3PLKA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLLNSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plkA02
2VIWA 1FPCH 1Y5AT 3ZYEA 1KLTA 5AFZH 1MUEB 1UTOA 1ZJKA 5HM2A 1MBQA 1G3BA 1F2SE 1SOZA 3ODFA 3PMAB 2GCTB 2ZDVH 1S85A 2PWXA 5EXMA 3TNSA 1QL7A 1NRPH 2XWAA 2SGEE 3SI3H 3S7HB 4FUCA 3QDZB 2BLOA 3GCNA 1YLDA 2XYAA 1SQTA 1YGCH 3RXMA 1EZXC 1T7CA 1AKSA 2TBSA 1S82A 4E06H 3U8RH 2Z9KA 2F9PA 1ZPBA 2GV7A 2BD4A 1MTSA 3E91A 3HKIB 1GJ9B 1LKAA 1SLWB 2FMJA 2R2WU 1IQLA 1C5PA 2ZTYA 2ZDMA 4Y8XA 1QL8A 3EA7A 1IQIA 4GCHF 3KCGH 1EAXA 2STBE 3ZVBA 1J9CH 2OQ5A 4B75A 3ZZBA 1GBEA 2QXIA 4CBOA 3MO9A 1FLEE 2O8TA 2WPLS 2Z3DA 1C1OA 1ESTA 3NPSA 1HJAB 4RKOB 1E38B 1H8DH 5HM9A 1GVKB 1TONA 3STJA 1HIAA 2GT7A 3TK5A 2JH6D 1HFDA 1UTMA 1NRSH 1O2TA 4Y6DA 1UVSH 2FLRH 4GSOA 1P12E 4SGAE 2P93A 2XRCA 1NFUA 3HGNA 1TALA 2AGIX 1O3IA 2J38A 2OQUA 3M35A 1ID5H 2A45B 2BYAX 3A84A 3ZVAA 4AX9H 4CRCA 1SVPA 1G36A 1S0RA 4WH8A 5TJXA 1MQ5A 2A2XH 1ZRBA 1O2NA 3TGKE 2UWOA 1MZDA 1DT2A 1OWKA 2CHAB 3ZYDA 3BF6H 3RMOH 2G00A 2ZWLH 2NU2E 7GCHG 1JXPA 2PUQH 2UWPA 4HI3A 1Y59T 1ZGIA 2Q1JA 1BRCE 2J34A 1MU6B 2GZ8A 3UTUH 2GX4A 2XNIA 2A4OA 1SHHB 2B7DH 2QYIA 4X1QU 2BX4A 1K1NA 3PO1B 1GI0A 1OP2A 1UO6A 4TY6A 1KLJH 1ZHMA 3SJKA 1KYNA 2ESTE 1WQVH 1LVMA 4UEHH 3V7TA 3VGCB 4ZXYH 2A31A 1ZLRA 2ZHQH 3VPKA 2GMTB 4Q7XA 5DGJA 2ZU2A 1EAWA 3A83A 3F9HA 3SOSA 4ESTE 2FOCA 4MTBA 2P94A 3E0PB 1ELBA 1BTZA 1TRNA 1TGNA 1HYLA 3TVJB 3MNBA 1B7XB 3SJOA 1UMAH 2HNTE 5LGOA 4HZHA 1XMNB 1BJUA 1TGCA 1AFEH 1LVBA 5F6MA 4TPIZ 1NC6A 3RXRA 5FPSA 1HAHH 1SGYE 1O30A 1SG8B 2KAIA 3GICB 5C67A 1KXFA 2SGFE 5BPEA 2ULLA 3VB6A 4Y8YA 1VZQH 1W8BH 2A7CA 4SGBE 3SGBE 3ZVFA 2WYJA 4D7FA 4JZIA 1SGDE 2J92A 3IITA 2ANWA 1K1OA 7ESTE 4DY7B 1DFPA 1S84A 4Y71A 3RM2H 5IYTA 1DVAH 4X0WU 2TIOA 4I32A 1LVYA 3D62A 2F9NA 4Y76A 3KQBA 3UWIA 1KTSB 3QN7A 2A5IA 1RRKA 2VH0A 4DCDA 1V2QT 3E1XB 2FEQH 4K1SA 3T28A 4Y0ZE 4UFGH 1H4WA 3BIUH 3RXPA 1GJAB 1QB6A 1OSSA 1LO6A 1EXFA 3RXSA 6ESTA 2HLCA 1ORFA 1LHDH 3PLKA 1KTTB 1BBRK 3BTEE 1AVWA 3QO6A 5JB8S 4ZKSU 2AMQA 1K1PA 1O3DA 1NRRH 4AYVB 1HAVB 2OD3B 3RP2A 2STAE 1MQ6A 1O2OA 2FOBA 1T8NA 4NWLA 2CJIA 3NCLA 1C5WB 5DP7A 1LDTT 2YNBA 1M9UA 3U69H 1THRH 4BTTB 1C5MD 1K2I1 1QL9A 3LGUA 3BTTE 1O2JA 1ELAA 1EP6A 1LPZB 1VCWA 3H7OA 4LXBH 2A4RA 2XW9A 3U9AH 9ESTA 2FI4E 1ANBA 2FTLE 1SGPE 2PHBA 2G52A 2YOLA 4M7GA 3VB4A 4OS7A 1MTNB 3QGNB 1ELTA 4FU7A 1HNEE 1BUIA 2AIQA 2PR3A 3A87A 1W12U 2C8YB 1WYKA 3E0NB 2ASUB 3Q3YA 4KP0A 3OSYA 1QIXB 4ZKRU 1UJ1A 4NZLA 3C27B 5T3HA 4ISIH 2WV5A 2VIDA 1DSTA 4WY3A 1ABJH 3SV7A 1A5GH 1JWTA 2V6NA 3ZV8A 5EW2H 4TY7A 3MH4A 4BAMB 1MTUA 1C5OH 1UTQA 1ANEA 4IN2A 1DWCH 4Q7YA 2TGAA 5BRRE 3PLBA 2BDIA 2GZ7A 9LPRA 1UTPA 2ZFQH 2Y81A 1NU9A 1FN8A 4DG4A 1KXBA 1QNJA 1O34A 4RSPA 2HPQH 3BTQE 1Y8TA 2C8XB 2AERH 1C2IA 4I8JA 2GD4B 1SFQB 1P2QA 1F5KU 2EI6A 1O5DH 1KDQB 4J2YB 2ZFPH 1H9IE 4KKDA 3QUMP 5B6OA 1XUFA 2R2MB 3AASA 2THFB 2PKAA 2A32A 2XBXA 1C5VA 1ZHRA 4DJZB 1MU8B 2BQWB 1BT7A 1FAKH 4KTCA 3TJUA 3O8DA 5ESTE 1QA7A 1QJ1B 2GV6A 3RXTA 2G8TA 1AIXH 4UONA 1SGFA 1HJ8A 1O2KA 1TQ7B 2ZTZA 1O31A 2BD7A 1VITH 2C90B 3Q00A 4B71A 3A7VA 5HGGA 4E7NA 1TNJA 1GJ6A 2P3FH 2WV4A 4NZQA 3SV9A 1HXEH 5C3NA 1QFKH 1DICA 1ZPCA 3VB7A 2ZU1A 3RXQA 1K9OE 5C1UA 3MH7A 4INHA 1J17T 2ZO3H 1BMNH 1XM1A 4DIIH 4WWYA 4FUBA 1ANCA 5C1YA 1KY9A 3BTME 3RC5A 3VB5A 4WH6A 4INKA 1G2MA 4ABAA 4YOIA 1RJXB 2O9QA 1AN1E 1HDTH 4CH8B 1G30B 1GMCF 3MU5A 3UNRA 5FBEA 1KLIH 5A2MH 1Y3YA 1Z7KA 1ZTJA 1BCUH 1T8MA 1C2MA 3EGKH 5L2ZH 2O8WA 8GCHF 3A88A 1K1IA 1RTFB 3IG6B 1N1LA 4XBCA 2PKSC 2CV3A 3OY5U 3GISB 4Y10E 1AU8A 3RMMH 5TCAA 1OWJA 1WCZA 3BTGE 1O3AA 4O9VA 2H5DA 3TJNA 7LPRA 4JK6A 1BA8B 2JH0D 1UCYK 1T8LA 1H9HE 1J8AA 2XBYA 3HATH 1AFQB 1LHCH 1IAUA 4K2YA 1HUTH 1MKWH 1Y3UA 8ESTE 1NPMA 2H9HA 1W13U 3BTFE 1O5AB 3F9EA 1C4Y2 1EPTB 2V3OH 1XXFA 5GCHG 1TWXB 5T6GA 4GHQA 2IPHA 1Q3XA 3ZZ7A 2JETB 1QRXA 1FY8E 1JMOH 4X8UH 1THSH 1DXPA 3BTWE 1P3EA 1EATA 3QTVH 4BAQB 1RD3B 3TH2H 4A1TA 1O5EH 2P8OC 2BDHA 2VH6A 5E0GA 1EB2A 3MWIU 1OOKB 2BOHB 4AGKA 4Y8ZA 4AB9A 1NU7B 1O35A 3A80A 2GTBA 1KXCA 3ZVGA 1GHAG 3EDXB 4Q7ZA 1WTGH 1GI6A 5DG6A 2FESH 2J95A 2O8MA 4BANB 2QN5T 5ETXA 1YM0A 3S9AA 2ZA5A 3QZQA 1O2LA 2OBQA 4WF8A 1P2NA 2F9BH 1PYTD 1CBWC 1EASA 2DUCA 1V2ST 1LPKB 3OU0A 4UFDH 2PGBB 4UFFH 1ZMNA 5JYIA 2IJOB 2GCHG 4BXWA 2H1UA 4ZAEA 2ZG0H 2RDLA 1DX5M 1GWAA 1Z1JA 2BY9X 4A1XA 1W11U 2GZ9A 1AI8H 1QBNA 1J14A 2Y5FA 2I6QA 2UUFB 1TBQH 2A5AA 