3PLKA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLLNSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA02
1F0SA 1W0ZU 4J1YA 1N8OC 3F9GA 3SI4H 4AG2A 5CE1A 3M5MA 1FY8E 1LCYA 2DUCA 1MBQA 3LGUA 1XKBC 2TGDA 1O2XA 1C4V2 1T7CA 1HBTH 3BF6H 3QTOH 2Y7XA 2PUQH 3EA7A 2QA9E 4K60A 1C5XB 2GCTB 3Q3YA 4HTCH 1HAGE 3SU2A 3F1SB 3E8LA 2XWBI 3V12A 1Z8RA 2QF0A 1C5YB 1E0FD 2HNTE 1P03A 3TNSA 3TH2H 3SQEE 3M3SA 3K65B 3TK9A 3VB5A 2HALA 1V2MT 1WTGH 1YPJH 3QTVH 1C5NH 1YP9A 4LXBH 4CBOA 4X2XA 1TBZH 1UTQA 2ZKSA 1JMOH 3F9EA 1SGPE 1Y3XA 3SNAA 2FTMA 1PPBH 3MNSA 4XE4A 1OP0A 4JZEH 5BRRE 3P70B 3MH4A 1UCYH 3URCA 1C5VA 2GD4B 2AH4X 1EZXC 2VGCB 2VIPA 1DOJA 1TBRH 1PQ5A 2F83A 1OS8A 1RS0A 1QL7A 3GCHB 1ABIH 3SJ9A 3FVFB 9ESTA 1FJSA 3BIVH 2G4UA 2FESH 1LVMA 2OCVB 2ZFQH 4ZKNU 1GI3A 2F9PA 4D7FA 4Q80A 5H4IB 1ZTKA 1K1JA 4Y7AA 1YC0A 4D7GA 3A8BA 4X1QU 1QNJA 1DUAA 1ZR0A 1UVTH 3U9AH 4B73A 4A1XA 5B6OA 1V2LT 4Y0YE 3ZZAA 2XWAA 4ISIH 2HNTC 1GL0E 1W10U 3LKWA 2A7CA 2VINA 2PTCE 2ALVA 3WY8A 4PROA 4CRGA 3MU0A 1O5DH 1PYTD 2AFQB 2ZQ2A 3RXEA 1OSSA 3PLBA 4OS5A 2ZHQH 1VGCB 1RIWC 4DJZB 4NG9H 1MU6B 1D3TB 5JB9S 1KIGH 2BX4A 1O3OA 5JYIA 2GGVB 1QCPA 2ZDKA 3BTFE 6CHAC 4NSVA 5JB8S 3KEEA 1FQ3A 2F91A 4BAKB 2SGPE 5ABWA 1Y3UA 3KHVA 1LPKB 1MKXH 3ZVCA 2DE8A 3D23A 1QY6A 2O8LA 1D4PB 1O2VA 1THRH 3ODFA 5FBIA 3P95A 2I6QA 1BRBE 1AO5A 2WYJA 1BTWA 4CRCA 2ANYA 2LNCA 1MMJN 1C5MD 1ID5H 1GHYH 1RGQA 3ZZ6A 1PPGE 1HAZB 4DOQA 1JRTA 3RXMA 4CH8B 1P2JA 4NCYA 1LVOA 1QB9A 3SV2H 1SHHB 2ZFFH 1DSUA 1FV9A 1GMDF 3LC3A 5AFZH 2Z7FE 1Q31A 2D1JA 5A0CA 1H1BA 4ZUHA 4X8VH 1K1MA 9LPRA 4KKDA 1JXPA 4ZKOU 1RJXB 2FMJA 3RMOH 1KY9A 2ZDAH 2FOAA 2G52A 2FI3E 2ZP0H 3TIUA 4DCDA 2B0FA 3T5FH 1O2KA 1GVKB 3B9FH 3SNEA 5E0JA 3LGYA 3Q3XA 3K6ZA 1C5SA 4K1TA 1BMAA 4ABFA 3SU5A 2UUYA 1ESBA 2A4OA 1HGTH 4AX9H 1GBBA 1NFYA 1UTKA 1RD3B 1DPOA 1GDUA 1LHDH 1QURH 3SU3A 4YZUA 1SLWB 5DP6A 1SI5H 1ZPCA 2VVUA 3STJA 3R3GB 1ELAA 1MTNB 1YPHE 2ZU3A 3ZV9A 1UTMA 4X8SH 2PFEA 3M37A 1ZTJA 1KTTB 1D3DB 1NY22 1TONA 1PPHE 3GY8A 3W94A 4FUHA 2F9VA 4UD9H 2FP7B 3QLPH 1NO9H 5LH8A 1O39A 1O5FH 2FLRH 4DT7B 2BD8A 4JZIA 1NZQH 3ATLA 1AVGH 2QC2A 4FUDA 4FUEA 1F5KU 4HZHA 1EOJA 2R9PA 2F9NA 1A1RA 3S9AA 1Y8TA 3E16B 2A4RA 1RTKA 1S0QA 2G81E 1E36B 4OS7A 2QXGA 1OKXA 2THFB 1F2SE 3VB4A 1KXEA 2V6NA 1C5UA 4MNYA 4NIVA 2Y81A 1MKWH 3SUEA 2G55A 3B8JA 5A0AE 3NPSA 2NWNA 3A8CA 3JZ2B 3LJOA 4D76A 1XKAC 1J16A 2FX6A 1W13U 3MU8A 4MTBA 1ZHMA 5HGGA 1C1TA 1TMUH 1NFWA 5DP9A 2PW8H 2P3UB 3BG4C 3UIRA 3KL6A 2J34A 1V2QT 2Z94A 5JPMH 2FWWA 2H9EH 2AIPA 5E0HA 2QIQA 1K22H 2A31A 2IN2A 1IOEA 2ZZUH 4IN1A 1K1LA 1WYKA 4CRAA 5AF9H 2XNIA 1HLTH 1TNKA 5JBAS 1KXCA 1TGNA 1LVYA 4KTSA 3TK6A 3U8TH 4X6NA 5DO4H 3JZ1B 1TPAE 1DFPA 3UY9A 3M3VA 2O8TA 1T31A 1NM6A 2J38A 4OS4A 1IHTH 1E37B 2W7SA 2UWLA 1FLEE 1DXPA 1FPHH 3NKKA 3ZVDA 1QL8A 4WH6A 1GJCB 2SGQE 2ZWLH 4YOIA 3PV4A 1V2ST 3RXTA 4AOQA 6ESTA 1IQEA 4Y79A 1SFIA 1TNJA 1JRSA 1GJDB 1ANEA 2ZC9H 1HYLA 1ZLRA 2W3IA 4JCNA 2CMYA 4I8LA 4IBLH 5E8EH 2UWOA 1QR3E 5EODA 2BLWA 4ZHLU 2AGEX 2BVRH 2H6MA 2BB4A 4RKJB 1T32A 4MG3A 2A7JA 1QRXA 1O3EA 3MTYA 3SJKA 2PGQB 1TNGA 1SOTA 3MI4A 1UVSH 1GI5A 1MTUA 1GCTB 3GISB 3UFAA 1GL1A 3MO3A 1J14A 1INCA 3MWIU 3S7HB 1MU8B 3PROA 1DS2E 1ZYOA 4H4FA 3S9CA 2GTBA 1Z8GA 3ELAH 1EOLA 1G3CA 3I29A 4AZ2B 8ESTE 2W7UA 4WY3A 5C3NA 4LZ4B 3KQBA 3F68H 3ZVGA 4A6LA 2J94A 1K1IA 1C1SA 2VVCA 3A87A 1OP8A 4BANB 2FTLE 3TGJE 1BMNH 1GI7B 2XC5A 2Z9JA 1O5EH 4O3UA 1GBLA 5F8ZA 4DURA 1TX8A 1O3PB 3SHCH 4YT7H 1FONA 3P8GA 3NWUA 2P94A 1VJAU 4Y8ZA 5DP3A 4FVBA 4IW4E 1VITG 3D49H 4K5ZA 1TAWA 1GGDC 1MH0A 5FCKA 2SGAA 1WAYB 1CVWH 1GI1A 1IQKA 5I46H 1SLVB 1LHCH 3SNBA 1F0UA 4O97A 2HGTH 4MPXA 1UTLM 3PWCA 1D9IA 1DY8A 1A4WH 2BQ7B 1Q3XA 3ZYEA 2O8UA 1QB6A 2FOMB 5F8TA 4NZLA 2FPZA 2ANKH 4JYTA 4Y11E 2ESTE 1O2LA 2OBOA 4H6SB 2VIDA 1AE8H 3RXRA 3ZV8A 1P2NA 2BDIA 3A7WA 3NUMA 1CBWB 3RXSA 3V13A 1NU7B 4KP0A 3M5LA 3KCGH 5A8YA 1L4DA 1A0JA 1TMTH 3ZVAA 4LZ1H 1DLEA 2BD3A 2ZU4A 4B71A 4K2YA 3E6PH 1ETRH 2Y7ZA 2O9QA 1PQ7A 3GY4A 5A8ZA 4CHAC 2Y5GA 2PKSB 3ZZBA 3SNCA 1XUHA 2JETB 3K2UA 2BYAX 5AHGH 3LDXH 1H4WA 2AS9A 1TQ0B 2VU8E 1DITH 4TY6A 1BRUP 1Y5BT 2FM2A 4BAHB 1GHAG 1Y3YA 3BTTE 1T4UH 4UFEH 1O32A 4E05H 2OLGA 4IMZA 1Z71A 1BBRK 3A8AA 2I6SA 4BOHA 1S85A 2FOHA 1EAXA 1MD8A 3RMLH 1K9OE 1TE0A 1ZMLA 1NU9A 3P17H 3LT3A 3LPRA 5DP4A 1W7GH 4DGJA 4I7YH 2AEIH 2NU4E 2Z3DA 2ZCHP 4RSPA 3P8FA 2FDAA 4XDEA 1TLDA 4ABEA 1EUFA 4X1NU 1M9UA 2XCFA 4FU7A 4MNXA 1SL3A 5CHAB 1HJ9A 4I8JA 3RXDA 5JDUB 1CGHA 2A5KA 4NWKA 1W8BH 2GMTB 1OOKB 2A5AA 2RG3A 2BDYA 5DGJA 4INKA 1EP6A 1AE5A 1JIMA 1ELGA 1HAVB 1SB1H 2CXVA 1BTUA 1ESTA 4A5TS 1C1PA 3LONA 3SV7A 7GCHG 3ESTA 3RXVA 4B75A 1BMLA 3U1JB 5JBTA 4ZXXH 5C5NA 2WUBA 1SMFE 1W7XH 4Y8XA 1DM4B 2XBYA 1V2TT 1E35B 2F9OA 2Q6GA 1HJAC 4XFQA 1C2EA 2NU2E 1ELCA 2XBVA 1SGCA 5EG4A 4GHTA 3ZVFA 2SFAA 1SGTA 3EQ0H 4WMEA 5GCHF 3TGIE 4CH2B 3GCNA 1EATA 3U98H 5DP5A 1GPZA 2BOKA 1FUJA 6CHAB 3Q77A 1HAVA 2ZHWH 1P12E 4GVUA 4MDSA 1WSSH 1C1RA 1C2HA 1EAWA 1TFXA 1ZJDA 2BDGA 3K6YA 1AWFH 2ASUB 3PO1B 4JYVH 7ESTE 3SNDA 3LGWA 5JBCS 1UO6A 4BAOB 1F92A 