4OS2A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk602 (bicyclic 1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os2A01
2PR3A 1C1MA 2HNTE 1OWHA 3M5NA 1BRCE 1CHGA 1D3QB 2ZTXA 3CENA 2ODYB 3LPRA 3ZZ9A 5TJXA 2OINA 3I78A 3T27A 1HAPH 5C1XA 1AY6H 3LGYA 3C27B 2F83A 2FO9A 4H6TA 3VXEH 2R2WU 1K1OA 4F49A 1DX5M 1THSH 5HYOA 1EB2A 1W8BH 1D6RA 4H42U 5A0BA 2H1UA 1BTHH 4HFPB 2UWPA 1G37A 1EATA 4SGAE 2BY5X 1W13U 2Y5FA 1LHEH 4NGAH 1A1RA 3IWMA 1O30A 2A5AA 2QN5T 1DICA 1UTJA 5EG4A 3AW0A 1YPLH 4ISIH 5EQSA 2ZHDA 4B1TA 3DHKH 2PHBA 2R0KA 5E0JA 1KXDA 3K65B 1AFQC 1TRMA 5E2OA 1C2EA 1BITA 3EAJA 3TJNA 3KEEA 1SGCA 1JBUH 2UUKB 3ZV8A 3E3TA 1GPZA 3R0FA 2BQ6B 5JBTA 3P17H 1H9IE 1DUEA 2ZGBH 3A8DA 1F0UA 2P8OB 5FCKA 3GDSA 1UTMA 4ISLA 1GI4A 3U8TH 1EOLA 1EX3A 2O8WA 5DP9A 1Q31A 5F03A 3A89A 1O34A 1JIRA 1NM6A 2ZA5A 3RXIA 2FLRH 4NZLA 4WMEA 1FY8E 2BY9X 4FXGH 3RXSA 1IQMA 1V2QT 1WV7H 5T6FA 1NFUA 3V3MA 3KF2A 1P2JA 2PLXA 1T8NA 4WMFA 1V2KT 3GY6A 1ELVA 4JZ1A 1JXPA 4YOGA 3VB7A 2XBXA 1VCPA 2XTTB 3AAUA 2VWLA 5AFYH 1C1TA 3TK5A 3C1KA 1SB1H 3LGVA 3SU3A 1FJSA 1CU1A 4DGJA 3ZVBA 1AKSB 1P2OA 3TIUA 1IQEA 2H5DA 4AG1A 1DXWA 1PPBH 5ETXA 1O38A 3MTYA 1NT1A 1DPOA 3RXKA 1LVMA 1C5WB 3UUZA 2VIPA 2FOCA 1K1LA 3PO1B 2BX4A 4U32A 1QR3E 2AGGX 1OSSA 2PKAA 1QA7A 2ZPSA 1AVGH 4TYDA 3M7QA 5FXLA 2PTCE 2G4UA 2HGTH 1MKXH 5C67A 9ESTA 5FPTA 2QCYA 1ANBA 1DOJA 2ODQA 2Q6DA 1GBJA 3VB4A 1C4Y2 1YC0A 1WU1A 4JCNA 1AE5A 1GHYH 1OPHB 1C5XB 2FOAA 3L33A 3LH1A 3SHCH 4CRAA 1O3FA 3M3SA 3ZVGA 3PMHB 1ESTA 2FI3E 1LCYA 1O2RA 2GV7A 3E0PB 1DVAH 1SMFE 3K9XB 3BEIB 2FYRA 2PWXA 2O8MA 1ETTH 5LH8A 1V3XA 2ESTE 4E06H 3FVFB 2BD4A 1GI1A 2VGCB 2ILNA 3ZZ6A 1LMWB 1Y5AT 5GJ4B 5ESTE 1TNIA 4YESB 2QC2A 1P2QA 4IC5A 2W5EA 2FYQA 1QB6A 4YZUA 1FXYA 1RGQA 3M3VA 1PJPA 1HRTH 4INKA 3RXUA 8GCHG 3E16B 4D7GA 2Z7FE 5HXFA 2ZFTA 4X8VH 1OWIA 5A8ZA 1D6WA 1EXFA 7KMEH 2B0FA 1CGHA 1W7GH 2A4QA 5F8TA 1T32A 4BXSA 2G81E 4WVPE 5L2ZH 1IQKA 2SNWA 1LTOA 1G9IE 2VIDA 1YLCA 3S9CA 1MBQA 1EZXC 1AE8H 3DFJA 4Y7AA 2CGAA 3A8BA 5C20A 3E0NB 2VVVA 4A1VA 4ISOA 5G4BA 1VITG 3ZVAA 2TBSA 2GT7A 4YM9A 4QT8C 5DP7A 1SGNE 2HPPH 1SQOA 1QFKH 2F9NA 1DFPA 3S7KB 1Z1IA 4XBCA 1RS0A 4BAOB 1ZJDA 1CGIE 3BF6H 1SVPA 4K1SA 4NIXA 1ZMJA 4THNH 1GBMA 4CREA 2SGEE 1G2LA 3UFAA 1OXGA 5GPIB 1SC8U 2TPIZ 2AMQA 3LKWA 4ISHH 1K9OE 3EDXB 1O39A 2FOBA 3M37A 5A0AE 1NZQH 4CRDA 1TMBH 1LPZB 2ZHEH 4X2XA 1SGYE 1KLTA 2WINI 4BOHA 3JZ2B 4FUJA 2HNTF 4FU7A 2IN2A 4A7IB 2OTVA 1GI5A 5A8XA 4IMZA 2ZTYA 1XVOA 1P09A 1A0HB 2FDAA 2G5NA 2ZDLA 2BDIA 2XBVA 5EOKA 3RXBA 1GGDC 2GCTC 5I25A 2BVXH 1MTWA 2P93A 3OTJE 4Y79A 2PSXA 3RLYH 2C8YB 3TNSA 2WV4A 1O2VA 2XCNA 2OC7A 2ZDAH 1HAVA 1UO6A 1ANEA 2DUCA 2IOTA 2LNCA 2BMGB 2VB0A 1IQHA 4D8NA 1UVUH 4IW4E 2ZG0H 1ELFA 1NO9H 8GCHF 1S6FA 3RXHA 1A3EH 3WY8A 3BIUH 4A92A 2ZEBA 3QK1A 5H4IB 3A83A 3KHVA 2J94A 1C5PA 2WPMS 2CF9H 1ELGA 3ATIA 1DDJA 5JYIA 3RDZA 2Y7XA 1O37A 1QQUA 2BB4A 1Z7KA 2TIOA 1GL0E 4IS5A 2FI4E 2C8WB 2B7DH 2SFAA 3M5LA 1O3EA 1UVOA 1BUIA 2AEIH 3UIRA 4ZAEA 2Z9JA 4D9QA 1MQ5A 3SHAH 2H9TH 5DP8A 1HBTH 1SOZA 4M7GA 3ITIA 1EZSC 3URCA 1FAXA 4NIYA 3T26A 2F9BH 1TX8A 3SNCA 1EUFA 1IQJA 1RD3B 3OSYA 4Y76A 2HPQH 1CA8B 3MU8A 5DO4H 4DG4A 1AZ8A 2FOGA 1ZHPA 3EQ0H 3RP2A 1EPTA 3UR6A 1O2WA 3DA9B 2EI7A 4GPGA 1TGSZ 1BRUP 1UTNA 4Y7BA 1TRNA 2ZCHP 1L4DA 1D9IA 2O8LA 1XXFA 1SHHB 1S81A 2WV5A 1J17T 1DLEA 2P94A 1HJ9A 4ABDA 1QY6A 1C5UA 1ARBA 1C5QA 1YGCH 1MAYA 3A81A 3TJUA 4MQAA 3QO6A 1IAUA 3PTBA 2XBYA 2QXJA 4MVNA 4ZXXH 4JZEH 2HNTC 2J92A 3RU4E 3ELAH 1AIXH 1WYKA 1GMCF 2C8ZB 3N7OA 4NCYA 1AO5A 1BMAA 1GMHF 3A7YA 1GBLA 2BD5A 3K2UA 4CRFA 2A0QB 2GTBA 3ZYDA 1A5HA 1X7AC 3T25A 1P3CA 4B2CA 8KME2 5JB8S 4MDSA 1N1LA 3LH3A 2ANKH 2ALPA 3ZZ5A 5J4SA 1HXEH 1HXFH 2TGPZ 1C4U2 1O2TA 1LHFH 1ELCA 3MNBA 1MMJN 2VH6A 2HALA 1DM4B 2BLOA 2R3UA 1FDPA 1ZMNA 1D3TB 1SGEE 4F4OC 1V2JT 7ESTE 1DWDH 4GLYA 3EA9A 1ZSLA 4X8TH 2CHAC 3P8OA 1UCYK 3O8CA 3CS7A 2WUBA 3T29A 1SBWA 4KTSA 1A0LA 2G55A 4OS5A 3L6PA 1C2JA 1XUIA 4X6NA 4NFFA 2VH0A 1MTVA 1O5FH 1QL9A 1O31A 4JMYA 1LVBA 4KTUA 3MNSA 3SO3A 3E1XB 2D8WA 1C2IA 2VGCC 1A61H 1NY22 4R8TB 1K1MA 1P57B 4K69A 3BTQE 3SUEA 1BMNH 3TH2H 1GJBB 3TJVA 4AB8A 3LU9B 3VB6A 2GMTC 1BMLA 1S82A 1XUFA 5T3HA 2BY8X 1OP2A 2PKAB 1EKBB 4JZFH 1CA0C 1FZZA 1D4PB 1ORFA 4KGAA 1GBFA 1F2SE 1O32A 1MZDA 1NN6A 3W94A 4LXBH 2P3FH 1Y3UA 3UWIA 4GHTA 2BQ7B 1O3GA 4TPIZ 1VGCC 2FIRH 2KAIB 3KCGH 1AU8A 4X1PU 2WPJS 2AMPA 1G36A 4I8JA 3S7HB 1TPSA 1Y59T 3TJOA 1YCPH 2THFB 3GCOA 1ZGVA 2FX4A 2FEQH 1A46H 1LQDB 1ETSH 1GHXH 1GMDG 4MPVA 5PTPA 1EOJA 4E7RG 6LPRA 3HK6B 1AWFH 2GZ7A 4O3UA 3TU7H 5AHGH 1O5DH 2ZFFH 1IOEA 2BDHA 3M7UA 1AQ7A 2ODPA 3RMLH 4XE4A 2YOLA 3T5FH 1T7CA 2F3CE 3UQVA 3P8GA 4OGYA 2BOKA 3SV9A 1MUEB 3MH6A 1N8OB 5B6OA 4NSVA 3SJ8A 1GBIA 1GHWH 1TGBA 4CHAB 2YNAA 4CR9A 3M3TA 1OWDA 1INCA 1SGTA 1KLJH 2W7SA 1HDTH 2H9HA 3QLPH 3QGNB 1SGDE 3TK6A 4WWYA 3A7TA 3SZNA 3SUFA 1LHCH 5J4QA 2VIVA 1RXPA 2XXLA 3NZIA 2V3OH 3SJOA 3UNQA 1O3AA 3ZZ7A 1LPKB 1H4WA 1EJAA 1UTQA 1C9PA 1YYY1 1N6XA 4K3JA 4LOYH 2VIQA 1MD7A 3NPSA 3OX7U 3Q77A 2D26C 1CVWH 1C1OA 1TMTH 1TOCB 1SL3A 2ZKSA 