1Z1IA

Crystal structure of native sars clpro
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
301
structure length
301
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Understanding the maturation process and inhibitor design of SARS-CoV 3CLpro from the crystal structure of C145A in a product-bound form
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 71
structure length 301
sequence length 301
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1z1iA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1iA02
1A0LA 2QAAA 1DDJA 4AG2A 1W14U 2AGGX 2IOTA 3ZZDA 3TGIE 3VB5A 1IOEA 1AIXH 1TMUH 9ESTA 1CSOE 4LZ1H 4BAMB 2THFB 1J16A 1UVTH 1VZQH 3BTWE 4WMFA 1MZDA 4KTSA 1T8MA 2Y5HA 1IQHA 3VB6A 1TX6A 2LIZA 2SNVA 2JKHA 2I6QA 2ULLA 1O3HA 1GJCB 3FANA 3V12A 1C1QA 2GCTC 7GCHG 1JWTA 2WUBA 3OYPA 1KDQB 2QXHA 1PJPA 5C2ZA 3QK1A 3C1KA 1V2MT 3RXJA 4ZUHA 1ETSH 1GI2A 1MBMA 1VITG 1MUEB 2XC5A 3BEUA 1EB2A 1GBTA 2UWLA 3OU0A 1O3FA 1E0FD 4NG9H 5C5NA 1GMDG 3SUGA 3A8BA 5T3HA 1V2UT 1ESTA 5DKMA 2BX4A 5EW2H 2JH5D 2W3IA 2BXUH 1GHVH 1SGRE 3QGJA 3S9AA 1TYNA 4INKA 2BQWB 3SU2A 3LIWA 4E7NA 1FXYA 4HFPB 4AX9H 5C1XA 2GDEH 1XMNB 5A09A 1QA0A 2G5NA 1DM4B 4DJZB 2ZTYA 1V2QT 3SU6A 1MTNC 1GBLA 1O3EA 2ANMH 2ZU1A 4D7GA 1SMFE 4X6MA 5TCCA 3RP2A 3HK3B 2Y5FA 4GVUA 4BANB 1WQVH 3SNBA 3LGWA 1JIRA 5AHGH 1K1IA 1P09A 2WPJS 2VGCC 4X6PA 1VGCB 1GBHA 1GHBF 4ABHA 1YGCH 3A7VA 2R2WU 2VWLA 1SQAA 4XBBA 2HALA 2ZU2A 1YCPH 1UK2A 4HGCA 5E8EH 1O3KA 1EAXA 1ZLRA 1XM1A 5T6GA 4MQAA 1DT2A 2UUJB 5EPYA 5FBEA 1SLXB 5DP4A 3ZV9A 2BZAA 2P93A 2FTMA 4IN1A 1UTLM 4A6LA 1C5LH 1QY6A 2D26C 1BJUA 5FAHA 1GI5A 1MAXA 3LGVA 1C2JA 3F6UH 3QLPH 2A2QH 2ZHEH 2GT8A 3V3MA 1TOCB 4CRCA 2H6MA 4TWYA 2PUQH 3S0NA 4K60A 3T28A 1EZXC 2QXGA 3SUFA 4WVPE 2VWMA 3A8AA 1S83A 2F91A 3PWBA 4O9VA 1ZSJA 1HJAB 1LKBA 2PHBA 1BTWA 1YPMH 3MNBA 1IQGA 5T6DA 4O97A 5C1UA 1Z8GA 1AUJA 1GWAA 1CHOF 2AH4X 1C1SA 1PQAA 4WXIA 4OS2A 1Z8RA 2J95A 1C1UH 3BV9B 3P17H 4I31A 4GSOA 3SGQE 1ELEE 1NRRH 3A7XA 1HRTH 3BTKE 3AW1A 2O8MA 2WUCA 3T26A 4M7GA 1GBJA 5FPSA 1TGSZ 2FP7B 1SGYE 1LQEA 2FPZA 4DIIH 2AGEX 1TPAE 2FESH 3UR6A 5GIBA 4ABGA 1FV9A 1EQ9A 3RC5A 1DLEA 1A46H 3MHWU 3SORA 1MH0A 2G8TA 1C1PA 5E2OA 2ZCHP 1TLDA 3HGPA 5F8ZA 2B9LA 4GHQA 2Z3CA 1C2GA 4GCHF 2VIOA 1QHRB 1W7XH 1NO9H 1WOFA 1YP9A 4K8BA 2P3TB 1K28D 1YYY1 5DP6A 1K21H 1QRWA 3PO1C 1BBRK 3O8DA 1THRH 1YPHE 1K1NA 1GJ4H 3R3GB 4ZAEA 4HZHA 3V0XA 1FUJA 4ABBA 1QNJA 2FS9A 2BDYA 2GCHF 1SGQE 2A7HA 3ZZ7A 1YPLH 3NUMA 3H7TA 4YM9A 1XKAC 3OTJE 2BD7A 1JMOH 1HJ9A 1GVZA 4B75A 2STBE 1FN8A 3HPTB 4U2WA 4ZXXH 4DY7B 2A4RA 5LPFA 3CS0A 1HAYB 2GTBA 1AVGH 3KGPA 1VR1H 4AOQA 1C9PA 5C3NA 2RDLA 5FPTA 2AS9A 2TBSA 1A5GH 1W12U 2XBVA 2QYIA 4DW2U 3M35A 3TNTA 2F9UA 5HM2A 2F3CE 2FOMB 2A7CA 4R0IA 3F1SB 1W2KH 4IMZA 3RXFA 1TNGA 1GI3A 2XWBI 3M5LA 3SNEA 3EBNA 3UWJH 1H8IH 4IMQA 2FWWA 4NWKA 1KYNA 1AQ7A 2C8ZB 1O2XA 3AAUA 4JMYA 1DITH 3STJA 3BG8A 5A0BA 3TGJE 1P0SH 1SBWA 1P2MA 4YESB 2HPPH 3LH1A 5DP7A 2SGDE 1K9OE 1BTUA 5JYIA 3RXPA 1N6YA 3SGBE 2BY9X 5L2YH 3U1IB 2ZP0H 3HGNA 3PYHA 1NC6A 2ESTE 3L33A 1A1RA 3BTHE 1JIMA 5DJ7A 3MI4A 2ODQA 4WMEA 1ORFA 1IQIA 4ASHA 3K65B 3ZVFA 3U69H 4B2CA 1HIAB 2J38A 4B74A 3UNRA 1Y3UA 4X0WU 3GYLB 2VWNA 3S9CA 1GMHF 3A88A 4Q7ZA 1FQ3A 3SJKA 3T29A 1INCA 1MTNB 3RLYH 4AFQA 1DX5M 4YOIA 1IQLA 3PMAB 1C1TA 1O5CB 1UTMA 2Y6TA 1FY4A 4BAQB 1ZR0A 2ASUB 1C2HA 2A4OA 1AMHA 1MTVA 1WU1A 1TONA 1SB1H 3A83A 3KQBA 2R2MB 3RXSA 4Q7YA 3UNQA 3UIRA 2AYWA 2CHAC 4D7FA 3QDZB 3MU1A 1NU7B 2ZPSA 1J17T 3GISB 2J34A 3ESTA 5EOKA 3ZVGA 1HGTH 2Z9LA 1G30B 2Y82A 2PKAB 5AFYH 2AERH 1C4V2 3BTGE 3TJOA 4OS4A 4OS1A 8GCHG 1F0UA 2BVRH 7ESTE 2BZ6H 2O8TA 3TH3H 3FFGA 1QQ4A 5EXNA 3NPSA 3SV7A 2Z6BD 2H1UA 1SGCA 4NIYA 4FVBA 3S7HB 1KXFA 1ZZZA 2TIOA 4XE4A 1EJAA 1BHXB 1DY9A 1O2NA 1KDQA 1OP2A 4VGCC 4RN6A 3ZZ6A 3PMBB 1E35B 1UVPA 1D3PB 3RXRA 3T62A 1B0EA 1Q3XA 2H9EH 4AFUA 4DCDA 3IWMA 1OWEA 5HYOA 1T4VH 2QGRA 2STAE 2BXTH 1WCZA 2IN2A 4CR9A 3F9HA 1TAWA 1O35A 3P8GA 1Q31A 3IITA 4UDWH 2GX4A 3A8DA 4O03A 4THNH 2Z9IA 1V2NT 4U30A 3TJVA 3F68H 2P16A 4ISIH 1MKWK 3RXIA 2ZHFH 2HVXA 2HPQH 2BD4A 2YOLA 1GL0E 1O3IA 2ZDAH 1S84A 1EATA 3A7ZA 4UONA 1GCTC 1EASA 4FUJA 2ZDVH 1Y5UT 5DG6A 1AKSA 1O2SA 1F0SA 2ZFQH 3GCHB 3UPEA 2AEIH 1C4U2 1P10A 1SOTA 3MU8A 3ENSB 3QZQA 1NRNH 1ARCA 1F7ZA 1C5XB 1OWDA 1G36A 1QBOA 2A32A 3GOVB 1C5RA 3E1XB 3GDUA 2R0LA 3SHCH 4K1TA 4FUCA 8KME2 1C5QA 3ODFA 5A8ZA 3WY8A 4X1PU 1ELCA 4ZKRU 1BITA 1VJ9U 2NU1E 2PUXB 4A1VA 4ABAA 2SNWA 3ITIA 1ELTA 1TNLA 1DVAH 1Y8TA 4X2XA 1C5OH 1VJAU 3M3SA 5LPRA 3OSYA 1C5SA 3KEEA 1FONA 3QN7A 4ISNA 1BTHH 1S0QA 1SR5C 2AMPA 5BPEA 3DT0H 3GCOA 4I8KA 1SGFG 1O2OA 1O3JA 3BTQE 1T8NA 1C5TA 7GCHF 1L1GA 1UMAH 2VIVA 5DP5A 1SHHB 4NSYA 1ESAA 3SBKA 1GMHG 1RS0A 1YF4A 4QT8C 3SU5A 1AUTC 1YPEH 4OS5A 1MKXK 1C1WH 2PGBB 2AIPA 1DLKB 4XSKU 5EQSA 5FHTA 2ZHDA 1CA0C 1GVKB 1CGHA 1MD8A 1GMDF 1GI1A 3NKKA 1NFWA 5J4SA 1NRSH 3NK8A 2A5KA 1T7CA 3K6ZA 4UFGH 5K7RA 2BY8X 4WF8A 4WH6A 4BTTB 1HAVB 4YOGA 2NU2E 3BIUH 4Y0ZE 1G3DA 3JZ2B 3PMJA 3RXKA 3KQEA 1O37A 3CS7A 3K9XB 4ZKOU 3VPKA 1GCDA 4DT7B 4F49A 2W7SA 1GDQA 2ZQ2A 1V2VT 2NWNA 1IQFA 1L1JA 