4TY7A 4A7IB 4IS5A 1QB1A 8KME2 1VITH 3LH3A 1O2RA 1W11U 2P8OB 2P3TB 1IQLA 3RLYH 1NFXA 2AIQA 3ZZDA 1SLUB 4KELA 4AB9A 2CHAB 1YCPH 3U1IB 4E7NA 1DDJA 3RU4T 1FY4A 3HGPA 4IC5A 4ZHAA 2P16A 4I32A 2A1DB 4U01A 1MBMA 3TGKE 1EZSC 2FS8A 5DP8A 1UVPA 2HPQH 1GJ6A 2PWXA 1AKSB 1BZXE 3VGCC 1O2UA 1GVLA 4NSYA 1GBEA 2BY7X 2Z9GA 1TGBA 1SFQB 2B9LA 1FN8A 5HM9A 1C1NA 1DY9A 1P02A 4X6OA 5AVDA 2ZFSA 3VXFH 1BOQA 1C2GA 1LO6A 1TRYA 4INLA 1NT1A 4HGCA 1BIOA 4E7RG 3SJOA 5GWZA 5DPAA 1QA7A 1GDNA 3RU4E 3ATKA 1HXEH 1O2SA 4WXIA 3QDZB 2TRMA 1GVZA 1UTPA 1MCVA 2BY6X 1V2NT 2ZEBA 1C9PA 3PTBA 3U8RH 3ZZ8A 3RXGA 4Y71A 2BD2A 3AAUA 1QL9A 3VXEH 1AKSA 2GT8A 1FAKH 2IJOB 1GCDA 4K8BA 2ZDVH 1BMMH 1UMAH 5L6NH 1TA2A 5GCHG 2ZGXH 3SO3A 2XBXA 1C2LA 3A82A 1CT0E 4Q2KA 1Z6EA 1IQJA 4ISLA 5T6DA 5ESBA 4FUIA 1A3EH 3BTWE 1GBAA 3EA8A 1CA8B 3STIA 4X2YA 3RDZA 3H7OA 4JZ1A 4BTIB 1G3DA 1SR5C 1K1OA 1IQGA 1Q2WA 5G4BA 1GJ5H 1Z1IA 2XCNA 3MU4A 2NU0E 3K9XB 4Y6DA 3E91A 1AMHA 3ZYDA 1PPFE 3A8DA 3SGBE 4J2YB 1AI8H 1CA0B 1RXPA 3G01A 1GDQA 1Y5AT 4FU9A 1KXBA 5T6GA 2B5TB 4NFEA 1NESE 4CRDA 1AFQC 5FX5A 3RXIA 1A5GH 1MTWA 3M7TA 1AD8H 1CT2E 1J17T 5GXPA 1AHTH 1EAUA 2A32A 2P95A 5EPNA 1C9TA 1HJ8A 4YESB 3SUGA 2Q6DA 3V3MA 2R2WU 7LPRA 1BHXF 3QO6A 4WXVA 3DA9B 5FX6A 4FUCA 4NZQA 5LPEA 1HAYB 1A46H 1KLIH 2V3OH 5AFYH 1B5GH 1NRNH 3PMJA 5E0GA 3UR9A 2VIOA 3UNRA 1SGFA 5L2ZH 3P8OA 3TPIZ 1IHSH 2EC9H 2ZDNA 4X1PU 1GI2A 3MU5A 1LHFH 3SZNA 1O3BA 3BV9B 1O33A 2R3UA 3B23B 1P3EA 1O30A 1NC6A 5ESTE 3VFEA 1EX3A 2GCHG 2H2ZA 2WPLS 3GDVA 1YCPM 1Z8JB 4O03A 1TOCB 3EAJA 3TJOA 3RXKA 4Y10E 2A2QH 1AN1E 4X8TH 1GMCG 2OUAA 2PSXA 1K1PA 3RC6A 1BQYA 1TYNA 4FUFA 1AVXA 1BTXA 1ZOMA 1A61H 1TB6H 3T27A 1A0LA 1OWJA 3CP7A 4IMQA 1HDTH 1TPSA 2ZECA 2BQ6B 1P2OA 2ODQA 4B2BA 3V0XA 2BMGB 1EB2A 4U30A 1O2WA 1LTOA 2AGIX 4XBBA 4DIIH 1C5QA 1DWCH 2GCTC 1MTSA 1ELBA 1SC8U 1AB9B 3A7ZA 3BEIB 1CGIE 3HATH 5C1YA 3MU1A 1XVOA 2ULLA 2ZFTA 4R8TB 1O2NA 3LH1A 3UUZA 2A0QB 3R0FA 3HKJB 2J4IA 4A1VA 1YPGH 2ANWA 2F9BH 3A83A 1A2CH 2HOBA 1KXDA 3HK3B 3ZZ9A 1D3PB 2VWNA 3A86A 1JOUB 4X1RU 1QA0A 1GI9B 3Q76A 1S83A 3MH6A 1DT2A 3CS0A 3MYWA 4X0WU 2LPRA 4K3JA 3M36A 1UCYK 1GJ9B 1O3KA 1V2KT 3ZZ4A 5EGMA 1TNLA 1YLCA 3T29A 4JZDH 3DFLA 3NCLA 1BITA 2VGCC 1F0RA 2B8OH 1FZZA 4WMFA 5C1UA 5J4SA 1P9SA 2WV5A 2JH0D 1G2MA 1N6XA 3RMMH 2ZGCA 1C5WB 3KQCA 3Q00A 2J92A 4FUJA 4Y7BA 3P6ZB 4BAMB 4KTCA 1SQOA 1LPGB 3GY7A 2ZA5A 1ZGVA 4YTAA 3Q3KA 1N1LA 2R3YA 3MHWU 1DXWA 3UNSA 1CQQA 1JIRA 1TA6A 3PMBB 1H9LB 3E90B 2EEKA 3GY6A 1QJ6B 4ISNA 1MZAA 3FZDA 3NK8A 2ZPQA 2H9TH 4AFUA 1FPCH 4X6PA 1F7ZA 4FXGH 1ABJH 4I33A 3RLWH 1EPTB 1OXGA 1TNIA 1JBUH 1ZRKA 2G00A 5C1XA 1VGCC 1YBWA 4DG4A 3UQOA 3GOVB 2K1QA 1BCUH 1AWHB 1QRWA 1SG8B 1EB1H 2CF9H 3W95A 1QBNA 1MKXK 1C2FA 4RN6A 2YNBA 2UUFB 3C27B 3SGAE 1WOFA 3SJ8A 1FXYA 5TCCA 1YF4A 4WF8A 3UREA 4CR9A 1YPLH 1VITF 1A3BH 5EQRA 4HI3A 1RTFB 3BTGE 1NTPA 4GCHF 2FOGA 3OY6U 2OC1A 4AGJA 1EPTA 3DHKH 3PYHA 4D8NA 1BHXB 3MO6A 3PMAB 3TNTA 3U8OH 3M7QA 5E2OA 4INHA 3RXPA 3BG8A 1V2WT 2G5NA 1EZUC 2FOEA 4ABIA 4FUGA 1P9UA 2D8WA 1ETSH 1QQ4A 2HNTF 2ZU2A 5T6FA 1C1OA 1GMHG 3L3TA 3UNQA 4JK5A 1G30B 2Z9IA 1W2KH 1O3DA 2OQUA 2Y6TA 1W14U 2A2XH 3FFGA 1AUJA 3OU0A 5A0BA 3OYPA 4X8UH 4AFZA 2D2DA 1A7SA 1SQTA 3OY5U 5E2PA 3BEUA 2NU1E 4JZFH 1O3FA 3OSYA 1XUIA 1NRRH 1GHWH 1GJ4H 1F0TA 2ZGHA 1MAYA 1QBOA 1B7XB 2ZU5A 2GZ9A 2A4GA 1EJMA 1G3EA 3L6PA 1C2KA 1QJ7B 4YO9A 1ZHRA 1HAIH 1J15A 1SOZA 3A7XA 2OTVA 1J9CH 3SU0A 1GHAF 4X2VA 1C4U2 1GI4A 2QGRA 2WPIS 2PSYA 1VCQA 3DFJA 1MTNC 2BY8X 1T8NA 5BPEA 2YNAA 3GICB 4O3TA 3ATWA 4XOJA 4NIXA 2ZCKP 3UWIA 2BX3A 1GWAA 2FIRH 4R0IA 4YM9A 3ODDA 5L30H 4Z6AH 1FDPA 1SPJA 1TX6A 2Z6BD 3RXAA 3SU6A 3OTJE 1IQNA 1O3AA 4U2WA 1TGTA 1GI0A 4WWYA 1HUTH 4ZMAH 1BA8B 1P2KA 4BNRA 2BVXH 5DJ7A 4XBDA 4GCHG 5EQQA 1P0SH 1DWDH 2WV4A 1MKWK 1XUKA 2BD5A 3RC5A 1CHGA 4ZKSU 3E0PB 1J8AA 7GCHF 1MAXA 4ZXYH 2PR3A 1GI8B 1TABE 4D9QA 2F9UA 5HMAA 3SBKA 1XX9A 3UPEA 1GHBG 1ACBE 1GG6C 1C2DA 2ZFPH 2FXRA 2ODPA 4K8YA 1MQ5A 2HRVA 3GYMA 1ZSKA 1SVPA 1GJBB 3FANA 1S6HA 3TH4H 3SV9A 1N8OB 2BDHA 4OS1A 2G8TA 4VGCC 2C93B 4YT6H 1O3LA 2BHGA 3HGNA 3O8DA 2FODA 2H5DA 1C1MA 1GBCA 2PLXA 4AYVB 3F9HA 4Z0KA 1VCPA 2ZIQH 2HVXA 4MNVA 4NGAH 2EI8A 1KLTA 1AQ7A 1XM1A 4AGKA 1SGIB 1PPEE 1PPZA 1C2MA 1XUGA 1Y3WA 1O2PA 3NZIA 4F49A 1K2I1 3S69A 4F4OC 4TWWA 3LOXA 4B1TA 3QUMP 3OX7U 2Y5HA 1DSTA 1WV7H 1UVUH 4UONA 1AIXH 2EA3A 1O5CB 5FPYA 1IAUA 2KAIA 5F03A 1OWIA 2OC7A 3SU1A 1BUIA 3RXLA 2F3CE 3A7YA 1Y59T 3RXUA 1LVBA 2C4FH 3MNXA 3P92A 4DVAU 3EDXB 3MH7A 1OWEA 1UVOA 2ZGBH 3A80A 1H9HE 1KDQB 1BTZA 3P8NA 2VIVA 2Z9KA 1UK3A 4ASHA 5T3HA 2RCEA 2C8ZB 3SJIA 3D65E 5K0HA 1PQAA 3LC5A 2VWMA 1BTHH 2FX4A 1O2GH 3UTUH 1FMGA 1GCTC 5DKMA 1LDTT 3PMHB 2C8WB 3SHAH 1DX5M 1YM0A 4LK4A 1YPMH 2BVSH 4BTTB 2QXIA 3SUFA 1TOMH 1ZSJA 4CR5A 1GBIA 1YKTA 2JH6D 1S82A 3RP2A 4ESTE 1DWEH 5HYOA 1HV7A 1P57B 2ZPRA 3RXFA 1KDQA 4I8KA 3QWCH 2QAAA 3GCTG 1O2OA 4I8GA 3L33A 4ZKRU 3ZZCA 1N6YA 1QFKH 1O0DH 1EQ9A 1K1NA 2ZG0H 1T8OA 4DIHH 2Z3CA 4UFDH 5DK1A 1RIWB 4MPVA 1O3IA 4JYUH 1A5HA 1UK2A 1O2HA 2C3SA 1BTPA 3BTQE 4GSOA 1THSH 4I8HA 1XUJA 