1EPTB

Refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
SRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords PORCINE E-TRYPSIN
publication title Refined 1.8 A resolution crystal structure of the porcine epsilon-trypsin.
pubmed doi rcsb
source organism Sus scrofa
total genus 4
structure length 82
sequence length 82
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eptB00
2BLOA 5CHAC 2WUBA 2FMJA 3A7TA 1C2MA 2FOBA 5FX5A 1P03A 4GHQA 3VGCB 2FOAA 2Y81A 3JZ2B 1IQNA 3U8OH 1FY1A 1HAPH 4IGDA 1S6FA 2PSYA 4FUCA 1UCYH 4A5TS 1H1BA 2ZFFH 4X1SU 4BOHA 1EB2A 1O3IA 4CH8B 2GKVE 1GHBF 3PO1C 1ETSH 1H9HE 4DCDA 1SGTA 2SGDE 3LGUA 4I31A 1IQFA 1ZJDA 2PUQH 1XVMA 5GCHF 2ZCKP 5LH8A 1RTLA 2ANYA 1ELTA 1HPGA 1YM0A 2ZFPH 4NCYA 1S85A 1C1VH 1VGCB 1RXPA 3RC6A 3M7TA 1TGCA 3SI4H 1S5SA 1AI8H 4F49A 3UWJH 2HVXA 5F8XA 4AFQA 4H6TA 1D3PB 5GWZA 1AY6H 1F5KU 1SQAA 1V3XA 1A61H 2A2QH 1FPCH 3GY7A 1TBQH 1V2WT 3RXLA 1QCPA 2WPLS 3E8LA 1G30B 1Z8RA 3ZVBA 3A82A 2FOCA 1HNEE 1MTVA 2Z9KA 8GCHG 3LJOA 1ETTH 1GCTC 1V2NT 2W26A 2G55A 1KDQA 1GJ7B 2AYWA 4GCHF 4DG4A 1INCA 5K7RA 1IQKA 2PKAB 4TY7A 3G01A 4GAWA 1KXAA 4VGCB 1TQ7B 5H4IB 2B7DH 3KQCA 1QA0A 4YESB 1HAIH 1YGCH 3VB3A 4UFFH 1WCZA 1WV7H 3MOCA 2BM2A 1HB0B 4NZLA 3F9FA 1DT2A 1LHFH 1LTOA 2ZDAH 1ZHPA 4RKJB 1QURH 3EYDA 5A8YA 4NWLA 1TALA 4NIWA 4B74A 2ZGHA 3GCHB 1BBRE 3E6PH 1DLKB 3UFAA 1NC6A 1YF4A 1JIMA 2O9QA 4KKDA 3T62A 1BIOA 1VJ9U 4IN2A 1O32A 3M7UA 3ZZ5A 5G4BA 3S69A 4WWYA 3SV9A 1LHEH 4AFUA 1C2FA 5L2ZH 2QCYA 3TNTA 1NY22 2R2MB 1HJ8A 1GWAA 3SORA 1GI8B 5BPEA 4I8JA 2QN5T 2D26C 2OLGA 3Q77A 2R3YA 2V6NA 4I32A 2ZDMA 1GBEA 1J15A 3IG6B 1GMHF 1TNJA 3TNSA 1C1MA 2GV6A 1UJ1A 3RMMH 2Y82A 3U98H 3LGYA 1BT7A 2F9OA 2TGAA 1GJCB 4NZQA 4JYUH 4AG1A 1QIXB 2IPHA 1Z71A 1LPGB 1BTUA 1W0YH 4D9QA 2ZPQA 1O3HA 3SNDA 1VGCC 4Y76A 3MHWU 2IJOB 1AZZA 1FQ3A 4AB9A 1P3CA 2V3HH 2VWOA 2PHBA 3VFEA 1G2LA 4BXWA 2XBYA 1N8OC 2BOKA 4Z6AH 2BD2A 1LQDB 1Y59T 4OS6A 3TJVA 2JH5D 1GHAF 2QAAA 4MNVA 1HUTH 4FU8A 2R3UA 2G8TA 1GBAA 1TMUH 4K69A 3T27A 1O3LA 4NWKA 1TBZH 3PTBA 3RMLH 3PLBA 4INLA 1J17T 2B8OH 1DM4B 2BDBA 1W14U 3F9HA 2VIQA 1OWDA 4VGCC 3ZYEA 4WH6A 1GMDF 1DFPA 3M5LA 1P05A 3QK1A 1FN8A 3F6UH 1FLEE 3MYWA 3KQEA 1LPKB 3KQDA 4ABAA 1S81A 2HRVA 1FUJA 1DE7H 3RXHA 3RXVA 1P11E 2FZZA 3GCHC 1QJ1B 3EA9A 2W3IA 3SV8A 1O3DA 3RXTA 1VITF 5DP9A 2O8UA 2WYJA 2ZIQH 2I6QA 3M5OA 1V6DA 2FOGA 1P01A 4IMQA 4TWYA 2HPPH 5JBTA 3O8RA 2O8LA 2EA3A 3MO6A 1QY6A 1TOCB 4ZKNU 3V3MA 1A5IA 1XUJA 1RRKA 3VB5A 3ODFA 2GZ9A 3IWMA 1GJ8B 1N6XA 5F6MA 2Z3DA 1ELEE 3QGJA 1C5OH 1DUEA 3RLWH 2WUCA 1FY8E 3M37A 4U01A 5E2OA 1TGSZ 1C5RA 1C2DA 2BVXH 1O3MA 1TA2A 3RUOA 3ZZ9A 2RA0A 2A4RA 3TH4H 2BDCA 3A89A 4O9VA 2F83A 3C1KA 2OQ5A 2W3KA 3OTJE 1P2QA 2BY8X 2C93B 2Y7XA 1GBBA 4JK5A 3RXIA 2FLBH 3C27B 2P59A 3MU8A 3BTEE 3FP8E 1YPHE 4Q7YA 2TIOA 1O3BA 1QTFA 1Y8TA 2V0BA 4NSVA 5F03A 2BD4A 3RXAA 4CRBA 1C1RA 4Q7XA 1ABJH 2FXRA 3SU2A 5JDUB 4BAKB 3ZYDA 1UTJA 1O5EH 5DKMA 3LU9B 4MPVA 3I29A 1LQEA 1L4ZA 4E06H 3EA8A 1RGQA 3FAOA 4TYDA 2XTTB 5T6DA 2ZG0H 2FYQA 1F0RA 4A1VA 2WPIS 1B0FA 1TNHA 3LPRA 4NGAH 1KXEA 2A7HA 4D76A 3FZDA 2GCTC 1MTUA 5DJ7A 4X1PU 2UUYA 1E38B 2F9UA 2IN2A 1NM6A 3F68H 1GHYH 4ZH8A 3M3VA 4Y8ZA 1NFUA 1BBRH 1NU7B 1TONA 5EXNA 1MMJN 2ZP0H 2R0KA 2ASUB 1EP6A 2YOLA 3S7HB 5A2MH 2EC9H 3SNAA 4A1TA 3TLOA 4WMEA 3SU1A 1Z8JB 2G51A 1SR5C 1CHOF 2GCHF 2SGEE 3L33A 1K1PA 1O5GH 2OBOA 1MTNC 2FODA 1C2EA 2ZPSA 1FJSA 1C5XB 4H42U 1W7XH 3PWCA 1XXDA 4DT7B 4YO9A 1OWHA 1C1UH 4HI3A 4I8GA 5L2YH 3P8GA 3UOUA 2ZQ2A 1Z6EA 1PQ5A 5A0AE 4GLYA 2VJ1A 4Q80A 5HMAA 3W95A 1JIRA 2ZNKH 5JYIA 1C5SA 2H9EH 4I8KA 4OS2A 4ABFA 5EXMA 3SU6A 3MU0A 2ALPA 4U30A 1TX6A 2BMGB 9ESTA 2RCEA 2J95A 3ZV9A 1GHVH 1SPJA 1O39A 4GPGA 1ELCA 1O0DH 1B7XB 1EP5A 2G4UA 1HIAB 1TX8A 4TPYA 5L30H 1QA7A 1AN1E 1LDTT 2XBWA 4IMZA 1D3TB 4ZXYH 1K1IA 2BQWB 1YPEH 4BNRA 3SNBA 1MU8B 3P17H 3PLKA 1BB0B 2G00A 3BEFB 1ETRH 1ZGIA 2XC4A 3F1SB 3EQ0H 4OS1A 1G36A 3RM2H 3SI3H 1UVSH 2VU8E 4IS5A 2XCNA 4PROA 1KXCA 4M7GA 2GZ8A 2QXGA 2OC8A 4JK6A 2BDYA 1SGRE 3GY6A 3A8BA 5FCKA 4F4OC 2UUKB 1GHZA 1QGFA 4AX9H 5I46H 2HALA 4JZIA 2FI3E 1O2YA 2HNTE 2KAIA 1GI5A 1THRH 1XUIA 5HM9A 4FUFA 1EZUC 3MH4A 5ESTE 1UTPA 3DA9B 5FX6A 2Z9GA 5EQSA 1GBTA 1SC8U 2GGVB 3D23A 4K1SA 3EDXB 4SGBE 4OGXA 2ZHDA 1K22H 5EPYA 4UFDH 4WMDA 1FXYA 3PWBA 4BTTB 4Y10E 1ZTKA 5C5OA 1Z1IA 1E36B 2NU1E 4ZAEA 1W13U 3SV2H 1AIXH 2B0FA 4X6MA 1DWDH 2OINA 5DG6A 3ZVEA 2QA9E 3GCNA 1MH0A 1MCTA 3L3TA 4ZKSU 2F9VA 3ODDA 2VWMA 5K0HA 2GP9B 2VIDA 1TPPA 2OQUA 5EOKA 1NTPA 1MBMA 2W7SA 3GY8A 1BTHH 3MMGA 1V2QT 3UNQA 3L6PA 3QX5H 5C2ZA 3M35A 3RC5A 2BZAA 3W94A 5DGJA 3PMHB 2ZF0H 2WPHS 3URCA 2O8WA 3BTME 1PPCE 3NWUA 1SLVB 1GPZA 3NXPA 1YCPH 1ACBE 1XUGA 1W10U 1O2QA 4BAOB 4B76A 1WQVH 1GI7B 1YCPK 4FU7A 1OPHB 3PMAB 4MNYA 2JH0D 3BV9B 3M61U 3CP7A 1ABIH 5FBIA 1JWTA 2BHGA 5ABWA 2BLVA 1BTPA 4XBBA 1HAVA 2Y5FA 2A1DB 3NKKA 1K21H 2WYGA 2A0QB 1FN6A 2FTLE 1ZPBA 3GYLB 4CRDA 1ZZZA 2Z9LA 1EOLA 4OGYA 3CS0A 1ORFA 4A7IB 3VPKA 2BDIA 1TX7A 2CGAA 3EGKH 5HXFA 5A0BA 3TITA 1OYQA 1AWFH 1V2VT 1GBDA 3RU4D 1LVYA 4RN6A 3HKJB 1TOMH 2YNBA 4ABDA 1NS3A 2A4GA 1B0EA 