 2BDAA 5EG4A 4ABIA 2WV5A 1ZRKA 3I77A 1GHYH 4ZAEA 1IQNA 3TGJE 2PUXB 2ZGJA 4FETA 3RXHA 5DP3A 3GDUA 1CVWH 5GWZA 1VCQA 4X1SU 5CHAB 1A61H 3RXIA 1SGYE 1P2IA 3VB3A 2KZ4A 1FZZA 1X7AC 5EQRA 1JMOH 3E16B 3F9GA 4FXGH 1FPCH 1GBJA 1C5VA 1V2LT 2BD2A 3HGNA 3A7XA 3SNBA 6LPRA 2OBOA 4JK6A 2TGPZ 1HAHH 2Z6BD 2FX4A 1NROH 1OWEA 2VU8E 1SKYE 3H7OA 1V2KT 1C5YB 1ZLRA 4GCHG 4Y10E 1K2I1 3RXJA 1H9IE 2EI8A 2SGEE 3UREA 1EPTC 1C5PA 1JOUB 1TMUH 1AE5A 1PJPA 1FMGA 2V3OH 5EQSA 3TH3H 1RIWC 5EIYA 1AVGH 1AKSB 4AFQA 3TGKE 3UPEA 3MO6A 3GY4A 4BAQB 4X2WA 3GY2A 1ARBA 2SNVA 3NK8A 2OK5A 3P8FA 1GBDA 4MQAA 2G5NA 2XBYA 1HRTH 4B6EA 2CGAA 2FOEA 5ETXA 1RS0A 3PV5A 1MZDA 1B7XB 3ZV9A 3F0PA 4ASUD 1EAWA 2W3IA 1BHXF 2F91A 3DSGA 3ZZCA 1AFEH 1TNHA 1VITF 1S0QA 1SQRA 2PKSB 1SSXA 1XUJA 3NCLA 1A5GH 1TQ0B 1O2PA 1P10A 3L3TA 4AX9H 4AYYB 4NFEA 1S6LA 3K9XB 4K2YA 4WXIA 1O30A 1OSSA 1HDTH 1O3LA 2SFAA 1V2MT 1TNGA 1ELTA 3OY5U 1QFKH 1HJAC 4OS1A 3KYFA 2GJGA 4ABHA 1GI2A 2GCHG 1XUHA 1WXRA 1GWAA 3M3TA 1KDQA 1GPZA 1LHEH 1O2SA 2GT8A 4FVBA 1C5ZB 1QL7A 2WZQA 1FN6A 1G3CA 3UQOA 4Y6DA 4BAMB 3RDZA 3A80A 1BMFD 1O5GH 4MNYA 5C1UA 1JXPA 2FESH 1GJ8B 1EFRD 4DCDA 3UQVA 3QTOH 1IQHA 1C5LH 3SOSA 2RA0A 3SV7A 1BCUH 2Q6GA 3URCA 3UOUA 3BG4B 2KCOA 3SGAE 2WPIS 1YPMH 1BQYA 5A0AE 1C2FA 3OFND 1T4VH 3BV9B 3SNAA 3SUGA 1S5SA 3SQHE 1F0UA 1W0ZU 1K9OE 4VGCB 1O3NA 5T6DA 1LHGH 3BTME 2VIOA 3NXPA 3OTPA 1KXDA 3F1SB 5KEDA 4CREA 4AFUA 4X8UH 2AERH 1UVTH 1BITA 4MDSA 3QLPH 3FN8A 1HAVA 2K0QA 1TBRH 1GMCF 2F83A 4ABDA 2ALVA 1NC6A 4M9FA 3ZZDA 1YP9A 5GJ4B 1C2GA 3OX7U 3ZZ5A 1TRMA 2HVYB 3RC5A 3MQKC 3OY6U 4GPGA 1XXDA 1P2MA 2R2WU 1FX0B 3AAUA 5EJ1A 2HALA 2PWXA 3DSOA 3FAOA 3MU4A 4FU9A 3SNDA 3T62A 1JWTA 1Z8IB 2ZFSA 5JBAS 2RA3A 4UONA 1QJ7B 1S82A 1K0HA 3ZIAD 4IC6A 3KQBA 3MMGA 1SG8B 1E35B 4K8BA 2WYGA 2GV7A 1CBWB 1TNIA 1TNJA 1ZJKA 3ZVAA 1QL9A 3RXKA 1GI8B 3LT3A 1UVSH 4ZCNA 1PPFE 1E36B 4FVDA 3TK5A 1MQ6A 1WAYB 1NFYA 1TE0A 3VB6A 1GGDC 2FEQH 3A84A 1Q3XA 2EY4C 2FOMB 4NIVA 2AIPA 2VWNA 1AE8H 2FOFA 4CBNA 1AVWA 1K28D 4K60A 4JZEH 1AB9C 2GTBA 3LGWA 4LZ1H 1MU6B 3GCOA 1HBTH 1NFXA 1S84A 4O97A 4P02A 