3P6ZB 3MU0A 1V2TT 5EQQA 3QWCH 3TK6A 2Z3EA 3BTKE 4CR5A 4KELA 1J16A 1CGHA 3KF2A 1GBCA 1QTFA 1TE0A 4NFEA 1P57B 2BY7X 4CHAC 5LH8A 4YT7H 4NIYA 5IDKA 1C2LA 2ODYB 1CE5A 5JBTA 1EJNA 1NFXA 2J94A 2XCNA 2AFQB 1SLVB 2UUJB 4R0IA 5A8XA 1DSUA 4TPYA 2WPHS 3KN2A 2B9LA 2G55A 1NRNH 3E16B 4GCHG 1BIOA 4B73A 5LPFA 3GCHC 5DP6A 1FY3A 1GBIA 3O8CA 4TWWA 1C4U2 1PQ7A 3K65B 1FY4A 2UUKB 4YLQH 4IMQA 5DO4H 3H7TA 2PLXA 1O3OA 3UWJH 1DM4B 1W10U 2DE8A 1C2EA 1GHBF 4ABJA 2JH5D 1CHGA 1OX1A 3OTJE 3LGYA 3PROA 2BTCE 3K6ZA 2BY8X 1ELCA 3QLPH 2VVVA 1ZJDA 3ELAH 4D9QA 4A7IB 4YZUA 1DANH 1CU1A 1RIWB 1TMBH 1SGRE 3VB3A 2WINI 5TCCA 1LQDB 3BG4B 3PYHA 3U8OH 1LVOA 1SB1H 3GY8A 1ETSH 2BOKA 1F92A 2XCFA 3O8RA 1E35B 3SJ8A 3TIUA 4BAHB 1C5XB 1TB6H 1O3NA 1EZUC 3ZZCA 5DP8A 3TJOA 1TBZH 3D23A 5AHGH 3SJIA 2VIOA 1O2HA 3MI4A 1GJDB 1O2PA 2QA9E 2F83A 1SFIA 5HYOA 4CREA 3OY6U 2FTMA 4A6LA 3UNSA 1ZTLA 1Z6EA 2BD5A 1ELVA 1X7AC 2BHGA 1NZQH 1DY9A 5E8EH 3QZRA 1C9TA 1HXFH 5L2YH 3E8LA 4IN1A 1SOTA 3SU3A 3SW2B 1PPCE 1O38A 2HNTF 1V2OT 2VB0A 2VWLA 2Z7FE 4IS5A 1JIMA 1AUJA 4JCNA 1FONA 2VWNA 2M5TA 1GCTC 2OC1A 1IQMA 3HPTB 2ZI2H 1O3KA 1EJAA 1JIRA 3LJJA 3ZV9A 1AD8H 6CHAB 3SGQE 3P8FA 5HXFA 4A92A 5A8ZA 1Z8IB 2CGAA 1Z6JH 2EI7A 3GDVA 3K9XB 1HJ9A 4IW4E 3TK9A 3LGTA 4DOQA 2TGDA 2WPJS 1Z8GA 1K21H 3EE0B 4VGCC 2ZHEH 2AIPA 1CA8B 4GAWA 2CXVA 5AF9H 1C5QA 1EAIA 2GDDA 1AWFH 1O2QA 1ZSJA 4U32A 1VITF 1BTWA 5A09A 4ISHH 5FCRA 1C2DA 1D6WA 1EAUA 1PPBH 2AYWA 1NN6A 1JRSA 1AWHB 4K3JA 2OC0A 1TNKA 2QXJA 2CN0H 4O3TA 1TQ0B 3LGIA 1GGDC 4X8VH 4TWYA 5F8XA 5I25A 4MNYA 5A8YA 2LPRA 2GGVB 1C1VH 1LHFH 3PMBB 5C2ZA 2H6MA 4X8SH 1DE7H 4K5ZA 3W95A 2QC2A 1P2KA 1C1WH 1N8OB 2ZTXA 5A0CA 2C93B 5FCKA 3FAOA 2Y6TA 1A4WH 1A0HB 1L1GA 2O8UA 1WSSH 1EJMA 2ZU5A 3NWUA 1QGFA 1L4DA 2FIRH 3KL6A 1W2KH 1HAVA 5C5NA 1A5HA 1K1LA 1A2CH 2ZCLP 1CT0E 2QAAA 1LHEH 5EXNA 2ZFSA 3RC6A 1HB0B 2FYQA 2Y5GA 1C4V2 3MU1A 2WUCA 5A0AE 1P2OA 1AB9C 1UVUH 1AZ8A 3B23B 3A7ZA 3RMLH 1ESAA 1TX7A 1QB9A 1GBDA 2OXSA 3ZZ3A 2FI5E 2XWBI 2CF9H 3L33A 2BY6X 2ZCKP 3GCHB 2EEKA 1IQEA 1P11E 2ZPRA 1HAIH 2SGQE 1EUFA 5AVDA 1HGTH 3R3GB 4THNH 1DWEH 1XUKA 3P92A 1MMJN 5CHAB 1PQ5A 4YTAA 3GY6A 3BSQA 5FPYA 2ZPQA 1ABIH 1UHBB 3E90B 4Q2KA 4YM9A 2G81E 1C5NH 5F03A 1O5CB 1IHTH 1FUJA 2F9UA 2OUAA 3CS7A 4B76A 1CA0B 2XXLA 5CMXH 1O3HA 2AEIH 2Z6BD 1C1MA 4AFUA 1KXDA 4XFQA 3AAUA 2OCVB 2OC7A 3A86A 1ESBA 3RU4T 2ZHFH 4Y79A 4X1SU 4IC5A 2NU1E 2PV9B 4O03A 4OGYA 1E0FD 1D3QB 3M3SA 3D65E 4KGAA 1RXPA 1AMHA 4LOYH 3Q76A 1CHOG 1O2UA 2BZ6H 1FNIA 3VEQB 3RXLA 2PUXB 1UK4A 5K0HA 2W5EA 3M7UA 2SGAA 3MO3A 3T27A 3V12A 2FWWA 4ABDA 3M5OA 1CT4E 4DGJA 3ZVDA 1OWEA 4CRDA 4CRFA 2C3SA 2P16A 2OTVA 5DPAA 4ASHA 4FVDA 4AOQA 3DD2H 1F7ZA 2Z3CA 1KDQA 4NFFA 1F5LA 1AVXA 5J4QA 3VXEH 1UTKA 1UVPA 1A3BH 1Z8RA 4PROA 2FPZA 1E36B 1V2MT 1K22H 2HGTH 4X2VA 1C5SA 1O5FH 4CBNA 1BHXF 1TX8A 1KXEA 1O2XA 4DT7B 4NA8A 3SU1A 5FHTA 4GLYA 1PPGE 1Q31A 1LQEA 3A8BA 1YCPK 1BBRE 2F9VA 3SNEA 3SU0A 3TH3H 3UOPA 3VXFH 5PTPA 1V2VT 1AUTC 1OKXA 4I33A 5GDSH 2A0QB 2B0FA 2FX4A 1O3JA 1FIWA 3DA9B 4D9RA 1RGQA 4GVUA 1L1NA 3RLWH 4X6NA 4BOHA 1YPLH 2FM2A 3MNXA 1H9LB 3UIRA 1DOJA 1TNHA 1MTWA 2FS8A 1D3DB 4OGXA 1NFYA 2W7SA 2ANYA 2WYGA 1BDAA 4WMEA 3I29A 1XVOA 5JBCS 1C1PA 2BLVA 3RU4D 4AG2A 3QGJA 2OP9A 1SLXB 4FUEA 1BTXA 1O3PB 1CHOF 1SGCA 3SNDA 1ZMLA 1T8OA 1HLTH 1GL1A 1TX6A 1QR3E 5DKMA 1C1TA 4D76A 1JOUB 3MMGA 1LTOA 2D2DA 1LKBA 2BZAA 4ZHMU 1GMCG 3LDXH 1XKBC 2ZIQH 1GBHA 2EC9H 4WMFA 1L0ZA 3GYLB 2UWLA 3A82A 3F1SB 4MNVA 2ZGBH 4K8BA 1A1RA 1V2WT 2ALVA 1O2YA 1ELFA 5ABWA 3B8JA 8GCHG 1P2IA 1IOEA 1G2LA 2FOAA 3PLPA 1O2IA 1LPGB 4A5TS 3SV2H 3I78A 1C5RA 1B5GH 4ABEA 1GG6C 1UVOA 3KGPA 1AY6H 3LIWA 5DP5A 2FLBH 3LONA 2ZFRH 1W3CA 2W3KA 2BX3A 4HGCA 4JK5A 1V6DA 2SGPE 5EG4A 1VGCC 1C1RA 3KHVA 4CRGA 1GI4A 2VIQA 2VGCC 1H8IH 7KMEH 4BTIB 1TOCB 2PGQB 3A89A 1C1NA 1J15A 2R0LA 2XC0A 3MHWU 4HFPB 2Z9IA 3PV4A 2OBOA 2SNVA 5AFYH 1EPTA 1SQAA 3UFAA 2BDAA 4RKJB 3K2UA 2QV1A 1WOFA 1DLEA 3UQVA 1C2FA 2W26A 4NGAH 1V2RT 4X2YA 3GY5A 2ZEBA 1C2HA 1KIGH 5F8TA 2YNAA 3M37A 3B9FH 2BDYA 4YLUA 4MDSA 5EQSA 2VIVA 3WY8A 1TABE 3SU5A 1D3PB 5DJ7A 4BTUB 5EPYA 2A2QH 4CR9A 5G4BA 3MFJA 4GUXA 1TA6A 4X6PA 2Y82A 1O3MA 3LJOA 1V2NT 1BTHH 3UUZA 1OP8A 2G5NA 3G01A 3BTDE 4NIWA 1YC0A 1P04A 2FOMB 4R8TB 1BBRH 2GCTC 1GMHG 1KSNA 1BRAA 1T32A 1G32B 3E6PH 1YPMH 1IQJA 3VFEA 2Y5HA 1Z8JB 1BTYA 2ZHWH 1XXDA 1C9PA 4ZKNU 1TPAE 1GDNA 1HAZB 4XBBA 2FO9A 3HKJB 5EQRA 4AFQA 1GBJA 