4X1SU 3M3TA 1G32B 2HWLB 3A81A 3O8BA 2AMQA 1IQHA 4WJG2 3SORA 1W12U 1YYY1 2IPHA 2BZAA 2STAE 1UK4A 2YOLA 3AAVA 3MMGA 1KLJH 1QBVH 1ZTLA 5EOKA 4FU8A 1NRSH 2BDBA 5K7RA 1FNIA 3UOUA 3SN8A 2AGGX 1MD7A 4NWLA 3BSQA 1P3CA 1SLXB 1TX7A 2FOCA 1ZPZA 1P2QA 4Y8YA 2QV1A 1MCTA 3A84A 1HAHH 1L1GA 5GIBA 3ENSB 4SGBE 1QQUA 2WPMS 1EASA 2BY9X 1VZQH 3LIWA 1GI6A 1NFUA 2BDCA 2AERH 5C67A 2VWOA 3SUDA 1SGDE 1LMWB 2CF8H 1NROH 3UQVA 5ETXA 3SQHE 3ITIA 1A5IA 2UUJB 4GHQA 2BOHB 1ETTH 1KXAA 2ODYB 1CBWC 3BN9A 3QZQA 2UUKB 2VH0A 1O2ZA 1CHOG 1NRQH 1W0YH 4KTUA 1AUTC 1L1NA 1T4VH 1GJ7B 1MUEB 3SGQE 1D6RA 3RXJA 5L2YH 2ZHFH 3EE0B 1MZDA 2CGAA 1L0ZA 2PKAB 2PKSC 3QGNB 3KQDA 1AZZA 3HPTB 3RXOA 1SQAA 1PFXC 2JETC 1EZQA 4ABJA 2GCHF 1V2RT 1DVAH 3RU4D 3AW1A 1FY5A 5FXLA 3GY5A 4NIYA 1E34B 1TQ7B 2ANMH 1GMCF 1SGNE 1O2MA 5PTPA 2SNVA 1O5AB 4BXWA 1TIOA 1TBQH 1P11E 3V7TA 3C1KA 1P2MA 1RFNA 1LQDB 1NRPH 1H8IH 4I31A 2GV7A 2ZDLA 2W26A 2H5CA 2GDDA 1CSOE 4CRFA 1GBDA 3ATMA 1TGCA 1HFDA 1C1QA 4JMYA 1EJAA 1AGJA 5EXLA 2PKAA 3BTKE 4ABBA 1BRAA 1L2EA 3RXCA 1O2TA 1HAOH 1LPZB 5FPSA 2AYWA 1V3XA 1ORFA 1UCYE 1WTHD 1XMNB 4M7GA 1TPPA 5CHAC 1O2YA 2GMTC 2ZGJA 2V35A 1HNEE 1GHVH 1T8MA 2BLOA 1DLKB 2JH5D 3HK6B 1EAIA 3GDUA 1BRCE 2PTNA 2ZI2H 4Q7YA 4DW2U 1Z1JA 2WINI 2BXUH 2SGFE 2GDEH 4YLQH 6GCHG 4ISOA 3FP7E 3BG4B 4CREA 2UWPA 4UE7H 1ESAA 4DY7B 3CENA 4AFQA 1P09A 3EGKH 3QZRA 2W3KA 1BB0B 5FBEA 1TRMA 1OYTH 2FOBA 1QJ1B 4BTUB 4O9VA 3BTME 3I78A 4RKOB 2BQWB 4IGDA 1SHYA 1D3QB 4BXSA 1ZJKA 3T26A 1GBKA 1P06A 1F5RA 3PB1E 4CBNA 1G36A 4SGAE 2FZZA 2VIWA 1FIWA 1O3HA 2OXSA 1RRKA 3NXPA 1AZ8A 5EXNA 4AG1A 3RXQA 3TJNA 3PO1C 1HPGA 1YGCH 4NA8A 1X7AC 2TBSA 4OS6A 1QGFA 1NS3A 3UR6A 2OINA 3DUXH 4AN7A 2WPJS 2R2MB 4GLYA 1SGQE 1UTOA 2ZTZA 2P3FH 1L4ZA 5FPTA 1YCPK 2Y80A 3PLPA 2P8OC 2TGAA 3S7KB 2XRCA 4OGYA 5LGOA 5LPRA 3M7UA 2CHAC 1T8LA 1P05A 1GBMA 3A7TA 5GJ4B 1O37A 4MQAA 1C5ZB 2VVVA 2ZU1A 3KNXA 1PYTC 1AY6H 1D6WA 1UTNA 2FI5E 3BTEE 3O8CA 3FP6E 1S81A 1XXFA 1Z7KA 2G51A 4X2WA 5LPFA 1P10A 2VH6A 1HB0B 2BM2A 4ABGA 2A4QA 2FS9A 1ELFA 1PJPA 4A92A 4XSKU 1DUEA 1FN6A 2OD3B 3M35A 2RA0A 2QYIA 3AASA 1C5LH 1P04A 3PTNA 4NA9H 2J95A 2RDLA 1AU8A 2XTTB 2PV9B 4WH8A 4AFSA 4K1EA 5GDSH 2BD7A 2SNWA 3ZZ7A 2WYGA 3MNCA 3LGIA 1GJAB 2OQ5A 2FYRA 1K21H 1O3NA 3LU9B 3TJVA 3RM0H 3RXHA 1O5BB 4BAQB 3E1XB 1O3GA 3UOPA 2V3HH 1KTSB 1LHEH 3QGJA 2W5EA 2XXLA 1L1JA 1CU1A 1GMHF 2FI4E 3KF2A 3VB3A 3T25A 3GCHC 2ZTXA 2DE9A 4MLFB 4WVPE 1BTYA 1C5PA 3IITA 1Y5UT 5GPIB 2A45B 2CV3A 1SSXA 2A7HA 4IN2A 1ZGIA 3KQEA 4Q7XA 1GGDB 3A7VA 3S9BA 1S84A 5HM2A 4YOGA 1HAXB 2OC0A 1C5OH 4UDWH 1ZRBA 1ELTA 1CA0C 3F9FA 1O36A 4ZROA 4HFPB 3QK1A 3RUOA 2XC4A 1TNHA 2JKHA 3H5CB 1ARCA 2FOFA 1KXFA 1ELDE 1EP5A 3N7OA 2SGDE 2G5VA 2J9NA 5C20A 2ZPSA 1Z6JH 1GMDG 2PGBB 1CE5A 1ELVA 1GG6B 2ALPA 1CGJE 4YOJA 2VB0A 1DANH 4IC6A 4AYYB 5FHTA 2QXHA 3BTDE 2XW9A 5IDKA 2QCYA 2HPPH 2ZHDA 4VGCB 2XBWA 1V2JT 1YPHC 2FEQH 4TWYA 2NU3E 2A5IA 2SGEE 3SOSA 2XC0A 2O8MA 1GBJA 1KYNA 3BEFB 4LOYH 4B2AA 2GKVE 1SGEE 5JBBS 4B74A 4CHAB 2BLVA 2WUCA 1A0HB 3FP8E 2BDAA 2V0BA 1SBWA 3F6UH 4D9RA 4OGXA 3DD2H 1SGYE 3EA9A 1ZHPA 1HCGA 4Q7ZA 3PM3A 1G9IE 1Z8IB 2GZ7A 2J2UA 4ZH8A 1GHBF 1F5LA 1WQVH 1G2LA 2TPIZ 3EYDA 1SGRE 1O38A 4ABDA 1AFEH 1WBGB 3LJJA 1O2JA 1G3BA 3MH5A 5DP7A 4Y0ZE 1HIAB 1GHZA 1TPOA 3DT0H 4MNWA 1UHBB 2Y82A 2ZHEH 1DWBH 1BBRE 3GY3A 4YLUA 1BBRH 8GCHF 1P2IA 1O31A 1ANCA 2QN5T 1IQIA 1JWTA 3VEQB 3MO9A 3BIUH 1HXFH 4B2CA 2Q1JA 2ZDMA 1AVWA 5EXMA 1FY1A 1EKBB 1LKAA 2ZTYA 4K69A 5DG6A 3TK5A 2BY5X 2RA3A 3RMNH 4GAWA 3E0NB 1AB9C 4Y76A 5SGAE 2ZCLP 1DICA 4FVDA 3KIDU 3ATIA 3IG6B 1TRNA 1UJ1A 2AMPA 1HIAA 1ZPBA 1O3CA 2TGTA 3M61U 3D62A 1HRTH 1UHBA 2CJIA 3A88A 2Z9LA 3HKIB 4UFFH 1TGSZ 4MPUA 2VNTA 1MQ6A 2QF3A 1C1UH 1HJAB 1XXDA 5C5OA 2ZNKH 5A09A 1W3CA 3BTHE 1CT4E 1S5SA 3T62A 2C8YB 1KSNA 2FLBH 5EQSA 1WU1A 4KGAA 4AORA 1O35A 3GCOA 2C8XB 1O2QA 3GYLB 1V2UT 1G37A 1OX1A 1C2JA 4K1SA 1BJVA 1YPEH 1WCZA 1IQFA 3M5OA 3LGTA 2Z3EA 1H9IE 1FIZA 1MTVA 1OWHA 3PWBA 3IWMA 1TMBH 4B76A 2GX4A 1GBHA 4GUXA 3TLOA 3H7TA 3CS7A 1OPHB 2ZF0H 2STBE 3E3TA 3RXBA 5A2MH 1TWXB 2FO9A 1RTLA 3GCTF 2KAIB 2GV6A 3A85A 3TH3H 2BZ6H 2GZ8A 1EPTC 2GT7A 2VIQA 4FUBA 1PQ8A 2M5TA 1DE7H 3FZZA 3O8RA 1NN6A 4QT8C 1C5RA 1C1WH 8GCHG 3A89A 2R0LA 2VJ1A 4ZAEA 1WUNH 5FAHA 1P8VC 3MFJA 2OC8A 3MOCA 3ZZ5A 3VGCB 1C5TA 2B7DH 5EU8A 3UWJH 1LQEA 1WQSA 1P01A 1B0EA 1V2VT 3GY2A 1ZMJA 2P59A 2WPHS 4UEHH 1HAPH 3LGVA 1GJ8B 4AB8A 1TALA 1ZMNA 5J4QA 1OWKA 1S0RA 4ISHH 5F6MA 3PLKA 1O2IA 2QY0B 3SI3H 5HXFA 4NIWA 4U32A 1GHXH 1V2OT 3ZVBA 5IYTA 1YPKH 4A1TA 1K28D 1FY3A 1BT7A 5EW2H 2AMDA 4X6MA 3TU7H 4MPWA 2QXJA 4THNH 3QN7A 4JK6A 3SU4A 3GDSA 2EI7A 1Y3VA 3MNBA 1ARBA 2GP9B 4NA7A 2G4TA 1OWDA 2ZO3H 3ZVEA 3SW2B 1U6QA 1O5GH 2OP9A 3URDA 4ABAA 3RM2H 2R0KA 2C90B 1QIXB 1CHOF 2HLCA 2H9HA 1ZZZA 5CMXH 4CRBA 1LHGH 1GBTA 1VR1H 1O3JA 2BXTH 1OP2A 1IQMA 1C4Y2 2D26C 1CO7E 1XVMA 1ANDA 4ABHA 1QTFA 2VWLA 4XBCA 2BTCE 4H6TA 5TJXA 2PHBA 3FAOA 1LKBA 4UFGH 1UTJA 3VB7A 1V6DA 3KGPA 5EW1H 1EJNA 3TITA 1S6FA 3KN2A 1C1VH 1FAXA 1FI8A 1ZSLA 2ILNA 2IOTA 3T28A 2FYQA 1AFQB 3U69H 1C2IA 2WPKS 4TYDA 5EPYA 5F8XA 1QRZA 2ZFRH 5FCRA 4E06H 2P93A 2BD9A 6LPRA 2TGPZ 1ELEE 3ZZ3A 4GPGA 2XYAA 3VB6A 1ANBA 8LPRA 1BDAA 3M5NA 3SV8A 1H8DH 1GBFA 1O3MA 3I77A 5C2ZA 1XUFA 1V2PT 5TCAA 2OBQA 7KMEH 3SV6A 2H1UA 3S0NA 3RC4A 4ZHMU 5I25A 1VJ9U 1QHRB 4NFFA 2GVFA 4TPIZ 3TJUA 1E38B 2O8WA 2BLQA 1B0FA 2CN0H 1YLDA 2EI6A 3AVZA 1BJUA 1NPMA 2BD4A 4OS2A 4TPYA 3T2NA 1EXFA 3QX5H 1PPCE 1VCWA 2TIOA 2Y5FA 2PUXB 4WMDA 1O34A 5A8XA 2ZQ1A 1SGFG 3TVJB 4MVNA 6GCHF 1THPB 1OYQA 2Q6FA 4H42U 3VPKA 3AW0A
