2BDCA

Porcine pancreatic elastase complexed with asn-pro-ile at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdcA01
1KY9A 3ZZCA 1TIOA 2Y7ZA 2ZDLA 1UK2A 1B5GH 2ZQ2A 2A2XH 4I32A 2TRMA 2XWBI 5EPNA 3ZVGA 1Q2WA 3DFLA 2ZFSA 1FLEE 1AWHB 1HAOH 1ZMNA 2EI7A 1O2OA 1V2TT 1PPEE 1DX5M 1N8OC 1V2NT 4Y11E 3ZZ6A 3P8GA 1T8OA 2ZIQH 3RXLA 5C1UA 1PQ8A 2ILNA 1Z1JA 3F68H 2GTBA 3RXQA 1UTKA 4FU7A 3ZZBA 1CU1A 3RXKA 2BD8A 3GCTF 1D6RA 5C5NA 1ZTKA 1SGTA 3AW1A 1TMUH 4E7RG 4B75A 1ELGA 1DSTA 2A5KA 3HKJB 1K1NA 3A8DA 1WUNH 1O3DA 5J4SA 1HV7A 2BHGA 1P03A 4FVBA 2H6MA 1KSNA 1KYNA 2BZAA 3EA7A 4MVNA 3PO1B 1DT2A 1HFDA 2PLXA 4I8KA 4AFUA 2EEKA 1AFQC 3S7HB 3CP7A 1TONA 3RC4A 1FONA 4YT6H 1A1RA 9LPRA 3RXIA 4B76A 4GPGA 2A4QA 4FUHA 3F9GA 1W3CA 1DY9A 2HWLB 2P95A 1VITH 1X7AC 3EDXB 3ATWA 1TGCA 1TRMA 5EQRA 1O39A 1TAWA 2FLRH 4YTAA 1P3CA 4LZ1H 3RXBA 1KXDA 3A8CA 4INLA 1SL3A 5EXMA 1V2OT 3UNRA 2D8WA 2J9NA 3KF2A 5E2PA 3GCHC 5LPEA 3FANA 1PPGE 1SBWA 1FI8A 1FXYA 4ZXXH 2ANWA 2JKHA 6GCHG 1CGIE 3PWCA 3BG4B 1T7CA 3U98H 1O2NA 5L6NH 2XC0A 3FP7E 1F92A 4MTBA 1YKTA 3SZNA 1IQIA 1N6YA 4H6TA 3PTNA 3UQOA 4ASHA 2QF3A 2GP9B 2A5AA 3IWMA 1Y3YA 1V3XA 5K7RA 1EPTB 4XBCA 5FX6A 5DP5A 2O8WA 5GDSH 4HGCA 1AI8H 4AYYB 3PMAB 1O36A 2VJ1A 2XBXA 1NFYA 1TRNA 1BBRE 4UFFH 1O35A 1RS0A 3UQVA 5A0CA 3U69H 5B6OA 2WPHS 3MOCA 1UHBA 1O5GH 1S5SA 2Z3EA 6CHAC 4U30A 1H9IE 1LHEH 2W7UA 2FZZA 4ISHH 1GHBF 1T8LA 3D65E 5DK1A 1O3CA 2PFEA 1HXFH 3STJA 4I8LA 4TWWA 2NU4E 3MH4A 1C4Y2 3BF6H 2BY8X 3MHWU 1QL7A 5HMAA 3O8DA 1QCPA 1XUIA 4ABAA 4NWKA 2PGQB 1SPJA 1HAGE 4WJG2 3PV4A 3HK3B 1W2KH 1DXPA 3BTKE 5FXLA 1MTNC 2Q1JA 2UUYA 3PMHB 2BTCE 4FXGH 3SBKA 3GY5A 1EP5A 1FY8E 2BD7A 2Z94A 3GCNA 1O3EA 1NRSH 2ANYA 3P70B 3P17H 3NKKA 4D7GA 1CVWH 5DP8A 1C4V2 3SUGA 1HAIH 3Q3YA 1C2LA 3H7OA 2Z9JA 1HGTH 4ZHAA 1YPMH 2VIVA 1YCPH 1OXGA 2Z3CA 2BVXH 3MNBA 4OGYA 1L0ZA 1SC8U 1AY6H 1SLWB 2BX4A 1GI0A 2V0BA 3CS7A 1S0RA 1T32A 4I33A 1NS3A 1TGSZ 3A89A 4X0WU 4FUJA 5EQSA 3SU6A 1Y3XA 1VCWA 5ESBA 5C2ZA 5HGGA 2BM2A 1HYLA 1O3IA 1C5PA 3TJOA 1QR3E 2FTLE 4U01A 2QAAA 4JK5A 1C5UA 3RXUA 1O2RA 5JB8S 4THNH 2WINI 1GMCG 3MU5A 2GD4B 3PMBB 3I29A 2OP9A 1V2VT 1ZZZA 2BY9X 2YNBA 5GCHG 1PPHE 2UUKB 3GISB 1ZHPA 1ZTJA 1GJ5H 1HBTH 1HUTH 3MO9A 1PPZA 1BTHH 1ZRKA 2QA9E 3ZVFA 1BRAA 2PTNA 3IITA 1OP2A 1H9HE 2QXJA 1E35B 2J95A 1EAXA 1S0QA 1KXAA 4OS1A 1DWBH 5JB9S 1GGDB 3SU3A 1BUIA 1ZPCA 3RXCA 4Y79A 2BD9A 2XBYA 1XXDA 3FP6E 1AGJA 1TX7A 3KNXA 1O3NA 3B9FH 1AB9B 1RIWB 2CV3A 3M3TA 1FPHH 2B7DH 1VJAU 3M3SA 1P9UA 1K9OE 1JWTA 1ESBA 3F9HA 1QQ4A 1GI1A 1FQ3A 1QRZA 2FESH 2PW8H 3BTWE 1O3GA 3ODDA 2BD3A 4JZEH 7GCHF 2ZFPH 2BD2A 4IN1A 3D62A 3Q77A 3M36A 1SGRE 1C1TA 3AAUA 1UVTH 1SLVB 3LGVA 3C1KA 3UPEA 1V2UT 1SGQE 3EGKH 4DW2U 2Y5GA 4IC5A 5GPIB 5AFZH 1EAUA 2UWPA 2BLQA 2JH5D 3UTUH 2GVFA 4FUBA 3WY8A 1GBDA 2HNTE 3GCTG 1GJ4H 1YPHE 2V35A 2FOBA 4BTTB 4GCHG 5HM2A 1C5WB 4AYVB 3NCLA 1MKWH 3QO6A 1E37B 1CBWC 2NWNA 1DS2E 2EI6A 2BD4A 2B9LA 1QA0A 1Z71A 4IMZA 2CJIA 1VR1H 2XYAA 1SMFE 1UK4A 4UD9H 4I8HA 2EC9H 4FU9A 2ANKH 3AW0A 4DIIH 3BTME 1A5HA 4K1TA 3RXDA 4CHAC 1C2FA 1W0YH 2ALPA 2FI3E 3B23B 4NZQA 4NWLA 1GI8B 1HB0B 4H4FA 1OYTH 2GZ7A 1GMCF 1XVOA 2Z9GA 4O9VA 3UOPA 2FIRH 4FUIA 4Q7ZA 1V2LT 3TGKE 3S0NA 5HYOA 2GT8A 2PSXA 1ELBA 1BIOA 1LVYA 3TK5A 2HNTC 3UR6A 3SV9A 2WUCA 1JMOH 5DKMA 2TGPZ 2ZU2A 2ODPA 4MNVA 2WV4A 3FZZA 4Y0YE 2C8XB 2W5EA 3MI4A 3PTBA 1KTSB 4X2YA 3G01A 4NZLA 3RMMH 1HAPH 3SGAE 3QX5H 1GBKA 1AKSA 3M35A 1DLEA 4K69A 3SJOA 5E0HA 3F6UH 3KQDA 3V7TA 4BANB 1DUEA 3LKWA 4K5ZA 1C2IA 4BAKB 5A0BA 1L1GA 2OC0A 3QZRA 2XW9A 1FAKH 1GI6A 1MQ6A 2J38A 1C5ZB 4YLQH 2ZCHP 1O2UA 1GBHA 1SHYA 1RJXB 3RU4T 2OCVB 1BTXA 1FY4A 5LPFA 4Q7XA 3SV7A 4CBOA 1W10U 1IOEA 4CRFA 2WYGA 1Y5BT 4FUFA 4B71A 1BA8B 3RU4D 1P57B 1XUKA 3KQEA 2CF9H 1NFXA 3M7UA 3MO3A 3T62A 3TH2H 4CRBA 2BVRH 2G52A 5HXFA 4TY7A 1H8IH 1SGDE 1UTPA 3SORA 7ESTE 1DITH 2PGBB 4HFPB 1Z6EA 5CHAC 2GX4A 3M7TA 1C5VA 2XBWA 1Z8RA 4DT7B 1ZSLA 3QN7A 1SVPA 4GHTA 4ISIH 3H5CB 2ZTYA 3M5NA 1DE7H 1MBMA 1HIAB 5DP7A 1NFWA 4NA7A 4DOQA 4KP0A 1SOTA 4GCHF 5EG4A 2H5DA 3OU0A 1WCZA 2ZQ1A 5L2YH 1XMNB 1E38B 1FY1A 2GDDA 3E0NB 3UWJH 1QGFA 3VXEH 1V2JT 5JBTA 1K1PA 1Y3WA 1QBOA 3SUEA 1GBAA 5C1XA 5DPAA 3OTJE 4TPIZ 1C9PA 2BLOA 2UUFB 1ABJH 4AG2A 5FAHA 3L6PA 4Y8XA 1K1LA 2Z9KA 1WOFA 2R9PA 3M7QA 3A83A 1B7XB 2OLGA 2ZNKH 4OS2A 1BRBE 3ZV8A 4NFEA 1SGEE 1UJ1A 5F8TA 5T6DA 3Q00A 1TBZH 1EZUC 5DG6A 1JXPA 3GICB 4AB8A 1O2YA 3TITA 1BHXF 1O31A 3MTYA 8ESTE 1C1NA 1QB9A 3D49H 3TPIZ 3ELAH 4WH6A 1TNJA 3RXRA 1LCYA 1V6DA 1ELFA 2ZGHA 1T4VH 2JETC 4JZDH 1IQHA 3S7KB 1EZXC 2AGGX 3ENSB 4ABFA 3AASA 1Y59T 1H1BA 1MQ5A 5GXPA 3URCA 1ANEA 1G2MA 1SSXA 4FVDA 1E36B 3P8NA 1FJSA 3TH3H 1IQMA 1DVAH 1GHAF 4X8UH 1RRKA 1TPPA 4E06H 1P2NA 4ZHLU 1T31A 3ZVBA 1GJDB 2TPIZ 3GY4A 4ZROA 1B0EA 1SB1H 1P11E 3K9XB 4AN7A 2J34A 5A2MH 1TNHA 5FX5A 2G4TA 1T8MA 1QIXB 1BOQA 1BJVA 3JZ1B 2HALA 3QWCH 3VPKA 1SQAA 1DXWA 6GCHF 1A5GH 1HAVA 3A8AA 2C93B 4X1QU 1IQFA 4NSVA 2R2MB 3OY6U 4IMQA 1GL0E 4H6SB 1O2MA 3SGQE 1GCTB 3LONA 1W8BH 4X1PU 4IBLH 3LDXH 1QL8A 5TCAA 4AFQA 1ZJKA 2GV6A 5FBIA 4DIHH 2G5VA 