1DX5M 1MQ5A 2Z9JA 3TIUA 1GCDA 5C3NA 1SGNE 1BITA 3BIVH 1DANH 1IQHA 4WY3A 1QBOA 1O3PB 2AFQB 4BTIB 1MBQA 1RJXB 5C5NA 2TBSA 2XWAA 1DITH 3IITA 2BLWA 4Z0KA 3Q3KA 5JB9S 1Y3XA 1T32A 6ESTA 4SGAE 2WPMS 5FPSA 4ABGA 2GDEH 2AH4X 2ODQA 3OYPA 3KGPA 2F9NA 2A5KA 1C9TA 3KHVA 1GMCG 3O8BA 2VIPA 3E1XB 3F9GA 3P8FA 3QO6A 3VEQB 1ZTJA 3ZZ8A 4ABJA 2ZHFH 4U32A 1P09A 3GDUA 1WUNH 1TE0A 2ANWA 4Y71A 2BY6X 4CREA 1EQ9A 1L1NA 1TRNA 1CHGA 5HM2A 1AWHB 1TRMA 1GL0E 5GPIB 1GJ5H 1YPGH 2PKAA 1SVPA 3T29A 1TNKA 2UUFB 2EI7A 2BDHA 1KIGH 2FWWA 3V13A 4RSPA 5LPEA 1W2KH 5F8TA 3RXJA 3BG4B 1EOJA 4UD9H 1C5QA 4K8BA 3S0NA 3SJKA 2BYAX 1O3FA 2HWLB 4OS5A 4Y0ZE 1C4V2 2PGBB 1J9CH 1GBLA 5AFZH 1WAYB 2K1QA 3LC3A 1ZMJA 4ABHA 3P95A 1DSTA 1YPKH 7GCHG 4UONA 4X8UH 4D9RA 1GI1A 5DP8A 2ZKSA 4AB8A 1ZRBA 4KGAA 1MUEB 1EZQA 8GCHF 1UCYK 2ZC9H 4UDWH 1SBWA 3NUMA 2Q6GA 2A4QA 4FUDA 1C1PA 1ZOMA 3M5MA 4NFEA 2ZWLH 4ZHMU 2BY9X 1GHXH 2QXIA 3A8AA 1HAHH 3PLPA 5EU8A 1DXWA 3Q3XA 3AASA 1K1LA 1H8IH 1DDJA 3LIWA 4HFPB 2Z7FE 3AW1A 5DO4H 1A5HA 1EPTA 1GVLA 2QV1A 1GVZA 1N8OB 1BRUP 2CMYA 1XKBC 1ELAA 3BIUH 2BZ6H 1UHBB 3RXMA 3JZ1B 2B5TB 1C5PA 1AB9B 1XM1A 1DS2E 2IOTA 1AE5A 1FAKH 2J92A 1GJBB 1G9IE 2VVUA 3ENSB 2LPRA 1GI4A 1A0JA 2HPQH 4X2XA 4JZEH 4X8VH 1Y3WA 3BTGE 5T6GA 2Q6DA 1O3GA 2GV7A 2J9NA 3UQOA 1LKBA 4MNXA 2BVSH 4A6LA 1SGDE 1NFXA 1W7GH 1V2LT 2JH6D 4DIHH 1Y5BT 3SUDA 4MNWA 3T2NA 2BDAA 5DP7A 2ZU3A 3E0NB 3SV6A 1OSSA 1RTFB 1BRBE 1A5GH 2GVFA 1PFXC 2OUAA 5SGAE 5E2PA 3A83A 1NRSH 3E16B 4YOJA 3ZZDA 1G37A 3LDXH 1CBWB 2P8OB 1DVAH 1QBNA 3BG4C 3ZVCA 1PQ8A 1DPOA 3SOSA 1A4WH 2ZO3H 4BXSA 2FI4E 1QRXA 1A7SA 2AMPA 3QZQA 4ABEA 1OWEA 1Q2WA 1TABE 4BAHB 1H9IE 4CBNA 2BD5A 2EEKA 2BD9A 2PWXA 4X8TH 2W5EA 2W7UA 1G3EA 1KXFA 4MDSA 1ELVA 2A31A 3RXRA 1F92A 5HGGA 1O2VA 2XW9A 1AKSB 3TH2H 1QB6A 3TPIZ 3QZRA 4CBOA 1F0TA 3SQHE 3TJOA 1P9UA 4ZKOU 1DICA 4KELA 4AGJA 1THPB 1MU6B 4UFEH 1BDAA 1TPAE 2ZHWH 5LPFA 4IC5A 1A46H 1FY3A 1QNJA 2SGQE 1C5MD 2F9PA 1ZPZA 1UVUH 1KYNA 3UWIA 5EG4A 3SUGA 8KME2 1NRNH 4FUEA 1NRQH 3SHCH 1GDQA 1FY5A 1ZPCA 1TBRH 3DT0H 4X0WU 3RXQA 4AYYB 5LGOA 1YYY1 3BSQA 1CGHA 1YP9A 2VIVA 2EI6A 3U9AH 2AGEX 2BX3A 1SMFE 5FPYA 4B2CA 3A8DA 1AB9C 1FIZA 2VWNA 4AFSA 1KDQB 4Q2KA 1LVMA 1MD8A 1M9UA 2CF9H 2D8WA 4YOIA 1FY4A 1QRWA 3HPTB 3WY8A 1DUAA 4BAQB 1ZYOA 1FDPA 1LVBA 3A8CA 1BMMH 3O8DA 1WBGB 2SFAA 4X6OA 3TH3H 1BTYA 2GCTB 1O2PA 4FUHA 1D3DB 3TJNA 3ZZ4A 1KTTB 2ZEBA 3MH6A 2EI8A 2ZI2H 3ESTA 1TGTA 2XYAA 1BOQA 2RDLA 5JBCS 1HCGA 1GBJA 3BF6H 3H7OA 3P92A 2HGTH 1ZR0A 1C5TA 2FTMA 4K1EA 2WPJS 4GHTA 3MWIU 3UPEA 1AQ7A 1RIWB 1CBWC 2P8OC 2UUJB 1MTNB 1KSNA 3QLPH 3T25A 4GVUA 1P57B 2XWBI 5HYOA 1S82A 3NPSA 4MTBA 1O31A 1SLXB 3BTWE 1CE5A 1Z1JA 2H6MA 4ZHAA 2H9TH 1P04A 1AO5A 1HJ9A 4WF8A 2P3UB 2BD8A 2FIRH 4B2BA 4DVAU 1EAWA 1O2SA 4BAMB 7KMEH 2PW8H 3RC4A 1OOKB 1SHYA 1G3CA 2C8YB 3SU0A 4DURA 2JKHA 1V2RT 2XBVA 1GMDG 1GI6A 2J2UA 1PJPA 1EKBB 1BMAA 1P0SH 1GBHA 1W8BH 2VIWA 1QQUA 1PPBH 1F0UA 3OSYA 4HZHA 2B9LA 5E0GA 1H9LB 3MTYA 1VITG 1SOZA 1VITH 2DE9A 2FS9A 3BTHE 3SV7A 1F2SE 1PPGE 2ZU2A 3I77A 1C1SA 4KTCA 6GCHG 4TY6A 5PTPA 2FX4A 1L1GA 1ZSJA 2C8ZB 3B23B 3GDSA 1JXPA 3A86A 1CA8B 3RMOH 2NWNA 2CHAB 2SGAA 1NT1A 4NA9H 1O5FH 1GJAB 2PFEA 2XNIA 1AVWA 3MO3A 1SGPE 1BRAA 2M5TA 4FVBA 1HFDA 4ZMAH 2FOMB 1DWBH 4Y7BA 1MQ6A 2GT7A 3D49H 2QF0A 1NRRH 1EAIA 1FIWA 1Y3UA 2XBXA 1D6WA 1DWCH 4XBCA 1O2XA 3EE0B 3GCTG 2UWLA 4Y0YE 1YPJH 5DP4A 3UREA 1EASA 3MH7A 3B8JA 1FONA 1DY8A 1O2LA 1P8VC 4DW2U 2O8TA 2FPZA 1ANEA 1P3EA 5EXLA 1BBRK 1C2IA 1BHXB 1SB1H 2GZ7A 2STAE 2BQ6B 1OP0A 3NZIA 3BEUA 1RIWC 1V2KT 1UVPA 4B1TA 4LXBH 2BDGA 3VXFH 1GGDB 1DOJA 3DUXH 2OXSA 2FOHA 1K1NA 1C2LA 1TIOA 3QUMP 8ESTE 3A84A 1UK4A 5AFYH 4MVNA 1KLIH 3SGBE 4E05H 2ZFQH 3ATKA 1TPSA 1E34B 3AW0A 1IAUA 2ZDVH 5FXLA 3LH3A 5C1XA 3RXFA 3TGKE 1V2TT 3BEIB 2ZHEH 4XE4A 1BA8B 5B6OA 4LZ1H 4JCNA 4YZUA 2ZCHP 1AVGH 1LHGH 1AGJA 1HJAC 1O35A 3MNCA 5EW1H 2Y5HA 1MAXA 3A87A 1UK3A 2J34A 3RLYH 1YLCA 3RU4E 1CA0B 3STJA 2P3FH 5EPNA 2Z9IA 2DUCA 3FVFB 1GDUA 1O3JA 3K6YA 2OTVA 1XX9A 3F9EA 3GICB 2H5DA 4WH8A 1LPZB 1ZHMA 3PMBB 3O8CA 3U8RH 3SBKA 4YT6H 5E0JA 3A88A 3UR9A 1PQAA 2BOHB 1W0ZU 2ZCLP 1GJ9B 1QL7A 4R0IA 3SJ9A 3T28A 2CHAC 1J8AA 1NZQH 2BTCE 2OC7A 4I8HA 1BMNH 1ANDA 3ZV8A 4IN1A 3LONA 2BVRH 1ANCA 1PPZA 1Z8IB 3SHAH 1N6YA 1S6HA 1GBCA 3GOVB 1O33A 1SQTA 3EAJA 1P02A 1QJ7B 1JOUB 1O2KA 1ZJKA 5A09A 4NFFA 1TPOA 2AMDA 1T8OA 4AG2A 5J4SA 2ZECA 4ISOA 2A4OA 3MNXA 3QWCH 4X6NA 2NU3E 3TVJB 1PYTD 4ESTE 2CXVA 1QB1A 2XC5A 3RXOA 1ZRKA 5ESBA 1GGDC 2FESH 2A7CA 1GDNA 1NPMA 1X7AC 2PTCE 3VB4A 1JMOH 2G5NA 4O3UA 2D2DA 1C4Y2 1SLWB 1L1JA 2STBE 2F3CE 1T31A 6CHAB 2PUXB 1C2HA 1RTKA 1THSH 1HXFH 2F91A 4LK4A 3ATLA 4CRFA 1C5ZB 1CSOE 2RG3A 3ELAH 2G4TA 2VVVA 5IYTA 1OWKA 2J38A 2H9HA 1UK2A 4K1TA 2Z94A 3KNXA 1ARCA 3RXPA 4R8TB 3P8OA 4FUIA 1CA0C 5GIBA 2VGCB 3UUZA 1O2GH 1S83A 2SNWA 4FU9A 3S9AA 4O97A 3RXEA 5JBBS 1P2NA 3B9FH 3HGPA 4K5ZA 5C1YA 3MNBA 1EJNA 1MKXH 3FFGA 3I78A 1Q3XA 1SGCA 1WSSH 2A45B 1QB9A 4INKA 1MAYA 2FM2A 2NU4E 1EJMA 4Q7ZA 4JZ1A 5JB8S 1KTSB 1QHRB 1YLDA 1GMCF 1EAUA 2AERH 9LPRA 2RA3A 1O3AA 1K1MA 2V3OH 1GBIA 2WV5A 1FV9A 1GBKA 1AFEH 2XC0A 