1HAZB 4MNVA 1AI8H 2UUYA 1UCYH 2TPIZ 3BTME 1NZQH 6CHAC 3TVJB 1GHXH 3GY7A 1GJ6A 2BDBA 4K8YA 2QF0A 1LKAA 2GZ9A 2CF9H 4YOJA 1W10U 1ETRH 2ZGJA 1TBZH 5A8YA 5LPEA 5J4QA 2ZGCA 3D65E 1HV7A 2YNBA 3FZDA 1E38B 1OP0A 1XKBC 1XX9A 4SGAE 1LCYA 2XBXA 1OXGA 2ZIQH 4FUBA 5A8XA 1QBVH 1RTKA 4B2BA 1EJNA 4A92A 2PFEA 2EI8A 3U9AH 1O3MA 3L3TA 3TPIZ 3ZYDA 2FXRA 1AFEH 1LHFH 1QGFA 2R3UA 4OS6A 2QY0B 3A81A 2BLWA 2OC0A 3A7TA 1O2ZA 1ZMJA 1ZTKA 2HGTH 1KTTB 2TGPZ 5EPNA 2BOKA 2VJ1A 3EYDA 3FZZA 1GPZA 1BTXA 1HLTH 1P01A 4XOJA 1JXPA 1G32B 4U01A 3RU4D 2BD2A 1P8VC 1M9UA 3LDXH 3MNXA 1MTWA 5EQRA 2PKSC 2XTTB 3AW0A 2HRVA 1U6QA 4INHA 1OYTH 2F83A 1BMLA 5DP8A 1A4WH 1O32A 1F0TA 1WV7H 2GMTC 5H4IB 2ZU5A 1SG8B 3RXBA 2DE8A 3ZZCA 5DK1A 3B9FH 2W7UA 3SJ8A 3LC5A 2RA0A 1NPMA 5C20A 1MU6B 4B76A 1QFKH 2VWOA 3BEFB 1O2VA 1C5YB 2SGFE 2XRCA 5DPAA 2C3SA 1EPTA 1HNEE 2TGTA 5EG4A 2F9BH 3ZZ5A 3SUEA 1ZSKA 1H1BA 5E0HA 3U8TH 3SU4A 4Y8YA 3PM3A 1A0HB 2J4IA 2ZHQH 1LHDH 1HXFH 1MQ5A 1DSTA 1C5VA 3M5MA 4Y8XA 2PSXA 1V2LT 2PW8H 1O3LA 3OY5U 1NESE 1O2IA 4XDEA 5T6FA 5C67A 1P2KA 4ISHH 2BDGA 1QJ7B 1GBEA 2JETB 1ELBA 2Q6DA 1DANH 2XBWA 4NCYA 2ZZUH 1UVOA 1ID5H 4CR5A 1MD7A 2FI5E 4E06H 1O3NA 3E0NB 1PYTD 1GI0A 1HAPH 1IHSH 3P8FA 1O38A 2OBOA 1O3OA 2OLGA 3T5FH 2BX3A 3A80A 1DWCH 5BRRE 1O5BB 4B1TA 4WWYA 5IDKA 3MH5A 4XBDA 3ZZAA 1AU8A 2JH0D 2KAIB 4E05H 1MAYA 2QF3A 1V2ST 1S6FA 1FAXA 1THSH 4D9RA 5JB8S 5A0CA 4FUDA 1C2LA 3BTFE 2JH6D 4LK4A 1QA7A 1RD3B 3SN8A 3BTTE 2LNCA 3Q77A 1HAGE 1SGDE 1ZYOA 3Q3XA 2ZFTA 1DUAA 1CU1A 1AHTH 2PKAA 2WPLS 1C5UA 1O5EH 1ANEA 1EKBB 2FOAA 4ESTE 1Y5AT 3KF2A 1ZJKA 4JYUH 2CMYA 2A0QB 1OX1A 2P94A 1O39A 2OCVB 1HXEH 8LPRA 1UK4A 1NFYA 4K1SA 1FMGA 1XVOA 1SC8U 5LH8A 3STIA 1GHAG 2RG3A 1FAKH 3Q3YA 3A84A 1QRZA 1SVPA 1SGFA 1T4UH 1W8BH 1P2JA 2ZGHA 2FYRA 3V7TA 1XXFA 4ZHMU 1FPHH 1Y3YA 3SUDA 4A5TS 2GKVE 4JZFH 1KSNA 2BY5X 1G2LA 1YCPK 3M7QA 2IJOB 2BVSH 2XNIA 1EAWA 1A0JA 1PFXC 3T27A 1O2QA 3MO3A 1C2DA 1FIWA 2QV1A 3A82A 1L0ZA 1S0RA 1A61H 2A5AA 1GDNA 3A85A 2FIRH 3KNXA 3MH4A 4H42U 3RXCA 2FEQH 2ODPA 4AORA 3EA8A 1EAIA 4IW4E 1G3EA 2GV7A 1TRMA 1W7GH 3ATKA 5JB9S 3F9GA 1TBQH 2FI3E 1WUNH 2VH0A 3LGYA 1HJ8A 4WMDA 1O3AA 1MTUA 1QJ1B 1P2OA 1DWBH 6CHAB 4MPWA 1ZGVA 1TNIA 3GY6A 1PPGE 2B5TB 2A45B 2TRMA 1SHYA 3TNSA 2Z9GA 3MNSA 3P95A 1QIXB 4K3JA 3H7OA 2H2ZA 3DFJA 4MPUA 2AMDA 2A4GA 3VB4A 1DFPA 1TX7A 3P6ZB 4J2YB 4INLA 3EA7A 1AD8H 1QB1A 4JYVH 4KGAA 3O8RA 8GCHF 1ACBE 2BLOA 3L6PA 4FVDA 1A5HA 4I8LA 1BBRH 5L6NH 2PR3A 3RMNH 3RXQA 1NRQH 4MTBA 4WJG2 1GG6C 2OC8A 5FX6A 4FUGA 1UCYE 2ZDNA 4UEHH 2CV3A 2XW9A 3BN9A 4FUIA 3TGKE 3GDSA 3MU4A 1D4PB 2FODA 3GY3A 4Q2KA 3ZVBA 3LPRA 4NGAH 1Y5BT 2GZ7A 1L1NA 2PTNA 1AFQB 3Q3KA 2D8WA 3EQ0H 3TK9A 1LPGB 2ZPRA 3UTUH 2A2XH 1QCPA 1HAVA 3UY9A 1D3TB 1RRKA 4YT7H 2FDAA 1SGNE 1EP5A 1O2UA 3QTVH 2BDHA 1SFIA 2GMTB 2WPMS 1TGCA 5CHAC 1H9LB 4WH8A 3RXDA 2ANWA 1EOLA 2CGAA 5DO4H 2O8UA 5LGOA 3MO6A 2GDDA 1D6WA 3I29A 1O3DA 3NCLA 3SV8A 1PPCE 3ZVEA 1OS8A 3TU7H 3RU4E 2G4UA 1E37B 2I6SA 1BRBE 2H9TH 4B71A 1IHTH 1O2LA 1W0ZU 1J9CH 1O5GH 1TIOA 3MOCA 1ZHPA 4UFDH 1EUFA 2VIPA 1HAXB 1O2KA 2B0FA 1S5SA 2GCTB 5CMXH 2W26A 2B8OH 3QX5H 1A5IA 1ANCA 1A3BH 2J94A 1KY9A 3I77A 1Y59T 1GGDC 3DUXH 2W5EA 3MYWA 4AG1A 4FUHA 3TJNA 4MLFB 1DXPA 1K1OA 4X1QU 2VINA 3GY2A 1TABE 1TOMH 1TRYA 1S6HA 1UHBA 1WTHD 5F03A 1GJBB 2HWLB 1Y3XA 2Y5GA 1TRNA 2AIQA 1TQ0B 1OPHB 3BG4C 1GBAA 2ZFSA 2Z94A 4ZMAH 5FX5A 1LO6A 2EI7A 2XC0A 4AYVB 4GLYA 1QB6A 2GP9B 3NWUA 3SO3A 1Z1IA 3P70B 3B8JA 3A89A 3ODDA 3KL6A 3A7YA 4D76A 3M3TA 1DE7H 2ODYB 2LPRA 1KXEA 1ZTLA 1SQOA 1NU9A 1FI8A 3GCTG 1ZHMA 3E3TA 1P57B 3RXMA 1P3EA 1YLDA 2BB4A 2VGCB 4BAOB 2BMGB 1SQTA 5F6MA 1LHCH 5FPYA 1K1JA 4OGYA 2H5CA 4JZEH 3FP8E 1Z6EA 2RA3A 3GICB 1ZTJA 2CXVA 1NS3A 2ZA5A 1V2PT 3EGKH 5FCRA 3RM2H 3QZRA 5FCKA 1G3BA 3DFLA 3GY4A 2P8OC 3UR9A 3LONA 4TPYA 2PTCE 2YNAA 3RXTA 2Y80A 1YKTA 1LPKB 4RSPA 1UK3A 1H9HE 4CREA 3PLKA 1OYQA 1QL9A 3E8LA 6GCHG 2V3OH 2ZDMA 1KLIH 3U1JB 2WPKS 1TQ7B 1A2CH 2BY7X 3SNCA 3QWCH 2VU8E 2XC4A 3E6PH 4X8VH 1TBRH 2SFAA 5AVDA 5GXPA 1ZJDA 1MKWH 2A31A 1P04A 1IQMA 1G2MA 1DOJA 1UVSH 2VIQA 1MBQA 3LU9B 4CBNA 2P59A 4AZ2B 3SNAA 1TWXB 3SJ9A 4HI3A 1C2IA 1ZOMA 4MNYA 1KXBA 3SI3H 3SZNA 2QC2A 1V2TT 3F9EA 1TMBH 1PPEE 3M7UA 3UOPA 1SGEE 2FOBA 1AVWA 1LTOA 4JK6A 4WY3A 2M5TA 1OWJA 4NA7A 2ZU3A 2A1DB 3BEIB 1N8OC 4RKJB 1GBCA 1D3DB 3UQOA 4Y6DA 1YCPM 1FNIA 1O34A 1NY22 1AZ8A 1YPGH 2XYAA 5AF9H 3MO9A 1AWFH 1P9UA 5HMAA 2J2UA 1H4WA 4KP0A 1SGIB 3U8OH 3VB7A 1TALA 1GI7B 1P3CA 1HAOH 3UFAA 4KTCA 1SOZA 2BY6X 1UTOA 2BM2A 3ATLA 4CRBA 1C5MD 3RU4T 1FLEE 3LJJA 4U32A 4MG3A 3PO1B 1O2HA 3M3VA 4BXWA 5HXFA 1FPCH 1VGCC 1QJ6B 1BB0B 4MPXA 4D9QA 1MKXH 1CGJE 2UWPA 4GPGA 3QTOH 4X6NA 2BQ7B 1TE0A 3SU0A 2EC9H 1OWIA 3K2UA 1MU8B 1GMCG 1HB0B 3UOUA 1HCGA 4XFQA 1O2RA 3RM0H 4YLUA 1RGQA 1RXPA 1YPJH 2Z7FE 1LVMA 3KIDU 1GL1A 2FX6A 1PPZA 1CA8B 3KHVA 5FBIA 1L2EA 1TPPA 1ANBA 3RUOA 5TCAA 3ZVAA 1ZRKA 2OBQA 2DE9A 2G55A 2HOBA 2O8WA 2O8LA 1HDTH 3BIVH 4CRFA 1QTFA 4ZHLU 4CRAA 1Z1JA 4TWWA 3TH4H 5A0AE 3A87A 5FXLA 3S69A 4ISOA 1ZPZA 3G01A 3EA9A 1WTGH 1PPHE 4K1EA 3UQVA 3JZ1B 4BAKB 1T8LA 4AGKA 4I7YH 1WSSH 2ALPA 1C5WB 1F5RA 