3PLKA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLLNSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA02
5DJ7A 3GY7A 3AW1A 1EZSC 4X2YA 3BTTE 1IQHA 2BD3A 3TK9A 1QCPA 1GDUA 3KQDA 4XOJA 1FY4A 5T6FA 1OP0A 1F5LA 1QJ7B 1EAXA 1XM1A 2PSXA 1S82A 1UCYH 1O5BB 1SGQE 2J92A 1BRCE 8ESTE 5HM2A 4CR9A 1GI2A 3UWJH 1J17T 2BX3A 1FI8A 2H6MA 3RU4E 2CF8H 3KIDU 4DVAU 3UREA 2EI6A 1FXYA 4I8HA 1K1NA 1PQ7A 3TU7H 1SHYA 3VB5A 3VXFH 4A1VA 3G01A 1QQUA 1OWDA 1ZSKA 4YTAA 3C1KA 1HJAB 4WMDA 4INLA 1ZYOA 6CHAB 1GI3A 1P04A 4NFFA 2SGAA 3TH3H 4YOGA 4ISNA 3TJVA 1QBNA 1V2LT 2O8MA 1CGJE 2PTNA 1GHBF 2H1UA 1UTKA 1ZMLA 2AEIH 3ZVFA 4A7IB 3GY4A 1FN6A 1RIWB 4NZQA 2GZ9A 2Q6GA 4OS7A 5EU8A 2IPHA 5IDKA 1C5UA 3QWCH 4ABGA 4CHAC 2A0QB 2FYRA 3ZZ3A 5C1UA 2AERH 2P94A 2XC5A 3RXGA 2FEQH 1NESE 3MWIU 2F9OA 2FIRH 1O2XA 1Z8RA 1C1QA 1W0ZU 5B6OA 4ZXYH 2HPQH 2GTBA 2QC2A 1KTTB 3GDVA 1ZRBA 1YC0A 1WUNH 3EAJA 5EQQA 3SU6A 1C5TA 2ZHFH 3MNCA 4NIXA 2Y7ZA 4WWYA 1DSUA 1BMAA 5JBCS 1FAKH 2DE9A 1KY9A 2A4QA 1DS2E 1MKXH 2GV7A 2Z3DA 3AW0A 1EZXC 5BRRE 3PMJA 1TB6H 3VGCC 3TH4H 1H9LB 1ABJH 4I8JA 1SGFG 2PTCE 1O35A 3UNQA 3TGJE 2XCFA 1O3DA 3ATIA 1RXPA 3SNEA 1F0UA 2BD5A 3FAOA 1EZUC 1GBHA 1A5HA 1O30A 4GHQA 3RC4A 2G51A 3NUMA 1SGNE 2A2QH 3GCTG 1PFXC 1FY5A 1C5VA 1SFQB 1LVMA 2C90B 1Q31A 3GY5A 4RSPA 1B5GH 1GBLA 1ZMJA 3RXPA 4DT7B 1Z1JA 1HXFH 1SVPA 1F2SE 2WUBA 2H5DA 1C1OA 1PPEE 2PSYA 2ZCHP 1EB1H 3A7XA 1O2UA 1ELDE 2KAIB 1ELEE 1SLUB 4Q80A 1HBTH 3QZQA 2W7SA 4ISOA 1EOJA 1VITF 4AYVB 1O3OA 2Z6BD 1O2RA 3Q76A 4KTSA 3TJUA 2OC7A 1P2QA 3SJIA 1GJAB 3MHWU 4UONA 4XBBA 2FWWA 4OS1A 3S9BA 4TPIZ 3RXKA 2ZPSA 4INKA 1F0SA 1V2WT 1MTWA 2A7CA 1H8IH 1RTLA 3K6YA 4SGAE 2CMYA 1VCQA 2XXLA 2ALPA 3RXRA 5LPEA 1ZMNA 3MOCA 1IQEA 4BAKB 2AGGX 2QXGA 2R0KA 4CBOA 1WCZA 1UHBB 2WPIS 3ITIA 2V35A 2TGAA 2GMTC 2ZCKP 1AMHA 3QUMP 5FX6A 2QAAA 1TNGA 3M5MA 3M7UA 2VWMA 1LHDH 3PO1C 1E35B 2FXRA 1KLTA 3QZRA 1TNLA 4A1TA 4BAMB 4BAHB 3ODFA 1QJ6B 5JB8S 3JZ2B 3A8DA 1Y5BT 3A81A 1GI9B 1SMFE 1OS8A 3HK3B 3ZVDA 2O8UA 1DVAH 1P9UA 1NTPA 3D62A 4DW2U 3FP7E 1K28D 1ELBA 2H9HA 2AYWA 1FV9A 3R0FA 4MNXA 4B1TA 1O2LA 1WBGB 1Q3XA 1RTKA 2B5TB 2PHBA 2QGRA 5FPSA 2FS9A 3ZZ9A 1QY6A 3QGNB 2FLRH 1EP6A 3LONA 4E05H 3KQEA 1DLKB 3CENA 1DOJA 1E38B 3VB7A 1SQOA 3FVFB 4ABJA 1AFQC 2P8OB 1KTSB 5C67A 1C5LH 3K2UA 1GWAA 1ZHRA 4BXWA 1FZZA 2EC9H 4K3JA 4GSOA 1NFUA 1Q2WA 4JZEH 3DT0H 1AWFH 4AFSA 1O0DH 2RG3A 4FUEA 1BT7A 1W11U 1XKBC 3KQCA 1MMJN 2R2MB 3BN9A 1Z71A 2EI7A 1OOKB 3TJOA 1Y5AT 5CHAC 5I46H 3BTGE 4CREA 4ISHH 1RJXB 1QURH 2Y7XA 3E0PB 4CBNA 4J1YA 1LPGB 4H6SB 3M37A 5BPEA 2EEKA 1HAHH 1GBFA 1SFIA 3SORA 1UTPA 1A5GH 1BA8B 5IYTA 1NFYA 4X1QU 2V3OH 1SGCA 3RXSA 1THPB 3TK5A 2B7DH 1XUKA 1QL8A 2GGVB 1O5DH 3ATMA 1AI8H 3ZZ6A 5E0JA 1TGTA 1Y3VA 2BVXH 3MO3A 1UMAH 3GY3A 4OGYA 4NIYA 4JK5A 2UWPA 2ZGXH 1ZGIA 1GBIA 1C2IA 1MTUA 2H9TH 2V6NA 4U32A 2HRVA 2A7HA 2A1DB 1KXFA 4B75A 5DO4H 3OSYA 1UK2A 1T7CA 1SI5H 1F5RA 3R3GB 1HJAC 3SU2A 1IQMA 1LTOA 1TBQH 6CHAC 1UVUH 1J8AA 1NRNH 1UTOA 3MH5A 2JH6D 1A3EH 4AB8A 3F68H 2BOHB 1AIXH 4B76A 1GJ7B 3TJNA 4NCYA 3D23A 5CE1A 5TCCA 2XRCA 1SOTA 5A0AE 3SJ9A 5GXPA 4VGCB 2SGPE 2B0FA 3TIUA 2VB0A 3S0NA 1W13U 2G00A 2ZEBA 1AUTC 4ZUHA 4IMZA 3KF2A 1ZPBA 2IOTA 1GJ8B 3KHVA 4ZKOU 1G9IE 5A0CA 2HVXA 1ARCA 2XYAA 3MH4A 3SQEE 3MNBA 5DKMA 3IITA 1H9IE 1GDNA 1U6QA 1O2PA 1EXFA 4WH6A 1FY8E 3GY8A 5A09A 4FUJA 3OYPA 5LPRA 1JIRA 1K21H 1Z1IA 4HFPB 3UNRA 1NS3A 1T32A 1EAIA 3BSQA 4H4FA 2ZG0H 3URDA 1JBUH 3SUFA 4YM9A 1BRUP 1FONA 3GOVB 3FFGA 1KSNA 2HOBA 3RXBA 5GWZA 3BG8A 1D3QB 1MZDA 1QRXA 2RDLA 4DG4A 2Z9GA 1WU1A 1O3BA 1YCPM 2AFQB 1L1GA 2FS8A 2BLVA 2W26A 1UK4A 1CT4E 5DP9A 1RD3B 1JWTA 2GD4B 3GY6A 1YGCH 2SGDE 3OX7U 4YOJA 1C1PA 1TRMA 2FOFA 3VGCB 2R2WU 4FXGH 5A0BA 1FPCH 1V2KT 2BD9A 3VB3A 2JH5D 1CBWB 4WF8A 3ELAH 5JDUB 2FX4A 1E37B 3MMGA 3MO6A 3M3TA 4U30A 3EDXB 1GMCF 4FUCA 3RXEA 3SU3A 1RFNA 4Q7YA 1EP5A 4Z6AH 1C2KA 4THNH 1MTVA 1JIMA 1GJCB 2JH0D 2VH6A 1OWHA 1P2KA 3GCNA 1HAVB 3T62A 1BMLA 3NKKA 1GBDA 3O8DA 2FI3E 1TA6A 2WV5A 2ALVA 3GDSA 3I78A 5GCHF 1SC8U 1SGYE 1XUHA 2BQ6B 5ESTE 4UFGH 1D6WA 4A6LA 1XXFA 6GCHG 3E6PH 2CXVA 3CS7A 3UFAA 2STAE 3VFEA 1KXBA 2C3SA 3TPIZ 3BTQE 4JZDH 2ZU3A 1C5ZB 5T6GA 5C3NA 4JCNA 2P3TB 2OXSA 1QA0A 2FESH 2J4IA 2GVFA 4MPXA 4AOQA 1S85A 1WAYB 4NFEA 2PV9B 3EA9A 3SU4A 1ANBA 1B0EA 4HTCH 1ACBE 1GI6A 1GMHG 1O5CB 1TGSZ 1V2OT 2O8WA 4KTCA 4YO9A 4MVNA 1TQ0B 4H6TA 3Q77A 1Z8GA 2WPJS 1AN1E 1EQ9A 1V2QT 4MNWA 1UJ1A 4KKDA 2PGBB 2PKAB 3LJJA 4WXVA 2GMTB 3ZZBA 2FOBA 4NIWA 1AE8H 5A2MH 2FOGA 2FODA 1IQNA 5ETXA 3PMBB 1PPHE 1W2KH 1EAWA 3VPKA 1HAVA 1TX7A 3BTFE 3ZZ7A 1CA0B 3RXTA 2Z3EA 1IHSH 1UTNA 1GHXH 3B23B 4AZ2B 2P8OC 2ZNKH 2CJIA 3EA8A 4ZXXH 3QLPH 2VJ1A 4NA7A 4XE4A 1W8BH 1OSSA 2BVRH 2TGPZ 3W94A 3PMAB 3N7OA 2P3UB 3FZDA 5FXLA 1C5YB 1T8LA 1A61H 3OU0A 1MTNB 1NM6A 3BG4B 3SHCH 1GVKB 3LOXA 7LPRA 1GCDA 1HFDA 1TALA 3LJOA 4FU8A 1GGDB 1UVTH 1EUFA 1ANEA 1AFQB 3QGJA 2FTLE 2PWXA 3TVJB 3PLKA 3U8OH 1F92A 1O31A 5E0GA 1DXWA 4X2VA 1O3KA 2WINI 2BDBA 1XUFA 1RTFB 3ATWA 3U98H 2ANMH 4I31A 5F6MA 3GY2A 3RC5A 1TABE 3A86A 1O3CA 1Y3UA 1ID5H 