4ABBA 1FQ3A 1GI3A 3AVZA 1EKBB 1O2VA 2HWLB 2ILNA 4OS2A 3ZZ4A 3A85A 1PFXC 2AMPA 1SSXA 3SN8A 1HAYB 5E2PA 5E2OA 1V2UT 1CGIE 3JZ2B 3SQHE 1WAYB 2P3UB 1V2PT 2J2UA 4AYYB 4ZHLU 1TPPA 1FMGA 1PYTC 2WPMS 1O3EA 3OX7U 1HAGE 1A7SA 1HV7A 1HJAC 1T31A 3S69A 1JRTA 3SGAE 1EOLA 1S6FA 3DT0H 1UCYE 4CRBA 1EB1H 1MCTA 4E7RG 1GJ4H 2QIQA 3SUFA 1F0RA 1IQHA 2PFEA 4WVPE 4BAKB 1INCA 2ODPA 4XE4A 2G4TA 3M5NA 1GPZA 5F8ZA 1P2JA 2VWOA 3JZ1B 1OWHA 1NROH 1MKXK 4AFZA 1HBTH 1RFNA 3MU8A 3Q3KA 3P8NA 1UVTH 1P06A 4NG9H 6GCHF 2JKHA 1BB0B 2TPIZ 1TBRH 1PQAA 1GMHF 3M5LA 4MPXA 1ACBE 2D26C 1QJ6B 1YLCA 4WMDA 3LPRA 1C1SA 3NKKA 1GHBG 1CSOE 1P10A 2DE9A 1Y3VA 4TYDA 1C5YB 4RN6A 2ZZUH 4F49A 1C1UH 1UTLM 2ZDKA 3L3TA 3ATKA 3LGVA 2CHAC 5HMAA 2H9TH 3F68H 2Y80A 1A46H 1P03A 1TYNA 1NTPA 2VINA 5EU8A 1E34B 2R3UA 3EYDA 1FV9A 1LCYA 1DLKB 2J4IA 2VIPA 3E3TA 2RA0A 2RG3A 5T6FA 3SV6A 4AN7A 2Q6FA 3UR9A 3PO1C 2PW8H 1TPSA 4Q80A 2J9NA 3TJVA 4H42U 3U8TH 2VNTA 1EX3A 2OC8A 1BTUA 1GG6B 2BD8A 3SUEA 3VGCC 3O8BA 3PWCA 1O5BB 1ZYOA 3MNSA 1G3EA 3LT3A 3RXIA 1O36A 3MYWA 1U6QA 1IQKA 1EZQA 1AE5A 3BG8A 3OYPA 3TGIE 4I7YH 4Y11E 3BIVH 1PPEE 1RTKA 1GMDF 2ZKSA 1Q2WA 3MO6A 3GY2A 4OS6A 5DP4A 1OWDA 4BNRA 4ABHA 3EAJA 3DUXH 3M7QA 1ZTKA 4FUHA 1ZZZA 1IQGA 3M3VA 3UR6A 1YPEH 1SPJA 2ZGHA 4NA9H 1F0SA 2XTTB 1UK3A 1NT1A 5EGMA 1SHYA 3ITIA 1HAPH 3MH6A 3QTOH 5FXLA 3GDUA 3SNBA 1GHYH 3MNCA 5E0JA 3SQEE 1GCDA 4UDWH 2V0BA 1ELDE 1FAXA 1GJ5H 2FOEA 4ABIA 1TNLA 3RXUA 1C2KA 2Y7XA 3KQDA 2VU8E 1C2GA 4OS5A 2SGDE 1DITH 3M3TA 1NS3A 3TH4H 1ZRKA 2ANKH 4O97A 3GY3A 3P8GA 4X6MA 4ZMAH 4OS1A 1AO5A 1FIZA 1MD7A 3KQCA 1OPHB 1W7XH 5GWZA 2ZP0H 1VITG 2PKSB 5K7RA 4H6SB 1SI5H 4MQAA 2BD3A 5FBIA 1K28D 3FVFB 4JYVH 2VJ1A 1UCYH 4Y7AA 2FOGA 1L4ZA 2SFAA 1S0QA 3ZZ9A 2W7UA 3SZNA 2HVXA 1O5GH 1O37A 2F9OA 1HAXB 4U30A 2FYRA 1TMTH 3SUDA 3QK1A 4D8NA 1OYQA 3SO3A 1IQNA 2BDBA 3P17H 1OXGA 4JYUH 1GBAA 1YPKH 1ZPZA 1PPZA 1UK2A 1K1JA 2BVSH 1MD8A 5EODA 4MNXA 1XKAC 5EPNA 3RXHA 3UNQA 1FJSA 4XDEA 5FPTA 5GPIB 3RXOA 1BRBE 3TPIZ 5JBBS 3N7OA 2ZDNA 2ZGJA 3A7WA 4FXGH 3RXEA 4I8GA 1TPOA 3FANA 2H2ZA 2P8OB 3PMJA 2BVXH 1QQUA 1ZR0A 1PQ8A 4INLA 4K60A 1C1QA 1MTNC 1MKXH 4MPVA 1AE8H 1XUGA 2F91A 4MVNA 4MG3A 3AAVA 1NO9H 4NIVA 3TNTA 1WUNH 3LC3A 3SU2A 1O0DH 4IMZA 2TRMA 1YCPM 3ZZ6A 1UHBA 1FZZA 6LPRA 1TRMA 4IBLH 1L1JA 2FOHA 2P95A 3A7YA 4ZH8A 3RLYH 1O32A 1F0TA 3UREA 4FUFA 3TGJE 2ZGXH 5DP3A 1CBWB 1MZAA 4B1TA 3K6YA 4FUIA 3BEIB 3KNXA 1Y5BT 4I8LA 1S5SA 2Z9JA 1GJ7B 1V3XA 1A61H 5C5OA 1DUEA 2VVUA 1T4VH 1SL3A 3HK6B 3LKWA 4FU9A 1AKSB 1EOJA 4Y7BA 1AHTH 4JZ1A 2D8WA 3KEEA 3RM0H 1SR5C 2G4UA 1YPJH 4I8KA 3T5FH 1BITA 2WPIS 1TMUH 4JZDH 5JB9S 2NWNA 3GOVB 4B2AA 2FI3E 4AFSA 4CHAB 2F3CE 2Q6DA 2VVCA 3R0FA 1ELEE 1O2ZA 3GCTG 1ZSKA 2BD2A 4HTCH 1P09A 2ZDAH 1YPHE 2NU3E 4K1EA 1C2JA 4OS4A 2R0KA 2A7JA 4IC6A 4CH2B 1O3FA 1TGTA 2C8ZB 3FZDA 1GI9B 1QHRB 1W7GH 2BXUH 2QF0A 2GT8A 2H5CA 2XBWA 1HIAB 1B0FA 4X1NU 5EW1H 1QY6A 3ENSB 2ZHDA 2RA3A 4WJG2 1GHXH 3CP7A 1QJ7B 4H4FA 3M7TA 4F4OC 2Y7ZA 3QX5H 1O2GH 4I31A 3GY4A 1PPHE 2A1DB 2A5KA 2AGEX 1GBFA 2TGPZ 1ZOMA 3RDZA 1P9UA 4AORA 1GBTA 2GKVE 3ATIA 3S0NA 3GYMA 1BRUP 1QURH 2HPPH 2OLGA 3RXDA 7GCHF 2QXGA 2C4FH 1AQ7A 1D9IA 4UE7H 1BMMH 1L2EA 3CS0A 4X6OA 3STIA 1XX9A 4E05H 1N6YA 4Z0KA 3UPEA 4AG1A 1OWIA 1YBWA 3EQ0H 4JZFH 1QBOA 2B5TB 3A8AA 3PMHB 1D4PB 1ARCA 3W94A 2V3HH 4FUJA 5JPMH 1WU1A 4XOJA 2HOBA 1W0ZU 1VJ9U 2SNWA 3A81A 1TNIA 3F9FA 3F6UH 4ZROA 3V0XA 2ZECA 4DIHH 3GCTF 2Q6GA 2QF3A 2ODQA 1TFXA 3S9BA 3LGWA 4X8TH 3RXBA 1MTVA 1MH0A 1GJCB 1BMAA 2PTNA 3BTHE 4U01A 4FUDA 2K1QA 4ZKOU 4X2XA 1H1BA 1UTJA 5GJ4B 3RUOA 1W0YH 3FP6E 2VWMA 3FFGA 3SJ9A 1AFQC 1MAYA 3AW1A 3NK8A 4LZ1H 1QCPA 4JZEH 1O2MA 3ZZDA 1LMWB 1ETTH 1ETRH 3TLOA 4B2BA 1GI1A 2AGGX 3RXAA 1GBMA 2ZFTA 1GBKA 1JBUH 1EPTC 1NY22 2NU0E 1MKWK 1VR1H 1GDQA 3M61U 2BMGB 1WBGB 3P70B 5T6DA 3L6PA 3RXFA 3I77A 2FDAA 2JETC 1GCTB 3RMNH 2ZDLA 2KAIB 2HRVA 3SHAH 3V3MA 1GVLA 3BN9A 5J4SA 1GBLA 1FXYA 2ZGCA 1P8VC 4J1YA 4VGCB 3SNAA 2BQ7B 4KTSA 4YO9A 4X1RU 8LPRA 5FAHA 2QGRA 4ZXXH 1BHXB 2BVRH 1MAXA 2HALA 5C1XA 3GDSA 1G37A 2GDEH 3T29A 3D49H 2H9EH 4ZUHA 1QB1A 1CVWH 1S6HA 2XBVA 1V2JT 1VJAU 5ESBA 3ZZAA 1SGTA 2C8WB 3KQEA 2G51A 4MNWA 1AGJA 1XUJA 3FP7E 1ANDA 1O33A 1TGBA 2PSXA 3MTYA 2IOTA 3A8DA 4K1TA 5GIBA 1YP9A 1O3LA 1FPHH 1YF4A 3ZVEA 1N6XA 1GGDB 1QQ4A 3F9GA 3MU4A 5JDUB 3RXJA 4KTUA 4YOJA 4AB8A 1GI7B 2QY0B 1KXAA 4CRAA 1FI8A 1WV7H 2ZNKH 1SGFG 2ZU3A 1TIOA 4ZHAA 4H6TA 2PTCE 