4KTUA 1CT0E 2ZHWH 4H6SB 3GDVA 2F9NA 1O3CA 1TMTH 1XVMA 1BOQA 4AGJA 4MVNA 3RXHA 1C2FA 2ZFPH 1XXDA 4YTAA 5DP9A 3RMLH 1BTYA 4AB9A 4YZUA 1ZMLA 5EQQA 3CP7A 3Q00A 1UCYK 2OP9A 1AN1E 2C8YB 1EZQA 2FYQA 4NZQA 4TYDA 1C1VH 1OWKA 1DS2E 3SQHE 4K2YA 2BVXH 1GHAF 5I46H 1S85A 2PGQB 5GPIB 1SI5H 4DIHH 1KXAA 1GBBA 1C5ZB 1O33A 2V0BA 3AASA 2J92A 2BD3A 3TK6A 1HBTH 1GBMA 1AGJA 3MMGA 3T25A 4NA8A 3SQEE 3AVZA 1K1LA 2VH6A 1EB1H 4JK5A 2GD4B 3NZIA 1GVLA 1OKXA 1P06A 7LPRA 1ANDA 3LGUA 3PB1E 2C4FH 5ESBA 1P9SA 1CT2E 5B6OA 4X8SH 5EODA 5G4BA 2CHAB 4NSVA 4E7RG 1S81A 5F8TA 2SGQE 5I25A 3RXOA 2O9QA 3DD2H 4NZLA 2EI6A 3TIUA 4CHAC 4OGXA 4AFZA 2BLVA 4X2WA 4AB8A 2QCYA 2VVUA 3FAOA 5JDUB 2P8OB 1BIOA 2F9OA 2WYGA 1CVWH 4CRDA 5EGMA 2FOEA 1F2SE 3KQDA 7KMEH 3S9BA 3SU1A 2Y7XA 3MTYA 1ELDE 1QL7A 1BDAA 1O2GH 4VGCB 1EX3A 3SNDA 1VCQA 2ZEBA 4GAWA 4X2YA 1N1LA 2H9HA 3OY6U 2ZO3H 3EAJA 4FUEA 2OD3B 1LHGH 1TA6A 4IN2A 4IBLH 2WYJA 1FY5A 1TGTA 3RLWH 2NU0E 1GI6A 2IPHA 4Z6AH 1EPTC 2QN5T 1ETTH 3VXEH 5GCHF 1E36B 1GCTB 1HIAA 1BMNH 1TPSA 2FS8A 3ZZ3A 1HPGA 4BTIB 3URCA 2PV9B 3RC4A 1C1RA 4ZKNU 3U98H 1CGIE 2ZF0H 4OS7A 1O5DH 4YO9A 4IS5A 5HGGA 3KN2A 1GI8B 4TPIZ 1IQKA 2FI4E 3ZVCA 5SGAE 4H6TA 1TGNA 1SL3A 1NROH 4H4FA 2EEKA 3BTDE 1NTPA 1YLCA 5EXLA 1N8OB 4JZ1A 1W0YH 4UFFH 3SV6A 1B5GH 1X7AC 1KIGH 2OUAA 1PQ8A 3RMMH 2A4QA 3ZV8A 4I8HA 2OC1A 2BD5A 5EW1H 1AKSB 2ALVA 2Y81A 1O2JA 1GJ7B 1O2TA 3LKWA 1OP8A 1MCTA 4CRGA 2F9VA 2FOHA 2V6NA 1P2QA 1THPB 1Z7KA 1W11U 3O8CA 1C2KA 1MZAA 2Q1JA 1ZHRA 5L30H 1K2I1 4DG4A 4J1YA 2ZFRH 1JRSA 1SSXA 1UO6A 4X1SU 1EP6A 1SFQB 4SGBE 2BOHB 5EXMA 1T8OA 3P8NA 2F9PA 2ZNKH 4MNXA 4UE7H 1ELAA 3B23B 1SLUB 1TB6H 4K69A 4O3UA 3RXAA 1CA0B 1NT1A 1YPKH 1KLTA 1F5KU 1SGTA 3TITA 1EOJA 1VCWA 1IQJA 1P12E 1O30A 5ETXA 2CN0H 5E0GA 1Y3WA 1BRUP 1G9IE 4BNRA 1V6DA 2VVCA 1UTPA 3MU5A 4BAHB 1QL8A 5E0JA 2FOCA 2HNTC 4MDSA 1E34B 2BDAA 5JPMH 4ZKSU 3A8CA 1O5FH 2ZTXA 3M61U 1IQEA 3VFEA 4FUFA 1CE5A 4UD9H 4PROA 4TY7A 1C1OA 3PMHB 4X1RU 4FU7A 3T2NA 3D49H 1EAUA 1LQDB 3PTNA 2XWAA 3GCTF 3W95A 6LPRA 1NRPH 4LXBH 2R9PA 3URDA 1W13U 3DA9B 1QR3E 3UREA 4I33A 5IYTA 1DUEA 2G00A 1YBWA 2AMQA 3VGCC 2ZCLP 3MH7A 1P2NA 1ELVA 1T31A 3TJUA 2ZU4A 1J14A 1H9IE 3GCHC 1QBNA 1ZRBA 1MTSA 1NFUA 2ZTZA 4GHTA 1ZPCA 1CO7E 1YM0A 3VXFH 1UTKA 1AB9C 2V35A 2PSYA 3UWIA 1JOUB 1HFDA 2A7JA 2B7DH 3D23A 1PPBH 1XUKA 1XUIA 3PROA 3S7KB 2OXSA 6GCHF 5GCHG 1F92A 3RXEA 2Y7ZA 4NIXA 1PPFE 2K1QA 3MU0A 1HAHH 1KXCA 1F5LA 2ILNA 1HAIH 2QXJA 1O5AB 4XBCA 4ABDA 4CH2B 4ZH8A 4KELA 4I32A 2FZZA 2H5DA 1DXWA 2ZDKA 1LPZB 2UUFB 2NU4E 1LVYA 2D1JA 4X2VA 1V2WT 3K6YA 2OC7A 2XCNA 2V3HH 3ATMA 2PKSB 6ESTA 3VB3A 4FXGH 3EDXB 4CHAB 3E16B 1YC0A 1W3CA 1EXFA 4NA9H 2BD9A 1LDTT 2PLXA 2P3FH 4X8UH 3SU3A 2HLCA 2Z9KA 1H8DH 3RDZA 1CBWC 1O2YA 4AN7A 3PLPA 1T32A 2FMJA 1FJSA 4GUXA 3LGIA 1TFXA 4MNWA 3SJIA 2WINI 2ANYA 1GDUA 1Y3VA 3AAVA 2D2DA 1JRTA 2FX4A 3PTBA 2C8XB 3QUMP 1A3EH 2QA9E 3IG6B 1DICA 3LC3A 1ELFA 4I8GA 1ELGA 4NFFA 4X6OA 3QO6A 1GHBG 2VNTA 3LT3A 2AGIX 3ZZ9A 3LJOA 1V3XA 1C1NA 4JZDH 4LZ4B 3GYMA 1RTFB 1Z8JB 1C5NH 3OX7U 1ZSLA 3M36A 4KKDA 1GJ8B 2GGVB 3PLBA 2BDCA 2TGDA 3I78A 1V2OT 1C5PA 1LHEH 1SGPE 2QIQA 1S82A 2R0KA 2ZWLH 2ZC9H 3QGNB 5C1YA 3E90B 4DURA 2ZI2H 1RIWC 1GBKA 5DP3A 1EPTB 5JBCS 1BHXF 1XUHA 1KXDA 1UVUH 2GV6A 3SI4H 2R3YA 4O3TA 3ZYEA 1ESBA 2HNTF 1GHYH 3RXGA 2GVFA 3FP6E 2Z9JA 2WV5A 4ABEA 1GMCF 1AWHB 3M37A 3M5OA 3RMOH 2XCFA 1RFNA 3ZZ8A 3KQCA 3ATWA 5GJ4B 2P95A 1AE8H 4NFEA 1KTSB 1XUJA 4ABIA 5K0HA 2XBYA 1CQQA 1BUIA 4NIVA 1AY6H 1K1PA 1WYKA 2VIWA 1WQSA 1N6XA 3P8OA 4YLQH 1DWEH 3HATH 3HKIB 5F8XA 3GCNA 2Z3DA 1FZZA 1CHOG 1DPOA 2ANKH 1TNKA 2AFQB 3MWIU 1FY3A 4Z0KA 1C9TA 1BRCE 1P05A 3FVFB 2W3KA 3RXVA 1GHZA 4I8JA 4R8TB 3TH2H 4B2AA 1HUTH 1EZSC 2ZKSA 1WBGB 1EJMA 3UNSA 1XUGA 1SPJA 4AYYB 2ZECA 4Y0YE 2C8WB 2ZQ1A 4JZIA 3TK5A 2CJIA 1P2IA 1V2KT 4ZROA 2DUCA 1IAUA 1FIZA 5PTPA 1VCPA 1ABJH 4DVAU 2OTVA 4F4OC 4GCHG 1UJ1A 1VITH 4ZHAA 3ATIA 4TY6A 4IGDA 4AFSA 1K22H 5AFZH 1SLVB 3ELAH 3BF6H 1O3GA 1GI9B 2BDIA 3ZVDA 1DSUA 1FDPA 3LH3A 4LOYH 2FOFA 1MMJN 3E0PB 1ZPBA 2UWOA 5GDSH 4X8TH 2PWXA 4K5ZA 2NU3E 5E2PA 2GZ8A 1BRAA 2GCHG 4Y7AA 4Y11E 1D9IA 1DY8A 4Y8ZA 1B7XB 1TX8A 3BTEE 3PWCA 2A5IA 3R0FA 1GI4A 2BHGA 2BTCE 2KAIA 1QQUA 1LVBA 2OQ5A 1LMWB 1TNHA 2JETC 3SGAE 3SW2B 3M5NA 3SV9A 1OWHA 2G81E 4ABFA 8ESTE 1GJ5H 2SGAA 3VEQB 3D62A 1O0DH 1IQNA 1P02A 1O2PA 2SGEE 2ZGBH 5JBTA 1BTZA 1J15A 1FY8E 2VB0A 1KLJH 3ZZ4A 3NXPA 5JBBS 3VGCB 4BXSA 3MFJA 3RXLA 1RTLA 3E91A 1BTPA 3RC6A 1FY1A 3KCGH 1UTJA 4ISLA 2GT7A 2FTLE 1AB9B 2FLBH 3UUZA 1CHGA 4X1NU 2G51A 1AE5A 1AZZA 5A2MH 1GJ9B 1MQ6A 4DOQA 2FOGA 1C1MA 1GG6B 5HM9A 5ESTE 1BCUH 1GJDB 1OSSA 1V2JT 3GY8A 4FU9A 2Q6FA 2VIDA 1C2EA 4BTUB 4NWLA 1JBUH 1DWDH 2BYAX 4A7IB 3DHKH 1J8AA 1QB9A 1AO5A 9LPRA 5EU8A 1Z71A 2ZCKP 1B0FA 2Q6GA 1O3BA 3A7WA 1PQ5A 2ZG0H 4B73A 1QURH 1GBIA 1D3QB 1TGBA 2HNTE 1O2MA 1YPHC 3PV4A 1BQYA 1VITF 2WV4A 5CHAB 1OOKB 2EA3A 1CBWB 1G3CA 5DGJA 5GWZA 4BOHA 2J9NA 1BBRE 1L4ZA 1CT4E 3GY5A 4IC6A 2OQUA 3CENA 1UTNA 1MCVA 1XUFA 3FP7E 4IC5A 2G52A 4CH8B 3ZZBA 4Y79A 2FO9A 1QRXA 1PQ7A 1D6RA 1ZGIA 4DGJA 1GBDA 4HTCH 1C2MA 3LGTA 1BA8B 1A7SA 4JYTA 1HJAC 1P11E 