4FVDA 1GHAF 1OWIA 5EW1H 2ZDNA 1SGEE 3NWUA 1C1UH 4E06H 3A85A 5DP6A 3ESTA 1BB0B 1HAZB 1O3IA 1YPLH 2SGFE 3SUEA 8KME2 1YPKH 1C2LA 1O3AA 4KGAA 1GVZA 4UEHH 4IN1A 3RLWH 1ETSH 5FAHA 3DFLA 4WJG2 2ZPRA 4NA8A 1P2OA 3A7ZA 4E7NA 1YPHE 2M5TA 1EPTB 2VU8E 1TAWA 2XWBI 1TLDA 2BDCA 1A7SA 5EPNA 1W3CA 4GCHG 2TBSA 1GBJA 2YNBA 3RMMH 1FQ3A 2LPRA 3SZNA 2FOEA 4MQAA 1YM0A 4MG3A 2GCHF 1C4U2 1BRBE 1DDJA 1QB1A 3SOSA 1EAUA 4OS6A 1SGFA 3V0XA 2F3CE 2SNVA 3A8AA 1ARBA 1GCTB 3B8JA 1HGTH 1LKAA 1BBRK 1BOQA 1W0YH 3GYLB 4YOIA 3RXOA 5H4IB 4VGCC 3M7QA 4D7GA 1S6HA 2BX4A 1QRWA 1ESAA 4JYUH 4DURA 1V2MT 1HDTH 5JYIA 1GJ6A 1RGQA 1TX6A 1HJ9A 3T25A 2DUCA 3P92A 3TGIE 1GI8B 1O5AB 2WPKS 1NC6A 2YOLA 2A32A 1TGNA 1V2PT 1EPTA 1O3MA 2ILNA 4B2BA 3EA7A 1FUJA 1UVSH 1CQQA 2BY5X 1MD8A 5C20A 2WUCA 3DA9B 1C2DA 4YLUA 5LH8A 1O2HA 5DP4A 1WQSA 1GDQA 1F0TA 3PTBA 5AFYH 5EQRA 1BDAA 1LPZB 3GYMA 3LT3A 1O37A 1AKSB 1SHHB 1BUIA 4XFQA 1P11E 3T5FH 4MPWA 1FIWA 2PGQB 3A8CA 1GI0A 4DIHH 2ZIQH 4UFFH 2BTCE 1EZQA 1NROH 2Z94A 1BTYA 1T8OA 3RXCA 3ZYEA 1SL3A 1SG8B 3LKWA 4Y7AA 5C1XA 2PLXA 2BDIA 4X1PU 3LGUA 2BDAA 3RXDA 3BTKE 1O3NA 5ABWA 2SFAA 1SPJA 1DICA 1BTHH 1CBWC 3RXVA 1SLWB 7ESTE 3UR9A 2QXJA 3MU8A 1IHTH 4X1SU 2ZHWH 3MU5A 5EOKA 1MU6B 2RA0A 3CS0A 5I25A 1TBZH 2FPZA 1LHCH 3PM3A 1AO5A 1DWDH 4FUGA 2ZFPH 4Y8ZA 1NRQH 1ZZZA 1T4VH 1LMWB 5J4QA 4A1XA 5SGAE 4NWLA 2BDHA 1GJ4H 1MTSA 2UUKB 1L4ZA 2C8WB 1JRTA 5EGMA 1SQTA 1NZQH 1H8DH 1G36A 1MU8B 3ZZAA 3E0NB 1ETTH 1QRZA 2ZPQA 5K7RA 1AQ7A 1QNJA 2ZGCA 2ZGBH 1C5QA 1AKSA 3HKIB 4X1NU 3K65B 4Q2KA 1PPBH 4CRGA 2TPIZ 5T3HA 1C1RA 5L2ZH 3I29A 4AB9A 3TNTA 1C2JA 1K1IA 1O3EA 2VIOA 3PV4A 3LC5A 1DY8A 1K9OE 1GBMA 4AG1A 1K1LA 2Z9IA 1P01A 1CA8B 1L0ZA 1LHFH 3ZZDA 1SGPE 1RS0A 3VB6A 2PKSB 3UUZA 1O3LA 1CT2E 3MU1A 2QY0B 1YCPK 3RC6A 2P93A 5F8ZA 4Y0YE 5HMAA 1HAXB 2IJOB 1QR3E 1S6FA 1CSOE 5DP3A 2A31A 3H7OA 3GDUA 3SI4H 3KL6A 3Q3YA 2F91A 2R3YA 2SGEE 3QO6A 2VVCA 1W7XH 1ESBA 2ANWA 4A92A 1QGFA 2J38A 4DGJA 1EJNA 1CA0C 1TNIA 3P8GA 4GLYA 2XTTB 3NPSA 2ZECA 5E2OA 2FP7B 5J4SA 1OXGA 1Z8JB 5L2YH 1WOFA 2P59A 2RA3A 3RM2H 3URCA 3GCHB 4YESB 1A4WH 2BD7A 1O2JA 3BV9B 1HLTH 1UTQA 4NG9H 1QA7A 1THSH 5DGJA 1MTNC 4X8UH 3BG4C 5A8ZA 1UO6A 4K5ZA 5FPTA 3UQVA 4NSYA 2ZQ1A 1UTMA 2ZI2H 1D3DB 2ODPA 1GGDC 1TGCA 4MNYA 2ZDAH 2TGTA 1ZLRA 2GKVE 3JZ1B 1QBOA 5A8XA 1MZAA 1BZXE 1HAIH 1P12E 3A84A 2CN0H 1QIXB 1TPPA 3GICB 3L6PA 1IQFA 1NPMA 1NFWA 2J94A 1VGCB 3T28A 2G8TA 4ZHMU 3TH2H 2VH0A 2B8OH 1XUGA 1TPOA 1V2NT 4FU9A 1GI5A 2UUJB 1MBQA 4ZKRU 2AGEX 3LH3A 5HGGA 4ISLA 3PYHA 1MKWH 3T2NA 1LQDB 1A1RA 3U69H 1UTJA 1NU9A 1DANH 2PR3A 3A89A 1MQ5A 2C8YB 1BCUH 1NO9H 3W95A 3SI3H 1UCYK 3ODDA 4PROA 3LU9B 1BJVA 1V2TT 3LDXH 1K1MA 1YP9A 2C4FH 4X8SH 1G3BA 1QHRB 1C2EA 2NWNA 1EPTC 4D8NA 1CVWH 5ESBA 1DSTA 4H42U 4TPYA 1HXEH 4B2AA 1LQEA 2BQ7B 5C1YA 1P9SA 3BEUA 4ISIH 4X6NA 1W7GH 4AORA 2VWNA 1CHOF 4A5TS 1TMTH 8GCHF 4WY3A 4NGAH 4XBCA 1QQ4A 1S5SA 3L3TA 2Z9LA 1BIOA 1Z7KA 1GHBG 4Y8XA 2BZ6H 4HZHA 3HK6B 3PMHB 4NSVA 2FO9A 2BD4A 2OD3B 3P95A 7GCHF 1XVOA 1ANDA 1GCTC 4BNRA 2HNTC 1FMGA 1ZPZA 2ZTXA 4I7YH 3M3VA 4JZIA 1GMDF 2ZKSA 2QF3A 4MTBA 2A4RA 4Y0ZE 2VIDA 1YPMH 3DFJA 1AVGH 2C93B 2GZ8A 3UWIA 5GIBA 4OS2A 2JETC 5FCRA 3SU1A 1SGTA 3SV8A 1G3DA 2A4OA 4R0IA 1AWHB 2GP9B 4CRBA 4IN2A 1XKAC 4Q7XA 4AFUA 2QXIA 1Z6JH 1O2OA 2K1QA 1XUJA 3RUOA 1YBWA 1GJBB 2P3FH 2QIQA 3RDZA 3ZV8A 2GT8A 2BZAA 1O2SA 1GHVH 4HGCA 4WXIA 1PPZA 1Y3YA 2VGCB 1O2IA 1P06A 1PQAA 1MUEB 1ZTKA 3AVZA 3TITA 2OCVB 1WSSH 3AAVA 1ZSJA 1G2LA 1GVLA 1IQIA 3QTOH 5TCAA 4O3UA 2ZDVH 1MKXK 3O8RA 5DP7A 1FDPA 2XBVA 4ABFA 2Y5HA 3MI4A 2BY7X 1J14A 3FZZA 5JBTA 4OS5A 4UFEH 1KIGH 1LO6A 4LZ1H 2J95A 4AN7A 5AVDA 1MAYA 2XC0A 3SJOA 2ODYB 1P3CA 5C5OA 1C5PA 1AVWA 3EGKH 3RXFA 3NZIA 1FNIA 1CHGA 4UFDH 1W10U 1O36A 3ZZ5A 3L33A 3PTNA 3SJKA 1QBVH 4UE7H 4ABIA 1EJMA 4ZH8A 3ZZCA 4D76A 5JBBS 1VITG 1ZJDA 2XC4A 3IWMA 4B74A 4Y6DA 1SQAA 1T8MA 2XBWA 1TGBA 3SBKA 4B2CA 1BTPA 1IQGA 1X7AC 3UPEA 1G30B 1CE5A 1DUEA 4ZKSU 1KXEA 3FP8E 1V2UT 1KXCA 1GJ9B 1OYTH 4FUDA 4ABHA 1FY1A 1YPHC 3MNSA 3PWCA 4DIIH 4YT7H 2V0BA 3RMLH 1Z8IB 3P17H 2J9NA 3DUXH 1DE7H 3BIVH 3K9XB 2ZTYA 4TWYA 1O2GH 1PPFE 4AGKA 2PUXB 4YLQH 3P8NA 3RXAA 3NK8A 1GL0E 5T6DA 1TOMH 4ZMAH 3M7TA 3P70B 2H2ZA 4ZHAA 1Y3XA 3ZVEA 1HCGA 2FOAA 1AY6H 2Q6DA 1C1SA 1ZPCA 2QA9E 3A88A 1DWEH 3RU4T 2PKSC 1XUIA 2C8ZB 2G81E 1TX8A 1ELGA 2GV6A 2XCNA 4FVBA 3UQOA 4K1TA 3DHKH 4TYDA 2O8LA 3PLBA 1V6DA 1D9IA 2NU3E 1LVYA 2BOKA 2W3KA 1J16A 2ZF0H 1MH0A 4ZROA 3DD2H 1RRKA 1C1NA 1VR1H 1ELFA 2ZCLP 5JPMH 4YT6H 1O32A 9ESTA 1BHXB 3RM0H 1MAXA 1K1JA 2BD2A 1TNJA 2G5VA 1AUJA 2F9VA 5F03A 1ORFA 3SGAE 1C2HA 4AG2A 1BJUA 1C1WH 2BYAX 1PYTC 4YZUA 1VJ9U 1L1NA 1UTLM 1Y3WA 1HAYB 3GCHC 1GG6B 4FUBA 1NFXA 2HALA 3F9HA 2F9BH 2NU2E 1EOLA 3GCTF 1DWBH 2AMPA 1O38A 1TQ7B 2BB4A 1SGDE 2XBXA 1KYNA 2W5EA 5EXNA 5E8EH 2YNAA 2OTVA 1ELAA 4ABAA 3H7TA 2CHAB 1TPSA 4I8GA 1GBTA 2RCEA 3BF6H 3Q3XA 9LPRA 1O5GH 2PUQH 5CMXH 1VGCC 1AB9B 1O2MA 4KELA 3SW2B 1V2VT 4CR5A 2G4UA 1O2YA 1Y8TA 1A2CH 4ESTE 3RP2A 2PFEA 1MQ6A 1EJAA 2ZDLA 2UWLA 1GI1A 2P16A 3RMOH 2OC8A 1XMNB 2R9PA 2ZHEH 2HNTF 