2ZTZA 5J4QA 1O2HA 2WV5A 1LQEA 1ID5H 1PQAA 3A7WA 2M5TA 3M5OA 4BAQB 1HPGA 1P3EA 2DE9A 5E0JA 5DP3A 2CHAB 3K6ZA 1YC0A 4K2YA 2K1QA 1O2VA 4A7IB 4YLUA 4WXIA 2AGIX 1TNLA 3SJ8A 1JIMA 3ITIA 2YOLA 3ESTA 2ZHQH 1AU8A 3LGIA 1GBCA 4JYTA 1RD3B 2FX4A 4WMDA 1C5NH 2NU1E 4KTUA 3RM2H 1CBWB 4NCYA 1QB6A 2F9VA 3E3TA 3SU1A 1SLUB 3SN8A 4A92A 1ELAA 1SQTA 1F0RA 3PROA 2PWXA 2FX6A 3FFGA 1TNKA 1AFEH 1YF4A 1AKSB 2PKAB 1C5SA 1C1PA 4X6NA 1N8OB 1GI3A 2A4RA 5DGJA 1QRXA 5FCRA 4AGJA 1HAYB 2ZHDA 1PQ7A 1VITG 3RXGA 2AIQA 4KKDA 2CF8H 5AVDA 4ZKSU 3TGIE 2P16A 4AOQA 3A7TA 1W7GH 3KHVA 4AFZA 1ZYOA 2VH0A 4ABHA 3LGTA 4BTUB 2ALVA 4BNRA 2TGAA 3KEEA 4F49A 1GBIA 2A4GA 3ZV9A 1GMDF 2PKAA 3HK6B 2FM2A 1GI7B 1L1JA 1DOJA 1YGCH 1G3EA 5LH8A 3AAVA 3VB7A 4DCDA 1YBWA 4ISOA 1O2TA 4D9QA 1ZMJA 4Y8YA 1OOKB 2SNVA 1LVBA 3GDSA 1RXPA 1EUFA 1C5MD 3ATKA 1AD8H 1AE8H 1VJ9U 1BDAA 2UWLA 3RM0H 8KME2 1F5LA 1S81A 1XM1A 3RXEA 1GVKB 1UK3A 1HLTH 4UFDH 3W94A 1G30B 2FLBH 3HPTB 1W11U 1RTLA 1TRYA 6LPRA 2G55A 2PSYA 2PUQH 2ZU5A 1AUJA 2ZDKA 1TE0A 1Y8TA 1WAYB 1O3LA 3RXSA 3R0FA 2VIWA 4D9RA 5EW2H 1O2ZA 1BMMH 1C5YB 1P09A 4X1NU 2OBQA 2OXSA 1DANH 1EJAA 4A1XA 4NIVA 2GCHG 2NU2E 2ZPRA 2ZHEH 1FDPA 1SGNE 4ABJA 2PUXB 2IN2A 1YCPK 1ELCA 4ZHMU 1SGFG 5IDKA 1PQ5A 2TGDA 2FMJA 2O8TA 2G81E 5C67A 2W3IA 5FCKA 3DD2H 2OQ5A 1JBUH 3RXJA 2ZU3A 1K22H 1ELVA 1SGIB 1IAUA 3QLPH 1MTSA 2SGDE 4VGCB 1FMGA 1C1SA 1G3DA 4AGKA 3LJJA 3P6ZB 1EZQA 3FVFB 1K21H 1MCTA 4MPWA 3SU4A 1O3JA 1ZHMA 2FTMA 1HRTH 1K1OA 3HGPA 9ESTA 1EPTA 4K3JA 4HI3A 8LPRA 4JZFH 1P2MA 4Y6DA 1MZAA 2R3UA 1O5AB 2QYIA 1C1MA 2O8LA 2HPQH 2AIPA 1MTWA 4RSPA 3Q76A 2VH6A 2WPIS 4VGCC 5I46H 5K0HA 4FUCA 3UY9A 3N7OA 2FYQA 3VB3A 4E7NA 1IQJA 2P94A 1C1UH 1OP0A 2EI8A 2BLVA 1P06A 5FPSA 1FNIA 4XSKU 1LVMA 2FP7B 4ZKOU 1Y3UA 2WPMS 2G51A 1O3HA 1GJ7B 2A31A 2D26C 2IOTA 4ZH8A 1MH0A 1OX1A 1PYTD 2FEQH 3RXHA 1NZQH 4CHAB 2ZZUH 1LMWB 3P8OA 2P8OC 4OGXA 1BMLA 4HZHA 1G2LA 1C1VH 4FUEA 4CH2B 1FZZA 4I8JA 1SLXB 1QJ1B 3PLBA 1SFQB 2FDAA 5A8ZA 1BZXE 4JZIA 3SV6A 1BRUP 1TLDA 3UNQA 3Q3XA 1JRTA 1IQGA 3T2NA 1A5IA 3I78A 4CRAA 2ZF0H 1UO6A 1LHGH 3M37A 1SHHB 2ANMH 1P9SA 3R3GB 3E0PB 3EAJA 4AORA 1S85A 4IN2A 4CRGA 1GG6C 4RKOB 1TPOA 4YZUA 4AZ2B 2BMGB 1UCYE 2FI5E 4ISLA 4U2WA 3PYHA 1PPFE 3TU7H 4BOHA 1CA0C 1MKWK 3TNTA 1MTVA 2C8ZB 1MKXK 4NFFA 5H4IB 2D2DA 2B8OH 2BQ6B 4ABEA 1VGCB 1HIAA 2PR3A 1YYY1 2I6SA 3VEQB 3FAOA 4FU8A 1YLDA 4KGAA 1UTNA 1UVOA 2JETB 3RMNH 1KXEA 1AHTH 2P3TB 3NUMA 3RMOH 1L4ZA 2SGQE 3B8JA 4CBNA 1GHVH 5JBAS 3P95A 4WF8A 2H5CA 1P0SH 2CGAA 4U32A 1EPTC 2A7HA 1EJMA 1P01A 3RXPA 1ZPBA 1J17T 2WPLS 1TGNA 1YPLH 3P8FA 1RIWC 1BQYA 1KDQA 3PLPA 5A8XA 3MU0A 3A86A 1S83A 1BTZA 4KTCA 2Q6DA 3ZZ8A 1GJ6A 4BTIB 1EATA 1S6FA 1KLJH 4B2CA 2BDCA 4ZKNU 3C27B 1K2I1 2ZP0H 1Y3VA 4O3UA 5C1YA 3ZZDA 5EOKA 3UUZA 2W26A 1OKXA 2C8WB 1ZR0A 1GJAB 4NGAH 4NG9H 1SI5H 2VINA 1TALA 1NU7B 4ABIA 3GY6A 1TYNA 3H7TA 4MQAA 4B74A 1WQSA 2VWLA 4WWYA 1GI5A 3MYWA 3A82A 1A46H 1OSSA 3ZVDA 5FPYA 1UCYH 4MPXA 1THRH 1HJ8A 1V2ST 2BDYA 2FOHA 2QN5T 1FAXA 2WYJA 3BIVH 5T6GA 1YPJH 1FN8A 1QA7A 2V6NA 2O8UA 3ODFA 4CREA 3ZZ5A 1TWXB 1KLTA 3RLWH 5ESTE 3A85A 3LGWA 1GCDA 1LVOA 4YOJA 1O2IA 1BTWA 1FV9A 2A2QH 2ZA5A 1CT4E 3GY8A 1FUJA 1BMNH 4DY7B 1VZQH 5TCCA 4WMFA 4MLFB 1N1LA 2VWMA 1ZTLA 1BHXB 2ESTE 1GJBB 2O8MA 3CENA 2AMDA 1QY6A 1ARBA 1OWHA 1XUGA 3RC6A 3VXFH 2VGCC 1A3EH 4ESTE 2FOAA 4XBBA 3QUMP 1NRPH 3BEIB 1QURH 3QK1A 2F9NA 1C2JA 2JH6D 1HAHH 2QGRA 1GBLA 1GI2A 3SUDA 4E05H 3ZVAA 1Z8JB 1DUAA 4OS6A 2Y80A 2ZTXA 3SJ9A 1ZLRA 2BYAX 4DJZB 3SNEA 1LHCH 5BPEA 2BQ7B 2VIQA 2ZWLH 3T26A 4Y76A 1LO6A 8GCHF 1FIZA 1CHOG 3SJKA 1CHOF 2A45B 4JYUH 1TX6A 3UR9A 3V12A 3TK6A 1SGYE 1EX3A 4Y7BA 1Z8IB 2PTCE 1MBQA 4Y0ZE 3T28A 2W7SA 4SGBE 2GGVB 1QB1A 3U8RH 1ELDE 1K28D 6ESTA 2STAE 1PFXC 1A61H 4GLYA 1VGCC 2BX3A 1DFPA 3KGPA 3GY7A 2FS9A 4NSYA 1CQQA 1C4U2 2A5IA 2R2WU 2ZGXH 2ZU4A 3M3VA 3TJNA 1MKXH 3RLYH 4GHQA 1GI4A 4DVAU 4IGDA 2NU3E 2HRVA 1B0FA 2I6QA 3F9FA 3U8OH 2A32A 1GPZA 2A7JA 1XKBC 1HDTH 5EQQA 1V2KT 3KCGH 4QT8C 1WBGB 1F2SE 5G4BA 3VB6A 3SHAH 3MMGA 2TIOA 3A88A 1TX8A 3UREA 3ZZ7A 1ZJDA 3DUXH 4D7FA 1MD8A 4INKA 5A0AE 2FOGA 1GJCB 3SU2A 2STBE 2BY5X 2P8OB 4GUXA 1RTFB 2A0QB 3QTVH 1O3MA 1P2IA 2SGFE 2ULLA 2Z9IA 1CSOE 1BMAA 1CA8B 2A1DB 1J8AA 1ANDA 1WYKA 1TB6H 1UMAH 2AGEX 2ZDMA 1TABE 3MNCA 3RMLH 1RFNA 2O9QA 4UE7H 1O5BB 5CE1A 1DPOA 4X8TH 1O3PB 1GJ9B 3E1XB 1NU9A 2UUJB 2OUAA 2GZ9A 1CGJE 4K60A 5JBCS 1C2KA 2Q6GA 3BTTE 1AIXH 1ELTA 1V2MT 4H42U 4HTCH 1E34B 2BOKA 1O32A 1TA6A 3P92A 2KAIA 1V2WT 3IG6B 2DUCA 2ZFRH 1P10A 1EAWA 2CHAC 3TLOA 1IQNA 1JRSA 1DDJA 1QQUA 4WMEA 3RC5A 3MNXA 3URDA 1O2SA 3ZYDA 1OS8A 2BB4A 1P04A 1QTFA 4ABGA 2Y7XA 4K8YA 4UDWH 1QBNA 1GVZA 2QC2A 3LH1A 2QXHA 1W13U 1DWDH 1SG8B 2VIPA 3MU8A 1DM4B 1HNEE 4WH8A 4LXBH 3RU4E 3S9AA 3BTQE 2B0FA 1Z7KA 3OX7U 4A1TA 1TGBA 4ZUHA 4WY3A 1AO5A 2WUBA 1GHZA 4X2WA 3U9AH 1HAVB 4IS5A 2IPHA 4J2YB 4YT7H 1QHRB 3QTOH 3ATIA 1A3BH 3EE0B 4BXSA 1O3OA 2QF0A 5L2ZH 1G36A 4B2BA 2ODYB 3BEFB 1MU8B 2ZHFH 1VCPA 2PHBA 2ZG0H 4DGJA 1ZHRA 2FOCA 3TJVA 2Z9LA 1NN6A 4B73A 1UHBB 5T6FA 1UTJA 2FPZA 1DLKB 2FOEA 1O2XA 