1Z1IA

Crystal structure of native sars clpro
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Understanding the maturation process and inhibitor design of SARS-CoV 3CLpro from the crystal structure of C145A in a product-bound form
pubmed doi rcsb
source organism Sars coronavirus
total genus 71
structure length 301
sequence length 301
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1z1iA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1iA02
4U2WA 5DP9A 2FPZA 1JIMA 3TJUA 3UREA 4BAMB 1TB6H 2CHAB 1FY4A 2AEIH 3FZDA 1P04A 2ZP0H 5EXMA 2VVCA 2Y5HA 2QGRA 2PHBA 3MNSA 1YPMH 3TNTA 3RXSA 4I8LA 5E0HA 1GHZA 3ITIA 1GMHF 4FVDA 5E2PA 2FOGA 4MNVA 2FOAA 3ZV9A 1EZQA 1GHAG 1ZTJA 1BHXF 3HGPA 1HYLA 3DA9B 1C1SA 1OWJA 3B9FH 4ABGA 4MVNA 5L6NH 5CHAB 1UVSH 3PO1C 1TMBH 3RXIA 1V2MT 3BTHE 1BRAA 1HRTH 3FAOA 1CVWH 2ZFSA 8GCHG 3STJA 2TBSA 3KQEA 2SFAA 1V2WT 4ABIA 5LH8A 1SMFE 4BNRA 2UUFB 4X2VA 1SL3A 1SFIA 3H7TA 1P3EA 1O3JA 2WV4A 2ZO3H 1AFQB 1O2ZA 2R2WU 4HI3A 4XSKU 2Z94A 3MH6A 1ID5H 4IMZA 1DDJA 2BVSH 3ZZDA 4ZH8A 5EPYA 4MTBA 1Y59T 2H9HA 1RXPA 4YLUA 1VR1H 1SLUB 4XOJA 4WF8A 1TBQH 3RXOA 1YC0A 3P17H 5FX6A 2BY7X 1L1JA 4AGJA 1HJAC 1JOUB 4KTSA 1ESBA 4Y0ZE 1VITG 2FYQA 3TPIZ 1G3BA 1C2FA 2VGCB 5C2ZA 5C20A 1G2MA 3OY5U 5DP4A 1O5DH 3FP6E 3NCLA 4Y8YA 1ZTKA 1NZQH 1Z8JB 1Z1IA 1O3CA 2DE8A 1MBQA 1AMHA 5JYIA 1DUAA 5F8TA 1SOZA 4A1XA 4H6SB 5T6DA 3HKJB 2G5NA 2ANKH 3EQ0H 5DP3A 1BUIA 5K7RA 1MMJN 1C5NH 4KTCA 2STBE 2ZDKA 2ODQA 1O2HA 2R0KA 4B1TA 4DY7B 1UHBA 3GY6A 3UNRA 4BAOB 1CHGA 2B7DH 3URCA 2RA3A 1BRBE 2SNWA 1GG6B 2ODPA 2H9EH 2HLCA 4H42U 1OXGA 2J2UA 3RM0H 3RXQA 4BTIB 2ALPA 3BTME 4A5TS 2CJIA 1GBJA 2F91A 1T32A 3U69H 2J38A 4J2YB 2F9OA 3RC6A 2VIOA 3T5FH 4ABAA 1JRTA 1E38B 3RXBA 1TNKA 3PYHA 1A3BH 1FPHH 1Y3VA 1C4Y2 3ZVAA 2H2ZA 1WTGH 1GMCG 3A8BA 5GIBA 2FXRA 1QR3E 3TU7H 1IQGA 1Y5UT 3Q3YA 2BLQA 2OTVA 3AW1A 3S7KB 1MU8B 1XXDA 4FUIA 1AE8H 2H9TH 3U1JB 2ZTZA 5JB9S 4K69A 3E90B 3P6ZB 4IC6A 3SUGA 4F4OC 1ELCA 4AFQA 1SGYE 2FEQH 3EYDA 1ZRKA 3MMGA 2Y80A 3ATKA 1L1GA 4NZLA 1S85A 1OSSA 4ABBA 1PYTC 1GMDF 2PTNA 1RRKA 1H1BA 3OYPA 2W26A 2JH0D 1AFEH 3O8BA 1WYKA 4GSOA 1LDTT 5C5NA 5HMAA 3BTDE 2Y81A 2WPHS 1BTYA 5HYOA 2BD9A 2QXHA 1VITH 2FOFA 4JYTA 2AS9A 1HAIH 1BZXE 1P2KA 1UHBB 2ANMH 4A92A 1V2PT 1TPSA 1SHHB 5A0BA 2Y7ZA 4ESTE 2CMYA 3VB7A 1D3TB 2THFB 1MU6B 1AE5A 3S0NA 3M5MA 1NU7B 1K1LA 5A2MH 5HXFA 2A7CA 3U8TH 1O5BB 5F03A 3KQCA 1ETTH 2FS8A 3ZVGA 3TJNA 2AIPA 4K8YA 3SJIA 1HAOH 3M7UA 3TVJB 1DPOA 1WOFA 1BOQA 2BY6X 5L30H 3MNCA 3PO1B 3C1KA 2A0QB 1W3CA 1EPTC 1CGHA 1TNGA 1Z8GA 1ZTLA 3LKWA 3LT3A 2UWPA 3EA7A 1RIWC 3MI4A 3PMHB 2C90B 1GI3A 1MTVA 3PMAB 3SHAH 4CRCA 4GHQA 2AIQA 3GDSA 2A4RA 3RXUA 1ZMLA 1P2JA 2G51A 1HAVA 3E1XB 4JZ1A 1GJ7B 1UTOA 2Q6DA 1A0LA 1Z8RA 4ISOA 1E35B 1UVOA 2OCVB 1L2EA 4GCHG 4HZHA 3EA9A 3LJOA 3CS7A 4K1SA 1ZMNA 4Y71A 1RTKA 1SGIB 1LVBA 2OBOA 3RXGA 4INLA 2IJOB 1BA8B 3UNQA 3ZZ4A 1O5EH 4KELA 1GJ8B 2EI7A 3K6YA 4GPGA 1AQ7A 4CH2B 1K1OA 1LHDH 3F68H 4JYVH 3MFJA 1LPKB 1DWCH 1TGCA 2EI6A 2HWLB 3TNSA 2BLOA 4YOJA 3KEEA 4AZ2B 1CT2E 3A7ZA 2Y5GA 4I8JA 1C1OA 1HDTH 2Y6TA 3D65E 1TQ0B 2B8OH 3QX5H 1W2KH 5EXLA 2SGQE 5AFZH 1OOKB 2ZCHP 3SHCH 1KTTB 2SGDE 1FXYA 1BJUA 1QFKH 4TYDA 1MTWA 1GCDA 1SGFG 3RC4A 1F0RA 1FZZA 3LDXH 5JBTA 2FOMB 1UK4A 1MCTA 4TWYA 3KNXA 1ZYOA 1GMHG 2ZHFH 3SV9A 1C5SA 1GI6A 2YNBA 4O3TA 1AVWA 2SNVA 2ZU5A 1V2OT 2ZDMA 1BJVA 3RXPA 4O3UA 3MNBA 2RDLA 2O8LA 2VWLA 1ANBA 2VIPA 2PW8H 5JBBS 2ZPRA 3QDZB 3O8DA 3A85A 1L4ZA 1V2RT 1QRXA 1SGFA 1TNJA 1D9IA 1OWKA 7GCHF 2QXIA 2FP7B 1HAVB 4OS6A 3TLOA 2GV7A 4NIXA 2D1JA 2G4TA 4GAWA 2Z3DA 2UUJB 6GCHG 1EPTA 1PQ8A 3ZZCA 2H5CA 3BTGE 1HIAA 3M7TA 2OLGA 2WYJA 2WINI 3TJOA 1DVAH 1G32B 1EB2A 1GI1A 1QL8A 5F8ZA 4NIWA 4UFDH 4CRAA 1JWTA 5LPEA 2ZA5A 5A09A 2C93B 1A0JA 1LHEH 2PKSC 3BF6H 3P8OA 3LPRA 5A8ZA 1DANH 2VVUA 2GV6A 3Q77A 4AYYB 1C5WB 1OWDA 1GHWH 1GVKB 2WPLS 3M5NA 1O2LA 1D4PB 1TONA 1LKAA 1KDQA 4X1SU 2V35A 1F0UA 2G00A 1SHYA 1XUIA 4X6PA 3UOPA 2BY9X 1NY22 1B0EA 1L4DA 2BDGA 1SG8B 4JZIA 1UK2A 2PTCE 4YLQH 3PWCA 4IN2A 1JBUH 2CV3A 2I6QA 3SN8A 1P2MA 2I6SA 1QRWA 3FP7E 2GZ7A 4U32A 1GI7B 1LHFH 5HGGA 3GOVB 1FONA 1GVLA 3IWMA 5EOKA 5A0CA 1EP5A 3SU4A 2G52A 2GKVE 4CR9A 2ZHWH 1SQTA 4DOQA 1ARBA 4E7RG 4RN6A 3M37A 1W12U 1NRNH 3MHWU 1EPTB 3QWCH 1HIAB 1QB9A 3PLKA 3SV7A 1ZZZA 2ZGXH 1AN1E 3BEUA 1RIWB 5DK1A 2A7HA 1Q2WA 5AHGH 3VFEA 1GDQA 2F9NA 1LPGB 1YM0A 2XXLA 5BRRE 1QQUA 2QV1A 1A5HA 3D62A 1GL1A 1RFNA 3P70B 1E37B 2UUKB 3E91A 1SSXA 2BDHA 1O3GA 1H9IE 1BTXA 1P2QA 3SJKA 5EW1H 3SQEE 5K0HA 2PLXA 4ZXYH 1O3LA 2ZI2H 1KDQB 3L3TA 3M61U 1HAYB 1ESTA 1GMDG 4NZQA 4K60A 3RLWH 1AZZA 2FIRH 3SNBA 3P8FA 1GWAA 2CF8H 4LZ1H 2OINA 3URDA 1O5GH 1WQSA 2Z7FE 3T28A 4GLYA 1GHYH 2F9UA 4XDEA 1PPBH 3VB5A 2ZIQH 1MTUA 1F5KU 1DFPA 7ESTE 1P02A 4FU8A 2NU2E 1QRZA 2BZ6H 3V7TA 1OKXA 4ABJA 1KIGH 1P03A 3UQOA 2BM2A 1EOLA 3ZZBA 1EAUA 3RM2H 3SGAE 5FPTA 4LOYH 1LCYA 1W7GH 1MCVA 3LGIA 4I33A 2ZFFH 5DP6A 4YT7H 2K1QA 2G4UA 2WV5A 3MU5A 1A5IA 1HXFH 2CF9H 2AMDA 3ODDA 2VB0A 1C2KA 1HAGE 2GZ8A 1SGEE 3EGKH 3JZ1B 3M3TA 3L33A 4K5ZA 3SZNA 3RP2A 1YGCH 4ZKOU 2XW9A 1FY3A 6CHAB 1KXCA 3RU4D 