2ZTZA 1MKWK 1EZUC 1P9SA 4JZDH 1IQGA 2RDLA 4JYUH 1H9LB 2D2DA 3SNEA 1AFQB 2BLQA 4GVUA 1RFNA 2SGPE 1C2KA 2AFQB 3DT0H 1PPGE 2BDBA 1OOKB 3U8RH 4E05H 3LGTA 4VGCB 2BD2A 2ZC9H 1G2MA 2R9PA 4AYVB 3G01A 1EPTB 1JWTA 4CR5A 2HWLB 4FVBA 1NS3A 1CT4E 4JZIA 2NU1E 4ZHLU 1BTWA 1J8AA 1Z6JH 3UREA 1IQLA 5GCHG 2ZGCA 4ABGA 1P06A 2Y6TA 2Q1JA 2BDCA 2GKVE 2V3HH 1TE0A 3V7TA 1TOMH 1NESE 1AN1E 4K60A 4AFQA 1Z8RA 2ZF0H 1P2IA 1ANCA 4CRGA 1NC6A 2FMJA 2FOMB 7GCHG 5A0CA 1UTLM 1L0ZA 3MU5A 3PWCA 3QDZB 1ESBA 1UTOA 2ZDKA 3KGPA 3KQDA 1C5TA 1CGJE 1GI2A 2ZU3A 4X1QU 1BTUA 1L1GA 1TBZH 3FP8E 2ZCKP 1HAVB 3Q3YA 4FUDA 4WMDA 2G52A 4BTTB 3FFGA 4Y11E 1UVSH 3OU0A 2BLWA 1QCPA 4ZKSU 3O8BA 1GHVH 1FY1A 1NU9A 3ENSB 3K6YA 1FQ3A 1K1JA 1ZTLA 4I8LA 5DPAA 4X1SU 1BT7A 3PLPA 3RXEA 4UFEH 2C8XB 2BD7A 2FPZA 3GY2A 1BHXF 3GY5A 1C1QA 3URDA 5L2YH 1PPCE 1G3BA 4Y0ZE 3QZQA 1KDQA 1A5GH 4GUXA 3E90B 4NZQA 1ZGIA 2ZPQA 1BQYA 2B9LA 2ZZUH 1XM1A 1T4VH 1P04A 1C2MA 1IQIA 1L4ZA 1TNKA 1ZTJA 1QQ4A 5CHAB 3VGCC 4XOJA 3VPKA 1SGFA 1OYTH 1TBRH 1GHBG 4U01A 2BD8A 4GAWA 1V2NT 1LDTT 1MKXK 3ATKA 4Y6DA 1XXDA 3TGJE 1AZZA 3QTVH 4MPWA 3RXMA 1UK3A 2EA3A 3UNRA 1V2MT 1F5LA 2ZWLH 4X6MA 2Z3CA 1ZJKA 4YLQH 2ANWA 1CSOE 3UR9A 1VITF 1GMCG 1SGFG 6GCHF 3U1IB 4UE7H 2FESH 1DSUA 2WPIS 1O3MA 4CBOA 2SGFE 1BZXE 1JOUB 2A7HA 4KELA 4D7FA 1SFQB 3O8DA 2ANYA 4AG2A 3PMBB 1A4WH 4YT6H 3EA8A 4DT7B 3D49H 1RJXB 4DJZB 1VJAU 3B23B 6CHAC 3ZZBA 1K22H 1GJ5H 1RIWB 4BAHB 5TCCA 4NA7A 1FY3A 1U6QA 1C2GA 1TIOA 5GIBA 4LZ4B 1LHDH 1EPTC 2FP7B 3BTEE 5HM2A 1SLXB 2Z9KA 1GG6B 1KIGH 1FIWA 1P3EA 1RIWC 1S83A 1FLEE 2GVFA 2PSYA 1HIAB 2P59A 1GG6C 1EJNA 3M7TA 4FUBA 3SI3H 3ZZDA 1BTPA 1QNJA 1C5NH 1RRKA 2QGRA 1TFXA 3SU6A 1EJMA 1F0RA 1GBHA 3SJ9A 1V2LT 5SGAE 1GJAB 1OKXA 1T8OA 2UUYA 2ASUB 4ZH8A 5EXLA 5K7RA 3RXJA 4D76A 1QBNA 3BG4C 4NWKA 4RN6A 3TH4H 1SFIA 1GVZA 4TWWA 3OY5U 4BTIB 3QUMP 1SG8B 4U2WA 1O3IA 1G3EA 1ZPBA 1SOTA 1Z8GA 3GCHC 1C1UH 2GDDA 3SJKA 1ZZZA 2SNVA 5EU8A 2V0BA 3RC4A 4ABIA 1L1NA 1HGTH 5E0HA 1AGJA 3HKIB 2ZQ1A 1O2MA 5F8XA 3BTHE 3PB1E 3STJA 5EW2H 1AB9C 2VNTA 1C5MD 1S84A 1DWCH 4INLA 1QHRB 4WH8A 2CMYA 1DE7H 3S9BA 1D3DB 1ZPZA 3PLBA 1NRQH 1HAXB 3S9AA 1GBDA 4ISNA 1IHSH 2WPHS 1MU6B 4OS6A 4ZXYH 2BXUH 1O3BA 1VGCB 1HB0B 5C2ZA 1CHOG 3L3TA 1UTKA 3ATWA 3RXGA 3SU1A 3LONA 1F5KU 3FP7E 4Z0KA 3VFEA 3KQEA 4BANB 5BRRE 5L30H 3TNTA 2PTNA 3Q76A 3F6UH 2O8TA 1OWKA 1TQ0B 2XCFA 1EASA 1MQ6A 1LPGB 4AN7A 2PFEA 1HJAB 6GCHG 2GCHF 5JB9S 1Z8JB 3AVZA 3TK9A 2EI8A 1YM0A 3BTME 1O2ZA 3CP7A 5CMXH 4JK6A 3SV7A 1P8VC 1TA6A 3BTDE 5HGGA 4DW2U 2B8OH 3P95A 1SGRE 1YPHC 2ALVA 4TY6A 5FX5A 4CH2B 1Q2WA 1IQNA 4X1NU 5DP6A 1ABJH 1UHBA 3MU1A 1GDUA 1TWXB 3I77A 3MH4A 1C5LH 3RXDA 3GISB 1QTFA 1C1PA 1SLWB 1TALA 3MH7A 1O5EH 1KXAA 2J34A 3M35A 1CT0E 4I8GA 4WXIA 4K1TA 1TPAE 1C2HA 1GJ9B 3GICB 1QB1A 4OS7A 2EEKA 2JETC 4GHQA 1RTKA 1FV9A 3MU4A 3EA7A 2A32A 2AGIX 4A6LA 4UONA 2Z3EA 2PUQH 4ABEA 1AWHB 2JETB 1GVKB 4Y8XA 2VVUA 2W3IA 2B5TB 2ZDVH 3GDUA 1Y5UT 3LGUA 1Y8TA 1QBOA 3KNXA 1E34B 2G8TA 1GBAA 1LQEA 2ZIQH 4WXVA 1TPPA 5GDSH 2I6SA 2LPRA 1O2UA 3U69H 1YP9A 6ESTA 1PQ5A 1G3DA 2VWNA 2ZGXH 3DD2H 1EQ9A 5DG6A 1MH0A 1TQ7B 3FP6E 1C4V2 5LGOA 1KXEA 1EAIA 1D3PB 1OP0A 1Y3XA 2ZCLP 2SGDE 1ZHMA 4MPXA 1CHOF 4CRCA 1O5AB 5JBAS 4ZKOU 2NWNA 1HFDA 2BLVA 2VINA 2GD4B 2I6QA 3A84A 1JMOH 3U9AH 1WTHD 2A5KA 1TX6A 2BD3A 3M5MA 1EP6A 2QV1A 2XBWA 3KQBA 1XUKA 1ZPCA 3SQHE 2BVRH 2ZU1A 4A1XA 1O3LA 2QXIA 4B73A 2IPHA 4FUEA 3ZVEA 1C5VA 1ZTKA 4OGXA 4X2YA 1C2DA 4IN1A 2PGQB 1TGTA 3PWBA 1KLIH 1DT2A 2V6NA 2UWOA 3BEUA 4A1TA 1K1IA 2QF3A 1O2HA 3A88A 4AZ2B 4YTAA 4ABJA 3PMAB 3A7WA 4YOJA 1HIAA 1A0JA 1YPJH 1PPZA 1BBRK 3UNSA 2C90B 1YCPK 4X6PA 2GV6A 1P9UA 1GBKA 5HMAA 1AKSA 1BCUH 1TRYA 2ZDMA 2ZO3H 5DP4A 2FX6A 2UUFB 2NU3E 2OUAA 4A5TS 2Y5GA 1B0EA 1HUTH 1O2LA 3NK8A 4K8YA 2BM2A 1GHAF 2FODA 2P16A 4ABHA 1GVLA 1ZYOA 2FZZA 2VVCA 1T4UH 2CN0H 2G00A 4AOQA 4YO9A 3NUMA 1A2CH 1ID5H 2WYJA 5I46H 4OS1A 1P2KA 2Z94A 1TPOA 3ZZCA 1UK4A 5FBEA 3V13A 3ODDA 1ZRBA 1PPHE 1YLDA 2XWAA 3NXPA 1P05A 4O3TA 3P92A 4X0WU 2Y80A 4K8BA 1TBQH 3ZYEA 4CH8B 1Z8IB 3V0XA 3BTTE 2GCTB 1CT2E 1ZLRA 1WTGH 1GDQA 3A7VA 1ANDA 3RXTA 4ZMAH 3TITA 1N8OC 2NU0E 5CE1A 1O2YA 2ZP0H 1HPGA 4XSKU 5C5NA 3QWCH 3F1SB 3U8OH 4AGKA 1YKTA 1O3CA 4ABBA 1FIZA 1UVTH 1C1VH 2K1QA 6CHAB 2QAAA 1ZHRA 3MYWA 2H2ZA 4I8KA 1IQFA 1LVYA 1DS2E 3OYPA 3RUOA 3SUDA 3Q3KA 1BBRE 3UQOA 1PYTC 4DIIH 1WSSH 2ZDNA 2FLBH 1ACBE 4UD9H 2QY0B 4IGDA 2PKSB 2VU8E 2TRMA 1WOFA 1PFXC 1TNHA 2ANMH 4O97A 1TAWA 2Q6GA 3QGJA 2OD3B 1F0TA 1FAKH 1Z71A 4AFUA 1GL1A 2GZ9A 2PGBB 3AW1A 3Q00A 4I8HA 3E8LA 3PV4A 1UK2A 3M36A 2DE8A 4H4FA 5EXNA 5IYTA 2J4IA 1BMMH 1LVOA 2H9EH 2STBE 2RA3A 1O5CB 3GDVA 1DSTA 4UFFH 2WPLS 1XVMA 5DGJA 2ZFSA 1K2I1 1W12U 1GDNA 2VJ1A 5E8EH 3KQCA 4ZHMU 1EAXA 1YPMH 2R3YA 5EODA 1UCYH 2XRCA 2FOHA 2EI6A 5A2MH 1BJUA 1TLDA 4X8UH 2GT8A 3UTUH 1DXPA 1O2QA 1QB9A 1T8LA 4RSPA 4ESTE 1Y3VA 3P70B 3LGIA 2QIQA 1YF4A 1TMUH 4BTUB 1TA2A 1HJ8A 4X8SH 1K21H 1GJ8B 1DITH 3S0NA 4NSYA 3GY8A 1QRWA 3H7TA 4MG3A 3SV6A 5JPMH 3TGKE 1G30B 1N6YA 1J14A 3HGPA 1C5YB 1ABIH 2AERH 1F5RA 3GOVB 4TY7A 1C1WH 2FOEA 