3RMNH 1TMUH 3ATKA 3M3SA 3F1SB 4DY7B 3F9GA 1O3FA 1L2EA 1FAXA 2A7JA 3LGVA 4R8TB 2TIOA 2THFB 1SGIB 2FX6A 5C2ZA 3TK6A 2ZGJA 1ZRKA 3MH7A 4Y10E 1DLEA 2VIVA 3PWBA 2D2DA 1ZR0A 3RLYH 3T26A 5GDSH 1C5XB 1D3TB 3SNBA 2BQWB 1NY22 2ZFTA 3SNCA 3AAUA 5K0HA 1E34B 1ANCA 1C5SA 3QK1A 1OWEA 3UY9A 2ESTE 3RXLA 3LPRA 1WTGH 1EATA 4SGBE 4IS5A 4I8LA 4TWWA 1INCA 3SV7A 3OY6U 3A83A 4WMEA 4JYTA 2FMJA 3WY8A 1O2NA 1QJ1B 1DY9A 5HXFA 3FANA 2F9UA 3T29A 1ELTA 3TGKE 3NXPA 2OUAA 1TBRH 1NRRH 1VCPA 1AGJA 1VZQH 1G37A 2VGCC 2G4TA 2VVVA 1E36B 4F49A 1HNEE 1NN6A 2JETB 3SU0A 2ZU2A 4XBDA 1F5KU 1DX5M 1O2TA 2GZ7A 2VIWA 4KP0A 4RKOB 1ZOMA 1NU7B 1W14U 3SU5A 1S83A 1EASA 3PB1E 4I32A 2FDAA 1OP2A 1P2IA 2ZFSA 2G52A 1DUAA 1SLVB 1C4V2 3SJ8A 2ZFRH 2A5IA 3D65E 1H9HE 2TRMA 3STIA 1EKBB 4I33A 3KEEA 2BLWA 3BEIB 2FTMA 5A8YA 1M9UA 2GDEH 1C2FA 3HKJB 3LH1A 2WV4A 1A0LA 1NT1A 3ZVGA 4XSKU 2BHGA 1GMCG 4FUFA 1SBWA 4CH2B 1G3CA 3Q00A 1C2GA 1C9TA 5DP8A 3RXJA 8LPRA 3LGYA 1HB0B 2Y82A 4LK4A 1G2MA 3OY5U 2EA3A 1XXDA 1SB1H 1DPOA 1TFXA 5GCHG 1MD7A 3SGQE 1C1TA 4CRCA 3CP7A 4K8BA 1BTUA 1TRYA 3KGPA 1GJDB 1OP8A 2ZHDA 1AZZA 1MCVA 1LHEH 1F0RA 2BD8A 2BY8X 2ZFQH 4BTTB 1A0JA 1CGIE 4X6OA 4Y11E 3Q3KA 1JXPA 1OWKA 1H4WA 2PW8H 5HYOA 3RXQA 1N8OC 1TA2A 3MH6A 4X1RU 4K1SA 1TYNA 1G3EA 5AF9H 2ZGHA 3ZVBA 1P03A 5DG6A 2WPHS 1O33A 2VINA 4AGJA 1N1LA 5GPIB 1YPGH 2BDGA 1L4DA 2UUFB 1UVPA 1SLXB 3A80A 3MFJA 2ZU4A 3KNXA 4O03A 4BOHA 2ZTZA 2ZDKA 5EXLA 3U8TH 1WYKA 1LVOA 1FPHH 1HUTH 1T31A 3UR6A 5LPFA 1KLJH 4K8YA 5F8TA 1FY3A 1TRNA 3OTJE 3EQ0H 3LC3A 1ELCA 4K60A 1WV7H 1UVOA 1V2JT 2BXTH 3IG6B 3H5CB 1ESTA 3E1XB 1PJPA 1JRSA 4ZKNU 1HPGA 2GX4A 5JBAS 1P02A 3M5LA 1T8NA 2BY9X 1A46H 2J2UA 4XDEA 3SV9A 1TOCB 1O3PB 1KXAA 2BLOA 2BDYA 3U9AH 3O8CA 4MNVA 2FI4E 4M7GA 3SHAH 3E90B 3ZV9A 2OLGA 3V12A 1TMBH 2W3IA 1OPHB 3MNXA 2J34A 3VB4A 4B71A 3V7TA 1YPJH 2BMGB 2OBQA 1GG6C 1THRH 1ZHPA 5AHGH 4D9QA 4E7RG 2P95A 1BMNH 2ZFFH 2QV1A 3U1IB 4INHA 5FHTA 1LCYA 3GISB 1GBBA 1C5MD 1QL9A 1YKTA 1ZTLA 2JKHA 4IGDA 3LIWA 3F9FA 2VWLA 4WVPE 4IBLH 2ZO3H 4ZAEA 2ANYA 2OC0A 2CHAC 3VXEH 1GHAG 1K1PA 3B9FH 2ZC9H 4FU7A 2AS9A 3UOPA 5DK1A 1AB9C 3MTYA 1P05A 1ETRH 3SNDA 4KTUA 3QX5H 3T27A 4IMQA 1Z6EA 2WYJA 1IQJA 3LGIA 1FJSA 1P2MA 1VITH 2UUYA 1XX9A 4BAOB 4MPUA 4LOYH 4X2XA 3RXMA 1OKXA 3QTVH 4RN6A 4GHTA 6GCHF 1AZ8A 4NZLA 2F9PA 4WH8A 4IW4E 3E8LA 4MPVA 4JZ1A 3EE0B 4K1EA 5E2PA 2H9EH 4U01A 4Y8YA 2WPMS 1XVMA 2KAIA 2Q6FA 4GVUA 3M36A 4UD9H 2FZZA 2I6SA 4HI3A 3S9AA 1T4UH 1O2VA 1ZHMA 2OINA 2CF9H 2VIPA 2Z9JA 1HAOH 1WTHD 4DOQA 2GCHG 2STBE 1AE5A 4AX9H 1BBRE 4X8TH 2ZP0H 3P8OA 2B9LA 1GMHF 1HV7A 1WQVH 2OP9A 2W7UA 1OYQA 1P2JA 1C5WB 1DM4B 2VNTA 5EQSA 1IQLA 3ZZ4A 4I8KA 5E0HA 1UHBA 4B73A 1JOUB 4BTIB 3TNSA 2G55A 2QCYA 1P57B 2GCTB 5EXMA 2HWLB 1K22H 1K1OA 2A45B 2D1JA 1AHTH 4BAQB 2TGDA 2AIPA 1HAGE 2C8XB 2ZU5A 2ZHQH 4ABBA 1S81A 2NU4E 4CRAA 3NCLA 2BM2A 3P6ZB 4J2YB 1O3GA 4IC6A 1D4PB 2ZQ2A 3BIUH 2Y81A 2AMQA 1O39A 4X8VH 1DFPA 2Y6TA 4ABDA 5JB9S 5DPAA 1Y5UT 1SOZA 3ENSB 4X6MA 3SV2H 5L30H 1P3EA 4U2WA 1P2NA 2A5KA 1V2ST 1HYLA 2A2XH 2HPPH 1KLIH 2AGIX 3KCGH 1N6XA 1YF4A 1O34A 1W12U 1TNHA 1AU8A 1B0FA 2FOMB 1PQ8A 3MU4A 1IOEA 5FCKA 1O2ZA 3BTWE 1GI7B 2FI5E 4Y7BA 1CGHA 1AVXA 3KQBA 4JMYA 2WPLS 1LDTT 1C5OH 1CT0E 5FBIA 1FN8A 2AMDA 5AFZH 1O5FH 1ABIH 2GT7A 2GDDA 4Z0KA 1TONA 4O97A 3RXHA 2FM2A 5EG4A 3A7YA 4CH8B 2SNWA 4CRFA 2ASUB 4AFQA 2BLQA 1V2RT 1S0RA 1ZGVA 1ZSLA 1E0FD 1PQ5A 5EPYA 3U1JB 2XWAA 1GPZA 1RIWC 5G4BA 1SR5C 3A87A 1HJ8A 3A82A 3BTME 5L6NH 4GCHF 3BTEE 3A7WA 3SQHE 1A0HB 1P0SH 4X2WA 5DP5A 1C1MA 2ODQA 5FX5A 3UIRA 2Z3CA 1GHZA 1S84A 2ZA5A 2OQ5A 4GAWA 1BBRH 1LKBA 4JYVH 2DE8A 3PLPA 4IC5A 3U8RH 1PPGE 1HRTH 1S0QA 1YYY1 4X0WU 2ZZUH 3QN7A 1ELVA 3ZYDA 1L1JA 3S69A 5LGOA 1A3BH 4OS4A 5EW2H 2XNIA 1P10A 3RXIA 1TPAE 1J15A 4CHAB 1O2QA 3A8BA 2QN5T 1C5NH 1MBMA 3BEFB 1KXDA 1PPCE 3I77A 2OC1A 2NU0E 3UNSA 2FYQA 4LXBH 5EODA 3SV6A 2O9QA 2QYIA 3PROA 2UWOA 4Q7ZA 1BHXF 2I6QA 1NRPH 5HM9A 1CU1A 1N8OB 1G32B 1GHYH 1GJ5H 2ULLA 1TIOA 3MU0A 1J9CH 3E91A 2AH4X 1A5IA 3SO3A 2ZWLH 1QB6A 2R0LA 1BITA 3E16B 3MO9A 1OWJA 2EI8A 2Z7FE 3AASA 2IN2A 1BTWA 2O8TA 2ANKH 3D49H 3M5NA 4MDSA 3HPTB 1QTFA 1GL1A 2BVSH 3QDZB 2R3UA 4UDWH 3E3TA 5FPYA 3VEQB 2AIQA 1FLEE 4BANB 2D26C 3HGPA 1HIAB 3O8BA 3M61U 1GI4A 1YLDA 6ESTA 1AD8H 1SGRE 4QT8C 4D9RA 1QB9A 5C5NA 1C5RA 3HGNA 3M35A 1C1VH 2Z9KA 1H1BA 3V3MA 4ABEA 3STJA 2XBYA 1IAUA 1DITH 3SGBE 1NRSH 1VCWA 1YLCA 2BY6X 4F4OC 2VWOA 1YPEH 1GBCA 2QF0A 4ASHA 4AYYB 3F6UH 1GBKA 3RXUA 1Y59T 2Y5GA 4FUHA 3GCOA 3F9EA 1UK3A 1D6RA 3BTDE 2F9NA 1TNKA 1BMMH 1UCYE 2HNTE 1N6YA 4RKJB 3M5OA 3ATLA 3LGWA 1BRAA 1DXPA 1D3PB 3A7TA 4ZHLU 3SUDA 4TY7A 1MKWK 1VJAU 1KDQB 2Y80A 5PTPA 4OGXA 4Y71A 1QFKH 1HAPH 4K2YA 3BTHE 1AFEH 1V3XA 1P8VC 1GHWH 4LZ4B 1B7XB 1GBEA 4JZFH 2F83A 2A4GA 1HIAA 2FOCA 7KMEH 1TWXB 1C9PA 3PO1B 3UTUH 1CHOG 1GBAA 8GCHG 1LHGH 1BTXA 3RU4D 4CRDA 2SGQE 3KN2A 3EYDA 3HATH 3ZZ8A 1BQYA 2G5NA 6LPRA 5F8XA 3V13A 1YCPH 1O5EH 2VIQA 4NIVA 3ZVAA 7GCHG 4BTUB 1C4Y2 4O9VA 4X6PA 3A7VA 4JK6A 3TLOA 2FLBH 4MLFB 1GMDG 3UOUA 4TY6A 2Q1JA 2HLCA 2ZU1A 2CV3A 1K2I1 2Y5FA 4FUIA 2D8WA 3S7KB 3S9CA 2WYGA 3SUGA 2FOHA 4D7FA 1ZTJA 1EB2A 1O3JA 1OX1A 5GJ4B 4AFZA 1ZJKA 2GCTC 1O2WA 3SN8A 1LVBA 1FIZA 1P09A 1IQKA 1PYTD 1MCTA 3MYWA 2HGTH 2ZDMA 2NU1E 1SSXA 4GPGA 3ZVCA 3SNAA 1KDQA 4Y76A 1QL7A 1TE0A 2OQUA 3FP6E 1O3HA 1BTZA 5TJXA 1CO7E 4NA9H 1EX3A 2VVUA 1LPKB 2LNCA 2XW9A 2PKAA 2OBOA 2A5AA 5CHAB 4DCDA 4DJZB 3S7HB 3P8FA 1O2KA 2CGAA 1F7ZA 4O3TA 1C2MA 1DT2A 4NWKA 5FBEA 1DWCH 2V3HH 2BXUH 4K69A 1JMOH 3LGTA 2H5CA 2QXHA 3C27B 4GUXA 4WMFA 4Y79A 3K6ZA 4BXSA