3SOSA 2THFB 1F0UA 1Q31A 5F03A 5SGAE 3EYDA 1JOUB 3BTFE 1NPMA 3LPRA 1YPGH 2RCEA 3UOUA 2BZ6H 1TBQH 2HLCA 1O2PA 1D3PB 1L1NA 3MO6A 1C1RA 2QV1A 1OYQA 3S9BA 5EXNA 3SNAA 1HJ9A 2OTVA 1CT2E 3QGJA 2ZI2H 4IW4E 1D6WA 1LKAA 2XC4A 4O3TA 2AYWA 1NM6A 1TGTA 1A0HB 1GVLA 1ARCA 4O97A 2BDIA 2SNWA 4JYVH 1O33A 2ASUB 3LIWA 1GMDG 1HJAC 1KXBA 3RXMA 1GDQA 3A8BA 2FI4E 1G37A 2FOFA 3SJIA 1TBRH 1DSUA 1P05A 1O34A 1O5FH 3NXPA 3S69A 1FY3A 1TPSA 7KMEH 2P93A 1EB2A 1L4DA 1EQ9A 1AB9C 2CMYA 1TMBH 1GDUA 3ATLA 5AFYH 3NK8A 1D3DB 2WPKS 1O2GH 4YOIA 4AB9A 1SFIA 4Q7YA 1SGPE 4JZ1A 4R0IA 1ABIH 4Q80A 2BDAA 2OC1A 3LJOA 1GI9B 5LPRA 1A7SA 3BEUA 3PM3A 3QDZB 3MH5A 2Y6TA 2FODA 2Y81A 3VB5A 1F5RA 2G00A 2Z6BD 4XFQA 2Y5FA 1ELEE 4NIWA 4X1RU 1D3QB 4XE4A 3GCOA 3MWIU 1YM0A 5IYTA 1P2OA 2GV7A 4Q2KA 2SGEE 1GBJA 1ANCA 1ZMLA 5F8ZA 2ZPSA 1MTUA 2G4UA 5ABWA 1ESAA 2ZHWH 4Z6AH 3SU0A 1GHBG 1C2GA 4ZXYH 1GWAA 1A0JA 3A84A 3A80A 1ZPZA 4TWYA 2BXTH 3LH3A 4A1VA 4UEHH 3UWIA 4OS7A 2LPRA 1NO9H 3T25A 3BIUH 1N6XA 1O3AA 1YCPM 4UONA 1Z1IA 4X1SU 1EB1H 1XUJA 5T3HA 2ZGJA 4D8NA 1ETRH 1O0DH 1O3FA 5I25A 1PJPA 3SV2H 5C3NA 4SGAE 5A8YA 2BXUH 2IJOB 1LPKB 1RGQA 1LPZB 1BCUH 3BSQA 3ZZ9A 1ANBA 4MPUA 1S82A 1EASA 1NT1A 3M5LA 1UVPA 4DURA 1THSH 1WTGH 1VITF 2JH0D 3KIDU 5C20A 1Q3XA 3OY5U 1O37A 1QJ7B 1FIWA 1QJ6B 1D9IA 2FO9A 1UTQA 2PKSB 1AZ8A 1TOMH 4WXVA 3K2UA 2ZU1A 2H2ZA 1MCVA 2TBSA 2TGTA 3ZZ4A 1WV7H 1QBVH 4MPVA 3LC5A 7LPRA 3E91A 1HAXB 2AS9A 1WU1A 3A7YA 2XTTB 3LGYA 5GJ4B 3SO3A 3GDVA 3VFEA 4A5TS 2Q6FA 1OWEA 2BDBA 2ZDVH 4NIXA 4I8GA 2SGPE 3VB4A 1BITA 1S84A 2ZGBH 1KTTB 4Y71A 1WTHD 3V0XA 1UCYK 1QFKH 1MZDA 3SI4H 4PROA 5L30H 3V13A 2W3KA 3E8LA 1P2QA 2QIQA 1L2EA 3PWBA 1THPB 1BBRK 2ZEBA 5GCHF 3MH6A 3BV9B 3NWUA 2GZ8A 1V2PT 3F9EA 2CXVA 1BTUA 1G3CA 1KXFA 1YPKH 1TQ7B 1KDQB 3ZZ3A 2DE8A 5FBEA 1F0TA 3A7VA 5EXLA 2BLWA 2RDLA 2Y82A 1OP8A 1AUTC 2F9PA 5CHAB 4X8VH 1QNJA 3GOVB 2OINA 1AVGH 1C2DA 1NTPA 1O30A 4UFGH 2OC8A 6CHAB 3ZVEA 1BTPA 3T29A 3U1IB 1OWKA 1TNGA 2ODQA 2XBVA 2P3FH 3ATMA 4YM9A 1U6QA 8GCHG 2FXRA 5TJXA 5GWZA 2BQWB 2J94A 1F0SA 1WQVH 1ZSJA 4FUDA 2C8YB 3PMJA 4XDEA 5DP6A 1DY8A 1TMTH 1C1WH 1C5TA 3STIA 2QXIA 1KLIH 3BN9A 1UVUH 3CS0A 3K65B 3BG8A 1V2QT 4ABBA 3K6YA 1BBRH 2VNTA 2GDEH 2VVVA 1HAZB 1GMHF 1BTYA 5AF9H 1TOCB 1GBTA 4MNXA 3A7ZA 4AX9H 1ORFA 1IQKA 2AFQB 2C3SA 1H4WA 3RXAA 1EOLA 1UTMA 2ZDAH 4ZKRU 5EGMA 4BAHB 3VGCC 2VIOA 1ZGIA 2XXLA 5DP4A 4X6OA 3RXVA 1GMHG 2G8TA 4NIYA 3SU5A 5E2OA 1C5OH 2HPPH 2Z3DA 1Y5AT 1LQDB 1AN1E 3SQEE 1C5RA 1AWFH 4LZ4B 1NC6A 1MU6B 3T27A 2V3HH 2XNIA 5EW1H 3TK9A 1ESTA 3V3MA 1ETSH 1A0LA 4Z0KA 3Q3KA 3E16B 3S9CA 4Y8ZA 5PTPA 1OWDA 2ZDNA 4X2VA 4K8BA 3F1SB 1GBEA 1NRRH 1YPHC 2FYRA 1CO7E 1O38A 1QRWA 1SGCA 3MU4A 1C5QA 4ISNA 2FOMB 4TPYA 4RN6A 3RUOA 1SR5C 2HOBA 4XBDA 2GCTB 3GYLB 4R8TB 4D76A 3M61U 2F9OA 1FY5A 2H9HA 2VU8E 1TFXA 1WSSH 1HXEH 1G9IE 3SHCH 1NFUA 1MUEB 1EZSC 2F91A 4AFSA 3SUFA 3SQHE 1ZOMA 1JIRA 2VGCB 2ZFFH 4I31A 7GCHG 2ZKSA 2GCHF 3MFJA 3O8CA 2VIDA 5C5OA 3SI3H 1CGHA 1OPHB 4A6LA 1HJAB 1V2RT 2LNCA 4ABDA 1D3TB 1W0ZU 1S6HA 1ACBE 1J14A 4X6PA 1CHGA 1KXCA 1XX9A 4WVPE 2A7CA 3TVJB 1PPBH 3QGNB 3RXTA 2P3UB 2XCNA 3RDZA 4KTSA 1PYTC 1W7XH 2G5NA 2ZPQA 3E6PH 4GVUA 2F83A 4Y7AA 1A4WH 1O3KA 4YOGA 1LKBA 3U1JB 1AVXA 2NU0E 2H1UA 2F3CE 2AH4X 2UWOA 3OSYA 5FHTA 2RA0A 3SGBE 2AMPA 2C4FH 3RXFA 3SNBA 2GMTC 1GDNA 1XUHA 3TIUA 1Z8GA 1GHXH 3DA9B 1C2MA 3U8TH 5BRRE 1UTLM 3FZDA 1XXFA 2ZCLP 1IHSH 4GSOA 1C2EA 1O3BA 1F7ZA 1XKAC 3O8BA 4MDSA 1OWIA 2BVSH 3MU1A 1EXFA 1BRCE 2HVXA 4O03A 1EJNA 2QY0B 2BDGA 3T5FH 1GHYH 3NPSA 3GDUA 1MAYA 3W95A 1FPCH 4INHA 1GL1A 2BD5A 1J9CH 1P2JA 1O5DH 1PPCE 1AMHA 1ZSKA 1AQ7A 1XUFA 1C9TA 4UFEH 1ETTH 3KQCA 3OYPA 1Y5UT 2CN0H 5DJ7A 1BB0B 1G32B 2F9BH 3ZZAA 1DICA 1LDTT 2H9TH 1MMJN 2BOHB 1IHTH 4BAOB 1TQ0B 3DFJA 1SOZA 2VB0A 4J1YA 1C5XB 3TH4H 5F8XA 2J2UA 3SNCA 2EA3A 3EQ0H 1LHDH 1EP6A 2ZCKP 1CE5A 4B2AA 2AEIH 1YLCA 3TNSA 1O2WA 1SQOA 4ZMAH 2FS8A 1GHAG 3HATH 1AVWA 3LOXA 1MTNB 3PLKA 2ZFQH 3BTGE 1J15A 1VCQA 3PB1E 2BY6X 2P59A 1O2KA 3LU9B 2QXGA 2OBOA 1O2LA 4K1SA 1AE5A 5DO4H 1K1MA 2KAIB 5DP9A 2J4IA 5EPYA 1TPAE 4AG1A 5AHGH 3L3TA 4CRCA 3M5MA 4FUGA 4Y10E 1GBFA 2GCTC 1YP9A 3NZIA 5GIBA 2C90B 2QCYA 1DWEH 2XWAA 3DT0H 1GBBA 3SW2B 1NROH 5HM9A 5FPTA 5JDUB 1T4UH 4BAMB 3O8RA 4MNWA 2AMQA 2OQUA 3BTEE 5JPMH 3QZQA 3D23A 2XRCA 3JZ2B 1P02A 3A87A 2PV9B 1J16A 4BXWA 1C1QA 5A09A 1IQEA 3L33A 1H9LB 4CR9A 4CR5A 2XCFA 1EAIA 2J92A 1C5LH 3MH7A 4K1EA 4JCNA 2ZGCA 1GCTC 1EOJA 3KL6A 1H8DH 2ZECA 1HCGA 2FWWA 4ZAEA 4CRDA 1UVSH 1INCA 3RP2A 4OS4A 2ZO3H 4LK4A 2RG3A 1GJ8B 1KIGH 2ZFTA 5LGOA 3A81A 2VWNA 1LTOA 3VGCB 1SGFA 2BY7X 4B1TA 4M7GA 3UIRA 2SGAA 5JBBS 1Z6JH 2VVUA 3TJUA 4DG4A 3SNDA 5E0GA 2VVCA 4NA8A 1MAXA 4GAWA 1W12U 3DHKH 1TA2A 5CMXH 1O5CB 3KN2A 2GMTB 3E90B 3AVZA 4OS5A 1QL9A 2D1JA 2OC7A 1G3BA 1CT0E 3GY2A 4IC6A 4I7YH 2Y5HA 1LHFH 1M9UA 1TNIA 4JMYA 2OD3B 2VWOA 3HGNA 4XOJA 1FN6A 3EA8A 4JK6A 1P8VC 3A7XA 3RXOA 1ZGVA 5JYIA 2Z7FE 1F5KU 4YO9A 3LGUA 5F6MA 4X6MA 1O2JA 1A2CH 3BTHE 1T8NA 1XVMA 4F4OC 2R0LA 1O5EH 3PO1C 1GBMA 1EKBB 1P12E 2SFAA 5ETXA 3I77A 3KQBA 4X2XA 1NY22 3HKIB 4KELA 2V3OH 1NRQH 1W14U 3BG4C 1GGDC 1GHWH 1BJUA 4YESB 1CA0B 3UFAA 2R3YA 4RKJB 3ZVCA 3BTDE 1K1JA 1LPGB 2R0KA 3ZYEA 5EODA 1BT7A 1GG6B 2AERH 4X8SH 2WPJS 2BDHA 3GYMA 1ZRBA 1IQLA 2HGTH 1AZZA 3UNSA 1C1OA 3SV8A 1RTKA 3LT3A 4LOYH 1OWJA 2GT7A 1MD7A 3GCHB 2GKVE 1DWCH 4MNYA 1UTOA 3EA9A 1O2QA 2B5TB 3LC3A 2HNTF 2XC5A 4CH8B 5EU8A 4MG3A 2F9UA 1YPEH 2H9EH 3FP8E 3TGJE 2A4OA 3MNSA 4TYDA 1P2KA 5E8EH 1NRNH 1D4PB 2YNAA 4TY6A 2ZC9H 1NESE 4NA9H 1K1IA 3GY3A 1C2HA 1E0FD 2RA3A 2PKSC 1AFQB