chains in the Genus database with same CATH superfamily
1F0SA 1W0ZU 4J1YA 1N8OC 3F9GA 3SI4H 4AG2A 5CE1A 3M5MA 1FY8E 1LCYA 2DUCA 1MBQA 3LGUA 1XKBC 2TGDA 1O2XA 1C4V2 1T7CA 1HBTH 3BF6H 3QTOH 2Y7XA 2PUQH 3EA7A 2QA9E 4K60A 1C5XB 2GCTB 3Q3YA 4HTCH 1HAGE 3SU2A 3F1SB 3ZIAD 3E8LA 2XWBI 3V12A 1Z8RA 2QF0A 1C5YB 1E0FD 2HNTE 1P03A 3TNSA 2QF5A 3TH2H 3SQEE 3M3SA 3K65B 3TK9A 3VB5A 2HALA 1V2MT 1WTGH 1YPJH 3QTVH 1C5NH 1YP9A 4LXBH 4CBOA 4X2XA 1TBZH 1UTQA 2ZKSA 1JMOH 3F9EA 2J98B 1SGPE 1Y3XA 3SNAA 2FTMA 1PPBH 3MNSA 4XE4A 2YMSB 1OP0A 4JZEH 5BRRE 3P70B 3MH4A 1UCYH 3URCA 1C5VA 2GD4B 2AH4X 1EZXC 2VGCB 2VIPA 1DOJA 1TBRH 1PQ5A 2F83A 1OS8A 1RS0A 1QL7A 3GCHB 1ABIH 3SJ9A 3FVFB 9ESTA 1FJSA 3BIVH 2G4UA 2FESH 1LVMA 2OCVB 2ZFQH 4ZKNU 1GI3A 2F9PA 4D7FA 4Q80A 5H4IB 1ZTKA 1K1JA 4Y7AA 1YC0A 4D7GA 3A8BA 4X1QU 1QNJA 2IPQX 1DUAA 1ZR0A 1UVTH 3U9AH 4B73A 4A1XA 5B6OA 1V2LT 2J98A 4Y0YE 3ZZAA 2XWAA 4ISIH 2HNTC 1GL0E 1W10U 3LKWA 2A7CA 2VINA 2PTCE 2ALVA 3WY8A 4PROA 4CRGA 3MU0A 1O5DH 1PYTD 2AFQB 2ZQ2A 3RXEA 1OSSA 3PLBA 4OS5A 2ZHQH 1VGCB 1RIWC 4DJZB 4NG9H 1MU6B 1D3TB 5JB9S 1KIGH 2BX4A 4M9FA 1O3OA 5JYIA 2GGVB 1QCPA 2ZDKA 3BTFE 6CHAC 4NSVA 1EFRD 4TSFD 5JB8S 3KEEA 1FQ3A 2F91A 4BAKB 2SGPE 5ABWA 1Y3UA 3KHVA 1LPKB 1MKXH 3ZVCA 2DE8A 2KCPA 1QY6A 2O8LA 3D23A 1D4PB 1O2VA 1THRH 3ODFA 5FBIA 3P95A 2I6QA 1BRBE 1AO5A 2WYJA 1BTWA 5C0TA 3F2HA 4CRCA 2ANYA 2LNCA 1MMJN 1C5MD 1ID5H 1GHYH 1RGQA 3ZZ6A 1PPGE 1HAZB 4DOQA 1JRTA 3RXMA 4CH8B 1P2JA 4NCYA 1LVOA 2YMSD 1QB9A 3SV2H 1SHHB 2ZFFH 1DSUA 1FV9A 1GMDF 3LC3A 5AFZH 2Z7FE 1Q31A 1E1QD 2D1JA 1H1BA 5A0CA 4ZUHA 4X8VH 1K1MA 9LPRA 4KKDA 1JXPA 4ZKOU 1RJXB 2FMJA 3WWBA 3RMOH 1KY9A 2ZDAH 2FOAA 2G52A 2FI3E 2ZP0H 3TIUA 4DCDA 2B0FA 3T5FH 1O2KA 1GVKB 3B9FH 3KYGA 3SNEA 5E0JA 3LGYA 3Q3XA 3K6ZA 1C5SA 2EY4C 4K1TA 1BMAA 4ABFA 3SU5A 2UUYA 1ESBA 2A4OA 1HGTH 4AX9H 1GBBA 5HIYA 1NFYA 1UTKA 1RD3B 1DPOA 1GDUA 1LHDH 1QURH 3SU3A 4YZUA 1SLWB 5DP6A 1SI5H 1ZPCA 2VVUA 3STJA 3R3GB 1ELAA 1MTNB 1YPHE 2ZU3A 3ZV9A 1UTMA 4X8SH 2PFEA 3M37A 1ZTJA 4TT3D 5CHBA 1KTTB 1D3DB 1NY22 1TONA 2J5UA 1PPHE 3GY8A 3W94A 4FUHA 2F9VA 4UD9H 2FP7B 3QLPH 1NO9H 5LH8A 1O39A 3MQKC 3EE7A 1O5FH 2FLRH 4DT7B 2BD8A 4JZIA 1NZQH 3ATLA 1AVGH 2QC2A 3DCLA 4FUDA 4FUEA 1F5KU 4HZHA 1EOJA 4Z1MD 2R9PA 2F9NA 3WW7A 1A1RA 3S9AA 1Y8TA 3E16B 2A4RA 1RTKA 1S0QA 2G81E 1E36B 4OS7A 2QXGA 1OKXA 3NRLA 2THFB 1F2SE 3VB4A 1KXEA 2V6NA 1C5UA 4MNYA 5KECA 4NIVA 2Y81A 3DSOA 1MKWH 3SUEA 2G55A 3B8JA 5A0AE 3NPSA 2WV9A 2NWNA 3A8CA 3JZ2B 3LJOA 4D76A 1XKAC 1J16A 2FX6A 1W13U 3MU8A 4MTBA 1ZHMA 5HGGA 1C1TA 1TMUH 1NFWA 5DP9A 2PW8H 2P3UB 3BG4C 3UIRA 3KL6A 2J34A 5B6LA 1V2QT 2Z94A 5JPMH 2FWWA 2H9EH 2AIPA 5E0HA 2QIQA 1K22H 2A31A 2IN2A 2VBCA 1IOEA 4ACAA 2ZZUH 4IN1A 1K1LA 1WYKA 4CRAA 5AF9H 2XNIA 1HLTH 1TNKA 5JBAS 1KXCA 1TGNA 1LVYA 2WSSD 4KTSA 3TK6A 3U8TH 4X6NA 5DO4H 3JZ1B 1TPAE 1DFPA 3UY9A 3M3VA 2QF4A 3UAIC 2O8TA 1T31A 1NM6A 2J38A 4OS4A 1IHTH 1E37B 2W7SA 4AC9A 2UWLA 1FLEE 1DXPA 1FPHH 3NKKA 3ZVDA 1QL8A 4WH6A 1GJCB 2SGQE 2ZWLH 4YOIA 3PV4A 1V2ST 3RXTA 4AOQA 4XD7D 6ESTA 1IQEA 4Y79A 1SFIA 1TNJA 3KQ5A 1JRSA 1GJDB 1ANEA 2ZC9H 1HYLA 1ZLRA 2W3IA 4JCNA 2CMYA 4I8LA 4IBLH 5E8EH 2UWOA 1QR3E 5EODA 2BLWA 4ZHLU 2AGEX 2BVRH 2H6MA 2BB4A 4RKJB 1T32A 4MG3A 2A7JA 1QRXA 1O3EA 2KR7A 3MTYA 3SJKA 2PGQB 1TNGA 1SOTA 3MI4A 1UVSH 1GI5A 1MTUA 1GCTB 3GISB 3UFAA 1GL1A 3MO3A 1J14A 1INCA 3MWIU 3S7HB 1MU8B 3PROA 1DS2E 1ZYOA 4H4FA 3S9CA 2GTBA 1Z8GA 3ELAH 1EOLA 1G3CA 3I29A 4AZ2B 8ESTE 2W7UA 4WY3A 5C3NA 4LZ4B 3KQBA 3F68H 3ZVGA 4A6LA 1E79D 2J94A 1K1IA 1COWD 1C1SA 2VVCA 3A87A 3PRDA 1OP8A 4BANB 2FTLE 3TGJE 1BMNH 1GI7B 2XC5A 2Z9JA 1O5EH 4O3UA 1GBLA 5F8ZA 4DURA 1TX8A 1O3PB 3SHCH 4YT7H 1BMFD 1FONA 4ACBA 3P8GA 3NWUA 2P94A 1VJAU 4Y8ZA 5DP3A 4FVBA 4IW4E 1VITG 3D49H 4K5ZA 1TAWA 1GGDC 3F2GA 1MH0A 5FCKA 2SGAA 1WAYB 1CVWH 1GI1A 4FETA 2IJD1 1IQKA 5I46H 4YXWD 1SLVB 1LHCH 3SNBA 1F0UA 4O97A 2HGTH 4MPXA 1UTLM 3PWCA 1D9IA 1DY8A 1A4WH 2BQ7B 1Q3XA 3ZYEA 2O8UA 1QB6A 2FOMB 5F8TA 4NZLA 2FPZA 2ANKH 4JYTA 4Y11E 2ESTE 1O2LA 2OBOA 4H6SB 2VIDA 1AE8H 3RXRA 3ZV8A 1P2NA 2BDIA 3A7WA 3NUMA 1CBWB 3RXSA 3V13A 1NU7B 4KP0A 3M5LA 3KCGH 5A8YA 1L4DA 1A0JA 1TMTH 3ZVAA 4LZ1H 1DLEA 2BD3A 2ZU4A 4B71A 4K2YA 3E6PH 1ETRH 2Y7ZA 2O9QA 5HKKD 1PQ7A 3GY4A 5A8ZA 4CHAC 2Y5GA 2PKSB 3ZZBA 3SNCA 1XUHA 2JETB 3K2UA 2BYAX 5AHGH 3LDXH 2M2AA 1H4WA 2AS9A 1TQ0B 2VU8E 3UB0A 1DITH 3PRBA 4TY6A 1BRUP 1Y5BT 2KZ4A 2FM2A 4BAHB 1GHAG 1Y3YA 3BTTE 1T4UH 4UFEH 1O32A 4E05H 2OLGA 4IMZA 1Z71A 1BBRK 3A8AA 2I6SA 4BOHA 1S85A 2KCYA 2FOHA 1EAXA 1MD8A 3RMLH 1K9OE 1TE0A 1ZMLA 