3BTFE 1JIMA 1SLVB 4DVAU 1GGDB 1QBVH 5T6GA 1ELEE 1AUJA 1O5BB 1E38B 3K6ZA 5IDKA 1TNGA 1VR1H 1K1PA 3MHWU 4B75A 1EB1H 3H5CB 4Z6AH 5FCRA 5DJ7A 2AYWA 3SUGA 1NRRH 3P8NA 5A8YA 5DK1A 1CO7E 1KYNA 1FPHH 4JK5A 3GCTG 1GBCA 5FPYA 1H9HE 1O5GH 1QRXA 4Q7ZA 2ZFPH 3JZ1B 5DP5A 1PPEE 1PYTD 1GI8B 1W2KH 1ZR0A 5EQQA 1W0ZU 2ZECA 4Y8YA 3BTWE 4JYTA 1TABE 1SLUB 4ABFA 4NIWA 4X1RU 4DURA 1HAHH 2BQWB 1AD8H 2Z9IA 3OY6U 1C1RA 1WUNH 2J95A 1ELAA 5CHAC 1E36B 1O2KA 1JRTA 3SV2H 4UEHH 3VB5A 1SGIB 3SU4A 4GCHG 1V2PT 3B8JA 2XC5A 1G32B 4I32A 4BNRA 3CS0A 1AMHA 1NROH 8ESTE 3RXVA 1O3HA 2HLCA 4YOIA 1O3JA 1FI8A 4R0IA 1G3CA 3P6ZB 2G51A 1V2VT 2VWOA 1GMHG 2PUXB 1BA8B 4B2BA 1C5ZB 1RTFB 3PTNA 5JDUB 1S0QA 3FZDA 1ARCA 3ZZ4A 2YNBA 4Y10E 2P3UB 3UPEA 1P10A 1GHZA 5GWZA 1WQVH 1CA0B 3UWJH 1TONA 2PV9B 1K28D 3LDXH 1T8MA 1NFXA 1P01A 2P3TB 1KY9A 1F7ZA 1UCYE 2GGVB 1CBWC 3GCHB 1JRSA 1YPHE 2SGQE 4XBDA 3BTGE 3RXPA 2QXHA 1DUAA 1V2OT 3KL6A 1VITH 5AVDA 1MTNB 1C9TA 1V6DA 2AMDA 4K2YA 1TX7A 2OP9A 4TWYA 5JBCS 5LPEA 1SPJA 1AFEH 5FX6A 2BXTH 2FXRA 2WYGA 3EYDA 1ZOMA 1W11U 1EZQA 1HAYB 1J9CH 1IHTH 3A8CA 3LGWA 1P0SH 3GY4A 4BAQB 1HAZB 3UY9A 2BDYA 1O3KA 1GI7B 4WJG2 1TNJA 3E6PH 2C93B 2EC9H 3TH3H 3MO6A 1OX1A 1O36A 2GDEH 1L1JA 2BDAA 2FTMA 1FONA 5F8ZA 2OBQA 1H8IH 2JH5D 1DY9A 2ZPRA 5AF9H 2Y7ZA 1B0FA 1GI9B 5DKMA 2BX3A 5LPRA 1OP8A 1P03A 2BZ6H 1VCWA 3A8AA 4IBLH 2HVXA 5TCAA 1C5RA 3TLOA 4NWLA 2XC4A 3SNAA 3RU4T 5ESBA 4IN2A 3W95A 2Z3DA 2BD9A 2A4OA 4ZUHA 1XKBC 9LPRA 1GBTA 4MPUA 1SR5C 3GCTF 3RMMH 2BHGA 1A5IA 4ZROA 4NA8A 1A7SA 1O2JA 2ZGJA 5BPEA 7GCHF 2A45B 2GZ8A 3ESTA 2QXGA 1DWBH 3SBKA 2GMTB 3VXFH 1MD8A 4WF8A 1B5GH 3LIWA 4DOQA 2H6MA 3EGKH 2A2QH 1GBBA 3ATLA 5FHTA 3SU5A 2ULLA 5E0GA 1BIOA 2OQ5A 2J38A 1PQAA 1BTYA 3GCNA 4MLFB 5EXMA 3DUXH 3LC5A 1SSXA 3MMGA 2M5TA 2ZU5A 4X2WA 4Y8ZA 4IMQA 2ZI2H 1O35A 1THPB 2BVSH 1W14U 4AFZA 1BBRH 4NG9H 2P95A 2F9PA 3SQEE 1KTSB 1FMGA 1SI5H 1V2WT 1GJDB 4HZHA 1ESAA 5EW1H 2KAIA 2OQUA 1MKWH 1PQ8A 2OXSA 3MFJA 3GYMA 4B2AA 2CJIA 3IG6B 3A7ZA 3ZVDA 1XMNB 1YBWA 3MWIU 1L2EA 4Q80A 2FOFA 4HGCA 1Q3XA 1BJVA 4FUHA 2HRVA 1H8DH 5GCHF 4XBBA 4K5ZA 1J16A 4K1EA 3RXCA 1HV7A 1GI6A 3PROA 4PROA 1MCVA 2RG3A 1W7XH 5EPYA 2A4GA 3HPTB 1A3BH 1SQAA 1XX9A 1HLTH 1PQ7A 2DE9A 7LPRA 1NTPA 1KSNA 2W7UA 3I29A 4I33A 3ZV9A 1MU8B 2G5VA 1QGFA 3U1JB 2CXVA 2FWWA 1C5SA 1HAOH 1FNIA 3FANA 4DCDA 2A7JA 1GCTB 3A80A 2BZAA 4ZKRU 3BEFB 4XDEA 1C2LA 1O3NA 2OC0A 3SJIA 1MBMA 4D9RA 4AB9A 1MZAA 2NU2E 1GCTC 2R0LA 3A7XA 1DWEH 3PYHA 1Z1JA 1OYQA 3SV8A 1PPFE 2CF8H 3ZZ3A 1RTLA 3HKJB 3RMNH 1QA0A 1O2PA 1S6HA 1GHAG 1YPEH 3LC3A 3UOPA 1BDAA 3SNDA 4LK4A 2ZFRH 3RC6A 1BTXA 1ELBA 4FVDA 4VGCC 2TGDA 3VGCB 1VJ9U 4Q2KA 1V2TT 3MO9A 4FUCA 3A86A 1VZQH 4NFEA 4CRBA 3RM2H 3SNBA 1GCDA 5FAHA 2CV3A 5EGMA 1GWAA 1V2RT 1O2XA 1FN8A 1F0SA 3SW2B 1UJ1A 5F6MA 3FZZA 2FS8A 1E35B 4MTBA 4Q7YA 1P11E 1ETRH 1ZSKA 1T31A 2V35A 4DIHH 2FTLE 3P8FA 4U30A 3SORA 4B76A 1V2ST 3LJJA 1AI8H 1GJ4H 1OWEA 2R2MB 2IJOB 3RLWH 3ZZAA 2A4RA 2HOBA 2RCEA 3MNXA 4GCHF 5C5OA 3PO1C 3HGNA 1HNEE 2A5IA 1SGQE 1TNLA 2TGAA 1NFWA 4ZHAA 2OBOA 3PLKA 1YPKH 1QRZA 1DY8A 2FI5E 1J15A 1NRNH 5AFZH 2OC8A 3RXAA 1M9UA 1GI0A 1O3DA 3A87A 2Q6FA 1AVWA 3MU0A 1W10U 3BV9B 3S69A 1C1SA 2ZU2A 1ZMLA 1LHGH 3BSQA 4I7YH 5K0HA 3NWUA 3D23A 1SGPE 1GHBF 2BYAX 1HAGE 2J2UA 2ZHWH 3ODFA 3H7OA 2A31A 1GBEA 1MTUA 2ZU4A 1ZRKA 1DLKB 2AH4X 2ZHQH 2Y5HA 4NA9H 5FPSA 1QL7A 1WBGB 3BTKE 1OS8A 3MO3A 1B7XB 4FUIA 2BOHB 3ZVCA 1BOQA 4FUFA 3BG8A 3KIDU 1CQQA 1O3OA 5L6NH 2OC1A 1FY5A 4BXWA 1SHYA 1EAUA 3T28A 2JH6D 4AX9H 4BAKB 1GJCB 1AVXA 2F9VA 4ASHA 1H1BA 2AIQA 1QJ6B 1FN6A 1C5OH 2OLGA 1KDQB 1FY4A 3LOXA 1HJAC 1WQSA 3KN2A 1DANH 5C1YA 1TYNA 2FM2A 4B74A 2WPKS 5FBIA 4KTCA 4AGJA 2NU4E 2STAE 1O2GH 2VWMA 1MTSA 4Y71A 3Q3XA 2VIOA 5LPFA 1P2NA 1MAXA 2ZQ2A 3SI4H 1P12E 3F9FA 1EAWA 3F9HA 3V12A 1O2IA 1ELDE 2GCHG 1OWJA 2QYIA 3TPIZ 1LKAA 1P2MA 2BDGA 1KTTB 3F9GA 3SU0A 4KKDA 1Y3YA 5A09A 1ELTA 1BRBE 2XNIA 4UFDH 4AFSA 3SU2A 2A2XH 3M61U 1LKBA 2O9QA 1O2SA 3RXRA 4LZ1H 3GY7A 3T62A 2QF0A 5ABWA 1CBWB 1O2NA 1EP5A 1KXCA 3MI4A 3D65E 5HM9A 3R3GB 1BTZA 3BIVH 1MTNC 2SGAA 3RXOA 2BY6X 4BAMB 3AAVA 4IC6A 1UHBB 2GP9B 3RM0H 4OS4A 4H6SB 1MCTA 4YT7H 3E91A 3M5OA 2P8OC 1NFYA 2PW8H 1W0YH 5EQRA 4FUGA 1F92A 4Q7XA 3VEQB 1KXBA 4CHAC 3D62A 4GSOA 2QA9E 4HTCH 2XYAA 4INHA 2C4FH 3TGIE 3MNCA 1O0DH 2Y82A 2C3SA 1HCGA 3QX5H 1W3CA 3QTOH 4MNVA 2BY7X 4XFQA 1FUJA 3VB3A 4E7NA 4UDWH 1BHXB 4O9VA 1O33A 1NPMA 1O3PB 4OS2A 1V2UT 3U98H 2W3KA 4DY7B 2FS9A 3ZZ8A 3GYLB 5EPNA 1UMAH 3F9EA 2F9UA 4B71A 3MOCA 2ZFQH 3O8RA 1HYLA 3ZVFA 4AORA 4SGBE 4CBNA 2VIWA 3SGAE 1QJ1B 3RXQA 4WH6A 3UOUA 4FU9A 2A7CA 4UFGH 4MNXA 1AUTC 2JKHA 1TGNA 3GY3A 5DP3A 2JH0D 2TGTA 3RXLA 3IITA 2XWBI 3T2NA 1Y3WA 1VCQA 3FAOA 4NIVA 1WAYB 2F91A 2Z9GA 1XUJA 8LPRA 4KP0A 2GX4A 1AB9B 2BTCE 4X6OA 2OCVB 3HK3B 3RC5A 1E0FD 2RA0A 1Z6EA 3A82A 1S85A 1XKAC 3TVJB 3F68H 3PMJA 2ZGHA 2AS9A 2J9NA 3SGBE 1GMDF 4ABAA 1GJ7B 1YPGH 4X2VA 4RKJB 1ZSJA 5GXPA 4MNWA 2F9OA 5C3NA 1NU7B 1QIXB 1CE5A 4J1YA 2AIPA 1GJ6A 4WY3A 1UVPA 4HI3A 5C1UA 2CHAB 3BN9A 3AASA 1YCPM 1C1NA 3B9FH 4MNYA 3DFLA 3BG4B 1XUHA 1HAIH 1P02A 3RXFA 1S5SA 2O8UA 4Y0YE 4JYVH 1KXFA 2UUJB 2AGEX 2A1DB 1THRH 1BB0B 4RKOB 2WUCA 3NCLA 3QZRA 2XC0A 2D1JA 3NKKA 2UWLA 3A85A 1XUGA 2ZNKH 3SOSA 1E37B 3SGQE 3EE0B 3ATMA 2ZHFH 3LT3A 1TB6H 1K1NA 3RMOH 2XW9A 3HATH 1S0RA 1QURH 4J2YB 4TPYA 1O2OA 3QN7A 2H5CA 4AYYB 4ZKNU 2Z9LA 1QL8A 3SN8A 2Z6BD 2PKSC 3LJOA 1LO6A 1QJ7B 4YLUA 1WCZA 5E2PA 5JBBS 1UTPA 1C2FA 5T6DA 4I31A 2Y81A 3RU4D 1Y5BT 1GI3A 1AHTH 1FPCH 4FU8A 2G4TA 3STIA 1BRAA 1NRSH 3MH5A 3PM3A 4O03A 1NRPH 1SQTA 1TGCA 2W26A