2CF8H 3EE0B 1ARBA 1GJAB 3LOXA 1C4Y2 2QXIA 1GGDB 4WXVA 4A1TA 1ZMNA 3O8BA 4NIWA 4Y71A 3F9FA 1K1MA 1O3PB 3SV2H 1V2RT 3N7OA 3SJOA 1LVOA 1BMAA 5C5OA 1BZXE 2VVVA 3TLOA 4D8NA 1EZUC 1NFXA 1RIWB 2SGPE 5L2ZH 1WAYB 1HYLA 3BG4B 4Y10E 3SOSA 1TPOA 1TNJA 2K7XA 1P03A 4CBOA 2P3UB 5TJXA 3V13A 3HKJB 2C93B 2WPHS 4YT6H 2FLRH 2G5VA 3A86A 1O31A 1O2WA 1F0RA 5ABWA 1Z6JH 2WPIS 1L4DA 3C27B 4Q80A 3MNCA 1UHBB 4ZXYH 1BT7A 1GBFA 2ZFFH 1SLWB 3P92A 2BQ6B 4JCNA 2UUKB 2TGAA 1ABIH 1AVXA 1TA2A 2Z3EA 4UFEH 1UTQA 4Y7BA 1BJVA 1FN6A 1O36A 3BSQA 3M7TA 2XXLA 4RKOB 1NM6A 3SHAH 1NN6A 2ZGXH 2C90B 1G37A 4Q7XA 2BLQA 2BD8A 1Q2WA 3HK6B 4Y76A 1BMMH 3Q76A 3H5CB 5JBAS 1Z8IB 3MH6A 2G4TA 3W94A 3U8RH 4ABJA 2OINA 2ZPQA 4FU8A 4MPVA 1AFQC 1GHWH 2FM2A 2RCEA 4A1XA 1PYTC 5CE1A 1RJXB 2ZDLA 3RXUA
chains in the Genus database with same CATH superfamily
1A0LA 2QAAA 1DDJA 4AG2A 1W14U 2AGGX 2IOTA 3ZZDA 3TGIE 3VB5A 1IOEA 1AIXH 1TMUH 9ESTA 1CSOE 4LZ1H 4BAMB 3AK5A 2THFB 1J16A 1UVTH 1VZQH 3BTWE 4WMFA 1MZDA 4KTSA 1T8MA 2Y5HA 1IQHA 3VB6A 1TX6A 2LIZA 2SNVA 2JKHA 2I6QA 2ULLA 1O3HA 1GJCB 3FANA 3V12A 1C1QA 2GCTC 7GCHG 4F55A 1JWTA 2WUBA 3OYPA 1KDQB 2QXHA 1PJPA 5C2ZA 3QK1A 3C1KA 1V2MT 3RXJA 4ZUHA 1ETSH 1GI2A 1MBMA 1VITG 1MUEB 2XC5A 3BEUA 1EB2A 1GBTA 1NBME 2UWLA 3OU0A 1O3FA 1E0FD 4NG9H 5C5NA 1GMDG 1W0KD 3SUGA 3A8BA 3PRDA 5T3HA 1V2UT 1ESTA 5DKMA 2BX4A 3WW7A 5EW2H 2JH5D 2W3IA 2BXUH 1GHVH 1SGRE 3QGJA 4P00A 3S9AA 1TYNA 4INKA 2BQWB 3SU2A 3LIWA 4E7NA 1FXYA 4HFPB 1E1QD 4AX9H 5C1XA 2GDEH 1XMNB 5A09A 1QA0A 2G5NA 1DM4B 4DJZB 2ZTYA 1V2QT 3SU6A 1MTNC 1GBLA 1O3EA 2ANMH 2ZU1A 4D7GA 1SMFE 4X6MA 5TCCA 3RP2A 3HK3B 2XNDD 2Y5FA 4GVUA 4BANB 1WQVH 3SNBA 3LGWA 1JIRA 5AHGH 1K1IA 1P09A 2WPJS 2VGCC 4X6PA 1VGCB 1GBHA 1GHBF 4ABHA 1YGCH 5B6LA 3A7VA 2R2WU 2VWLA 1SQAA 4XBBA 2HALA 1YY3A 2ZU2A 1YCPH 1UK2A 4HGCA 5E8EH 1O3KA 1EAXA 1ZLRA 1XM1A 5T6GA 4MQAA 1DT2A 2UUJB 5EPYA 5FBEA 1SLXB 5DP4A 3ZV9A 2BZAA 2P93A 2FTMA 4IN1A 1UTLM 4A6LA 1C5LH 1QY6A 2K0QA 2D26C 1BJUA 5FAHA 3UAIC 1GI5A 1MAXA 3LGVA 1C2JA 3F6UH 3QLPH 2A2QH 2ZHEH 2GT8A 3V3MA 4M9FA 1TOCB 4CRCA 2H6MA 4TWYA 2PUQH 3OAAD 3S0NA 4K60A 3T28A 1EZXC 2QXGA 3SUFA 4WVPE 2VWMA 3A8AA 1S83A 2F91A 3PWBA 4O9VA 1ZSJA 1HJAB 1LKBA 2PHBA 1BTWA 2YMSB 1YPMH 3MNBA 1IQGA 5T6DA 4O97A 5C1UA 1Z8GA 1AUJA 1GWAA 1CHOF 2AH4X 1C1SA 1PQAA 4WXIA 4OS2A 1Z8RA 2J95A 1C1UH 3BV9B 5HKKD 3P17H 4I31A 4GSOA 3SGQE 1ELEE 1NRRH 3A7XA 1HRTH 3BTKE 3AW1A 2O8MA 2WUCA 3T26A 2L74A 1GBJA 4M7GA 5FPSA 1TGSZ 2FP7B 1SGYE 1LQEA 2FPZA 4DIIH 2IJD1 5T1VA 2AGEX 1TPAE 2FESH 3UR6A 5GIBA 4ABGA 1FV9A 1EQ9A 3RC5A 1DLEA 1A46H 3MHWU 3SORA 1MH0A 2G8TA 1C1PA 5E2OA 2ZCHP 1TLDA 3HGPA 5F8ZA 2B9LA 4GHQA 2Z3CA 1C2GA 4GCHF 2VIOA 1QHRB 1W7XH 1NO9H 1WOFA 1YP9A 4K8BA 1S6LA 2P3TB 3F0OA 1K28D 1YYY1 5DP6A 1K21H 1QRWA 3PO1C 1BBRK 3O8DA 1THRH 1YPHE 1K1NA 1GJ4H 3R3GB 4ZAEA 4HZHA 3V0XA 1FUJA 4ABBA 1MABB 1QNJA 2FS9A 2BDYA 2GCHF 1SGQE 2A7HA 3ZZ7A 1YPLH 3NUMA 3H7TA 4YM9A 1XKAC 3OTJE 2BD7A 3SZEA 1JMOH 1HJ9A 1GVZA 4B75A 2STBE 1FN8A 3HPTB 4U2WA 4ZXXH 4DY7B 2A4RA 5LPFA 3CS0A 1HAYB 2GTBA 1AVGH 3DSPA 3KGPA 4RI0A 1VR1H 4AOQA 1C9PA 5C3NA 2RDLA 5FPTA 2AS9A 2TBSA 1A5GH 1W12U 2XBVA 2QYIA 4DW2U 3M35A 3TNTA 2F9UA 5HM2A 2F3CE 2FOMB 2A7CA 4R0IA 3F1SB 1W2KH 4IMZA 3RXFA 1TNGA 1GI3A 2XWBI 3M5LA 3SNEA 3EBNA 3UWJH 1H8IH 4IMQA 2FWWA 4NWKA 1KYNA 1AQ7A 2C8ZB 1O2XA 3AAUA 4JMYA 1DITH 3STJA 3BG8A 5A0BA 3TGJE 1P0SH 1SBWA 1P2MA 4YESB 2HPPH 3LH1A 5DP7A 2SGDE 1K9OE 1BTUA 5JYIA 3RXPA 1N6YA 3SGBE 2BY9X 5L2YH 3U1IB 2ZP0H 3HGNA 3PYHA 1NC6A 2ESTE 3L33A 1A1RA 3BTHE 1JIMA 5DJ7A 3MI4A 2ODQA 4WMEA 1ORFA 1COWD 1IQIA 4Q63A 3K65B 4ASHA 3ZVFA 3U69H 4B2CA 2PP6A 1HIAB 2J38A 4B74A 3UNRA 1Y3UA 4X0WU 3GYLB 2VWNA 3S9CA 1GMHF 5IK2D 3A88A 4Q7ZA 1FQ3A 3SJKA 3T29A 1INCA 1MTNB 3RLYH 4AFQA 1DX5M 4YOIA 1IQLA 3PMAB 1C1TA 1O5CB 1UTMA 2Y6TA 1FY4A 4BAQB 1ZR0A 2ASUB 1C2HA 2A4OA 1AMHA 1MTVA 1WU1A 1TONA 1SB1H 3A83A 3KQBA 2R2MB 3RXSA 4Q7YA 3UNQA 3UIRA 2AYWA 2CHAC 4D7FA 3QDZB 3MU1A 1NU7B 2ZPSA 1J17T 3GISB 2J34A 3ESTA 5EOKA 3ZVGA 1HGTH 2Z9LA 1G30B 2Y82A 2PKAB 2W6ID 5AFYH 2AERH 1C4V2 3BTGE 3TJOA 4OS4A 4OS1A 8GCHG 1F0UA 2BVRH 7ESTE 1E1RD 2BZ6H 2O8TA 3TH3H 3PV5A 3FFGA 1QQ4A 5EXNA 3NPSA 3SV7A 2Z6BD 2LELA 2H1UA 1SGCA 4NIYA 4FVBA 3S7HB 1KXFA 1ZZZA 2TIOA 4XE4A 1EJAA 1BHXB 1DY9A 1O2NA 1KDQA 1OP2A 4VGCC 4RN6A 3ZZ6A 3PMBB 1E35B 1UVPA 1D3PB 3RXRA 3T62A 1B0EA 1Q3XA 2H9EH 4AFUA 4DCDA 3IWMA 1OWEA 5HYOA 1T4VH 2QGRA 2STAE 2BXTH 1WCZA 2IN2A 4CR9A 3F9HA 1TAWA 1O35A 3P8GA 2WSSD 1Q31A 3IITA 4UDWH 2GX4A 3A8DA 4O03A 4THNH 2Z9IA 1V2NT 2RFKC 4U30A 3TJVA 3F68H 2P16A 4ISIH 1MKWK 5DSFA 2ZHFH 3RXIA 2HVXA 2HPQH 2BD4A 2YOLA 1GL0E 1O3IA 2ZDAH 1S84A 1EATA 3A7ZA 4UONA 1GCTC 2CK3D 1EASA 4FUJA 2ZDVH 1Y5UT 5DG6A 1AKSA 1O2SA 1F0SA 2ZFQH 3GCHB 3UPEA 2AEIH 1C4U2 1P10A 1SOTA 3MU8A 3GS9A 3ENSB 3QZQA 1NRNH 1ARCA 1F7ZA 1C5XB 1OWDA 1G36A 1QBOA 2A32A 3GOVB 1C5RA 3E1XB 3GDUA 2R0LA 3SHCH 4K1TA 4FUCA 8KME2 1C5QA 3ODFA 5A8ZA 3WY8A 4X1PU 1ELCA 4ZKRU 1BITA 1VJ9U 2NU1E 2PUXB 4A1VA 4ABAA 2SNWA 3ITIA 1ELTA 1TNLA 1DVAH 1Y8TA 4X2XA 1C5OH 1VJAU 3M3SA 5LPRA 3OSYA 1C5SA 3KEEA 1FONA 3QN7A 4ISNA 1BTHH 