1C1VH 2EC9H 2FESH 1DSTA 5CE1A 3BV9B 4TPIZ 1DWBH 3LH3A 3TH3H 4DCDA 3AAVA 1CA8B 3KN2A 3H5CB 1QBNA 2XNIA 1ZLRA 4THNH 4BAQB 1PQAA 1V2JT 3D49H 1A46H 3LIWA 4PROA 4O9VA 1O5FH 1V2QT 1NU9A 3E3TA 2ZNKH 3GY2A 3H7OA 5C5OA 2ZGHA 1NFUA 3MO3A 5J4SA 1DT2A 4DIHH 3IITA 2BQ7B 2ZU4A 3QUMP 3A7VA 3PLPA 1J8AA 2QY0B 1O3FA 3TITA 2O9QA 1SB1H 4XBDA 2HGTH 2QCYA 3SU2A 3SU6A 4U01A 2PKSB 2FI4E 2BB4A 4LZ4B 3HGNA 1D3QB 2PSYA 1BRUP 1JMOH 4J1YA 2XRCA 1QURH 3NKKA 3TK5A 3SU3A 3ODFA 4XBBA 4ZKRU 2BDYA 2ANWA 4SGBE 1W8BH 1O3IA 3BIVH 2O8UA 1NC6A 4IS5A 1YBWA 5EQQA 6LPRA 1TA2A 3M7QA 3NXPA 4JYUH 1FV9A 3M35A 2HNTE 2PV9B 1XUHA 1INCA 5FPSA 2P16A 3BIUH 2GCHG 4FXGH 1HLTH 1N1LA 1ELGA 2Z9GA 3QTOH 4X8UH 1E34B 1MH0A 4UDWH 3SUDA 1MTNC 1O35A 1ELEE 1HFDA 1DOJA 3EA8A 2ZHDA 5BPEA 1UTJA 1ANEA 1GJAB 3UFAA 5F6MA 3RMOH 4BXSA 1Y3XA 3BTFE 5FPYA 3HPTB 3QZRA 1J17T 4ISHH 4AB9A 2RCEA 4ASHA 1BTPA 2AFQB 1S5SA 2ODYB 1T8LA 3SV2H 1W11U 1GGDC 4YESB 2ZDLA 3SBKA 3TH2H 1SGCA 2ZFTA 1W7XH 2LNCA 7GCHG 1RTFB 1IOEA 2ZPQA 3SJOA 1TGSZ 1ZMJA 4D9RA 4A7IB 4NA8A 2O8WA 4ABDA 1C1WH 2TGDA 1F7ZA 4X8VH 1C9TA 2ZPSA 4XFQA 3LGVA 2VIWA 1EATA 4Y79A 1G36A 1D3DB 1KLTA 2Z3EA 1LHGH 3JZ2B 1V3XA 1BRCE 4FUBA 5DKMA 2C8YB 1UCYE 2BOHB 3RXFA 1GI9B 1PPEE 1GJ4H 2BZAA 1XUGA 1XUKA 3MOCA 4MG3A 2BOKA 2XBYA 1QA0A 1NT1A 1AUJA 1HAHH 2AGEX 3E8LA 1GBDA 2VWOA 4WWYA 1ZJDA 3UWJH 2EEKA 4FUGA 1E36B 1THPB 1B5GH 2SGPE 1C5PA 2A1DB 3BTQE 2OXSA 3KQBA 3KQDA 4X1QU 1FMGA 1P10A 2KAIA 3K65B 5E0JA 2FOBA 1LHCH 1TPAE 8KME2 3Q3KA 2P3FH 1MQ6A 1NFXA 2AMQA 1DY8A 2R2MB 5ABWA 1TAWA 3SJ9A 4H6TA 2FTLE 5GXPA 1KXBA 3A82A 2JETC 2QXGA 1ETSH 3VGCC 2XBXA 1SLXB 3TGIE 1MZDA 1EAWA 4X1RU 1SGPE 4BANB 2BY5X 1O2GH 1ZGVA 4WMEA 1GBBA 1FY1A 2R3YA 2V3OH 1EQ9A 4IN1A 1RD3B 3DUXH 3QTVH 2VVVA 1MQ5A 3RUOA 4E7NA 3E16B 3F9FA 2VH0A 3EBNA 2A4GA 3DD2H 3QGNB 5L2ZH 2NU1E 1HJ8A 1LVMA 3UUZA 4CRBA 1T4UH 1S0RA 3PTNA 1EX3A 3PWBA 1NRRH 1C1QA 5DP8A 1TPOA 4RSPA 1S0QA 1TBZH 1IQNA 3P95A 4NWLA 1C5XB 3GY4A 2NU4E 1QJ1B 4RKJB 1GBKA 1AZ8A 4X6MA 1PJPA 5T3HA 1S6HA 1O33A 4GHTA 2PKAA 4Q7XA 1YYY1 1MBMA 1H8IH 2ZCLP 3KF2A 1PFXC 2NU3E 2OP9A 3MH7A 3SV8A 5SGAE 1UTLM 1BBRE 1C1MA 1XXFA 2O8MA 1GJDB 3R3GB 8LPRA 3A7YA 4Y7AA 2HOBA 4X1NU 1SPJA 1Y5BT 1HB0B 4YZUA 1V6DA 2BLWA 4JZDH 4WMFA 3ZZAA 1SBWA 1WAYB 2KAIB 3ZZ6A 4FUFA 3ZZ7A 1TWXB 3SNAA 2P8OC 4AN7A 1F5LA 2B5TB 3S7HB 1V2TT 1FDPA 5DP7A 1IAUA 2V3HH 4GVUA 1GI5A 4B71A 3UPEA 4O03A 5DJ7A 2HPPH 3SU0A 2ZKSA 3RXHA 3SORA 1O2RA 3EE0B 4ISNA 1L1NA 2ALVA 1DY9A 4Y11E 1HAXB 1AY6H 1MTNB 3ZVEA 2ZG0H 1TYNA 5DO4H 3S9AA 1NESE 1SGNE 4FUHA 5HM2A 3EDXB 1G30B 3RXTA 1VGCC 1C5VA 4M7GA 1K1IA 1OWIA 1Y5AT 4AYVB 1EZSC 1JIRA 1SR5C 3F1SB 1G9IE 1ZSKA 3CP7A 2ZTXA 1GGDB 1P2OA 3ZVCA 1YCPM 5ESTE 2ZC9H 1T8MA 3I29A 4TY6A 3ZZ8A 3S9BA 1K1JA 1UMAH 3V13A 4FU7A 3ATWA 3BN9A 4MNXA 2AH4X 2PKAB 3SQHE 2GVFA 1CT0E 1O2WA 2Y82A 1ZGIA 3VB4A 2WPMS 4X8SH 3UWIA 1MKWK 1P2NA 2OQUA 3D23A 1FIZA 1NRQH 2H5DA 1CGJE 3NPSA 1CBWC 1TRMA 1O30A 4CH8B 2AGGX 5CMXH 2A7JA 3QN7A 1BT7A 4DT7B 2CXVA 1AIXH 1EKBB 5B6OA 5GWZA 1TGTA 4FUCA 4K3JA 1GDUA 2XCNA 1BTUA 1ZHMA 1OWHA 1KXAA 3VPKA 1EUFA 3FVFB 4WXVA 3M5LA 3C27B 5FX5A 1HJAB 1T31A 3MTYA 4Z6AH 3GISB 3K6ZA 1GJ6A 1V2KT 2BDAA 1O2KA 1SC8U 1C1TA 5EXNA 3Q76A 2OC7A 1XKAC 1G3DA 1QIXB 5C1XA 2W3IA 4NCYA 2HPQH 4FU9A 4FUEA 2JETB 4B2CA 3ZZ5A 2F9VA 1GI4A 3VGCB 2G5VA 2J94A 3GYLB 3ZVDA 1Z7KA 1O2PA 2BX4A 1A0HB 2ZQ2A 5EQRA 4K2YA 3T29A 2ZDAH 1O3AA 2UWLA 4R8TB 1OWEA 4BAKB 1GCTC 1O3HA 1GBLA 3A7WA 4X8TH 3ZVFA 3T2NA 1N6XA 4BTUB 4YO9A 1ABJH 4CRGA 1IQEA 1P8VC 2C4FH 2V0BA 4SGAE 1O2NA 1XM1A 1IQIA 2FO9A 2TPIZ 1BIOA 1EAIA 2ZF0H 2QYIA 2TRMA 4BXWA 2FODA 2H6MA 3BEFB 5C1UA 1UTPA 2IOTA 3TK9A 3A88A 3G01A 1GBEA 1GHAF 1ANCA 2P59A 1AGJA 1TABE 1EZUC 3T27A 1O31A 1PPGE 2GMTC 1LQDB 1RJXB 4CREA 1Z6EA 4K1EA 5GJ4B 2P3TB 4OS5A 1C2JA 1QHRB 2J34A 3KL6A 4B76A 2TGAA 1FIWA 1QCPA 2ANYA 4NA9H 4JCNA 5HM9A 1NROH 5EQSA 3VXEH 2ZDVH 1W0ZU 4ABEA 1O3EA 1OP2A 4X6NA 4DG4A 1IHSH 1ETRH 2TGPZ 1TOCB 3P92A 4A6LA 4AFZA 3SUEA 1TQ7B 2P8OB 3PTBA 1GJBB 5C67A 1BITA 2F83A 5GPIB 2Z9LA 2BD3A 4UD9H 2STAE 1WU1A 2ZU1A 2ULLA 1WBGB 1SFQB 1MTSA 4JK5A 4KTUA 5AFYH 1S82A 1BMAA 3SO3A 4AFUA 4DW2U 4Y6DA 5AF9H 2ZTYA 3TIUA 1O5CB 1O36A 1W10U 3M3SA 2GDDA 3GY8A 2ZGJA 4B75A 5T6FA 1BMLA 2NWNA 5IYTA 5I25A 2XC0A 3ZVBA 3S69A 1BCUH 1GBFA 2ZFRH 1GHBF 3PLBA 2QAAA 3RXJA 1A2CH 1HCGA 1UJ1A 3U98H 1EXFA 1TE0A 1J15A 3GCHC 4OS4A 1VGCB 2VNTA 2AGIX 3VB3A 3DFJA 3F9GA 1T8NA 3RMNH 1DS2E 3AAUA 2DE9A 3AASA 4HTCH 2A45B 1K21H 1QNJA 2V6NA 2FZZA 3GY3A 2A4OA 8ESTE 3DFLA 2GTBA 3TH4H 1O38A 1AKSA 1IQKA 3PMJA 1BHXB 3K2UA 4UE7H 1KLIH 1VCPA 1V2ST 3KGPA 1V2VT 4CRDA 1KY9A 2FLRH 1HXEH 1O2OA 3TK6A 2AERH 1QBOA 2C8WB 1AVGH 1ESAA 1NPMA 2VH6A 4OGYA 4OS7A 4IBLH 1C5MD 5TCAA 1TLDA 2ZEBA 1Y8TA 2LIZA 1DUEA 1SGDE 3ATLA 1ELDE 1CBWB 4I31A 4Y10E 1ELTA 4IC5A 1FN8A 1ELBA 3BEIB 2XBWA 2B0FA 1EB1H 4K8BA 4I8HA 3UR9A 2D8WA 1D3PB 5I46H 1ZPZA 1IQFA 4AX9H 1T8OA 2BYAX 1P12E 1C1NA 1NRPH 1K2I1 2VU8E 3E0PB 4AORA 1WSSH 1YP9A 3GY7A 2NU0E 2WUCA 4FUDA 1C4U2 4FVBA 4WVPE 3LU9B 1Y3WA 2BX3A 5JDUB 1CSOE 4AGKA 4YM9A 2ZHQH 2BD5A 2ZGBH 2H1UA 2RG3A 1VCQA 4MPUA 1O2VA 