chains in the Genus database with same CATH superfamily
2CK3D 2PR3A 1C1MA 2HNTE 1OWHA 3M5NA 1BRCE 1CHGA 1D3QB 2GJGA 2ZTXA 3CENA 2ODYB 3LPRA 3ZZ9A 5TJXA 2OINA 3I78A 3T27A 1HAPH 5C1XA 1AY6H 3LGYA 2EY4C 3C27B 2F83A 2FO9A 4H6TA 3VXEH 2J97A 2R2WU 1K1OA 4F49A 1DX5M 1THSH 5HYOA 1EB2A 1W8BH 1D6RA 4H42U 5A0BA 2H1UA 1BTHH 4HFPB 3SYJA 2UWPA 1G37A 1EATA 4SGAE 2BY5X 1W13U 2Y5FA 1LHEH 4NGAH 1A1RA 3IWMA 1O30A 2A5AA 2QN5T 1DICA 1UTJA 5EG4A 3AW0A 1YPLH 4ISIH 5EQSA 2ZHDA 4B1TA 3DHKH 2PHBA 2R0KA 5E0JA 1KXDA 3K65B 1AFQC 1TRMA 5E2OA 1C2EA 1BITA 3EAJA 3TJNA 3KEEA 1SGCA 1JBUH 2UUKB 3ZV8A 3E3TA 1GPZA 3R0FA 2BQ6B 4M9FA 5JBTA 3P17H 1H9IE 1DUEA 2ZGBH 3A8DA 1F0UA 2P8OB 5FCKA 3GDSA 1UTMA 4ISLA 1GI4A 3U8TH 1EOLA 1EX3A 2O8WA 5DP9A 1Q31A 5F03A 5EJ1A 3A89A 1O34A 1JIRA 4FOUC 1NM6A 2ZA5A 3RXIA 2FLRH 4NZLA 4WMEA 1FY8E 2BY9X 4FXGH 3RXSA 1IQMA 1V2QT 1WV7H 5T6FA 1NFUA 3V3MA 3KF2A 1P2JA 2PLXA 1T8NA 1MABB 2J5UA 2JDID 4WMFA 1V2KT 3GY6A 1ELVA 4JZ1A 1JXPA 4YOGA 3VB7A 2XBXA 1VCPA 2XTTB 3AAUA 2VWLA 5AFYH 1C1TA 3TK5A 3C1KA 5IK2D 1SB1H 3LGVA 3SU3A 1YLNA 1FJSA 1CU1A 4DGJA 3ZVBA 1AKSB 1P2OA 3TIUA 1IQEA 2H5DA 4AG1A 1DXWA 1PPBH 5ETXA 1O38A 3MTYA 1NT1A 1DPOA 3RXKA 1LVMA 1C5WB 3UUZA 4YXWD 2VIPA 2FOCA 1K1LA 3PO1B 2BX4A 4U32A 1QR3E 2AGGX 1OSSA 2PKAA 1QA7A 2ZPSA 1AVGH 4TYDA 3M7QA 5FXLA 2PTCE 2G4UA 2HGTH 2YMSB 1MKXH 5C67A 9ESTA 5FPTA 2QCYA 1ANBA 1DOJA 2ODQA 2Q6DA 1GBJA 3VB4A 1C4Y2 1YC0A 1WU1A 4JCNA 1AE5A 1GHYH 1OPHB 1C5XB 2FOAA 3L33A 3LH1A 3SHCH 4CRAA 1O3FA 5EJLA 5C0UA 3M3SA 3ZVGA 3PMHB 1ESTA 2FI3E 1LCYA 1O2RA 2GV7A 3E0PB 1DVAH 1SMFE 2JJ1D 3K9XB 3BEIB 2FYRA 2PWXA 2O8MA 1ETTH 3F3BA 5LH8A 1V3XA 2ESTE 4E06H 3FVFB 2BD4A 1GI1A 2VGCB 2ILNA 3ZZ6A 1LMWB 1Y5AT 5GJ4B 3UAIC 5ESTE 1TNIA 4YESB 2QC2A 1P2QA 4IC5A 2W5EA 2FYQA 1QB6A 4YZUA 1FXYA 1RGQA 3M3VA 1PJPA 1HRTH 4INKA 2K8IA 3RXUA 8GCHG 3E16B 4D7GA 2Z7FE 5HXFA 2ZFTA 3FOAA 4ACAA 4X8VH 1OWIA 5C0TA 5A8ZA 1D6WA 1EXFA 7KMEH 2B0FA 1CGHA 1W7GH 2A4QA 5F8TA 1T32A 4BXSA 2G81E 4WVPE 2RFKC 5L2ZH 1IQKA 2SNWA 1LTOA 5F53A 1G9IE 2VIDA 1YLCA 3S9CA 1MBQA 1EZXC 1AE8H 3DFJA 4Y7AA 2CGAA 3A8BA 5C20A 3E0NB 2VVVA 4A1VA 4ISOA 5G4BA 3F0OA 2W6JD 1VITG 3ZVAA 3ZIAD 2TBSA 3VG8A 2GT7A 4YM9A 4QT8C 5DP7A 1SGNE 2HPPH 1SQOA 1QFKH 2F9NA 1DFPA 3S7KB 2J98B 1Z1IA 4XBCA 1RS0A 4BAOB 1ZJDA 1CGIE 3BF6H 3GS9A 1SVPA 2WZQA 4K1SA 4NIXA 1ZMJA 4THNH 1GBMA 4CREA 2SGEE 1G2LA 3UFAA 1OXGA 5GPIB 1SC8U 2TPIZ 2AMQA 3LKWA 4ISHH 1K9OE 3EDXB 1O39A 2FOBA 3M37A 5A0AE 1NZQH 4CRDA 1TMBH 1LPZB 2ZHEH 4X2XA 1SGYE 1KLTA 2WINI 4BOHA 3JZ2B 2LELA 4FUJA 2HNTF 4FU7A 2IN2A 4A7IB 2OTVA 1GI5A 5A8XA 4IMZA 2ZTYA 1XVOA 1P09A 1A0HB 2FDAA 2G5NA 2ZDLA 2BDIA 2XBVA 5EOKA 3RXBA 1GGDC 2GCTC 5I25A 2BVXH 1MTWA 2P93A 3OTJE 4Y79A 2PSXA 3RLYH 2C8YB 3TNSA 2WV4A 1O2VA 2XCNA 2OC7A 2ZDAH 1HAVA 1UO6A 1ANEA 2DUCA 2IOTA 2LNCA 2BMGB 2VB0A 1IQHA 4D8NA 2AHME 1UVUH 4IW4E 2ZG0H 1ELFA 1NO9H 8GCHF 1S6FA 3RXHA 1A3EH 3WY8A 3BIUH 4A92A 4ASUD 2ZEBA 3QK1A 5H4IB 3A83A 3KHVA 2J94A 1C5PA 2WPMS 2CF9H 1ELGA 3ATIA 1DDJA 5JYIA 3RDZA 2Y7XA 1O37A 2YMSC 1QQUA 2BB4A 1Z7KA 3PRBA 2TIOA 1GL0E 4IS5A 2FI4E 2C8WB 2B7DH 2SFAA 3M5LA 1O3EA 1UVOA 1BUIA 2AEIH 3UIRA 4ZAEA 2Z9JA 4D9QA 1MQ5A 3SHAH 2H9TH 5DP8A 3FO8D 1HBTH 1SOZA 4M7GA 3ITIA 1EZSC 3URCA 1FAXA 2WHXA 4NIYA 3T26A 2F9BH 1TX8A 3SNCA 1EUFA 1IQJA 1RD3B 3OSYA 4Y76A 2HPQH 1CA8B 3MU8A 3UB0A 5DO4H 4DG4A 1AZ8A 2FOGA 1ZHPA 3EQ0H 3RP2A 1EPTA 3UR6A 1O2WA 3DA9B 2EI7A 4GPGA 1TGSZ 1BRUP 1UTNA 4Y7BA 1TRNA 2ZCHP 1L4DA 1D9IA 2O8LA 1XXFA 1SHHB 1S81A 2WV5A 1J17T 1DLEA 2P94A 1HJ9A 4ABDA 3SZEA 1QY6A 1C5UA 1ARBA 1C5QA 1YGCH 1MAYA 3A81A 3TJUA 4MQAA 3QO6A 1IAUA 3PTBA 2XBYA 2QXJA 4MVNA 4ZXXH 4JZEH 2HNTC 2J92A 3RU4E 3ELAH 1AIXH 1WYKA 1GMCF 2C8ZB 3N7OA 4NCYA 1AO5A 1BMAA 1GMHF 3A7YA 1GBLA 2BD5A 2YMSD 5C17A 3K2UA 4CRFA 2A0QB 2GTBA 3ZYDA 1A5HA 1X7AC 3T25A 1P3CA 4B2CA 8KME2 5JB8S 4MDSA 1N1LA 3LH3A 2ANKH 2ALPA 3ZZ5A 5J4SA 1HXEH 1HXFH 2TGPZ 1C4U2 1O2TA 1W0JD 1LHFH 1ELCA 3MNBA 1MMJN 2VH6A 2HALA 1DM4B 2BLOA 2R3UA 1FDPA 1ZMNA 1D3TB 1SGEE 4F4OC 2IPQX 1V2JT 7ESTE 1DWDH 4GLYA 3EA9A 1ZSLA 4ZCNA 4X8TH 2CHAC 3P8OA 1UCYK 3O8CA 3CS7A 2WUBA 3T29A 1SBWA 4KTSA 1A0LA 5HIYA 2G55A 4OS5A 3L6PA 1C2JA 1XUIA 4X6NA 2WPDD 4NFFA 1MTVA 1O5FH 1QL9A 2VH0A 1O31A 4JMYA 1LVBA 4KTUA 3MNSA 3SO3A 3E1XB 2D8WA 1C2IA 2VGCC 1A61H 1NY22 4R8TB 1K1MA 1P57B 4K69A 3BTQE 3SUEA 1BMNH 3TH2H 1GJBB 3TJVA 4AB8A 3LU9B 3VB6A 2GMTC 1BMLA 1S82A 1XUFA 5T3HA 2BY8X 1K0HA 1OP2A 2PKAB 1EKBB 2J98A 4JZFH 1CA0C 1FZZA 1D4PB 1ORFA 4KGAA 1GBFA 1F2SE 1O32A 1MZDA 1NN6A 3W94A 4LXBH 3NRLA 2P3FH 