chains in the Genus database with same CATH superfamily
5DJ7A 3GY7A 3AW1A 1EZSC 4X2YA 3BTTE 1IQHA 2BD3A 3TK9A 1QCPA 1GDUA 3KQDA 4XOJA 1FY4A 5T6FA 1OP0A 1F5LA 1QJ7B 1EAXA 1XM1A 2PSXA 1S82A 1UCYH 4Z1MD 1O5BB 1SGQE 2J92A 1BRCE 8ESTE 5HM2A 4CR9A 1GI2A 5C0UA 3UWJH 5CHBA 1J17T 2BX3A 1FI8A 2H6MA 3RU4E 2CF8H 3KIDU 4DVAU 3UREA 2EI6A 1FXYA 4I8HA 1K1NA 1PQ7A 3TU7H 1SHYA 3VB5A 3VXFH 4A1VA 2YMSD 3G01A 1QQUA 1OWDA 1ZSKA 4AC9A 4YTAA 3WWBA 3C1KA 1HJAB 4WMDA 4INLA 1ZYOA 3DSOA 6CHAB 1GI3A 1P04A 5HKKD 4NFFA 2SGAA 3TH3H 1WXRA 4YOGA 4ISNA 3TJVA 1QBNA 5GNDA 1V2LT 2O8MA 1CGJE 2PTNA 3OEED 1GHBF 2H1UA 1UTKA 1ZMLA 2AEIH 3ZVFA 4A7IB 3GY4A 1FN6A 1RIWB 4NZQA 2F4LA 2KCPA 2GZ9A 2Q6GA 4OS7A 5EU8A 2IPHA 2CK3D 5IDKA 1C5UA 3QWCH 4ABGA 4CHAC 2A0QB 2FYRA 3ZZ3A 5C1UA 2AERH 2P94A 2XC5A 3RXGA 2FEQH 1NESE 3MWIU 2F9OA 2FIRH 1O2XA 1Z8RA 4FETA 1C1QA 1W0ZU 4XRNA 2AHME 5B6OA 4ZXYH 2HPQH 2GTBA 2QC2A 1KTTB 3GDVA 1ZRBA 1YC0A 1WUNH 3EAJA 5EQQA 3SU6A 1C5TA 2ZHFH 3MNCA 4NIXA 2Y7ZA 4WWYA 1DSUA 1BMAA 5JBCS 1FAKH 2DE9A 3W1EA 1KY9A 2A4QA 1DS2E 1MKXH 2GV7A 2Z3DA 3AW0A 1EZXC 1EFRD 1YLNA 5BRRE 3PMJA 1TB6H 3VGCC 3TH4H 1H9LB 1ABJH 4I8JA 1SGFG 2PTCE 1O35A 3UNQA 3TGJE 2XCFA 1O3DA 2KCAA 3ATIA 1RXPA 2HVYB 3SNEA 1F0UA 2BD5A 3FAOA 1EZUC 1GBHA 1A5HA 1O30A 4GHQA 3FN8A 3RC4A 2G51A 3NUMA 1SGNE 2A2QH 3GCTG 1PFXC 1FY5A 1C5VA 1SFQB 1LVMA 2C90B 1Q31A 3GY5A 4RSPA 1B5GH 1GBLA 1ZMJA 3RXPA 4DT7B 1Z1JA 1HXFH 1SVPA 1F2SE 2WUBA 2H5DA 1C1OA 1PPEE 2LP6A 2PSYA 2ZCHP 1EB1H 3A7XA 1O2UA 1ELDE 2KAIB 1ELEE 1SLUB 4Q80A 1HBTH 3QZQA 2W7SA 3CNRA 4ISOA 1EOJA 1VITF 4AYVB 1O3OA 2Z6BD 1O2RA 3Q76A 4KTSA 3TJUA 2OC7A 1P2QA 3SJIA 1GJAB 3MHWU 4UONA 4XBBA 2FWWA 4OS1A 3S9BA 4TPIZ 3RXKA 2ZPSA 4INKA 1F0SA 1V2WT 5DN6D 1MTWA 2A7CA 1H8IH 1RTLA 3K6YA 4SGAE 4M9FA 2CMYA 3SYJA 1VCQA 2XXLA 2ALPA 3RXRA 5LPEA 1ZMNA 3MOCA 1IQEA 4BAKB 2J98A 2AGGX 2QXGA 2R0KA 4CBOA 1WCZA 1UHBB 2WPIS 3ITIA 2V35A 2TGAA 2GMTC 4Q4LA 2ZCKP 1AMHA 3QUMP 5FX6A 2QAAA 1TNGA 3M5MA 3M7UA 2VWMA 2J5UA 1KMHB 1LHDH 1E35B 2FXRA 1KLTA 3PO1C 1TNLA 2QF5A 3QZRA 3U28C 4A1TA 3ODFA 4BAMB 4BAHB 1QJ6B 5JB8S 3JZ2B 3A8DA 1Y5BT 3A81A 1GI9B 1SMFE 1OS8A 3HK3B 3ZVDA 2O8UA 1DVAH 1P9UA 1NTPA 3D62A 4DW2U 3FP7E 1K28D 1ELBA 2H9HA 3FKSD 2AYWA 1FV9A 3R0FA 4MNXA 4B1TA 1O2LA 1WBGB 3GS9A 1Q3XA 1RTKA 2B5TB 2PHBA 2QGRA 5FPSA 2FS9A 3ZZ9A 1QY6A 3QGNB 2FLRH 1EP6A 3LONA 4E05H 3KQEA 3NRLA 1DLKB 3N99A 3CENA 1DOJA 1E38B 3VB7A 1SQOA 2WSSD 3FVFB 4ABJA 1AFQC 2P8OB 1KTSB 5C67A 1C5LH 3K2UA 1GWAA 1ZHRA 4BXWA 1FZZA 2EC9H 4K3JA 4GSOA 1NFUA 4TSFD 1Q2WA 4XD7D 4JZEH 3DT0H 1AWFH 4AFSA 1O0DH 2RG3A 4FUEA 3F0OA 1BT7A 1W11U 1XKBC 3KQCA 1MMJN 2R2MB 3BN9A 1Z71A 2EI7A 1OOKB 3TJOA 1Y5AT 5CHAC 5I46H 3BTGE 4CREA 4ISHH 1RJXB 1QURH 2Y7XA 3E0PB 4CBNA 1SKYE 4J1YA 1LPGB 4H6SB 3M37A 5BPEA 2EEKA 1HAHH 1GBFA 1SFIA 3SORA 1UTPA 1A5GH 1BA8B 4YXWD 5IYTA 1NFYA 4X1QU 2V3OH 1SGCA 3RXSA 1THPB 3TK5A 2B7DH 2XNDD 1XUKA 1QL8A 2GGVB 1O5DH 3ATMA 1AI8H 3ZZ6A 5E0JA 1TGTA 1Y3VA 2BVXH 3MO3A 1UMAH 3GY3A 4OGYA 2JJ2D 4NIYA 4JK5A 2UWPA 2ZGXH 1ZGIA 1GBIA 1C2IA 1MTUA 2H9TH 2V6NA 4U32A 2HRVA 2A7HA 2A1DB 1KXFA 4B75A 5DO4H 2KZ4A 3OSYA 1UK2A 1T7CA 1SI5H 1F5RA 3R3GB 1HJAC 3SU2A 1IQMA 1LTOA 1TBQH 6CHAC 1UVUH 1J8AA 1NRNH 1UTOA 3MH5A 2JH6D 1A3EH 4AB8A 3F68H 2BOHB 3ZIAD 1AIXH 2EQNA 4B76A 1GJ7B 3TJNA 4NCYA 3D23A 5CE1A 5TCCA 2XRCA 1SOTA 5A0AE 3SJ9A 5GXPA 4VGCB 2SGPE 2B0FA 3TIUA 2VB0A 3S0NA 1W13U 2G00A 2ZEBA 1AUTC 3OAAD 4ZUHA 4IMZA 3KF2A 1ZPBA 2IOTA 2EY4C 1GJ8B 3KHVA 4ZKOU 1G9IE 5A0CA 2HVXA 1ARCA 2XYAA 3MH4A 3SQEE 3MNBA 5DKMA 3IITA 1H9IE 1GDNA 1U6QA 1O2PA 1EXFA 4WH6A 1FY8E 3GY8A 5A09A 4FUJA 3OYPA 5LPRA 1JIRA 1K21H 1Z1IA 4HFPB 3UNRA 1NS3A 1T32A 1EAIA 3BSQA 4H4FA 3OEHD 2ZG0H 3URDA 1JBUH 3SUFA 4YM9A 1BRUP 1FONA 3GOVB 1VKYA 3FFGA 1KSNA 2HOBA 2K0QA 3RXBA 5GWZA 3BG8A 1D3QB 1MZDA 1QRXA 2RDLA 4DG4A 2Z9GA 1WU1A 1O3BA 1YCPM 2AFQB 1L1GA 2FS8A 2GJGA 2BLVA 2W26A 1UK4A 1CT4E 4I86A 5DP9A 1RD3B 1JWTA 2GD4B 3GY6A 1YGCH 2SGDE 3OX7U 4YOJA 1C1PA 1TRMA 2FOFA 3VGCB 2R2WU 4FXGH 5A0BA 1FPCH 1V2KT 2BD9A 3VB3A 2JH5D 1CBWB 4WF8A 3ELAH 5JDUB 2FX4A 1E37B 2IJD1 3MMGA 3M3TA 3MO6A 4U30A 3EDXB 1GMCF 4FUCA 3RXEA 3SU3A 1RFNA 4Q7YA 1EP5A 3N7EA 1C2KA 4Z6AH 4THNH 1MTVA 1JIMA 1GJCB 2JH0D 2VH6A 1OWHA 1P2KA 3GCNA 1HAVB 3T62A 1BMLA 3NKKA 1GBDA 3O8DA 2FI3E 1TA6A 2WV5A 5KECA 3KQ5A 1H8HD 2ALVA 3GDSA 3I78A 5GCHF 1SC8U 1SGYE 1XUHA 2BQ6B 5ESTE 4UFGH 1D6WA 4A6LA 1XXFA 6GCHG 3E6PH 2CXVA 1YY3A 3CS7A 3UFAA 2STAE 3VFEA 1KXBA 2C3SA 3TPIZ 3BTQE 4JZDH 2ZU3A 2L6OA 3F2FA 1C5ZB 5T6GA 5C3NA 2HLDD 4JCNA 2P3TB 3F0PA 2OXSA 1QA0A 