4GHTA 2Z94A 2G5VA 1IQFA 2TGTA 3CENA 4AGJA 4WXIA 3RXVA 3A7XA 4X2WA 4ABGA 1CO7E 3A8CA 4K8YA 4WXVA 1NFWA 1QRWA 2A4GA 3C1KA 1NM6A 3BV9B 4K69A 1DY8A 2W3IA 1QA0A 2LNCA 2BLWA 1O2SA 2ANMH 2I6SA 3PTBA 1RS0A 2QCYA 2CMYA 1XVMA 1AB9B 1BQYA 3HGPA 1P05A 3SU6A 2O8LA 8KME2 2FS9A 1DDJA 1G3CA 2NU4E 5L30H 4DURA 3T26A 3A7TA 4B2CA 2A4QA 2CF8H 1BTPA 3HK3B 1P2MA 5CE1A 1THPB 3NXPA 5GXPA 1GHWH 1SGEE 2ZU4A 3U1JB 3LH3A 2WPKS 1T4UH 3DHKH 4D7GA 1AVGH 2QXHA 4FUGA 3M36A 1D6RA 1A3EH 2IN2A 1GI8B 1MCVA 2UUYA 1TAWA 2WUBA 2B8OH 1GDUA 1RIWC 1Y3WA 1OYTH 1YYY1 4QT8C 3V13A 6GCHG 2BXTH 3BG4C 3EA9A 3LC5A 3PM3A 1O2RA 1V2KT 5I46H 4ISOA 1VCPA 5SGAE 3T25A 4BXSA 2BDCA 3S9CA 3BEUA 4LK4A 1NESE 5A0BA 3ESTA 4ISLA 4JYTA 1DPOA 1ARBA 2BY5X 1HPGA 1G3DA 2GVFA 3SORA 1A0LA 3Q3XA 4IGDA 3RC4A 2EA3A 1K1MA 3URDA 3ATMA 1GHZA 3RXGA 3LH1A 3UQOA 3TU7H 1B0EA 1P3CA 2PKAB 3ZVCA 2EI8A 4UD9H 1GBBA 1GVZA 1FY5A 2AMDA 1GL0E 1YCPH 3RXCA 1BMLA 2ZCHP 1SBWA 1YKTA 1TA2A 4X1PU 5EOKA 1O2WA 1XUHA 4BAOB 1ZMJA 2BB4A 4NCYA 2A7HA 3DFJA 3MOCA 2R9PA 3LOXA 3M5MA 3MH5A 1A5IA 3SUGA 1SGQE 1EQ9A 2R3YA 1EZSC 3SI4H 3U1IB 3KIDU 1TLDA 2ZFFH 1P9SA 1C5UA 4Y0YE 1S83A 2FOFA 1WTHD 3S7KB 4YOGA 1CT2E 2P59A 1E37B 2BD9A 1ELGA 1GJ8B 1GMDG 2ALPA 1QRZA 4UFEH 6CHAC 3PWBA 1C5ZB 4DW2U 3P8OA 3PTNA 2AS9A 1FY1A 1SGIB 5L6NH 1O39A 1S81A 2GP9B 1QBVH 1DXWA 2XC4A 1SQOA 1YPHC 2Z9LA 1O3BA 1FN6A 1O3CA 4U2WA 3URCA 2P3TB 3U98H 1TOMH 1ZGVA 3ATWA 1GHVH 1ZSLA 3RXKA 3DFLA 4GPGA 3RU4E 4Z6AH 1G9IE 1TNGA 3ATLA 1D3TB 2BDGA 1P02A 1WQSA 3FZZA 4MLFB 1HCGA 1PPFE 1GI5A 1A0JA 3GCOA 4NSYA 4YT6H 5FX6A 1HAOH 4MPUA 4YESB 2HNTC 4NWKA 4JMYA 4LZ4B 2BLQA 5C20A 3LU9B 2ZPSA 4XBDA 3UOUA 2Z9GA 4MPWA 1OS8A 2D1JA 1PJPA 1NRQH 3Q77A 1RTLA 2V35A 3ZZ5A 4DVAU 1ZHPA 3NUMA 5E0HA 4AZ2B 3FP8E 1TGSZ 1SGNE 2ZC9H 1BZXE 2FX6A 1N8OC 4NIXA 1Z1IA 4ABFA 1C5TA 2GMTC 3ODDA 5JBAS 3ZZ8A 1SC8U 1LHGH 4ISNA 3SNCA 2ZQ1A 4FVBA 2RCEA 1VGCB 5GCHF 1SMFE 3GY7A 2VGCB 1DUAA 1Z71A 5DP9A 1XUIA 5H4IB 1Y3XA 5LPRA 2AH4X 2FODA 2FZZA 2XC5A 1TRYA 4XSKU 3BEFB 1YPGH 4O3UA 1DWDH 5DK1A 1CGJE 1MBMA 1BJVA 5EXLA 4A1VA 1DWBH 2PSYA 2OINA 1OP0A 4I8HA 1GHAF 3AW0A 1DS2E 4B74A 1EP5A 1C5LH 1P0SH 3NZIA 1BOQA 1AZZA 2ZQ2A 1F0UA 1GJBB 1HRTH 1Y5UT 3IWMA 4FU8A 1FDPA 1IHSH 3SBKA 3SHCH 2BQ6B 3H5CB 5CHAC 1SLUB 3SV8A 1GI2A 1V2LT 2BM2A 5FX5A 3T2NA 2FXRA 3PB1E 3UY9A 1UTNA 4NA7A 5LPEA 1F5RA 2ZF0H 1W14U 1CQQA 3EA8A 1CA0C 4NSVA 3TITA 2FP7B 3P95A 2GCHF 1O3GA 3T62A 1P01A 1VCQA 3SU4A
chains in the Genus database with same CATH superfamily
2VIWA 1FPCH 1Y5AT 3ZYEA 1KLTA 1QZ8A 5AFZH 1MUEB 1UTOA 1ZJKA 5HM2A 1MBQA 1G3BA 1F2SE 1SOZA 5HIYA 3ODFA 3PMAB 2GCTB 2ZDVH 1S85A 2PWXA 5EXMA 3TNSA 1QL7A 1NRPH 2XWAA 2SGEE 3SI3H 2KX4A 3S7HB 4FUCA 3QDZB 2BLOA 3GCNA 1YLDA 2XYAA 1SQTA 1YGCH 3RXMA 1EZXC 1T7CA 1AKSA 2TBSA 1S82A 4E06H 3U8RH 2Z9KA 2F9PA 2OK5A 1ZPBA 4ZCNA 2GV7A 2BD4A 1MTSA 3E91A 3WWBA 3HKIB 1GJ9B 1LKAA 1SLWB 2FMJA 2R2WU 1IQLA 1C5PA 2ZTYA 2ZDMA 2J98B 4Y8XA 1QL8A 3EA7A 1IQIA 2K0QA 4GCHF 3KCGH 1EAXA 2STBE 3ZVBA 1J9CH 1H8HD 2OQ5A 4B75A 3ZZBA 1GBEA 2QXIA 4CBOA 3MO9A 1FLEE 2O8TA 2WPDD 2WPLS 2Z3DA 1C1OA 1ESTA 3NPSA 1HJAB 4RKOB 1E38B 1H8DH 5HM9A 1GVKB 1TONA 3STJA 1HIAA 2GT7A 3TK5A 2JH6D 1HFDA 1UTMA 3PV5A 1NRSH 1O2TA 4Y6DA 5F53A 2F4LA 1UVSH 2FLRH 4GSOA 1P12E 4SGAE 2P93A 4YXWD 2XRCA 1NFUA 3HGNA 4F55A 1TALA 2AGIX 1O3IA 2J38A 2OQUA 3M35A 1ID5H 2A45B 2BYAX 3A84A 3ZVAA 4AX9H 4CRCA 1SVPA 1G36A 1S0RA 4WH8A 5TJXA 1MQ5A 2A2XH 1ZRBA 1O2NA 3TGKE 2UWOA 1MZDA 1DT2A 1OWKA 2CHAB 3ZYDA 3BF6H 3RMOH 2G00A 2ZWLH 2NU2E 7GCHG 3FO8D 1JXPA 2PUQH 2UWPA 4HI3A 3KYFA 1Y59T 1ZGIA 2Q1JA 1BRCE 2J34A 1MU6B 2GZ8A 3UTUH 5C94A 2GX4A 2V3MA 4HG6A 2XNIA 2A4OA 1SHHB 2B7DH 2QYIA 4X1QU 2BX4A 1K1NA 3PO1B 1GI0A 1OP2A 1UO6A 4TY6A 1KLJH 1ZHMA 3SJKA 1KYNA 2ESTE 1WQVH 1LVMA 4UEHH 3V7TA 3VGCB 4ZXYH 2A31A 1ZLRA 2ZHQH 3VPKA 2GMTB 4Q7XA 5DGJA 2ZU2A 2F43B 1EAWA 3A83A 3F9HA 3SOSA 4ESTE 2FOCA 4MTBA 2P94A 3F0PA 1NBMD 3E0PB 1ELBA 1BTZA 1TRNA 1TGNA 1HYLA 3TVJB 3MNBA 1B7XB 3SJOA 1UMAH 2HNTE 5LGOA 4HZHA 1XMNB 1BJUA 1TGCA 1AFEH 1LVBA 5F6MA 4TPIZ 1NC6A 3RXRA 5FPSA 1HAHH 1SGYE 1O30A 1SG8B 2KAIA 3GICB 5C67A 1KXFA 2SGFE 5BPEA 2ULLA 3VB6A 4Y8YA 1VZQH 1W8BH 2A7CA 4SGBE 3SGBE 3ZVFA 2WYJA 4D7FA 3H09A 4JZIA 1SGDE 2J92A 3IITA 2ANWA 1K1OA 7ESTE 4DY7B 1DFPA 1S84A 4Y71A 3RM2H 5IYTA 1DVAH 4X0WU 2TIOA 4I32A 1LVYA 3D62A 2F9NA 4Y76A 3KQBA 3UWIA 1KTSB 3QN7A 2A5IA 1RRKA 2VH0A 4DCDA 1V2QT 3E1XB 2FEQH 