5B6LA 1Y3UA 3UWIA 4GHTA 2BQ7B 1O3GA 4TPIZ 1VGCC 2FIRH 2KAIB 3KCGH 1AU8A 4X1PU 2WPJS 2AMPA 1G36A 4I8JA 5KECA 3S7HB 3OE7D 1TPSA 1Y59T 3TJOA 1YCPH 2THFB 3GCOA 3U28C 1ZGVA 2FX4A 4XD7D 2FEQH 1A46H 1LQDB 1ETSH 1GHXH 1GMDG 4MPVA 5PTPA 1EOJA 4E7RG 6LPRA 3HK6B 1AWFH 3OEHD 2GZ7A 4O3UA 3TU7H 5C94A 5AHGH 1O5DH 2ZFFH 1IOEA 2BDHA 3OEED 3M7UA 1AQ7A 3F2FA 3FN8A 4I86A 2ODPA 3RMLH 4XE4A 2YOLA 3T5FH 1T7CA 2F3CE 3UQVA 3P8GA 4OGYA 2BOKA 3SV9A 1MUEB 3MH6A 1N8OB 5B6OA 4NSVA 3SJ8A 2KZ4A 1GBIA 1GHWH 1TGBA 4CHAB 2YNAA 4CR9A 3M3TA 1OWDA 1INCA 1SGTA 1KLJH 2W7SA 1HDTH 2H9HA 3QLPH 3QGNB 1SGDE 3TK6A 4WWYA 3A7TA 3SZNA 3SUFA 1LHCH 5J4QA 2VIVA 1RXPA 2XXLA 3NZIA 2V3OH 3SJOA 3UNQA 1O3AA 3ZZ7A 1LPKB 1H4WA 1QZ8A 1EJAA 1UTQA 1C9PA 1YYY1 1N6XA 4K3JA 4LOYH 2VIQA 1MD7A 3NPSA 3OX7U 3Q77A 2D26C 1CVWH 1C1OA 1TMTH 1TOCB 1SL3A 2ZKSA 2ZTZA 1MKWK 1EZUC 1P9SA 4JZDH 1IQGA 2RDLA 4JYUH 1H9LB 2D2DA 3SNEA 1AFQB 2BLQA 4GVUA 1RFNA 2SGPE 1C2KA 2AFQB 3DT0H 1PPGE 4Q4LA 2BDBA 1OOKB 3U8RH 4E05H 3LGTA 4VGCB 2BD2A 2ZC9H 1G2MA 2R9PA 4AYVB 3G01A 1EPTB 4P00A 1JWTA 4CR5A 2HWLB 4FVBA 1NS3A 1CT4E 4JZIA 2NU1E 4ZHLU 1BTWA 1J8AA 1Z6JH 3UREA 5KEDA 1IQLA 5GCHG 2ZGCA 4ABGA 1P06A 2Y6TA 2Q1JA 2BDCA 2GKVE 2V3HH 1TE0A 3V7TA 1TOMH 1NESE 1AN1E 4K60A 4AFQA 1Z8RA 2ZF0H 1P2IA 1ANCA 4CRGA 1NC6A 2FMJA 2FOMB 7GCHG 5A0CA 1UTLM 1L0ZA 3MU5A 4Q63A 3PWCA 3QDZB 1ESBA 1UTOA 2ZDKA 3KGPA 3KQDA 1C5TA 3KYGA 1CGJE 1GI2A 2ZU3A 4X1QU 1BTUA 1L1GA 1TBZH 3FP8E 2ZCKP 1HAVB 3Q3YA 4FUDA 4WMDA 2G52A 4BTTB 3FFGA 4Y11E 1UVSH 3OU0A 1SKYE 2BLWA 1QCPA 4ZKSU 3O8BA 3WWBA 1GHVH 1FY1A 1NU9A 3ENSB 3K6YA 1FQ3A 1SQRA 1K1JA 1ZTLA 4I8LA 5DPAA 4X1SU 3CNRA 2V3MA 1BT7A 3PLPA 3RXEA 4UFEH 2C8XB 2BD7A 2FPZA 3GY2A 1BHXF 3GY5A 1C1QA 3URDA 5L2YH 1PPCE 1G3BA 4Y0ZE 3QZQA 1KDQA 1A5GH 4GUXA 3E90B 4NZQA 1ZGIA 2ZPQA 1BQYA 2B9LA 2ZZUH 1XM1A 1T4VH 4TSFD 1P04A 1C2MA 3DCLA 1IQIA 1L4ZA 3FKSD 1TNKA 1ZTJA 1QQ4A 5CHAB 3VGCC 4XOJA 3VPKA 1SGFA 1OYTH 1TBRH 1GHBG 4U01A 2BD8A 4GAWA 1V2NT 1LDTT 1MKXK 3ATKA 4Y6DA 1XXDA 3TGJE 1AZZA 3QTVH 4MPWA 3RXMA 1UK3A 2EA3A 3UNRA 1V2MT 1F5LA 2ZWLH 1E79D 4X6MA 2Z3CA 1ZJKA 4YLQH 2ANWA 1CSOE 3UR9A 1VITF 1GMCG 1SGFG 6GCHF 3U1IB 4UE7H 2FESH 1DSUA 2WPIS 1O3MA 2KCYA 4CBOA 2SGFE 1BZXE 1JOUB 2A7HA 4KELA 4D7FA 1SFQB 2HVYB 3O8DA 2ANYA 4AG2A 3PMBB 1A4WH 4YT6H 3EA8A 2WV9A 4DT7B 3D49H 1RJXB 4DJZB 1VJAU 3B23B 6CHAC 3ZZBA 1K22H 1GJ5H 1RIWB 4BAHB 5TCCA 4NA7A 1FY3A 1U6QA 2JIZD 1C2GA 1TIOA 2KCAA 5GIBA 4LZ4B 1LHDH 1EPTC 2FP7B 3BTEE 5HM2A 1SLXB 2Z9KA 1GG6B 1KIGH 1FIWA 1P3EA 1RIWC 1S83A 1FLEE 2GVFA 2PSYA 1HIAB 2P59A 1GG6C 1EJNA 3M7TA 4FUBA 3SI3H 3ZZDA 1BTPA 1QNJA 1C5NH 1RRKA 2QGRA 1TFXA 3SU6A 1EJMA 1F0RA 1GBHA 3SJ9A 1V2LT 5SGAE 1GJAB 1OKXA 1T8OA 1KMHB 2UUYA 2ASUB 3EE7A 5EXLA 4ZH8A 3RXJA 5K7RA 4D76A 1QBNA 3BG4C 4NWKA 4RN6A 4ACBA 3TH4H 1SFIA 1GVZA 4TWWA 3OY5U 4BTIB 3QUMP 1SG8B 4U2WA 1O3IA 1G3EA 1ZPBA 1SOTA 1Z8GA 3GCHC 1C1UH 2GDDA 3SJKA 1ZZZA 2SNVA 5EU8A 2V0BA 3RC4A 4ABIA 1L1NA 1HGTH 5E0HA 1AGJA 3HKIB 2ZQ1A 1O2MA 5F8XA 3BTHE 3PB1E 3STJA 5EW2H 1AB9C 2VNTA 1C5MD 1S84A 1DWCH 4INLA 1QHRB 4WH8A 2CMYA 1DE7H 2XNDD 3S9BA 1D3DB 1ZPZA 3PLBA 1NRQH 1HAXB 3S9AA 1GBDA 4ISNA 1IHSH 2WPHS 2F43B 1MU6B 4OS6A 4ZXYH 2BXUH 1O3BA 1VGCB 1HB0B 5C2ZA 1CHOG 3L3TA 1UTKA 3ATWA 3RXGA 3SU1A 3LONA 1F5KU 3FP7E 4Z0KA 3VFEA 3KQEA 4BANB 5BRRE 5L30H 3TNTA 2PTNA 3Q76A 3F6UH 2O8TA 1OWKA 1TQ0B 2XCFA 1EASA 1MQ6A 1LPGB 4AN7A 2PFEA 1HJAB 6GCHG 2GCHF 2OK5A 5JB9S 1Z8JB 3AVZA 3TK9A 2EI8A 1YM0A 3BTME 1O2ZA 3CP7A 5CMXH 4JK6A 3SV7A 1P8VC 1TA6A 3BTDE 5HGGA 4DW2U 2B8OH 3P95A 1SGRE 1YPHC 2ALVA 4TY6A 5FX5A 4CH2B 1Q2WA 3PRDA 1IQNA 4X1NU 5DP6A 1ABJH 1UHBA 3MU1A 1GDUA 1TWXB 3I77A 3MH4A 1C5LH 3RXDA 1WDIA 3GISB 1QTFA 1C1PA 1SLWB 1TALA 3MH7A 1O5EH 1KXAA 2J34A 3M35A 1CT0E 4I8GA 4WXIA 4K1TA 1TPAE 1C2HA 1GJ9B 3GICB 1QB1A 4OS7A 2EEKA 2JETC 4GHQA 1RTKA 1FV9A 3MU4A 3EA7A 2A32A 2AGIX 4A6LA 4UONA 2Z3EA 2PUQH 2L74A 4ABEA 2WSSD 1AWHB 2JETB 1GVKB 4Y8XA 2VVUA 2W3IA 2KR7A 2B5TB 2ZDVH 3GDUA 4HG6A 4P02A 4RT0A 1Y5UT 3LGUA 1Y8TA 1QBOA 3KNXA 5FL7D 1E34B 2G8TA 1GBAA 1LQEA 2ZIQH 4WXVA 1TPPA 5GDSH 2I6SA 2LPRA 1O2UA 3U69H 1YP9A 6ESTA 1PQ5A 1G3DA 2VWNA 2ZGXH 3DD2H 1EQ9A 5DG6A 1MH0A 1TQ7B 3FP6E 1C4V2 5LGOA 3MQKC 1KXEA 1EAIA 1D3PB 1OP0A 1Y3XA 2ZCLP 2SGDE 1ZHMA 4MPXA 1CHOF 4CRCA 1O5AB 5JBAS 4ZKOU 2NWNA 1HFDA 2RDEA 2BLVA 2VINA 2GD4B 2I6QA 3A84A 1JMOH 3U9AH 1WTHD 2A5KA 1TX6A 2BD3A 3M5MA 1EP6A 2QV1A 2XBWA 3KQBA 1XUKA 1ZPCA 3SQHE 2K0QA 2BVRH 2ZU1A 4A1XA 1O3LA 2QXIA 4B73A 2IPHA 4FUEA 3ZVEA 1C5VA 1ZTKA 4OGXA 4X2YA 1C2DA 4IN1A 2PGQB 1TGTA 3PWBA 1KLIH 1DT2A 2V6NA 2UWOA 3BEUA 4A1TA 1K1IA 2QF3A 1O2HA 3A88A 4AZ2B 4YTAA 4ABJA 1VKYA 3PMAB 3A7WA 4YOJA 1HIAA 1A0JA 1YPJH 1PPZA 1BBRK 3UNSA 2C90B 1YCPK 3F2GA 4X6PA 2GV6A 1P9UA 1GBKA 5HMAA 1AKSA 1BCUH 1TRYA 2ZDMA 2ZO3H 5DP4A 2FX6A 2UUFB 2NU3E 1FX0B 2OUAA 4A5TS 2Y5GA 1B0EA 1HUTH 1O2LA 3NK8A 4K8YA 2BM2A 1GHAF 2FODA 2P16A 4ABHA 1GVLA 1ZYOA 2FZZA 2VVCA 1T4UH 2CN0H 2G00A 4AOQA 4YO9A 3NUMA 1A2CH 1ID5H 2WYJA 5I46H 4OS1A 1P2KA 2Z94A 1TPOA 3ZZCA 1UK4A 5FBEA 3V13A 3ODDA 5GNDA 1ZRBA 1PPHE 