1NU9A 3P17H 4B6EA 3LT3A 3LPRA 5DP4A 1W7GH 4F48B 1W0KD 4DGJA 4I7YH 2AEIH 2NU4E 2Z3DA 2ZCHP 4RSPA 3P8FA 2FDAA 4XDEA 5KGOA 1TLDA 4ABEA 1EUFA 4X1NU 1M9UA 2XCFA 4FU7A 4MNXA 1SL3A 5CHAB 1HJ9A 4I8JA 3RXDA 5JDUB 1CGHA 2A5KA 4NWKA 1W8BH 2GMTB 1OOKB 2A5AA 2RG3A 2BDYA 5DGJA 4INKA 1EP6A 1AE5A 1JIMA 1ELGA 1HAVB 1SB1H 3CNRA 2CXVA 1BTUA 1ESTA 4A5TS 1C1PA 3LONA 3SV7A 7GCHG 3ESTA 3RXVA 4B75A 1BMLA 3U1JB 5JBTA 4ZXXH 5C5NA 2WUBA 3OEED 1SMFE 1W7XH 4Y8XA 1DM4B 2XBYA 1V2TT 1E35B 2F9OA 2Q6GA 1HJAC 3OEHD 4XFQA 1C2EA 2NU2E 1ELCA 2XBVA 5HIZA 1SGCA 5EG4A 4GHTA 3ZVFA 2SFAA 1SGTA 3EQ0H 4WMEA 5GCHF 5EJ1A 3TGIE 4CH2B 3GCNA 1EATA 3U98H 5DP5A 1GPZA 2BOKA 1FUJA 2J97A 6CHAB 3Q77A 1HAVA 2ZHWH 1P12E 4GVUA 4MDSA 1WSSH 1C1RA 1C2HA 1EAWA 1TFXA 1ZJDA 2BDGA 3N99A 3K6YA 1AWFH 2ASUB 3PO1B 4JYVH 7ESTE 3SNDA 3LGWA 5JBCS 1UO6A 4BAOB 1F92A 4TY7A 4A7IB 4IS5A 1QB1A 8KME2 1VITH 3LH3A 1O2RA 1W11U 2P8OB 2P3TB 1IQLA 3RLYH 1NFXA 2AIQA 3ZZDA 1SLUB 4KELA 4AB9A 2CHAB 1YCPH 3U1IB 4E7NA 1DDJA 3RU4T 1FY4A 3HGPA 4IC5A 4ZHAA 2P16A 4I32A 2A1DB 4U01A 1MBMA 3TGKE 1EZSC 2FS8A 5DP8A 1UVPA 2HPQH 1GJ6A 2PWXA 1AKSB 1BZXE 4P00A 3VGCC 1O2UA 1GVLA 4NSYA 1GBEA 2BY7X 2Z9GA 1TGBA 1SFQB 2B9LA 1FN8A 5HM9A 1C1NA 1DY9A 1P02A 4X6OA 5AVDA 2ZFSA 3VXFH 1BOQA 3F3BA 1C2GA 1LO6A 1TRYA 4INLA 1NT1A 4HGCA 1BIOA 4E7RG 3SJOA 5GWZA 5DPAA 1QA7A 1GDNA 3RU4E 3ATKA 1HXEH 1O2SA 4WXIA 3QDZB 2TRMA 1GVZA 1UTPA 1MCVA 2BY6X 1V2NT 2ZEBA 1C9PA 3PTBA 3U8RH 3ZZ8A 3RXGA 4Y71A 2BD2A 3AAUA 1QL9A 3VXEH 1AKSA 2GT8A 1FAKH 2IJOB 1GCDA 5CDFE 4K8BA 2ZDVH 1BMMH 2V3MA 1UMAH 5L6NH 1TA2A 5GCHG 2ZGXH 3SO3A 2XBXA 1C2LA 3A82A 1CT0E 4Q2KA 1Z6EA 1IQJA 4ISLA 5T6DA 5ESBA 4FUIA 1A3EH 3BTWE 1GBAA 3EA8A 1CA8B 3STIA 4X2YA 3RDZA 3H7OA 4JZ1A 4BTIB 1G3DA 1SR5C 1K1OA 1IQGA 1Q2WA 5G4BA 1GJ5H 1Z1IA 2XCNA 3PV5A 3MU4A 2NU0E 3OTPA 3K9XB 4Y6DA 3E91A 1AMHA 3ZYDA 1PPFE 3A8DA 1H8ED 3SGBE 4J2YB 1AI8H 1CA0B 1RXPA 3G01A 1GDQA 1Y5AT 4FU9A 1KXBA 5T6GA 2B5TB 4NFEA 5DN6D 1NESE 4CRDA 1AFQC 5FX5A 3RXIA 1A5GH 2QE7D 2XNDD 1MTWA 3M7TA 1AD8H 1CT2E 1J17T 5GXPA 1AHTH 1EAUA 2A32A 2P95A 2KM0A 1C9TA 1HJ8A 4YESB 5EPNA 3SUGA 2Q6DA 3V3MA 2R2WU 7LPRA 1BHXF 3QO6A 4WXVA 3DA9B 5FX6A 4FUCA 4NZQA 5LPEA 1HAYB 1A46H 1KLIH 2V3OH 5AFYH 1B5GH 1NRNH 3PMJA 5E0GA 3UR9A 2VIOA 5IK2D 3UNRA 1SGFA 5L2ZH 3P8OA 3TPIZ 1IHSH 2EC9H 2ZDNA 4X1PU 1GI2A 3MU5A 1LHFH 3SZNA 1O3BA 3BV9B 1O33A 2XOKD 2R3UA 3B23B 3U28C 1P3EA 1O30A 1NC6A 5ESTE 3VFEA 1EX3A 2GCHG 2H2ZA 2WPLS 3GDVA 1YCPM 1Z8JB 4O03A 1TOCB 3EAJA 3TJOA 3RXKA 4Y10E 2A2QH 1AN1E 4X8TH 1GMCG 2OUAA 2PSXA 1K1PA 3RC6A 1BQYA 1TYNA 4FUFA 1AVXA 1BTXA 1ZOMA 1A61H 1TB6H 3T27A 1A0LA 1OWJA 3CP7A 2OK5A 3KYFA 1UW7A 4IMQA 1HDTH 1TPSA 2ZECA 1SKYE 3DSPA 2BQ6B 1P2OA 2ODQA 4B2BA 3V0XA 2BMGB 1EB2A 4U30A 1O2WA 1LTOA 2AGIX 4XBBA 4DIIH 1C5QA 1DWCH 2GCTC 1MTSA 1ELBA 1SC8U 1AB9B 3A7ZA 3BEIB 1CGIE 3HATH 5C1YA 3MU1A 1XVOA 2ULLA 2ZFTA 4R8TB 1O2NA 3LH1A 4Q63A 3UUZA 2A0QB 3W1EA 3R0FA 3HKJB 2J4IA 4A1VA 1YPGH 2ANWA 2F9BH 3A83A 1A2CH 2HOBA 1KXDA 3HK3B 3ZZ9A 1D3PB 2VWNA 3A86A 1JOUB 4X1RU 1QA0A 1GI9B 3Q76A 1S83A 3MH6A 1DT2A 3CS0A 3MYWA 4X0WU 2LPRA 4K3JA 3M36A 1UCYK 1GJ9B 1O3KA 1V2KT 3ZZ4A 5EGMA 1TNLA 1YLCA 3T29A 2YMSC 4JZDH 3DFLA 3NCLA 1BITA 2VGCC 4Q4LA 1F0RA 2B8OH 1FZZA 4WMFA 5C1UA 5J4SA 1P9SA 2WV5A 2JH0D 1G2MA 1N6XA 3RMMH 2ZGCA 1C5WB 3KQCA 3Q00A 2J92A 4FUJA 2KX4A 4Y7BA 3P6ZB 4BAMB 4KTCA 1SQOA 1LPGB 3GY7A 2ZA5A 1ZGVA 4YTAA 5KEDA 3Q3KA 1N1LA 2R3YA 3MHWU 1DXWA 3UNSA 1CQQA 1JIRA 1TA6A 3PMBB 1H9LB 3E90B 2EEKA 3GY6A 1QJ6B 4ISNA 1MZAA 3FZDA 3NK8A 2ZPQA 2H9TH 4AFUA 1FPCH 4X6PA 1F7ZA 4FXGH 1ABJH 4I33A 3RLWH 1EPTB 1K0HA 1OXGA 1TNIA 1JBUH 1ZRKA 2G00A 5C1XA 1VGCC 1YBWA 4DG4A 3UQOA 3GOVB 2K1QA 1BCUH 1AWHB 1QRWA 1SG8B 1EB1H 2CF9H 3W95A 1QBNA 1MKXK 1C2FA 4RN6A 2YNBA 2UUFB 3C27B 3SGAE 1WOFA 3SJ8A 1FXYA 5TCCA 5EIYA 1YF4A 4WF8A 3UREA 4CR9A 1YPLH 1KMHB 1VITF 1A3BH 5EQRA 4HI3A 1RTFB 3BTGE 1NTPA 4GCHF 2FOGA 3OY6U 2OC1A 4AGJA 1EPTA 3DHKH 3PYHA 4D8NA 5GNDA 1BHXB 3MO6A 3PMAB 3TNTA 3U8OH 3M7QA 5E2OA 4INHA 3RXPA 3BG8A 1V2WT 2G5NA 1EZUC 2FOEA 4ABIA 4DT4A 4FUGA 1P9UA 2D8WA 1ETSH 1QQ4A 2HNTF 2ZU2A 5T6FA 1C1OA 1GMHG 3L3TA 3UNQA 4JK5A 1G30B 2Z9IA 1W2KH 2KCOA 1O3DA 2OQUA 2Y6TA 1W14U 2A2XH 3FFGA 1AUJA 3OU0A 5A0BA 3OYPA 4X8UH 4AFZA 2D2DA 1A7SA 1SQTA 3OY5U 5E2PA 3BEUA 4I86A 2NU1E 4JZFH 1O3FA 3OSYA 1XUIA 1NRRH 1GHWH 1GJ4H 1F0TA 2ZGHA 1MAYA 1QBOA 1B7XB 2ZU5A 2GZ9A 2A4GA 1EJMA 1G3EA 3L6PA 1C2KA 1QJ7B 4YO9A 1ZHRA 1HAIH 1J15A 1SOZA 3A7XA 2OTVA 1J9CH 3SU0A 1GHAF 4X2VA 1C4U2 1GI4A 2QGRA 2WPIS 2PSYA 1VCQA 3DFJA 1MTNC 2BY8X 1T8NA 5BPEA 2YNAA 3GICB 4O3TA 3ATWA 4XOJA 4NIXA 2ZCKP 3UWIA 2BX3A 1GWAA 2FIRH 4R0IA 4YM9A 3ODDA 5L30H 4Z6AH 1FDPA 1SPJA 1TX6A 2Z6BD 3RXAA 3SU6A 3OTJE 1IQNA 1O3AA 4U2WA 4RT0A 5T1VA 1TGTA 1GI0A 4WWYA 1HUTH 4ZMAH 1BA8B 1P2KA 4BNRA 2BVXH 5DJ7A 4XBDA 4GCHG 5EQQA 1P0SH 1DWDH 2WV4A 1MKWK 1XUKA 2BD5A 3RC5A 1CHGA 4ZKSU 3E0PB 1J8AA 7GCHF 1MAXA 4ZXYH 2PR3A 1GI8B 1TABE 4D9QA 2F9UA 5HMAA 3SBKA 1XX9A 2K8IA 3UPEA 1GHBG 1ACBE 1GG6C 1C2DA 2ZFPH 2FXRA 2ODPA 4K8YA 1MQ5A 2HRVA 3GYMA 1ZSKA 