3E90B 1ELGA 1AZ8A 1Z6JH 1C5NH 1K1OA 2QYIA 1EPTB 3ATWA 3A82A 2KM0A 2ZO3H 5E0JA 2O8LA 2FX6A 3D23A 4ZMAH 4B76A 1NFUA 1C1MA 4X1PU 1QRWA 5DP8A 2BLOA 1ANBA 3ZZ7A 1O5DH 1O35A 1BMAA 3LGIA 2ZKSA 1OXGA 1GMHG 5B6LA 2A4OA 3RXMA 1O2TA 1TB6H 4FUJA 1GHAF 3SZEA 4PROA 3S69A 1NRPH 1ZMJA 4RKJB 4X2VA 1YPHC 4BTIB 1GCTB 1P2KA 2AMDA 2VJ1A 4JK5A 3GYLB 1J16A 4FUBA 1MBMA 2BD8A 1K1JA 1RIWB 4RKOB 3T5FH 1CGJE 3LKWA 3S9AA 1GG6B 2ZF0H 3CS0A 1W7XH 1DE7H 3RMNH 5F03A 3T28A 4YM9A 1WTHD 2TRMA 1XXFA 1GHAG 1UCYK 1GHWH 4U01A 2ODYB 3PTBA 4CH2B 3SW2B 4TY7A 2FODA 1O3DA 2IJD1 5LPRA 5LPEA 1ZTKA 1CT4E 1LVOA 3BG8A 3UNQA 3MHWU 2QN5T 2BDIA 4QT8C 2XC5A 5J4QA 1RTKA 1QY6A 4X1NU 1PPBH 4Y11E 1ZZZA 2D8WA 1LVYA 2SGFE 2KCAA 1O5EH 5C5OA 4JZ1A 2P8OC 2A4QA 4MTBA 1D3QB 2Y7ZA 5LGOA 4XDEA 3BF6H 7LPRA 3EGKH 1SGQE 1FY3A 2ASUB 1P2NA 1TPPA 5E0HA 3L6PA 5JB8S 4HG6A 4YTAA 2V3HH 1O3IA 1P04A 2G00A 3PTNA 1TOCB 1O5AB 1DX5M 3EDXB 3FP6E 1G3DA 3PWCA 1AB9B 3GY6A 1AN1E 4O9VA 1JIRA 4MG3A 1DPOA 1HGTH 1SOZA 3C27B 1QIXB 1O2XA 1NS3A 2ZFQH 1Z8RA 1A2CH 1DUAA 2CJIA 2F9UA 2STBE 1BTWA 4FUGA 5FPYA 1ZGIA 1A5HA 1BMLA 1TAWA 1HAGE 1PYTD 1QBNA 2OC1A 1TMBH 2YNAA 4ISLA 1PYTC 2J97A 1DSTA 1WQSA 2FOGA 2QF0A 4CH8B 1D3TB 1O5FH 1P11E 1MKXH 1KIGH 3VGCB 3PMHB 2ZFFH 1CHOG 3MH7A 3E6PH 4U32A 4TSFD 1TPAE 2ANMH 4I8HA 1LPKB 2W3KA 1YPKH 1OWKA 3BTQE 1F5RA 1KLTA 2DE9A 1BOQA 4Y79A 2C90B 1ZOMA 2Z9IA 1F0TA 3MOCA 4NGAH 3SI4H 1T7CA 4JYVH 3RXVA 5HIZA 3M61U 4NG9H 2WSSD 2AH4X 1CA0C 1EZXC 1F0RA 1L1GA 3ATMA 4ABFA 1C5RA 4UFDH 3T27A 1TNLA 1MKXK 4YESB 2ZCHP 5C94A 1MTNC 2ZFPH 2Y5HA 5CDFE 1TGCA 2P3TB 2IJOB 4NIXA 4R8TB 4X8TH 1BBRE 1EB2A 7ESTE 5F8XA 4MLFB 3SU0A 1QB6A 1ETTH 1ZHRA 3SU1A 4UFFH 1QRXA 1KSNA 4HTCH 4ABGA 3A8AA 3B9FH 2H9EH 1OP2A 2G55A 2ESTE 2BVRH 1XUKA 1MAYA 3AVZA 3QZRA 2GVFA 3EE0B 1P12E 3ATKA 2BHGA 2BLWA 5JBCS 3M5MA 4K1TA 4MPUA 1TGBA 3T26A 2BY5X 3RXSA 5CHBA 1BRUP 2UWOA 2C4FH 5EW2H 1WSSH 2GZ8A 4Y71A 4INLA 4ACAA 1W0JD 1JIMA 1C1NA 2GCTB 3M37A 3IWMA 1ANCA 3L33A 2D26C 1C2IA 1YLNA 5TCAA 1O2JA 5I25A 4O3UA 2OBQA 1P06A 1QNJA 4WMFA 5F8TA 2GD4B 2BLVA 4I8GA 1ELDE 2AGEX 2AGIX 