1YLDA 2XWAA 3NXPA 1P05A 4O3TA 3P92A 4X0WU 2Y80A 4K8BA 1TBQH 3ZYEA 4CH8B 4Z1MD 1Z8IB 3V0XA 3BTTE 2GCTB 1CT2E 1ZLRA 1WTGH 1GDQA 3A7VA 1ANDA 3RXTA 4ZMAH 3TITA 1N8OC 2NU0E 5CE1A 1O2YA 2ZP0H 1HPGA 4XSKU 5C5NA 5KGOA 3QWCH 3F1SB 3U8OH 4AGKA 1YKTA 1O3CA 4ABBA 1FIZA 1UVTH 1C1VH 2K1QA 6CHAB 2QAAA 1ZHRA 3MYWA 2H2ZA 4I8KA 1IQFA 1YWUA 1LVYA 1DS2E 3OYPA 3RUOA 3SUDA 3Q3KA 1BBRE 3UQOA 1PYTC 4DIIH 1WSSH 2ZDNA 2FLBH 1ACBE 4UD9H 2QY0B 4IGDA 3KYFA 2PKSB 2VU8E 2TRMA 1WOFA 1PFXC 1TNHA 2ANMH 4O97A 1TAWA 2Q6GA 3QGJA 2OD3B 1F0TA 1FAKH 1Z71A 4AFUA 1GL1A 2VBCA 2GZ9A 2PGBB 3AW1A 3Q00A 4I8HA 3E8LA 3PV4A 1UK2A 3M36A 2DE8A 4H4FA 5EXNA 5IYTA 2J4IA 1BMMH 1LVOA 2EQNA 2H9EH 2STBE 2RA3A 1O5CB 3GDVA 1DSTA 4UFFH 2WPLS 1XVMA 5DGJA 2ZFSA 1K2I1 1W12U 1GDNA 2VJ1A 5E8EH 3F2HA 5EIYA 3KQCA 4ZHMU 1EAXA 1YPMH 2R3YA 5EODA 1UCYH 2W6ID 2XRCA 2FOHA 2EI6A 5A2MH 1BJUA 1TLDA 4X8UH 2GT8A 3UTUH 1DXPA 1O2QA 1QB9A 1T8LA 4RSPA 4ESTE 1Y3VA 3P70B 3LGIA 2QIQA 1YF4A 1NBMD 1TMUH 4BTUB 1TA2A 1HJ8A 4X8SH 1K21H 1GJ8B 1DITH 3S0NA 4NSYA 3GY8A 1QRWA 3H7TA 4MG3A 3SV6A 5JPMH 3TGKE 1G30B 1N6YA 1J14A 3HGPA 1C5YB 1ABIH 2AERH 1F5RA 3GOVB 4TY7A 1C1WH 2FOEA 3BTFE 1JIMA 1SLVB 4DVAU 1GGDB 1QBVH 5T6GA 4B6FA 1ELEE 5DSFA 1AUJA 1O5BB 1E38B 3K6ZA 5IDKA 1TNGA 1VR1H 1K1PA 3MHWU 4B75A 1EB1H 3H5CB 4Z6AH 5FCRA 5DJ7A 3PV2A 2QE7D 2AYWA 3SUGA 1NRRH 3P8NA 5A8YA 5DK1A 1CO7E 1KYNA 1FPHH 4JK5A 3GCTG 1GBCA 5FPYA 1H9HE 1O5GH 1QRXA 4Q7ZA 2ZFPH 3JZ1B 5DP5A 1PPEE 1PYTD 1GI8B 1W2KH 1ZR0A 5EQQA 2JJ2D 1W0ZU 2ZECA 4Y8YA 3BTWE 4JYTA 1TABE 1SLUB 4ABFA 4NIWA 4X1RU 4DURA 1HAHH 2BQWB 1AD8H 2KM0A 2Z9IA 3OY6U 1C1RA 1WUNH 2J95A 1ELAA 5CHBA 5CHAC 1E36B 1O2KA 1JRTA 3SV2H 4UEHH 3VB5A 1SGIB 3SU4A 4GCHG 1V2PT 3B8JA 2XC5A 1G32B 4I32A 4BNRA 3CS0A 1AMHA 1NROH 8ESTE 3RXVA 1O3HA 3H09A 2HLCA 4YOIA 1O3JA 3WWFA 1FI8A 4R0IA 1G3CA 3P6ZB 2XOKD 2G51A 1V2VT 1GMHG 2VWOA 2PUXB 1BA8B 4B2BA 1C5ZB 1RTFB 3PTNA 3AK5A 5JDUB 1S0QA 3FZDA 1ARCA 3ZZ4A 2YNBA 4Y10E 2P3UB 3UPEA 1P10A 1GHZA 5GWZA 1WQVH 1CA0B 3UWJH 1TONA 2PV9B 1K28D 3LDXH 1T8MA 1NFXA 1P01A 2P3TB 1KY9A 1F7ZA 1UCYE 2GGVB 1CBWC 3GCHB 1H8HD 1JRSA 1YPHE 2SGQE 4XBDA 3BTGE 1H8ED 3RXPA 2QXHA 1DUAA 1V2OT 2PP6A 3KL6A 1VITH 5AVDA 1MTNB 1C9TA 1V6DA 2AMDA 4K2YA 1TX7A 2OP9A 4TWYA 5JBCS 5LPEA 1SPJA 1AFEH 5FX6A 2BXTH 3WW7A 2FXRA 2WYGA 3EYDA 1ZOMA 1W11U 1EZQA 1HAYB 1J9CH 1IHTH 3A8CA 3LGWA 1P0SH 3GY4A 4BAQB 1HAZB 2KX4A 3UY9A 2BDYA 1O3KA 1GI7B 4WJG2 1TNJA 3E6PH 2C93B 2EC9H 3TH3H 3MO6A 1OX1A 1O36A 2GDEH 1L1JA 2BDAA 2FTMA 1FONA 5F8ZA 2OBQA 1H8IH 2JH5D 1DY9A 2ZPRA 5AF9H 2Y7ZA 1B0FA 1GI9B 5DKMA 2BX3A 5LPRA 1OP8A 1P03A 2BZ6H 1VCWA 3A8AA 4IBLH 2HVXA 5TCAA 1C5RA 3TLOA 2F4LA 4NWLA 2XC4A 3SNAA 3RU4T 5ESBA 4IN2A 3W95A 2Z3DA 2BD9A 2A4OA 4ZUHA 1XKBC 9LPRA 1GBTA 4MPUA 1SR5C 3GCTF 3RMMH 2BHGA 1A5IA 4ZROA 4NA8A 1A7SA 1O2JA 2ZGJA 5BPEA 7GCHF 2A45B 2GZ8A 3ESTA 2QXGA 1DWBH 3SBKA 2GMTB 3DSPA 3VXFH 1MD8A 4WF8A 1B5GH 3LIWA 4DOQA 2H6MA 3EGKH 2A2QH 1GBBA 1NBME 3ATLA 5FHTA 3SU5A 2ULLA 5E0GA 1BIOA 2OQ5A 2J38A 1PQAA 1BTYA 3GCNA 4MLFB 5EXMA 3DUXH 3LC5A 1SSXA 3MMGA 2M5TA 2ZU5A 4X2WA 5EJZA 4Y8ZA 4IMQA 2ZI2H 1O35A 1THPB 3F0PA 2BVSH 1W14U 4AFZA 3DSOA 1BBRH 4NG9H 2P95A 2F9PA 3SQEE 1KTSB 1FMGA 1OHHD 1SI5H 1V2WT 1GJDB 4HZHA 1ESAA 3OAAD 5EW1H 2KAIA 2OQUA 1MKWH 1PQ8A 2OXSA 3MFJA 3GYMA 4B6EA 4B2AA 2CJIA 3IG6B 3A7ZA 3ZVDA 1XMNB 1YBWA 3MWIU 1L2EA 4FETA 4Q80A 2FOFA 4HGCA 1Q3XA 5HIZA 1BJVA 4FUHA 2HRVA 1H8DH 5GCHF 4XBBA 4K5ZA 1J16A 4K1EA 3RXCA 1HV7A 1GI6A 3PROA 4PROA 1MCVA 2RG3A 1W7XH 5EPYA 2A4GA 3HPTB 1A3BH 1SQAA 1XX9A 1HLTH 1PQ7A 2DE9A 7LPRA 1NTPA 1KSNA 2W7UA 1WXRA 3I29A 4TT3D 4I33A 3ZV9A 1MU8B 2G5VA 1QGFA 3U1JB 2CXVA 2FWWA 1C5SA 1HAOH 1FNIA 3FANA 4DCDA 2A7JA 1GCTB 3A80A 2BZAA 4ZKRU 3BEFB 4XDEA 4XRNA 1C2LA 1O3NA 2OC0A 3SJIA 1MBMA 4D9RA 4AB9A 1MZAA 2NU2E 1GCTC 2R0LA 3A7XA 1DWEH 3PYHA 1Z1JA 1OYQA 3SV8A 1PPFE 2CF8H 2KFWA 3ZZ3A 1RTLA 3HKJB 3RMNH 1QA0A 1O2PA 1S6HA 1GHAG 1EFRD 1YPEH 3LC3A 3UOPA 1BDAA 3SNDA 4LK4A 2ZFRH 3DSGA 3RC6A 1BTXA 1ELBA 4FVDA 4VGCC 2TGDA 2V7QD 3VGCB 1VJ9U 4Q2KA 1V2TT 3MO9A 4FUCA 3A86A 1VZQH 4NFEA 4CRBA 3RM2H 3SNBA 1GCDA 5FAHA 2CV3A 5EGMA 1GWAA 1V2RT 1O2XA 1FN8A 1F0SA 5DN6D 3SW2B 1UJ1A 5F6MA 3FZZA 2FS8A 1E35B 4MTBA 4Q7YA 1P11E 1ETRH 1ZSKA 1T31A 2V35A 4DIHH 2FTLE 3P8FA 4U30A 3SORA 3N7EA 1V2ST 3LJJA 4B76A 1AI8H 1GJ4H 1OWEA 2R2MB 2IJOB 3RLWH 3ZZAA 2A4RA 2HOBA 2RCEA 3MNXA 4GCHF 5C5OA 3PO1C 3HGNA 1HNEE 2A5IA 1SGQE 1TNLA 2TGAA 1NFWA 4ZHAA 2OBOA 3PLKA 1YPKH 1QRZA 1DY8A 1UW7A 2FI5E 1J15A 1NRNH 5AFZH 4OM9A 2QF5A 4F55A 4AC9A 2OC8A 3RXAA 1M9UA 1GI0A 1O3DA 3A87A 2Q6FA 1AVWA 3MU0A 1W10U 3BV9B 2HLDD 3S69A 1C1SA 2ZU2A 1ZMLA 1LHGH 3PV5A 3BSQA 4I7YH 5K0HA 3NWUA 3D23A 1SGPE 3KQ5A 1GHBF 2BYAX 1HAGE 2J2UA 2ZHWH 3ODFA 3H7OA 2A31A 1GBEA 1MTUA 2ZU4A 5T1VA 1ZRKA 1DLKB 2AH4X 2ZHQH 2Y5HA 4NA9H 5FPSA 1QL7A 1WBGB 3BTKE 1OS8A 3MO3A 1B7XB 4FUIA 2BOHB 3ZVCA 1BOQA 4FUFA 3BG8A 3KIDU 1CQQA 1O3OA 4DT4A 5L6NH 2M2AA 2OC1A 1FY5A 4BXWA 1SHYA 1EAUA 3T28A 2JH6D 4AX9H 4BAKB 1GJCB 1AVXA 2F9VA 4ASHA 1H1BA 2AIQA 1QJ6B 1FN6A 1C5OH 2OLGA 1KDQB 1FY4A 