1S0QA 1SR5C 2AMPA 5BPEA 3DT0H 5C0UA 3GCOA 4I8KA 1SGFG 1O2OA 1O3JA 3BTQE 1T8NA 1C5TA 7GCHF 1L1GA 1UMAH 2VIVA 5DP5A 1SHHB 4NSYA 1ESAA 3SBKA 1GMHG 1RS0A 1YF4A 4QT8C 3SU5A 1AUTC 1YPEH 4OS5A 1MKXK 1C1WH 2PGBB 2AIPA 1DLKB 4XSKU 5EQSA 5FHTA 2ZHDA 1CA0C 1GVKB 1CGHA 1MD8A 4ACBA 1GMDF 1GI1A 3NKKA 1NFWA 5J4SA 1NRSH 3NK8A 2A5KA 1T7CA 3K6ZA 4UFGH 5K7RA 2BY8X 2J98B 4WF8A 4WH6A 4BTTB 1HAVB 4YOGA 2NU2E 3BIUH 4Y0ZE 1G3DA 3JZ2B 3PMJA 3RXKA 3KQEA 1O37A 3CS7A 3K9XB 4ZKOU 3VPKA 1GCDA 4DT7B 4F49A 2W7SA 1GDQA 2ZQ2A 1V2VT 2NWNA 1IQFA 1L1JA 1HAZB 3DCLA 4MNVA 1AI8H 1VKYA 2UUYA 1UCYH 2TPIZ 3BTME 1NZQH 6CHAC 5CDFE 3TVJB 1GHXH 3GY7A 1GJ6A 2BDBA 4K8YA 2QF0A 1LKAA 2GZ9A 2CF9H 4YOJA 1W10U 1ETRH 2ZGJA 1TBZH 5A8YA 5LPEA 5J4QA 2ZGCA 3D65E 1HV7A 2YNBA 3FZDA 1E38B 1OP0A 1XKBC 4RT0A 1XX9A 4SGAE 1LCYA 2XBXA 1OXGA 2ZIQH 4FUBA 5A8XA 1QBVH 1RTKA 4B2BA 1EJNA 4A92A 2PFEA 2EI8A 3U9AH 2GJGA 1O3MA 3L3TA 3TPIZ 3ZYDA 2FXRA 1AFEH 1LHFH 1QGFA 2R3UA 4OS6A 2QY0B 3A81A 2BLWA 2OC0A 3A7TA 1O2ZA 1ZMJA 2YMSD 1ZTKA 2HGTH 1KTTB 2TGPZ 5EPNA 2RDEA 2BOKA 2VJ1A 3EYDA 3FZZA 1GPZA 1BTXA 1HLTH 1P01A 2KR7A 4XOJA 1JXPA 1G32B 4U01A 3RU4D 2BD2A 1P8VC 1M9UA 3LDXH 3MNXA 1MTWA 5EQRA 2PKSC 2XTTB 3AW0A 2HRVA 1U6QA 4INHA 1OYTH 2F83A 1BMLA 5DP8A 1A4WH 1O32A 1F0TA 1WV7H 2GMTC 5H4IB 2ZU5A 1SG8B 3RXBA 2DE8A 3ZZCA 3DSGA 5DK1A 3B9FH 2W7UA 3SJ8A 3LC5A 2RA0A 1NPMA 5C20A 1MU6B 4B76A 1QFKH 2VWOA 3BEFB 1O2VA 1C5YB 1WDIA 2SGFE 2XRCA 5DPAA 2C3SA 1EPTA 1HNEE 2TGTA 5EG4A 2F9BH 3ZZ5A 3SUEA 1ZSKA 1H1BA 5E0HA 3U8TH 3SU4A 4Y8YA 3PM3A 1A0HB 2J4IA 2ZHQH 1LHDH 1HXFH 1MQ5A 1DSTA 1C5VA 3M5MA 4Y8XA 2PSXA 1V2LT 2PW8H 1O3LA 3OY5U 1NESE 1O2IA 4XDEA 5T6FA 5C67A 1P2KA 4ISHH 2BDGA 1QJ7B 1GBEA 2JETB 1ELBA 2Q6DA 1DANH 2XBWA 4NCYA 2ZZUH 1UVOA 2WV9A 1ID5H 4CR5A 1MD7A 2FI5E 4E06H 1O3NA 1SKYE 3E0NB 1PYTD 1GI0A 1HAPH 1IHSH 3P8FA 1O38A 2OBOA 1O3OA 2OLGA 3T5FH 2BX3A 3A80A 1DWCH 5BRRE 1O5BB 4B1TA 4WWYA 5IDKA 3MH5A 4XBDA 3ZZAA 1AU8A 2JH0D 2KAIB 4E05H 1MAYA 2QF3A 1V2ST 5GNDA 1S6FA 1FAXA 1THSH 4D9RA 5JB8S 5A0CA 4FUDA 1C2LA 3BTFE 2JH6D 4LK4A 1QA7A 1RD3B 3SN8A 3BTTE 2LNCA 3Q77A 1HAGE 1SGDE 1ZYOA 3Q3XA 2ZFTA 2KCYA 2KX4A 1DUAA 1CU1A 1AHTH 2PKAA 2WPLS 1C5UA 1O5EH 1ANEA 1EKBB 2FOAA 4ESTE 1Y5AT 3KF2A 1ZJKA 4JYUH 2CMYA 2A0QB 1OX1A 2P94A 1O39A 2OCVB 1HXEH 3KYGA 3DSOA 8LPRA 1UK4A 1NFYA 4K1SA 1FMGA 1XVOA 1SC8U 5LH8A 3STIA 1GHAG 2RG3A 1FAKH 3Q3YA 3A84A 1QRZA 1SVPA 1SGFA 1T4UH 1W8BH 1P2JA 2ZGHA 2FYRA 3V7TA 1XXFA 4ZHMU 1FPHH 1Y3YA 2K8IA 3SUDA 4A5TS 2GKVE 4JZFH 1KSNA 2BY5X 1G2LA 1YCPK 3M7QA 2IJOB 3FN8A 2BVSH 2XNIA 1EAWA 1A0JA 1PFXC 3T27A 1O2QA 3MO3A 1C2DA 1FIWA 2QV1A 3A82A 1L0ZA 3FO8D 1S0RA 1A61H 2IPQX 2A5AA 1GDNA 3A85A 2FIRH 3KNXA 3MH4A 4H42U 3RXCA 2FEQH 2ODPA 4AORA 3EA8A 1EAIA 4IW4E 1G3EA 2GV7A 1TRMA 4FETA 1W7GH 3ATKA 5JB9S 3F9GA 1TBQH 2FI3E 1WUNH 2VH0A 3LGYA 1HJ8A 4WMDA 1O3AA 1MTUA 1QJ1B 1P2OA 1DWBH 6CHAB 4MPWA 1ZGVA 1TNIA 3GY6A 4B6FA 1PPGE 2B5TB 2A45B 2TRMA 1SHYA 3TNSA 2Z9GA 3MNSA 3P95A 1QIXB 4K3JA 3H7OA 2H2ZA 3DFJA 4MPUA 2AMDA 2A4GA 3VB4A 1DFPA 1TX7A 2WZQA 3P6ZB 4J2YB 1E79D 4INLA 3EA7A 1AD8H 1QB1A 4JYVH 4KGAA 3W1EA 3O8RA 8GCHF 1ACBE 2BLOA 3L6PA 4FVDA 1A5HA 4I8LA 1BBRH 4OM9A 5L6NH 2PR3A 3RMNH 3RXQA 1NRQH 4MTBA 4WJG2 1GG6C 2OC8A 5FX6A 4FUGA 1UCYE 2ZDNA 4UEHH 2CV3A 2XW9A 3BN9A 4FUIA 3TGKE 3GDSA 3MU4A 1D4PB 2FODA 3GY3A 4Q2KA 3ZVBA 3LPRA 4NGAH 1Y5BT 2WPDD 2GZ7A 1L1NA 2PTNA 1AFQB 3Q3KA 2D8WA 3EQ0H 3TK9A 1LPGB 2ZPRA 3UTUH 2A2XH 1QCPA 1HAVA 3UY9A 1D3TB 1RRKA 4YT7H 2FDAA 1SGNE 1EP5A 1O2UA 3QTVH 2BDHA 2J5UA 1SFIA 2GMTB 2WPMS 1TGCA 5CHAC 1H9LB 4WH8A 3RXDA 2ANWA 1EOLA 2CGAA 5DO4H 2O8UA 2KM0A 5LGOA 3MO6A 2GDDA 1D6WA 3I29A 1O3DA 3NCLA 3SV8A 1PPCE 3ZVEA 1OS8A 3TU7H 3RU4E 2G4UA 1E37B 2I6SA 1BRBE 2H9TH 4B71A 1IHTH 1O2LA 1W0ZU 1J9CH 1O5GH 1TIOA 3MOCA 1ZHPA 4UFDH 1EUFA 2VIPA 1HAXB 1O2KA 2B0FA 1S5SA 2GCTB 3F2GA 5CMXH 2W26A 2B8OH 3QX5H 1A5IA 1ANCA 3N7DA 1A3BH 2J94A 5EIYA 1KY9A 3I77A 1Y59T 1GGDC 3DUXH 2W5EA 3MYWA 4AG1A 4FUHA 3TJNA 4MLFB 1DXPA 1K1OA 4X1QU 2VINA 3GY2A 1TABE 1TOMH 1TRYA 1S6HA 1UHBA 1WTHD 5F03A 1GJBB 2HWLB 1Y3XA 2Y5GA 1TRNA 2AIQA 1TQ0B 1OPHB 3BG4C 1H8HD 3U28C 4P02A 1GBAA 2ZFSA 2Z94A 4ZMAH 5FX5A 1LO6A 2EI7A 2XC0A 4AYVB 1OHHD 4GLYA 1QB6A 2GP9B 3NWUA 3SO3A 1Z1IA 3P70B 3B8JA 3A89A 3ODDA 3MQKC 3KL6A 3A7YA 4D76A 3M3TA 1DE7H 2ODYB 2LPRA 1KXEA 1ZTLA 1SQOA 2EQNA 1NU9A 1FI8A 3GCTG 1ZHMA 3E3TA 1P57B 3RXMA 1P3EA 1YLDA 3OEHD 2BB4A 2VGCB 4BAOB 2BMGB 1SQTA 5F6MA 1LHCH 5FPYA 1K1JA 4OGYA 2H5CA 4JZEH 3FP8E 1Z6EA 2RA3A 3GICB 1ZTJA 2CXVA 1NS3A 2ZA5A 1V2PT 3EGKH 5FCRA 3RM2H 3QZRA 5FCKA 1G3BA 3DFLA 3GY4A 2P8OC 3UR9A 3LONA 4TPYA 2PTCE 2JDID 1QZ8A 2YNAA 3RXTA 2Y80A 1YKTA 1LPKB 4RSPA 1UK3A 1H9HE 4CREA 3PLKA 1OYQA 1QL9A 3E8LA 6GCHG 2V3OH 2ZDMA 1KLIH 3U1JB 2WPKS 1TQ7B 1A2CH 2BY7X 3SNCA 3QWCH 2VU8E 2EY4C 2XC4A 3E6PH 4X8VH 1TBRH 2SFAA 5AVDA 5GXPA 1ZJDA 1MKWH 2A31A 1P04A 1IQMA 1G2MA 1DOJA 1UVSH 2VIQA 1MBQA 3LU9B 4CBNA 2P59A 4AZ2B 3EE7A 3SNAA 1TWXB 3SJ9A 4HI3A 1C2IA 1ZOMA 2JIZD 4MNYA 1KXBA 3SI3H 3SZNA 5C17A 2QC2A 1V2TT 3F9EA 1TMBH 1PPEE 3M7UA 3UOPA 1SGEE 2FOBA 1AVWA 4TT3D 1LTOA 2V3MA 1YWUA 4JK6A 