2FESH 2J4IA 2GVFA 4MPXA 4AOQA 1S85A 1WAYB 4NFEA 2PV9B 3EA9A 3SU4A 1ANBA 1B0EA 2JIZD 4HTCH 1ACBE 1GI6A 1GMHG 1O5CB 1TGSZ 1V2OT 2O8WA 4KTCA 4YO9A 4MVNA 1TQ0B 5C0TA 4H6TA 3Q77A 1Z8GA 2WPJS 1AN1E 1EQ9A 1V2QT 4MNWA 1UJ1A 4KKDA 2PGBB 2PKAB 3LJJA 4WXVA 2GMTB 3ZZBA 5C17A 2FOBA 4NIWA 1AE8H 5A2MH 2FOGA 2FODA 1IQNA 5ETXA 3PMBB 1PPHE 1W2KH 1EAWA 3VPKA 1HAVA 1TX7A 3BTFE 3ZZ7A 1CA0B 3RXTA 2Z3EA 1IHSH 3DCLA 1UTNA 2RDEA 1GHXH 3B23B 4AZ2B 2P8OC 2ZNKH 2CJIA 3EA8A 4ZXXH 3QLPH 2VJ1A 4NA7A 4XE4A 1W8BH 1OSSA 3PV2A 2BVRH 2TGPZ 3W94A 3PMAB 3N7OA 2P3UB 3FZDA 5FXLA 1C5YB 3UB0A 2KCYA 2IPQX 2QE7D 1T8LA 1A61H 1WDIA 3OU0A 1MTNB 1NM6A 3BG4B 3SHCH 1GVKB 3LOXA 7LPRA 1GCDA 1HFDA 1TALA 3LJOA 4FU8A 1GGDB 1UVTH 1EUFA 1ANEA 1AFQB 3QGJA 4ACBA 2FTLE 2PWXA 3TVJB 3PLKA 3U8OH 1F92A 1O31A 1UW7A 5E0GA 1DXWA 4X2VA 1O3KA 2WINI 2BDBA 1XUFA 1RTFB 3ATWA 3U98H 2ANMH 4I31A 5F6MA 3GY2A 3RC5A 1TABE 3A86A 1O3CA 1Y3UA 1ID5H 4FVDA 1GHAF 1OWIA 5EW1H 2ZDNA 1SGEE 3NWUA 1C1UH 4E06H 3A85A 5DP6A 3ESTA 1BB0B 1HAZB 1O3IA 1YPLH 2SGFE 3SUEA 8KME2 1YPKH 1C2LA 1O3AA 4KGAA 1GVZA 4UEHH 4IN1A 3RLWH 1ETSH 5FAHA 3DFLA 4WJG2 2W6ID 2ZPRA 4NA8A 1P2OA 3A7ZA 4E7NA 1YPHE 2M5TA 1EPTB 3FOAA 2VU8E 1TAWA 2XWBI 1TLDA 2BDCA 1A7SA 5EPNA 1W3CA 4GCHG 2TBSA 1GBJA 2YNBA 3RMMH 1FQ3A 2LPRA 3SZNA 5FL7D 2FOEA 4MQAA 1YM0A 4MG3A 2GCHF 1C4U2 1BRBE 3WWFA 1DDJA 1QB1A 3SOSA 1EAUA 4OS6A 1SGFA 3V0XA 2F3CE 2SNVA 3A8AA 1ARBA 1GCTB 3B8JA 1HGTH 1LKAA 1BBRK 1BOQA 1W0YH 3GYLB 4YOIA 3RXOA 5H4IB 4VGCC 3M7QA 4D7GA 1S6HA 2BX4A 1QRWA 1ESAA 4JYUH 4DURA 1V2MT 1HDTH 5JYIA 1GJ6A 1RGQA 1TX6A 1HJ9A 3T25A 2DUCA 3P92A 3TGIE 1GI8B 1O5AB 2WPKS 1NC6A 2YOLA 2A32A 1TGNA 1V2PT 1EPTA 1O3MA 2ILNA 4B2BA 3EA7A 1FUJA 1UVSH 1CQQA 1YWUA 2BY5X 1MD8A 5C20A 2WUCA 3DA9B 1C2DA 1OHHD 4YLUA 5LH8A 1O2HA 5DP4A 1WQSA 1GDQA 1F0TA 3PTBA 5AFYH 5EQRA 1BDAA 1LPZB 3GYMA 3DSGA 3LT3A 1O37A 1AKSB 1SHHB 1BUIA 4XFQA 1P11E 3T5FH 4MPWA 1FIWA 2PGQB 3A8CA 1GI0A 4DIHH 2ZIQH 4UFFH 2BTCE 1EZQA 1NROH 2Z94A 1BTYA 1T8OA 3RXCA 3ZYEA 1SL3A 1SG8B 3LKWA 4Y7AA 5C1XA 2PLXA 1E1RD 4F55A 2BDIA 4X1PU 3LGUA 2BDAA 3RXDA 3BTKE 1O3NA 2J98B 2SFAA 1SPJA 1DICA 1BTHH 1CBWC 3RXVA 5ABWA 1SLWB 7ESTE 3UR9A 2QXJA 3MU8A 1IHTH 4X1SU 2ZHWH 3MU5A 5EOKA 1MU6B 2RA0A 3CS0A 5I25A 1TBZH 2FPZA 4DT4A 3N7DA 1LHCH 3PM3A 1AO5A 1DWDH 4FUGA 2ZFPH 4Y8ZA 1NRQH 1ZZZA 1T4VH 1LMWB 5J4QA 4A1XA 5SGAE 4NWLA 2BDHA 1GJ4H 1MTSA 2UUKB 1L4ZA 2C8WB 1JRTA 5EGMA 1SQTA 1NZQH 1H8DH 1G36A 1MU8B 3ZZAA 3E0NB 1ETTH 1QRZA 2ZPQA 5K7RA 5EJ1A 1AQ7A 1QNJA 2ZGCA 2ZGBH 1C5QA 3VG8A 1AKSA 3HKIB 4X1NU 3K65B 4Q2KA 1PPBH 4CRGA 2TPIZ 5T3HA 1C1RA 5L2ZH 3I29A 4AB9A 3TNTA 1C2JA 1K1IA 1O3EA 2VIOA 3UAIC 3PV4A 3LC5A 1DY8A 1K9OE 1GBMA 4AG1A 1K1LA 2Z9IA 1P01A 1CA8B 1L0ZA 1LHFH 3ZZDA 1SGPE 1RS0A 3VB6A 2PKSB 3UUZA 1O3LA 1CT2E 3MU1A 2QY0B 1YCPK 3RC6A 2P93A 5F8ZA 4Y0YE 5HMAA 1HAXB 2IJOB 1QR3E 1S6FA 1CSOE 5DP3A 2A31A 3H7OA 3GDUA 3SI4H 3KL6A 3Q3YA 2F91A 2R3YA 2SGEE 3QO6A 2VVCA 1W7XH 1ESBA 2ANWA 4A92A 1QGFA 2J38A 4DGJA 2WV9A 1EJNA 1CA0C 1TNIA 3P8GA 4GLYA 2XTTB 3NPSA 2ZECA 5E2OA 2FP7B 5J4SA 1OXGA 1Z8JB 5L2YH 1WOFA 2P59A 2RA3A 3RM2H 3URCA 3GCHB 4YESB 1A4WH 2BD7A 1O2JA 3BV9B 1HLTH 1UTQA 4NG9H 1QA7A 1THSH 5DGJA 1MTNC 4RI0A 3BG4C 4X8UH 5A8ZA 1UO6A 4K5ZA 5FPTA 3UQVA 4NSYA 2ZQ1A 1UTMA 2ZI2H 1D3DB 2ODPA 1GGDC 1TGCA 4MNYA 2ZDAH 2TGTA 1ZLRA 2GKVE 3JZ1B 1QBOA 5A8XA 1MZAA 1BZXE 1HAIH 1P12E 3A84A 2CN0H 1QIXB 1TPPA 4ASUD 3GICB 3L6PA 1IQFA 1NPMA 1NFWA 2J94A 1VGCB 3T28A 2G8TA 4ZHMU 3TH2H 2VH0A 2B8OH 1XUGA 1TPOA 1V2NT 4FU9A 1GI5A 2UUJB 1MBQA 4P02A 4ZKRU 2AGEX 3LH3A 5HGGA 4ISLA 3PYHA 5C94A 1MKWH 3T2NA 4ZCNA 3SZEA 1LQDB 1A1RA 3U69H 1UTJA 1NU9A 1DANH 2PR3A 3A89A 1MQ5A 2C8YB 1BCUH 1NO9H 3W95A 3SI3H 1UCYK 3ODDA 4PROA 3LU9B 1BJVA 1V2TT 3LDXH 2K8IA 1K1MA 1YP9A 2C4FH 4X8SH 1G3BA 1QHRB 1C2EA 2NWNA 1EPTC 4D8NA 1CVWH 5ESBA 1DSTA 4H42U 4TPYA 1HXEH 4B2AA 1LQEA 2BQ7B 5C1YA 1P9SA 3BEUA 4ISIH 4X6NA 1W7GH 4AORA 2VWNA 1CHOF 4A5TS 1TMTH 8GCHF 1H8ED 4WY3A 4NGAH 4XBCA 1QQ4A 1S5SA 2YMSB 2Z9LA 3L3TA 1BIOA 1Z7KA 1GHBG 2KX4A 2BZ6H 4HZHA 4Y8XA 3HK6B 3PMHB 4NSVA 2FO9A 2BD4A 2OD3B 3P95A 7GCHF 1XVOA 1ANDA 1GCTC 4BNRA 2HNTC 1FMGA 1ZPZA 2ZTXA 4I7YH 3M3VA 4JZIA 1GMDF 2ZKSA 2QF3A 4MTBA 2A4RA 4Y0ZE 2VIDA 1YPMH 3DFJA 1AVGH 2C93B 2GZ8A 3UWIA 5GIBA 4OS2A 2JETC 5FCRA 3SU1A 1SGTA 3SV8A 1G3DA 5HIZA 2A4OA 4R0IA 1AWHB 2GP9B 4CRBA 4IN2A 1XKAC 4Q7XA 4AFUA 2QXIA 1Z6JH 1O2OA 2K1QA 1XUJA 3RUOA 1YBWA 1GJBB 2P3FH 2QIQA 3RDZA 3ZV8A 2GT8A 2BZAA 1O2SA 4F48B 1GHVH 4HGCA 4WXIA 1PPZA 1Y3YA 2VGCB 1O2IA 1P06A 1PQAA 1MUEB 1ZTKA 3AVZA 3TITA 2OCVB 1WSSH 3AAVA 1ZSJA 1G2LA 1GVLA 1IQIA 2V3MA 3QTOH 5TCAA 4O3UA 2ZDVH 1MKXK 3O8RA 5DP7A 1FDPA 2XBVA 4ABFA 2Y5HA 3MI4A 2BY7X 1J14A 5DSFA 3FZZA 5JBTA 2KM0A 4OS5A 4UFEH 1KIGH 1LO6A 4LZ1H 2J95A 4AN7A 5AVDA 1COWD 1MAYA 2XC0A 3SJOA 2ODYB 1P3CA 5C5OA 2WPDD 1C5PA 1AVWA 3EGKH 3RXFA 3NZIA 1FNIA 1CHGA 4UFDH 2M2AA 1W10U 1O36A 3ZZ5A 3L33A 3PTNA 3SJKA 1QBVH 4UE7H 4ABIA 1EJMA 4ZH8A 3ZZCA 4D76A 5JBBS 1VITG 1ZJDA 2XC4A 3IWMA 4B74A 4Y6DA 1SQAA 1T8MA 2XBWA 1TGBA 3SBKA 4B2CA 1BTPA 