1B7XB 2Z6BD 3RXLA 1O3KA 2Z9IA 2JH6D 2ZECA 1C1PA 5E0GA 1VJAU 1QBVH 5EGMA 4CHAC 1FAXA 2Q6FA 4CR5A 1C2HA 1P9SA 1DX5M 2VWMA 1TRNA 2PUXB 3UQVA 1GI8B 1FAKH 5FAHA 1P57B 3M36A 1GCTB 4RKOB 2PSXA 3A87A 1T4VH 4BAHB 1XX9A 3LGTA 3P8NA 1K1MA 4INKA 1PPCE 2OC8A 3F6UH 1TFXA 1AKSB 1LMWB 1O3NA 1SGQE 3KCGH 5EODA 2TGTA 5LPRA 2BTCE 4B2AA 5T6GA 2Y7XA 1P2IA 4UFGH 2ZCKP 1DSUA 3QK1A 1DLEA 1UCYK 2PFEA 1AHTH 2W7UA 3A8CA 4E06H 2YNAA 1O2SA 1O0DH 3UY9A 2Q6GA 1XUFA 1TALA 4KP0A 1FLEE 2WPIS 3RC5A 1UO6A 4ISIH 4DURA 1ZR0A 2ZU2A 1ELFA 1LPZB 1O2IA 4JMYA 1BTZA 2GMTB 2A5KA 3LJJA 2GZ9A 3O8RA 1MD7A 2BXTH 4TPYA 3A7XA 4QT8C 1AB9C 5A0AE 3PB1E 4K1TA 1YPHC 1ZOMA 5DP5A 1GI2A 1SGRE 4Q7YA 2CGAA 2PUQH 4I7YH 1WUNH 3ENSB 1O3PB 1F0SA 2RA0A 1MKWH 5E8EH 2QF0A 1TX6A 2FX4A 1Q3XA 3V3MA 1YLCA 2JH5D 2M5TA 1CHOF 2C8ZB 1HAZB 4D8NA 2F3CE 1AD8H 3BSQA 4X6OA 1AU8A 2PWXA 1FQ3A 2BD4A 3RXCA 1MAYA 3MO9A 1YPEH 4NG9H 4U30A 3HATH 3S9CA 1DM4B 4AG1A 2VIDA 1FUJA 1C2DA 4IMQA 3SJ8A 4ZKSU 2FMJA 3UOUA 3SW2B 1L0ZA 1PPZA 1ELVA 1YPJH 5AVDA 5TJXA 1EZXC 3KHVA 2XTTB 2BDIA 4FUJA 1C1UH 1WTHD 1ZSJA 3A84A 1HJ9A 1TPPA 3GDUA 1TOMH 3L6PA 3GCHB 4CBNA 4JZFH 4CRFA 3BTEE 1G3EA 1TA6A 3A8AA 5IDKA 4Q80A 1BBRK 4IW4E 1EAXA 4ABHA 1Z71A 1CQQA 4NWKA 1T7CA 1TRYA 1H9LB 3M5OA 4I8KA 4DVAU 1F5RA 3SUFA 1GPZA 2BMGB 3W94A 5A8XA 2OD3B 2GT8A 1O3BA 5JBCS 1WV7H 1GVZA 3NK8A 2R3UA 3AVZA 2GCTC 3V0XA 2Q1JA 2OUAA 3B8JA 3U8RH 2ILNA 1GBCA 3PV4A 1Z1JA 1QB1A 3RXVA 4YOGA 2A5AA 6GCHF 3GCNA 2IPHA 3QLPH 1C5UA 3VEQB 2C3SA 2WUBA 3LGYA 3PROA 1B0FA 9LPRA 2QXJA 2ESTE 1QQ4A 1GBHA 1EP6A 2BY8X 4ABFA 2VJ1A 2ZQ1A 2P93A 1PPHE 4Y76A 2P94A 1O2UA 1Q31A 4AB8A 4D76A 2PR3A 2WPKS 3F9HA 1PQ7A 3LGWA 1IQJA 1O2QA 1ARCA 1F0TA 3W95A 1HBTH 1Z8IB 1TMUH 2BQ6B 3BTWE 1GBAA 2BLVA 2XWAA 1GJ5H 4CHAB 1AO5A 1P3CA 1GHBG 1W13U 3B23B 3FZZA 3MH4A 2CN0H 2FS9A 3TGKE 1YCPK 2OC0A 3ZYEA 3GCTF 5DPAA 1K1NA 1G2LA 3VXFH 9ESTA 3ESTA 2J92A 2BVXH 1OX1A 2XC5A 2YOLA 1CT4E 3OU0A 5PTPA 5DGJA 3HK6B 4YT6H 4TY7A 1XMNB 1P01A 1IHTH 1C5QA 2J4IA 2XCFA 2VINA 1FY8E 1C2IA 3MNXA 1UTNA 2G81E 2BDCA 4WY3A 4MDSA 1O2XA 3SU5A 1A5GH 1P09A 1BMMH 2O8TA 3GICB 2GT7A 1GHXH 2WYGA 1O34A 1H4WA 1Y3YA 3KIDU 6ESTA 4VGCC 1TIOA 1AB9B 4X2XA 7KMEH 1SQAA 2BD2A 2D26C 1THRH 4IGDA 4UEHH 4INHA 3Q3XA 3LC5A 5ETXA 1OP8A 4Y8XA 1AWFH 2BQWB 1AVXA 1LKBA 4ZROA 4D7FA 1BTHH 1YPLH 4Q2KA 3ATIA 3I77A 1O2JA 1X7AC 1ZPCA 2BD8A 1MAXA 4MPWA 1C5YB 3RMMH 3A89A 2HVXA 1U6QA 1K9OE 4TWWA 4R0IA 1DWDH 1UVTH 4WJG2 1HUTH 3CENA 1ZPBA 1CGIE 1GBIA 3BTTE 1GBMA 3QGJA 3DT0H 3LC3A 1ZHPA 1BB0B 3SV6A 1QTFA 2A2QH 1D6WA 2W5EA 5GCHF 2A32A 1FNIA 1UVPA 2FWWA 1O37A 2ZU3A 4X2YA 5E2OA 5C3NA 2VIQA 4ZAEA 3CS0A 3M3VA 3RXMA 3FANA 1A1RA 1DLKB 1C5OH 1DWEH 1C2MA 4OS2A 1O3OA 3NWUA 4B73A 5LGOA 3RXAA 3R0FA 1P0SH 4ZHAA 3ZV8A 3ZZ3A 5F8XA 2GX4A 2Y5FA 4O97A 2FOEA 4CBOA 4ZKNU 2BD7A 1H8DH 4MNWA 1UCYH 1K28D 1C2EA 2GCTB 1EJAA 1OYTH 1QA7A 1E0FD 1LVYA 4MNYA 1NM6A 1C9PA 5JBAS 1RS0A 1C5TA 1F2SE 2FI5E 5FCKA 1CU1A 1C5ZB 1CHOG 1QL7A 3RMLH 3LH1A 1G37A 1KYNA 1SGTA 1NS3A 5A8YA 3Q00A 1O2MA 3AW0A 3TJVA 1MKXK 4Y8ZA 5EW2H 1A7SA 1W0YH 2EA3A 4D9QA 1FJSA 4WMDA 1KTSB 4I8GA 4D7GA 1J9CH 4B74A 1O3DA 1UVUH 1V2NT 2ZFQH 3HKIB 4B2BA 3BG8A 1SOTA 1AUTC 1ZSLA 1BDAA 1ZJKA 4DIIH 2FM2A 4AOQA 1HV7A 1BMNH 1S6FA 1WCZA 3LONA 4XBCA 4UFFH 2IN2A 1QB6A 3SNDA 1RTLA 4JK6A 5JPMH 4WH8A 1DXPA 4ZHMU 1F92A 5DG6A 2GCHF 4ZHLU 3NUMA 2R9PA 3V12A 1NN6A 4HGCA 2G55A 2QC2A 4ISLA 5G4BA 2XBVA 3P8GA 1YKTA 4I32A 5FBIA 1XUJA 5H4IB 2AMPA 1FPCH 3I78A 1MUEB 4YTAA 1K22H 3MU1A 3A80A 1VZQH 3BG4C 4ZXXH 3RU4E 4MPXA 1EJMA 2C8XB 1GDNA 1QY6A 2ZHEH 2AYWA 4NFFA 5JB8S 6CHAC 2EI8A 3OX7U 3SNCA 1DICA 1BBRH 3PMBB 2J95A 4BTTB 1M9UA 1O2YA 4VGCB 8GCHF 1CO7E 4XE4A 2GD4B 4JZEH 4A1TA 1OPHB 4F49A 2W3KA 2HNTF 4ZUHA 3RXKA 2FI3E 1Z6JH 2XYAA 1UK3A 3MU8A 2FYRA 3O8CA 1A4WH 3OTJE 2BDBA 1O32A 2G8TA 4MLFB 1CA0C 1TNHA 1SQOA 1O39A 1GJCB 2W7SA 1N8OC 2Z9KA 1SLVB 3EAJA 3GYMA 5FBEA 2DUCA 3RLYH 1YPKH 3IG6B 4Y0YE 1JXPA 1AWHB 2OQ5A 3UR6A 1IQLA 1UTQA 1UTKA 1AI8H 1ELAA 2ZGCA 4NSYA 3VB6A 2XWBI 1VITF 1LO6A 2UUYA 2F9PA 3GCTG 1GBTA 3FP8E 3RXRA 5LPFA 2Z9JA 1JRSA 2P95A 1W14U 5FHTA 5FXLA 3SOSA 2CHAC 3SI4H 1PQ5A 4A1VA 2ZWLH 1FY5A 1PYTD 1D6RA 1NFWA 1YCPH 2FTMA 7LPRA 3SI3H 2JKHA 4ZMAH 1C5LH 1YPGH 2ZZUH 3SU1A 2J9NA 5CHAC 4AG2A 1HAPH 1IQMA 2K7XA 1HNEE 3WY8A 1BTWA 1WQVH 4MQAA 3GY5A 2UWOA 3OY6U 4X2WA 1QJ7B 1DITH 2FDAA 5GDSH 3RXDA 2OBQA 1ANDA 3A83A 3QZQA 1EASA 4NIYA 4Q7ZA 1O5AB 1UTMA 1S83A 4AFSA 1ZHRA 4NSVA 4NIVA 4WH6A 3DHKH 3T62A 1C5RA 1G3CA 1TNIA 1GI0A 2SGFE 2HRVA 3UTUH 3A8DA 3MU4A 1ORFA 5TCCA 3RDZA 2GP9B 1GJ9B 1V2LT 1AFQC 5EU8A 4KKDA 1GMCF 2FLBH 2BVRH 1YLDA 2SGEE 1TBRH 3PM3A 4H4FA 1ACBE 3QO6A 2A5IA 1C4V2 1GHVH 1LTOA 1VJ9U 3N7OA 4MPVA 4NGAH 1NO9H 1Y3UA 4OS1A 3ELAH 1OS8A 4YOIA 2VIVA 4Z0KA 1J14A 2A4QA 2QF3A 1O2TA 2ASUB 1HPGA 3A81A 5EG4A 3UIRA 4UONA 5J4QA 2VGCC 1OP0A 1TGNA 3A7TA 3GDVA 3RXEA 1NFYA 5GCHG 1P11E 3ZZ9A 5EPNA 1BQYA 1LQEA 2FOCA 3E6PH 1XKBC 2ZFPH 3E0NB 1QL9A 1P05A 1DXWA 3T26A 1NTPA 2Z3CA 1FN6A 1QJ6B 1OYQA 1S84A 4DJZB 2OC1A 3U8OH 1C2GA 2TIOA 1GL0E 1P06A 3MWIU 1KXDA 4NA7A 2GDEH 2BXUH 1N6YA 1A61H 5C1YA 2A31A 2WPJS 3TGJE 3U9AH 1KSNA 2QIQA 4BOHA 3MYWA 1SLWB 4DGJA 2FOHA 1KXEA 3BG4B 2PGBB 1GG6C 1TNLA 1EJNA 5ESBA 1TGBA 3ZYDA 1A3EH 1KLJH 4WXIA 2VWNA 1QGFA 2XC4A 2QA9E 1XVOA 1KXFA 3MU0A 5FCRA 1P9UA 3SGQE 4E05H 3BTKE 1C2LA 3STIA 3U1IB 1C1RA 1VCWA 4OGXA 1FI8A 4GUXA 1DE7H 1S81A 1H9HE 2ZDNA 4LXBH 3F9EA 1J16A 2B9LA 3A86A 1HGTH 1MD8A 1ZRBA 2HALA 2P3UB 2QN5T 4Y7BA 2GGVB 2R0LA 2PGQB 1THSH 3UNSA 4NFEA 2FX6A 3ATMA 2A2XH 4GCHF 3GCOA 1MZAA 4LK4A 1O3MA 1V2UT 3NZIA 2HNTC 1CA0B 3MH5A 3MO6A 3SNEA 1PPFE 1YPHE 3HK3B 1SI5H 1IQHA 1TX7A 1YF4A 3FFGA 4UFEH 1N8OB 3K9XB 1XVMA 1K1PA 3LGUA 3LOXA 1LVOA 1TMTH 1NRSH 3OSYA 2SGAA 2F9BH 1CE5A 3T25A 4KGAA 4X1PU 4X0WU 2BHGA 1ABIH 1TX8A 3RU4T 2D2DA 2LPRA 5L2YH 4HFPB 1MKXH 1EOJA 1RGQA 3SGBE 1SVPA