4WY3A 2M5TA 1OWJA 4NA7A 4ACAA 2ZU3A 2A1DB 3BEIB 1N8OC 4RKJB 1GBCA 1D3DB 3UQOA 4Y6DA 3VG8A 1YCPM 1FNIA 1O34A 1NY22 1AZ8A 1YPGH 2XYAA 5AF9H 3MO9A 1AWFH 1P9UA 5HMAA 2J2UA 1H4WA 4KP0A 1SGIB 3U8OH 3VB7A 1TALA 1GI7B 1P3CA 1HAOH 2F4LA 3UFAA 4KTCA 1SOZA 1YLNA 2BY6X 1UTOA 2BM2A 3ATLA 4Q4LA 4CRBA 1C5MD 3RU4T 1FLEE 3LJJA 4U32A 4MG3A 3PO1B 1O2HA 3M3VA 4BXWA 5HXFA 1FPCH 1VGCC 1QJ6B 1BB0B 4MPXA 4D9QA 1MKXH 1CGJE 2UWPA 4GPGA 3QTOH 4X6NA 2BQ7B 1TE0A 3SU0A 2EC9H 1OWIA 3K2UA 1MU8B 1GMCG 1HB0B 3UOUA 1HCGA 4XFQA 2KCOA 1O2RA 3RM0H 4TSFD 4YLUA 1RGQA 1RXPA 1YPJH 2Z7FE 1LVMA 3KIDU 1GL1A 2FX6A 1PPZA 4HG6A 1CA8B 3KHVA 5FBIA 1L2EA 1TPPA 1ANBA 3RUOA 5TCAA 3ZVAA 1ZRKA 2OK5A 2OBQA 2DE9A 2QE7D 2G55A 2HOBA 2O8WA 5DN6D 2O8LA 1HDTH 3BIVH 4CRFA 1QTFA 4ZHLU 3F2FA 3F2HA 4CRAA 1Z1JA 4TWWA 3TH4H 5A0AE 3A87A 5FXLA 3S69A 4ISOA 1ZPZA 3G01A 3EA9A 1WTGH 1PPHE 4K1EA 3UQVA 3JZ1B 4BAKB 1T8LA 4AGKA 4I7YH 1WSSH 2ALPA 1C5WB 1F5RA 4KTUA 1CT0E 3WWBA 2ZHWH 4H6SB 3GDVA 2F9NA 1O3CA 1TMTH 1XVMA 1BOQA 5EJLA 4AGJA 4MVNA 3RXHA 1C2FA 2ZFPH 1XXDA 4YTAA 5EJZA 5DP9A 3RMLH 1BTYA 4AB9A 4YZUA 1ZMLA 5EQQA 3CP7A 3Q00A 1UCYK 2OP9A 1AN1E 2C8YB 5HIYA 1EZQA 2FYQA 4NZQA 4TYDA 1C1VH 1OWKA 1DS2E 3SQHE 4K2YA 2BVXH 1GHAF 5I46H 1S85A 2PGQB 5GPIB 2LP6A 1SI5H 4DIHH 3OTPA 1KXAA 1GBBA 1C5ZB 1O33A 2V0BA 3AASA 2J92A 2BD3A 2M2AA 5C94A 3TK6A 1HBTH 1GBMA 1AGJA 3MMGA 3T25A 4NA8A 3SQEE 3AVZA 1K1LA 2VH6A 4F48B 1EB1H 4YXWD 4JK5A 2GD4B 3NZIA 1GVLA 1OKXA 1P06A 7LPRA 1ANDA 3LGUA 3PB1E 2C4FH 5ESBA 1P9SA 1CT2E 5B6OA 4X8SH 5EODA 5G4BA 2CHAB 4NSVA 4E7RG 1S81A 5F8TA 2SGQE 5I25A 3RXOA 2O9QA 3DD2H 4NZLA 2EI6A 3TIUA 4CHAC 4OGXA 4AFZA 2BLVA 4X2WA 4AB8A 2QCYA 2VVUA 3FAOA 5JDUB 2P8OB 1BIOA 2F9OA 2WYGA 1CVWH 4CRDA 2JJ1D 5EGMA 2FOEA 1F2SE 3KQDA 7KMEH 3S9BA 3SU1A 2Y7XA 3MTYA 1ELDE 1QL7A 1BDAA 1O2GH 4VGCB 1EX3A 3SNDA 1VCQA 1K0HA 2ZEBA 4GAWA 4X2YA 1N1LA 2H9HA 3OY6U 2ZO3H 3EAJA 4ZCNA 4FUEA 2OD3B 1LHGH 5KEDA 1TA6A 3H09A 4IN2A 4IBLH 2WYJA 1FY5A 3F3BA 1TGTA 3RLWH 2NU0E 1GI6A 1KMHB 2IPHA 4Z6AH 1EPTC 2QN5T 1ETTH 3VXEH 5GCHF 1E36B 1GCTB 1HIAA 1BMNH 1TPSA 2FS8A 3N99A 3ZZ3A 3NRLA 1HPGA 4BTIB 3URCA 2PV9B 3RC4A 1C1RA 4ZKNU 3U98H 2AHME 1BMFD 1CGIE 2ZF0H 4OS7A 1O5DH 4YO9A 4IS5A 5HGGA 3KN2A 1GI8B 4TPIZ 1IQKA 2FI4E 1FX0B 3ZVCA 5SGAE 4H6TA 1TGNA 1SL3A 1NROH 4H4FA 2EEKA 3BTDE 1NTPA 1YLCA 5EXLA 1N8OB 4JZ1A 1W0YH 4UFFH 3SV6A 1EFRD 1B5GH 1X7AC 1KIGH 2OUAA 1PQ8A 3RMMH 2A4QA 3ZV8A 2QF5A 4I8HA 2OC1A 2BD5A 5EW1H 1AKSB 2ALVA 2JJ2D 2Y81A 1O2JA 1GJ7B 1O2TA 3LKWA 1OP8A 3F0PA 1MCTA 4CRGA 2F9VA 2FOHA 2V6NA 1P2QA 1THPB 1Z7KA 5KECA 1W11U 3O8CA 1C2KA 1MZAA 2Q1JA 4DT4A 1ZHRA 5L30H 1K2I1 4DG4A 4J1YA 2ZFRH 1JRSA 1SSXA 1UO6A 4X1SU 1EP6A 1SFQB 4SGBE 2BOHB 5EXMA 1T8OA 3P8NA 2F9PA 2ZNKH 4MNXA 4UE7H 1ELAA 3B23B 1SLUB 1TB6H 4K69A 3OEED 4O3UA 3RXAA 1CA0B 1NT1A 1YPKH 1KLTA 1F5KU 1SGTA 3TITA 1EOJA 1VCWA 1IQJA 1P12E 1O30A 5ETXA 2CN0H 5E0GA 1H8ED 1Y3WA 1BRUP 1G9IE 4BNRA 1V6DA 2VVCA 1UTPA 3MU5A 4BAHB 1QL8A 5E0JA 2FOCA 2HNTC 4MDSA 1E34B 2BDAA 5JPMH 4ZKSU 3A8CA 1O5FH 2ZTXA 3M61U 1IQEA 3VFEA 4FUFA 1CE5A 4UD9H 4PROA 4TY7A 1C1OA 3PMHB 4X1RU 4FU7A 3CNRA 3T2NA 3D49H 1EAUA 1LQDB 3PTNA 2XWAA 3GCTF 3W95A 6LPRA 1NRPH 4LXBH 1WXRA 2R9PA 3URDA 1W13U 3DA9B 1QR3E 3UREA 2XOKD 4I33A 5IYTA 4B6EA 1DUEA 2G00A 4ASUD 1YBWA 2AMQA 3VGCC 4Z1MD 2ZCLP 3MH7A 1P2NA 4RT1A 1ELVA 1T31A 3TJUA 2ZU4A 1J14A 1H9IE 3GCHC 1QBNA 1ZRBA 1MTSA 1NFUA 2ZTZA 4GHTA 1ZPCA 1CO7E 1YM0A 3VXFH 1UTKA 1AB9C 2V35A 2PSYA 5EJ1A 3UWIA 1JOUB 1HFDA 2A7JA 2B7DH 3D23A 1PPBH 1XUKA 1XUIA 3PROA 3S7KB 2OXSA 6GCHF 5GCHG 1F92A 3RXEA 2Y7ZA 4NIXA 1PPFE 2K1QA 3MU0A 1HAHH 1KXCA 1F5LA 2ILNA 1HAIH 2QXJA 1O5AB 4XBCA 4ABDA 2HVYB 4CH2B 4ZH8A 4KELA 4I32A 2FZZA 2H5DA 1DXWA 2ZDKA 1LPZB 2UUFB 2NU4E 1LVYA 2D1JA 4X2VA 1V2WT 2J98A 3K6YA 2OC7A 2XCNA 2V3HH 3ATMA 2PKSB 3KYFA 4AC9A 3VB3A 4FXGH 3EDXB 6ESTA 4CHAB 3E16B 1YC0A 1W3CA 3N7EA 1EXFA 4NA9H 2BD9A 1LDTT 2PLXA 2P3FH 4X8UH 3SU3A 2HLCA 2Z9KA 1H8DH 3RDZA 1CBWC 2QF4A 1O2YA 4AN7A 3PLPA 1T32A 2FMJA 1FJSA 4GUXA 3LGIA 1TFXA 4MNWA 3SJIA 2WINI 2ANYA 1GDUA 1Y3VA 3AAVA 2D2DA 1JRTA 2FX4A 3PTBA 2C8XB 2KCAA 3QUMP 1A3EH 2QA9E 3IG6B 1DICA 3LC3A 1ELFA 4I8GA 1ELGA 4NFFA 4X6OA 3QO6A 1GHBG 2VNTA 3LT3A 2AGIX 3ZZ9A 3LJOA 1V3XA 1C1NA 4JZDH 4LZ4B 3GYMA 1RTFB 1Z8JB 1C5NH 3OX7U 1ZSLA 3M36A 4KKDA 1GJ8B 2GGVB 3PLBA 2BDCA 2TGDA 3I78A 1V2OT 1C5PA 1LHEH 1SGPE 2QIQA 1S82A 2R0KA 2ZWLH 3KQ5A 2ZC9H 3QGNB 5FL7D 5C1YA 3E90B 4DURA 2ZI2H 1RIWC 1SQRA 1GBKA 5DP3A 1EPTB 5JBCS 1BHXF 1XUHA 1KXDA 1UVUH 2GV6A 3SI4H 2R3YA 4O3TA 3ZYEA 1ESBA 2HNTF 1GHYH 3RXGA 2GVFA 3FP6E 2Z9JA 2WV5A 2KFWA 2L6OA 1GMCF 4ABEA 1AWHB 3M37A 3M5OA 3RMOH 2XCFA 1RFNA 3ZZ8A 3KQCA 3ATWA 5GJ4B 2P95A 1AE8H 5KGOA 4NFEA 1KTSB 1XUJA 4ABIA 5K0HA 2XBYA 1CQQA 1BUIA 4NIVA 1AY6H 1K1PA 1WYKA 3PRBA 2VIWA 1WQSA 1N6XA 2KZ4A 3P8OA 4YLQH 1DWEH 3HATH 3HKIB 5F8XA 3GCNA 2Z3DA 1FZZA 1CHOG 2W6JD 1DPOA 2ANKH 1TNKA 2AFQB 3MWIU 1FY3A 4Z0KA 1C9TA 1BRCE 2KCPA 1P05A 3FVFB 2W3KA 3RXVA 1GHZA 4I8JA 4R8TB 3TH2H 4B2AA 1HUTH 1EZSC 2ZKSA 1WBGB 1EJMA 3UNSA 1XUGA 1SPJA 4AYYB 2ZECA 4Y0YE 2C8WB 2ZQ1A 4JZIA 3TK5A 2CJIA 2VBCA 4XD7D 1P2IA 