1B5GH 1SL3A 3AAUA 3TJUA 2SGPE 3MI4A 4X2YA 1SFIA 3V7TA 4A1XA 5DP5A 1SGFA 1WQSA 4WMFA 2P94A 1T7CA 1G32B 1HAOH 1O2IA 3SU5A 3CENA 1SG8B 3PM3A 4LZ4B 2VIOA 4NIXA 3URDA 1O38A 2R2WU 1BHXF 2A32A 1C5VA 1OKXA 1P10A 1NO9H 3GY3A 4NIYA 1UHBA 3KL6A 5AVDA 3ZZBA 3BTDE 4OS7A 4DOQA 1ELBA 3LT3A 4XDEA 1ANBA 4D7GA 2SNVA 4DJZB 1A3EH 1KY9A 4AZ2B 1A0HB 6CHAC 2GX4A 4O3TA 3A7VA 2ULLA 5F8ZA 4ISNA 1EX3A 1O2NA 4AYVB 1UTKA 1C5YB 1F5LA 1NFWA 5EW2H 1C1TA 2V35A 3DFJA 1DSUA 3UY9A 4ZROA 4YT7H 1IQLA 4NG9H 1TFXA 1FMGA 3PYHA 1BRCE 2C4FH 2ILNA 3NCLA 3PMJA 4K2YA 2BY5X 4UEHH 3ZZ6A 4ISHH 3UQVA 1VCPA 4DGJA 4WJG2 2VGCC 1MTSA 2ZA5A 4HTCH 5AF9H 1LCYA 1O2TA 4HGCA 1GI3A 4YOGA 1G3DA 4TWWA 4AORA 1KLJH 1ID5H 1OWJA 3BG8A 4DIIH 2ZTZA 1MZAA 4Y8YA 1L2EA 1NESE 4X8SH 1V2MT 3VB7A 4X1QU 1ESTA 1DLEA 5TCAA 2D1JA 4ISLA 3GCOA 2A2XH 1EXFA 1FAXA 1GBMA 1TNLA 1AMHA 2F9BH 1C2GA 1OS8A 1HAXB 3SZNA 1K1JA 3SGQE 1S0RA 1CGIE 3T5FH 1SGEE 1AKSA 3DHKH 3RMNH 1GG6B 2VH0A 3M3TA 1LHDH 3BTTE 2YNAA 5E8EH 4Y79A 1CQQA 2TRMA 3ZZCA 1CT0E 1O36A 3SU3A 1OWIA 1IQEA 3M36A 4H6SB 4B71A 2HOBA 1CO7E 2BD7A 1P2KA 2VVCA 5A8XA 5AHGH 1BJUA 1NROH 2AS9A 4E7NA 1HDTH 4MPUA 1VCQA 3ZVGA 4ZHLU 2VB0A 4U2WA 2UWPA 1GHBG 3K2UA 1SGIB 1O3KA 1TNGA 2C90B 4FUJA 3E90B 4RKOB 1PPFE 2PV9B 1T8MA 1YC0A 3UIRA 1VZQH 2ZTXA 5GCHG 3DD2H 1O5DH 2CJIA 2TPIZ 1HXEH 5C1UA 1K1OA 2GTBA 4UE7H 5GXPA 1MZDA 7LPRA 3KIDU 4MPXA 2Z3EA 3K65B 3A7XA 2BB4A 4ZXXH 4I8LA 3RXBA 1NFYA 3BTFE 2WINI 1O2RA 4X2VA 1O30A 2P93A 1TA6A 1YPLH 2A5IA 5DK1A 3E91A 1V2JT 3MFJA 4J1YA 3S9BA 4GUXA 1UTOA 5E0HA 1GJ4H 1P2OA 4Y7AA 3ZVDA 4ABBA 2H5CA 5GJ4B 1CGJE 2AIPA 4ASHA 2XCFA 4CHAB 4GCHG 1ZSLA 3NK8A 4AN7A 2GMTB 1RS0A 3V12A 1A1RA 2ZDNA 1F7ZA 4X1RU 4X2WA 1A3BH 3RP2A 3VGCC 2ZGCA 1P2IA 3K6ZA 3RDZA 1QBVH 3KF2A 1XUHA 3BTKE 2LNCA 3TK6A 1A0LA 2OC0A 1EPTB 3LKWA 4WXIA 3U1JB 2ZFSA 4AOQA 1J16A 4CR9A 2CF8H 2I6SA 1SQOA 1CT4E 2AMQA 3A7YA 2TGPZ 1XUFA 2FOEA 1TMTH 1GG6C 3OY5U 4CR5A 1O2MA 1P12E 1UVOA 1IQMA 2ZDLA 1HYLA 1F5RA 2ZZUH 3HK6B 3ATWA 1DWEH 2FEQH 3R3GB 2J94A 3AVZA 2P16A 2FO9A 4TPIZ 1V2OT 4DY7B 5FCRA 1BTXA 1ELDE 4NA7A 1ZSKA 5EQQA 4A92A 3ZVAA 2ZGJA 4FUGA 2JETB 2ZFTA 4OS4A 1MD7A 1YPMH 2UWOA 1W12U 4BTUB 3TK9A 4I33A 1GMHG 4QT8C 1V2UT 3T26A 1SGQE 4CRCA 2ODPA 2P95A 3HK3B 3PTNA 3Q76A 3ATMA 1TNIA 2ZTYA 1RD3B 2FOFA 4WXVA 7ESTE 1AFQB 3A81A 1O34A 5A0CA 1EB1H 3SUFA 1NN6A 3HKIB 4AGKA 2P3TB 3S9CA 1U6QA 1O2HA 3MU4A 3SN8A 1C1OA 1GJDB 1H8DH 1BTWA 3RXKA 5FAHA 3MH5A 1YCPM 4H4FA 3K9XB 4B2AA 3SUEA 2A7JA 2FI5E 2PR3A 2SGFE 5C20A 1WTGH 3LOXA 1HAGE 3ZVFA 2QF3A 4CRAA 3R0FA 1OP8A 2QIQA 5L6NH 1GHAG 3FZZA 1UTMA 4AFZA 2OD3B 4Y8XA 3PB1E 4THNH 1P2JA 1ZLRA 1TAWA 1LHCH 4K60A 4CHAC 2OBQA 2FLRH 3LJJA 6GCHF 3FANA 2XRCA 2GMTC 4K3JA 3MNSA 2OC1A 3SGAE 1V2ST 1VJAU 1HRTH 1D4PB 1FPHH 5TJXA 1HJAB 3SJ8A 1DXPA 1EUFA 1O3NA 2BD3A 1JBUH 4ISIH 1BTZA 2A5AA 2R0LA 4INHA 1Y5AT 3Q00A 1XKAC 3MU5A 3OU0A 4JMYA 1GBFA 1HLTH 4CH2B 3SQEE 1EPTC 1O5CB 2ZPRA 5T3HA 3TU7H 1QR3E 1OXGA 1RFNA 2HLCA 2NU2E 3GCTF 4FUBA 1QJ6B 2C8WB 1FI8A 1E37B 1EJAA 1MCVA 3M3SA 3LGIA 4ABIA 3P8NA 3D62A 2ZQ1A 4JZFH 1P9SA 2H2ZA 4XSKU 3GY5A 1E0FD 1HIAA 1L0ZA 1C5UA 1E35B 1SHHB 1LVOA 2ANKH 1NU9A 1FNIA 2ZFRH 5IDKA 5BRRE 1C2KA 1C4U2 3TGIE 1HGTH 1SFQB 2Q1JA 4NA8A 3UOPA 3A7WA 1MKWH 1BZXE 1PPHE 3H7TA 3RXDA 1UTNA 4JZDH 1VR1H 2JETC 1HAZB 4IBLH 1MKWK 1MTWA 1IQGA 1D6RA 1UTLM 1UMAH 3STIA 1KXDA 2FS8A 3D65E 1Z7KA 1O5AB 1HV7A 1SI5H 1AFQC 1SGFG 2VINA 4BANB 1S0QA 2O8MA 1V2PT 4J2YB 2Y80A 4GSOA 1Q31A 3ZZAA 5TCCA 1TB6H 4K8YA 4KTSA 1YPHC 4NIVA 3SU4A 4MQAA 4XBDA 1CVWH 1ZTLA 5ETXA 4I7YH 1PYTC 2OP9A 5FBEA 3GYMA 1L4DA 3TGJE 1IHSH 1S84A 3GISB 2ALVA 2BXTH 1ZMNA 1QL9A 1T8NA 1O2JA 2NU0E 4IC6A 4NSYA 1HAYB 1P06A 4KP0A 3BN9A 2BQ7B 1TRYA 5JPMH 3LH1A 2BY7X 1IQJA 1EZSC 1ZGVA 4MPWA 4D8NA 2QXJA 2XXLA 1GJ6A 3Q3YA 1C9PA 2WV4A 1VCWA 2DE8A 1TMBH 1BUIA 2GD4B 1O3OA 2H1UA 1P2MA 3KCGH 2THFB 3MO9A 2BX4A 4KTUA 3LC5A 2TGTA 2Y5GA 4JYTA 3KQBA 4ZUHA 4Y6DA 2QY0B 2ZGBH 5EGMA 2C3SA 1YBWA 2AGIX 1G3BA 1UVTH 2PKSB 5I25A 1CHOG 2GCHG 1K9OE 2QGRA 1GHWH 2QXHA 3P6ZB 1ARBA 1C5WB 3TK5A 1TGNA 4B73A 2ZHQH 1Z6JH 1W11U 1WU1A 2ZGXH 2QYIA 3N7OA 1BCUH 3E3TA 1NRPH 1ZMLA 2G5VA 3AAVA 5DPAA 1C5NH 1QL8A 1ELFA 1UCYE 1W3CA 5FHTA 1SSXA 1BJVA 1O3EA 3CS7A 4YM9A 3QDZB 2VWLA 1K28D 1UO6A 1JRSA 2QC2A 1SLUB 1O3CA 3DFLA 1LO6A 3QN7A 1WTHD 3V0XA 2FDAA 2Q6FA 3A80A 1EATA 3SJOA 3UNRA 3A85A 4ZKRU 1KXBA 1DY9A 2BXUH 2FP7B 2PGQB 1UTQA 1AU8A 3M7QA 1TLDA 1XVOA 1HBTH 1SOTA 4LOYH 3ZZ3A 1C1QA 1D9IA 2G81E 1FZZA 4MLFB 2CV3A 4X6PA 1C5LH 2PSXA 4FVDA 1T4UH 1Y3VA 3M5NA 2G52A 1CU1A 2FYRA 2ANMH 2BLQA 3E0PB 1XMNB 3GY4A 1O5BB 3KEEA 2CN0H 3UNSA 3MU1A 4B75A 5C67A 3S7KB 3RM0H 3OY6U 1C2JA 1QFKH 1XUKA 2GT8A 3ITIA 3A7ZA 1TWXB 2FX6A 4D7FA 4JYVH 1O2WA 5DP3A 3KN2A 4YLUA 4X1NU 3QTOH 1XXFA 1D3QB 4UFGH 3SW2B 1IHTH 1WOFA 1LMWB 2HNTC 1JRTA 2J4IA 2Y6TA 1K2I1 2Z6BD 3SO3A 1J14A 2AEIH 5FPTA 3H5CB 3LGTA 1EZXC 3U8TH 3HATH 1A2CH 2PTNA 1GI0A 1N1LA 3SNCA 4WVPE 5CHAB 2TGDA 3P70B 3VB6A 1O2OA 3ATIA 1T8LA 1AE8H 2PKSC 1TQ0B 3QTVH 3VXEH 4YLQH 1MKXK 3PROA 2OCVB 3ZZ7A 3SJIA 6LPRA 4Y11E 1GI2A 2GDDA 2KAIB 3PO1B 3U1IB 3BTQE 1EAXA 1SGYE 5CMXH 1KLTA 1QQ4A 2AGGX 3GDVA 1BMLA 3FP6E 3OX7U 1Y3YA 1AUTC 5GDSH 5T6FA 1OYTH 5A8ZA 5LPRA 4MG3A 2R9PA 1LKAA 1GI9B 4CRGA 2Z3CA 1ZHRA 1O37A 1Z8GA 4E7RG 4FXGH 3UR6A 5EODA 1TGBA 3RXCA 4XFQA 1ESAA 2VH6A 2ZU4A 5DP6A 1GVKB 1PPEE 1YKTA 3RXUA 1WYKA 2PLXA 3GY2A 4IW4E 3QGNB 4YTAA 5JBAS 2ZU1A 1BQYA 5CE1A 3FP7E 2AIQA 2C8XB 3LGVA 1OX1A 8LPRA 3U69H 7GCHF 1AD8H 4XOJA 3UTUH 1ELGA 1AUJA 1GCTB 2ZDKA 1O2UA 3PV4A 2VNTA 1PQ7A 1AHTH 1C1NA 1IOEA 1Y5UT 3LGWA 1OP2A 1AZ8A 3RXGA 1O2ZA 4O03A 3SNEA 2ZU5A 1G2MA 1ESBA 1H4WA 5EQRA 1F0SA 2WPKS 2Y7ZA 2HNTF 1IQIA 3HGNA 5J4QA 3RXSA 2ESTE 1C1WH 1T4VH 3RU4T 1HAVB 1AVXA 1GL1A 3EA7A 1QRZA 1CT2E 1TYNA 2ODYB