chains in the Genus database with same CATH superfamily
4U2WA 5DP9A 2FPZA 1JIMA 3TJUA 3UREA 4BAMB 1TB6H 2CHAB 1FY4A 2AEIH 3FZDA 1P04A 2ZP0H 5EXMA 2VVCA 2Y5HA 2QGRA 3DSPA 2PHBA 3MNSA 1YPMH 3TNTA 3RXSA 4I8LA 5E0HA 1GHZA 3ITIA 1GMHF 4FVDA 5E2PA 2FOGA 4MNVA 2FOAA 3ZV9A 2QE7D 1EZQA 1GHAG 1ZTJA 1BHXF 3HGPA 1HYLA 3DA9B 1C1SA 1OWJA 3B9FH 4ABGA 4MVNA 5L6NH 5CHAB 1UVSH 3PO1C 1TMBH 2AHME 3RXIA 1V2MT 3BTHE 1BRAA 1HRTH 3FAOA 1CVWH 2ZFSA 8GCHG 3STJA 2TBSA 3KQEA 2SFAA 1V2WT 4ABIA 5LH8A 2J98A 1SMFE 4BNRA 2UUFB 2KFWA 4X2VA 1SL3A 1SFIA 3H7TA 5B6LA 1P3EA 1O3JA 2WV4A 3F2HA 2ZO3H 1AFQB 1O2ZA 2R2WU 4HI3A 1SKYE 4XSKU 2Z94A 3MH6A 4B6FA 1ID5H 4IMZA 1DDJA 2BVSH 3ZZDA 3OFND 4ZH8A 5EPYA 4MTBA 1Y59T 2H9HA 1RXPA 4YLUA 2IJD1 4Q4LA 1VR1H 1SLUB 4XOJA 4WF8A 1TBQH 3RXOA 1YC0A 3P17H 5FX6A 2BY7X 1L1JA 4AGJA 1HJAC 1JOUB 4KTSA 1ESBA 4Y0ZE 1VITG 2FYQA 3TPIZ 1G3BA 1C2FA 2VGCB 5C2ZA 5C20A 1G2MA 3OY5U 5DP4A 1O5DH 3FP6E 3NCLA 4Y8YA 1ZTKA 1NZQH 1Z8JB 1Z1IA 1O3CA 2DE8A 1MBQA 1AMHA 5JYIA 1DUAA 5F8TA 1SOZA 4A1XA 4H6SB 5KEDA 2W6ID 5T6DA 3HKJB 1H8HD 2G5NA 2ANKH 3EQ0H 5DP3A 1BUIA 5K7RA 1MMJN 1C5NH 4KTCA 2STBE 2ZDKA 2ODQA 1O2HA 5HIYA 2R0KA 2QF4A 4B1TA 4DY7B 1UHBA 3PRBA 3GY6A 3UNRA 4BAOB 1CHGA 2B7DH 3URCA 2RA3A 1BRBE 2SNWA 1GG6B 2ODPA 2H9EH 2HLCA 4H42U 1OXGA 2J2UA 3RM0H 3RXQA 4BTIB 2ALPA 3BTME 4A5TS 2J98B 2CJIA 1EFRD 1GBJA 2F91A 1T32A 3U69H 2J38A 4J2YB 2F9OA 3RC6A 2VIOA 3T5FH 5EJZA 4ABAA 1JRTA 1E38B 3RXBA 1TNKA 3PYHA 1A3BH 1FPHH 1Y3VA 1C4Y2 3ZVAA 2H2ZA 1WTGH 1GMCG 3A8BA 5GIBA 2FXRA 1QR3E 3TU7H 1IQGA 1Y5UT 3Q3YA 2BLQA 2OTVA 3AW1A 3S7KB 1MU8B 1XXDA 4FUIA 1AE8H 2H9TH 3U1JB 2ZTZA 5JB9S 4K69A 3E90B 3P6ZB 4IC6A 3SUGA 4F4OC 1ELCA 4AFQA 1SGYE 2FEQH 3EYDA 1ZRKA 3MMGA 2Y80A 3ATKA 1L1GA 5HKKD 4NZLA 2KM0A 1S85A 1OSSA 4ABBA 1PYTC 1GMDF 2PTNA 1RRKA 1H1BA 3OYPA 2W26A 2JH0D 1AFEH 3O8BA 1WYKA 4GSOA 1LDTT 5C5NA 5HMAA 3BTDE 2Y81A 2WPHS 1BTYA 5HYOA 2BD9A 2QXHA 1VITH 2FOFA 4JYTA 2AS9A 1HAIH 1BZXE 1P2KA 1UHBB 2ANMH 4A92A 1V2PT 1TPSA 1SHHB 5A0BA 2Y7ZA 4ESTE 2CMYA 3PV2A 3VB7A 1D3TB 2THFB 1MU6B 1AE5A 3S0NA 3M5MA 1NU7B 1K1LA 5A2MH 5HXFA 2A7CA 3U8TH 1O5BB 5F03A 3KQCA 3AK5A 1ETTH 2FS8A 3ZVGA 3TJNA 2AIPA 4K8YA 3SJIA 1HAOH 3M7UA 3TVJB 1DPOA 1WOFA 1BOQA 2BY6X 5L30H 3MNCA 3PO1B 3C1KA 2A0QB 1W3CA 1EPTC 1CGHA 1TNGA 1Z8GA 1ZTLA 3LKWA 3LT3A 2UWPA 3EA7A 1RIWC 3MI4A 3PMHB 2C90B 1GI3A 1MTVA 3PMAB 3SHAH 4CRCA 4GHQA 2AIQA 3GDSA 2WSSD 2A4RA 3RXUA 1ZMLA 1P2JA 2G51A 1HAVA 2JIZD 3E1XB 4JZ1A 1GJ7B 1UTOA 2Q6DA 1A0LA 1Z8RA 4ISOA 1E35B 1UVOA 2OCVB 1L2EA 4GCHG 4HZHA 3EA9A 3LJOA 4XRNA 3CS7A 4K1SA 2KZ4A 1ZMNA 4Y71A 1RTKA 1SGIB 1LVBA 2OBOA 3RXGA 4INLA 2IJOB 1BA8B 3UNQA 3ZZ4A 1O5EH 4KELA 1GJ8B 2EI7A 3K6YA 4GPGA 1AQ7A 4CH2B 2IPQX 1K1OA 1LHDH 3F68H 4JYVH 3MFJA 5EJLA 1LPKB 1DWCH 1TGCA 2EI6A 2HWLB 3TNSA 2BLOA 4YOJA 3KEEA 4AZ2B 1CT2E 3A7ZA 2Y5GA 4I8JA 1C1OA 1HDTH 2Y6TA 3D65E 1TQ0B 2B8OH 3QX5H 1W2KH 2V3MA 5EXLA 2SGQE 4ACAA 5AFZH 1OOKB 2ZCHP 3SHCH 3SZEA 1KTTB 2SGDE 1FXYA 1BJUA 1QFKH 4TYDA 1MTWA 1GCDA 1SGFG 3RC4A 1F0RA 1FZZA 3LDXH 5JBTA 2FOMB 1UK4A 1MCTA 4TWYA 3KNXA 1ZYOA 1GMHG 2ZHFH 3SV9A 1C5SA 1GI6A 2YNBA 4O3TA 1AVWA 2SNVA 2ZU5A 1V2OT 2ZDMA 1BJVA 3RXPA 4O3UA 3MNBA 2RDLA 2O8LA 2VWLA 1ANBA 2VIPA 2PW8H 5JBBS 2ZPRA 4P02A 1S6LA 3QDZB 3O8DA 3A85A 1L4ZA 1V2RT 1QRXA 1SGFA 1TNJA 1D9IA 1OWKA 7GCHF 2QXIA 2FP7B 1HAVB 4OS6A 3TLOA 2GV7A 4NIXA 2D1JA 1QZ8A 2G4TA 4GAWA 3H09A 2Z3DA 2UUJB 6GCHG 1EPTA 2YMSD 1PQ8A 3ZZCA 2H5CA 3BTGE 1HIAA 3M7TA 2OLGA 2WYJA 2WINI 3TJOA 1DVAH 1G32B 1EB2A 1GI1A 1QL8A 5F8ZA 2WZQA 4NIWA 4UFDH 4CRAA 1JWTA 5LPEA 2ZA5A 5A09A 2C93B 1A0JA 1LHEH 2PKSC 3BF6H 3P8OA 3LPRA 3OEHD 5A8ZA 1DANH 2VVUA 2GV6A 3N99A 3Q77A 4AYYB 1C5WB 1OWDA 1GHWH 1GVKB 2WPLS 1FX0B 3M5NA 1O2LA 1D4PB 1TONA 1LKAA 1KDQA 4X1SU 2V35A 2GJGA 1F0UA 2G00A 1SHYA 1XUIA 4X6PA 3UOPA 2BY9X 1NY22 1B0EA 1L4DA 1VKYA 2BDGA 1SG8B 4JZIA 1UK2A 2PTCE 4YLQH 3PWCA 4IN2A 1JBUH 2CV3A 2I6QA 3SN8A 1P2MA 2I6SA 1QRWA 3FP7E 2GZ7A 4U32A 1GI7B 1LHFH 5HGGA 3GOVB 1FONA 1GVLA 3IWMA 5EOKA 5A0CA 1EP5A 3SU4A 2G52A 2GKVE 4CR9A 2ZHWH 1SQTA 4DOQA 1ARBA 4E7RG 4RN6A 3M37A 1W12U 1NRNH 3MHWU 1EPTB 3QWCH 1HIAB 1QB9A 3PLKA 3SV7A 1ZZZA 2ZGXH 1AN1E 3BEUA 1COWD 1RIWB 5DK1A 2A7HA 1Q2WA 5AHGH 3VFEA 1GDQA 2F9NA 1LPGB 1YM0A 2XXLA 5BRRE 1QQUA 2QV1A 1A5HA 3D62A 1GL1A 1RFNA 2W6JD 3P70B 1E37B 2UUKB 3E91A 1SSXA 2BDHA 1O3GA 1H9IE 1BTXA 