4K1SA 3T28A 5EJLA 5DN6D 4Y0ZE 4UFGH 1H4WA 3BIUH 3RXPA 1GJAB 1QB6A 1OSSA 1LO6A 1EXFA 3RXSA 6ESTA 2HLCA 1ORFA 1LHDH 3PLKA 1KTTB 1BBRK 3BTEE 1AVWA 3QO6A 5JB8S 4ZKSU 2AMQA 1K1PA 1O3DA 1NRRH 4AYVB 1HAVB 2OD3B 3RP2A 2STAE 1MQ6A 1O2OA 3CNRA 2FOBA 1T8NA 4NWLA 2CJIA 3NCLA 1C5WB 5DP7A 1LDTT 2YNBA 1M9UA 3U69H 1THRH 4BTTB 1C5MD 1K2I1 1QL9A 3LGUA 3BTTE 1O2JA 2JJ2D 1ELAA 1EP6A 1LPZB 1VCWA 3H7OA 4LXBH 2A4RA 2XW9A 3U9AH 9ESTA 2FI4E 1ANBA 2FTLE 1FX0B 1SGPE 2PHBA 3DSGA 2G52A 2YOLA 4M7GA 3VB4A 4OS7A 2KZ4A 1MTNB 3QGNB 1ELTA 4FU7A 1HNEE 1BUIA 2AIQA 2PR3A 3A87A 1W12U 2C8YB 1WYKA 3E0NB 2ASUB 3Q3YA 4KP0A 3OSYA 1QIXB 4ZKRU 1H8ED 1UJ1A 4NZLA 3C27B 5T3HA 4ISIH 2WV5A 2VIDA 1DSTA 4WY3A 1ABJH 3SV7A 1A5GH 1JWTA 2V6NA 2EY4C 3ZV8A 5EW2H 4FOUC 4TY7A 3MH4A 4BAMB 1MTUA 1C5OH 1UTQA 1ANEA 4IN2A 1DWCH 3DCLA 5GNDA 4Q7YA 2TGAA 5BRRE 3N7DA 3PLBA 2BDIA 2GZ7A 9LPRA 1UTPA 2ZFQH 2Y81A 1NU9A 1FN8A 4DG4A 1KXBA 4M9FA 1QNJA 1O34A 4RSPA 2HPQH 3BTQE 1Y8TA 2C8XB 2AERH 1C2IA 4I8JA 4Z1MD 2GD4B 1SFQB 1P2QA 2CK3D 1F5KU 2EI6A 1O5DH 3PRBA 1KDQB 4J2YB 2ZFPH 1H9IE 4KKDA 3QUMP 5B6OA 1XUFA 2R2MB 3AASA 2THFB 2PKAA 2A32A 2XBXA 1C5VA 1ZHRA 4DJZB 1MU8B 2BQWB 1BT7A 1FAKH 4KTCA 3TJUA 3O8DA 5ESTE 1QA7A 1QJ1B 2GV6A 3OEHD 3RXTA 2G8TA 1AIXH 4UONA 1SGFA 1HJ8A 1O2KA 1TQ7B 5CHBA 2ZTZA 1O31A 2BD7A 1VITH 2C90B 3Q00A 4B71A 3A7VA 5HGGA 4E7NA 1TNJA 5KEDA 1GJ6A 2P3FH 3KQ5A 2WV4A 4NZQA 3SV9A 1HXEH 5C3NA 1QFKH 1DICA 1ZPCA 3VB7A 2ZU1A 3RXQA 1K9OE 1E79D 5C1UA 3MH7A 4INHA 1J17T 2ZO3H 1BMNH 1XM1A 4DIIH 4WWYA 4FUBA 1ANCA 5C1YA 1KY9A 3BTME 3RC5A 3VB5A 4WH6A 4INKA 1G2MA 4ABAA 4YOIA 1RJXB 2O9QA 1AN1E 1HDTH 4CH8B 1G30B 1GMCF 3MU5A 3UNRA 5FBEA 1KLIH 5A2MH 1Y3YA 1Z7KA 1ZTJA 1BCUH 1T8MA 1C2MA 3EGKH 5L2ZH 2O8WA 3DSPA 8GCHF 3A88A 1K1IA 1RTFB 3IG6B 1N1LA 4XBCA 2PKSC 2CV3A 3OY5U 3GISB 2HLDD 4Y10E 1AU8A 3RMMH 5TCAA 1OWJA 1WCZA 3BTGE 1O3AA 4O9VA 4Q4LA 2H5DA 3TJNA 7LPRA 4JK6A 1BA8B 2JH0D 1UCYK 1T8LA 1H9HE 1J8AA 2XBYA 3HATH 1AFQB 1LHCH 1IAUA 4K2YA 1HUTH 1MKWH 1Y3UA 8ESTE 1NPMA 2H9HA 1W13U 3BTFE 2EQNA 1O5AB 3F9EA 1YWUA 1C4Y2 1EPTB 2V3OH 1XXFA 5GCHG 1TWXB 5T6GA 4GHQA 3GS9A 2IPHA 1Q3XA 3ZZ7A 2JETB 1QRXA 1FY8E 1JMOH 4X8UH 1THSH 1DXPA 3BTWE 1P3EA 1EATA 3QTVH 4BAQB 1RD3B 3TH2H 4A1TA 1O5EH 2P8OC 2BDHA 2VH6A 5E0GA 1EB2A 3MWIU 5IK2D 1OOKB 2BOHB 4AGKA 4Y8ZA 4AB9A 1NU7B 1O35A 3A80A 2GTBA 1KXCA 3ZVGA 1GHAG 3EDXB 4Q7ZA 1WTGH 1GI6A 2IPQX 5DG6A 2FESH 2J95A 2O8MA 4BANB 2QN5T 5ETXA 1YM0A 3S9AA 2ZA5A 3QZQA 1O2LA 2OBQA 2K8IA 4WF8A 1P2NA 2F9BH 1PYTD 1CBWC 1EASA 2DUCA 1V2ST 1LPKB 3OU0A 4UFDH 2PGBB 2KCAA 4UFFH 2YMSC 1ZMNA 5JYIA 4P02A 2IJOB 4FETA 2GCHG 4BXWA 2H1UA 4ZAEA 2ZG0H 2RDLA 2L6OA 1DX5M 1GWAA 1Z1JA 2BY9X 4A1XA 1W11U 2RFKC 2GZ9A 1AI8H 1QBNA 1J14A 2Y5FA 2I6QA 2UUFB 1TBQH 2A5AA 3MQKC 3P6ZB 3MU0A 1V2TT 5EQQA 3QWCH 3TK6A 2Z3EA 3BTKE 4CR5A 4KELA 1J16A 1CGHA 3KF2A 1GBCA 1QTFA 1TE0A 4NFEA 4ASUD 1P57B 2BY7X 4CHAC 5LH8A 4YT7H 4NIYA 5IDKA 3WW7A 1C2LA 2ODYB 1CE5A 5JBTA 1EJNA 1NFXA 2J94A 2J98A 2XCNA 2AFQB 1SLVB 2UUJB 4R0IA 5A8XA 2GJGA 1DSUA 4TPYA 1YLNA 2WPHS 3KN2A 2B9LA 2L74A 2G55A 1NRNH 3E16B 4GCHG 1BIOA 4B73A 3FKSD 2PP6A 5LPFA 3GCHC 5DP6A 1FY3A 1GBIA 3O8CA 4TWWA 1C4U2 1PQ7A 3K65B 1FY4A 2UUKB 4YLQH 4IMQA 5DO4H 3H7TA 2KCPA 2PLXA 1O3OA 3UWJH 1DM4B 1W10U 2DE8A 4TT3D 1C2EA 1GHBF 4ABJA 2JH5D 1CHGA 1OX1A 3OTJE 3LGYA 3PROA 2BTCE 3K6ZA 2BY8X 3FN8A 1ELCA 3QLPH 2VVVA 1ZJDA 3ELAH 4D9QA 4A7IB 4YZUA 1DANH 1CU1A 1RIWB 1TMBH 1SGRE 3VB3A 2WINI 4OM9A 5TCCA 1LQDB 3BG4B 3PYHA 3U8OH 1LVOA 1SB1H 3GY8A 1ETSH 2BOKA 1F92A 2XCFA 3O8RA 1E35B 3SJ8A 3TIUA 4BAHB 1C5XB 1TB6H 1O3NA 1EZUC 3ZZCA 5DP8A 3TJOA 1TBZH 5EJZA 3D23A 2WSSD 5AHGH 3SJIA 2VIOA 1O2HA 3MI4A 1GJDB 1O2PA 2QA9E 5DSFA 2QE7D 2F83A 1SFIA 5HYOA 4CREA 3OY6U 2FTMA 4A6LA 3UB0A 3UNSA 1ZTLA 1Z6EA 2BD5A 1ELVA 1X7AC 2BHGA 1NZQH 1DY9A 5E8EH 3QZRA 1C9TA 1HXFH 5L2YH 3E8LA 4IN1A 1SOTA 3SU3A 3SW2B 1PPCE 1O38A 3AK5A 2HNTF 1V2OT 2VB0A 2VWLA 2Z7FE 4IS5A 1JIMA 1AUJA 4JCNA 1FONA 2VWNA 2M5TA 1GCTC 2OC1A 1IQMA 3HPTB 2ZI2H 1O3KA 1EJAA 1JIRA 4I86A 3LJJA 3ZV9A 1AD8H 4ACBA 6CHAB 3SGQE 3P8FA 5HXFA 4A92A 5A8ZA 1Z8IB 2CGAA 1Z6JH 2EI7A 3GDVA 3K9XB 3U28C 1HJ9A 4IW4E 3TK9A 3LGTA 4DOQA 2TGDA 2AHME 2WPJS 1Z8GA 1K21H 3EE0B 4VGCC 2ZHEH 2AIPA 1CA8B 4GAWA 2CXVA 5AF9H 1C5QA 1EAIA 2GDDA 1AWFH 1O2QA 1ZSJA 4U32A 1VITF 1BTWA 5A09A 4ISHH 5FCRA 1C2DA 1D6WA 1EAUA 1PPBH 3F2FA 2AYWA 1NN6A 1JRSA 5EIYA 1AWHB 4K3JA 2OC0A 1TNKA 