1IQGA 1X7AC 3UPEA 1G30B 1CE5A 1DUEA 4ZKSU 1KXEA 3FP8E 1V2UT 1KXCA 2KCOA 2RFKC 1GJ9B 2JDID 1OYTH 4FUDA 4ABHA 1FY1A 1YPHC 3MNSA 3PWCA 4DIIH 4YT7H 2V0BA 3RMLH 1Z8IB 3P17H 2J9NA 3DUXH 1DE7H 3BIVH 3K9XB 2ZTYA 4TWYA 1O2GH 1PPFE 4AGKA 2PUXB 4YLQH 3P8NA 3RXAA 3NK8A 1GL0E 5T6DA 1TOMH 5KGOA 4ZMAH 3M7TA 3P70B 2H2ZA 4ZHAA 1Y3XA 3ZVEA 1HCGA 1SQRA 3PV5A 2FOAA 1AY6H 2Q6DA 1C1SA 1ZPCA 2QA9E 3A88A 1DWEH 3RU4T 2PKSC 1XUIA 2C8ZB 2G81E 1TX8A 1ELGA 2GV6A 3KYFA 2XCNA 4FVBA 3UQOA 4K1TA 3DHKH 4TYDA 4OM9A 2O8LA 3PLBA 1V6DA 1D9IA 2NU3E 1LVYA 2BOKA 2W3KA 1J16A 2ZF0H 1MH0A 4ZROA 3DD2H 1RRKA 1C1NA 1VR1H 1ELFA 2ZCLP 5JPMH 4YT6H 1O32A 9ESTA 4B6EA 1BHXB 3RM0H 1MAXA 1K1JA 2VBCA 2BD2A 1TNJA 2G5VA 1AUJA 2F9VA 5F03A 1ORFA 3SGAE 1K0HA 1C2HA 4AG2A 1BJUA 1C1WH 2BYAX 1PYTC 4YZUA 1VJ9U 1L1NA 1UTLM 1Y3WA 1HAYB 3GCHC 1GG6B 4FUBA 1NFXA 2HALA 4B6FA 3F9HA 2F9BH 2NU2E 1EOLA 3GCTF 1DWBH 2AMPA 1O38A 1TQ7B 2BB4A 1SGDE 2XBXA 1KYNA 1S6LA 2W5EA 5EXNA 5E8EH 3PRBA 2YNAA 2OTVA 1ELAA 4ABAA 3H7TA 2CHAB 1TPSA 4I8GA 1GBTA 2RCEA 3BF6H 3Q3XA 9LPRA 1O5GH 2PUQH 5CMXH 1VGCC 1AB9B 3H09A 1O2MA 4KELA 3SW2B 3OFND 1V2VT 4CR5A 2G4UA 1O2YA 1Y8TA 1A2CH 4ESTE 3RP2A 2PFEA 1MQ6A 1EJAA 2ZDLA 2UWLA 1GI1A 2P16A 3RMOH 2OC8A 1XMNB 2R9PA 5IK2D 2ZHEH 2HNTF 3RMNH 1TMUH 3ATKA 3M3SA 3F1SB 4DY7B 3F9GA 1O3FA 1L2EA 1FAXA 2A7JA 3LGVA 4R8TB 5T1VA 2TIOA 2THFB 1SGIB 2FX6A 5C2ZA 3TK6A 2ZGJA 2YMSC 1ZRKA 3MH7A 4Y10E 1DLEA 2VIVA 3PWBA 2D2DA 1ZR0A 3RLYH 3T26A 5GDSH 1C5XB 1D3TB 3SNBA 2BQWB 1NY22 2ZFTA 3F2HA 3SNCA 3AAUA 5K0HA 5CDFE 1E34B 1ANCA 1C5SA 3QK1A 1OWEA 3UY9A 2ESTE 2JJ1D 4P00A 3RXLA 3LPRA 1WTGH 1EATA 4SGBE 4IS5A 4I8LA 4TWWA 1INCA 3SV7A 3OY6U 3A83A 4WMEA 4JYTA 2FMJA 3WY8A 1O2NA 1QJ1B 1DY9A 5HXFA 3FANA 2F9UA 3T29A 1ELTA 3TGKE 3NXPA 3MQKC 2OUAA 1TBRH 1NRRH 1VCPA 1AGJA 2KFWA 1VZQH 1G37A 2VGCC 2G4TA 2VVVA 1E36B 4F49A 5KEDA 1HNEE 1NN6A 2JETB 2F43B 3SU0A 2ZU2A 4XBDA 1F5KU 1DX5M 1O2TA 2GZ7A 2VIWA 4KP0A 4RKOB 1ZOMA 1NU7B 1W14U 3SU5A 1S83A 1EASA 3PB1E 1W0JD 4I32A 2FDAA 1OP2A 1P2IA 3AK5A 2ZFSA 2G52A 1DUAA 1SLVB 1C4V2 3SJ8A 2ZFRH 2A5IA 3D65E 1H9HE 2TRMA 3STIA 1EKBB 4I33A 3KEEA 2BLWA 3BEIB 2FTMA 5A8YA 1M9UA 2GDEH 1C2FA 3HKJB 3LH1A 2WV4A 1A0LA 1NT1A 3ZVGA 4XSKU 2BHGA 1GMCG 4FUFA 1SBWA 4CH2B 1G3CA 3Q00A 1C2GA 1C9TA 5DP8A 3RXJA 8LPRA 3LGYA 1HB0B 2Y82A 4LK4A 1G2MA 3WW7A 2XOKD 3OY5U 2EA3A 1XXDA 1SB1H 1DPOA 1TFXA 5GCHG 1MD7A 3DSPA 3SGQE 1C1TA 4CRCA 3CP7A 4K8BA 1BTUA 1TRYA 3KGPA 1GJDB 1OP8A 2ZHDA 1AZZA 1MCVA 1E79D 1LHEH 1F0RA 2BD8A 2BY8X 2ZFQH 4BTTB 1A0JA 1CGIE 4X6OA 4Y11E 3Q3KA 1JXPA 1OWKA 1H4WA 2PW8H 5HYOA 3RXQA 1N8OC 1TA2A 3MH6A 4X1RU 4K1SA 1TYNA 1G3EA 5AF9H 2ZGHA 3ZVBA 1P03A 5DG6A 2WPHS 1O33A 2VINA 4AGJA 1N1LA 5GPIB 1YPGH 2BDGA 2L74A 1L4DA 2UUFB 1UVPA 1SLXB 3A80A 3MFJA 2ZU4A 3KNXA 4O03A 4BOHA 2ZTZA 2ZDKA 5EXLA 3U8TH 1WYKA 1LVOA 1FPHH 1HUTH 1T31A 3UR6A 5LPFA 1KLJH 4K8YA 5F8TA 1FY3A 1TRNA 3OTJE 3EQ0H 3LC3A 1ELCA 4K60A 1WV7H 5B6LA 1UVOA 1V2JT 2BXTH 3IG6B 1MABB 3H5CB 1ESTA 3E1XB 1PJPA 1JRSA 1E1QD 1HPGA 4ZKNU 2GX4A 5JBAS 1P02A 3M5LA 1T8NA 2BY9X 1A46H 2J2UA 4XDEA 3SV9A 1TOCB 1O3PB 3KYGA 1KXAA 2BLOA 2BDYA 3U9AH 3O8CA 4MNVA 2FI4E 4M7GA 3SHAH 3E90B 3ZV9A 2OLGA 3V12A 1TMBH 2W3IA 1OPHB 3MNXA 2J34A 2WHXA 3VB4A 4B71A 3V7TA 1YPJH 2BMGB 2OBQA 1GG6C 1THRH 1ZHPA 5AHGH 4D9QA 4E7RG 2P95A 1BMNH 2ZFFH 2QV1A 3U1IB 4INHA 5FHTA 1LCYA 3GISB 1GBBA 1C5MD 1QL9A 1YKTA 1ZTLA 2JKHA 4IGDA 3LIWA 3F9FA 2VWLA 4WVPE 4IBLH 2ZO3H 4ZAEA 2ANYA 1NBMD 2OC0A 2CHAC 3VXEH 1GHAG 1K1PA 3B9FH 2ZC9H 4FU7A 2AS9A 5EJZA 3UOPA 5DK1A 1AB9C 3MTYA 1P05A 1ETRH 3SNDA 4KTUA 3QX5H 3T27A 4IMQA 1Z6EA 2WYJA 1IQJA 3LGIA 1FJSA 1P2MA 1VITH 2UUYA 1XX9A 4BAOB 4MPUA 4LOYH 4X2XA 3RXMA 1OKXA 3QTVH 4RN6A 4GHTA 6GCHF 1AZ8A 4NZLA 2F9PA 4WH8A 4IW4E 3E8LA 4MPVA 4JZ1A 3EE0B 4K1EA 5E2PA 2H9EH 4U01A 4Y8YA 2WPMS 1XVMA 2KAIA 2Q6FA 4GVUA 3M36A 4ACAA 4UD9H 2FZZA 2I6SA 4HI3A 3S9AA 1T4UH 1O2VA 1ZHMA 2CF9H 2OINA 2VIPA 2Z9JA 1HAOH 1WTHD 4DOQA 2GCHG 2STBE 1AE5A 4AX9H 1BBRE 4X8TH 2ZP0H 3P8OA 2B9LA 1GMHF 1HV7A 1WQVH 2OP9A 2W7UA 1OYQA 1P2JA 1C5WB 1DM4B 2VNTA 5EQSA 1IQLA 3ZZ4A 4I8KA 5E0HA 1UHBA 4B73A 1JOUB 4BTIB 3TNSA 2G55A 2QCYA 1P57B 2GCTB 5EXMA 2HWLB 1K22H 1K1OA 2A45B 2D1JA 1AHTH 4BAQB 2TGDA 4FOUC 2AIPA 5HIYA 1HAGE 2C8XB 2ZU5A 2ZHQH 4ABBA 1S81A 2NU4E 4CRAA 3NCLA 2BM2A 3P6ZB 4J2YB 1O3GA 4IC6A 2QF4A 1D4PB 2ZQ2A 3BIUH 2Y81A 2AMQA 1O39A 4X8VH 1DFPA 2Y6TA 4ABDA 5JB9S 5DPAA 1Y5UT 1SOZA 3ENSB 4X6MA 3SV2H 5L30H 1P3EA 4U2WA 1P2NA 1W0KD 2A5KA 1V2ST 1HYLA 2A2XH 2HPPH 1NBME 1KLIH 2AGIX 3KCGH 1N6XA 1YF4A 1O34A 1W12U 1TNHA 1AU8A 1B0FA 2FOMB 1PQ8A 3MU4A 1IOEA 5FCKA 1O2ZA 1QZ8A 3BTWE 3F3BA 1GI7B 2FI5E 4Y7BA 1CGHA 1AVXA 2V7QD 3KQBA 2LELA 4JMYA 2WPLS 1LDTT 1C5OH 1CT0E 5FBIA 1FN8A 2AMDA 5AFZH 1O5FH 1ABIH 3PRDA 2GT7A 2GDDA 4Z0KA 1TONA 4O97A 3RXHA 2FM2A 5EG4A 3A7YA 4CH8B 2SNWA 4CRFA 2ASUB 4AFQA 2BLQA 1V2RT 1S0RA 1ZGVA 1ZSLA 1E0FD 1PQ5A 5EPYA 3EE7A 3U1JB 2XWAA 1GPZA 1RIWC 5G4BA 1SR5C 3A87A 1HJ8A 3A82A 3BTME 5L6NH 4GCHF 3BTEE 3A7WA 3SQHE 1A0HB 1P0SH 4X2WA 5DP5A 1C1MA 2ODQA 5FX5A 3UIRA 2Z3CA 1GHZA 