3UWIA 2L74A 1MCVA 1MD8A 1GI6A 2V3MA 2FXRA 2FO9A 1MTWA 1UK3A 1P02A 3TVJB 4BNRA 1C2HA 3EE7A 3SV8A 3W94A 1T4UH 3MU5A 4WVPE 4DOQA 1O5CB 2P16A 1CGIE 1C5MD 1GI9B 1ESAA 2XC4A 2Y6TA 3A87A 4Y8XA 2TGTA 2JH5D 2YNBA 1FY1A 5BRRE 2TGAA 1C5XB 2HPPH 2FYRA 4DT4A 2FOBA 2VB0A 2HRVA 1TX6A 1FDPA 3VG8A 2O9QA 1XX9A 3HPTB 3M3VA 2OQ5A 1DM4B 3K6ZA 4XOJA 3A7TA 1DXPA 4K8YA 2TIOA 2ZDKA 1ORFA 1ELAA 3GCTG 1O3EA 3STJA 4FU8A 2XOKD 3GDVA 2BOHB 3KQEA 1GBLA 1O3MA 7KMEH 2HLCA 3RXDA 1FAKH 3P6ZB 2FPZA 1VJ9U 5EW1H 1QHRB 2BY7X 4DJZB 2RG3A 4A5TS 2HNTE 1AMHA 2PTCE 1YLDA 1YPGH 1J14A 5FL7D 1O0DH 1O3FA 1DSUA 1ZPCA 2VIVA 1W7GH 2VIPA 4I7YH 1MMJN 3GY3A 2FP7B 3A7VA 4B1TA 1F5KU 4MNWA 2ZTZA 1SBWA 1VCWA 3H09A 1K1MA 4HI3A 8GCHF 1Y3VA 3LJOA 1TBQH 5KECA 1G36A 5IK2D 1GI5A 1CQQA 2H5CA 1BT7A 1K1NA 4U30A 3VPKA 2BXTH 1O3PB 1RTFB 1LPZB 5DP4A 4ZHLU 5F8ZA 5JPMH 1LPGB 4WH8A 2GMTC 1Q2WA 5F6MA 2F9BH 2A7HA 3PV2A 1K1LA 2ZCKP 4AN7A 4TWWA 3ZZ3A 1C4U2 4WJG2 4TY6A 4AGKA 2J98B 2Z94A 2LP6A 4WMEA 4DVAU 1EJNA 2FI5E 3G01A 1MAXA 1GDUA 4IN1A 3W95A 2Y5FA 3TH2H 2J98A 1TGSZ 2BDBA 3O8DA 1UW7A 2CF9H 5KGOA 2RDLA 2JDID 1GJ9B 1OWIA 4IMZA 4Y0ZE 1NFWA 1UJ1A 4JYTA 4VGCC 2VWLA 2GKVE 1L1NA 1UO6A 3RXCA 2I6QA 2FOCA 4E7NA 1GJ6A 3NWUA 1EB1H 3P8NA 2A31A 1Y3UA 1O3AA 2BB4A 2J92A 2Z9JA 2D2DA 4UDWH 1ZPBA 1H8DH 2ZNKH 3RP2A 1GHBG 3MWIU 5A8YA 1G32B 2RCEA 2R9PA 1E0FD 1YCPH 1ELBA 3ELAH 1YLCA 2OC8A 3F9EA 4K3JA 2ZHDA 2IN2A 2NWNA 2TGDA 1GHZA 1SGDE 3IITA 4I33A 3RXEA 1TALA 3HKJB 1VGCB 3ZYEA 1GDQA 1KDQB 1O2IA 1PPGE 1ZPZA 2Y5GA 4SGAE 1MKWH 2BYAX 2A45B 3DUXH 1KXEA 4E06H 1GHBF 2W26A 1KLIH 2B8OH 2D1JA 2QCYA 2BMGB 3S9CA 1GI4A 2FTLE 1WTGH 2WPHS 3MU1A 2BX3A 2CK3D 3KN2A 1Y59T 1C1RA 1BIOA 2Q1JA 1O3BA 1F0SA 1PPCE 3M5LA 3V0XA 3A89A 3HK3B 9ESTA 3HK6B 1XM1A 1HJAB 2F9OA 1RTLA 3BIVH 1ESTA 5EPNA 4MNVA 3BTWE 3MH5A 2YMSB 1ZTJA 2PKSC 1GCDA 2QXJA 2FI4E 3ZV8A 2ZQ2A 1UTKA 4MNXA 1MQ5A 4D7GA 1COWD 1OKXA 2GP9B 1Y8TA 3LH3A 1UTOA 1S85A 3T2NA 1YPEH 3ESTA 1CHGA 1HXEH 1UVUH 3RMMH 4I86A 1O2HA 4JZDH 4KTUA 4YT6H 1TA6A 2ODPA 5DSFA 3TJOA 2BZAA 2FLBH 1OP0A 2V0BA 3CENA 4ASHA 1KTSB 3ZZ8A 1GI0A 1GI1A 