chains in the Genus database with same CATH superfamily
1KY9A 3ZZCA 1TIOA 2Y7ZA 2ZDLA 1UK2A 1B5GH 2ZQ2A 2A2XH 4I32A 2TRMA 2XWBI 5EPNA 3ZVGA 1Q2WA 3DFLA 2ZFSA 1FLEE 1AWHB 1HAOH 1ZMNA 2EI7A 1O2OA 1V2TT 1PPEE 1DX5M 1N8OC 1V2NT 4Y11E 3ZZ6A 3P8GA 1T8OA 2ZIQH 3RXLA 5C1UA 1PQ8A 2ILNA 1Z1JA 3F68H 2GTBA 3RXQA 1UTKA 4FU7A 3ZZBA 1CU1A 3FO8D 3RXKA 2BD8A 3GCTF 1D6RA 5C5NA 1ZTKA 1SGTA 3AW1A 1TMUH 4E7RG 4B75A 1ELGA 1DSTA 2A5KA 3HKJB 1K1NA 3A8DA 1WUNH 1O3DA 5J4SA 1HV7A 2BHGA 1P03A 4FVBA 2H6MA 1KSNA 1KYNA 2BZAA 3EA7A 4MVNA 3PO1B 1DT2A 1HFDA 2PLXA 4I8KA 4AFUA 2EEKA 1AFQC 3S7HB 3CP7A 1TONA 3RC4A 1FONA 4YT6H 1A1RA 9LPRA 3RXIA 4B76A 4GPGA 2A4QA 4FUHA 3F9GA 1W3CA 1DY9A 2HWLB 2P95A 1VITH 1X7AC 3EDXB 3ATWA 1TGCA 1TRMA 5EQRA 1O39A 1TAWA 2FLRH 4YTAA 1P3CA 4LZ1H 4HG6A 3RXBA 1KXDA 3A8CA 4INLA 3U28C 1SL3A 5EXMA 1V2OT 2F4LA 3UNRA 2D8WA 2J9NA 3KF2A 5E2PA 3GCHC 5LPEA 3FANA 1PPGE 3OFND 1SBWA 1FI8A 1FXYA 4ZXXH 2ANWA 2JKHA 1QZ8A 6GCHG 1CGIE 3PWCA 3DSPA 2QE7D 3BG4B 1T7CA 3U98H 1O2NA 5L6NH 2XC0A 2AHME 3FP7E 1F92A 4MTBA 1YKTA 3SZNA 1IQIA 1N6YA 4H6TA 3PTNA 3UQOA 4ASHA 2QF3A 2GP9B 2A5AA 3IWMA 1Y3YA 1V3XA 5K7RA 1EPTB 4XBCA 5FX6A 5DP5A 1K0HA 2O8WA 4Q4LA 1SQRA 5GDSH 4HGCA 1AI8H 4AYYB 3PMAB 1O36A 2VJ1A 3N7DA 2XBXA 1NFYA 1TRNA 2YMSB 1BBRE 4UFFH 1O35A 1RS0A 3UQVA 5A0CA 3U69H 5B6OA 2WPHS 3MOCA 1UHBA 1O5GH 1S5SA 2Z3EA 6CHAC 4U30A 1H9IE 3OTPA 1LHEH 2FZZA 2W7UA 4ISHH 1GHBF 1T8LA 3D65E 5DK1A 1O3CA 2PFEA 1HXFH 3STJA 4I8LA 4TWWA 2NU4E 3MH4A 1C4Y2 3BF6H 2BY8X 3MHWU 1QL7A 5HMAA 3O8DA 1QCPA 1XUIA 4ABAA 4NWKA 2PGQB 1SPJA 1HAGE 4WJG2 3PV4A 3HK3B 1W2KH 1DXPA 3BTKE 5FXLA 1MTNC 2Q1JA 2UUYA 3PMHB 2BTCE 4FXGH 3SBKA 3GY5A 1EP5A 1FY8E 2BD7A 2Z94A 3GCNA 1O3EA 1NRSH 2ANYA 3P70B 3P17H 3NKKA 4D7GA 1CVWH 5DP8A 1C4V2 3SUGA 1HAIH 3Q3YA 1C2LA 4TT3D 3H7OA 2Z9JA 1HGTH 2VBCA 1YPMH 2VIVA 4ZHAA 1YCPH 1OXGA 2Z3CA 2BVXH 2WZQA 3MNBA 4OGYA 1L0ZA 1SC8U 1AY6H 1SLWB 2BX4A 1GI0A 2V0BA 3CS7A 1S0RA 1T32A 2JJ2D 4I33A 2PP6A 1NS3A 1TGSZ 3A89A 4X0WU 4FUJA 5EQSA 3SU6A 1Y3XA 1VCWA 5ESBA 5C2ZA 5HGGA 2BM2A 1HYLA 1O3IA 4RT1A 1C5PA 3TJOA 1QR3E 2FTLE 4U01A 4B6FA 2QAAA 4JK5A 1C5UA 3RXUA 1O2RA 5JB8S 4THNH 2WINI 1GMCG 3MU5A 2GD4B 3PMBB 3I29A 2OP9A 1V2VT 1ZZZA 2BY9X 2YNBA 5GCHG 1PPHE 2UUKB 3GISB 1ZHPA 2KFWA 2WV9A 1ZTJA 1GJ5H 1S6LA 1HBTH 1HUTH 3MO9A 1PPZA 1BTHH 1ZRKA 2QA9E 3ZVFA 1BRAA 2PTNA 3IITA 1OP2A 1H9HE 2QXJA 1E35B 2J95A 1EAXA 1S0QA 1KXAA 4OS1A 1DWBH 5JB9S 1GGDB 3SU3A 1BUIA 1ZPCA 3RXCA 4Y79A 2BD9A 2XBYA 1XXDA 3FP6E 1AGJA 1TX7A 3KNXA 1O3NA 3B9FH 1AB9B 1RIWB 2CV3A 3M3TA 1FPHH 2B7DH 1VJAU 3M3SA 1P9UA 1K9OE 1JWTA 1ESBA 3F9HA 1QQ4A 1GI1A 1FQ3A 1QRZA 2FESH 2PW8H 3BTWE 1O3GA 3ODDA 3VG8A 2BD3A 1NBME 2KX4A 4JZEH 7GCHF 2ZFPH 2BD2A 4IN1A 3D62A 1YLNA 3Q77A 3M36A 1SGRE 1C1TA 3AAUA 1UVTH 1SLVB 3LGVA 3C1KA 3UPEA 1V2UT 1SGQE 3EGKH 4DW2U 2Y5GA 4IC5A 5GPIB 5AFZH 1EAUA 2UWPA 2BLQA 2JH5D 3UTUH 2GVFA 2KM0A 4FUBA 3WY8A 1GBDA 2HNTE 3GCTG 3F2HA 1GJ4H 1YPHE 2V35A 2FOBA 4BTTB 4GCHG 5HM2A 1C5WB 2JDID 4AYVB 3NCLA 1MKWH 3QO6A 1E37B 2J97A 1CBWC 2NWNA 1DS2E 2EI6A 2BD4A 2B9LA 1QA0A 1OHHD 1Z71A 4IMZA 2CJIA 1VR1H 2XYAA 1SMFE 1UK4A 4UD9H 4I8HA 2EC9H 4FU9A 2ANKH 3AW0A 4DIIH 3BTME 1A5HA 4K1TA 3RXDA 4CHAC 1C2FA 1W0YH 2ALPA 2FI3E 3B23B 4NZQA 4NWLA 1GI8B 1HB0B 3PRDA 4H4FA 1OYTH 2GZ7A 1GMCF 1XVOA 2Z9GA 4O9VA 3UOPA 2FIRH 4FUIA 4Q7ZA 1V2LT 3TGKE 3S0NA 5HYOA 2GT8A 2PSXA 1ELBA 1BIOA 1LVYA 3TK5A 2HNTC 3UR6A 3SV9A 2WUCA 1JMOH 5DKMA 2TGPZ 2ZU2A 2ODPA 4MNVA 2WV4A 3FZZA 4Y0YE 2C8XB 2W5EA 3MI4A 3PTBA 1KTSB 4X2YA 3G01A 4NZLA 3RMMH 1HAPH 3SGAE 3QX5H 1GBKA 1AKSA 3M35A 1DLEA 4K69A 3SJOA 5E0HA 3F6UH 3KQDA 3V7TA 4BANB 1DUEA 3LKWA 4K5ZA 1C2IA 4BAKB 5A0BA 1L1GA 2OC0A 3QZRA 2XW9A 1FAKH 4RI0A 1GI6A 1MQ6A 2J38A 1C5ZB 4YLQH 2ZCHP 1O2UA 1GBHA 1SHYA 1RJXB 3RU4T 2OCVB 1BTXA 1FY4A 5LPFA 4Q7XA 3SV7A 4CBOA 1W10U 1IOEA 4CRFA 2WYGA 1Y5BT 4FUFA 4Q63A 4B71A 5T1VA 1BA8B 3RU4D 1P57B 1XUKA 3KQEA 2CF9H 1NFXA 3M7UA 3MO3A 3T62A 3TH2H 4CRBA 2BVRH 2G52A 5HXFA 4TY7A 1H8IH 1SGDE 5GNDA 1UTPA 3SORA 7ESTE 1DITH 2PGBB 4HFPB 1Z6EA 5CHAC 2GX4A 3M7TA 1C5VA 2XBWA 1Z8RA 3DCLA 4DT7B 1ZSLA 3QN7A 1SVPA 4GHTA 4ISIH 3H5CB 2ZTYA 3M5NA 1DE7H 1MBMA 1HIAB 5DP7A 2LP6A 1NFWA 4NA7A 4DOQA 4KP0A 1SOTA 4GCHF 5EG4A 2H5DA 2W6ID 3OU0A 1WCZA 2ZQ1A 5L2YH 1XMNB 1E38B 1FY1A 2GDDA 3E0NB 3UWJH 1QGFA 3VXEH 1V2JT 5JBTA 1K1PA 4XD7D 1Y3WA 1QBOA 3SUEA 1GBAA 5C1XA 5DPAA 3OTJE 4TPIZ 1C9PA 2BLOA 2UUFB 1ABJH 4AG2A 5FAHA 3L6PA 4Y8XA 1K1LA 2Z9KA 1WOFA 2R9PA 3M7QA 3A83A 1B7XB 3FN8A 3N99A 3UB0A 2OLGA 2ZNKH 4OS2A 1BRBE 3ZV8A 4NFEA 1SGEE 1UJ1A 5F8TA 