1P2QA 3SJKA 5EW1H 3SQEE 5CDFE 5K0HA 2PLXA 4ZXYH 1O3LA 2ZI2H 1KDQB 3L3TA 3M61U 4TSFD 1HAYB 1ESTA 1GMDG 4NZQA 4K60A 3RLWH 1AZZA 2FIRH 3SNBA 3P8FA 1GWAA 2CF8H 4LZ1H 3NRLA 2OINA 3URDA 1O5GH 1WQSA 2Z7FE 3T28A 4GLYA 1GHYH 2F9UA 3OTPA 4XDEA 1PPBH 3VB5A 2ZIQH 1MTUA 1F5KU 1DFPA 7ESTE 1P02A 4FU8A 2NU2E 1QRZA 2BZ6H 3V7TA 1OKXA 4ABJA 1KIGH 1P03A 3UQOA 2BM2A 1EOLA 5C0TA 3ZZBA 1EAUA 3RM2H 3SGAE 5FPTA 4XD7D 4LOYH 1LCYA 1W7GH 1MCVA 3LGIA 4I33A 3EE7A 2ZFFH 5DP6A 4YT7H 2J5UA 2K1QA 2G4UA 2WV5A 3MU5A 1A5IA 1HXFH 2CF9H 2AMDA 3ODDA 2VB0A 1C2KA 1HAGE 2GZ8A 1SGEE 3EGKH 3JZ1B 3M3TA 3L33A 5FL7D 4K5ZA 3SZNA 3RP2A 1YGCH 4ZKOU 2XW9A 1FY3A 6CHAB 3ZIAD 1KXCA 3RU4D 1C1VH 2EC9H 2FESH 1DSTA 5CE1A 3BV9B 4TPIZ 2KCAA 1DWBH 3LH3A 3TH3H 4DCDA 2K0QA 3AAVA 1CA8B 3KN2A 3H5CB 1QBNA 2XNIA 1ZLRA 4THNH 4BAQB 1PQAA 1V2JT 3D49H 1A46H 3LIWA 4PROA 4O9VA 1O5FH 1V2QT 1NU9A 3E3TA 2ZNKH 3GY2A 3H7OA 5C5OA 2ZGHA 1NFUA 3MO3A 5J4SA 1DT2A 4DIHH 3IITA 2BQ7B 2ZU4A 3QUMP 3A7VA 3PLPA 1J8AA 2QY0B 1O3FA 3TITA 2JJ1D 2O9QA 1SB1H 4XBDA 2HGTH 2QCYA 3SU2A 3SU6A 5EJ1A 4U01A 2PKSB 2FI4E 2BB4A 4LZ4B 3HGNA 1D3QB 2PSYA 1BRUP 1JMOH 4J1YA 2XRCA 1QURH 3NKKA 3TK5A 3SU3A 4B6EA 3ODFA 4XBBA 4ZKRU 2BDYA 2ANWA 4SGBE 1W8BH 1O3IA 3BIVH 2O8UA 1NC6A 4IS5A 1YBWA 5EQQA 6LPRA 1TA2A 3M7QA 3NXPA 4JYUH 1FV9A 3M35A 2HNTE 2PV9B 1XUHA 1INCA 5FPSA 2P16A 3BIUH 2GCHG 4FXGH 1HLTH 1N1LA 1ELGA 2Z9GA 5F53A 3QTOH 4X8UH 1E34B 1MH0A 4UDWH 3SUDA 1MTNC 1O35A 1ELEE 1HFDA 1DOJA 3EA8A 2ZHDA 5BPEA 1UTJA 1ANEA 1GJAB 3UFAA 5F6MA 3RMOH 4BXSA 1Y3XA 3BTFE 5FPYA 3HPTB 3QZRA 1J17T 4ISHH 4AB9A 2RCEA 4ASHA 1BTPA 2AFQB 1S5SA 2ODYB 1T8LA 3SV2H 1W11U 1GGDC 4Z1MD 4YESB 2ZDLA 3SBKA 3TH2H 1SGCA 2ZFTA 1W7XH 2LNCA 7GCHG 1RTFB 1IOEA 2ZPQA 3SJOA 1TGSZ 1ZMJA 3W1EA 4ZCNA 4I86A 4D9RA 4A7IB 4NA8A 5GNDA 2O8WA 4ABDA 1C1WH 2TGDA 1F7ZA 4X8VH 1C9TA 2ZPSA 4XFQA 3LGVA 2VIWA 1EATA 4Y79A 1G36A 1D3DB 1KLTA 2Z3EA 1LHGH 3JZ2B 1V3XA 1BRCE 4FUBA 5DKMA 2C8YB 1UCYE 2BOHB 3RXFA 1GI9B 1PPEE 1GJ4H 2BZAA 1XUGA 1XUKA 3MOCA 4MG3A 2BOKA 2XBYA 1QA0A 1NT1A 1AUJA 1HAHH 2AGEX 3E8LA 1GBDA 2VWOA 4WWYA 1ZJDA 3FN8A 3UWJH 2EEKA 4FUGA 1E36B 1THPB 1B5GH 2SGPE 1C5PA 2A1DB 3BTQE 2OXSA 3KQBA 3KQDA 4X1QU 1FMGA 1P10A 1UW7A 2KAIA 3K65B 5E0JA 2FOBA 1LHCH 1TPAE 3OEED 8KME2 3Q3KA 2P3FH 1MQ6A 1NFXA 3FO8D 2AMQA 1DY8A 2R2MB 5ABWA 4TT3D 1TAWA 3SJ9A 4H6TA 2FTLE 5GXPA 1KXBA 3A82A 2JETC 3SYJA 2QXGA 1ETSH 3VGCC 2XBXA 1SLXB 3TGIE 1MZDA 1EAWA 4X1RU 2L6OA 1SGPE 4BANB 2BY5X 1O2GH 3F2GA 1ZGVA 4WMEA 1GBBA 1FY1A 2R3YA 2V3OH 1EQ9A 4IN1A 1RD3B 3DUXH 3QTVH 2VVVA 1MQ5A 3RUOA 4E7NA 3E16B 3F9FA 2VH0A 3EBNA 2A4GA 3DD2H 3QGNB 5L2ZH 2NU1E 1HJ8A 1LVMA 3UUZA 4CRBA 1T4UH 3FOAA 1S0RA 3PTNA 1EX3A 3PWBA 1NRRH 1C1QA 4FOUC 5DP8A 1TPOA 4RSPA 1S0QA 1TBZH 1IQNA 3P95A 4NWLA 1C5XB 3GY4A 2NU4E 1QJ1B 2EY4C 4RKJB 1GBKA 1AZ8A 4X6MA 1PJPA 5T3HA 1S6HA 1O33A 4GHTA 2PKAA 4Q7XA 1YYY1 1MBMA 1H8IH 2ZCLP 3KF2A 1PFXC 2NU3E 2OP9A 3MH7A 3SV8A 5SGAE 1UTLM 1BBRE 1C1MA 1XXFA 2O8MA 1GJDB 3R3GB 8LPRA 3A7YA 4Y7AA 2HOBA 4X1NU 1SPJA 1Y5BT 1HB0B 4YZUA 1V6DA 2BLWA 4JZDH 4WMFA 3ZZAA 1SBWA 1WAYB 4RT0A 2KAIB 3ZZ6A 4FUFA 3ZZ7A 1TWXB 3SNAA 2P8OC 4AN7A 1F5LA 2B5TB 3S7HB 1V2TT 1FDPA 4RT1A 5DP7A 4M9FA 1IAUA 2V3HH 4GVUA 2PP6A 1GI5A 4B71A 3UPEA 4O03A 5DJ7A 2HPPH 3SU0A 2ZKSA 3RXHA 3SORA 1W0KD 1O2RA 3EE0B 4ISNA 1L1NA 2ALVA 1DY9A 4Y11E 1HAXB 1AY6H 2KCYA 1MTNB 3ZVEA 2ZG0H 1TYNA 5DO4H 3S9AA 1NESE 1SGNE 4FUHA 5HM2A 3EDXB 1G30B 3RXTA 1VGCC 1C5VA 4M7GA 1K1IA 1OWIA 1Y5AT 4AYVB 1EZSC 1JIRA 1SR5C 3F1SB 1G9IE 1ZSKA 3CP7A 2ZTXA 1GGDB 2LELA 1P2OA 3ZVCA 1YCPM 5ESTE 2ZC9H 1T8MA 3I29A 4TY6A 3ZZ8A 3S9BA 1K1JA 5C17A 1UMAH 3V13A 4FU7A 3ATWA 3BN9A 4MNXA 2AH4X 2PKAB 3SQHE 2GVFA 1CT0E 1O2WA 2Y82A 1ZGIA 3VB4A 2WPMS 4X8SH 3UWIA 1MKWK 1P2NA 2OQUA 3D23A 1FIZA 1NRQH 2H5DA 1CGJE 3NPSA 1CBWC 1TRMA 1O30A 4CH8B 2AGGX 5CMXH 2A7JA 3QN7A 1BT7A 4DT7B 2CXVA 2CK3D 4ACBA 1AIXH 1EKBB 1SQRA 5B6OA 5GWZA 1TGTA 4FUCA 4K3JA 1GDUA 2XCNA 1BTUA 1ZHMA 1OWHA 5C0UA 1KXAA 3VPKA 1EUFA 3FVFB 4WXVA 3M5LA 3C27B 5FX5A 1HJAB 1T31A 3MTYA 4Z6AH 3GISB 3K6ZA 1GJ6A 1V2KT 2BDAA 1O2KA 1SC8U 5CHBA 1C1TA 5EXNA 2OK5A 3Q76A 2OC7A 1XKAC 1G3DA 1QIXB 5C1XA 2W3IA 4NCYA 2HPQH 4FU9A 4FUEA 2JETB 4B2CA 3ZZ5A 2F9VA 1GI4A 3VGCB 2G5VA 2J94A 3GYLB 3ZVDA 1Z7KA 1O2PA 2BX4A 1A0HB 2ZQ2A 5EQRA 4K2YA 3T29A 2ZDAH 1O3AA 2UWLA 4R8TB 1OWEA 4BAKB 1GCTC 1O3HA 1GBLA 3A7WA 4X8TH 3ZVFA 3T2NA 1N6XA 4BTUB 4YO9A 1ABJH 4CRGA 1IQEA 1P8VC 2C4FH 2V0BA 4SGAE 1O2NA 1XM1A 1IQIA 2FO9A 2TPIZ 1H8ED 1BIOA 1EAIA 2ZF0H 2QYIA 2TRMA 4BXWA 2FODA 2H6MA 3BEFB 5C1UA 1UTPA 2IOTA 3TK9A 3A88A 5KGOA 3G01A 1GBEA 2QF5A 4Q63A 1GHAF 1ANCA 2P59A 3WW7A 1AGJA 1TABE 1EZUC 3T27A 1O31A 1PPGE 2GMTC 1LQDB 1RJXB 2RFKC 4CREA 1Z6EA 4K1EA 5GJ4B 2P3TB 4OS5A 1C2JA 2HVYB 4RI0A 1QHRB 2J34A 3KL6A 4B76A 1WXRA 3WWFA 2TGAA 1FIWA 1QCPA 2ANYA 4NA9H 4JCNA 5HM9A 1NROH 5EQSA 3VXEH 2ZDVH 1W0ZU 4ABEA 2WPDD 1O3EA 1OP2A 4X6NA 4DG4A 4HG6A 1IHSH 1ETRH 2TGPZ 1TOCB 3P92A 4A6LA 4AFZA 3SUEA 1TQ7B 2P8OB 3PTBA 1GJBB 5C67A 1BITA 2F83A 5GPIB 2Z9LA 2BD3A 4UD9H 2STAE 1WU1A 2ZU1A 2ULLA 1WBGB 3MQKC 1SFQB 1MTSA 4JK5A 4KTUA 5AFYH 1S82A 