3LOXA 1HJAC 1WQSA 3KN2A 1DANH 5C1YA 1W0KD 1TYNA 2FM2A 4B74A 2WPKS 5FBIA 4KTCA 4AGJA 2NU4E 2STAE 1O2GH 2VWMA 1MTSA 4Y71A 3Q3XA 2VIOA 5LPFA 1P2NA 1MAXA 2ZQ2A 3SI4H 1P12E 3F9FA 1EAWA 3F9HA 3V12A 1O2IA 1ELDE 2GCHG 1OWJA 2QYIA 3TPIZ 1LKAA 1P2MA 2BDGA 1KTTB 3F9GA 3SU0A 4KKDA 1Y3YA 5A09A 1ELTA 1BRBE 2XNIA 4UFDH 4AFSA 3SU2A 2A2XH 3M61U 1LKBA 2O9QA 1O2SA 3RXRA 5HKKD 4LZ1H 3GY7A 3T62A 2L6OA 2QF0A 5ABWA 1CBWB 1O2NA 1EP5A 1KXCA 3N99A 3MI4A 3D65E 5HM9A 3R3GB 1BTZA 3BIVH 1MTNC 2SGAA 3RXOA 2BY6X 4BAMB 3AAVA 4IC6A 1UHBB 2GP9B 3RM0H 4OS4A 4H6SB 1MCTA 1COWD 4YT7H 3E91A 3M5OA 2P8OC 1NFYA 2PW8H 1W0YH 5EQRA 4FUGA 1F92A 4Q7XA 3VEQB 1KXBA 4CHAC 3D62A 4GSOA 2QA9E 4HTCH 3W1EA 2XYAA 4INHA 2C4FH 3TGIE 3MNCA 1O0DH 2Y82A 2C3SA 1HCGA 3QX5H 1W3CA 3QTOH 4MNVA 2BY7X 5CDFE 4XFQA 1FUJA 3VB3A 4E7NA 4UDWH 1BHXB 4O9VA 1O33A 1NPMA 1O3PB 4OS2A 1V2UT 4RI0A 3U98H 2W3KA 4DY7B 2FS9A 3ZZ8A 3GYLB 2IJD1 5EPNA 1UMAH 3F9EA 3N7DA 2F9UA 4B71A 3MOCA 2ZFQH 3O8RA 1HYLA 3ZVFA 4AORA 4SGBE 4CBNA 2VIWA 3SGAE 1QJ1B 3RXQA 4WH6A 3UOUA 4FU9A 2A7CA 4UFGH 4MNXA 1AUTC 2JKHA 1TGNA 3GY3A 5DP3A 2JH0D 2TGTA 3RXLA 3IITA 2KCOA 2XWBI 3T2NA 1Y3WA 1VCQA 3FAOA 4NIVA 1WAYB 2QF4A 2F91A 2Z9GA 1XUJA 8LPRA 4KP0A 2GX4A 1AB9B 2BTCE 4X6OA 2OCVB 3HK3B 4RT1A 3RC5A 1E0FD 2RA0A 1Z6EA 3A82A 1S85A 1XKAC 3TVJB 3F68H 3PMJA 2ZGHA 2AS9A 2KCPA 2J9NA 3SGBE 1GMDF 4ABAA 1GJ7B 1YPGH 4X2VA 4RKJB 1ZSJA 5GXPA 4MNWA 2F9OA 5C3NA 1NU7B 1QIXB 1YY3A 1CE5A 4F48B 2LP6A 4J1YA 2AIPA 1GJ6A 4WY3A 1UVPA 4HI3A 5C1UA 2CHAB 3BN9A 3AASA 1YCPM 1C1NA 3B9FH 4MNYA 3DFLA 3BG4B 1XUHA 1HAIH 1P02A 3RXFA 1S5SA 2O8UA 1E1RD 4JYVH 2UUJB 1BMFD 1KXFA 4Y0YE 2AGEX 2A1DB 1THRH 1BB0B 4RKOB 2WUCA 3NCLA 3QZRA 2XC0A 2D1JA 3NKKA 2UWLA 3A85A 1XUGA 2ZNKH 3SOSA 1E37B 3SGQE 3EE0B 3ATMA 2ZHFH 3LT3A 1TB6H 1K1NA 3RMOH 2XW9A 3HATH 1S0RA 1QURH 4J2YB 4TPYA 1O2OA 3QN7A 2H5CA 4AYYB 4ZKNU 1S6LA 2Z9LA 1QL8A 3SN8A 2Z6BD 2PKSC 3LJOA 1LO6A 1QJ7B 4YLUA 3OTPA 1WCZA 5E2PA 5JBBS 1UTPA 1C2FA 5T6DA 4I31A 3OFND 2Y81A 3RU4D 1Y5BT 1E1QD 1GI3A 1AHTH 1FPCH 4FU8A 2G4TA 3STIA 1BRAA 1NRSH 3MH5A 3PM3A 4O03A 1NRPH 1SQTA 1TGCA 2W26A
chains in the Genus database with same CATH topology
2PR3A 1C1MA 2HNTE 1OWHA 3M5NA 1BRCE 1CHGA 1D3QB 2ZTXA 3CENA 2ODYB 3LPRA 3ZZ9A 5TJXA 2OINA 3I78A 3T27A 1HAPH 5C1XA 1AY6H 3LGYA 3C27B 2F83A 2FO9A 4H6TA 3VXEH 2R2WU 1K1OA 4F49A 1DX5M 1THSH 5HYOA 1EB2A 1W8BH 1D6RA 4H42U 5A0BA 2H1UA 1BTHH 4HFPB 2UWPA 1G37A 1EATA 4SGAE 2BY5X 1W13U 2Y5FA 1LHEH 4NGAH 1A1RA 3IWMA 1O30A 2A5AA 2QN5T 1DICA 1UTJA 5EG4A 3AW0A 1YPLH 4ISIH 5EQSA 2ZHDA 4B1TA 3DHKH 2PHBA 2R0KA 5E0JA 1KXDA 3K65B 1AFQC 1TRMA 5E2OA 1C2EA 1BITA 3EAJA 3TJNA 3KEEA 1SGCA 1JBUH 2UUKB 3ZV8A 3E3TA 1GPZA 3R0FA 2BQ6B 5JBTA 3P17H 1H9IE 1DUEA 2ZGBH 3A8DA 1F0UA 2P8OB 5FCKA 3GDSA 1UTMA 4ISLA 1GI4A 3U8TH 1EOLA 1EX3A 2O8WA 5DP9A 1Q31A 5F03A 3A89A 1O34A 1JIRA 1NM6A 2ZA5A 3RXIA 2FLRH 4NZLA 4WMEA 1FY8E 2BY9X 4FXGH 3RXSA 1IQMA 1V2QT 1WV7H 5T6FA 1NFUA 3V3MA 3KF2A 1P2JA 2PLXA 1T8NA 4WMFA 1V2KT 3GY6A 1ELVA 4JZ1A 1JXPA 4YOGA 3VB7A 2XBXA 1VCPA 2XTTB 3AAUA 2VWLA 5AFYH 1C1TA 3TK5A 3C1KA 1SB1H 3LGVA 3SU3A 1FJSA 1CU1A 4DGJA 3ZVBA 1AKSB 1P2OA 3TIUA 1IQEA 2H5DA 4AG1A 1DXWA 1PPBH 5ETXA 1O38A 3MTYA 1NT1A 1DPOA 3RXKA 1LVMA 1C5WB 3UUZA 2VIPA 2FOCA 1K1LA 3PO1B 2BX4A 4U32A 1QR3E 2AGGX 1OSSA 2PKAA 1QA7A 2ZPSA 1AVGH 4TYDA 3M7QA 5FXLA 2PTCE 2G4UA 2HGTH 1MKXH 5C67A 9ESTA 5FPTA 2QCYA 1ANBA 1DOJA 2ODQA 2Q6DA 1GBJA 3VB4A 1C4Y2 1YC0A 1WU1A 4JCNA 1AE5A 1GHYH 1OPHB 1C5XB 2FOAA 3L33A 3LH1A 3SHCH 4CRAA 1O3FA 3M3SA 3ZVGA 3PMHB 1ESTA 2FI3E 1LCYA 1O2RA 2GV7A 3E0PB 1DVAH 1SMFE 3K9XB 3BEIB 2FYRA 2PWXA 2O8MA 1ETTH 5LH8A 1V3XA 2ESTE 4E06H 3FVFB 2BD4A 1GI1A 2VGCB 2ILNA 3ZZ6A 1LMWB 1Y5AT 5GJ4B 5ESTE 1TNIA 4YESB 2QC2A 1P2QA 4IC5A 2W5EA 2FYQA 1QB6A 4YZUA 1FXYA 1RGQA 3M3VA 1PJPA 1HRTH 4INKA 3RXUA 8GCHG 3E16B 4D7GA 2Z7FE 5HXFA 2ZFTA 4X8VH 1OWIA 5A8ZA 1D6WA 1EXFA 7KMEH 2B0FA 1CGHA 1W7GH 2A4QA 5F8TA 1T32A 4BXSA 2G81E 4WVPE 5L2ZH 1IQKA 2SNWA 1LTOA 1G9IE 2VIDA 1YLCA 3S9CA 1MBQA 1EZXC 1AE8H 3DFJA 4Y7AA 2CGAA 3A8BA 5C20A 3E0NB 2VVVA 4A1VA 4ISOA 5G4BA 1VITG 3ZVAA 2TBSA 2GT7A 4YM9A 4QT8C 5DP7A 1SGNE 2HPPH 1SQOA 1QFKH 2F9NA 1DFPA 3S7KB 1Z1IA 4XBCA 1RS0A 4BAOB 1ZJDA 1CGIE 3BF6H 1SVPA 4K1SA 4NIXA 1ZMJA 4THNH 1GBMA 4CREA 2SGEE 1G2LA 3UFAA 1OXGA 5GPIB 1SC8U 2TPIZ 2AMQA 3LKWA 4ISHH 1K9OE 3EDXB 1O39A 2FOBA 3M37A 5A0AE 1NZQH 4CRDA 1TMBH 1LPZB 2ZHEH 4X2XA 1SGYE 1KLTA 2WINI 4BOHA 3JZ2B 4FUJA 2HNTF 4FU7A 2IN2A 4A7IB 2OTVA 1GI5A 5A8XA 4IMZA 2ZTYA 1XVOA 1P09A 1A0HB 2FDAA 2G5NA 2ZDLA 2BDIA 2XBVA 5EOKA 3RXBA 1GGDC 2GCTC 5I25A 2BVXH 1MTWA 2P93A 3OTJE 4Y79A 2PSXA 3RLYH 2C8YB 3TNSA 2WV4A 1O2VA 2XCNA 2OC7A 2ZDAH 1HAVA 1UO6A 1ANEA 2DUCA 2IOTA 2LNCA 2BMGB 2VB0A 1IQHA 4D8NA 1UVUH 4IW4E 2ZG0H 1ELFA 1NO9H 8GCHF 1S6FA 3RXHA 1A3EH 3WY8A 3BIUH 4A92A 2ZEBA 3QK1A 5H4IB 3A83A 3KHVA 2J94A 1C5PA 2WPMS 2CF9H 1ELGA 3ATIA 1DDJA 5JYIA 3RDZA 2Y7XA 1O37A 1QQUA 2BB4A 1Z7KA 2TIOA 1GL0E 4IS5A 2FI4E 2C8WB 2B7DH 2SFAA 3M5LA 1O3EA 1UVOA 1BUIA 2AEIH 3UIRA 4ZAEA 2Z9JA 4D9QA 1MQ5A 3SHAH 