5T6DA 3Q00A 5B6LA 1TBZH 1EZUC 5DG6A 1JXPA 3GICB 4AB8A 5C17A 1O2YA 3TITA 1BHXF 1O31A 3MTYA 8ESTE 1C1NA 1QB9A 3D49H 3TPIZ 3ELAH 4WH6A 1TNJA 3RXRA 1LCYA 1V6DA 1ELFA 2ZGHA 1T4VH 2JETC 4JZDH 1IQHA 3S7KB 1EZXC 2AGGX 3ENSB 4ABFA 3AASA 1Y59T 1H1BA 1MQ5A 5GXPA 3URCA 1ANEA 1G2MA 1SSXA 4FVDA 1E36B 3P8NA 1FJSA 3TH3H 1IQMA 1DVAH 1GHAF 4X8UH 1RRKA 1TPPA 4E06H 1P2NA 4XRNA 4ZHLU 1T31A 3ZVBA 1GJDB 2TPIZ 3GY4A 3OE7D 4ZROA 1B0EA 1SB1H 1P11E 3K9XB 4AN7A 2J34A 5A2MH 1TNHA 5FX5A 2G4TA 1T8MA 1QIXB 1BOQA 1BJVA 3JZ1B 2HALA 3QWCH 3VPKA 1SQAA 1DXWA 6GCHF 1A5GH 1HAVA 3A8AA 2C93B 4X1QU 1IQFA 4NSVA 2R2MB 3OY6U 4IMQA 1GL0E 4H6SB 1O2MA 3SGQE 1GCTB 2KCPA 3LONA 1W8BH 4X1PU 1WDIA 4IBLH 3LDXH 1QL8A 5TCAA 4AFQA 2L6OA 1ZJKA 2GV6A 5FBIA 4DIHH 5F53A 2G5VA 2ZTZA 5J4QA 1O2HA 2WV5A 1LQEA 1ID5H 1PQAA 4Z1MD 3A7WA 2M5TA 3M5OA 4BAQB 1HPGA 1P3EA 2DE9A 5E0JA 3FKSD 2K8IA 5DP3A 2CHAB 3K6ZA 1YC0A 4K2YA 2K1QA 1O2VA 4A7IB 4YLUA 4WXIA 2AGIX 1TNLA 3SJ8A 1JIMA 3ITIA 2YOLA 3ESTA 2ZHQH 1AU8A 3LGIA 1GBCA 4JYTA 1RD3B 2FX4A 4WMDA 1C5NH 3GS9A 2NU1E 4KTUA 2XNDD 1CBWB 3RM2H 5IK2D 4NCYA 1QB6A 2F9VA 3E3TA 3SU1A 1SLUB 4OM9A 3SN8A 4A92A 1ELAA 1SQTA 3N7EA 1F0RA 3PROA 2PWXA 1KMHB 2FX6A 3FFGA 1TNKA 1AFEH 1YF4A 1AKSB 2PKAB 1C5SA 1C1PA 4X6NA 1N8OB 1GI3A 2A4RA 5DGJA 1QRXA 5FCRA 4AGJA 1HAYB 1UW7A 2ZHDA 1PQ7A 1VITG 3RXGA 2AIQA 4KKDA 2CF8H 5AVDA 4ZKSU 3TGIE 2P16A 4AOQA 3A7TA 1W7GH 3KHVA 4AFZA 1ZYOA 2VH0A 4ABHA 3LGTA 4BTUB 2ALVA 4BNRA 2TGAA 3KEEA 4F49A 1GBIA 2A4GA 3ZV9A 1GMDF 2PKAA 3HK6B 2FM2A 1GI7B 1L1JA 1DOJA 1YGCH 3PV5A 3KYFA 1E1QD 4DT4A 1G3EA 1FX0B 5LH8A 3AAVA 3VB7A 4DCDA 1YBWA 4ISOA 1O2TA 4D9QA 1ZMJA 4Y8YA 1OOKB 2SNVA 1LVBA 3GDSA 2V7QD 1RXPA 1EUFA 1C5MD 3ATKA 1AD8H 3NRLA 1AE8H 1VJ9U 1BDAA 2UWLA 3RM0H 8KME2 1F5LA 1S81A 1XM1A 3RXEA 1GVKB 1UK3A 1HLTH 4UFDH 3W94A 1G30B 2EY4C 2FLBH 3HPTB 1W11U 1RTLA 1TRYA 4FETA 6LPRA 2G55A 2PSYA 2PUQH 2ZU5A 1AUJA 1MABB 2ZDKA 1TE0A 1Y8TA 1WAYB 1O3LA 3RXSA 3R0FA 2VIWA 4D9RA 5EW2H 1O2ZA 1BMMH 1C5YB 4ACBA 1P09A 4X1NU 2OBQA 2OXSA 1DANH 1EJAA 2GJGA 4A1XA 4NIVA 2GCHG 2NU2E 2ZPRA 2ZHEH 1FDPA 1SGNE 4ABJA 2PUXB 2IN2A 1YCPK 3SZEA 1ELCA 4ZHMU 1SGFG 5IDKA 1PQ5A 2TGDA 2FMJA 2O8TA 2G81E 5C67A 2W3IA 5FCKA 3DD2H 5EIYA 2OQ5A 1JBUH 2K0QA 3RXJA 2ZU3A 1K22H 1ELVA 1SGIB 2XOKD 1IAUA 3QLPH 1MTSA 2JJ1D 2SGDE 4VGCB 1FMGA 1C1SA 1G3DA 4AGKA 3LJJA 3P6ZB 1EZQA 3FVFB 1K21H 1MCTA 4MPWA 3SU4A 1O3JA 1ZHMA 2FTMA 1HRTH 1K1OA 3HGPA 9ESTA 1EPTA 4K3JA 4HI3A 8LPRA 4JZFH 1P2MA 4Y6DA 1MZAA 2R3UA 1O5AB 2QYIA 1C1MA 2O8LA 2HPQH 2AIPA 1MTWA 4RSPA 3Q76A 2VH6A 2WPIS 4VGCC 2M2AA 5I46H 5K0HA 4FUCA 3UY9A 3N7OA 2FYQA 1WXRA 3VB3A 4E7NA 1IQJA 2P94A 1C1UH 1OP0A 2EI8A 2BLVA 1P06A 5FPSA 1FNIA 4XSKU 1LVMA 2FP7B 4ZKOU 1Y3UA 2WPMS 2G51A 1O3HA 1GJ7B 2A31A 2D26C 2IOTA 4ZH8A 1MH0A 1OX1A 1PYTD 2FEQH 3RXHA 1NZQH 4CHAB 2ZZUH 1LMWB 3P8OA 2P8OC 4OGXA 1BMLA 4HZHA 1G2LA 2IJD1 1C1VH 4FUEA 4CH2B 1FZZA 4I8JA 1SLXB 1QJ1B 3PLBA 1SFQB 2FDAA 5A8ZA 1BZXE 4JZIA 3SV6A 1BRUP 1TLDA 3UNQA 3Q3XA 1JRTA 1IQGA 3T2NA 1A5IA 3I78A 4CRAA 2ZF0H 1UO6A 1LHGH 3M37A 1SHHB 2ANMH 1P9SA 2RFKC 3R3GB 3E0PB 3EAJA 4AORA 1S85A 4IN2A 4CRGA 1GG6C 4RKOB 1TPOA 4YZUA 4AZ2B 2BMGB 1UCYE 2FI5E 4ISLA 4U2WA 3PYHA 1PPFE 3TU7H 4BOHA 1CA0C 1MKWK 3TNTA 1MTVA 2C8ZB 1MKXK 4NFFA 5H4IB 2D2DA 2B8OH 2BQ6B 4ABEA 1VGCB 1HIAA 2PR3A 1YYY1 2I6SA 3VEQB 3FAOA 4FU8A 1YLDA 4KGAA 1UTNA 1UVOA 2JETB 3RMNH 1KXEA 1AHTH 2P3TB 3F2FA 3NUMA 3RMOH 1L4ZA 2SGQE 3B8JA 4CBNA 1GHVH 5JBAS 3P95A 4WF8A 2H5CA 5C0UA 1P0SH 2CGAA 4U32A 1EPTC 2A7HA 1EJMA 1P01A 3RXPA 1ZPBA 1J17T 2WPLS 1TGNA 1YPLH 3P8FA 1RIWC 1BQYA 1KDQA 3PLPA 5A8XA 3MU0A 3A86A 1S83A 1BTZA 4KTCA 2Q6DA 3ZZ8A 1GJ6A 4BTIB 1EATA 1S6FA 1KLJH 4B2CA 2BDCA 4ZKNU 3C27B 1K2I1 2ZP0H 1Y3VA 4O3UA 5C1YA 3ZZDA 5EOKA 3UUZA 2W26A 1OKXA 2C8WB 1ZR0A 1GJAB 4NGAH 4NG9H 1SI5H 2VINA 1TALA 1NU7B 4ABIA 3GY6A 1TYNA 3H7TA 4MQAA 4B74A 1WQSA 2VWLA 4WWYA 1GI5A 3MYWA 3A82A 1A46H 1OSSA 3ZVDA 5FPYA 1UCYH 4MPXA 1THRH 1HJ8A 1V2ST 2BDYA 2FOHA 2QN5T 1FAXA 2WYJA 3BIVH 5T6GA 1YPJH 1FN8A 1QA7A 2V6NA 2O8UA 3ODFA 3WWBA 4CREA 3ZZ5A 1TWXB 1KLTA 3RLWH 5ESTE 3A85A 3LGWA 1GCDA 1LVOA 4YOJA 1O2IA 1BTWA 1FV9A 2A2QH 3F3BA 2J98A 2ZA5A 1CT4E 3GY8A 1FUJA 1BMNH 4DY7B 1VZQH 5TCCA 4WMFA 4MLFB 1N1LA 2VWMA 1ZTLA 1BHXB 2ESTE 1GJBB 2O8MA 3CENA 2J5UA 2AMDA 1QY6A 1ARBA 1OWHA 1XUGA 3RC6A 5C94A 3EE7A 3VXFH 2VGCC 1A3EH 4ESTE 2FOAA 4XBBA 3QUMP 1NRPH 3BEIB 1QURH 3QK1A 2F9NA 1C2JA 3OEHD 2JH6D 1HAHH 2QGRA 1GBLA 1GI2A 3SUDA 4E05H 3ZVAA 1Z8JB 1DUAA 3OEED 4OS6A 2Y80A 2ZTXA 3SJ9A 1ZLRA 2BYAX 4DJZB 3SNEA 1LHCH 5BPEA 2BQ7B 2VIQA 2ZWLH 3T26A 4Y76A 1LO6A 8GCHF 1FIZA 1CHOG 3SJKA 1CHOF 2A45B 4JYUH 1TX6A 3UR9A 3V12A 3TK6A 1SGYE 1EX3A 2YMSC 1Z8IB 4Y7BA 2PTCE 1MBQA 4Y0ZE 3T28A 2EQNA 2W7SA 4SGBE 2GGVB 1QB1A 3U8RH 1ELDE 1K28D 6ESTA 2STAE 1PFXC 1A61H 4GLYA 1VGCC 2BX3A 1DFPA 3KGPA 3GY7A 2FS9A 4NSYA 1CQQA 1C4U2 2A5IA 2R2WU 2ZGXH 2ZU4A 3M3VA 5DSFA 3TJNA 1MKXH 3RLYH 4GHQA 1GI4A 4DVAU 4IGDA 2NU3E 2HRVA 1B0FA 2I6QA 3F9FA 3U8OH 2A32A 1GPZA 2A7JA 1XKBC 1HDTH 5EQQA 1V2KT 3KCGH 1W0KD 4QT8C 1WBGB 1F2SE 5G4BA 