1SVPA 1GJBB 3FANA 1S6HA 3TH4H 3SV9A 1N8OB 2BDHA 4OS1A 2G8TA 4VGCC 2C93B 5C0UA 4YT6H 1O3LA 2BHGA 3HGNA 3O8DA 2FODA 2H5DA 1C1MA 1GBCA 2PLXA 4AYVB 3F9HA 4Z0KA 1VCPA 2ZIQH 1NBME 2HVXA 4MNVA 4NGAH 2EI8A 1KLTA 1AQ7A 1XM1A 4AGKA 1SGIB 1PPEE 1PPZA 1C2MA 1XUGA 1Y3WA 1O2PA 3NZIA 4F49A 1K2I1 3S69A 4F4OC 4TWWA 3LOXA 4B1TA 3QUMP 3OX7U 2Y5HA 1DSTA 1WV7H 1UVUH 4UONA 1AIXH 2EA3A 1O5CB 5FPYA 1IAUA 3SZEA 2KAIA 5F03A 1OWIA 2OC7A 3SU1A 1BUIA 3RXLA 2F3CE 2W6JD 3A7YA 1Y59T 3RXUA 1LVBA 2C4FH 3MNXA 3P92A 4DVAU 3EDXB 3MH7A 2L6OA 1OWEA 1UVOA 2ZGBH 4RT1A 3A80A 1H9HE 1KDQB 1BTZA 3P8NA 2VIVA 2Z9KA 1UK3A 4ASHA 5T3HA 2RCEA 2C8ZB 3SJIA 3D65E 5K0HA 1PQAA 3LC5A 2VWMA 1BTHH 2FX4A 1O2GH 3UTUH 1FMGA 1GCTC 5DKMA 1LDTT 3PMHB 2C8WB 3SHAH 1DX5M 1YM0A 4LK4A 1YPMH 2BVSH 4BTTB 2QXIA 3SUFA 1TOMH 1ZSJA 4CR5A 1GBIA 1YKTA 2JH6D 1S82A 3RP2A 4ESTE 1DWEH 5HYOA 1HV7A 1P57B 2ZPRA 3RXFA 1KDQA 4I8KA 3QWCH 1S6LA 2QAAA 3GCTG 1O2OA 4I8GA 3L33A 4ZKRU 2JDID 3ZZCA 1E1RD 1N6YA 1QFKH 1O0DH 1EQ9A 1K1NA 2ZG0H 1T8OA 4DIHH 2Z3CA 4UFDH 5DK1A 1RIWB 4MPVA 1O3IA 4JYUH 2HLDD 4P02A 1A5HA 1UK2A 1O2HA 2C3SA 1BTPA 3BTQE 4GSOA 1THSH 2KFWA 4I8HA 1XUJA 4X1SU 3M3TA 1G32B 2HWLB 3A81A 3O8BA 2AMQA 1IQHA 4WJG2 3SORA 1WXRA 1W12U 1YYY1 2IPHA 2BZAA 2STAE 1UK4A 2YOLA 3AAVA 3MMGA 1KLJH 1QBVH 1ZTLA 5EOKA 4FU8A 2RFKC 1NRSH 2BDBA 5K7RA 1FNIA 3UOUA 3SN8A 2AGGX 1MD7A 4NWLA 2JIZD 3BSQA 1P3CA 1SLXB 1TX7A 2FOCA 1ZPZA 1P2QA 4Y8YA 2QV1A 1MCTA 3A84A 1HAHH 1L1GA 1MABB 5GIBA 3ENSB 3DSGA 4SGBE 1QQUA 2WPMS 1EASA 2LP6A 2BY9X 2KCAA 1VZQH 3LIWA 1GI6A 1NFUA 2BDCA 2AERH 5C67A 2VWOA 3SUDA 1SGDE 1LMWB 2CF8H 1NROH 3UQVA 5ETXA 3SQHE 3ITIA 1A5IA 2UUJB 4GHQA 2BOHB 1ETTH 1KXAA 2ODYB 1CBWC 3BN9A 3QZQA 2UUKB 2WZQA 2VH0A 1O2ZA 1CHOG 1NRQH 1W0YH 3GS9A 4KTUA 1AUTC 1L1NA 1T4VH 2WPDD 1GJ7B 1MUEB 3SGQE 1D6RA 3RXJA 5L2YH 2ZHFH 3EE0B 1MZDA 2CGAA 1L0ZA 2JJ1D 2PKAB 2PKSC 3QGNB 3KQDA 1AZZA 3HPTB 3RXOA 1SQAA 1PFXC 2JETC 1EZQA 4ABJA 2GCHF 1V2RT 1DVAH 3RU4D 3AW1A 1FY5A 5FXLA 3GY5A 4NIYA 3FN8A 1E34B 1TQ7B 2ANMH 1GMCF 1SGNE 1O2MA 5PTPA 2SNVA 1O5AB 4BXWA 1TIOA 1TBQH 1P11E 1OHHD 3V7TA 3C1KA 1P2MA 1RFNA 1LQDB 1NRPH 1H8IH 4I31A 2GV7A 2ZDLA 2W26A 2H5CA 2GDDA 1CSOE 4CRFA 1GBDA 3ATMA 1TGCA 1HFDA 1C1QA 4JMYA 1EJAA 2L74A 1AGJA 5EXLA 2PKAA 3BTKE 4ABBA 1BRAA 1L2EA 3RXCA 1O2TA 1HAOH 1LPZB 5FPSA 2AYWA 1V3XA 2AHME 1ORFA 1UCYE 1WTHD 1XMNB 4M7GA 1TPPA 5CHAC 1O2YA 2GMTC 2ZGJA 2V35A 1HNEE 2W6ID 1GHVH 1T8MA 2BLOA 1DLKB 2JH5D 3HK6B 1EAIA 3GDUA 1BRCE 2PTNA 2ZI2H 4Q7YA 4DW2U 1Z1JA 2WINI 2BXUH 2SGFE 2GDEH 4YLQH 6GCHG 4ISOA 3FP7E 3BG4B 4CREA 2UWPA 4UE7H 1ESAA 4DY7B 3CENA 4AFQA 1P09A 3EGKH 3QZRA 2W3KA 1BB0B 5FBEA 1TRMA 1OYTH 2FOBA 1QJ1B 4BTUB 4O9VA 3H09A 3BTME 3I78A 4RKOB 2BQWB 4IGDA 1SHYA 1D3QB 4BXSA 1ZJKA 3T26A 1GBKA 1P06A 1F5RA 3PB1E 4CBNA 1G36A 4SGAE 2FZZA 2VIWA 1FIWA 4XRNA 1O3HA 2OXSA 1RRKA 3NXPA 1AZ8A 5EXNA 4AG1A 3RXQA 3TJNA 3PO1C 3N7EA 1HPGA 1YGCH 4NA8A 1X7AC 2F4LA 2TBSA 4OS6A 1QGFA 1NS3A 3UR6A 2OINA 3DUXH 4AN7A 4F55A 2WPJS 2PP6A 2R2MB 4GLYA 1SGQE 1UTOA 2ZTZA 2P3FH 1L4ZA 5FPTA 1YCPK 2Y80A 3PLPA 2P8OC 2TGAA 3S7KB 2XRCA 4OGYA 5LGOA 5LPRA 3M7UA 2CHAC 1T8LA 1P05A 1GBMA 3A7TA 5GJ4B 1O37A 4MQAA 1C5ZB 2CK3D 2VVVA 2ZU1A 3KNXA 1PYTC 1AY6H 1D6WA 1UTNA 2FI5E 3BTEE 3O8CA 3FP6E 1S81A 1XXFA 1Z7KA 2G51A 4X2WA 5LPFA 1P10A 2VH6A 1HB0B 2BM2A 1QZ8A 4ABGA 2A4QA 2FS9A 1ELFA 1PJPA 4A92A 4XSKU 1DUEA 1FN6A 2OD3B 3M35A 2RA0A 2QYIA 3AASA 1C5LH 1P04A 3PTNA 4NA9H 2J95A 2RDLA 1AU8A 2XTTB 2PV9B 4WH8A 4AFSA 4K1EA 5GDSH 3N7DA 2BD7A 2SNWA 3ZZ7A 2WYGA 3MNCA 3LGIA 1GJAB 2OQ5A 2FYRA 1K21H 1O3NA 3LU9B 3TJVA 3RM0H 3RXHA 1O5BB 4BAQB 3PV2A 3E1XB 1O3GA 3UOPA 2V3HH 1KTSB 1LHEH 3QGJA 2W5EA 2XXLA 1L1JA 1CU1A 1GMHF 2FI4E 3KF2A 3VB3A 4FOUC 3T25A 3GCHC 2ZTXA 2DE9A 3FO8D 4MLFB 4WVPE 1BTYA 1C5PA 3IITA 1Y5UT 5GPIB 2A45B 2CV3A 5EJZA 1SSXA 2A7HA 4IN2A 1ZGIA 3KQEA 4Q7XA 1GGDB 3A7VA 3S9BA 1S84A 5HM2A 4YOGA 1HAXB 2OC0A 1C5OH 4UDWH 1ZRBA 1ELTA 1CA0C 3F9FA 1O36A 4ZROA 4HFPB 3QK1A 3RUOA 2XC4A 1TNHA 3OAAD 2JKHA 3H5CB 1ARCA 2FOFA 3OFND 1KXFA 1ELDE 1EP5A 3N7OA 2SGDE 2G5VA 2J9NA 5C20A 1WDIA 2ZPSA 1Z6JH 1GMDG 2PGBB 1CE5A 1ELVA 1GG6B 2ALPA 1CGJE 4YOJA 2VB0A 1DANH 4IC6A 4AYYB 5FHTA 2QXHA 3BTDE 2XW9A 5IDKA 2QCYA 2HPPH 2ZHDA 4VGCB 2XBWA 1V2JT 1YPHC 2FEQH 4TWYA 2RDEA 2NU3E 2A5IA 2SGEE 1H8HD 3SOSA 2XC0A 2O8MA 1GBJA 1KYNA 3BEFB 4LOYH 4B2AA 2GKVE 1SGEE 5JBBS 4B74A 4CHAB 2BLVA 2WUCA 1A0HB 1FX0B 3FP8E 2BDAA 2V0BA 3FOAA 1SBWA 3F6UH 4D9RA 4OGXA 3DD2H 1SGYE 3EA9A 1ZHPA 1HCGA 4Q7ZA 3PM3A 1G9IE 1Z8IB 2GZ7A 2J2UA 4ZH8A 1GHBF 1F5LA 1WQVH 1G2LA 2TPIZ 3EYDA 1SGRE 1O38A 4ABDA 1AFEH 1WBGB 3LJJA 3SYJA 1O2JA 1G3BA 3MH5A 5DP7A 4Y0ZE 1HIAB 1GHZA 1TPOA 3DT0H 4MNWA 1UHBB 2Y82A 2ZHEH 1DWBH 1BBRE 3GY3A 4YLUA 1BBRH 8GCHF 1P2IA 1O31A 1ANCA 2QN5T 1IQIA 1JWTA 3VEQB 3MO9A 3BIUH 1HXFH 4B2CA 2Q1JA 2ZDMA 1AVWA 5EXMA 1FY1A 1EKBB 1LKAA 2ZTYA 4K69A 5DG6A 3TK5A 2BY5X 2RA3A 3RMNH 4GAWA 3E0NB 1AB9C 4Y76A 5SGAE 2ZCLP 3OE7D 1DICA 4FVDA 3KIDU 2F43B 3ATIA 3IG6B 1TRNA 1UJ1A 2AMPA 2V7QD 1HIAA 1ZPBA 1O3CA 2TGTA 3M61U 3D62A 1HRTH 1UHBA 2CJIA 