1BMAA 4P00A 3SO3A 4AFUA 4Y6DA 4DW2U 5AF9H 2ZTYA 3TIUA 1O5CB 1O36A 1W10U 3M3SA 2GDDA 3GY8A 2ZGJA 4B75A 5T6FA 1BMLA 2NWNA 5IYTA 1BMFD 5I25A 2XC0A 2M2AA 3ZVBA 3S69A 1BCUH 1GBFA 2ZFRH 4YXWD 1GHBF 3PLBA 2QAAA 3RXJA 1A2CH 1HCGA 1UJ1A 2JDID 3U98H 1EXFA 1TE0A 3F0PA 1J15A 3CNRA 3GCHC 4OS4A 1VGCB 2VNTA 2AGIX 3VB3A 3DFJA 3F9GA 1T8NA 3RMNH 1DS2E 3AAUA 2DE9A 3AASA 4HTCH 2A45B 1K21H 1QNJA 2V6NA 2FZZA 3GY3A 2A4OA 8ESTE 3DFLA 2GTBA 3TH4H 1O38A 1AKSA 1IQKA 3PMJA 1BHXB 3K2UA 4UE7H 1KLIH 1VCPA 1V2ST 2VBCA 3KGPA 1V2VT 4CRDA 1KY9A 2FLRH 1HXEH 1O2OA 3TK6A 2AERH 1QBOA 1E1RD 2C8WB 1AVGH 1ESAA 1NPMA 2VH6A 4OGYA 4OS7A 4IBLH 1C5MD 5TCAA 1TLDA 2ZEBA 1Y8TA 2LIZA 1DUEA 1SGDE 3ATLA 1ELDE 1CBWB 4I31A 4Y10E 1OHHD 1ELTA 4IC5A 1FN8A 1ELBA 3BEIB 2XBWA 2B0FA 1EB1H 4K8BA 4I8HA 3UR9A 2D8WA 1D3PB 5I46H 1ZPZA 1IQFA 4AX9H 1T8OA 2BYAX 1P12E 1C1NA 1NRPH 1K2I1 1W0JD 2VU8E 3E0PB 4AORA 1WSSH 1YP9A 3GY7A 2NU0E 3F0OA 2WUCA 4FUDA 5DSFA 1C4U2 4FVBA 4WVPE 3LU9B 1Y3WA 2BX3A 5JDUB 1CSOE 4AGKA 4YM9A 2ZHQH 2BD5A 2ZGBH 1KMHB 2H1UA 2RG3A 1VCQA 4MPUA 1O2VA 1B7XB 2Z6BD 3RXLA 1O3KA 2Z9IA 2JH6D 2ZECA 1C1PA 5E0GA 1VJAU 1QBVH 5EGMA 4CHAC 2RDEA 1FAXA 2Q6FA 4CR5A 1C2HA 1P9SA 1DX5M 2VWMA 1TRNA 2PUXB 3UQVA 1GI8B 1FAKH 5FAHA 4F48B 1P57B 3M36A 1GCTB 4RKOB 2PSXA 3A87A 1T4VH 4BAHB 1XX9A 3LGTA 2V7QD 3P8NA 1K1MA 5C94A 4INKA 1PPCE 2OC8A 3F6UH 1TFXA 1AKSB 1LMWB 1O3NA 1SGQE 3KCGH 5EODA 2TGTA 5IK2D 5LPRA 2BTCE 4B2AA 5T6GA 2Y7XA 1P2IA 4UFGH 1E1QD 2ZCKP 1YY3A 2KR7A 1DSUA 3QK1A 1DLEA 1UCYK 2PFEA 1AHTH 2W7UA 3A8CA 4E06H 2YNAA 1O2SA 1O0DH 3UY9A 2Q6GA 1XUFA 1TALA 4KP0A 1FLEE 2WPIS 3RC5A 1UO6A 4ISIH 4DURA 1ZR0A 2ZU2A 1ELFA 1LPZB 1O2IA 4JMYA 1BTZA 1MABB 2GMTB 2A5KA 3LJJA 2GZ9A 3O8RA 1MD7A 2BXTH 4TPYA 3A7XA 2J97A 4QT8C 1AB9C 5A0AE 3PB1E 4K1TA 1YPHC 1ZOMA 5DP5A 1GI2A 1SGRE 4Q7YA 2CGAA 2PUQH 4I7YH 1WUNH 3ENSB 1O3PB 1F0SA 2RA0A 1MKWH 5E8EH 2QF0A 1TX6A 2FX4A 1Q3XA 3V3MA 1YLCA 2JH5D 2M5TA 1WDIA 1CHOF 2C8ZB 1HAZB 4D8NA 2F3CE 1AD8H 3BSQA 4X6OA 1AU8A 2PWXA 1FQ3A 2BD4A 3RXCA 1MAYA 3MO9A 1YPEH 4NG9H 4U30A 3HATH 3S9CA 1DM4B 4AG1A 2VIDA 1FUJA 1C2DA 4IMQA 3SJ8A 4ZKSU 2FMJA 3UOUA 3SW2B 1L0ZA 1PPZA 1ELVA 1YPJH 5AVDA 5TJXA 1EZXC 3KHVA 2XTTB 2BDIA 4FUJA 1C1UH 1WTHD 1ZSJA 3A84A 1HJ9A 1TPPA 3GDUA 1TOMH 3L6PA 3GCHB 4CBNA 3DCLA 4JZFH 4CRFA 3BTEE 1G3EA 1TA6A 3A8AA 5IDKA 4Q80A 1BBRK 4IW4E 1EAXA 4ABHA 1Z71A 1CQQA 4NWKA 1T7CA 1TRYA 1H9LB 3M5OA 4I8KA 4DVAU 1F5RA 3SUFA 1GPZA 2BMGB 4DT4A 3W94A 5A8XA 2OD3B 2GT8A 1O3BA 5JBCS 1WV7H 1GVZA 3NK8A 2R3UA 3AVZA 2GCTC 3V0XA 2Q1JA 2OUAA 3B8JA 3U8RH 2ILNA 1GBCA 3PV4A 1Z1JA 1QB1A 1NBME 3RXVA 4YOGA 2A5AA 6GCHF 3GCNA 3OAAD 2IPHA 3QLPH 1C5UA 3VEQB 2C3SA 2WUBA 3LGYA 3PROA 1B0FA 9LPRA 2QXJA 2ESTE 1QQ4A 1YWUA 1GBHA 1EP6A 2BY8X 4ABFA 2VJ1A 2ZQ1A 2P93A 1PPHE 4Y76A 2P94A 1O2UA 1Q31A 4AB8A 4D76A 2PR3A 2WPKS 4ASUD 3F9HA 1PQ7A 3LGWA 1IQJA 1O2QA 1ARCA 1F0TA 3W95A 1HBTH 1Z8IB 1TMUH 2BQ6B 3BTWE 3KQ5A 1GBAA 2BLVA 2XWAA 1GJ5H 4CHAB 1AO5A 1P3CA 1GHBG 1W13U 3B23B 3FZZA 3MH4A 2CN0H 2FS9A 3TGKE 1YCPK 2OC0A 3ZYEA 3GCTF 5DPAA 1K1NA 1G2LA 3VXFH 9ESTA 2YMSC 3ESTA 2J92A 2BVXH 1OX1A 2XC5A 2YOLA 1CT4E 3OU0A 5PTPA 5DGJA 3HK6B 4YT6H 3WWBA 4TY7A 1XMNB 1P01A 1IHTH 1C5QA 2J4IA 5KECA 2XCFA 2VINA 1FY8E 1C2IA 3MNXA 1UTNA 2G81E 2BDCA 4WY3A 4MDSA 1O2XA 3SU5A 1A5GH 1P09A 1BMMH 2O8TA 3GICB 2GT7A 1GHXH 2WYGA 1O34A 1H4WA 1Y3YA 3KIDU 6ESTA 4VGCC 1TIOA 1AB9B 4X2XA 7KMEH 1SQAA 2BD2A 2D26C 5T1VA 1THRH 4IGDA 4UEHH 4INHA 2JJ2D 3Q3XA 2WHXA 3LC5A 5ETXA 1OP8A 4Y8XA 1AWFH 2BQWB 1AVXA 1LKBA 4ZROA 4D7FA 2K8IA 1BTHH 1YPLH 4Q2KA 3ATIA 3I77A 1O2JA 1X7AC 1ZPCA 2BD8A 1MAXA 4MPWA 1C5YB 3RMMH 3A89A 2HVXA 1U6QA 1K9OE 4TWWA 4R0IA 1DWDH 1UVTH 4WJG2 1HUTH 3CENA 1ZPBA 1CGIE 1GBIA 3BTTE 1GBMA 3QGJA 3DT0H 3LC3A 1ZHPA 1BB0B 3SV6A 1QTFA 2A2QH 1D6WA 2W5EA 5GCHF 2A32A 1FNIA 1UVPA 2F43B 2FWWA 1O37A 2ZU3A 4X2YA 5E2OA 5C3NA 2VIQA 4ZAEA 3CS0A 3M3VA 3RXMA 2XOKD 3FANA 1A1RA 3U28C 1DLKB 1C5OH 1DWEH 1C2MA 4OS2A 1O3OA 3NWUA 4B73A 5LGOA 2XNDD 3R0FA 3RXAA 1P0SH 4ZHAA 3ZV8A 3ZZ3A 5F8XA 2GX4A 2Y5FA 4O97A 2FOEA 4CBOA 4ZKNU 2BD7A 1H8DH 4MNWA 1UCYH 1K28D 1C2EA 2GCTB 1EJAA 1OYTH 1QA7A 1E0FD 3N7EA 1LVYA 4MNYA 1NM6A 1C9PA 2WV9A 5JBAS 1RS0A 1C5TA 1F2SE 2FI5E 5FCKA 1CU1A 1C5ZB 1CHOG 1NBMD 1QL7A 3RMLH 3LH1A 1G37A 1KYNA 1SGTA 1NS3A 5A8YA 3Q00A 1O2MA 3AW0A 3TJVA 1MKXK 4Y8ZA 5EW2H 1A7SA 1W0YH 2EA3A 4D9QA 1FJSA 4WMDA 1KTSB 4I8GA 4D7GA 1J9CH 4AC9A 1YLNA 3UB0A 4B74A 1O3DA 1UVUH 1V2NT 2ZFQH 3HKIB 4B2BA 3BG8A 1SOTA 1AUTC 1ZSLA 1BDAA 1ZJKA 4DIIH 2FM2A 4AOQA 1HV7A 1BMNH 1S6FA 1WCZA 3LONA 4XBCA 4UFFH 2IN2A 1QB6A 3SNDA 1RTLA 4JK6A 5JPMH 4WH8A 1DXPA 4ZHMU 1F92A 5DG6A 2GCHF 4ZHLU 3NUMA 2R9PA 3V12A 2YMSB 1NN6A 4HGCA 2G55A 2QC2A 4ISLA 5G4BA 2XBVA 3P8GA 1YKTA 4I32A 5FBIA 1XUJA 5H4IB 2AMPA 1FPCH 3I78A 1MUEB 4YTAA 1K22H 4FETA 3MU1A 3A80A 1VZQH 3BG4C 4ZXXH 3RU4E 4MPXA 1EJMA 2C8XB 1GDNA 1QY6A 2ZHEH 2AYWA 4NFFA 5JB8S 6CHAC 2EI8A 3OX7U 3SNCA 1DICA 1BBRH 3PMBB 2J95A 4BTTB 3GS9A 1M9UA 1O2YA 4VGCB 8GCHF 1CO7E 4XE4A 2GD4B 4JZEH 4A1TA 1OPHB 4F49A 2W3KA 2HNTF 4ZUHA 3RXKA 2FI3E 1Z6JH 2XYAA 2LP6A 1UK3A 3MU8A 2FYRA 3O8CA 