3VB6A 3SHAH 3MMGA 2TIOA 3A88A 1VKYA 1TX8A 3UREA 3ZZ7A 1ZJDA 3DUXH 4D7FA 1MD8A 4INKA 5A0AE 2FOGA 1GJCB 3SU2A 3CNRA 4I86A 2STBE 2BY5X 2P8OB 4GUXA 2IPQX 1RTFB 2A0QB 3QTVH 4F55A 1O3MA 1P2IA 2SGFE 2ULLA 2Z9IA 1CSOE 1BMAA 1CA8B 2A1DB 1J8AA 1ANDA 1WYKA 1TB6H 1UMAH 2AGEX 2ZDMA 1TABE 3MNCA 3UAIC 3RMLH 1BMFD 1RFNA 2O9QA 4UE7H 1O5BB 5CE1A 1DPOA 3WWFA 4X8TH 1O3PB 3ZIAD 4P00A 1GJ9B 3E1XB 2RDEA 1NU9A 2UUJB 2OUAA 2GZ9A 1CGJE 4K60A 5JBCS 1C2KA 3KYGA 2Q6GA 3BTTE 5HIYA 1AIXH 5EJ1A 1ELTA 1V2MT 4H42U 4HTCH 1E34B 2BOKA 1O32A 1TA6A 3P92A 2KAIA 1V2WT 3IG6B 2DUCA 2ZFRH 1P10A 1EAWA 2CHAC 3TLOA 1IQNA 1JRSA 1DDJA 1YY3A 1QQUA 4WMEA 3RC5A 3MNXA 4FOUC 3URDA 1O2SA 3ZYDA 1OS8A 2L74A 2BB4A 1P04A 1QTFA 4ABGA 2Y7XA 5EJLA 4K8YA 4UDWH 1QBNA 1GVZA 2QC2A 3LH1A 2QXHA 1W13U 1DWDH 1SG8B 2VIPA 3MU8A 1DM4B 3F2GA 1HNEE 4WH8A 4LXBH 3RU4E 3S9AA 3BTQE 2B0FA 1Z7KA 3OX7U 4A1TA 1TGBA 4ZUHA 4WY3A 1AO5A 2LELA 2WUBA 1GHZA 4X2WA 3U9AH 1HAVB 4IS5A 2IPHA 4J2YB 4YT7H 1QHRB 3QTOH 3MQKC 3ATIA 4ACAA 1A3BH 1EFRD 3EE0B 4BXSA 1O3OA 2QF0A 5L2ZH 1G36A 4B2BA 2ODYB 3BEFB 1MU8B 2ZHFH 1VCPA 2PHBA 2ZG0H 4DGJA 1ZHRA 2FOCA 3TJVA 2Z9LA 1NN6A 4B73A 1UHBB 5T6FA 1UTJA 2FPZA 1DLKB 2FOEA 1O2XA 3SOSA 2THFB 1F0UA 1Q31A 5F03A 5SGAE 3EYDA 1JOUB 3BTFE 2QF5A 1NPMA 3LPRA 1YPGH 2RCEA 3UOUA 2BZ6H 2KZ4A 1TBQH 2HLCA 1O2PA 1D3PB 1L1NA 3MO6A 1C1RA 2QV1A 1OYQA 3S9BA 5EXNA 3SNAA 1HJ9A 2OTVA 1CT2E 3QGJA 2ZI2H 4IW4E 1D6WA 1LKAA 2XC4A 4O3TA 2AYWA 1NM6A 1TGTA 1A0HB 1GVLA 1ARCA 4O97A 2BDIA 2SNWA 4JYVH 1O33A 2ASUB 3LIWA 1GMDG 1HJAC 1KXBA 3RXMA 1GDQA 3A8BA 2FI4E 1G37A 2FOFA 3SJIA 1TBRH 1DSUA 1P05A 1O34A 1O5FH 3NXPA 3S69A 1FY3A 1TPSA 7KMEH 2P93A 1EB2A 1L4DA 1EQ9A 1AB9C 2CMYA 3PV2A 1TMBH 1GDUA 3ATLA 5AFYH 3NK8A 1D3DB 2WPKS 1O2GH 4YOIA 1W0JD 4AB9A 1SFIA 4Q7YA 1SGPE 4JZ1A 4R0IA 1ABIH 4Q80A 2BDAA 2OC1A 3LJOA 1GI9B 5LPRA 1A7SA 3BEUA 3PM3A 3QDZB 3MH5A 2Y6TA 2FODA 2Y81A 3VB5A 1F5RA 2G00A 2Z6BD 4XFQA 2Y5FA 1ELEE 4NIWA 4X1RU 1D3QB 4XE4A 3GCOA 5CDFE 3MWIU 1YM0A 5IYTA 1P2OA 2GV7A 4Q2KA 2SGEE 1GBJA 1ANCA 1ZMLA 5F8ZA 2ZPSA 1MTUA 2G4UA 5ABWA 1ESAA 2ZHWH 4Z6AH 3SU0A 1GHBG 3F0PA 1C2GA 1SKYE 3AK5A 4ZXYH 1GWAA 1A0JA 3A84A 3A80A 1H8HD 1ZPZA 4TWYA 2BXTH 2WPDD 3LH3A 4A1VA 4UEHH 3UWIA 4OS7A 2LPRA 1NO9H 3T25A 3FOAA 3BIUH 1N6XA 1O3AA 1YCPM 4UONA 1Z1IA 4X1SU 1EB1H 1XUJA 5T3HA 2ZGJA 4D8NA 1ETRH 1O0DH 1O3FA 2W6JD 5I25A 2HLDD 1PJPA 2KCOA 3SV2H 5C3NA 4SGAE 5A8YA 2BXUH 2IJOB 1LPKB 1RGQA 1LPZB 1BCUH 3BSQA 4F48B 3ZZ9A 2YMSD 1ANBA 4MPUA 1S82A 3OAAD 1EASA 1NT1A 3M5LA 1UVPA 4DURA 1THSH 4TSFD 1WTGH 1VITF 2JH0D 3KIDU 5C20A 1Q3XA 3OY5U 1O37A 3WW7A 1QJ7B 1FIWA 1QJ6B 1D9IA 2FO9A 1UTQA 2PKSB 1AZ8A 1TOMH 4WXVA 3K2UA 2ZU1A 2H2ZA 1MCVA 2TBSA 2TGTA 3ZZ4A 1WV7H 1QBVH 4MPVA 3LC5A 3H09A 7LPRA 3E91A 3KQ5A 3W1EA 5KEDA 1HAXB 2AS9A 1WU1A 3A7YA 2XTTB 3LGYA 5GJ4B 3SO3A 3GDVA 3VFEA 4A5TS 2Q6FA 1OWEA 2BDBA 2ZDVH 4NIXA 4I8GA 2SGPE 3VB4A 1BITA 4M9FA 1S84A 2ZGBH 1KTTB 4Y71A 1WTHD 3V0XA 1UCYK 1QFKH 1MZDA 3SI4H 4PROA 5L30H 3V13A 2W3KA 3E8LA 1P2QA 2QIQA 1L2EA 3PWBA 1THPB 1BBRK 2ZEBA 5GCHF 3MH6A 3BV9B 3NWUA 2GZ8A 1V2PT 3F9EA 2CXVA 1BTUA 1G3CA 5HIZA 1KXFA 1YPKH 1TQ7B 1KDQB 3ZZ3A 2DE8A 5FBEA 3DSGA 1F0TA 3A7VA 5EXLA 2BLWA 2RDLA 2Y82A 1OP8A 1AUTC 2F9PA 5CHAB 4X8VH 1QNJA 3GOVB 2OINA 1AVGH 1C2DA 1NTPA 1O30A 4UFGH 2OC8A 6CHAB 3ZVEA 1BTPA 3T29A 3U1IB 2J98B 1OWKA 1TNGA 2ODQA 2XBVA 2P3FH 3ATMA 4YM9A 5DN6D 1U6QA 8GCHG 4YXWD 2FXRA 5TJXA 5GWZA 2CK3D 2BQWB 2J94A 1F0SA 1WQVH 1ZSJA 4FUDA 2C8YB 3PMJA 4XDEA 5DP6A 1DY8A 1TMTH 1C1WH 1C5TA 3STIA 2QXIA 1KLIH 2KCAA 3BN9A 1UVUH 3CS0A 3K65B 3BG8A 1V2QT 4ABBA 3K6YA 1BBRH 2VNTA 2GDEH 2VVVA 1HAZB 1GMHF 1BTYA 5AF9H 1TOCB 1GBTA 4MNXA 3A7ZA 4AX9H 1ORFA 1IQKA 2AFQB 2C3SA 1H4WA 3RXAA 1EOLA 1UTMA 2ZDAH 4ZKRU 5EGMA 4BAHB 3VGCC 2VIOA 1ZGIA 2XXLA 5DP4A 4X6OA 3RXVA 1GMHG 2G8TA 4NIYA 3SU5A 5E2OA 1C5OH 2HPPH 2Z3DA 1Y5AT 1LQDB 3PRBA 1AN1E 3SQEE 4ASUD 4ZCNA 1C5RA 1AWFH 4LZ4B 1NC6A 1MU6B 5FL7D 3T27A 2V3HH 2XNIA 5EW1H 3TK9A 1ESTA 3V3MA 1ETSH 1A0LA 4Z0KA 3Q3KA 3E16B 3S9CA 4Y8ZA 5PTPA 1OWDA 2ZDNA 4X2VA 4K8BA 3F1SB 1GBEA 1NRRH 1YPHC 2FYRA 1CO7E 1O38A 1QRWA 1SGCA 3MU4A 1C5QA 4ISNA 2FOMB 4TPYA 4RN6A 3RUOA 1SR5C 2HOBA 4XBDA 2GCTB 3GYLB 4R8TB 4D76A 3M61U 2F9OA 1FY5A 2H9HA 2VU8E 1TFXA 1WSSH 1HXEH 1G9IE 3SHCH 1NFUA 5HKKD 1MUEB 1EZSC 2F91A 4AFSA 3SUFA 3SQHE 1ZOMA 1JIRA 4AC9A 2VGCB 2ZFFH 4I31A 7GCHG 2ZKSA 2GCHF 3MFJA 3O8CA 2VIDA 5C5OA 3SI3H 1CGHA 1OPHB 4A6LA 4B6EA 1HJAB 1V2RT 2LNCA 4ABDA 1D3TB 1W0ZU 5CHBA 1S6HA 1ACBE 1J14A 4X6PA 1CHGA 1KXCA 1XX9A 4WVPE 2A7CA 3TVJB 1PPBH 1NBMD 3QGNB 3RXTA 2P3UB 2XCNA 3RDZA 4KTSA 1PYTC 1W7XH 2G5NA 2ZPQA 3E6PH 4GVUA 2F83A 4Y7AA 1A4WH 1E1RD 1O3KA 4YOGA 1LKBA 3U1JB 1AVXA 2NU0E 2H1UA 2F3CE 2AH4X 2UWOA 3OSYA 5FHTA 2RA0A 3SGBE 2AMPA 2C4FH 3RXFA 3SNBA 4RT0A 2GMTC 1GDNA 1XUHA 3TIUA 2F43B 1Z8GA 1GHXH 3DA9B 1C2MA 3SYJA 3U8TH 5BRRE 1UTLM 3FZDA 1XXFA 2ZCLP 1IHSH 4GSOA 1C2EA 1O3BA 1F7ZA 1XKAC 3O8BA 4MDSA 1OWIA 2BVSH 3MU1A 1EXFA 1BRCE 2HVXA 4O03A 5EJZA 1EJNA 2JIZD 5KECA 2QY0B 2BDGA 3T5FH 1GHYH 3NPSA 3GDUA 1MAYA 3W95A 1FPCH 4INHA 