2H9TH 5DP8A 1HBTH 1SOZA 4M7GA 3ITIA 1EZSC 3URCA 1FAXA 4NIYA 3T26A 2F9BH 1TX8A 3SNCA 1EUFA 1IQJA 1RD3B 3OSYA 4Y76A 2HPQH 1CA8B 3MU8A 5DO4H 4DG4A 1AZ8A 2FOGA 1ZHPA 3EQ0H 3RP2A 1EPTA 3UR6A 1O2WA 3DA9B 2EI7A 4GPGA 1TGSZ 1BRUP 1UTNA 4Y7BA 1TRNA 2ZCHP 1L4DA 1D9IA 2O8LA 1XXFA 1SHHB 1S81A 2WV5A 1J17T 1DLEA 2P94A 1HJ9A 4ABDA 1QY6A 1C5UA 1ARBA 1C5QA 1YGCH 1MAYA 3A81A 3TJUA 4MQAA 3QO6A 1IAUA 3PTBA 2XBYA 2QXJA 4MVNA 4ZXXH 4JZEH 2HNTC 2J92A 3RU4E 3ELAH 1AIXH 1WYKA 1GMCF 2C8ZB 3N7OA 4NCYA 1AO5A 1BMAA 1GMHF 3A7YA 1GBLA 2BD5A 3K2UA 4CRFA 2A0QB 2GTBA 3ZYDA 1A5HA 1X7AC 3T25A 1P3CA 4B2CA 8KME2 5JB8S 4MDSA 1N1LA 3LH3A 2ANKH 2ALPA 3ZZ5A 5J4SA 1HXEH 1HXFH 2TGPZ 1C4U2 1O2TA 1LHFH 1ELCA 3MNBA 1MMJN 2VH6A 2HALA 1DM4B 2BLOA 2R3UA 1FDPA 1ZMNA 1D3TB 1SGEE 4F4OC 1V2JT 7ESTE 1DWDH 4GLYA 3EA9A 1ZSLA 4X8TH 2CHAC 3P8OA 1UCYK 3O8CA 3CS7A 2WUBA 3T29A 1SBWA 4KTSA 1A0LA 2G55A 4OS5A 3L6PA 1C2JA 1XUIA 4X6NA 4NFFA 2VH0A 1MTVA 1O5FH 1QL9A 1O31A 4JMYA 1LVBA 4KTUA 3MNSA 3SO3A 3E1XB 2D8WA 1C2IA 2VGCC 1A61H 1NY22 4R8TB 1K1MA 1P57B 4K69A 3BTQE 3SUEA 1BMNH 3TH2H 1GJBB 3TJVA 4AB8A 3LU9B 3VB6A 2GMTC 1BMLA 1S82A 1XUFA 5T3HA 2BY8X 1OP2A 2PKAB 1EKBB 4JZFH 1CA0C 1FZZA 1D4PB 1ORFA 4KGAA 1GBFA 1F2SE 1O32A 1MZDA 1NN6A 3W94A 4LXBH 2P3FH 1Y3UA 3UWIA 4GHTA 2BQ7B 1O3GA 4TPIZ 1VGCC 2FIRH 2KAIB 3KCGH 1AU8A 4X1PU 2WPJS 2AMPA 1G36A 4I8JA 3S7HB 1TPSA 1Y59T 3TJOA 1YCPH 2THFB 3GCOA 1ZGVA 2FX4A 2FEQH 1A46H 1LQDB 1ETSH 1GHXH 1GMDG 4MPVA 5PTPA 1EOJA 4E7RG 6LPRA 3HK6B 1AWFH 2GZ7A 4O3UA 3TU7H 5AHGH 1O5DH 2ZFFH 1IOEA 2BDHA 3M7UA 1AQ7A 2ODPA 3RMLH 4XE4A 2YOLA 3T5FH 1T7CA 2F3CE 3UQVA 3P8GA 4OGYA 2BOKA 3SV9A 1MUEB 3MH6A 1N8OB 5B6OA 4NSVA 3SJ8A 1GBIA 1GHWH 1TGBA 4CHAB 2YNAA 4CR9A 3M3TA 1OWDA 1INCA 1SGTA 1KLJH 2W7SA 1HDTH 2H9HA 3QLPH 3QGNB 1SGDE 3TK6A 4WWYA 3A7TA 3SZNA 3SUFA 1LHCH 5J4QA 2VIVA 1RXPA 2XXLA 3NZIA 2V3OH 3SJOA 3UNQA 1O3AA 3ZZ7A 1LPKB 1H4WA 1EJAA 1UTQA 1C9PA 1YYY1 1N6XA 4K3JA 4LOYH 2VIQA 1MD7A 3NPSA 3OX7U 3Q77A 2D26C 1CVWH 1C1OA 1TMTH 1TOCB 1SL3A 2ZKSA 2ZTZA 1MKWK 1EZUC 1P9SA 4JZDH 1IQGA 2RDLA 4JYUH 1H9LB 2D2DA 3SNEA 1AFQB 2BLQA 4GVUA 1RFNA 2SGPE 1C2KA 2AFQB 3DT0H 1PPGE 2BDBA 1OOKB 3U8RH 4E05H 3LGTA 4VGCB 2BD2A 2ZC9H 1G2MA 2R9PA 4AYVB 3G01A 1EPTB 1JWTA 4CR5A 2HWLB 4FVBA 1NS3A 1CT4E 4JZIA 2NU1E 4ZHLU 1BTWA 1J8AA 1Z6JH 3UREA 1IQLA 5GCHG 2ZGCA 4ABGA 1P06A 2Y6TA 2Q1JA 2BDCA 2GKVE 2V3HH 1TE0A 3V7TA 1TOMH 1NESE 1AN1E 4K60A 4AFQA 1Z8RA 2ZF0H 1P2IA 1ANCA 4CRGA 1NC6A 2FMJA 2FOMB 7GCHG 5A0CA 1UTLM 1L0ZA 3MU5A 3PWCA 3QDZB 1ESBA 1UTOA 2ZDKA 3KGPA 3KQDA 1C5TA 1CGJE 1GI2A 2ZU3A 4X1QU 1BTUA 1L1GA 1TBZH 3FP8E 2ZCKP 1HAVB 3Q3YA 4FUDA 4WMDA 2G52A 4BTTB 3FFGA 4Y11E 1UVSH 3OU0A 2BLWA 1QCPA 4ZKSU 3O8BA 1GHVH 1FY1A 1NU9A 3ENSB 3K6YA 1FQ3A 1K1JA 1ZTLA 4I8LA 5DPAA 4X1SU 1BT7A 3PLPA 3RXEA 4UFEH 2C8XB 2BD7A 2FPZA 3GY2A 1BHXF 3GY5A 1C1QA 3URDA 5L2YH 1PPCE 1G3BA 4Y0ZE 3QZQA 1KDQA 1A5GH 4GUXA 3E90B 4NZQA 1ZGIA 2ZPQA 1BQYA 2B9LA 2ZZUH 1XM1A 1T4VH 1P04A 1C2MA 1IQIA 1L4ZA 1TNKA 1ZTJA 1QQ4A 5CHAB 3VGCC 4XOJA 3VPKA 1SGFA 1OYTH 1TBRH 1GHBG 4U01A 2BD8A 4GAWA 1V2NT 1LDTT 1MKXK 3ATKA 4Y6DA 1XXDA 3TGJE 1AZZA 3QTVH 4MPWA 3RXMA 1UK3A 2EA3A 3UNRA 1V2MT 1F5LA 2ZWLH 4X6MA 2Z3CA 1ZJKA 4YLQH 2ANWA 1CSOE 3UR9A 1VITF 1GMCG 1SGFG 6GCHF 3U1IB 4UE7H 2FESH 1DSUA 2WPIS 1O3MA 4CBOA 2SGFE 1BZXE 1JOUB 2A7HA 4KELA 4D7FA 1SFQB 3O8DA 2ANYA 4AG2A 3PMBB 1A4WH 4YT6H 3EA8A 4DT7B 3D49H 1RJXB 4DJZB 1VJAU 3B23B 6CHAC 3ZZBA 1K22H 1GJ5H 1RIWB 4BAHB 5TCCA 4NA7A 1FY3A 1U6QA 1C2GA 1TIOA 5GIBA 4LZ4B 1LHDH 1EPTC 2FP7B 3BTEE 5HM2A 1SLXB 2Z9KA 1GG6B 1KIGH 1FIWA 1P3EA 1RIWC 1S83A 1FLEE 2GVFA 2PSYA 1HIAB 2P59A 1GG6C 1EJNA 3M7TA 4FUBA 3SI3H 3ZZDA 1BTPA 1QNJA 1C5NH 1RRKA 2QGRA 1TFXA 3SU6A 1EJMA 1F0RA 1GBHA 3SJ9A 1V2LT 5SGAE 1GJAB 1OKXA 1T8OA 2UUYA 2ASUB 4ZH8A 5EXLA 5K7RA 3RXJA 4D76A 1QBNA 3BG4C 4NWKA 4RN6A 3TH4H 1SFIA 1GVZA 4TWWA 3OY5U 4BTIB 3QUMP 1SG8B 4U2WA 1O3IA 1G3EA 1ZPBA 1SOTA 1Z8GA 3GCHC 1C1UH 2GDDA 3SJKA 1ZZZA 2SNVA 5EU8A 2V0BA 3RC4A 4ABIA 1L1NA 1HGTH 5E0HA 1AGJA 3HKIB 2ZQ1A 1O2MA 5F8XA 3BTHE 3PB1E 3STJA 5EW2H 1AB9C 2VNTA 1C5MD 1S84A 1DWCH 4INLA 1QHRB 4WH8A 2CMYA 1DE7H 3S9BA 1D3DB 1ZPZA 3PLBA 1NRQH 1HAXB 3S9AA 1GBDA 4ISNA 1IHSH 2WPHS 1MU6B 4OS6A 4ZXYH 2BXUH 1O3BA 1VGCB 1HB0B 5C2ZA 1CHOG 3L3TA 1UTKA 3ATWA 3RXGA 3SU1A 3LONA 1F5KU 3FP7E 4Z0KA 3VFEA 3KQEA 4BANB 5BRRE 5L30H 3TNTA 2PTNA 3Q76A 3F6UH 2O8TA 1OWKA 1TQ0B 2XCFA 1EASA 1MQ6A 1LPGB 4AN7A 2PFEA 1HJAB 6GCHG 2GCHF 5JB9S 1Z8JB 3AVZA 3TK9A 2EI8A 1YM0A 3BTME 1O2ZA 3CP7A 5CMXH 4JK6A 3SV7A 1P8VC 1TA6A 3BTDE 5HGGA 4DW2U 2B8OH 3P95A 1SGRE 1YPHC 2ALVA 4TY6A 5FX5A 4CH2B 1Q2WA 1IQNA 4X1NU 5DP6A 1ABJH 1UHBA 3MU1A 1GDUA 1TWXB 3I77A 3MH4A 1C5LH 3RXDA 3GISB 1QTFA 1C1PA 1SLWB 1TALA 3MH7A 1O5EH 1KXAA 2J34A 3M35A 1CT0E 4I8GA 4WXIA 4K1TA 1TPAE 1C2HA 1GJ9B 3GICB 1QB1A 4OS7A 2EEKA 2JETC 4GHQA 1RTKA 1FV9A 3MU4A 3EA7A 2A32A 2AGIX 4A6LA 4UONA 2Z3EA 2PUQH 4ABEA 1AWHB 2JETB 1GVKB 4Y8XA 2VVUA 2W3IA 2B5TB 2ZDVH 3GDUA 1Y5UT 3LGUA 1Y8TA 1QBOA 3KNXA 1E34B 2G8TA 1GBAA 1LQEA 2ZIQH 4WXVA 1TPPA 5GDSH