1A4WH 3OTJE 2BDBA 1O32A 2G8TA 4MLFB 1CA0C 1TNHA 1SQOA 1O39A 1GJCB 2W7SA 1N8OC 2Z9KA 1SLVB 3EAJA 3GYMA 5FBEA 2DUCA 3RLYH 1YPKH 3IG6B 4Y0YE 1JXPA 1AWHB 2OQ5A 3UR6A 1IQLA 2KCPA 1UTQA 1UTKA 2F4LA 1AI8H 1ELAA 2ZGCA 2KCOA 4NSYA 3VB6A 2XWBI 1VITF 1LO6A 2UUYA 2F9PA 3GCTG 1GBTA 3FP8E 3RXRA 5LPFA 2Z9JA 1JRSA 3F2FA 2P95A 1W14U 5FHTA 5FXLA 3SOSA 3KYGA 2CHAC 3SI4H 1PQ5A 2KX4A 4A1VA 1K0HA 2ZWLH 1FY5A 1PYTD 1D6RA 1NFWA 1YCPH 3KYFA 2FTMA 7LPRA 3SI3H 2JKHA 4ZMAH 1C5LH 1YPGH 3N7DA 2ZZUH 3SU1A 2J9NA 5CHAC 4AG2A 1HAPH 1IQMA 2K7XA 1HNEE 3WY8A 1BTWA 1WQVH 4MQAA 3GY5A 2UWOA 3OY6U 4X2WA 1QJ7B 1DITH 2FDAA 5GDSH 3RXDA 2OBQA 1ANDA 3A83A 2L74A 3QZQA 1EASA 4NIYA 4Q7ZA 1O5AB 1UTMA 1S83A 4AFSA 1ZHRA 4NSVA 4NIVA 4WH6A 3DHKH 3T62A 1C5RA 1G3CA 1TNIA 1GI0A 2SGFE 2HRVA 3UTUH 3A8DA 3MU4A 1ORFA 5TCCA 3RDZA 2GP9B 1GJ9B 1V2LT 1AFQC 5EU8A 4KKDA 1GMCF 3PV5A 2FLBH 2BVRH 1YLDA 2SGEE 3UAIC 1TBRH 3PM3A 4H4FA 1ACBE 3QO6A 2A5IA 1C4V2 1GHVH 1LTOA 1VJ9U 3N7OA 4MPVA 4NGAH 1NO9H 1Y3UA 4OS1A 3ELAH 1OS8A 4YOIA 2VIVA 4Z0KA 1J14A 2A4QA 2QF3A 1O2TA 2ASUB 1HPGA 3A81A 5EG4A 5HIZA 3UIRA 4UONA 2VGCC 5J4QA 1OP0A 1TGNA 3A7TA 3GDVA 3RXEA 1NFYA 3VG8A 5GCHG 1P11E 3ZZ9A 5EPNA 1BQYA 1LQEA 2FOCA 3E6PH 1XKBC 2ZFPH 3E0NB 1QL9A 1P05A 4F55A 1DXWA 3T26A 2EQNA 1NTPA 2Z3CA 1FN6A 1QJ6B 2HLDD 1OYQA 1S84A 4DJZB 2OC1A 3U8OH 1C2GA 2TIOA 1GL0E 1P06A 3MWIU 1KXDA 4NA7A 2GDEH 2BXUH 1N6YA 1A61H 5C1YA 5DN6D 2A31A 2WPJS 3TGJE 3U9AH 1KSNA 2QIQA 4BOHA 3MYWA 1SLWB 4DGJA 2FOHA 1KXEA 3BG4B 2PGBB 1GG6C 1TNLA 1EJNA 5ESBA 1TGBA 3ZYDA 1A3EH 1KLJH 4WXIA 2VWNA 1QGFA 2XC4A 2QA9E 1XVOA 1KXFA 3MU0A 3OE7D 5FCRA 1P9UA 3SGQE 4E05H 3BTKE 1C2LA 3STIA 3U1IB 1C1RA 1VCWA 4OGXA 1FI8A 4GUXA 1DE7H 1S81A 1H9HE 2ZDNA 4LXBH 3F9EA 1J16A 2B9LA 3A86A 1HGTH 1MD8A 1ZRBA 2HALA 2P3UB 2QN5T 4Y7BA 2GGVB 2R0LA 2PGQB 1THSH 3F3BA 3UNSA 4NFEA 2FX6A 3ATMA 2A2XH 4GCHF 3GCOA 1MZAA 4LK4A 1O3MA 1V2UT 3NZIA 4OM9A 2HNTC 1CA0B 3MH5A 3MO6A 3SNEA 1PPFE 1YPHE 3HK3B 1SI5H 1IQHA 1TX7A 1YF4A 3FFGA 4UFEH 1N8OB 3K9XB 3DSGA 1XVMA 1K1PA 3LGUA 3LOXA 1LVOA 3DSOA 1TMTH 1NRSH 3OSYA 2SGAA 2F9BH 3PRDA 1CE5A 3T25A 5EIYA 4KGAA 4X1PU 4X0WU 2BHGA 1ABIH 1TX8A 3RU4T 2D2DA 2LPRA 5L2YH 4HFPB 1MKXH 1EOJA 1E79D 3FKSD 1RGQA 3SGBE 1SVPA
chains in the Genus database with same CATH topology
4U2WA 5DP9A 2FPZA 1JIMA 3TJUA 3UREA 4BAMB 1TB6H 2CHAB 1FY4A 2AEIH 3FZDA 1P04A 2ZP0H 5EXMA 2VVCA 2Y5HA 2QGRA 2PHBA 3MNSA 1YPMH 3TNTA 3RXSA 4I8LA 5E0HA 1GHZA 3ITIA 1GMHF 4FVDA 5E2PA 2FOGA 4MNVA 2FOAA 3ZV9A 1EZQA 1GHAG 1ZTJA 1BHXF 3HGPA 1HYLA 3DA9B 1C1SA 1OWJA 3B9FH 4ABGA 4MVNA 5L6NH 5CHAB 1UVSH 3PO1C 1TMBH 3RXIA 1V2MT 3BTHE 1BRAA 1HRTH 3FAOA 1CVWH 2ZFSA 8GCHG 3STJA 2TBSA 3KQEA 2SFAA 1V2WT 4ABIA 5LH8A 1SMFE 4BNRA 2UUFB 4X2VA 1SL3A 1SFIA 3H7TA 1P3EA 1O3JA 2WV4A 2ZO3H 1AFQB 1O2ZA 2R2WU 4HI3A 4XSKU 2Z94A 3MH6A 1ID5H 4IMZA 1DDJA 2BVSH 3ZZDA 4ZH8A 5EPYA 4MTBA 1Y59T 2H9HA 1RXPA 4YLUA 1VR1H 1SLUB 4XOJA 4WF8A 1TBQH 3RXOA 1YC0A 3P17H 5FX6A 2BY7X 1L1JA 4AGJA 1HJAC 1JOUB 4KTSA 1ESBA 4Y0ZE 1VITG 2FYQA 3TPIZ 1G3BA 1C2FA 2VGCB 5C2ZA 5C20A 1G2MA 3OY5U 5DP4A 1O5DH 3FP6E 3NCLA 4Y8YA 1ZTKA 1NZQH 1Z8JB 1Z1IA 1O3CA 2DE8A 1MBQA 1AMHA 5JYIA 1DUAA 5F8TA 1SOZA 4A1XA 4H6SB 5T6DA 3HKJB 2G5NA 2ANKH 3EQ0H 5DP3A 1BUIA 5K7RA 1MMJN 1C5NH 4KTCA 2STBE 2ZDKA 2ODQA 1O2HA 2R0KA 4B1TA 4DY7B 1UHBA 3GY6A 3UNRA 4BAOB 1CHGA 2B7DH 3URCA 2RA3A 1BRBE 2SNWA 1GG6B 2ODPA 2H9EH 2HLCA 4H42U 1OXGA 2J2UA 3RM0H 3RXQA 4BTIB 2ALPA 3BTME 4A5TS 2CJIA 1GBJA 2F91A 1T32A 3U69H 2J38A 4J2YB 2F9OA 3RC6A 2VIOA 3T5FH 4ABAA 1JRTA 1E38B 3RXBA 1TNKA 3PYHA 1A3BH 1FPHH 1Y3VA 1C4Y2 3ZVAA 2H2ZA 1WTGH 1GMCG 3A8BA 5GIBA 2FXRA 1QR3E 3TU7H 1IQGA 1Y5UT 3Q3YA 2BLQA 2OTVA 3AW1A 3S7KB 1MU8B 1XXDA 4FUIA 1AE8H 2H9TH 3U1JB 2ZTZA 5JB9S 4K69A 3E90B 3P6ZB 4IC6A 3SUGA 4F4OC 1ELCA 4AFQA 1SGYE 2FEQH 3EYDA 1ZRKA 3MMGA 2Y80A 3ATKA 1L1GA 4NZLA 1S85A 1OSSA 4ABBA 1PYTC 1GMDF 2PTNA 1RRKA 1H1BA 3OYPA 2W26A 2JH0D 1AFEH 3O8BA 1WYKA 4GSOA 1LDTT 5C5NA 5HMAA 3BTDE 2Y81A 2WPHS 1BTYA 5HYOA 2BD9A 2QXHA 1VITH 2FOFA 4JYTA 2AS9A 1HAIH 1BZXE 1P2KA 1UHBB 2ANMH 4A92A 1V2PT 1TPSA 1SHHB 5A0BA 2Y7ZA 4ESTE 2CMYA 3VB7A 1D3TB 2THFB 1MU6B 1AE5A 3S0NA 3M5MA 1NU7B 1K1LA 5A2MH 5HXFA 2A7CA 3U8TH 1O5BB 5F03A 3KQCA 1ETTH 2FS8A 3ZVGA 3TJNA 2AIPA 4K8YA 3SJIA 1HAOH 3M7UA 3TVJB 1DPOA 1WOFA 1BOQA 2BY6X 5L30H 3MNCA 3PO1B 3C1KA 2A0QB 1W3CA 1EPTC 1CGHA 1TNGA 1Z8GA 1ZTLA 3LKWA 3LT3A 2UWPA 3EA7A 1RIWC 3MI4A 3PMHB 2C90B 1GI3A 1MTVA 3PMAB 3SHAH 4CRCA 4GHQA 2AIQA 3GDSA 2A4RA 3RXUA 1ZMLA 1P2JA 2G51A 1HAVA 3E1XB 4JZ1A 1GJ7B 1UTOA 2Q6DA 1A0LA 1Z8RA 4ISOA 1E35B 1UVOA 2OCVB 1L2EA 4GCHG 4HZHA 3EA9A 3LJOA 3CS7A 4K1SA 1ZMNA 4Y71A 1RTKA 1SGIB 1LVBA 2OBOA 3RXGA 4INLA 2IJOB 1BA8B 3UNQA 3ZZ4A 1O5EH 4KELA 1GJ8B 2EI7A 3K6YA 4GPGA 1AQ7A 4CH2B 1K1OA 1LHDH 3F68H 4JYVH 3MFJA 1LPKB 1DWCH 1TGCA 2EI6A 2HWLB 3TNSA 2BLOA 4YOJA 3KEEA 4AZ2B 1CT2E 3A7ZA 2Y5GA 4I8JA 1C1OA 1HDTH 2Y6TA 3D65E 1TQ0B 2B8OH 3QX5H 1W2KH 5EXLA 2SGQE 5AFZH 1OOKB 2ZCHP 3SHCH 1KTTB 2SGDE 1FXYA 1BJUA 1QFKH 4TYDA 1MTWA 1GCDA 1SGFG 3RC4A 1F0RA 1FZZA 3LDXH 5JBTA 2FOMB 1UK4A 1MCTA 4TWYA 3KNXA 