chains in the Genus database with same CATH superfamily
2BLOA 5CHAC 2WUBA 2FMJA 3A7TA 4P02A 1C2MA 2FOBA 5FX5A 1P03A 4GHQA 3VGCB 2FOAA 2Y81A 3JZ2B 1IQNA 3U8OH 1FY1A 1HAPH 4IGDA 1S6FA 2PSYA 4FUCA 1UCYH 4A5TS 1H1BA 2ZFFH 4X1SU 4BOHA 1EB2A 1O3IA 2HVYB 1S6LA 4CH8B 2GKVE 1GHBF 3PO1C 1ETSH 1H9HE 4DCDA 1SGTA 2SGDE 3LGUA 4I31A 4RI0A 1IQFA 1ZJDA 2PUQH 1XVMA 5GCHF 2ZCKP 5LH8A 1RTLA 2ANYA 1ELTA 1HPGA 1YM0A 2ZFPH 4NCYA 1S85A 3H09A 1C1VH 1VGCB 1RXPA 3RC6A 3M7TA 1TGCA 3SI4H 1S5SA 1AI8H 4F49A 3UWJH 2HVXA 5F8XA 4AFQA 4H6TA 1D3PB 5GWZA 1AY6H 1F5KU 1SQAA 1V3XA 1A61H 2A2QH 1FPCH 3GY7A 1TBQH 1V2WT 2K0QA 1QCPA 2WPLS 3E8LA 3RXLA 1G30B 1Z8RA 3ZVBA 3A82A 2FOCA 1HNEE 1MTVA 2Z9KA 8GCHG 3LJOA 1ETTH 1GCTC 1V2NT 5IK2D 2W26A 2G55A 1KDQA 1GJ7B 2AYWA 2YMSB 4GCHF 4DG4A 1INCA 5K7RA 1IQKA 2PKAB 4TY7A 3G01A 4GAWA 1KXAA 4VGCB 1TQ7B 5H4IB 2B7DH 3KQCA 1QA0A 4YESB 1HAIH 1YGCH 3VB3A 4UFFH 1WCZA 1WV7H 3MOCA 2BM2A 1HB0B 4NZLA 3F9FA 1DT2A 1LHFH 1LTOA 2ZDAH 1ZHPA 4RKJB 1QURH 3EYDA 5A8YA 4NWLA 1TALA 2JJ1D 4NIWA 4B74A 2ZGHA 3GCHB 1BBRE 3E6PH 1DLKB 3UFAA 1NC6A 1YF4A 1JIMA 2O9QA 4KKDA 3T62A 1BIOA 1VJ9U 4IN2A 1O32A 3M7UA 3ZZ5A 5G4BA 1QZ8A 3S69A 4WWYA 3SV9A 1LHEH 4AFUA 1C2FA 5L2ZH 5EJ1A 2QCYA 3TNTA 1NY22 2R2MB 1HJ8A 1GWAA 3SORA 1GI8B 5BPEA 4I8JA 2QN5T 2D26C 2OLGA 3Q77A 2R3YA 2V6NA 4I32A 2ZDMA 1GBEA 1J15A 3IG6B 1GMHF 1TNJA 3TNSA 1C1MA 2GV6A 1UJ1A 3RMMH 3VG8A 2Y82A 3U98H 3LGYA 1BT7A 2F9OA 2TGAA 1GJCB 4NZQA 4JYUH 4AG1A 1QIXB 2IPHA 1Z71A 1LPGB 1BTUA 1W0YH 4D9QA 2ZPQA 1O3HA 3SNDA 1VGCC 4Y76A 4ACAA 3MHWU 2IJOB 5KGOA 1AZZA 1FQ3A 4AB9A 1P3CA 2V3HH 2VWOA 2PHBA 3VFEA 1G2LA 4BXWA 2XBYA 1N8OC 2BOKA 4Z6AH 2BD2A 1LQDB 1Y59T 4OS6A 3TJVA 2JH5D 1GHAF 2QAAA 4MNVA 1HUTH 4FU8A 2R3UA 2KCPA 3U28C 2G8TA 1GBAA 1TMUH 4K69A 3T27A 5EJLA 1O3LA 4NWKA 1TBZH 3PTBA 3RMLH 3PLBA 4INLA 2YMSC 1J17T 2B8OH 1DM4B 2BDBA 1W14U 3F9HA 2VIQA 1OWDA 4VGCC 3ZYEA 4WH6A 1GMDF 1DFPA 3M5LA 1P05A 3QK1A 1FN8A 3F6UH 1FLEE 1H8ED 3MYWA 3KQEA 1LPKB 3KQDA 4ABAA 1S81A 2HRVA 1FUJA 1DE7H 3RXHA 3RXVA 1P11E 2FZZA 3GCHC 1QJ1B 3EA9A 2W3IA 3SV8A 1O3DA 3RXTA 1VITF 5DP9A 2O8UA 2WYJA 2ZIQH 2I6QA 3M5OA 3GS9A 1V6DA 2FOGA 1P01A 4IMQA 4TWYA 2HPPH 5JBTA 3O8RA 2O8LA 2EA3A 3MO6A 1QY6A 1TOCB 4ZKNU 3V3MA 1A5IA 1XUJA 1RRKA 3VB5A 3ODFA 1MABB 2GZ9A 3IWMA 1GJ8B 1N6XA 5F6MA 2Z3DA 1ELEE 3QGJA 1C5OH 1DUEA 3RLWH 2WUCA 1FY8E 3M37A 4U01A 5E2OA 1TGSZ 1C5RA 1C2DA 2BVXH 2OK5A 1O3MA 2LELA 1TA2A 3RUOA 3ZZ9A 2RA0A 2A4RA 3TH4H 4OM9A 2BDCA 3A89A 4O9VA 2F83A 3C1KA 2OQ5A 2W3KA 3OTJE 1P2QA 2BY8X 2C93B 2Y7XA 1GBBA 4JK5A 2KCYA 3RXIA 2V7QD 2FLBH 3C27B 2P59A 3MU8A 3BTEE 3FP8E 5DN6D 1YPHE 4Q7YA 2TIOA 1O3BA 1QTFA 2GJGA 1Y8TA 2V0BA 4NSVA 5F03A 2BD4A 3RXAA 4CRBA 1C1RA 4Q7XA 1ABJH 2FXRA 3SU2A 5JDUB 4BAKB 3ZYDA 3OEHD 1UTJA 1O5EH 5DKMA 3LU9B 4MPVA 3I29A 1LQEA 1L4ZA 4E06H 3EA8A 1RGQA 3FAOA 4TYDA 2XTTB 5T6DA 1NBMD 2ZG0H 2FYQA 1F0RA 4A1VA 2WPIS 1B0FA 1TNHA 3LPRA 4NGAH 1KXEA 2A7HA 4B6FA 4D76A 3FZDA 2GCTC 1MTUA 5DJ7A 4X1PU 1UW7A 2UUYA 5FL7D 1E38B 2F9UA 2IN2A 1NM6A 3F68H 1GHYH 4ZH8A 3M3VA 4Y8ZA 1NFUA 1BBRH 1NU7B 1TONA 5EXNA 1MMJN 2ZP0H 2R0KA 2ASUB 1EP6A 2YOLA 3S7HB 5A2MH 2EC9H 3SNAA 4A1TA 3TLOA 4WMEA 3SU1A 1Z8JB 2G51A 1SR5C 1CHOF 2GCHF 2SGEE 3L33A 1K1PA 1O5GH 2OBOA 1MTNC 2FODA 1C2EA 2ZPSA 1FJSA 1C5XB 4H42U 1W7XH 3PWCA 1XXDA 2KM0A 4DT7B 4YO9A 1OWHA 1C1UH 4HI3A 4I8GA 4RT1A 5L2YH 3P8GA 3UOUA 2ZQ2A 1Z6EA 1PQ5A 5A0AE 4GLYA 2VJ1A 4Q80A 5HMAA 3W95A 1JIRA 2ZNKH 5JYIA 1C5SA 2H9EH 4I8KA 4OS2A 4ABFA 5EXMA 3SU6A 3MU0A 2ALPA 4U30A 1TX6A 2BMGB 9ESTA 2RCEA 2J95A 2QF5A 3ZV9A 1GHVH 1SPJA 1O39A 4GPGA 1ELCA 1O0DH 1B7XB 1EP5A 2G4UA 1HIAB 1TX8A 4TPYA 5L30H 1QA7A 1AN1E 4F48B 1LDTT 2XBWA 4IMZA 1D3TB 4ZXYH 1K1IA 2BQWB 1YPEH 4BNRA 3SNBA 1MU8B 3P17H 3PLKA 1BB0B 2G00A 3BEFB 1ETRH 1ZGIA 2F43B 2XC4A 3EQ0H 3F1SB 4OS1A 1G36A 3RM2H 3SI3H 1UVSH 2VU8E 4IS5A 2XCNA 3FOAA 4PROA 1KXCA 4M7GA 2GZ8A 2QXGA 2OC8A 4JK6A 2BDYA 1SGRE 3GY6A 3A8BA 5FCKA 4F4OC 2UUKB 1GHZA 1QGFA 4AX9H 5I46H 2HALA 3F0PA 4JZIA 2FI3E 1O2YA 2HNTE 2KAIA 1GI5A 1THRH 2EY4C 1XUIA 3SZEA 5HM9A 4FUFA 1EZUC 3MH4A 5ESTE 1UTPA 3DA9B 5FX6A 2Z9GA 5EQSA 1GBTA 1SC8U 2GGVB 3D23A 4K1SA 3EDXB 4SGBE 4OGXA 2ZHDA 1K22H 4HG6A 5EPYA 4UFDH 4WMDA 1FXYA 3PWBA 4BTTB 4Y10E 1ZTKA 5C5OA 1Z1IA 1E36B 2NU1E 4ZAEA 1W13U 3SV2H 1AIXH 2B0FA 4X6MA 1DWDH 2OINA 5DG6A 3ZVEA 2QA9E 3GCNA 1MH0A 1MCTA 3L3TA 4ZKSU 2F9VA 3ODDA 2VWMA 5K0HA 2GP9B 2VIDA 1TPPA 2OQUA 5EOKA 1NTPA 1MBMA 2W7SA 3GY8A 