2XBWA 4H4FA 1UMAH 1GBBA 1T32A 2ZPSA 4ABEA 2KFWA 4HZHA 2QC2A 3KQDA 1VZQH 2A5IA 1EX3A 1DY9A 2OQUA 3M36A 4TYDA 2XBVA 4UE7H 1A4WH 2PGBB 1TWXB 3VXEH 5HGGA 1P9UA 5AHGH 1G2MA 2WINI 1NO9H 1A0LA 1B0EA 3LGTA 3UNSA 4D9RA 1TPSA 3VB5A 3ENSB 1L1JA 4ISIH 5LH8A 4Y8YA 1HUTH 1SMFE 3JZ2B 1O31A 2ZIQH 3OSYA 5EOKA 3SU3A 1DVAH 3RM0H 1LCYA 5EPYA 1VR1H 4YO9A 1F92A 1G37A 1G30B 5G4BA 1TPOA 2B7DH 3I78A 2ZPRA 1SOTA 2A7JA 5E2OA 1ZRBA 1GL0E 1VITG 2P94A 1MABB 2G52A 4AG2A 2NU1E 3KQ5A 1YF4A 3BEIB 3UY9A 1DS2E 3BIUH 4MPWA 4OGXA 4WH6A 1C1WH 1TGTA 5C0UA 2FM2A 5ESBA 3RXAA 3MNSA 1T8MA 1GJ4H 2FWWA 1BTYA 1Z7KA 2WYJA 1BUIA 1GJ5H 1MTSA 1NTPA 3SO3A 5DPAA 1FV9A 4Y8ZA 3LGYA 1O37A 1C9PA 2H6MA 1Y5BT 3F68H 1C2KA 2P93A 2UWPA 3SUDA 1CSOE 5EGMA 5C20A 2V7QD 4D76A 1IHTH 1NU9A 1KXFA 1CO7E 1FLEE 5C2ZA 3ZZ4A 3ZZ6A 2VVCA 1T8OA 4B2BA 5EQQA 5TCCA 2A4RA 2UUKB 2XW9A 3ZYDA 3PO1B 3V3MA 1SLVB 2G5VA 3Q00A 2WV4A 3KGPA 1QBVH 5DK1A 2FZZA 1YBWA 1GBFA 2OC7A 3TU7H 4O03A 3HATH 3U1JB 1SHYA 3SGBE 3SHAH 3U28C 2AMQA 2F3CE 1OWJA 2C8ZB 1A3BH 2BQ6B 1QRZA 2KCPA 3U8TH 1UK2A 1C1SA 2XCNA 3NPSA 1KXAA 1L4DA 1QA7A 3O8RA 5L2YH 2NU3E 3GCHB 4HGCA 2SGDE 4INHA 1EUFA 1SQOA 8KME2 2STAE 3A85A 1FXYA 1C5WB 2GMTB 2Z3CA 1BA8B 1GGDB 3CP7A 4FU7A 3V12A 1SR5C 7GCHF 4X6MA 2OINA 1THPB 1UTQA 4I32A 1BRCE 3SJ8A 1UK4A 2QF4A 5DKMA 2OC0A 1SGRE 3A86A 3GY8A 3KQCA 5E2PA 1UHBB 2EI6A 3LC5A 2YOLA 2J34A 5DO4H 4OS5A 1ETRH 1NPMA 1YPHE 3SU5A 4WWYA 1LHFH 1ACBE 1SHHB 2K1QA 2PLXA 3N7DA 1NRQH 2PP6A 3KL6A 1WBGB 2BM2A 1MTUA 2F43B 4B6FA 3TPIZ 4BANB 2PTNA 4MPVA 5HIYA 2JETC 1A7SA 4JYUH 2QY0B 1P3CA 3AAVA 1LKBA 1SQTA 4D7FA 1SI5H 1GCTC 5JBTA 2XRCA 4M7GA 1HAVB 1RFNA 2OTVA 3F2HA 1V6DA 1Y5UT 2PHBA 1N1LA 3LGUA 5EXLA 1V2RT 2Y7XA 5A8XA 3SV6A 1OYQA 1RD3B 2Z7FE 3GS9A 4ZKOU 2W7SA 2M5TA 5LPFA 1AZZA 5HYOA 4A1VA 5EXNA 1DWEH 9LPRA 4Z0KA 2QV1A 1EKBB 2OD3B 1GI7B 2QAAA 3RXQA 5C1XA 2XXLA 1GVLA 1FAXA 4DIHH 1INCA 4AYVB 1KMHB 3NRLA 3AK5A 2VH0A 1EP6A 4MVNA 3A88A 3F9FA 3SNEA 2JH6D 1H4WA 2RFKC 5DP9A 1G9IE 2J38A 3Q3YA 1YGCH 1O2UA 3M5OA 5JB9S 5C3NA 3BEUA 3NKKA 1BMMH 4BAKB 4ZXYH 4XD7D 2XBXA 4I8JA 1YCPM 