1S84A 2ZA5A 2OQ5A 4GAWA 1BBRH 1LKBA 4JYVH 2DE8A 3PLPA 4IC5A 3U8RH 1PPGE 1HRTH 1S0QA 1YYY1 4X0WU 2ZZUH 3QN7A 1ELVA 3ZYDA 1L1JA 3S69A 5LGOA 1A3BH 4OS4A 3OE7D 5EW2H 2XNIA 1P10A 3RXIA 1TPAE 4RT1A 1J15A 4CHAB 1O2QA 2W6JD 3A8BA 2QN5T 1C5NH 1FX0B 1MBMA 3BEFB 1KXDA 1PPCE 3I77A 2OC1A 2NU0E 4RT0A 3UNSA 1BMFD 2FYQA 4LXBH 5EODA 3SV6A 2O9QA 2QYIA 3PROA 2UWOA 4Q7ZA 1BHXF 2I6QA 1NRPH 5HM9A 1CU1A 1N8OB 1G32B 1GHYH 1GJ5H 2ULLA 1TIOA 3MU0A 1J9CH 3E91A 2AH4X 1A5IA 3SO3A 2OK5A 2WZQA 2ZWLH 1QB6A 2R0LA 1BITA 3E16B 2J97A 3MO9A 1OWJA 2EI8A 2Z7FE 3AASA 2IN2A 1BTWA 2O8TA 2ANKH 3D49H 3M5NA 4MDSA 3HPTB 1QTFA 1GL1A 2BVSH 3QDZB 2R3UA 4UDWH 3E3TA 5FPYA 3VEQB 2AIQA 1FLEE 4BANB 2D26C 3HGPA 1HIAB 3O8BA 3M61U 2KR7A 1GI4A 1YLDA 6ESTA 4TT3D 1AD8H 1SGRE 4QT8C 4D9RA 1QB9A 5C5NA 1C5RA 3HGNA 3M35A 1C1VH 2Z9KA 1H1BA 3V3MA 4ABEA 3STJA 2XBYA 1IAUA 1DITH 3SGBE 1NRSH 1VCWA 1YLCA 2BY6X 4F4OC 2VWOA 1YPEH 1GBCA 2QF0A 4ASHA 4AYYB 3F6UH 1GBKA 3RXUA 1Y59T 2Y5GA 4FUHA 3GCOA 3F9EA 1UK3A 1D6RA 3BTDE 2F9NA 1TNKA 1BMMH 1UCYE 2HNTE 1N6YA 4RKJB 5F53A 3M5OA 3ATLA 3LGWA 1BRAA 1DXPA 1D3PB 3A7TA 4ZHLU 3SUDA 4TY7A 1MKWK 1VJAU 1KDQB 2Y80A 5PTPA 4OGXA 4Y71A 1QFKH 1HAPH 4K2YA 3BTHE 1AFEH 1V3XA 1P8VC 5EIYA 1GHWH 4LZ4B 1B7XB 1GBEA 4JZFH 2F83A 2A4GA 1HIAA 2FOCA 5EJLA 7KMEH 1TWXB 1C9PA 3PO1B 3UTUH 1CHOG 1GBAA 8GCHG 1LHGH 1BTXA 3RU4D 4CRDA 2SGQE 3KN2A 3EYDA 3HATH 3ZZ8A 1BQYA 2G5NA 6LPRA 5F8XA 3V13A 4Q63A 1YCPH 1O5EH 2VIQA 4NIVA 3ZVAA 7GCHG 4BTUB 1C4Y2 4O9VA 4X6PA 3A7VA 4JK6A 3TLOA 2FLBH 4MLFB 1GMDG 3UOUA 4TY6A 2Q1JA 2HLCA 2ZU1A 2CV3A 1K2I1 2Y5FA 4FUIA 2D8WA 3S7KB 3S9CA 2WYGA 3SUGA 2FOHA 4D7FA 1ZTJA 1EB2A 1O3JA 1OX1A 5GJ4B 4AFZA 1ZJKA 2GCTC 1O2WA 3SN8A 1LVBA 1FIZA 1P09A 1IQKA 1PYTD 1MCTA 3MYWA 2HGTH 2PP6A 2ZDMA 2NU1E 1SSXA 4GPGA 3ZVCA 3SNAA 1KDQA 4Y76A 1QL7A 1TE0A 2OQUA 3FP6E 1O3HA 1BTZA 5TJXA 1CO7E 4NA9H 1EX3A 2VVUA 1LPKB 2LNCA 2XW9A 2PKAA 3FO8D 2OBOA 2A5AA 3OTPA 5CHAB 4DCDA 4DJZB 3S7HB 3P8FA 1O2KA 2CGAA 1F7ZA 4O3TA 1C2MA 1DT2A 4NWKA 5FBEA 1DWCH 2V3HH 2BXUH 4K69A 1JMOH 3LGTA 2H5CA 2QXHA 3F2GA 4HG6A 3C27B 4GUXA 4WMFA 4Y79A 3K6ZA 4BXSA
chains in the Genus database with same CATH topology
5DJ7A 3GY7A 3AW1A 1EZSC 4X2YA 3BTTE 1IQHA 2BD3A 3TK9A 1QCPA 1GDUA 3KQDA 4XOJA 1FY4A 5T6FA 1OP0A 1F5LA 1QJ7B 1EAXA 1XM1A 2PSXA 1S82A 1UCYH 1O5BB 1SGQE 2J92A 1BRCE 8ESTE 5HM2A 4CR9A 1GI2A 3UWJH 1J17T 2BX3A 1FI8A 2H6MA 3RU4E 2CF8H 3KIDU 4DVAU 3UREA 2EI6A 1FXYA 4I8HA 1K1NA 1PQ7A 3TU7H 1SHYA 3VB5A 3VXFH 4A1VA 3G01A 1QQUA 1OWDA 1ZSKA 4YTAA 3C1KA 1HJAB 4WMDA 4INLA 1ZYOA 6CHAB 1GI3A 1P04A 4NFFA 2SGAA 3TH3H 4YOGA 4ISNA 3TJVA 1QBNA 1V2LT 2O8MA 1CGJE 2PTNA 1GHBF 2H1UA 1UTKA 1ZMLA 2AEIH 3ZVFA 4A7IB 3GY4A 1FN6A 1RIWB 4NZQA 2GZ9A 2Q6GA 4OS7A 5EU8A 2IPHA 5IDKA 1C5UA 3QWCH 4ABGA 4CHAC 2A0QB 2FYRA 3ZZ3A 5C1UA 2AERH 2P94A 2XC5A 3RXGA 2FEQH 1NESE 3MWIU 2F9OA 2FIRH 1O2XA 1Z8RA 1C1QA 1W0ZU 5B6OA 4ZXYH 2HPQH 2GTBA 2QC2A 1KTTB 3GDVA 1ZRBA 1YC0A 1WUNH 3EAJA 5EQQA 3SU6A 1C5TA 2ZHFH 3MNCA 4NIXA 2Y7ZA 4WWYA 1DSUA 1BMAA 5JBCS 1FAKH 2DE9A 1KY9A 2A4QA 1DS2E 1MKXH 2GV7A 2Z3DA 3AW0A 1EZXC 5BRRE 3PMJA 1TB6H 3VGCC 3TH4H 1H9LB 1ABJH 4I8JA 1SGFG 2PTCE 1O35A 3UNQA 3TGJE 2XCFA 1O3DA 3ATIA 1RXPA 3SNEA 1F0UA 2BD5A 3FAOA 1EZUC 1GBHA 1A5HA 1O30A 4GHQA 3RC4A 2G51A 3NUMA 1SGNE 2A2QH 3GCTG 1PFXC 1FY5A 1C5VA 1SFQB 1LVMA 2C90B 1Q31A 3GY5A 4RSPA 1B5GH 1GBLA 1ZMJA 3RXPA 4DT7B 1Z1JA 1HXFH 1SVPA 1F2SE 2WUBA 2H5DA 1C1OA 1PPEE 2PSYA 2ZCHP 1EB1H 3A7XA 1O2UA 1ELDE 2KAIB 1ELEE 1SLUB 4Q80A 1HBTH 3QZQA 2W7SA 4ISOA 1EOJA 1VITF 4AYVB 1O3OA 2Z6BD 1O2RA 3Q76A 4KTSA 3TJUA 2OC7A 1P2QA 3SJIA 1GJAB 3MHWU 4UONA 4XBBA 2FWWA 4OS1A 3S9BA 4TPIZ 3RXKA 2ZPSA 4INKA 1F0SA 1V2WT 1MTWA 2A7CA 1H8IH 1RTLA 3K6YA 4SGAE 2CMYA 1VCQA 2XXLA 2ALPA 3RXRA 5LPEA 1ZMNA 3MOCA 1IQEA 4BAKB 2AGGX 2QXGA 2R0KA 4CBOA 1WCZA 1UHBB 2WPIS 3ITIA 2V35A 2TGAA 2GMTC 2ZCKP 1AMHA 3QUMP 5FX6A 2QAAA 1TNGA 3M5MA 3M7UA 2VWMA 1LHDH 3PO1C 1E35B 2FXRA 1KLTA 3QZRA 1TNLA 4A1TA 4BAMB 4BAHB 3ODFA 1QJ6B 5JB8S 3JZ2B 3A8DA 1Y5BT 3A81A 1GI9B 1SMFE 1OS8A 3HK3B 3ZVDA 2O8UA 1DVAH 1P9UA 1NTPA 3D62A 4DW2U 3FP7E 1K28D 1ELBA 2H9HA 2AYWA 1FV9A 3R0FA 4MNXA 4B1TA 1O2LA 1WBGB 1Q3XA 1RTKA 2B5TB 2PHBA 2QGRA 5FPSA 2FS9A 3ZZ9A 1QY6A 3QGNB 2FLRH 1EP6A 3LONA 4E05H 3KQEA 1DLKB 3CENA 1DOJA 1E38B 3VB7A 1SQOA 3FVFB 4ABJA 1AFQC 2P8OB 1KTSB 5C67A 1C5LH 3K2UA 1GWAA 1ZHRA 4BXWA 1FZZA 2EC9H 4K3JA 4GSOA 1NFUA 1Q2WA 4JZEH 3DT0H 1AWFH 4AFSA 1O0DH 2RG3A 4FUEA 1BT7A 1W11U 1XKBC 3KQCA 1MMJN 2R2MB 3BN9A 1Z71A 2EI7A 1OOKB 3TJOA 1Y5AT 5CHAC 5I46H 3BTGE 4CREA 4ISHH 1RJXB 1QURH 2Y7XA 3E0PB 4CBNA 4J1YA 1LPGB 4H6SB 3M37A 5BPEA 2EEKA 1HAHH 1GBFA 1SFIA 3SORA 1UTPA 1A5GH 1BA8B 5IYTA 1NFYA 4X1QU 2V3OH 1SGCA 3RXSA 1THPB 3TK5A 2B7DH 1XUKA 1QL8A 2GGVB 1O5DH 3ATMA 1AI8H 3ZZ6A 5E0JA 1TGTA 1Y3VA 2BVXH 3MO3A 1UMAH 3GY3A 4OGYA 4NIYA 4JK5A 2UWPA 2ZGXH 1ZGIA 1GBIA 1C2IA 1MTUA 2H9TH 2V6NA 4U32A 2HRVA 2A7HA 2A1DB 1KXFA 4B75A 5DO4H 3OSYA 1UK2A 1T7CA 1SI5H 1F5RA 3R3GB 1HJAC 3SU2A 1IQMA 1LTOA 1TBQH 6CHAC 1UVUH 1J8AA 1NRNH 1UTOA 3MH5A 2JH6D 1A3EH 