5DSFA 1BTHH 1BMFD 3MMGA 1V2QT 3UNQA 3L6PA 3QX5H 5C2ZA 3M35A 3RC5A 2BZAA 3W94A 5DGJA 3PMHB 2ZF0H 2WPHS 3URCA 2O8WA 3BTME 1PPCE 3NWUA 1SLVB 1GPZA 3NXPA 1YCPH 1ACBE 1XUGA 1W10U 1O2QA 4BAOB 3F3BA 4B76A 1WQVH 1GI7B 1YCPK 4FU7A 1OPHB 3PMAB 4MNYA 2JH0D 3BV9B 3M61U 3CP7A 1ABIH 5FBIA 1JWTA 2BHGA 5ABWA 2BLVA 1BTPA 4XBBA 1HAVA 2Y5FA 2L74A 2A1DB 3NKKA 1K21H 2WYGA 2A0QB 1FN6A 2FTLE 1ZPBA 3GYLB 1W0JD 4CRDA 2WV9A 1SKYE 1ZZZA 2Z9LA 1EOLA 4FOUC 4OGYA 3CS0A 1ORFA 4M9FA 4A7IB 3VPKA 2BDIA 1TX7A 2CGAA 3EGKH 5HXFA 5A0BA 3TITA 3F2GA 1OYQA 1AWFH 1V2VT 3OTPA 1GBDA 3RU4D 1LVYA 2M2AA 4RN6A 3HKJB 1TOMH 2YNBA 4ABDA 5EIYA 1NS3A 2A4GA 1B0EA 2K8IA 1DX5M 1MQ5A 2Z9JA 3TIUA 1GCDA 5C3NA 1SGNE 1BITA 3BIVH 1DANH 1IQHA 4WY3A 1QBOA 1O3PB 2AFQB 4BTIB 1MBQA 1RJXB 2KCAA 5C5NA 2TBSA 2XWAA 1DITH 3IITA 5C0TA 2BLWA 4Z0KA 3Q3KA 5JB9S 1Y3XA 1T32A 3W1EA 6ESTA 4SGAE 2WPMS 5FPSA 4ABGA 2GDEH 2AH4X 2ODQA 3OYPA 3KGPA 2F9NA 2A5KA 1C9TA 3KHVA 1GMCG 3O8BA 2VIPA 3E1XB 3F9GA 3P8FA 3QO6A 3VEQB 1ZTJA 3ZZ8A 4ABJA 2ZHFH 4U32A 3AK5A 1P09A 3GDUA 1WUNH 1TE0A 2L6OA 2ANWA 4Y71A 3KQ5A 2BY6X 4ASUD 4CREA 1EQ9A 4Z1MD 1L1NA 1TRNA 1CHGA 5HM2A 1AWHB 1TRMA 1GL0E 5GPIB 1GJ5H 1YPGH 2PKAA 4Q63A 1SVPA 3T29A 1TNKA 2UUFB 2EI7A 2BDHA 1KIGH 2FWWA 3V13A 4RSPA 5LPEA 1W2KH 5F8TA 3RXJA 3BG4B 1EOJA 4UD9H 1C5QA 4K8BA 3S0NA 3SJKA 2BYAX 2F4LA 1O3FA 2HWLB 4OS5A 4Y0ZE 1C4V2 2PGBB 1J9CH 1GBLA 5AFZH 1WAYB 2K1QA 3LC3A 3FO8D 1ZMJA 4ABHA 3P95A 1DSTA 1YPKH 7GCHG 4UONA 4X8UH 4D9RA 1GI1A 5DP8A 2ZKSA 4AB8A 1ZRBA 4KGAA 1MUEB 1EZQA 8GCHF 1UCYK 2ZC9H 4UDWH 1SBWA 3NUMA 2Q6GA 2A4QA 4FUDA 1C1PA 1ZOMA 3M5MA 4NFEA 2ZWLH 4ZHMU 2BY9X 1GHXH 2QXIA 3A8AA 1HAHH 3PLPA 5EU8A 1DXWA 3Q3XA 3AASA 1K1LA 1H8IH 1DDJA 3LIWA 4HFPB 2Z7FE 5HKKD 3AW1A 5DO4H 1A5HA 1EPTA 1GVLA 2QV1A 1GVZA 1N8OB 1BRUP 2CMYA 1XKBC 1ELAA 3BIUH 2BZ6H 1UHBB 3RXMA 3JZ1B 2B5TB 1C5PA 1AB9B 1XM1A 1DS2E 2IOTA 1AE5A 1FAKH 2J92A 1GJBB 1G9IE 3DSOA 2VVUA 3ENSB 2LPRA 1GI4A 1A0JA 2HPQH 4X2XA 4JZEH 4X8VH 1Y3WA 3BTGE 5T6GA 2Q6DA 1O3GA 2GV7A 2J9NA 3ZIAD 3UQOA 1LKBA 4MNXA 2V3MA 2BVSH 4A6LA 1SGDE 1NFXA 1W7GH 1V2LT 2JH6D 4DIHH 1Y5BT 3SUDA 4F55A 4MNWA 3T2NA 2BDAA 5DP7A 2ZU3A 3E0NB 3SV6A 1OSSA 1RTFB 1BRBE 1A5GH 2GVFA 1PFXC 2OUAA 5SGAE 5E2PA 3A83A 1NRSH 3E16B 2J5UA 4YOJA 3ZZDA 1G37A 3LDXH 5EJZA 3WWBA 1CBWB 2P8OB 3F2FA 1DVAH 3PRBA 1QBNA 3BG4C 3ZVCA 1PQ8A 1DPOA 3SOSA 1A4WH 2ZO3H 4BXSA 2FI4E 1QRXA 1A7SA 2AMPA 3QZQA 4ABEA 1OWEA 1Q2WA 1TABE 4BAHB 1H9IE 4CBNA 2BD5A 2EEKA 2BD9A 2PWXA 4X8TH 2W5EA 2W7UA 1G3EA 1KXFA 1W0KD 4MDSA 1ELVA 2A31A 3RXRA 1F92A 5HGGA 1O2VA 2XW9A 1AKSB 2RDEA 3TH2H 1QB6A 3TPIZ 3QZRA 1OHHD 4CBOA 1F0TA 1COWD 3SQHE 3TJOA 1P9UA 4ZKOU 1DICA 4KELA 4AGJA 1THPB 1MU6B 4UFEH 1BDAA 1TPAE 2ZHWH 5LPFA 4IC5A 4TSFD 1A46H 1FY3A 1QNJA 2SGQE 1C5MD 2F9PA 1ZPZA 1UVUH 1KYNA 3UWIA 5EG4A 2KX4A 3SUGA 8KME2 1NRNH 4FUEA 1NRQH 3SHCH 1GDQA 1FY5A 1ZPCA 1TBRH 3DT0H 4X0WU 3RXQA 4AYYB 5LGOA 3N7DA 1YYY1 3BSQA 1CGHA 1YP9A 2VIVA 2EI6A 3U9AH 2AGEX 2BX3A 1SMFE 5FPYA 4B2CA 2JDID 1AB9C 1FIZA 2VWNA 3A8DA 4AFSA 1KDQB 4Q2KA 1LVMA 1MD8A 1M9UA 2CF9H 2D8WA 4YOIA 1FY4A 1QRWA 3HPTB 3WY8A 1DUAA 4BAQB 1ZYOA 1FDPA 1LVBA 3A8CA 1BMMH 3O8DA 1WBGB 2SFAA 4X6OA 3TH3H 1BTYA 2GCTB 1O2PA 4FUHA 1D3DB 3TJNA 3ZZ4A 1KTTB 2ZEBA 3MH6A 2EI8A 2ZI2H 3ESTA 1TGTA 2XYAA 1BOQA 2RDLA 5JBCS 1HCGA 1GBJA 3BF6H 3H7OA 3P92A 2HGTH 1ZR0A 1C5TA 2FTMA 4K1EA 2WPJS 4GHTA 2WSSD 3MWIU 2LP6A 3UPEA 1AQ7A 1RIWB 1CBWC 2P8OC 2UUJB 1MTNB 1KSNA 3QLPH 5GNDA 3T25A 4GVUA 1P57B 2XWBI 5HYOA 1S82A 3NPSA 4MTBA 1O31A 1SLXB 3BTWE 1CE5A 1Z1JA 2H6MA 4ZHAA 2H9TH 1P04A 1AO5A 1HJ9A 4WF8A 2P3UB 2BD8A 2FIRH 4B2BA 4DVAU 1EAWA 1O2SA 4BAMB 7KMEH 2PW8H 3RC4A 1OOKB 1SHYA 1G3CA 4AC9A 2C8YB 3SU0A 4DURA 2JKHA 1V2RT 2XBVA 1GMDG 1E1QD 3F2HA 1GI6A 2J2UA 2W6JD 1PJPA 1EKBB 1BMAA 1P0SH 1YLNA 1GBHA 1W8BH 2VIWA 1QQUA 1PPBH 1F0UA 3OSYA 4HZHA 2B9LA 3OFND 5E0GA 1H9LB 3MTYA 1VITG 1SOZA 1VITH 2DE9A 2FS9A 3BTHE 3SV7A 2AHME 1F2SE 1PPGE 2ZU2A 3I77A 1C1SA 4KTCA 6GCHG 4TY6A 5PTPA 2FX4A 1L1GA 1ZSJA 2C8ZB 3B23B 3GDSA 1JXPA 3A86A 1CA8B 3RMOH 2NWNA 2CHAB 2SGAA 2EQNA 1NT1A 4NA9H 1O5FH 1GJAB 2PFEA 2XNIA 1AVWA 3MO3A 1SGPE 1BRAA 2M5TA 4FVBA 1HFDA 4ZMAH 2FOMB 1DWBH 4Y7BA 1MQ6A 2GT7A 3D49H 2QF0A 1NRRH 1EAIA 1FIWA 1Y3UA 2XBXA 1D6WA 1DWCH 4XBCA 1O2XA 3EE0B 3GCTG 2UWLA 4Y0YE 1YPJH 5DP4A 3UREA 1EASA 3MH7A 3B8JA 1FONA 1DY8A 1O2LA 1P8VC 4DW2U 2O8TA 2FPZA 1ANEA 1P3EA 5EXLA 1BBRK 2XOKD 1C2IA 1BHXB 1SB1H 2GZ7A 2STAE 2BQ6B 1OP0A 3NZIA 2JJ2D 3BEUA 1RIWC 1V2KT 1UVPA 4B1TA 4LXBH 2BDGA 3VXFH 3MQKC 1GGDB 1DOJA 3DUXH 2OXSA 2FOHA 1K1NA 1C2LA 1TIOA 3QUMP 8ESTE 3A84A 1UK4A 5AFYH 4MVNA 1KLIH 3SGBE 5B6LA 4E05H 2ZFQH 3ATKA 1TPSA 1E34B 3AW0A 2KZ4A 1IAUA 2IPQX 2ZDVH 5FXLA 3LH3A 5C1XA 3DSPA 3RXFA 3TGKE 1V2TT 3BEIB 2ZHEH 4XE4A 1BA8B 5B6OA 3OEED 4LZ1H 4JCNA 4YZUA 2ZCHP 1AVGH 1LHGH 1AGJA 1HJAC 1O35A 3MNCA 5EW1H 2Y5HA 1MAXA 3A87A 1UK3A 2J34A 3RLYH 1YLCA 3RU4E 1CA0B 3STJA 2P3FH 5EPNA 2Z9IA 2DUCA 3FVFB 1GDUA 1O3JA 3K6YA 2OTVA 1XX9A 3OAAD 3EE7A 3F9EA 3GICB 2H5DA 4WH8A 1LPZB 1ZHMA 3PMBB 3O8CA 3U8RH 3SBKA 4YT6H 5E0JA 3A88A 3UR9A 1PQAA 2BOHB 3CNRA 1W0ZU 2ZCLP 