1GL1A 2BD5A 1J9CH 1P2JA 1O5DH 1PPCE 1AMHA 1ZSKA 1AQ7A 1XUFA 1C9TA 4UFEH 1ETTH 3KQCA 3OYPA 1Y5UT 2CN0H 5DJ7A 1BB0B 1G32B 2F9BH 3ZZAA 1DICA 1LDTT 1YWUA 2H9TH 1MMJN 2BOHB 1IHTH 4BAOB 1TQ0B 3DFJA 1SOZA 2VB0A 4J1YA 1C5XB 3TH4H 5F8XA 2J2UA 2WHXA 3SNCA 2EA3A 3EQ0H 1LHDH 1EP6A 2ZCKP 1CE5A 4B2AA 2AEIH 3DSOA 1YLCA 3TNSA 1O2WA 1SQOA 4ZMAH 2FS8A 1GHAG 3HATH 1AVWA 3LOXA 1MTNB 3PLKA 2ZFQH 3BTGE 1J15A 1VCQA 3PB1E 2BY6X 2P59A 3F0OA 1O2KA 3LU9B 2QXGA 2OBOA 1O2LA 4K1SA 1AE5A 5DO4H 1K1MA 2KAIB 5DP9A 2J4IA 5EPYA 1TPAE 4AG1A 5AHGH 3L3TA 4CRCA 3M5MA 4FUGA 4Y10E 1E79D 1GBFA 2KR7A 2GCTC 1YP9A 3NZIA 5GIBA 2C90B 2QCYA 1DWEH 2XWAA 3DT0H 1GBBA 3SW2B 2QF4A 1NROH 5HM9A 5FPTA 5JDUB 1T4UH 4BAMB 3O8RA 4MNWA 2AMQA 2OQUA 3BTEE 5JPMH 3QZQA 3D23A 2XRCA 3JZ2B 1P02A 3A87A 2PV9B 1J16A 4BXWA 1C1QA 5A09A 1IQEA 3L33A 1COWD 1H9LB 4CR9A 4CR5A 2XCFA 1EAIA 2J92A 1C5LH 3MH7A 4K1EA 4JCNA 2ZGCA 1GCTC 1EOJA 3KL6A 1H8DH 2ZECA 1HCGA 2FWWA 4ZAEA 4CRDA 1UVSH 1INCA 3RP2A 4OS4A 2ZO3H 4LK4A 2RG3A 1GJ8B 1KIGH 2ZFTA 5LGOA 3A81A 2VWNA 1LTOA 3VGCB 1SGFA 2BY7X 4B1TA 4M7GA 3UIRA 2SGAA 5JBBS 1Z6JH 2VVUA 2OK5A 3TJUA 4DG4A 3SNDA 5E0GA 2VVCA 4NA8A 1MAXA 4P02A 4GAWA 1W12U 3DHKH 1TA2A 5CMXH 1O5CB 3KN2A 2HVYB 2GMTB 3E90B 3AVZA 4OS5A 1QL9A 2D1JA 2OC7A 1G3BA 1CT0E 3GY2A 5KGOA 4IC6A 4I7YH 2Y5HA 1LHFH 1M9UA 1TNIA 4JMYA 2OD3B 2VWOA 3HGNA 4XOJA 1FN6A 3EA8A 4JK6A 1P8VC 3A7XA 3RXOA 1ZGVA 5JYIA 2Z7FE 2KCYA 1F5KU 4YO9A 5C0TA 3LGUA 5F6MA 4X6MA 1O2JA 1A2CH 3BTHE 1T8NA 1XVMA 4F4OC 2R0LA 1O5EH 3PO1C 1GBMA 1EKBB 1P12E 2SFAA 5ETXA 3I77A 3KQBA 4X2XA 1NY22 3HKIB 4KELA 2V3OH 1NRQH 1W14U 3BG4C 1GGDC 1GHWH 1BJUA 4YESB 1CA0B 3UFAA 2R3YA 4RKJB 3ZVCA 3BTDE 1K1JA 1LPGB 2R0KA 3ZYEA 5EODA 1BT7A 1GG6B 2AERH 4X8SH 2WPJS 2BDHA 3GYMA 1ZRBA 1IQLA 2HGTH 1AZZA 3UNSA 1C1OA 3SV8A 1RTKA 3LT3A 4LOYH 1OWJA 2GT7A 1MD7A 3GCHB 2GKVE 1DWCH 4MNYA 1UTOA 3EA9A 1O2QA 2B5TB 3LC3A 2HNTF 2XC5A 4CH8B 5EU8A 4MG3A 2V3MA 2F9UA 1YPEH 2H9EH 3FP8E 3TGJE 2A4OA 3MNSA 4TYDA 1P2KA 5E8EH 2WSSD 1NRNH 1D4PB 2YNAA 4TY6A 2ZC9H 1NESE 1H8ED 4NA9H 1K1IA 3GY3A 1C2HA 1E0FD 2RA3A 2PKSC 1AFQB
chains in the Genus database with same CATH topology
1KY9A 3ZZCA 1TIOA 2Y7ZA 2ZDLA 1UK2A 1B5GH 2ZQ2A 2A2XH 4I32A 2TRMA 2XWBI 5EPNA 3ZVGA 1Q2WA 3DFLA 2ZFSA 1FLEE 1AWHB 1HAOH 1ZMNA 2EI7A 1O2OA 1V2TT 1PPEE 1DX5M 1N8OC 1V2NT 4Y11E 3ZZ6A 3P8GA 1T8OA 2ZIQH 3RXLA 5C1UA 1PQ8A 2ILNA 1Z1JA 3F68H 2GTBA 3RXQA 1UTKA 4FU7A 3ZZBA 1CU1A 3RXKA 2BD8A 3GCTF 1D6RA 5C5NA 1ZTKA 1SGTA 3AW1A 1TMUH 4E7RG 4B75A 1ELGA 1DSTA 2A5KA 3HKJB 1K1NA 3A8DA 1WUNH 1O3DA 5J4SA 1HV7A 2BHGA 1P03A 4FVBA 2H6MA 1KSNA 1KYNA 2BZAA 3EA7A 4MVNA 3PO1B 1DT2A 1HFDA 2PLXA 4I8KA 4AFUA 2EEKA 1AFQC 3S7HB 3CP7A 1TONA 3RC4A 1FONA 4YT6H 1A1RA 9LPRA 3RXIA 4B76A 4GPGA 2A4QA 4FUHA 3F9GA 1W3CA 1DY9A 2HWLB 2P95A 1VITH 1X7AC 3EDXB 3ATWA 1TGCA 1TRMA 5EQRA 1O39A 1TAWA 2FLRH 4YTAA 1P3CA 4LZ1H 3RXBA 1KXDA 3A8CA 4INLA 1SL3A 5EXMA 1V2OT 3UNRA 2D8WA 2J9NA 3KF2A 5E2PA 3GCHC 5LPEA 3FANA 1PPGE 1SBWA 1FI8A 1FXYA 4ZXXH 2ANWA 2JKHA 6GCHG 1CGIE 3PWCA 3BG4B 1T7CA 3U98H 1O2NA 5L6NH 2XC0A 3FP7E 1F92A 4MTBA 1YKTA 3SZNA 1IQIA 1N6YA 4H6TA 3PTNA 3UQOA 4ASHA 2QF3A 2GP9B 2A5AA 3IWMA 1Y3YA 1V3XA 5K7RA 1EPTB 4XBCA 5FX6A 5DP5A 2O8WA 5GDSH 4HGCA 1AI8H 4AYYB 3PMAB 1O36A 2VJ1A 2XBXA 1NFYA 1TRNA 1BBRE 4UFFH 1O35A 1RS0A 3UQVA 5A0CA 3U69H 5B6OA 2WPHS 3MOCA 1UHBA 1O5GH 1S5SA 2Z3EA 6CHAC 4U30A 1H9IE 1LHEH 2W7UA 2FZZA 4ISHH 1GHBF 1T8LA 3D65E 5DK1A 1O3CA 2PFEA 1HXFH 3STJA 4I8LA 4TWWA 2NU4E 3MH4A 1C4Y2 3BF6H 2BY8X 3MHWU 1QL7A 5HMAA 3O8DA 1QCPA 1XUIA 4ABAA 4NWKA 2PGQB 1SPJA 1HAGE 4WJG2 3PV4A 3HK3B 1W2KH 1DXPA 3BTKE 5FXLA 1MTNC 2Q1JA 2UUYA 3PMHB 2BTCE 4FXGH 3SBKA 3GY5A 1EP5A 1FY8E 2BD7A 2Z94A 3GCNA 1O3EA 1NRSH 2ANYA 3P70B 3P17H 3NKKA 4D7GA 1CVWH 5DP8A 1C4V2 3SUGA 1HAIH 3Q3YA 1C2LA 3H7OA 2Z9JA 1HGTH 4ZHAA 1YPMH 2VIVA 1YCPH 1OXGA 2Z3CA 2BVXH 3MNBA 4OGYA 1L0ZA 1SC8U 1AY6H 1SLWB 2BX4A 1GI0A 2V0BA 3CS7A 1S0RA 1T32A 4I33A 1NS3A 1TGSZ 3A89A 4X0WU 4FUJA 5EQSA 3SU6A 1Y3XA 1VCWA 5ESBA 5C2ZA 5HGGA 2BM2A 1HYLA 1O3IA 1C5PA 3TJOA 1QR3E 2FTLE 4U01A 2QAAA 4JK5A 1C5UA 3RXUA 1O2RA 5JB8S 4THNH 2WINI 1GMCG 3MU5A 2GD4B 3PMBB 3I29A 2OP9A 1V2VT 1ZZZA 2BY9X 2YNBA 5GCHG 1PPHE 2UUKB 3GISB 1ZHPA 1ZTJA 1GJ5H 1HBTH 1HUTH 3MO9A 1PPZA 1BTHH 1ZRKA 2QA9E 3ZVFA 1BRAA 2PTNA 3IITA 1OP2A 1H9HE 2QXJA 1E35B 2J95A 1EAXA 1S0QA 1KXAA 4OS1A 1DWBH 5JB9S 1GGDB 3SU3A 1BUIA 1ZPCA 3RXCA 4Y79A 2BD9A 2XBYA 1XXDA 3FP6E 1AGJA 1TX7A 3KNXA 1O3NA 3B9FH 1AB9B 1RIWB 2CV3A 3M3TA 1FPHH 2B7DH 1VJAU 3M3SA 1P9UA 1K9OE 1JWTA 1ESBA 3F9HA 1QQ4A 1GI1A 1FQ3A 1QRZA 2FESH 2PW8H 3BTWE 1O3GA 3ODDA 2BD3A 4JZEH 7GCHF 2ZFPH 2BD2A 4IN1A 3D62A 3Q77A 3M36A 1SGRE 1C1TA 3AAUA 1UVTH 1SLVB 3LGVA 3C1KA 3UPEA 1V2UT 1SGQE 3EGKH 4DW2U 2Y5GA 4IC5A 5GPIB 5AFZH 1EAUA 2UWPA 2BLQA 2JH5D 3UTUH 2GVFA 4FUBA 3WY8A 1GBDA 2HNTE 3GCTG 1GJ4H 1YPHE 2V35A 2FOBA 4BTTB 4GCHG 5HM2A 1C5WB 4AYVB 3NCLA 1MKWH 3QO6A 1E37B 1CBWC 2NWNA 1DS2E 2EI6A 2BD4A 2B9LA 1QA0A 1Z71A 4IMZA 2CJIA 1VR1H 2XYAA 1SMFE 1UK4A 4UD9H 4I8HA 2EC9H 4FU9A 2ANKH 3AW0A 4DIIH 