2QXJA 2CN0H 4O3TA 1TQ0B 3LGIA 1GGDC 4X8VH 4TWYA 5F8XA 5I25A 1W0JD 4MNYA 5A8YA 2LPRA 2GGVB 1C1VH 1LHFH 3PMBB 5C2ZA 2H6MA 4X8SH 1DE7H 4K5ZA 3W95A 2QC2A 1P2KA 1C1WH 1N8OB 2ZTXA 5A0CA 2C93B 5FCKA 3FAOA 2Y6TA 1A4WH 1A0HB 1L1GA 2O8UA 1WSSH 1EJMA 2ZU5A 3NWUA 1QGFA 1L4DA 2FIRH 3KL6A 1W2KH 1HAVA 5C5NA 1A5HA 1K1LA 1A2CH 2ZCLP 1CT0E 2QAAA 1LHEH 4TSFD 5EXNA 2ZFSA 3RC6A 1HB0B 2FYQA 2Y5GA 1C4V2 3MU1A 2WUCA 5A0AE 5HKKD 1P2OA 1AB9C 1UVUH 1AZ8A 3B23B 3A7ZA 1E1RD 1ESAA 1TX7A 3RMLH 1QB9A 1GBDA 2OXSA 3ZZ3A 2FI5E 2XWBI 2CF9H 2JIZD 3L33A 2BY6X 2ZCKP 3GCHB 2EEKA 1IQEA 1P11E 2ZPRA 4P00A 1HAIH 2SGQE 1EUFA 5AVDA 5C17A 1OHHD 1HGTH 3R3GB 4THNH 1DWEH 1XUKA 3P92A 1MMJN 5CHAB 1PQ5A 4YTAA 3GY6A 3BSQA 5FPYA 2ZPQA 1KMHB 1ABIH 1UHBB 3E90B 4Q2KA 4YM9A 2G81E 1C5NH 5F03A 1O5CB 1IHTH 1FUJA 2F9UA 2OUAA 3CS7A 4B76A 1CA0B 2XXLA 4DT4A 5CMXH 1O3HA 2AEIH 2Z6BD 1C1MA 4AFUA 1KXDA 4XFQA 3AAUA 2OCVB 2OC7A 3A86A 1ESBA 2XNDD 3RU4T 3ZIAD 2ZHFH 4Y79A 4X1SU 4IC5A 2NU1E 4F48B 2PV9B 4O03A 4OGYA 1E0FD 1D3QB 3M3SA 3D65E 4KGAA 1RXPA 1AMHA 4LOYH 3Q76A 1CHOG 1O2UA 2BZ6H 1FNIA 3VEQB 3RXLA 2PUXB 1UK4A 5K0HA 5C0TA 2W5EA 3M7UA 2SGAA 3MO3A 3T27A 3V12A 2FWWA 4ABDA 3M5OA 1CT4E 4DGJA 3ZVDA 1OWEA 4CRDA 4CRFA 2C3SA 2P16A 2OTVA 5DPAA 4ASHA 4FVDA 4AOQA 3DD2H 1K0HA 1F7ZA 2Z3CA 1KDQA 4NFFA 1F5LA 1AVXA 5J4QA 3VXEH 1UTKA 1UVPA 1A3BH 1Z8RA 4PROA 2FPZA 1E36B 1V2MT 1K22H 2HGTH 4X2VA 1C5SA 1O5FH 4CBNA 1BHXF 1TX8A 1KXEA 1O2XA 4DT7B 4NA8A 3SU1A 5FHTA 4GLYA 1PPGE 1Q31A 1LQEA 3A8BA 1YCPK 1BBRE 2F9VA 3SNEA 3SU0A 3TH3H 3UOPA 3VXFH 5PTPA 1V2VT 1AUTC 1OKXA 4I33A 5GDSH 2A0QB 2B0FA 2FX4A 1O3JA 1FIWA 3DA9B 4D9RA 1RGQA 4GVUA 1L1NA 3RLWH 4X6NA 4BOHA 1YPLH 2FM2A 3MNXA 1H9LB 3UIRA 1DOJA 3F2HA 1TNHA 1MTWA 2FS8A 1D3DB 4OGXA 1NFYA 2W7SA 2ANYA 2WYGA 1BDAA 4WMEA 3I29A 1XVOA 5JBCS 1C1PA 2BLVA 3RU4D 4AG2A 3QGJA 2OP9A 1SLXB 4FUEA 1BTXA 2KFWA 1O3PB 1CHOF 1SGCA 3SNDA 1ZMLA 1T8OA 1HLTH 1GL1A 1TX6A 1QR3E 5DKMA 1C1TA 4D76A 1JOUB 3MMGA 1LTOA 2D2DA 1LKBA 2BZAA 4ZHMU 1GMCG 3LDXH 1XKBC 2ZIQH 1GBHA 2EC9H 4WMFA 1L0ZA 3GYLB 2WZQA 2UWLA 3A82A 3F1SB 4MNVA 2ZGBH 4K8BA 1A1RA 1V2WT 2ALVA 1O2YA 1ELFA 5ABWA 3B8JA 8GCHG 1P2IA 1IOEA 1G2LA 2FOAA 3DSOA 1O2IA 1LPGB 3PLPA 4A5TS 3SV2H 3I78A 1C5RA 1B5GH 4ABEA 1GG6C 1UVOA 3KGPA 1AY6H 3LIWA 5DP5A 2FLBH 3LONA 4Q63A 2ZFRH 1W3CA 2W3KA 2BX3A 4HGCA 4JK5A 1V6DA 2SGPE 5EG4A 1VGCC 3KYGA 1C1RA 3KHVA 4CRGA 1GI4A 2VIQA 2VGCC 1H8IH 7KMEH 4BTIB 1TOCB 2PGQB 3A89A 1C1NA 1J15A 2R0LA 2XC0A 3OAAD 3MHWU 4HFPB 2Z9IA 3PV4A 2OBOA 2QF4A 2SNVA 5AFYH 1EPTA 1SQAA 3UFAA 2BDAA 4RKJB 3K2UA 2QV1A 1WOFA 1NBME 1DLEA 3UQVA 1C2FA 2W26A 4NGAH 1V2RT 3UAIC 3PV2A 4X2YA 3GY5A 2ZEBA 1C2HA 1KIGH 5F8TA 2KM0A 2YNAA 2W6ID 3M37A 5EJ1A 3B9FH 2BDYA 4YLUA 4MDSA 5EQSA 2VIVA 3WY8A 1TABE 3SU5A 1D3PB 5DJ7A 4BTUB 5EPYA 2A2QH 4CR9A 5G4BA 3MFJA 4GUXA 1TA6A 4X6PA 2Y82A 4AC9A 1O3MA 3LJOA 3PRDA 1V2NT 1BTHH 3UUZA 1SKYE 1OP8A 2G5NA 3G01A 3BTDE 4NIWA 1YC0A 1P04A 2FOMB 4R8TB 1BBRH 2GCTC 1GMHG 1KSNA 3EE7A 4RI0A 1BRAA 1T32A 1G32B 3E6PH 1YPMH 1IQJA 3VFEA 2Y5HA 1Z8JB 1BTYA 2ZHWH 1XXDA 1C9PA 1VKYA 4ZKNU 1TPAE 1GDNA 1HAZB 4XBBA 2FO9A 3HKJB 5EQRA 4AFQA 1GBJA 4ABBA 1FQ3A 1GI3A 3AVZA 1EKBB 1O2VA 2HWLB 2ILNA 4OS2A 3ZZ4A 3A85A 1PFXC 2AMPA 1SSXA 3SN8A 1HAYB 5E2PA 5E2OA 1V2UT 1CGIE 3JZ2B 3SQHE 1WAYB 2P3UB 1V2PT 2J2UA 4AYYB 4ZHLU 1TPPA 1FMGA 1PYTC 3OE7D 2WPMS 1O3EA 3OX7U 1HAGE 1A7SA 1HV7A 1HJAC 1T31A 3S69A 1JRTA 3SGAE 1EOLA 1S6FA 3DT0H 1UCYE 4CRBA 1EB1H 1MCTA 4E7RG 1GJ4H 2QIQA 3SUFA 1F0RA 1IQHA 2PFEA 4WVPE 4BAKB 1INCA 2ODPA 4XE4A 2G4TA 3M5NA 1GPZA 5F8ZA 1P2JA 2VWOA 3JZ1B 1OWHA 1NROH 1MKXK 4AFZA 1HBTH 1RFNA 3MU8A 3Q3KA 3P8NA 1UVTH 2JJ1D 1P06A 4NG9H 6GCHF 1W0KD 2JKHA 1BB0B 5KGOA 2TPIZ 1TBRH 1PQAA 1GMHF 3M5LA 4MPXA 1ACBE 2D26C 1QJ6B 1YLCA 4WMDA 3LPRA 1C1SA 3NKKA 1GHBG 1CSOE 1P10A 2DE9A 1Y3VA 4TYDA 1C5YB 4RN6A 2ZZUH 4F49A 1C1UH 1UTLM 2ZDKA 3L3TA 3ATKA 3LGVA 2CHAC 4XRNA 5HMAA 2H9TH 1EFRD 3F68H 2Y80A 1A46H 1P03A 1BMFD 1TYNA 4RT1A 1NTPA 2VINA 5EU8A 1E34B 2R3UA 3EYDA 1FV9A 1LCYA 1DLKB 2IJD1 2J4IA 2VIPA 3E3TA 2RA0A 2RG3A 5T6FA 2W6JD 3SV6A 4AN7A 3F0OA 2Q6FA 3UR9A 3PO1C 2PW8H 1TPSA 4Q80A 2J9NA 3TJVA 4H42U 3U8TH 2VNTA 1EX3A 2OC8A 1BTUA 1GG6B 2BD8A 3SUEA 3VGCC 3O8BA 3PWCA 1O5BB 1ZYOA 3MNSA 1G3EA 3LT3A 3RXIA 1O36A 3MYWA 1U6QA 2JDID 1IQKA 1EZQA 2M2AA 1AE5A 3BG8A 3OYPA 3TGIE 4I7YH 4Y11E 3BIVH 1PPEE 1RTKA 1GMDF 3N7EA 2ZKSA 1Q2WA 3MO6A 3GY2A 4OS6A 5DP4A 