3RU4E 1AWFH 2BOKA 4Q63A 3I29A 1Y3XA 3LONA 4NWLA 3SNCA 5FBIA 1TABE 4J1YA 3OEHD 2ANKH 1V2TT 4B75A 1WU1A 3MO9A 1W3CA 3PLBA 4A1TA 3P95A 2AYWA 1CE5A 1IQMA 3NUMA 5FAHA 4ZKSU 1GVZA 2HOBA 1AWHB 5DN6D 4F48B 5CHAC 1CA8B 2VGCC 1O36A 1A46H 4BAOB 1LKAA 4NCYA 4OS2A 4Q2KA 3VB4A 1OYTH 1C5SA 3N7EA 1O2RA 1J17T 1LVBA 4NA9H 1FUJA 2BDCA 2EEKA 1W11U 1E34B 2ZHWH 1DWBH 1QJ1B 2WPDD 1HCGA
chains in the Genus database with same CATH topology
3GICB 5FHTA 5GXPA 1D9IA 1UVPA 2ALPA 3M7UA 1TNKA 2HNTF 1HXFH 1ZSKA 1C4Y2 3M3SA 3ZZ9A 2AEIH 5CE1A 1PFXC 2HGTH 2ZEBA 1F7ZA 4CHAC 1QQUA 2ZC9H 3ATIA 1C1PA 1UTLM 4INKA 1ABIH 4I31A 1LVMA 3U69H 1K22H 3BTFE 2BXUH 1JRSA 4ABBA 1B5GH 1TX7A 1P0SH 2PKAB 2QXGA 2WPMS 4H6SB 3ZVBA 3FZDA 4KKDA 1A0HB 3F6UH 1IQIA 4ESTE 2OUAA 1NESE 4OS6A 1TFXA 2PKAA 1KXCA 1BTZA 1GMDG 1DT2A 2VWOA 3MU8A 5DP5A 4WMDA 1RGQA 1H9HE 3FP8E 3R3GB 2VH6A 1GJCB 2OLGA 3ZVGA 1IOEA 1C1VH 1V2NT 3Q3KA 1W0YH 1BHXB 1C1QA 1PPHE 1U6QA 1YKTA 3GY7A 2GZ7A 1ETSH 1V2VT 2JKHA 1O2GH 4B2AA 1AI8H 1NM6A 3PMAB 3SJOA 1YM0A 3GOVB 4ABAA 3MNBA 1SGEE 3SU6A 3PO1C 2AGGX 3KEEA 1DXWA 3MNXA 4IN2A 1O33A 2CN0H 1XVOA 3EA9A 1C2EA 1BRBE 5E0GA 1RXPA 1Z1JA 1SLWB 2ZZUH 1O39A 3DFLA 1BB0B 3A8BA 3E91A 3C1KA 5A8ZA 3EA7A 3DFJA 1C1TA 5IDKA 3PYHA 3A7YA 1O3KA 1FIWA 2WUCA 4K1SA 3RUOA 2G51A 1ZHPA 4GCHF 5IYTA 2BZ6H 1IQGA 2XYAA 2WUBA 2ZECA 4D8NA 4X6PA 1T31A 3MU0A 3ZVCA 2AS9A 3RC6A 1SVPA 4UFEH 1ZHMA 3U9AH 3KF2A 3BG4C 4NIYA 3VFEA 3SI3H 2P95A 1VGCC 1EOJA 4I8LA 1HAXB 3STIA 1BZXE 5ABWA 3TH4H 4CHAB 2H9HA 2QXIA 1QTFA 4FUCA 3LOXA 1SGTA 1LQEA 1DDJA 1W12U 2KAIB 2PUQH 4ZROA 1YPLH 1GMHF 1EASA 1A3EH 4NA7A 1O3GA 3OYPA 2BY8X 2BDHA 3H5CB 1E38B 2IPHA 4Z6AH 3SU2A 3A81A 4JZIA 3P92A 4B73A 4DURA 3E1XB 2W5EA 4XFQA 3O8BA 1W10U 2BD4A 1QGFA 5FPTA 5C5NA 3UTUH 1HYLA 5GCHG 2WPKS 3QGNB 2G8TA 5CMXH 4X8SH 1FJSA 2H1UA 2PV9B 4Q7XA 2BD3A 1EZUC 3GDSA 2BVSH 3VEQB 2FTMA 1GJ7B 1CU1A 1EAUA 5JBBS 1SC8U 1ELFA 5HXFA 1NT1A 4XE4A 2O8MA 2XTTB 4SGBE 3SGQE 1J9CH 1N6XA 2PGQB 2B0FA 2NU0E 5HM2A 3UWJH 1KLJH 5AFZH 5GPIB 4A1XA 1AFQC 1MU8B 3TJNA 4CRBA 4LK4A 4XBDA 2ZFTA 1G2LA 1NRSH 1V2UT 