3BTME 1A5HA 4K1TA 3RXDA 4CHAC 1C2FA 1W0YH 2ALPA 2FI3E 3B23B 4NZQA 4NWLA 1GI8B 1HB0B 4H4FA 1OYTH 2GZ7A 1GMCF 1XVOA 2Z9GA 4O9VA 3UOPA 2FIRH 4FUIA 4Q7ZA 1V2LT 3TGKE 3S0NA 5HYOA 2GT8A 2PSXA 1ELBA 1BIOA 1LVYA 3TK5A 2HNTC 3UR6A 3SV9A 2WUCA 1JMOH 5DKMA 2TGPZ 2ZU2A 2ODPA 4MNVA 2WV4A 3FZZA 4Y0YE 2C8XB 2W5EA 3MI4A 3PTBA 1KTSB 4X2YA 3G01A 4NZLA 3RMMH 1HAPH 3SGAE 3QX5H 1GBKA 1AKSA 3M35A 1DLEA 4K69A 3SJOA 5E0HA 3F6UH 3KQDA 3V7TA 4BANB 1DUEA 3LKWA 4K5ZA 1C2IA 4BAKB 5A0BA 1L1GA 2OC0A 3QZRA 2XW9A 1FAKH 1GI6A 1MQ6A 2J38A 1C5ZB 4YLQH 2ZCHP 1O2UA 1GBHA 1SHYA 1RJXB 3RU4T 2OCVB 1BTXA 1FY4A 5LPFA 4Q7XA 3SV7A 4CBOA 1W10U 1IOEA 4CRFA 2WYGA 1Y5BT 4FUFA 4B71A 1BA8B 3RU4D 1P57B 1XUKA 3KQEA 2CF9H 1NFXA 3M7UA 3MO3A 3T62A 3TH2H 4CRBA 2BVRH 2G52A 5HXFA 4TY7A 1H8IH 1SGDE 1UTPA 3SORA 7ESTE 1DITH 2PGBB 4HFPB 1Z6EA 5CHAC 2GX4A 3M7TA 1C5VA 2XBWA 1Z8RA 4DT7B 1ZSLA 3QN7A 1SVPA 4GHTA 4ISIH 3H5CB 2ZTYA 3M5NA 1DE7H 1MBMA 1HIAB 5DP7A 1NFWA 4NA7A 4DOQA 4KP0A 1SOTA 4GCHF 5EG4A 2H5DA 3OU0A 1WCZA 2ZQ1A 5L2YH 1XMNB 1E38B 1FY1A 2GDDA 3E0NB 3UWJH 1QGFA 3VXEH 1V2JT 5JBTA 1K1PA 1Y3WA 1QBOA 3SUEA 1GBAA 5C1XA 5DPAA 3OTJE 4TPIZ 1C9PA 2BLOA 2UUFB 1ABJH 4AG2A 5FAHA 3L6PA 4Y8XA 1K1LA 2Z9KA 1WOFA 2R9PA 3M7QA 3A83A 1B7XB 2OLGA 2ZNKH 4OS2A 1BRBE 3ZV8A 4NFEA 1SGEE 1UJ1A 5F8TA 5T6DA 3Q00A 1TBZH 1EZUC 5DG6A 1JXPA 3GICB 4AB8A 1O2YA 3TITA 1BHXF 1O31A 3MTYA 8ESTE 1C1NA 1QB9A 3D49H 3TPIZ 3ELAH 4WH6A 1TNJA 3RXRA 1LCYA 1V6DA 1ELFA 2ZGHA 1T4VH 2JETC 4JZDH 1IQHA 3S7KB 1EZXC 2AGGX 3ENSB 4ABFA 3AASA 1Y59T 1H1BA 1MQ5A 5GXPA 3URCA 1ANEA 1G2MA 1SSXA 4FVDA 1E36B 3P8NA 1FJSA 3TH3H 1IQMA 1DVAH 1GHAF 4X8UH 1RRKA 1TPPA 4E06H 1P2NA 4ZHLU 1T31A 3ZVBA 1GJDB 2TPIZ 3GY4A 4ZROA 1B0EA 1SB1H 1P11E 3K9XB 4AN7A 2J34A 5A2MH 1TNHA 5FX5A 2G4TA 1T8MA 1QIXB 1BOQA 1BJVA 3JZ1B 2HALA 3QWCH 3VPKA 1SQAA 1DXWA 6GCHF 1A5GH 1HAVA 3A8AA 2C93B 4X1QU 1IQFA 4NSVA 2R2MB 3OY6U 4IMQA 1GL0E 4H6SB 1O2MA 3SGQE 1GCTB 3LONA 1W8BH 4X1PU 4IBLH 3LDXH 1QL8A 5TCAA 4AFQA 1ZJKA 2GV6A 5FBIA 4DIHH 2G5VA 2ZTZA 5J4QA 1O2HA 2WV5A 1LQEA 1ID5H 1PQAA 3A7WA 2M5TA 3M5OA 4BAQB 1HPGA 1P3EA 2DE9A 5E0JA 5DP3A 2CHAB 3K6ZA 1YC0A 4K2YA 2K1QA 1O2VA 4A7IB 4YLUA 4WXIA 2AGIX 1TNLA 3SJ8A 1JIMA 3ITIA 2YOLA 3ESTA 2ZHQH 1AU8A 3LGIA 1GBCA 4JYTA 1RD3B 2FX4A 4WMDA 1C5NH 2NU1E 4KTUA 3RM2H 1CBWB 4NCYA 1QB6A 2F9VA 3E3TA 3SU1A 1SLUB 3SN8A 4A92A 1ELAA 1SQTA 1F0RA 3PROA 2PWXA 2FX6A 3FFGA 1TNKA 1AFEH 1YF4A 1AKSB 2PKAB 1C5SA 1C1PA 4X6NA 1N8OB 1GI3A 2A4RA 5DGJA 1QRXA 5FCRA 4AGJA 1HAYB 2ZHDA 1PQ7A 1VITG 3RXGA 2AIQA 4KKDA 2CF8H 5AVDA 4ZKSU 3TGIE 2P16A 4AOQA 3A7TA 1W7GH 3KHVA 4AFZA 1ZYOA 2VH0A 4ABHA 3LGTA 4BTUB 2ALVA 4BNRA 2TGAA 3KEEA 4F49A 1GBIA 2A4GA 3ZV9A 1GMDF 2PKAA 3HK6B 2FM2A 1GI7B 1L1JA 1DOJA 1YGCH 1G3EA 5LH8A 3AAVA 3VB7A 4DCDA 1YBWA 4ISOA 1O2TA 4D9QA 1ZMJA 4Y8YA 1OOKB 2SNVA 1LVBA 3GDSA 1RXPA 1EUFA 1C5MD 3ATKA 1AD8H 1AE8H 1VJ9U 1BDAA 2UWLA 3RM0H 8KME2 1F5LA 1S81A 1XM1A 3RXEA 1GVKB 1UK3A 1HLTH 4UFDH 3W94A 1G30B 2FLBH 3HPTB 1W11U 1RTLA 1TRYA 6LPRA 2G55A 2PSYA 2PUQH 2ZU5A 1AUJA 2ZDKA 1TE0A 1Y8TA 1WAYB 1O3LA 3RXSA 3R0FA 2VIWA 4D9RA 5EW2H 1O2ZA 1BMMH 1C5YB 1P09A 4X1NU 2OBQA 2OXSA 1DANH 1EJAA 4A1XA 4NIVA 2GCHG 2NU2E 2ZPRA 2ZHEH 1FDPA 1SGNE 4ABJA 2PUXB 2IN2A 1YCPK 1ELCA 4ZHMU 1SGFG 5IDKA 1PQ5A 2TGDA 2FMJA 2O8TA 2G81E 5C67A 2W3IA 5FCKA 3DD2H 2OQ5A 1JBUH 3RXJA 2ZU3A 1K22H 1ELVA 1SGIB 1IAUA 3QLPH 1MTSA 2SGDE 4VGCB 1FMGA 1C1SA 1G3DA 4AGKA 3LJJA 3P6ZB 1EZQA 3FVFB 1K21H 1MCTA 4MPWA 3SU4A 1O3JA 1ZHMA 2FTMA 1HRTH 1K1OA 3HGPA 9ESTA 1EPTA 4K3JA 4HI3A 8LPRA 4JZFH 1P2MA 4Y6DA 1MZAA 2R3UA 1O5AB 2QYIA 1C1MA 2O8LA 2HPQH 2AIPA 1MTWA 4RSPA 3Q76A 2VH6A 2WPIS 4VGCC 5I46H 5K0HA 4FUCA 3UY9A 3N7OA 2FYQA 3VB3A 4E7NA 1IQJA 2P94A 1C1UH 1OP0A 2EI8A 2BLVA 1P06A 5FPSA 1FNIA 4XSKU 1LVMA 2FP7B 4ZKOU 1Y3UA 2WPMS 2G51A 1O3HA 1GJ7B 2A31A 2D26C 2IOTA 4ZH8A 1MH0A 1OX1A 1PYTD 2FEQH 3RXHA 1NZQH 4CHAB 2ZZUH 1LMWB 3P8OA 2P8OC 4OGXA 1BMLA 4HZHA 1G2LA 1C1VH 4FUEA 4CH2B 1FZZA 4I8JA 1SLXB 1QJ1B 3PLBA 1SFQB 2FDAA 5A8ZA 1BZXE 4JZIA 3SV6A 1BRUP 1TLDA 3UNQA 3Q3XA 1JRTA 1IQGA 3T2NA 1A5IA 3I78A 4CRAA 2ZF0H 1UO6A 1LHGH 3M37A 1SHHB 2ANMH 1P9SA 3R3GB 3E0PB 3EAJA 4AORA 1S85A 4IN2A 4CRGA 1GG6C 4RKOB 1TPOA 4YZUA 4AZ2B 2BMGB 1UCYE 2FI5E 4ISLA 4U2WA 3PYHA 1PPFE 3TU7H 4BOHA 1CA0C 1MKWK 3TNTA 1MTVA 2C8ZB 1MKXK 4NFFA 5H4IB 2D2DA 2B8OH 2BQ6B 4ABEA 1VGCB 1HIAA 2PR3A 1YYY1 2I6SA 3VEQB 3FAOA 4FU8A 1YLDA 4KGAA 1UTNA 1UVOA 2JETB 3RMNH 1KXEA 1AHTH 2P3TB 3NUMA 3RMOH 1L4ZA 2SGQE 3B8JA 4CBNA 1GHVH 5JBAS 3P95A 4WF8A 2H5CA 1P0SH 2CGAA 4U32A 1EPTC 2A7HA 1EJMA 1P01A 3RXPA 1ZPBA 1J17T 2WPLS 1TGNA 1YPLH 3P8FA 1RIWC 1BQYA 1KDQA 3PLPA 5A8XA 3MU0A 3A86A 1S83A 1BTZA 4KTCA 2Q6DA 3ZZ8A 1GJ6A 4BTIB 1EATA 1S6FA 1KLJH 4B2CA 2BDCA 4ZKNU 3C27B 1K2I1 2ZP0H 1Y3VA 4O3UA 5C1YA 3ZZDA 5EOKA 3UUZA 2W26A 1OKXA 2C8WB 1ZR0A 1GJAB 4NGAH 4NG9H 1SI5H 2VINA 1TALA 1NU7B 4ABIA 3GY6A 1TYNA 3H7TA 4MQAA 4B74A 1WQSA 2VWLA 4WWYA 1GI5A 3MYWA 3A82A 1A46H 1OSSA 3ZVDA 5FPYA 1UCYH 4MPXA 1THRH 1HJ8A 1V2ST 2BDYA 2FOHA 2QN5T 1FAXA 2WYJA 3BIVH 5T6GA 1YPJH