3A88A 1YLNA 2Z9LA 3HKIB 4UFFH 1TGSZ 4MPUA 2VNTA 1MQ6A 2LELA 2QF3A 1C1UH 1HJAB 1XXDA 5C5OA 2ZNKH 5A09A 1W3CA 3BTHE 1CT4E 1S5SA 3T62A 1VKYA 2C8YB 1KSNA 2FLBH 5EJLA 5EQSA 1WU1A 4KGAA 4AORA 1O35A 3GCOA 2C8XB 1O2QA 3GYLB 1V2UT 1G37A 1OX1A 1C2JA 4K1SA 1BJVA 1YPEH 1WCZA 1IQFA 3M5OA 3LGTA 2Z3EA 1H9IE 1FIZA 1MTVA 1OWHA 3PWBA 3IWMA 1TMBH 4B76A 2GX4A 1GBHA 4GUXA 3TLOA 3H7TA 3CS7A 1OPHB 2ZF0H 2STBE 3E3TA 3RXBA 5A2MH 1TWXB 2FO9A 1RTLA 3GCTF 2KAIB 2GV6A 3A85A 3TH3H 2BZ6H 2GZ8A 1EPTC 2GT7A 2VIQA 4FUBA 1PQ8A 2M5TA 1DE7H 3FZZA 3O8RA 1NN6A 4QT8C 1C5RA 1C1WH 8GCHG 3A89A 2R0LA 1YWUA 2VJ1A 1WUNH 4ZAEA 5FAHA 1P8VC 3MFJA 2OC8A 3MOCA 3ZZ5A 3VGCB 1C5TA 2B7DH 5EU8A 3UWJH 1LQEA 1WQSA 1NBMD 1P01A 1B0EA 1V2VT 3GY2A 5DSFA 1ZMJA 2P59A 2WPHS 4UEHH 1HAPH 3LGVA 1GJ8B 4AB8A 1TALA 1ZMNA 5J4QA 1OWKA 1S0RA 4ISHH 5F6MA 3PLKA 1O2IA 2QY0B 3SI3H 5HXFA 4NIWA 4U32A 1GHXH 1V2OT 3ZVBA 5IYTA 3F2FA 1YPKH 4A1TA 4ASUD 1K28D 1FY3A 1BT7A 5EW2H 2AMDA 4X6MA 3TU7H 4MPWA 2QXJA 4THNH 3QN7A 4JK6A 3SU4A 3GDSA 2EI7A 1Y3VA 3MNBA 1ARBA 2GP9B 4NA7A 2G4TA 1OWDA 2HVYB 2ZO3H 3ZVEA 3SW2B 1U6QA 1YY3A 1O5GH 2OP9A 3URDA 4ABAA 3RM2H 2R0KA 2C90B 1QIXB 1CHOF 2HLCA 5FL7D 2H9HA 1ZZZA 5CMXH 4CRBA 4OM9A 1LHGH 1GBTA 1VR1H 3FKSD 1O3JA 2BXTH 4ZCNA 1OP2A 1IQMA 2WHXA 1C4Y2 4HG6A 2D26C 1CO7E 5F53A 1XVMA 1ANDA 4ABHA 1QTFA 2VWLA 4XBCA 2BTCE 4H6TA 5TJXA 2K0QA 2PHBA 3FAOA 3WWFA 1LKBA 4UFGH 1UTJA 3VB7A 3AK5A 1V6DA 3KGPA 5EW1H 1EJNA 3TITA 1S6FA 3KN2A 1C1VH 1FAXA 1FI8A 1ZSLA 2ILNA 2IOTA 3T28A 2FYQA 1AFQB 3U69H 2GJGA 1C2IA 2WPKS 4TYDA 5EPYA 5F8XA 1QRZA 2ZFRH 5FCRA 4E06H 2P93A 2BD9A 6LPRA 2TGPZ 1SQRA 1ELEE 3ZZ3A 4GPGA 2XYAA 3VB6A 1ANBA 8LPRA 1BDAA 3M5NA 3SV8A 1H8DH 1GBFA 1O3MA 5C17A 3I77A 5C2ZA 1XUFA 1V2PT 5TCAA 2EQNA 2OBQA 7KMEH 3SV6A 2H1UA 3S0NA 3RC4A 4ZHMU 5I25A 5C94A 1VJ9U 1QHRB 4NFFA 2GVFA 4TPIZ 3TJUA 1E38B 2O8WA 2BLQA 1B0FA 2CN0H 1YLDA 2EI6A 3AVZA 1BJUA 1NPMA 1W0JD 4RI0A 2BD4A 4OS2A 3VG8A 4TPYA 3F0OA 3T2NA 1EXFA 3QX5H 1PPCE 1VCWA 2JJ2D 2TIOA 2Y5FA 2PUXB 3F0PA 4WMDA 1O34A 5A8XA 2ZQ1A 1SGFG 3TVJB 4MVNA 6GCHF 4B6FA 1THPB 1OYQA 2Q6FA 4H42U 3VPKA 3AW0A
chains in the Genus database with same CATH topology
1F0SA 1W0ZU 4J1YA 1N8OC 3F9GA 3SI4H 4AG2A 5CE1A 3M5MA 1FY8E 1LCYA 2DUCA 1MBQA 3LGUA 1XKBC 2TGDA 1O2XA 1C4V2 1T7CA 1HBTH 3BF6H 3QTOH 2Y7XA 2PUQH 3EA7A 2QA9E 4K60A 1C5XB 2GCTB 3Q3YA 4HTCH 1HAGE 3SU2A 3F1SB 3E8LA 2XWBI 3V12A 1Z8RA 2QF0A 1C5YB 1E0FD 2HNTE 1P03A 3TNSA 3TH2H 3SQEE 3M3SA 3K65B 3TK9A 3VB5A 2HALA 1V2MT 1WTGH 1YPJH 3QTVH 1C5NH 1YP9A 4LXBH 4CBOA 4X2XA 1TBZH 1UTQA 2ZKSA 1JMOH 3F9EA 1SGPE 1Y3XA 3SNAA 2FTMA 1PPBH 3MNSA 4XE4A 1OP0A 4JZEH 5BRRE 3P70B 3MH4A 1UCYH 3URCA 1C5VA 2GD4B 2AH4X 1EZXC 2VGCB 2VIPA 1DOJA 1TBRH 1PQ5A 2F83A 1OS8A 1RS0A 1QL7A 3GCHB 1ABIH 3SJ9A 3FVFB 9ESTA 1FJSA 3BIVH 2G4UA 2FESH 1LVMA 2OCVB 2ZFQH 4ZKNU 1GI3A 2F9PA 4D7FA 4Q80A 5H4IB 1ZTKA 1K1JA 4Y7AA 1YC0A 4D7GA 3A8BA 4X1QU 1QNJA 1DUAA 1ZR0A 1UVTH 3U9AH 4B73A 4A1XA 5B6OA 1V2LT 4Y0YE 3ZZAA 2XWAA 4ISIH 2HNTC 1GL0E 1W10U 3LKWA 2A7CA 2VINA 2PTCE 2ALVA 3WY8A 4PROA 4CRGA 3MU0A 1O5DH 1PYTD 2AFQB 2ZQ2A 3RXEA 1OSSA 3PLBA 4OS5A 2ZHQH 1VGCB 1RIWC 4DJZB 4NG9H 1MU6B 1D3TB 5JB9S 1KIGH 2BX4A 1O3OA 5JYIA 2GGVB 1QCPA 2ZDKA 3BTFE 6CHAC 4NSVA 5JB8S 3KEEA 1FQ3A 2F91A 4BAKB 2SGPE 5ABWA 1Y3UA 3KHVA 1LPKB 1MKXH 3ZVCA 2DE8A 3D23A 1QY6A 2O8LA 1D4PB 1O2VA 1THRH 3ODFA 5FBIA 3P95A 2I6QA 1BRBE 1AO5A 2WYJA 1BTWA 4CRCA 2ANYA 2LNCA 1MMJN 1C5MD 1ID5H 1GHYH 1RGQA 3ZZ6A 1PPGE 1HAZB 4DOQA 1JRTA 3RXMA 4CH8B 1P2JA 4NCYA 1LVOA 1QB9A 3SV2H 1SHHB 2ZFFH 1DSUA 1FV9A 1GMDF 3LC3A 5AFZH 2Z7FE 1Q31A 2D1JA 5A0CA 1H1BA 4ZUHA 4X8VH 1K1MA 9LPRA 4KKDA 1JXPA 4ZKOU 1RJXB 2FMJA 3RMOH 1KY9A 2ZDAH 2FOAA 2G52A 2FI3E 2ZP0H 3TIUA 4DCDA 2B0FA 3T5FH 1O2KA 1GVKB 3B9FH 3SNEA 5E0JA 3LGYA 3Q3XA 3K6ZA 1C5SA 4K1TA 1BMAA 4ABFA 3SU5A 2UUYA 1ESBA 2A4OA 1HGTH 4AX9H 1GBBA 1NFYA 1UTKA 1RD3B 1DPOA 1GDUA 1LHDH 1QURH 3SU3A 4YZUA 1SLWB 5DP6A 1SI5H 1ZPCA 2VVUA 3STJA 3R3GB 1ELAA 1MTNB 1YPHE 2ZU3A 3ZV9A 1UTMA 4X8SH 2PFEA 3M37A 1ZTJA 1KTTB 1D3DB 1NY22 1TONA 1PPHE 3GY8A 3W94A 4FUHA 2F9VA 4UD9H 2FP7B 3QLPH 1NO9H 5LH8A 1O39A 1O5FH 2FLRH 4DT7B 2BD8A 4JZIA 1NZQH 3ATLA 1AVGH 2QC2A 4FUDA 4FUEA 1F5KU 4HZHA 1EOJA 2R9PA 2F9NA 1A1RA 3S9AA 1Y8TA 3E16B 2A4RA 1RTKA 1S0QA 2G81E 1E36B 4OS7A 2QXGA 1OKXA 2THFB 1F2SE 3VB4A 1KXEA 2V6NA 1C5UA 4MNYA 4NIVA 2Y81A 1MKWH 3SUEA 2G55A 3B8JA 5A0AE 3NPSA 2NWNA 3A8CA 3JZ2B 3LJOA 4D76A 1XKAC 1J16A 2FX6A 1W13U 3MU8A 4MTBA 1ZHMA 5HGGA 1C1TA 1TMUH 1NFWA 5DP9A 2PW8H 2P3UB 3BG4C 3UIRA 3KL6A 2J34A 1V2QT 2Z94A 5JPMH 2FWWA 2H9EH 2AIPA 5E0HA 2QIQA 1K22H 2A31A 2IN2A 1IOEA 2ZZUH 4IN1A 1K1LA 1WYKA 4CRAA 5AF9H 2XNIA 1HLTH 1TNKA 5JBAS 1KXCA 1TGNA 1LVYA 4KTSA 3TK6A 3U8TH 4X6NA 5DO4H 3JZ1B 1TPAE 1DFPA 3UY9A 3M3VA 2O8TA 1T31A 1NM6A 2J38A 4OS4A 1IHTH 1E37B 2W7SA 2UWLA 1FLEE 1DXPA 1FPHH 3NKKA 3ZVDA 1QL8A 4WH6A 1GJCB 2SGQE 2ZWLH 4YOIA 3PV4A 1V2ST 3RXTA 4AOQA 6ESTA 1IQEA 4Y79A 1SFIA 1TNJA 1JRSA 1GJDB 1ANEA 2ZC9H 1HYLA 1ZLRA 2W3IA 4JCNA 2CMYA 4I8LA 4IBLH 5E8EH 2UWOA 1QR3E 5EODA 2BLWA 