3UAIC 1K0HA 1GJ9B 3DCLA 1QL7A 4R0IA 3SJ9A 3T28A 2CHAC 1J8AA 1NZQH 2BTCE 2OC7A 4I8HA 1BMNH 5CHBA 1ANDA 3ZV8A 4IN1A 3LONA 2BVRH 1ANCA 1PPZA 1Z8IB 3SHAH 1N6YA 1S6HA 1GBCA 3GOVB 1O33A 1SQTA 3EAJA 1P02A 1QJ7B 1JOUB 1O2KA 2KR7A 1ZJKA 5A09A 4NFFA 1TPOA 2AMDA 1T8OA 4AG2A 5J4SA 2ZECA 4ISOA 2A4OA 3MNXA 3QWCH 4X6NA 2NU3E 3TVJB 1PYTD 4ESTE 2CXVA 1QB1A 2XC5A 3RXOA 1ZRKA 4I86A 5ESBA 3PV2A 1GGDC 2FESH 2A7CA 1GDNA 1NPMA 1X7AC 2PTCE 3VB4A 1JMOH 2G5NA 4O3UA 2D2DA 1C4Y2 1SLWB 1L1JA 2STBE 2F3CE 1T31A 6CHAB 2PUXB 1C2HA 1RTKA 1SQRA 1HXFH 1THSH 2F91A 4ACBA 4LK4A 3ATLA 4CRFA 1C5ZB 1CSOE 2RG3A 3ELAH 2G4TA 2VVVA 5IYTA 1OWKA 2IJD1 2J38A 2H9HA 1UK2A 4K1TA 2Z94A 3KNXA 1ARCA 3RXPA 4R8TB 2J98A 3P8OA 4FUIA 1CA0C 5GIBA 2VGCB 3UUZA 2CK3D 1O2GH 1S83A 2SNWA 4FU9A 3S9AA 4O97A 3RXEA 5JBBS 1P2NA 3B9FH 3HGPA 4K5ZA 5C1YA 2W6ID 3MNBA 1EJNA 1WDIA 1MKXH 3FFGA 3I78A 1Q3XA 1SGCA 1WSSH 2A45B 1QB9A 4INKA 1MAYA 2FM2A 2NU4E 1EJMA 2WHXA 4Q7ZA 4JZ1A 5JB8S 1KTSB 1QHRB 1YLDA 1GMCF 1H8HD 1EAUA 2AERH 9LPRA 2RA3A 1O3AA 1K1MA 2V3OH 1GBIA 2WV5A 1FV9A 1GBKA 4XRNA 1AFEH 2XC0A 1B5GH 1SL3A 3N99A 3AAUA 3TJUA 2SGPE 3MI4A 4X2YA 1SFIA 3V7TA 4A1XA 5DP5A 1SGFA 1WQSA 2WZQA 1YWUA 4WMFA 2P94A 1T7CA 1FX0B 1G32B 1HAOH 1O2IA 3SU5A 3CENA 1SG8B 3PM3A 4LZ4B 2VIOA 4NIXA 5C94A 3URDA 4YXWD 1O38A 2R2WU 1BHXF 2A32A 5KEDA 1C5VA 5C0UA 1OKXA 1P10A 1NO9H 3GY3A 4NIYA 1UHBA 3KL6A 5AVDA 3ZZBA 3OE7D 3BTDE 4OS7A 4DOQA 1ELBA 3LT3A 4XDEA 1ANBA 4D7GA 2SNVA 4DJZB 4XD7D 1A3EH 1KY9A 4AZ2B 1A0HB 6CHAC 2GX4A 4O3TA 3A7VA 2ULLA 3N7EA 5F8ZA 4ISNA 1EX3A 1O2NA 4AYVB 1UTKA 1C5YB 1F5LA 1NFWA 5EW2H 1C1TA 2V35A 3DFJA 1DSUA 3UY9A 4ZROA 4YT7H 1IQLA 4NG9H 1TFXA 1FMGA 3PYHA 1BRCE 2C4FH 2ILNA 3NCLA 3PMJA 4K2YA 2BY5X 4UEHH 3ZZ6A 4ISHH 3UQVA 1VCPA 4DGJA 4WJG2 2VGCC 1MTSA 2ZA5A 4HTCH 5AF9H 1LCYA 1O2TA 4HGCA 1GI3A 4YOGA 3PRDA 1G3DA 4TWWA 4AORA 1KLJH 1ID5H 1OWJA 3BG8A 4DIIH 2ZTZA 1MZAA 3KYGA 4Y8YA 1L2EA 1NESE 4X8SH 1V2MT 3VB7A 4X1QU 1ESTA 1DLEA 5T1VA 5TCAA 2D1JA 4ISLA 3GCOA 2A2XH 1EXFA 1FAXA 1GBMA 1TNLA 1AMHA 2F9BH 1C2GA 1OS8A 1HAXB 3SZNA 1K1JA 3SGQE 1S0RA 1CGIE 3T5FH 1SGEE 1AKSA 2XNDD 3DHKH 3RMNH 1GG6B 2VH0A 2WPDD 3M3TA 1LHDH 3BTTE 2YNAA 5E8EH 4Y79A 1CQQA 2TRMA 3ZZCA 1CT0E 1O36A 3SU3A 1OWIA 1IQEA 3M36A 4H6SB 2VBCA 4B71A 2HOBA 1CO7E 2BD7A 1P2KA 2VVCA 5A8XA 1EFRD 5AHGH 1BJUA 1NROH 2AS9A 4E7NA 1HDTH 4MPUA 1VCQA 3ZVGA 3UB0A 4ZHLU 2VB0A 4U2WA 2UWPA 2QF4A 1GHBG 3K2UA 1SGIB 1O3KA 3FN8A 1TNGA 2C90B 4FUJA 3E90B 4RKOB 1PPFE 2PV9B 1T8MA 1YC0A 3UIRA 1VZQH 2ZTXA 5GCHG 3DD2H 1O5DH 2CJIA 2TPIZ 1HXEH 5C1UA 1K1OA 2GTBA 4UE7H 5GXPA 1MZDA 7LPRA 3KIDU 4MPXA 2Z3EA 3K65B 3A7XA 2BB4A 4ZXXH 4I8LA 5HIYA 3RXBA 1NFYA 3BTFE 2WINI 1O2RA 4X2VA 1O30A 2P93A 1TA6A 1YPLH 2A5IA 5DK1A 3E91A 1V2JT 3MFJA 4J1YA 3S9BA 4GUXA 1UTOA 5E0HA 1GJ4H 1P2OA 2PP6A 4Y7AA 3ZVDA 2H5CA 4ABBA 5GJ4B 1CGJE 2AIPA 4ASHA 2XCFA 4CHAB 4GCHG 1ZSLA 3NK8A 4AN7A 2GMTB 1RS0A 1E1RD 3V12A 1A1RA 2ZDNA 1F7ZA 4X1RU 4X2WA 1A3BH 3RP2A 3VGCC 2ZGCA 1P2IA 3K6ZA 3RDZA 1QBVH 3KF2A 1XUHA 3BTKE 2LNCA 3TK6A 1A0LA 2OC0A 1EPTB 3LKWA 1NBME 3DSGA 4P00A 4WXIA 3U1JB 2ZFSA 4AOQA 1J16A 4CR9A 2CF8H 2I6SA 1SQOA 1CT4E 4ZCNA 4FETA 2KFWA 2AMQA 3A7YA 2TGPZ 3KYFA 1WXRA 1XUFA 2FOEA 1TMTH 1GG6C 3OY5U 4CR5A 1VKYA 1O2MA 1P12E 1UVOA 1IQMA 2ZDLA 1HYLA 1F5RA 2ZZUH 3HK6B 3ATWA 1DWEH 2FEQH 3R3GB 2J94A 3AVZA 3PV5A 2P16A 2FO9A 4TPIZ 1V2OT 4DY7B 5FCRA 1BTXA 1ELDE 4NA7A 1ZSKA 5EQQA 4A92A 3ZVAA 2ZGJA 4FUGA 2JETB 2ZFTA 4OS4A 1MD7A 1YPMH 2UWOA 1W12U 4B6EA 4BTUB 3TK9A 4I33A 1GMHG 4QT8C 1V2UT 3T26A 1SGQE 4CRCA 2ODPA 2P95A 3HK3B 3PTNA 3Q76A 3ATMA 1TNIA 2ZTYA 1RD3B 2FOFA 4WXVA 7ESTE 1AFQB 3A81A 1O34A 5A0CA 1EB1H 3SUFA 1NN6A 3SYJA 3HKIB 4AGKA 2P3TB 3S9CA 1U6QA 1O2HA 3MU4A 3SN8A 1C1OA 1GJDB 1H8DH 1BTWA 3RXKA 5FAHA 3MH5A 1YCPM 4H4FA 3K9XB 4B2AA 3SUEA 2A7JA 2FI5E 2PR3A 2SGFE 5C20A 1WTGH 3LOXA 1HAGE 3ZVFA 2QF3A 4CRAA 3R0FA 1OP8A 2QIQA 5L6NH 1GHAG 3FZZA 1UTMA 4AFZA 2OD3B 4Y8XA 3PB1E 5CDFE 4THNH 1P2JA 1ZLRA 1TAWA 1LHCH 4K60A 4CHAC 2OBQA 2FLRH 3LJJA 6GCHF 3FANA 2XRCA 2GMTC 4K3JA 3MNSA 2OC1A 3SGAE 1V2ST 1VJAU 1HRTH 1D4PB 1FPHH 4TT3D 5TJXA 1HJAB 3SJ8A 1KMHB 1DXPA 1EUFA 1O3NA 2BD3A 1JBUH 4ISIH 1BTZA 2A5AA 2R0LA 4INHA 1Y5AT 3Q00A 1XKAC 3MU5A 3OU0A 4JMYA 1GBFA 1HLTH 4CH2B 3SQEE 1EPTC 1O5CB 2ZPRA 5T3HA 3TU7H 1QR3E 1OXGA 1RFNA 2HLCA 2NU2E 3GCTF 4FUBA 1QJ6B 2C8WB 1FI8A 1E37B 1EJAA 1MCVA 3M3SA 3LGIA 4ABIA 3P8NA 3D62A 2ZQ1A 4JZFH 1P9SA 2H2ZA 4XSKU 3GY5A 1E0FD 1HIAA 1L0ZA 1C5UA 1E35B 1SHHB 1LVOA 2ANKH 1NU9A 1FNIA 2ZFRH 5IDKA 5BRRE 1C2KA 1C4U2 3TGIE 1HGTH 1SFQB 2Q1JA 4NA8A 2YMSD 3UOPA 3A7WA 1MKWH 1BZXE 1PPHE 3H7TA 3RXDA 1UTNA 4JZDH 1VR1H 2JETC 1HAZB 4IBLH 1MKWK 1MTWA 1YY3A 1IQGA 1D6RA 1UTLM 1UMAH 3STIA 1KXDA 2FS8A 3D65E 1Z7KA 1O5AB 1HV7A 1SI5H 1AFQC 1SGFG 2VINA 4BANB 1S0QA 2O8MA 1V2PT 4J2YB 2Y80A 4GSOA 1Q31A 3ZZAA 5TCCA 1TB6H 4K8YA 4KTSA 1YPHC 4NIVA 3SU4A 4MQAA 4XBDA 1CVWH 1ZTLA 5ETXA 4I7YH 1PYTC 2OP9A 5FBEA 3GYMA 1L4DA 3TGJE 1IHSH 1S84A 3GISB 2ALVA 2BXTH 1ZMNA 1QL9A 1T8NA 1O2JA 2NU0E 4IC6A 2RFKC 4NSYA 1HAYB 1P06A 4KP0A 3BN9A 2BQ7B 1TRYA 5JPMH 4RT0A 3LH1A 2BY7X 1IQJA 