5C0UA 1OWDA 4BNRA 1YY3A 4ABHA 3EAJA 3DUXH 3M7QA 1ZTKA 4FUHA 1ZZZA 1IQGA 3M3VA 3UR6A 1YPEH 1SPJA 2ZGHA 4NA9H 1F0SA 2XTTB 1UK3A 1NT1A 5EGMA 5T1VA 1SHYA 3ITIA 1HAPH 3MH6A 3QTOH 5FXLA 3GDUA 3NRLA 1GHYH 3MNCA 5E0JA 3SNBA 3SQEE 1GCDA 4UDWH 2V0BA 1ELDE 1WXRA 1FAXA 1GJ5H 2FOEA 4ABIA 3FOAA 1TNLA 3RXUA 1C2KA 2Y7XA 3KQDA 2VU8E 1C2GA 4OS5A 2SGDE 1DITH 3M3TA 1NS3A 3TH4H 1ZRKA 2ANKH 4O97A 3GY3A 2V7QD 3P8GA 4X6MA 4ZMAH 4OS1A 1AO5A 1FIZA 1MD7A 3KQCA 1OPHB 1W7XH 5GWZA 2ZP0H 1VITG 2PKSB 5K7RA 4H6SB 1SI5H 4MQAA 2BD3A 5FBIA 1K28D 3FVFB 4JYVH 2VJ1A 1UCYH 4Y7AA 2FOGA 1L4ZA 2SFAA 1S0QA 3ZZ9A 2W7UA 3SZNA 2HVXA 3OEED 5CDFE 1O5GH 1O37A 2F9OA 1HAXB 4U30A 2FYRA 1TMTH 3SUDA 3QK1A 4D8NA 1OYQA 1SQRA 3SO3A 1IQNA 2BDBA 3P17H 1OXGA 4JYUH 1GBAA 1YPKH 1ZPZA 1PPZA 1UK2A 1K1JA 2BVSH 1MD8A 2KR7A 5EODA 4MNXA 1XKAC 5EPNA 3RXHA 3UNQA 1FJSA 4XDEA 5FPTA 5GPIB 3RXOA 1BRBE 3TPIZ 5JBBS 3N7OA 2ZDNA 2ZGJA 3A7WA 4FXGH 3RXEA 4I8GA 1S6LA 1TPOA 3FANA 2H2ZA 2P8OB 3PMJA 2BVXH 1QQUA 1ZR0A 1PQ8A 3WWFA 4INLA 4K60A 1C1QA 1MTNC 1MKXH 4MPVA 1AE8H 1XUGA 2F91A 4MVNA 4MG3A 3AAVA 1NO9H 4NIVA 3TNTA 1WUNH 3LC3A 3SU2A 1O0DH 4IMZA 2TRMA 1YCPM 3ZZ6A 1UHBA 1FZZA 6LPRA 1TRMA 4IBLH 1L1JA 2FOHA 2P95A 3A7YA 4ZH8A 3RLYH 1O32A 1F0TA 3UREA 4FUFA 1COWD 3TGJE 2ZGXH 5DP3A 1CBWB 1MZAA 4B1TA 1UW7A 3K6YA 4FUIA 3BEIB 3KNXA 1Y5BT 2YMSB 4I8LA 1S5SA 2Z9JA 1WDIA 1GJ7B 1V3XA 1A61H 5C5OA 1DUEA 2VVUA 2KCYA 1T4VH 1SL3A 3HK6B 3LKWA 4FU9A 1AKSB 1EOJA 4Y7BA 1AHTH 4JZ1A 2D8WA 3KEEA 3RM0H 1SR5C 2G4UA 1YPJH 4I8KA 3T5FH 1BITA 2WPIS 1TMUH 2HVYB 4JZDH 5JB9S 2NWNA 3GOVB 4B2AA 2FI3E 4AFSA 4CHAB 2F3CE 2Q6DA 2VVCA 3R0FA 1ELEE 1O2ZA 3GCTG 1ZSKA 2BD2A 4HTCH 1P09A 2ZDAH 1YPHE 2NU3E 4K1EA 1C2JA 4OS4A 2R0KA 2A7JA 4IC6A 4CH2B 1O3FA 2KCOA 1TGTA 2C8ZB 3FZDA 1GI9B 1QHRB 1W7GH 2BXUH 4ACAA 2QF0A 2GT8A 2H5CA 2XBWA 1HIAB 1B0FA 4X1NU 5EW1H 4B6FA 1QY6A 3ENSB 2ZHDA 2RA3A 4WJG2 1GHXH 3CP7A 1QJ7B 4H4FA 3M7TA 4F4OC 2Y7ZA 3QX5H 1O2GH 4I31A 3SZEA 3GY4A 1PPHE 2A1DB 2A5KA 2AGEX 1GBFA 2TGPZ 1ZOMA 2RDEA 3RDZA 1P9UA 5B6LA 4AORA 1GBTA 2GKVE 3ATIA 3S0NA 3GYMA 1BRUP 1QURH 2HPPH 2OLGA 3RXDA 7GCHF 2QXGA 2C4FH 1AQ7A 1D9IA 4UE7H 1BMMH 1L2EA 3CS0A 4X6OA 3STIA 3F3BA 1XX9A 4E05H 1N6YA 4Z0KA 3UPEA 4AG1A 1OWIA 1YBWA 3EQ0H 1MABB 4JZFH 1QBOA 2B5TB 3A8AA 3PMHB 1D4PB 1ARCA 3W94A 2V3HH 4FUJA 5JPMH 1WU1A 4XOJA 2HOBA 1W0ZU 1VJ9U 2SNWA 3A81A 1TNIA 3F9FA 3F6UH 4ZROA 5KECA 3V0XA 2ZECA 4DIHH 3OTPA 3GCTF 2Q6GA 2QF3A 2ODQA 4B6EA 1TFXA 3S9BA 3LGWA 4X8TH 3RXBA 1MTVA 1MH0A 1GJCB 1BMAA 2PTNA 3BTHE 4U01A 4FUDA 2K1QA 4ZKOU 4X2XA 1H1BA 1UTJA 5GJ4B 3RUOA 1W0YH 3FP6E 2VWMA 3FFGA 3SJ9A 1AFQC 1MAYA 3AW1A 3NK8A 4LZ1H 1QCPA 4JZEH 1O2MA 3ZZDA 1LMWB 1ETTH 1ETRH 3TLOA 4B2BA 1GI1A 2AGGX 3RXAA 1GBMA 2ZFTA 1GBKA 1JBUH 1EPTC 1NY22 2NU0E 1MKWK 2LP6A 1VR1H 1GDQA 3M61U 2BMGB 1WBGB 3P70B 5T6DA 3L6PA 3RXFA 3I77A 2FDAA 2JETC 1GCTB 3RMNH 2ZDLA 2KAIB 2HRVA 3SHAH 3V3MA 1GVLA 3SYJA 3F2GA 3BN9A 5J4SA 1GBLA 1FXYA 2ZGCA 1P8VC 4J1YA 4XD7D 4VGCB 3SNAA 2BQ7B 4KTSA 4YO9A 4X1RU 8LPRA 5FAHA 2QGRA 4ZXXH 1BHXB 2BVRH 1MAXA 2HALA 5C1XA 3GDSA 1G37A 2GDEH 3T29A 3D49H 2H9EH 4ZUHA 1QB1A 1CVWH 1S6HA 2XBVA 1V2JT 1VJAU 5ESBA 3ZZAA 1SGTA 2C8WB 3KQEA 2G51A 4MNWA 1AGJA 1XUJA 3FP7E 1ANDA 1O33A 1TGBA 2PSXA 3MTYA 2IOTA 3A8DA 4K1TA 5GIBA 1YP9A 1O3LA 1FPHH 1YF4A 3ZVEA 1N6XA 1GGDB 1QQ4A 3F9GA 3MU4A 5JDUB 3RXJA 4KTUA 4YOJA 4AB8A 1GI7B 2QY0B 1KXAA 4CRAA 1FI8A 1WV7H 2ZNKH 1E1QD 1SGFG 2ZU3A 1TIOA 4ZHAA 4H6TA 2PTCE 4GHTA 2Z94A 2G5VA 1IQFA 2WV9A 2TGTA 3CENA 4AGJA 4WXIA 3RXVA 3VG8A 3A7XA 4X2WA 4ABGA 1CO7E 3A8CA 4K8YA 4WXVA 1NFWA 1QRWA 2A4GA 3C1KA 1NM6A 3BV9B 4K69A 1DY8A 2W3IA 1QA0A 2LNCA 2BLWA 2J97A 1O2SA 2ANMH 2I6SA 3PTBA 1RS0A 2QCYA 2CMYA 1XVMA 1AB9B 1BQYA 3HGPA 1P05A 3SU6A 2O8LA 8KME2 2FS9A 1DDJA 1G3CA 2NU4E 5L30H 4DURA 3T26A 3A7TA 4B2CA 2A4QA 2CF8H 1BTPA 3HK3B 1P2MA 5CE1A 5HIZA 1THPB 3NXPA 5GXPA 1GHWH 1SGEE 2ZU4A 3U1JB 3LH3A 2WPKS 1T4UH 3DHKH 4D7GA 1AVGH 2QXHA 4FUGA 3M36A 1D6RA 1A3EH 2IN2A 1GI8B 1MCVA 2UUYA 1TAWA 2WUBA 2B8OH 1GDUA 1RIWC 1Y3WA 1OYTH 1YYY1 4QT8C 3V13A 6GCHG 2BXTH 3BG4C 3EA9A 3LC5A 3PM3A 1O2RA 1V2KT 5I46H 4ISOA 1VCPA 5SGAE 3T25A 4BXSA 2BDCA 3S9CA 3BEUA 4LK4A 1NESE 5A0BA 3ESTA 4ISLA 4JYTA 1DPOA 1ARBA 2BY5X 1HPGA 1G3DA 2GVFA 3SORA 1A0LA 2WHXA 3Q3XA 4IGDA 3RC4A 2EA3A 1K1MA 3URDA 3ATMA 1GHZA 3RXGA 3LH1A 3UQOA 3TU7H 1B0EA 1P3CA 2PKAB 3ZVCA 5FL7D 2EI8A 4UD9H 1GBBA 1GVZA 1FY5A 2AMDA 1GL0E 