4ZHLU 2AGEX 2BVRH 2H6MA 2BB4A 4RKJB 1T32A 4MG3A 2A7JA 1QRXA 1O3EA 3MTYA 3SJKA 2PGQB 1TNGA 1SOTA 3MI4A 1UVSH 1GI5A 1MTUA 1GCTB 3GISB 3UFAA 1GL1A 3MO3A 1J14A 1INCA 3MWIU 3S7HB 1MU8B 3PROA 1DS2E 1ZYOA 4H4FA 3S9CA 2GTBA 1Z8GA 3ELAH 1EOLA 1G3CA 3I29A 4AZ2B 8ESTE 2W7UA 4WY3A 5C3NA 4LZ4B 3KQBA 3F68H 3ZVGA 4A6LA 2J94A 1K1IA 1C1SA 2VVCA 3A87A 1OP8A 4BANB 2FTLE 3TGJE 1BMNH 1GI7B 2XC5A 2Z9JA 1O5EH 4O3UA 1GBLA 5F8ZA 4DURA 1TX8A 1O3PB 3SHCH 4YT7H 1FONA 3P8GA 3NWUA 2P94A 1VJAU 4Y8ZA 5DP3A 4FVBA 4IW4E 1VITG 3D49H 4K5ZA 1TAWA 1GGDC 1MH0A 5FCKA 2SGAA 1WAYB 1CVWH 1GI1A 1IQKA 5I46H 1SLVB 1LHCH 3SNBA 1F0UA 4O97A 2HGTH 4MPXA 1UTLM 3PWCA 1D9IA 1DY8A 1A4WH 2BQ7B 1Q3XA 3ZYEA 2O8UA 1QB6A 2FOMB 5F8TA 4NZLA 2FPZA 2ANKH 4JYTA 4Y11E 2ESTE 1O2LA 2OBOA 4H6SB 2VIDA 1AE8H 3RXRA 3ZV8A 1P2NA 2BDIA 3A7WA 3NUMA 1CBWB 3RXSA 3V13A 1NU7B 4KP0A 3M5LA 3KCGH 5A8YA 1L4DA 1A0JA 1TMTH 3ZVAA 4LZ1H 1DLEA 2BD3A 2ZU4A 4B71A 4K2YA 3E6PH 1ETRH 2Y7ZA 2O9QA 1PQ7A 3GY4A 5A8ZA 4CHAC 2Y5GA 2PKSB 3ZZBA 3SNCA 1XUHA 2JETB 3K2UA 2BYAX 5AHGH 3LDXH 1H4WA 2AS9A 1TQ0B 2VU8E 1DITH 4TY6A 1BRUP 1Y5BT 2FM2A 4BAHB 1GHAG 1Y3YA 3BTTE 1T4UH 4UFEH 1O32A 4E05H 2OLGA 4IMZA 1Z71A 1BBRK 3A8AA 2I6SA 4BOHA 1S85A 2FOHA 1EAXA 1MD8A 3RMLH 1K9OE 1TE0A 1ZMLA 1NU9A 3P17H 3LT3A 3LPRA 5DP4A 1W7GH 4DGJA 4I7YH 2AEIH 2NU4E 2Z3DA 2ZCHP 4RSPA 3P8FA 2FDAA 4XDEA 1TLDA 4ABEA 1EUFA 4X1NU 1M9UA 2XCFA 4FU7A 4MNXA 1SL3A 5CHAB 1HJ9A 4I8JA 3RXDA 5JDUB 1CGHA 2A5KA 4NWKA 1W8BH 2GMTB 1OOKB 2A5AA 2RG3A 2BDYA 5DGJA 4INKA 1EP6A 1AE5A 1JIMA 1ELGA 1HAVB 1SB1H 2CXVA 1BTUA 1ESTA 4A5TS 1C1PA 3LONA 3SV7A 7GCHG 3ESTA 3RXVA 4B75A 1BMLA 3U1JB 5JBTA 4ZXXH 5C5NA 2WUBA 1SMFE 1W7XH 4Y8XA 1DM4B 2XBYA 1V2TT 1E35B 2F9OA 2Q6GA 1HJAC 4XFQA 1C2EA 2NU2E 1ELCA 2XBVA 1SGCA 5EG4A 4GHTA 3ZVFA 2SFAA 1SGTA 3EQ0H 4WMEA 5GCHF 3TGIE 4CH2B 3GCNA 1EATA 3U98H 5DP5A 1GPZA 2BOKA 1FUJA 6CHAB 3Q77A 1HAVA 2ZHWH 1P12E 4GVUA 4MDSA 1WSSH 1C1RA 1C2HA 1EAWA 1TFXA 1ZJDA 2BDGA 3K6YA 1AWFH 2ASUB 3PO1B 4JYVH 7ESTE 3SNDA 3LGWA 5JBCS 1UO6A 4BAOB 1F92A 4TY7A 4A7IB 4IS5A 1QB1A 8KME2 1VITH 3LH3A 1O2RA 1W11U 2P8OB 2P3TB 1IQLA 3RLYH 1NFXA 2AIQA 3ZZDA 1SLUB 4KELA 4AB9A 2CHAB 1YCPH 3U1IB 4E7NA 1DDJA 3RU4T 1FY4A 3HGPA 4IC5A 4ZHAA 2P16A 4I32A 2A1DB 4U01A 1MBMA 3TGKE 1EZSC 2FS8A 5DP8A 1UVPA 2HPQH 1GJ6A 2PWXA 1AKSB 1BZXE 3VGCC 1O2UA 1GVLA 4NSYA 1GBEA 2BY7X 2Z9GA 1TGBA 1SFQB 2B9LA 1FN8A 5HM9A 1C1NA 1DY9A 1P02A 4X6OA 5AVDA 2ZFSA 3VXFH 1BOQA 1C2GA 1LO6A 1TRYA 4INLA 1NT1A 4HGCA 1BIOA 4E7RG 3SJOA 5GWZA 5DPAA 1QA7A 1GDNA 3RU4E 3ATKA 1HXEH 1O2SA 4WXIA 3QDZB 2TRMA 1GVZA 1UTPA 1MCVA 2BY6X 1V2NT 2ZEBA 1C9PA 3PTBA 3U8RH 3ZZ8A 3RXGA 4Y71A 2BD2A 3AAUA 1QL9A 3VXEH 1AKSA 2GT8A 1FAKH 2IJOB 1GCDA 4K8BA 2ZDVH 1BMMH 1UMAH 5L6NH 1TA2A 5GCHG 2ZGXH 3SO3A 2XBXA 1C2LA 3A82A 1CT0E 4Q2KA 1Z6EA 1IQJA 4ISLA 5T6DA 5ESBA 4FUIA 1A3EH 3BTWE 1GBAA 3EA8A 1CA8B 3STIA 4X2YA 3RDZA 3H7OA 4JZ1A 4BTIB 1G3DA 1SR5C 1K1OA 1IQGA 1Q2WA 5G4BA 1GJ5H 1Z1IA 2XCNA 3MU4A 2NU0E 3K9XB 4Y6DA 3E91A 1AMHA 3ZYDA 1PPFE 3A8DA 3SGBE 4J2YB 1AI8H 1CA0B 1RXPA 3G01A 1GDQA 1Y5AT 4FU9A 1KXBA 5T6GA 2B5TB 4NFEA 1NESE 4CRDA 1AFQC 5FX5A 3RXIA 1A5GH 1MTWA 3M7TA 1AD8H 1CT2E 1J17T 5GXPA 1AHTH 1EAUA 2A32A 2P95A 5EPNA 1C9TA 1HJ8A 4YESB 3SUGA 2Q6DA 3V3MA 2R2WU 7LPRA 1BHXF 3QO6A 4WXVA 3DA9B 5FX6A 4FUCA 4NZQA 5LPEA 1HAYB 1A46H 1KLIH 2V3OH 5AFYH 1B5GH 1NRNH 3PMJA 5E0GA 3UR9A 2VIOA 3UNRA 1SGFA 5L2ZH 3P8OA 3TPIZ 1IHSH 2EC9H 2ZDNA 4X1PU 1GI2A 3MU5A 1LHFH 3SZNA 1O3BA 3BV9B 1O33A 2R3UA 3B23B 1P3EA 1O30A 1NC6A 5ESTE 3VFEA 1EX3A 2GCHG 2H2ZA 2WPLS 3GDVA 1YCPM 1Z8JB 4O03A 1TOCB 3EAJA 3TJOA 3RXKA 4Y10E 2A2QH 1AN1E 4X8TH 1GMCG 2OUAA 2PSXA 1K1PA 3RC6A 1BQYA 1TYNA 4FUFA 1AVXA 1BTXA 1ZOMA 1A61H 1TB6H 3T27A 1A0LA 1OWJA 3CP7A 4IMQA 1HDTH 1TPSA 2ZECA 2BQ6B 1P2OA 2ODQA 4B2BA 3V0XA 2BMGB 1EB2A 4U30A 1O2WA 1LTOA 2AGIX 4XBBA 4DIIH 1C5QA 1DWCH 2GCTC 1MTSA 1ELBA 1SC8U 1AB9B 3A7ZA 3BEIB 1CGIE 3HATH 5C1YA 3MU1A 1XVOA 2ULLA 2ZFTA 4R8TB 1O2NA 3LH1A 3UUZA 2A0QB 3R0FA 3HKJB 2J4IA 4A1VA 1YPGH 2ANWA 2F9BH 3A83A 1A2CH 2HOBA 1KXDA 3HK3B 3ZZ9A 1D3PB 2VWNA 3A86A 1JOUB 4X1RU 1QA0A 1GI9B 3Q76A 1S83A 3MH6A 1DT2A 3CS0A 3MYWA 4X0WU 2LPRA 4K3JA 3M36A 1UCYK 1GJ9B 1O3KA 1V2KT 3ZZ4A 5EGMA 1TNLA 1YLCA 3T29A 4JZDH 3DFLA 3NCLA 1BITA 2VGCC 1F0RA 2B8OH 1FZZA 4WMFA 5C1UA 5J4SA 1P9SA 2WV5A 2JH0D 1G2MA 1N6XA 3RMMH 2ZGCA 1C5WB 3KQCA 3Q00A 2J92A 4FUJA 4Y7BA 3P6ZB 4BAMB 4KTCA 1SQOA 1LPGB 3GY7A 2ZA5A 1ZGVA 4YTAA 3Q3KA 1N1LA 2R3YA 3MHWU 1DXWA 3UNSA 1CQQA 1JIRA 1TA6A 3PMBB 1H9LB 3E90B 2EEKA 3GY6A 1QJ6B 4ISNA 1MZAA 3FZDA 3NK8A 2ZPQA 2H9TH 4AFUA 1FPCH 4X6PA 1F7ZA 4FXGH 1ABJH 4I33A 3RLWH 1EPTB 1OXGA 1TNIA 1JBUH 1ZRKA 2G00A 5C1XA 1VGCC 1YBWA 4DG4A 3UQOA 3GOVB 2K1QA 1BCUH 1AWHB 1QRWA 1SG8B 1EB1H 2CF9H 3W95A 1QBNA 1MKXK 1C2FA 4RN6A 2YNBA 2UUFB 3C27B 3SGAE 1WOFA 3SJ8A 1FXYA 5TCCA 1YF4A 4WF8A 3UREA 4CR9A 1YPLH 1VITF 1A3BH 5EQRA 4HI3A 1RTFB 3BTGE 1NTPA 4GCHF 2FOGA 3OY6U 2OC1A 4AGJA 1EPTA 3DHKH 3PYHA 4D8NA 1BHXB 3MO6A 3PMAB 3TNTA 3U8OH 3M7QA 5E2OA 4INHA 3RXPA 3BG8A 1V2WT 2G5NA 1EZUC 2FOEA