1EZSC 1ZGVA 4MPWA 4D8NA 2J97A 2QXJA 2XXLA 1GJ6A 3Q3YA 1C9PA 2WV4A 3FKSD 1VCWA 2DE8A 1TMBH 1BUIA 2GD4B 1O3OA 2H1UA 1P2MA 3KCGH 2THFB 3MO9A 2BX4A 4KTUA 3LC5A 2TGTA 2Y5GA 4JYTA 3KQBA 4ZUHA 4Y6DA 2QY0B 2ZGBH 5EGMA 2C3SA 1YBWA 2AGIX 1G3BA 1UVTH 2PKSB 5I25A 1CHOG 2GCHG 1K9OE 2QGRA 1GHWH 2QXHA 3P6ZB 1ARBA 1C5WB 3TK5A 1TGNA 4B73A 2ZHQH 1Z6JH 1W11U 1WU1A 2ZGXH 2QYIA 3N7OA 1BCUH 3E3TA 1NRPH 1ZMLA 2G5VA 3AAVA 5DPAA 1C5NH 1QL8A 1ELFA 1UCYE 1W3CA 5FHTA 1SSXA 1BJVA 1O3EA 3CS7A 4YM9A 3QDZB 2VWLA 1K28D 1UO6A 1JRSA 2QC2A 1SLUB 1O3CA 3DFLA 1LO6A 3QN7A 1WTHD 3V0XA 2FDAA 2Q6FA 3A80A 1EATA 3SJOA 3UNRA 3A85A 4ZKRU 1KXBA 1DY9A 2BXUH 2FP7B 2PGQB 1UTQA 1AU8A 3M7QA 1TLDA 1XVOA 1HBTH 1SOTA 4LOYH 3ZZ3A 3NRLA 1C1QA 5KECA 1D9IA 2G81E 1FZZA 4MLFB 2CV3A 4X6PA 1C5LH 2PSXA 4FVDA 1T4UH 1Y3VA 3M5NA 2G52A 1CU1A 2FYRA 2ANMH 2BLQA 3E0PB 1XMNB 3GY4A 1O5BB 3KEEA 2CN0H 3UNSA 3MU1A 4B75A 5C67A 3S7KB 3RM0H 3OY6U 1C2JA 1QFKH 1XUKA 2GT8A 5C17A 3ITIA 3A7ZA 1TWXB 2FX6A 4D7FA 4JYVH 1O2WA 5DP3A 3KN2A 4YLUA 4X1NU 3QTOH 1XXFA 1D3QB 4UFGH 3SW2B 1IHTH 1WOFA 1LMWB 2HNTC 1JRTA 2J4IA 2Y6TA 1K2I1 2Z6BD 3SO3A 1J14A 5HIZA 2AEIH 5FPTA 3H5CB 3LGTA 1EZXC 3U8TH 3HATH 1A2CH 2PTNA 1GI0A 1N1LA 3SNCA 4WVPE 5CHAB 2TGDA 3P70B 3VB6A 1O2OA 1E79D 3ATIA 1T8LA 5F53A 1AE8H 2PKSC 1TQ0B 3QTVH 3VXEH 4YLQH 1MKXK 3PROA 2OCVB 3ZZ7A 3SJIA 2HLDD 6LPRA 4Y11E 1GI2A 2GDDA 2JIZD 2KAIB 3PO1B 3U1IB 3BTQE 1EAXA 1SGYE 5CMXH 1KLTA 1QQ4A 2AGGX 3F0OA 3GDVA 1BMLA 3FP6E 3OX7U 1Y3YA 1AUTC 5GDSH 5T6FA 1OYTH 3WWFA 5A8ZA 5LPRA 4MG3A 2R9PA 1LKAA 1GI9B 4CRGA 2Z3CA 1ZHRA 1O37A 1Z8GA 4E7RG 4FXGH 3UR6A 5EODA 1TGBA 3RXCA 4XFQA 1ESAA 2VH6A 2ZU4A 5DP6A 1GVKB 1PPEE 1YKTA 3RXUA 1WYKA 2PLXA 3GY2A 4IW4E 3QGNB 4YTAA 5JBAS 2ZU1A 1BQYA 5CE1A 3FP7E 2AIQA 2C8XB 3LGVA 4Q4LA 1OX1A 8LPRA 3U69H 7GCHF 1AD8H 4XOJA 3UTUH 1ELGA 1AUJA 1GCTB 2ZDKA 1O2UA 3PV4A 2QE7D 2VNTA 1PQ7A 1AHTH 1C1NA 1IOEA 1Y5UT 3LGWA 1OP2A 1AZ8A 3RXGA 3WW7A 1O2ZA 4O03A 3SNEA 2ZU5A 1G2MA 2KCOA 1ESBA 1H4WA 5EQRA 1F0SA 2WPKS 2Y7ZA 2HNTF 1IQIA 3HGNA 5J4QA 3RXSA 2J98B 2ESTE 4DT4A 1C1WH 1T4VH 3RU4T 1HAVB 1AVXA 1GL1A 3EA7A 1QRZA 1CT2E 1TYNA 2ODYB
chains in the Genus database with same CATH topology
2BLOA 5CHAC 2WUBA 2FMJA 3A7TA 1C2MA 2FOBA 5FX5A 1P03A 4GHQA 3VGCB 2FOAA 2Y81A 3JZ2B 1IQNA 3U8OH 1FY1A 1HAPH 4IGDA 1S6FA 2PSYA 4FUCA 1UCYH 4A5TS 1H1BA 2ZFFH 4X1SU 4BOHA 1EB2A 1O3IA 4CH8B 2GKVE 1GHBF 3PO1C 1ETSH 1H9HE 4DCDA 1SGTA 2SGDE 3LGUA 4I31A 1IQFA 1ZJDA 2PUQH 1XVMA 5GCHF 2ZCKP 5LH8A 1RTLA 2ANYA 1ELTA 1HPGA 1YM0A 2ZFPH 4NCYA 1S85A 1C1VH 1VGCB 1RXPA 3RC6A 3M7TA 1TGCA 3SI4H 1S5SA 1AI8H 4F49A 3UWJH 2HVXA 5F8XA 4AFQA 4H6TA 1D3PB 5GWZA 1AY6H 1F5KU 1SQAA 1V3XA 1A61H 2A2QH 1FPCH 3GY7A 1TBQH 1V2WT 3RXLA 1QCPA 2WPLS 3E8LA 1G30B 1Z8RA 3ZVBA 3A82A 2FOCA 1HNEE 1MTVA 2Z9KA 8GCHG 3LJOA 1ETTH 1GCTC 1V2NT 2W26A 2G55A 1KDQA 1GJ7B 2AYWA 4GCHF 4DG4A 1INCA 5K7RA 1IQKA 2PKAB 4TY7A 3G01A 4GAWA 1KXAA 4VGCB 1TQ7B 5H4IB 2B7DH 3KQCA 1QA0A 4YESB 1HAIH 1YGCH 3VB3A 4UFFH 1WCZA 1WV7H 3MOCA 2BM2A 1HB0B 4NZLA 3F9FA 1DT2A 1LHFH 1LTOA 2ZDAH 1ZHPA 4RKJB 1QURH 3EYDA 5A8YA 4NWLA 1TALA 4NIWA 4B74A 2ZGHA 3GCHB 1BBRE 3E6PH 1DLKB 3UFAA 1NC6A 1YF4A 1JIMA 2O9QA 4KKDA 3T62A 1BIOA 1VJ9U 4IN2A 1O32A 3M7UA 3ZZ5A 5G4BA 3S69A 4WWYA 3SV9A 1LHEH 4AFUA 1C2FA 5L2ZH 2QCYA 3TNTA 1NY22 2R2MB 1HJ8A 1GWAA 3SORA 1GI8B 5BPEA 4I8JA 2QN5T 2D26C 2OLGA 3Q77A 2R3YA 2V6NA 4I32A 2ZDMA 1GBEA 1J15A 3IG6B 1GMHF 1TNJA 3TNSA 1C1MA 2GV6A 1UJ1A 3RMMH 2Y82A 3U98H 3LGYA 1BT7A 2F9OA 2TGAA 1GJCB 4NZQA 4JYUH 4AG1A 1QIXB 2IPHA 1Z71A 1LPGB 1BTUA 1W0YH 4D9QA 2ZPQA 1O3HA 3SNDA 1VGCC 4Y76A 3MHWU 2IJOB 1AZZA 1FQ3A 4AB9A 1P3CA 2V3HH 2VWOA 2PHBA 3VFEA 1G2LA 4BXWA 2XBYA 1N8OC 2BOKA 4Z6AH 2BD2A 1LQDB 1Y59T 4OS6A 3TJVA 2JH5D 1GHAF 2QAAA 4MNVA 1HUTH 4FU8A 2R3UA 2G8TA 1GBAA 1TMUH 4K69A 3T27A 1O3LA 4NWKA 1TBZH 3PTBA 3RMLH 3PLBA 4INLA 1J17T 2B8OH 1DM4B 2BDBA 1W14U 3F9HA 2VIQA 1OWDA 4VGCC 3ZYEA 4WH6A 1GMDF 1DFPA 3M5LA 1P05A 3QK1A 1FN8A 3F6UH 1FLEE 3MYWA 3KQEA 1LPKB 3KQDA 4ABAA 1S81A 2HRVA 1FUJA 1DE7H 3RXHA 3RXVA 1P11E 2FZZA 3GCHC 1QJ1B 3EA9A 2W3IA 3SV8A 1O3DA 3RXTA 1VITF 5DP9A 2O8UA 2WYJA 2ZIQH 2I6QA 3M5OA 1V6DA 2FOGA 1P01A 4IMQA 4TWYA 2HPPH 5JBTA 3O8RA 2O8LA 2EA3A 3MO6A 1QY6A 1TOCB 4ZKNU 3V3MA 1A5IA 1XUJA 1RRKA 3VB5A 3ODFA 2GZ9A 3IWMA 1GJ8B 1N6XA 5F6MA 2Z3DA 1ELEE 3QGJA 1C5OH 1DUEA 3RLWH 2WUCA 1FY8E 3M37A 4U01A 5E2OA 1TGSZ 1C5RA 1C2DA 2BVXH 1O3MA 1TA2A 3RUOA 3ZZ9A 2RA0A 2A4RA 3TH4H 2BDCA 3A89A 4O9VA 2F83A 3C1KA 2OQ5A 2W3KA 3OTJE 1P2QA 2BY8X 2C93B 2Y7XA 1GBBA 4JK5A 3RXIA 2FLBH 3C27B 2P59A 3MU8A 3BTEE 3FP8E 1YPHE 4Q7YA 2TIOA 1O3BA 1QTFA 1Y8TA 2V0BA 4NSVA 5F03A 2BD4A 3RXAA 4CRBA 1C1RA 4Q7XA 1ABJH 2FXRA 3SU2A 5JDUB 4BAKB 3ZYDA 1UTJA 1O5EH 5DKMA 3LU9B 4MPVA 3I29A 1LQEA 1L4ZA 4E06H 3EA8A 1RGQA 3FAOA 4TYDA 2XTTB 5T6DA 2ZG0H 2FYQA 1F0RA 4A1VA 2WPIS 1B0FA 1TNHA 3LPRA 4NGAH 1KXEA 2A7HA 4D76A 3FZDA 2GCTC 1MTUA 5DJ7A 4X1PU 2UUYA 1E38B 2F9UA 2IN2A 1NM6A 3F68H 1GHYH 4ZH8A 3M3VA 4Y8ZA 1NFUA 1BBRH 1NU7B 1TONA 5EXNA 1MMJN 2ZP0H 2R0KA 2ASUB 1EP6A 2YOLA 3S7HB 5A2MH 2EC9H 3SNAA 4A1TA 3TLOA 4WMEA 