1V2KT 4ZROA 2DUCA 1IAUA 1FIZA 5PTPA 1VCPA 1ABJH 4DVAU 2OTVA 4F4OC 4GCHG 1UJ1A 1VITH 4ZHAA 3ATIA 4TY6A 4IGDA 1NBMD 4AFSA 1K22H 5AFZH 1SLVB 3ELAH 3BF6H 1O3GA 1GI9B 2BDIA 3ZVDA 1DSUA 1FDPA 3LH3A 4LOYH 3WWFA 2FOFA 1MMJN 3E0PB 1ZPBA 2UWOA 5GDSH 4X8TH 2PWXA 4K5ZA 2NU3E 5E2PA 5HIZA 2GZ8A 1BRAA 2GCHG 4Y7AA 4Y11E 1D9IA 1DY8A 4Y8ZA 1B7XB 1TX8A 3BTEE 3PWCA 2A5IA 3R0FA 1GI4A 2BHGA 2BTCE 2KAIA 1QQUA 1LVBA 2OQ5A 1LMWB 1TNHA 2JETC 3SGAE 3SW2B 3M5NA 3SV9A 1OWHA 2G81E 4ABFA 8ESTE 1GJ5H 2SGAA 3VEQB 3D62A 1O0DH 1IQNA 1P02A 3OFND 4FOUC 1O2PA 2SGEE 2ZGBH 5C0TA 5JBTA 1BTZA 1J15A 1FY8E 2J97A 2VB0A 1KLJH 3ZZ4A 2V7QD 3NXPA 5JBBS 3VGCB 4BXSA 3MFJA 3RXLA 1RTLA 3E91A 1BTPA 3RC6A 1FY1A 3KCGH 1UTJA 4ISLA 2GT7A 2FTLE 1AB9B 2FLBH 3UUZA 1CHGA 4X1NU 2G51A 1AE5A 1AZZA 5A2MH 2F43B 1GJ9B 1MQ6A 4DOQA 2FOGA 1C1MA 1GG6B 5HM9A 5ESTE 1BCUH 1GJDB 3PV2A 1OSSA 1V2JT 3GY8A 4FU9A 2Q6FA 2VIDA 1C2EA 4BTUB 4NWLA 1JBUH 1DWDH 1UW7A 2BYAX 4A7IB 3DHKH 1J8AA 3ZIAD 1QB9A 1AO5A 9LPRA 3SYJA 5EU8A 1Z71A 2ZCKP 1B0FA 2Q6GA 1O3BA 3A7WA 5CHBA 1PQ5A 2ZG0H 4B73A 1QURH 1GBIA 1D3QB 1TGBA 2HNTE 1O2MA 1YPHC 3PV4A 1BQYA 1VITF 2WV4A 5CHAB 1OOKB 2EA3A 1CBWB 1G3CA 5DGJA 5GWZA 4BOHA 2J9NA 1BBRE 1L4ZA 1CT4E 3GY5A 4IC6A 2OQUA 3CENA 5F53A 1UTNA 1MCVA 1XUFA 3FP7E 4IC5A 2G52A 4CH8B 3ZZBA 4Y79A 2FO9A 3FOAA 1QRXA 1PQ7A 1D6RA 1ZGIA 4DGJA 1GBDA 4HTCH 1C2MA 3LGTA 1BA8B 1A7SA 4JYTA 1HJAC 1P11E 2CF8H 2YMSC 3EE0B 1ARBA 1GJAB 3LOXA 1C4Y2 2QXIA 1GGDB 4WXVA 4A1TA 1ZMNA 3O8BA 4NIWA 4Y71A 3F9FA 1K1MA 1O3PB 3SV2H 1V2RT 3N7OA 3SJOA 1LVOA 1BMAA 5C5OA 1BZXE 2VVVA 3TLOA 4D8NA 1EZUC 1NFXA 1RIWB 2SGPE 5L2ZH 1WAYB 1HYLA 3BG4B 3UB0A 4Y10E 3SOSA 1TPOA 1TNJA 2K7XA 1P03A 4CBOA 2P3UB 5TJXA 3V13A 3HKJB 2C93B 2WPHS 4YT6H 2FLRH 2G5VA 3A86A 2WHXA 1O31A 1O2WA 1F0RA 5ABWA 1Z6JH 2WPIS 1L4DA 3C27B 4Q80A 3MNCA 1UHBB 4ZXYH 1BT7A 1GBFA 2ZFFH 1SLWB 3P92A 2BQ6B 4JCNA 2UUKB 2TGAA 1ABIH 1AVXA 4I86A 1TA2A 2Z3EA 4UFEH 1UTQA 4Y7BA 1BJVA 1FN6A 1O36A 3BSQA 2HLDD 3M7TA 2XXLA 4RKOB 1NM6A 3OE7D 3SHAH 1NN6A 2ZGXH 2C90B 4XRNA 1G37A 4Q7XA 2BLQA 2BD8A 1Q2WA 3HK6B 4Y76A 1BMMH 3Q76A 3H5CB 5JBAS 1Z8IB 3MH6A 2G4TA 3W94A 3U8RH 4ABJA 2OINA 2ZPQA 4FU8A 3FKSD 4MPVA 1AFQC 1GHWH 2FM2A 2RCEA 4A1XA 1PYTC 5CE1A 1RJXB 2ZDLA 3RXUA 1W0JD
chains in the Genus database with same CATH topology
1A0LA 2QAAA 1DDJA 4AG2A 1W14U 2AGGX 2IOTA 3ZZDA 3TGIE 3VB5A 1IOEA 1AIXH 1TMUH 9ESTA 1CSOE 4LZ1H 4BAMB 2THFB 1J16A 1UVTH 1VZQH 3BTWE 4WMFA 1MZDA 4KTSA 1T8MA 2Y5HA 1IQHA 3VB6A 1TX6A 2LIZA 2SNVA 2JKHA 2I6QA 2ULLA 1O3HA 1GJCB 3FANA 3V12A 1C1QA 2GCTC 7GCHG 1JWTA 2WUBA 3OYPA 1KDQB 2QXHA 1PJPA 5C2ZA 3QK1A 3C1KA 1V2MT 3RXJA 4ZUHA 1ETSH 1GI2A 1MBMA 1VITG 1MUEB 2XC5A 3BEUA 1EB2A 1GBTA 2UWLA 3OU0A 1O3FA 1E0FD 4NG9H 5C5NA 1GMDG 3SUGA 3A8BA 5T3HA 1V2UT 1ESTA 5DKMA 2BX4A 5EW2H 2JH5D 2W3IA 2BXUH 1GHVH 1SGRE 3QGJA 3S9AA 1TYNA 4INKA 2BQWB 3SU2A 3LIWA 4E7NA 1FXYA 4HFPB 4AX9H 5C1XA 2GDEH 1XMNB 5A09A 1QA0A 2G5NA 1DM4B 4DJZB 2ZTYA 1V2QT 3SU6A 1MTNC 1GBLA 1O3EA 2ANMH 2ZU1A 4D7GA 1SMFE 4X6MA 5TCCA 3RP2A 3HK3B 2Y5FA 4GVUA 4BANB 1WQVH 3SNBA 3LGWA 1JIRA 5AHGH 1K1IA 1P09A 2WPJS 2VGCC 4X6PA 1VGCB 1GBHA 1GHBF 4ABHA 1YGCH 3A7VA 2R2WU 2VWLA 1SQAA 4XBBA 2HALA 2ZU2A 1YCPH 1UK2A 4HGCA 5E8EH 1O3KA 1EAXA 1ZLRA 1XM1A 5T6GA 4MQAA 1DT2A 2UUJB 5EPYA 5FBEA 1SLXB 5DP4A 3ZV9A 2BZAA 2P93A 2FTMA 4IN1A 1UTLM 4A6LA 1C5LH 1QY6A 2D26C 1BJUA 5FAHA 1GI5A 1MAXA 3LGVA 1C2JA 3F6UH 3QLPH 2A2QH 2ZHEH 2GT8A 3V3MA 1TOCB 4CRCA 2H6MA 4TWYA 2PUQH 3S0NA 4K60A 3T28A 1EZXC 2QXGA 3SUFA 4WVPE 2VWMA 3A8AA 1S83A 2F91A 3PWBA 4O9VA 1ZSJA 1HJAB 1LKBA 2PHBA 1BTWA 1YPMH 3MNBA 1IQGA 5T6DA 4O97A 5C1UA 1Z8GA 1AUJA 1GWAA 1CHOF 2AH4X 1C1SA 1PQAA 4WXIA 4OS2A 1Z8RA 2J95A 1C1UH 3BV9B 3P17H 4I31A 4GSOA 3SGQE 1ELEE 1NRRH 3A7XA 1HRTH 3BTKE 3AW1A 2O8MA 2WUCA 3T26A 4M7GA 1GBJA 5FPSA 1TGSZ 2FP7B 1SGYE 1LQEA 2FPZA 4DIIH 2AGEX 1TPAE 2FESH 3UR6A 5GIBA 4ABGA 1FV9A 1EQ9A 3RC5A 1DLEA 1A46H 3MHWU 3SORA 1MH0A 2G8TA 1C1PA 5E2OA 2ZCHP 1TLDA 3HGPA 5F8ZA 2B9LA 4GHQA 2Z3CA 1C2GA 4GCHF 2VIOA 1QHRB 1W7XH 1NO9H 1WOFA 1YP9A 4K8BA 2P3TB 1K28D 1YYY1 5DP6A 1K21H 1QRWA 3PO1C 1BBRK 3O8DA 1THRH 1YPHE 1K1NA 1GJ4H 3R3GB 4ZAEA 4HZHA 3V0XA 1FUJA 4ABBA 1QNJA 2FS9A 2BDYA 2GCHF 1SGQE 2A7HA 3ZZ7A 1YPLH 3NUMA 3H7TA 4YM9A 1XKAC 3OTJE 2BD7A 1JMOH 1HJ9A 1GVZA 4B75A 2STBE 1FN8A 3HPTB 4U2WA 4ZXXH 4DY7B 2A4RA 5LPFA 3CS0A 1HAYB 2GTBA 1AVGH 3KGPA 1VR1H 4AOQA 1C9PA 5C3NA 2RDLA 5FPTA 2AS9A 2TBSA 1A5GH 1W12U 2XBVA 2QYIA 4DW2U 3M35A 3TNTA 2F9UA 5HM2A 2F3CE 2FOMB 2A7CA 4R0IA 3F1SB 1W2KH 4IMZA 3RXFA 1TNGA 1GI3A 2XWBI 3M5LA 3SNEA 3EBNA 3UWJH 1H8IH 4IMQA 2FWWA 4NWKA 1KYNA 1AQ7A 2C8ZB 1O2XA 3AAUA 4JMYA 1DITH 3STJA 3BG8A 5A0BA 3TGJE 1P0SH 1SBWA 1P2MA 4YESB 2HPPH 3LH1A 5DP7A 2SGDE 1K9OE 1BTUA 5JYIA 3RXPA 1N6YA 3SGBE 2BY9X 5L2YH 3U1IB 2ZP0H 3HGNA 3PYHA 1NC6A 2ESTE 3L33A 1A1RA 3BTHE 1JIMA 5DJ7A 3MI4A 2ODQA 4WMEA 1ORFA 1IQIA 4ASHA 3K65B 3ZVFA 3U69H 4B2CA 1HIAB 2J38A 4B74A 3UNRA 1Y3UA 4X0WU 3GYLB 2VWNA 3S9CA 1GMHF 3A88A 4Q7ZA 1FQ3A 3SJKA 3T29A 1INCA 1MTNB 3RLYH 4AFQA 1DX5M 4YOIA 1IQLA 3PMAB 1C1TA 1O5CB 1UTMA 2Y6TA 1FY4A 4BAQB 