5A2MH 1ZJDA 2F9VA 1G3BA 3MH4A 4JCNA 5L2ZH 1CT0E 3RLWH 1MD7A 4DT7B 2LNCA 1GBIA 3DHKH 3LGVA 1C2MA 1DOJA 1O3JA 3VGCC 3A7WA 4TWYA 3FFGA 1THSH 1BJVA 3E8LA 4GVUA 4JZFH 4AOQA 2BD9A 1BDAA 3RXGA 2SNWA 1QURH 4LXBH 1HPGA 4RN6A 5T3HA 4ISOA 1Z1IA 1IQLA 2AFQB 1XUGA 2HWLB 1O38A 3LJJA 3LU9B 1O5BB 4KTCA 3GCTF 2UUYA 1WUNH 3CS7A 2J94A 1LDTT 2QGRA 1TX8A 1GMCG 4OS7A 1MH0A 1GBTA 1ZSLA 4FUEA 1IAUA 3QN7A 2G4UA 1TRYA 1O2WA 4F4OC 1LTOA 1GG6C 2A2QH 4TPIZ 3UNRA 1QCPA 2FIRH 3ODDA 3FANA 4J2YB 1FIZA 3D65E 5DP7A 1J8AA 1OP8A 4FUDA 2DUCA 1HLTH 3RM2H 1LQDB 1SGPE 2A7CA 3PLPA 2O8UA 5FX6A 1TMTH 1L2EA 2PR3A 1GBHA 2SGPE 1SFQB 5DJ7A 1GL1A 3N7OA 4B71A 1JBUH 2EC9H 1FQ3A 3FVFB 2WPLS 5A0CA 1ELVA 3MYWA 4X6OA 3F9HA 1BTXA 3EAJA 1D3DB 1AFQB 1FN8A 3BTHE 2ODQA 4DG4A 4U2WA 4ZXXH 4ABJA 5FBEA 5FCKA 1AD8H 5K7RA 2P59A 1VJAU 3U8RH 1DLEA 3RU4D 3TJUA 2DE8A 3RXOA 2ZTXA 3IG6B 1V2PT 5DG6A 1Y3YA 1VCPA 2GX4A 4MPXA 2CHAB 2BTCE 1XMNB 1C2DA 2FLRH 3A7ZA 4Q7ZA 1GJAB 1V2OT 4CR5A 5TJXA 2EI7A 1ELEE 2ZGBH 4UFGH 3TITA 3QK1A 2BY9X 1BBRH 7GCHG 2CMYA 4WF8A 3M5NA 3B23B 1GBAA 4I8KA 3RXPA 1EOLA 2A5AA 1C1OA 2QF3A 2ZGHA 2GT7A 5EODA 1WV7H 1UTJA 2C8XB 1HAIH 1WYKA 3MNCA 2A1DB 3RMLH 4GUXA 1Y3WA 3HKIB 3RXBA 2HVXA 1HAOH 3SZNA 1A5IA 1A1RA 4E7RG 1PPEE 2ZG0H 2ZI2H 4B2CA 1OPHB 2FMJA 1KY9A 4GAWA 1IQKA 1BTUA 4NFFA 3QUMP 2GGVB 1P2OA 1AVXA 1SPJA 2NU2E 3DA9B 1O2YA 1Z8JB 2PFEA 1C1UH 1YPJH 1QA0A 4BTTB 4X2XA 2AMPA 3U8OH 4IGDA 4TPYA 3S0NA 1DWDH 4GSOA 2CXVA 4GHQA 4NSVA 4YLUA 1HAZB 1ZGVA 4B74A 1EJAA 3SJKA 4BXWA 1XVMA 6GCHG 2FYQA 2ANWA 1QB1A 1EPTA 1RJXB 1SLUB 1OWDA 3QO6A 3TNTA 3ZVEA 4O3TA 2J2UA 2J4IA 4CR9A 6CHAC 4A7IB 3D62A 1P8VC 3SJ9A 1XUIA 2JH0D 1AIXH 2VIDA 2BX4A 4BAHB 2R3UA 5JYIA 1BJUA 3PB1E 1CGHA 1WCZA 2VVVA 1XUFA 3P70B 3S7HB 1IHSH 3D49H 3QZQA 1S6FA 2QIQA 5B6OA 3LH1A 3BN9A 1KYNA 1V2ST 5FXLA 1GDNA 1C5OH 1LHDH 2V35A 3URDA 1P03A 1EZQA 1W8BH 4FUIA 2WPJS 3T25A 4AORA 1V2JT 2ZFRH 5T6FA 1UVOA 4YOIA 1G3EA 4WXVA 3WY8A 2ZDNA 2GCTC 2FOAA 1TOMH 4YZUA 1XKBC 3SHCH 1K21H 1O2LA 3TNSA 3SV2H 3GCHC 1SGIB 2ZDMA 4CRCA 3V13A 3DD2H 4XSKU 1XKAC 1DWCH 4ZHAA 2J9NA 1HV7A 