4AB8A 3F68H 2BOHB 1AIXH 4B76A 1GJ7B 3TJNA 4NCYA 3D23A 5CE1A 5TCCA 2XRCA 1SOTA 5A0AE 3SJ9A 5GXPA 4VGCB 2SGPE 2B0FA 3TIUA 2VB0A 3S0NA 1W13U 2G00A 2ZEBA 1AUTC 4ZUHA 4IMZA 3KF2A 1ZPBA 2IOTA 1GJ8B 3KHVA 4ZKOU 1G9IE 5A0CA 2HVXA 1ARCA 2XYAA 3MH4A 3SQEE 3MNBA 5DKMA 3IITA 1H9IE 1GDNA 1U6QA 1O2PA 1EXFA 4WH6A 1FY8E 3GY8A 5A09A 4FUJA 3OYPA 5LPRA 1JIRA 1K21H 1Z1IA 4HFPB 3UNRA 1NS3A 1T32A 1EAIA 3BSQA 4H4FA 2ZG0H 3URDA 1JBUH 3SUFA 4YM9A 1BRUP 1FONA 3GOVB 3FFGA 1KSNA 2HOBA 3RXBA 5GWZA 3BG8A 1D3QB 1MZDA 1QRXA 2RDLA 4DG4A 2Z9GA 1WU1A 1O3BA 1YCPM 2AFQB 1L1GA 2FS8A 2BLVA 2W26A 1UK4A 1CT4E 5DP9A 1RD3B 1JWTA 2GD4B 3GY6A 1YGCH 2SGDE 3OX7U 4YOJA 1C1PA 1TRMA 2FOFA 3VGCB 2R2WU 4FXGH 5A0BA 1FPCH 1V2KT 2BD9A 3VB3A 2JH5D 1CBWB 4WF8A 3ELAH 5JDUB 2FX4A 1E37B 3MMGA 3MO6A 3M3TA 4U30A 3EDXB 1GMCF 4FUCA 3RXEA 3SU3A 1RFNA 4Q7YA 1EP5A 4Z6AH 1C2KA 4THNH 1MTVA 1JIMA 1GJCB 2JH0D 2VH6A 1OWHA 1P2KA 3GCNA 1HAVB 3T62A 1BMLA 3NKKA 1GBDA 3O8DA 2FI3E 1TA6A 2WV5A 2ALVA 3GDSA 3I78A 5GCHF 1SC8U 1SGYE 1XUHA 2BQ6B 5ESTE 4UFGH 1D6WA 4A6LA 1XXFA 6GCHG 3E6PH 2CXVA 3CS7A 3UFAA 2STAE 3VFEA 1KXBA 2C3SA 3TPIZ 3BTQE 4JZDH 2ZU3A 1C5ZB 5T6GA 5C3NA 4JCNA 2P3TB 2OXSA 1QA0A 2FESH 2J4IA 2GVFA 4MPXA 4AOQA 1S85A 1WAYB 4NFEA 2PV9B 3EA9A 3SU4A 1ANBA 1B0EA 4HTCH 1ACBE 1GI6A 1GMHG 1O5CB 1TGSZ 1V2OT 2O8WA 4KTCA 4YO9A 4MVNA 1TQ0B 4H6TA 3Q77A 1Z8GA 2WPJS 1AN1E 1EQ9A 1V2QT 4MNWA 1UJ1A 4KKDA 2PGBB 2PKAB 3LJJA 4WXVA 2GMTB 3ZZBA 2FOBA 4NIWA 1AE8H 5A2MH 2FOGA 2FODA 1IQNA 5ETXA 3PMBB 1PPHE 1W2KH 1EAWA 3VPKA 1HAVA 1TX7A 3BTFE 3ZZ7A 1CA0B 3RXTA 2Z3EA 1IHSH 1UTNA 1GHXH 3B23B 4AZ2B 2P8OC 2ZNKH 2CJIA 3EA8A 4ZXXH 3QLPH 2VJ1A 4NA7A 4XE4A 1W8BH 1OSSA 2BVRH 2TGPZ 3W94A 3PMAB 3N7OA 2P3UB 3FZDA 5FXLA 1C5YB 1T8LA 1A61H 3OU0A 1MTNB 1NM6A 3BG4B 3SHCH 1GVKB 3LOXA 7LPRA 1GCDA 1HFDA 1TALA 3LJOA 4FU8A 1GGDB 1UVTH 1EUFA 1ANEA 1AFQB 3QGJA 2FTLE 2PWXA 3TVJB 3PLKA 3U8OH 1F92A 1O31A 5E0GA 1DXWA 4X2VA 1O3KA 2WINI 2BDBA 1XUFA 1RTFB 3ATWA 3U98H 2ANMH 4I31A 5F6MA 3GY2A 3RC5A 1TABE 3A86A 1O3CA 1Y3UA 1ID5H 4FVDA 1GHAF 1OWIA 5EW1H 2ZDNA 1SGEE 3NWUA 1C1UH 4E06H 3A85A 5DP6A 3ESTA 1BB0B 1HAZB 1O3IA 1YPLH 2SGFE 3SUEA 8KME2 1YPKH 1C2LA 1O3AA 4KGAA 1GVZA 4UEHH 4IN1A 3RLWH 1ETSH 5FAHA 3DFLA 4WJG2 2ZPRA 4NA8A 1P2OA 3A7ZA 4E7NA 1YPHE 2M5TA 1EPTB 2VU8E 1TAWA 2XWBI 1TLDA 2BDCA 1A7SA 5EPNA 1W3CA 4GCHG 2TBSA 1GBJA 2YNBA 3RMMH 1FQ3A 2LPRA 3SZNA 2FOEA 4MQAA 1YM0A 4MG3A 2GCHF 1C4U2 1BRBE 1DDJA 1QB1A 3SOSA 1EAUA 4OS6A 1SGFA 3V0XA 2F3CE 2SNVA 3A8AA 1ARBA 1GCTB 3B8JA 1HGTH 1LKAA 1BBRK 1BOQA 1W0YH 3GYLB 4YOIA 3RXOA 5H4IB 4VGCC 3M7QA 4D7GA 1S6HA 2BX4A 1QRWA 1ESAA 4JYUH 4DURA 1V2MT 1HDTH 5JYIA 1GJ6A 1RGQA 1TX6A 1HJ9A 3T25A 2DUCA 3P92A 3TGIE 1GI8B 1O5AB 2WPKS 1NC6A 2YOLA 2A32A 1TGNA 1V2PT 1EPTA 1O3MA 2ILNA 4B2BA 3EA7A 1FUJA 1UVSH 1CQQA 2BY5X 1MD8A 5C20A 2WUCA 3DA9B 1C2DA 4YLUA 5LH8A 1O2HA 5DP4A 1WQSA 1GDQA 1F0TA 3PTBA 5AFYH 5EQRA 1BDAA 1LPZB 3GYMA 3LT3A 1O37A 1AKSB 1SHHB 1BUIA 4XFQA 1P11E 3T5FH 4MPWA 1FIWA 2PGQB 3A8CA 1GI0A 4DIHH 2ZIQH 4UFFH 2BTCE 1EZQA 1NROH 2Z94A 1BTYA 1T8OA 3RXCA 3ZYEA 1SL3A 1SG8B 3LKWA 4Y7AA 5C1XA 2PLXA 2BDIA 4X1PU 3LGUA 2BDAA 3RXDA 3BTKE 1O3NA 5ABWA 2SFAA 1SPJA 1DICA 1BTHH 1CBWC 3RXVA 1SLWB 7ESTE 3UR9A 2QXJA 3MU8A 1IHTH 4X1SU 2ZHWH 3MU5A 5EOKA 1MU6B 2RA0A 3CS0A 5I25A 1TBZH 2FPZA 1LHCH 3PM3A 1AO5A 1DWDH 4FUGA 2ZFPH 4Y8ZA 1NRQH 1ZZZA 1T4VH 1LMWB 5J4QA 4A1XA 5SGAE 4NWLA 2BDHA 1GJ4H 1MTSA 2UUKB 1L4ZA 2C8WB 1JRTA 5EGMA 1SQTA 1NZQH 1H8DH 1G36A 1MU8B 3ZZAA 3E0NB 1ETTH 1QRZA 2ZPQA 5K7RA 1AQ7A 1QNJA 2ZGCA 2ZGBH 1C5QA 1AKSA 3HKIB 4X1NU 3K65B 4Q2KA 1PPBH 4CRGA 2TPIZ 5T3HA 1C1RA 5L2ZH 3I29A 4AB9A 3TNTA 1C2JA 1K1IA 1O3EA 2VIOA 3PV4A 3LC5A 1DY8A 1K9OE 1GBMA 4AG1A 1K1LA 2Z9IA 1P01A 1CA8B 1L0ZA 1LHFH 3ZZDA 1SGPE 1RS0A 3VB6A 2PKSB 3UUZA 1O3LA 1CT2E 3MU1A 2QY0B 1YCPK 3RC6A 2P93A 5F8ZA 4Y0YE 5HMAA 1HAXB 2IJOB 1QR3E 1S6FA 1CSOE 5DP3A 2A31A 3H7OA 3GDUA 3SI4H 3KL6A 3Q3YA 2F91A 2R3YA 2SGEE 3QO6A 2VVCA 1W7XH 1ESBA 2ANWA 4A92A 1QGFA 2J38A 4DGJA 1EJNA 1CA0C 1TNIA 3P8GA 4GLYA 2XTTB 3NPSA 2ZECA 5E2OA 2FP7B 5J4SA 1OXGA 1Z8JB 5L2YH 1WOFA 2P59A 2RA3A 3RM2H 3URCA 3GCHB 4YESB 1A4WH 2BD7A 1O2JA 3BV9B 1HLTH 1UTQA 4NG9H 1QA7A 1THSH 5DGJA 1MTNC 4X8UH 3BG4C 5A8ZA 1UO6A 4K5ZA 5FPTA 3UQVA 4NSYA 2ZQ1A 1UTMA 2ZI2H 1D3DB 2ODPA 1GGDC 1TGCA 4MNYA 2ZDAH 2TGTA 1ZLRA 2GKVE 3JZ1B 1QBOA 5A8XA 1MZAA 1BZXE 1HAIH 1P12E 3A84A 2CN0H 1QIXB 1TPPA 3GICB 3L6PA 1IQFA 1NPMA 1NFWA 2J94A 1VGCB 3T28A 2G8TA 4ZHMU 3TH2H 2VH0A 2B8OH 1XUGA 1TPOA 1V2NT 4FU9A 1GI5A 2UUJB 1MBQA 4ZKRU 2AGEX 3LH3A 5HGGA 4ISLA 3PYHA 1MKWH 3T2NA 1LQDB 1A1RA 3U69H 1UTJA 1NU9A 1DANH 2PR3A 3A89A 1MQ5A 2C8YB 1BCUH 1NO9H 3W95A 3SI3H 1UCYK 3ODDA 4PROA 3LU9B 1BJVA 1V2TT 3LDXH 1K1MA 1YP9A 2C4FH 4X8SH 1G3BA 1QHRB 1C2EA 2NWNA 1EPTC 4D8NA 1CVWH 5ESBA 1DSTA 4H42U 4TPYA 1HXEH 4B2AA 1LQEA 2BQ7B 5C1YA 1P9SA 3BEUA 4ISIH 4X6NA 1W7GH 4AORA 2VWNA 1CHOF 4A5TS 1TMTH 8GCHF 4WY3A 4NGAH 4XBCA 1QQ4A 1S5SA 3L3TA 2Z9LA 1BIOA 1Z7KA 1GHBG 4Y8XA 2BZ6H 4HZHA 3HK6B 3PMHB 4NSVA 2FO9A 2BD4A 2OD3B 3P95A 7GCHF 1XVOA