1ZR0A 2ASUB 1C2HA 2A4OA 1AMHA 1MTVA 1WU1A 1TONA 1SB1H 3A83A 3KQBA 2R2MB 3RXSA 4Q7YA 3UNQA 3UIRA 2AYWA 2CHAC 4D7FA 3QDZB 3MU1A 1NU7B 2ZPSA 1J17T 3GISB 2J34A 3ESTA 5EOKA 3ZVGA 1HGTH 2Z9LA 1G30B 2Y82A 2PKAB 5AFYH 2AERH 1C4V2 3BTGE 3TJOA 4OS4A 4OS1A 8GCHG 1F0UA 2BVRH 7ESTE 2BZ6H 2O8TA 3TH3H 3FFGA 1QQ4A 5EXNA 3NPSA 3SV7A 2Z6BD 2H1UA 1SGCA 4NIYA 4FVBA 3S7HB 1KXFA 1ZZZA 2TIOA 4XE4A 1EJAA 1BHXB 1DY9A 1O2NA 1KDQA 1OP2A 4VGCC 4RN6A 3ZZ6A 3PMBB 1E35B 1UVPA 1D3PB 3RXRA 3T62A 1B0EA 1Q3XA 2H9EH 4AFUA 4DCDA 3IWMA 1OWEA 5HYOA 1T4VH 2QGRA 2STAE 2BXTH 1WCZA 2IN2A 4CR9A 3F9HA 1TAWA 1O35A 3P8GA 1Q31A 3IITA 4UDWH 2GX4A 3A8DA 4O03A 4THNH 2Z9IA 1V2NT 4U30A 3TJVA 3F68H 2P16A 4ISIH 1MKWK 3RXIA 2ZHFH 2HVXA 2HPQH 2BD4A 2YOLA 1GL0E 1O3IA 2ZDAH 1S84A 1EATA 3A7ZA 4UONA 1GCTC 1EASA 4FUJA 2ZDVH 1Y5UT 5DG6A 1AKSA 1O2SA 1F0SA 2ZFQH 3GCHB 3UPEA 2AEIH 1C4U2 1P10A 1SOTA 3MU8A 3ENSB 3QZQA 1NRNH 1ARCA 1F7ZA 1C5XB 1OWDA 1G36A 1QBOA 2A32A 3GOVB 1C5RA 3E1XB 3GDUA 2R0LA 3SHCH 4K1TA 4FUCA 8KME2 1C5QA 3ODFA 5A8ZA 3WY8A 4X1PU 1ELCA 4ZKRU 1BITA 1VJ9U 2NU1E 2PUXB 4A1VA 4ABAA 2SNWA 3ITIA 1ELTA 1TNLA 1DVAH 1Y8TA 4X2XA 1C5OH 1VJAU 3M3SA 5LPRA 3OSYA 1C5SA 3KEEA 1FONA 3QN7A 4ISNA 1BTHH 1S0QA 1SR5C 2AMPA 5BPEA 3DT0H 3GCOA 4I8KA 1SGFG 1O2OA 1O3JA 3BTQE 1T8NA 1C5TA 7GCHF 1L1GA 1UMAH 2VIVA 5DP5A 1SHHB 4NSYA 1ESAA 3SBKA 1GMHG 1RS0A 1YF4A 4QT8C 3SU5A 1AUTC 1YPEH 4OS5A 1MKXK 1C1WH 2PGBB 2AIPA 1DLKB 4XSKU 5EQSA 5FHTA 2ZHDA 1CA0C 1GVKB 1CGHA 1MD8A 1GMDF 1GI1A 3NKKA 1NFWA 5J4SA 1NRSH 3NK8A 2A5KA 1T7CA 3K6ZA 4UFGH 5K7RA 2BY8X 4WF8A 4WH6A 4BTTB 1HAVB 4YOGA 2NU2E 3BIUH 4Y0ZE 1G3DA 3JZ2B 3PMJA 3RXKA 3KQEA 1O37A 3CS7A 3K9XB 4ZKOU 3VPKA 1GCDA 4DT7B 4F49A 2W7SA 1GDQA 2ZQ2A 1V2VT 2NWNA 1IQFA 1L1JA 1HAZB 4MNVA 1AI8H 2UUYA 1UCYH 2TPIZ 3BTME 1NZQH 6CHAC 3TVJB 1GHXH 3GY7A 1GJ6A 2BDBA 4K8YA 2QF0A 1LKAA 2GZ9A 2CF9H 4YOJA 1W10U 1ETRH 2ZGJA 1TBZH 5A8YA 5LPEA 5J4QA 2ZGCA 3D65E 1HV7A 2YNBA 3FZDA 1E38B 1OP0A 1XKBC 1XX9A 4SGAE 1LCYA 2XBXA 1OXGA 2ZIQH 4FUBA 5A8XA 1QBVH 1RTKA 4B2BA 1EJNA 4A92A 2PFEA 2EI8A 3U9AH 1O3MA 3L3TA 3TPIZ 3ZYDA 2FXRA 1AFEH 1LHFH 1QGFA 2R3UA 4OS6A 2QY0B 3A81A 2BLWA 2OC0A 3A7TA 1O2ZA 1ZMJA 1ZTKA 2HGTH 1KTTB 2TGPZ 5EPNA 2BOKA 2VJ1A 3EYDA 3FZZA 1GPZA 1BTXA 1HLTH 1P01A 4XOJA 1JXPA 1G32B 4U01A 3RU4D 2BD2A 1P8VC 1M9UA 3LDXH 3MNXA 1MTWA 5EQRA 2PKSC 2XTTB 3AW0A 2HRVA 1U6QA 4INHA 1OYTH 2F83A 1BMLA 5DP8A 1A4WH 1O32A 1F0TA 1WV7H 2GMTC 5H4IB 2ZU5A 1SG8B 3RXBA 2DE8A 3ZZCA 5DK1A 3B9FH 2W7UA 3SJ8A 3LC5A 2RA0A 1NPMA 5C20A 1MU6B 4B76A 1QFKH 2VWOA 3BEFB 1O2VA 1C5YB 2SGFE 2XRCA 5DPAA 2C3SA 1EPTA 1HNEE 2TGTA 5EG4A 2F9BH 3ZZ5A 3SUEA 1ZSKA 1H1BA 5E0HA 3U8TH 3SU4A 4Y8YA 3PM3A 1A0HB 2J4IA 2ZHQH 1LHDH 1HXFH 1MQ5A 1DSTA 1C5VA 3M5MA 4Y8XA 2PSXA 1V2LT 2PW8H 1O3LA 3OY5U 1NESE 1O2IA 4XDEA 5T6FA 5C67A 1P2KA 4ISHH 2BDGA 1QJ7B 1GBEA 2JETB 1ELBA 2Q6DA 1DANH 2XBWA 4NCYA 2ZZUH 1UVOA 1ID5H 4CR5A 1MD7A 2FI5E 4E06H 1O3NA 3E0NB 1PYTD 1GI0A 1HAPH 1IHSH 3P8FA 1O38A 2OBOA 1O3OA 2OLGA 3T5FH 2BX3A 3A80A 1DWCH 5BRRE 1O5BB 4B1TA 4WWYA 5IDKA 3MH5A 4XBDA 3ZZAA 1AU8A 2JH0D 2KAIB 4E05H 1MAYA 2QF3A 1V2ST 1S6FA 1FAXA 1THSH 4D9RA 5JB8S 5A0CA 4FUDA 1C2LA 3BTFE 2JH6D 4LK4A 1QA7A 1RD3B 3SN8A 3BTTE 2LNCA 3Q77A 1HAGE 1SGDE 1ZYOA 3Q3XA 2ZFTA 1DUAA 1CU1A 1AHTH 2PKAA 2WPLS 1C5UA 1O5EH 1ANEA 1EKBB 2FOAA 4ESTE 1Y5AT 3KF2A 1ZJKA 4JYUH 2CMYA 2A0QB 1OX1A 2P94A 1O39A 2OCVB 1HXEH 8LPRA 1UK4A 1NFYA 4K1SA 1FMGA 1XVOA 1SC8U 5LH8A 3STIA 1GHAG 2RG3A 1FAKH 3Q3YA 3A84A 1QRZA 1SVPA 1SGFA 1T4UH 1W8BH 1P2JA 2ZGHA 2FYRA 3V7TA 1XXFA 4ZHMU 1FPHH 1Y3YA 3SUDA 4A5TS 2GKVE 4JZFH 1KSNA 2BY5X 1G2LA 1YCPK 3M7QA 2IJOB 2BVSH 2XNIA 1EAWA 1A0JA 1PFXC 3T27A 1O2QA 3MO3A 1C2DA 1FIWA 2QV1A 3A82A 1L0ZA 1S0RA 1A61H 2A5AA 1GDNA 3A85A 2FIRH 3KNXA 3MH4A 4H42U 3RXCA 2FEQH 2ODPA 4AORA 3EA8A 1EAIA 4IW4E 1G3EA 2GV7A 1TRMA 1W7GH 3ATKA 5JB9S 3F9GA 1TBQH 2FI3E 1WUNH 2VH0A 3LGYA 1HJ8A 4WMDA 1O3AA 1MTUA 1QJ1B 1P2OA 1DWBH 6CHAB 4MPWA 1ZGVA 1TNIA 3GY6A 1PPGE 2B5TB 2A45B 2TRMA 1SHYA 3TNSA 2Z9GA 3MNSA 3P95A 1QIXB 4K3JA 3H7OA 2H2ZA 3DFJA 4MPUA 2AMDA 2A4GA 3VB4A 1DFPA 1TX7A 3P6ZB 4J2YB 4INLA 3EA7A 1AD8H 1QB1A 4JYVH 4KGAA 3O8RA 8GCHF 1ACBE 2BLOA 3L6PA 4FVDA 1A5HA 4I8LA 1BBRH 5L6NH 2PR3A 3RMNH 3RXQA 1NRQH 4MTBA 4WJG2 1GG6C 2OC8A 5FX6A 4FUGA 1UCYE 2ZDNA 4UEHH 2CV3A 2XW9A 3BN9A 4FUIA 3TGKE 3GDSA 3MU4A 1D4PB 2FODA 3GY3A 4Q2KA 3ZVBA 3LPRA 4NGAH 1Y5BT 2GZ7A 1L1NA 2PTNA 1AFQB 3Q3KA 2D8WA 3EQ0H 3TK9A 1LPGB 2ZPRA 3UTUH 2A2XH 1QCPA 1HAVA 3UY9A 1D3TB 1RRKA 4YT7H 2FDAA 1SGNE 1EP5A 1O2UA 3QTVH 2BDHA 1SFIA 2GMTB 2WPMS 1TGCA 5CHAC 1H9LB 4WH8A 3RXDA 2ANWA 1EOLA 2CGAA 5DO4H 2O8UA 5LGOA 3MO6A 2GDDA 1D6WA 3I29A 1O3DA 3NCLA 3SV8A 1PPCE 3ZVEA 1OS8A 3TU7H 3RU4E 2G4UA 1E37B 2I6SA 1BRBE 2H9TH 4B71A 1IHTH 1O2LA 1W0ZU 1J9CH 1O5GH 1TIOA 3MOCA 1ZHPA 4UFDH 1EUFA 2VIPA 1HAXB 1O2KA 2B0FA 1S5SA 2GCTB 5CMXH 2W26A 2B8OH 3QX5H 1A5IA 1ANCA 1A3BH 2J94A 1KY9A 3I77A 1Y59T 1GGDC 3DUXH 2W5EA 3MYWA 4AG1A 4FUHA 3TJNA 4MLFB 1DXPA 1K1OA 4X1QU 2VINA 3GY2A 1TABE 1TOMH 1TRYA 1S6HA 1UHBA 1WTHD 5F03A 1GJBB 2HWLB 1Y3XA 2Y5GA 1TRNA 2AIQA 1TQ0B 1OPHB 3BG4C 1GBAA