1V2QT 1P57B 1ZR0A 3UUZA 1E37B 5C67A 1IQJA 3UR9A 1HIAA 1UCYE 1HJ9A 2OXSA 3O8CA 1OS8A 1NY22 4DY7B 4ZKRU 1W2KH 1P9SA 3SBKA 2R2MB 2ZU1A 3AW0A 1O2NA 1D6WA 3LDXH 1AKSA 1SGFG 1O32A 1UTNA 2G4TA 3RXTA 1N6YA 3BEFB 3ZZBA 2ZU4A 1YCPK 1SL3A 3MH6A 5ESTE 2UUFB 3RXUA 1TA2A 1UTMA 3KCGH 3SV9A 1PQAA 1B0FA 4IMQA 1S6HA 2UUJB 2I6SA 2KAIA 3LIWA 1N8OC 1HFDA 2Z3EA 5JDUB 4UD9H 4D9QA 5HM9A 4IC5A 3GYMA 3Q77A 2FOHA 4KTSA 1FPHH 1NRNH 1CT2E 1MTNB 2ZU5A 3BTDE 2ZWLH 4ZHMU 2XWAA 1MKWK 4Y0YE 5AVDA 3TK9A 4BXSA 2H2ZA 2CHAC 3ODFA 5C1YA 2PW8H 1SGNE 1H8IH 1O3OA 2ZDVH 1ZMNA 1CHOF 1KXBA 1ZTLA 2Q6FA 1HIAB 3TJVA 2H9TH 2ZHQH 3UFAA 1LO6A 1SB1H 1S81A 2R0KA 1J15A 2SGQE 2Z9GA 2F9NA 3QDZB 3MFJA 1F2SE 1GHXH 1T8NA 1C5UA 2A0QB 2FI3E 1P2JA 8GCHG 1P2QA 2ZCLP 1VITH 1Z8GA 1AHTH 3KHVA 1HAPH 2GV6A 3GCNA 2BD7A 2ZPQA 3BTGE 3E3TA 4CRDA 1L0ZA 4GHTA 2ZHFH 1MCTA 1BTPA 3E0PB 2XC0A 2Y82A 2Z9KA 1V3XA 1FI8A 2ULLA 1HAYB 3RLYH 6GCHF 1D4PB 4LOYH 1AGJA 4DW2U 3UR6A 1TIOA 4NWKA 2ZHEH 2Q6DA 2TBSA 4UEHH 1UCYH 2ZDAH 2ZGCA 2Y80A 3RXRA 3BTKE 2VGCB 3DT0H 1GBMA 3PM3A 5SGAE 3SU4A 3V7TA 1BBRK 1GJDB 1OX1A 1P05A 4X1RU 2A4GA 4X6NA 1RRKA 2Z9LA 1FNIA 3SUFA 4Q80A 1K1PA 3B8JA 1T8LA 3KIDU 4YOGA 4ZKNU 1THRH 3AASA 3EYDA 4YOJA 1ID5H 1ELCA 4CRGA 3VXFH 3QWCH 1QBOA 6CHAB 1GHVH 4KP0A 1OOKB 1ESBA 3P8OA 3Q76A 4WY3A 3MTYA 3K65B 3RXFA 1GI3A 3OTJE 5GDSH 2GDEH 1NN6A 3SN8A 1ANEA 1C5QA 2C8WB 3R0FA 1M9UA 3BTTE 3JZ1B 4H6TA 4X8VH 2R0LA 5A0BA 4CBOA 2Z3DA 4Y7AA 3UIRA 1TONA 4NZQA 1Z6EA 4XBCA 1DANH 3ZVDA 3QTVH 2BQWB 5T6GA 4NIWA 4A92A 1ABJH 2P8OB 3K6YA 4KGAA 4CRFA 5E8EH 1TGNA 3QGJA 1CBWC 1QB9A 5AFYH 2XNIA 4IS5A 4IBLH 1NRRH 1MTVA 4HFPB 1LHCH 3SJIA 3PLKA 1TQ7B 1ARCA 2XWBI 4DGJA 2V6NA 2ZDLA 3ZZAA 1W13U 1EAXA 3FZZA 4K69A 1DLKB 4ZH8A 4A6LA 2EA3A 2ZGXH 2GDDA 1SFIA 4Q7YA 2UWLA 2ZA5A 3TIUA 1AQ7A 3P8GA 2A2XH 3VB7A 1C2LA 1YC0A 1NU7B 1D3PB 1IQFA 4OGYA 3U98H 1Z71A 2OP9A 2QXHA 1W14U 3GISB 3RC4A 1DITH 1EP5A 4AFZA 1DUEA 2C93B 1K1IA 3QX5H 4ISNA 3S9BA 3A8DA 2ANYA 3RMOH 3PMBB 1EQ9A 2A5KA 2ZTYA 4AFSA 1V2WT 6ESTA 2F9PA 3A83A 1MUEB 4F49A 1HB0B 2GZ9A 5A09A 5GCHF 4YT7H 3OU0A 5EU8A 1O3CA 