1ZYOA 1GMHG 2ZHFH 3SV9A 1C5SA 1GI6A 2YNBA 4O3TA 1AVWA 2SNVA 2ZU5A 1V2OT 2ZDMA 1BJVA 3RXPA 4O3UA 3MNBA 2RDLA 2O8LA 2VWLA 1ANBA 2VIPA 2PW8H 5JBBS 2ZPRA 3QDZB 3O8DA 3A85A 1L4ZA 1V2RT 1QRXA 1SGFA 1TNJA 1D9IA 1OWKA 7GCHF 2QXIA 2FP7B 1HAVB 4OS6A 3TLOA 2GV7A 4NIXA 2D1JA 2G4TA 4GAWA 2Z3DA 2UUJB 6GCHG 1EPTA 1PQ8A 3ZZCA 2H5CA 3BTGE 1HIAA 3M7TA 2OLGA 2WYJA 2WINI 3TJOA 1DVAH 1G32B 1EB2A 1GI1A 1QL8A 5F8ZA 4NIWA 4UFDH 4CRAA 1JWTA 5LPEA 2ZA5A 5A09A 2C93B 1A0JA 1LHEH 2PKSC 3BF6H 3P8OA 3LPRA 5A8ZA 1DANH 2VVUA 2GV6A 3Q77A 4AYYB 1C5WB 1OWDA 1GHWH 1GVKB 2WPLS 3M5NA 1O2LA 1D4PB 1TONA 1LKAA 1KDQA 4X1SU 2V35A 1F0UA 2G00A 1SHYA 1XUIA 4X6PA 3UOPA 2BY9X 1NY22 1B0EA 1L4DA 2BDGA 1SG8B 4JZIA 1UK2A 2PTCE 4YLQH 3PWCA 4IN2A 1JBUH 2CV3A 2I6QA 3SN8A 1P2MA 2I6SA 1QRWA 3FP7E 2GZ7A 4U32A 1GI7B 1LHFH 5HGGA 3GOVB 1FONA 1GVLA 3IWMA 5EOKA 5A0CA 1EP5A 3SU4A 2G52A 2GKVE 4CR9A 2ZHWH 1SQTA 4DOQA 1ARBA 4E7RG 4RN6A 3M37A 1W12U 1NRNH 3MHWU 1EPTB 3QWCH 1HIAB 1QB9A 3PLKA 3SV7A 1ZZZA 2ZGXH 1AN1E 3BEUA 1RIWB 5DK1A 2A7HA 1Q2WA 5AHGH 3VFEA 1GDQA 2F9NA 1LPGB 1YM0A 2XXLA 5BRRE 1QQUA 2QV1A 1A5HA 3D62A 1GL1A 1RFNA 3P70B 1E37B 2UUKB 3E91A 1SSXA 2BDHA 1O3GA 1H9IE 1BTXA 1P2QA 3SJKA 5EW1H 3SQEE 5K0HA 2PLXA 4ZXYH 1O3LA 2ZI2H 1KDQB 3L3TA 3M61U 1HAYB 1ESTA 1GMDG 4NZQA 4K60A 3RLWH 1AZZA 2FIRH 3SNBA 3P8FA 1GWAA 2CF8H 4LZ1H 2OINA 3URDA 1O5GH 1WQSA 2Z7FE 3T28A 4GLYA 1GHYH 2F9UA 4XDEA 1PPBH 3VB5A 2ZIQH 1MTUA 1F5KU 1DFPA 7ESTE 1P02A 4FU8A 2NU2E 1QRZA 2BZ6H 3V7TA 1OKXA 4ABJA 1KIGH 1P03A 3UQOA 2BM2A 1EOLA 3ZZBA 1EAUA 3RM2H 3SGAE 5FPTA 4LOYH 1LCYA 1W7GH 1MCVA 3LGIA 4I33A 2ZFFH 5DP6A 4YT7H 2K1QA 2G4UA 2WV5A 3MU5A 1A5IA 1HXFH 2CF9H 2AMDA 3ODDA 2VB0A 1C2KA 1HAGE 2GZ8A 1SGEE 3EGKH 3JZ1B 3M3TA 3L33A 4K5ZA 3SZNA 3RP2A 1YGCH 4ZKOU 2XW9A 1FY3A 6CHAB 1KXCA 3RU4D 1C1VH 2EC9H 2FESH 1DSTA 5CE1A 3BV9B 4TPIZ 1DWBH 3LH3A 3TH3H 4DCDA 3AAVA 1CA8B 3KN2A 3H5CB 1QBNA 2XNIA 1ZLRA 4THNH 4BAQB 1PQAA 1V2JT 3D49H 1A46H 3LIWA 4PROA 4O9VA 1O5FH 1V2QT 1NU9A 3E3TA 2ZNKH 3GY2A 3H7OA 5C5OA 2ZGHA 1NFUA 3MO3A 5J4SA 1DT2A 4DIHH 3IITA 2BQ7B 2ZU4A 3QUMP 3A7VA 3PLPA 1J8AA 2QY0B 1O3FA 3TITA 2O9QA 1SB1H 4XBDA 2HGTH 2QCYA 3SU2A 3SU6A 4U01A 2PKSB 2FI4E 2BB4A 4LZ4B 3HGNA 1D3QB 2PSYA 1BRUP 1JMOH 4J1YA 2XRCA 1QURH 3NKKA 3TK5A 3SU3A 3ODFA 4XBBA 4ZKRU 2BDYA 2ANWA 4SGBE 1W8BH 1O3IA 3BIVH 2O8UA 1NC6A 4IS5A 1YBWA 5EQQA 6LPRA 1TA2A 3M7QA 3NXPA 4JYUH 1FV9A 3M35A 2HNTE 2PV9B 1XUHA 1INCA 5FPSA 2P16A 3BIUH 2GCHG 4FXGH 1HLTH 1N1LA 1ELGA 2Z9GA 3QTOH 4X8UH 1E34B 1MH0A 4UDWH 3SUDA 1MTNC 1O35A 1ELEE 1HFDA 1DOJA 3EA8A 2ZHDA 5BPEA 1UTJA 1ANEA 1GJAB 3UFAA 5F6MA 3RMOH 4BXSA 1Y3XA 3BTFE 5FPYA 3HPTB 3QZRA 1J17T 4ISHH 4AB9A 2RCEA 4ASHA 1BTPA 2AFQB 1S5SA 2ODYB 1T8LA 3SV2H 1W11U 1GGDC 4YESB 2ZDLA 3SBKA 3TH2H 1SGCA 2ZFTA 1W7XH 2LNCA 7GCHG 1RTFB 1IOEA 2ZPQA 3SJOA 1TGSZ 1ZMJA 4D9RA 4A7IB 4NA8A 2O8WA 4ABDA 1C1WH 2TGDA 1F7ZA 4X8VH 1C9TA 2ZPSA 4XFQA 3LGVA 2VIWA 1EATA 4Y79A 1G36A 1D3DB 1KLTA 2Z3EA 1LHGH 3JZ2B 1V3XA 1BRCE 4FUBA 5DKMA 2C8YB 1UCYE 2BOHB 3RXFA 1GI9B 1PPEE 1GJ4H 2BZAA 1XUGA 1XUKA 3MOCA 4MG3A 2BOKA 2XBYA 1QA0A 1NT1A 1AUJA 1HAHH 2AGEX 3E8LA 1GBDA 2VWOA 4WWYA 1ZJDA 3UWJH 2EEKA 4FUGA 1E36B 1THPB 1B5GH 2SGPE 1C5PA 2A1DB 3BTQE 2OXSA 3KQBA 3KQDA 4X1QU 1FMGA 1P10A 2KAIA 3K65B 5E0JA 2FOBA 1LHCH 1TPAE 8KME2 3Q3KA 2P3FH 1MQ6A 1NFXA 2AMQA 1DY8A 2R2MB 5ABWA 1TAWA 3SJ9A 4H6TA 2FTLE 5GXPA 1KXBA 3A82A 2JETC 2QXGA 1ETSH 3VGCC 2XBXA 1SLXB 3TGIE 1MZDA 1EAWA 4X1RU 1SGPE 4BANB 2BY5X 1O2GH 1ZGVA 4WMEA 1GBBA 1FY1A 2R3YA 2V3OH 1EQ9A 4IN1A 1RD3B 3DUXH 3QTVH 2VVVA 1MQ5A 3RUOA 4E7NA 3E16B 3F9FA 2VH0A 3EBNA 2A4GA 3DD2H 3QGNB 5L2ZH 2NU1E 1HJ8A 1LVMA 3UUZA 4CRBA 1T4UH 1S0RA 3PTNA 1EX3A 3PWBA 1NRRH 1C1QA 5DP8A 1TPOA 4RSPA 1S0QA 1TBZH 1IQNA 3P95A 4NWLA 1C5XB 3GY4A 2NU4E 1QJ1B 4RKJB 1GBKA 1AZ8A 4X6MA 1PJPA 5T3HA 1S6HA 1O33A 4GHTA 2PKAA 4Q7XA 1YYY1 1MBMA 1H8IH 2ZCLP 3KF2A 1PFXC 2NU3E 2OP9A 3MH7A 3SV8A 5SGAE 1UTLM 1BBRE 1C1MA 1XXFA 2O8MA 1GJDB 3R3GB 8LPRA 3A7YA 4Y7AA 2HOBA 4X1NU 1SPJA 1Y5BT 1HB0B 4YZUA 1V6DA 2BLWA 4JZDH 4WMFA 3ZZAA 1SBWA 1WAYB 2KAIB 3ZZ6A 4FUFA 3ZZ7A 1TWXB 3SNAA 2P8OC 4AN7A 1F5LA 2B5TB 3S7HB 1V2TT 1FDPA 5DP7A 1IAUA 2V3HH 4GVUA 1GI5A 4B71A 3UPEA 4O03A 5DJ7A 2HPPH 3SU0A 2ZKSA 3RXHA 3SORA 1O2RA 3EE0B 4ISNA 1L1NA 2ALVA 1DY9A 4Y11E 1HAXB 1AY6H 1MTNB 3ZVEA 2ZG0H 1TYNA 5DO4H 3S9AA 1NESE 1SGNE 4FUHA 5HM2A 3EDXB 1G30B 3RXTA 1VGCC 1C5VA 4M7GA 1K1IA 1OWIA 1Y5AT 4AYVB 1EZSC 1JIRA 1SR5C 3F1SB 1G9IE 1ZSKA 3CP7A 2ZTXA 1GGDB 1P2OA 3ZVCA 1YCPM 5ESTE 2ZC9H 1T8MA 3I29A 4TY6A 3ZZ8A 3S9BA 1K1JA 1UMAH 3V13A 4FU7A 3ATWA 3BN9A 4MNXA 2AH4X 2PKAB 3SQHE 2GVFA 1CT0E 1O2WA 2Y82A 1ZGIA 3VB4A 2WPMS 4X8SH 3UWIA 1MKWK 1P2NA 2OQUA 3D23A 1FIZA 1NRQH 2H5DA 1CGJE 3NPSA 1CBWC 1TRMA 1O30A 4CH8B 2AGGX 5CMXH 2A7JA 3QN7A 1BT7A 4DT7B 2CXVA 1AIXH 1EKBB 5B6OA 5GWZA 1TGTA 4FUCA 4K3JA 1GDUA 2XCNA 1BTUA 1ZHMA 1OWHA 1KXAA 3VPKA 1EUFA 3FVFB 4WXVA 3M5LA 3C27B 5FX5A 1HJAB 1T31A 3MTYA 4Z6AH 3GISB 3K6ZA 1GJ6A 1V2KT 2BDAA 1O2KA 1SC8U 1C1TA 5EXNA 3Q76A 2OC7A 1XKAC 1G3DA 1QIXB 5C1XA 2W3IA 4NCYA 2HPQH 4FU9A 4FUEA 2JETB 4B2CA 3ZZ5A