3SU1A 1Z8JB 2G51A 1SR5C 1CHOF 2GCHF 2SGEE 3L33A 1K1PA 1O5GH 2OBOA 1MTNC 2FODA 1C2EA 2ZPSA 1FJSA 1C5XB 4H42U 1W7XH 3PWCA 1XXDA 4DT7B 4YO9A 1OWHA 1C1UH 4HI3A 4I8GA 5L2YH 3P8GA 3UOUA 2ZQ2A 1Z6EA 1PQ5A 5A0AE 4GLYA 2VJ1A 4Q80A 5HMAA 3W95A 1JIRA 2ZNKH 5JYIA 1C5SA 2H9EH 4I8KA 4OS2A 4ABFA 5EXMA 3SU6A 3MU0A 2ALPA 4U30A 1TX6A 2BMGB 9ESTA 2RCEA 2J95A 3ZV9A 1GHVH 1SPJA 1O39A 4GPGA 1ELCA 1O0DH 1B7XB 1EP5A 2G4UA 1HIAB 1TX8A 4TPYA 5L30H 1QA7A 1AN1E 1LDTT 2XBWA 4IMZA 1D3TB 4ZXYH 1K1IA 2BQWB 1YPEH 4BNRA 3SNBA 1MU8B 3P17H 3PLKA 1BB0B 2G00A 3BEFB 1ETRH 1ZGIA 2XC4A 3F1SB 3EQ0H 4OS1A 1G36A 3RM2H 3SI3H 1UVSH 2VU8E 4IS5A 2XCNA 4PROA 1KXCA 4M7GA 2GZ8A 2QXGA 2OC8A 4JK6A 2BDYA 1SGRE 3GY6A 3A8BA 5FCKA 4F4OC 2UUKB 1GHZA 1QGFA 4AX9H 5I46H 2HALA 4JZIA 2FI3E 1O2YA 2HNTE 2KAIA 1GI5A 1THRH 1XUIA 5HM9A 4FUFA 1EZUC 3MH4A 5ESTE 1UTPA 3DA9B 5FX6A 2Z9GA 5EQSA 1GBTA 1SC8U 2GGVB 3D23A 4K1SA 3EDXB 4SGBE 4OGXA 2ZHDA 1K22H 5EPYA 4UFDH 4WMDA 1FXYA 3PWBA 4BTTB 4Y10E 1ZTKA 5C5OA 1Z1IA 1E36B 2NU1E 4ZAEA 1W13U 3SV2H 1AIXH 2B0FA 4X6MA 1DWDH 2OINA 5DG6A 3ZVEA 2QA9E 3GCNA 1MH0A 1MCTA 3L3TA 4ZKSU 2F9VA 3ODDA 2VWMA 5K0HA 2GP9B 2VIDA 1TPPA 2OQUA 5EOKA 1NTPA 1MBMA 2W7SA 3GY8A 1BTHH 3MMGA 1V2QT 3UNQA 3L6PA 3QX5H 5C2ZA 3M35A 3RC5A 2BZAA 3W94A 5DGJA 3PMHB 2ZF0H 2WPHS 3URCA 2O8WA 3BTME 1PPCE 3NWUA 1SLVB 1GPZA 3NXPA 1YCPH 1ACBE 1XUGA 1W10U 1O2QA 4BAOB 4B76A 1WQVH 1GI7B 1YCPK 4FU7A 1OPHB 3PMAB 4MNYA 2JH0D 3BV9B 3M61U 3CP7A 1ABIH 5FBIA 1JWTA 2BHGA 5ABWA 2BLVA 1BTPA 4XBBA 1HAVA 2Y5FA 2A1DB 3NKKA 1K21H 2WYGA 2A0QB 1FN6A 2FTLE 1ZPBA 3GYLB 4CRDA 1ZZZA 2Z9LA 1EOLA 4OGYA 3CS0A 1ORFA 4A7IB 3VPKA 2BDIA 1TX7A 2CGAA 3EGKH 5HXFA 5A0BA 3TITA 1OYQA 1AWFH 1V2VT 1GBDA 3RU4D 1LVYA 4RN6A 3HKJB 1TOMH 2YNBA 4ABDA 1NS3A 2A4GA 1B0EA 1DX5M 1MQ5A 2Z9JA 3TIUA 1GCDA 5C3NA 1SGNE 1BITA 3BIVH 1DANH 1IQHA 4WY3A 1QBOA 1O3PB 2AFQB 4BTIB 1MBQA 1RJXB 5C5NA 2TBSA 2XWAA 1DITH 3IITA 2BLWA 4Z0KA 3Q3KA 5JB9S 1Y3XA 1T32A 6ESTA 4SGAE 2WPMS 5FPSA 4ABGA 2GDEH 2AH4X 2ODQA 3OYPA 3KGPA 2F9NA 2A5KA 1C9TA 3KHVA 1GMCG 3O8BA 2VIPA 3E1XB 3F9GA 3P8FA 3QO6A 3VEQB 1ZTJA 3ZZ8A 4ABJA 2ZHFH 4U32A 1P09A 3GDUA 1WUNH 1TE0A 2ANWA 4Y71A 2BY6X 4CREA 1EQ9A 1L1NA 1TRNA 1CHGA 5HM2A 1AWHB 1TRMA 1GL0E 5GPIB 1GJ5H 1YPGH 2PKAA 1SVPA 3T29A 1TNKA 2UUFB 2EI7A 2BDHA 1KIGH 2FWWA 3V13A 4RSPA 5LPEA 1W2KH 5F8TA 3RXJA 3BG4B 1EOJA 4UD9H 1C5QA 4K8BA 3S0NA 3SJKA 2BYAX 1O3FA 2HWLB 4OS5A 4Y0ZE 1C4V2 2PGBB 1J9CH 1GBLA 5AFZH 1WAYB 2K1QA 3LC3A 1ZMJA 4ABHA 3P95A 1DSTA 1YPKH 7GCHG 4UONA 4X8UH 4D9RA 1GI1A 5DP8A 2ZKSA 4AB8A 1ZRBA 4KGAA 1MUEB 1EZQA 8GCHF 1UCYK 2ZC9H 4UDWH 1SBWA 3NUMA 2Q6GA 2A4QA 4FUDA 1C1PA 1ZOMA 3M5MA 4NFEA 2ZWLH 4ZHMU 2BY9X 1GHXH 2QXIA 3A8AA 1HAHH 3PLPA 5EU8A 1DXWA 3Q3XA 3AASA 1K1LA 1H8IH 1DDJA 3LIWA 4HFPB 2Z7FE 3AW1A 5DO4H 1A5HA 1EPTA 1GVLA 2QV1A 1GVZA 1N8OB 1BRUP 2CMYA 1XKBC 1ELAA 3BIUH 2BZ6H 1UHBB 3RXMA 3JZ1B 2B5TB 1C5PA 1AB9B 1XM1A 1DS2E 2IOTA 1AE5A 1FAKH 2J92A 1GJBB 1G9IE 2VVUA 3ENSB 2LPRA 1GI4A 1A0JA 2HPQH 4X2XA 4JZEH 4X8VH 1Y3WA 3BTGE 5T6GA 2Q6DA 1O3GA 2GV7A 2J9NA 3UQOA 1LKBA 4MNXA 2BVSH 4A6LA 1SGDE 1NFXA 1W7GH 1V2LT 2JH6D 4DIHH 1Y5BT 3SUDA 4MNWA 3T2NA 2BDAA 5DP7A 2ZU3A 3E0NB 3SV6A 1OSSA 1RTFB 1BRBE 1A5GH 2GVFA 1PFXC 2OUAA 5SGAE 5E2PA 3A83A 1NRSH 3E16B 4YOJA 3ZZDA 1G37A 3LDXH 1CBWB 2P8OB 1DVAH 1QBNA 3BG4C 3ZVCA 1PQ8A 1DPOA 3SOSA 1A4WH 2ZO3H 4BXSA 2FI4E 1QRXA 1A7SA 2AMPA 3QZQA 4ABEA 1OWEA 1Q2WA 1TABE 4BAHB 1H9IE 4CBNA 2BD5A 2EEKA 2BD9A 2PWXA 4X8TH 2W5EA 2W7UA 1G3EA 1KXFA 4MDSA 1ELVA 2A31A 3RXRA 1F92A 5HGGA 1O2VA 2XW9A 1AKSB 3TH2H 1QB6A 3TPIZ 3QZRA 4CBOA 1F0TA 3SQHE 3TJOA 1P9UA 4ZKOU 1DICA 4KELA 4AGJA 1THPB 1MU6B 4UFEH 1BDAA 1TPAE 2ZHWH 5LPFA 4IC5A 1A46H 1FY3A 1QNJA 2SGQE 1C5MD 2F9PA 1ZPZA 1UVUH 1KYNA 3UWIA 5EG4A 3SUGA 8KME2 1NRNH 4FUEA 1NRQH 3SHCH 1GDQA 1FY5A 1ZPCA 1TBRH 3DT0H 4X0WU 3RXQA 4AYYB 5LGOA 1YYY1 3BSQA 1CGHA 1YP9A 2VIVA 2EI6A 3U9AH 2AGEX 2BX3A 1SMFE 5FPYA 4B2CA 3A8DA 1AB9C 1FIZA 2VWNA 4AFSA 1KDQB 4Q2KA 1LVMA 1MD8A 1M9UA 2CF9H 2D8WA 4YOIA 1FY4A 1QRWA 3HPTB 3WY8A 1DUAA 4BAQB 1ZYOA 1FDPA 1LVBA 3A8CA 1BMMH 3O8DA 1WBGB 2SFAA 4X6OA 3TH3H 1BTYA 2GCTB 1O2PA 4FUHA 1D3DB 3TJNA 3ZZ4A 1KTTB 2ZEBA 3MH6A 2EI8A 2ZI2H 3ESTA 1TGTA 2XYAA 1BOQA 2RDLA 5JBCS 1HCGA 1GBJA 3BF6H 3H7OA 3P92A 2HGTH 1ZR0A 1C5TA 2FTMA 4K1EA 2WPJS 4GHTA 3MWIU 3UPEA 1AQ7A 1RIWB 1CBWC 2P8OC 2UUJB 1MTNB 1KSNA 3QLPH 3T25A 4GVUA 1P57B 2XWBI 5HYOA 1S82A 3NPSA 4MTBA 1O31A 1SLXB 3BTWE 1CE5A 1Z1JA 2H6MA 4ZHAA 2H9TH 1P04A 1AO5A 1HJ9A 4WF8A 2P3UB 2BD8A 2FIRH 4B2BA 4DVAU 1EAWA 1O2SA 4BAMB 7KMEH 2PW8H 3RC4A 1OOKB 1SHYA 1G3CA 2C8YB 3SU0A 4DURA 2JKHA 1V2RT 2XBVA 1GMDG 1GI6A 2J2UA 1PJPA 1EKBB 1BMAA 1P0SH 1GBHA 1W8BH 2VIWA 1QQUA 1PPBH 1F0UA 3OSYA 4HZHA 2B9LA 5E0GA 1H9LB 3MTYA 1VITG 1SOZA 1VITH 2DE9A 2FS9A 3BTHE 3SV7A 1F2SE 1PPGE 2ZU2A 3I77A 1C1SA 4KTCA 6GCHG 4TY6A 5PTPA 2FX4A 1L1GA 1ZSJA 2C8ZB 3B23B 3GDSA 1JXPA 3A86A 1CA8B 3RMOH 2NWNA 2CHAB 2SGAA 1NT1A 4NA9H 1O5FH 1GJAB 2PFEA 2XNIA 1AVWA 3MO3A 1SGPE 1BRAA 2M5TA 4FVBA 1HFDA 4ZMAH 2FOMB 1DWBH 4Y7BA 1MQ6A 2GT7A 3D49H 2QF0A 1NRRH 1EAIA 1FIWA 1Y3UA 2XBX