1S83A 2B9LA 1MBQA 4AB9A 5GIBA 3AW1A 3T29A 1L4ZA 2Y81A 4KELA 1PQ5A 3GY5A 4YLQH 3SUEA 2VIQA 3BTEE 4JMYA 3P17H 3TGIE 4K5ZA 1EZSC 1GBEA 1QR3E 3ZVFA 2ZU3A 1FY5A 1GJBB 1O2KA 1HJ8A 1UTPA 4X0WU 4NSYA 2IOTA 8LPRA 3K2UA 3Q3XA 1DICA 3LPRA 1CA0B 4RSPA 4AZ2B 1WQVH 2CV3A 1TBZH 2SGAA 4ISHH 3PWBA 4DIIH 1QJ6B 1IQEA 1QL8A 2HNTC 3EQ0H 2FS8A 1N8OB 2FS9A 5I46H 1AUTC 2R3YA 3PMJA 1O2QA 1NZQH 2XCFA 3RU4T 5K0HA 1C2JA 1WOFA 2O8TA 3EA8A 4CRAA 1O2MA 2BD5A 2AIQA 1OWHA 4NZLA 1O3HA 1P09A 1PQ7A 2VVUA 1H1BA 2ZU2A 4FUHA 1SGFA 3MO3A 1AUJA 5DGJA 4FUFA 1C4V2 3KNXA 1BMNH 2VIWA 4X2YA 4OS4A 2VINA 3A8CA 2P3UB 1EXFA 5DP6A 1GVKB 2ILNA 1S0RA 1C9TA 3UOPA 1AU8A 1P3EA 5H4IB 1Y5AT 1KTTB 3M35A 2O8WA 3NZIA 2OCVB 4BOHA 3E0NB 1EAIA 3LC3A 3ATLA 1UHBA 3SORA 5FCRA 5EXMA 3H7TA 2P3FH 1GMDF 1BRAA 1AO5A 1DFPA 5HMAA 1GBCA 2W7UA 1D6RA 2GCHF 1O2OA 2H5DA 1FONA 1AY6H 3TLOA 1O2ZA 4AB8A 2A32A 3M7QA 1DY8A 1F5LA 2JETB 2VWMA 2PSYA 4H42U 1Q31A 1ANDA 3RXLA 1EATA 5FPSA 4LZ4B 2BLQA 2ZQ1A 3BSQA 1ZMLA 1P01A 1LMWB 1FY4A 2BDGA 3PROA 3MI4A 2THFB 5J4SA 4AG1A 3S7KB 3FP7E 5L6NH 1O2VA 2LPRA 1YYY1 3M7TA 4BTUB 1H9LB 2PSXA 5FX5A 1TRNA 1QQ4A 5AF9H 1FY8E 2J95A 2TPIZ 4K1EA 1SGCA 2VNTA 2HPQH 5BPEA 3HGPA 4AGJA 1BTHH 1SLXB 1PPZA 3SQEE 2BQ7B 1ZYOA 1PQ8A 3ITIA 1EJMA 2NU4E 4R0IA 1TLDA 4IW4E 4Y76A 2C8YB 3TK6A 2BVXH 2CF8H 4XBBA 4GLYA 2QA9E 4Y7BA 1HNEE 1O34A 1GBKA 2G81E 1C5TA 4ZUHA 5L30H 1TYNA 4E05H 4NA8A 2BDYA 8ESTE 1A0JA 1SQAA 4THNH 5PTPA 2FDAA 2BY6X 4X1QU 2C3SA 3U1IB 1JRTA 1ZSJA 1MZAA 3PV4A 2ZP0H 2B5TB 2BDAA 5EG4A 4ABIA 2WV5A 1ZRKA 3I77A 1GHYH 4ZAEA 1IQNA 3TGJE 2PUXB 2ZGJA 3RXHA 5DP3A 3GDUA 1CVWH 5GWZA 1VCQA 4X1SU 5CHAB 1A61H 3RXIA 1SGYE 1P2IA 3VB3A 1FZZA 1X7AC 5EQRA 1JMOH 3E16B 3F9GA 4FXGH 1FPCH 1GBJA 1C5VA 1V2LT 2BD2A 3HGNA 3A7XA 3SNBA 6LPRA 2OBOA 4JK6A 2TGPZ 1HAHH 2Z6BD 2FX4A 1NROH 1OWEA 2VU8E 3H7OA 1V2KT 1C5YB 1ZLRA 4GCHG 4Y10E 1K2I1 3RXJA 1H9IE 2EI8A 2SGEE 3UREA 1EPTC 1C5PA 1JOUB 1TMUH 1AE5A 1PJPA 1FMGA 2V3OH 5EQSA 3TH3H 1RIWC 1AVGH 1AKSB 4AFQA 3TGKE 3UPEA 3MO6A 3GY4A 4BAQB 4X2WA 3GY2A 1ARBA 2SNVA 3NK8A 3P8FA 1GBDA 4MQAA 2G5NA 2XBYA