1YCPH 3RXCA 1BMLA 2ZCHP 1SBWA 1YKTA 1TA2A 4X1PU 5EOKA 1O2WA 1XUHA 4BAOB 1ZMJA 2BB4A 4NCYA 2A7HA 3DFJA 3MOCA 2R9PA 3LOXA 3M5MA 3MH5A 1A5IA 3SUGA 1SGQE 1EQ9A 2R3YA 1EZSC 3SI4H 3U1IB 3KIDU 1TLDA 2ZFFH 1P9SA 1C5UA 4Y0YE 3W1EA 1S83A 2FOFA 1WTHD 3S7KB 4YOGA 1CT2E 2P59A 1E37B 2BD9A 1ELGA 1GJ8B 1GMDG 2ALPA 1QRZA 4UFEH 6CHAC 3PWBA 1C5ZB 4DW2U 3P8OA 3PTNA 2AS9A 1FY1A 1SGIB 5L6NH 1O39A 1S81A 3OFND 2GP9B 1QBVH 1DXWA 2XC4A 1SQOA 1YPHC 2Z9LA 1O3BA 1FN6A 1O3CA 4U2WA 3URCA 2P3TB 3U98H 1TOMH 1ZGVA 3ATWA 1GHVH 1ZSLA 3RXKA 3DFLA 4GPGA 3RU4E 4Z6AH 1G9IE 1TNGA 3ATLA 1D3TB 2BDGA 1P02A 1WQSA 2LELA 3FZZA 4MLFB 1HCGA 1PPFE 1GI5A 1A0JA 3GCOA 4NSYA 4YT6H 5FX6A 1HAOH 4MPUA 4YESB 2HNTC 4NWKA 4JMYA 4LZ4B 2BLQA 5C20A 3LU9B 2ZPSA 4XBDA 3UOUA 2Z9GA 4MPWA 1OS8A 2D1JA 1PJPA 3N99A 1NRQH 3Q77A 1RTLA 2V35A 3ZZ5A 4DVAU 1ZHPA 3NUMA 5E0HA 4AZ2B 3FP8E 1TGSZ 1SGNE 2ZC9H 1BZXE 2FX6A 1N8OC 4NIXA 1Z1IA 4ABFA 1C5TA 2GMTC 3ODDA 5JBAS 3ZZ8A 1SC8U 1LHGH 4ISNA 3SNCA 2ZQ1A 4FVBA 2RCEA 1VGCB 5GCHF 1SMFE 3GY7A 2VGCB 1DUAA 1Z71A 5DP9A 1XUIA 5H4IB 1Y3XA 5LPRA 2AH4X 2FODA 2FZZA 2XC5A 1TRYA 4XSKU 3BEFB 1YPGH 4O3UA 1DWDH 5DK1A 1CGJE 1MBMA 1BJVA 2YMSD 5EXLA 4A1VA 1DWBH 2PSYA 2OINA 1OP0A 4I8HA 1GHAF 3AW0A 1DS2E 4B74A 1EP5A 2XOKD 2QF5A 1C5LH 1P0SH 3NZIA 1BOQA 1AZZA 2ZQ2A 1F0UA 1GJBB 1HRTH 1Y5UT 3IWMA 4FU8A 1FDPA 1IHSH 3SBKA 3SHCH 2BQ6B 4RT0A 3H5CB 5CHAC 1SLUB 3SV8A 1GI2A 1V2LT 2BM2A 2VBCA 5FX5A 3T2NA 2FXRA 3PB1E 3UY9A 1UTNA 4NA7A 5LPEA 1F5RA 2ZF0H 1W14U 1CQQA 3EA8A 1CA0C 4NSVA 3TITA 2FP7B 3P95A 2GCHF 1O3GA 3T62A 2J5UA 1P01A 1VCQA 3SU4A
chains in the Genus database with same CATH topology
2VIWA 1FPCH 1Y5AT 3ZYEA 1KLTA 5AFZH 1MUEB 1UTOA 1ZJKA 5HM2A 1MBQA 1G3BA 1F2SE 1SOZA 3ODFA 3PMAB 2GCTB 2ZDVH 1S85A 2PWXA 5EXMA 3TNSA 1QL7A 1NRPH 2XWAA 2SGEE 3SI3H 3S7HB 4FUCA 3QDZB 2BLOA 3GCNA 1YLDA 2XYAA 1SQTA 1YGCH 3RXMA 1EZXC 1T7CA 1AKSA 2TBSA 1S82A 4E06H 3U8RH 2Z9KA 2F9PA 1ZPBA 2GV7A 2BD4A 1MTSA 3E91A 3HKIB 1GJ9B 1LKAA 1SLWB 2FMJA 2R2WU 1IQLA 1C5PA 2ZTYA 2ZDMA 4Y8XA 1QL8A 3EA7A 1IQIA 4GCHF 3KCGH 1EAXA 2STBE 3ZVBA 1J9CH 2OQ5A 4B75A 3ZZBA 1GBEA 2QXIA 4CBOA 3MO9A 1FLEE 2O8TA 2WPLS 2Z3DA 1C1OA 1ESTA 3NPSA 1HJAB 4RKOB 1E38B 1H8DH 5HM9A 1GVKB 1TONA 3STJA 1HIAA 2GT7A 3TK5A 2JH6D 1HFDA 1UTMA 1NRSH 1O2TA 4Y6DA 1UVSH 2FLRH 4GSOA 1P12E 4SGAE 2P93A 2XRCA 1NFUA 3HGNA 1TALA 2AGIX 1O3IA 2J38A 2OQUA 3M35A 1ID5H 2A45B 2BYAX 3A84A 3ZVAA 4AX9H 4CRCA 1SVPA 1G36A 1S0RA 4WH8A 5TJXA 1MQ5A 2A2XH 1ZRBA 1O2NA 3TGKE 2UWOA 1MZDA 1DT2A 1OWKA 2CHAB 3ZYDA 3BF6H 3RMOH 2G00A 2ZWLH 2NU2E 7GCHG 1JXPA 2PUQH 2UWPA 4HI3A 1Y59T 1ZGIA 2Q1JA 1BRCE 2J34A 1MU6B 2GZ8A 3UTUH 2GX4A 2XNIA 2A4OA 1SHHB 2B7DH 2QYIA 4X1QU 2BX4A 1K1NA 3PO1B 1GI0A 1OP2A 1UO6A 4TY6A 1KLJH 1ZHMA 3SJKA 1KYNA 2ESTE 1WQVH 1LVMA 4UEHH 3V7TA 3VGCB 4ZXYH 2A31A 1ZLRA 2ZHQH 3VPKA 2GMTB 4Q7XA 5DGJA 2ZU2A 1EAWA 3A83A 3F9HA 3SOSA 4ESTE 2FOCA 4MTBA 2P94A 3E0PB 1ELBA 1BTZA 1TRNA 1TGNA 1HYLA 3TVJB 3MNBA 1B7XB 3SJOA 1UMAH 2HNTE 5LGOA 4HZHA 1XMNB 1BJUA 1TGCA 1AFEH 1LVBA 5F6MA 4TPIZ 1NC6A 3RXRA 5FPSA 1HAHH 1SGYE 1O30A 1SG8B 2KAIA 3GICB 5C67A 1KXFA 2SGFE 5BPEA 2ULLA 3VB6A 4Y8YA 1VZQH 1W8BH 2A7CA 4SGBE 3SGBE 3ZVFA 2WYJA 4D7FA 4JZIA 1SGDE 2J92A 3IITA 2ANWA 1K1OA 7ESTE 4DY7B 1DFPA 1S84A 4Y71A 3RM2H 5IYTA 1DVAH 4X0WU 2TIOA 4I32A 1LVYA 3D62A 2F9NA 4Y76A 3KQBA 3UWIA 1KTSB 3QN7A 2A5IA 1RRKA 2VH0A 4DCDA 1V2QT 3E1XB 2FEQH 4K1SA 3T28A 4Y0ZE 4UFGH 1H4WA 3BIUH 3RXPA 1GJAB 1QB6A 1OSSA 1LO6A 1EXFA 3RXSA 6ESTA 2HLCA 1ORFA 1LHDH 3PLKA 1KTTB 1BBRK 3BTEE 1AVWA 3QO6A 5JB8S 4ZKSU 2AMQA 1K1PA 1O3DA 1NRRH 4AYVB 1HAVB 2OD3B 3RP2A 2STAE 1MQ6A 1O2OA 2FOBA 1T8NA 4NWLA 2CJIA 3NCLA 1C5WB 5DP7A 1LDTT 2YNBA 1M9UA 3U69H 1THRH 4BTTB 1C5MD 1K2I1 1QL9A 3LGUA 3BTTE 1O2JA 1ELAA 1EP6A 1LPZB 1VCWA 3H7OA 4LXBH 2A4RA 2XW9A 3U9AH 9ESTA 2FI4E 1ANBA 2FTLE 1SGPE 2PHBA 2G52A 2YOLA 4M7GA 3VB4A 4OS7A 1MTNB 3QGNB 1ELTA 4FU7A 1HNEE 1BUIA 2AIQA 2PR3A 3A87A 1W12U 2C8YB 1WYKA 3E0NB 2ASUB 3Q3YA 4KP0A 3OSYA 1QIXB 4ZKRU 1UJ1A 4NZLA 3C27B 5T3HA 4ISIH 2WV5A 2VIDA 1DSTA 4WY3A 1ABJH 3SV7A 1A5GH 1JWTA 2V6NA 3ZV8A 5EW2H 4TY7A 3MH4A 4BAMB 1MTUA 1C5OH 1UTQA 1ANEA 4IN2A 1DWCH 4Q7YA 2TGAA 5BRRE 3PLBA 2BDIA 2GZ7A 9LPRA 1UTPA 2ZFQH 2Y81A 1NU9A 1FN8A 4DG4A 1KXBA 1QNJA 1O34A 4RSPA 2HPQH 3BTQE 1Y8TA 2C8XB 2AERH 1C2IA 4I8JA 2GD4B 1SFQB 1P2QA 1F5KU 2EI6A 1O5DH 1KDQB 4J2YB 2ZFPH 1H9IE 4KKDA 3QUMP 5B6OA 1XUFA 2R2MB 3AASA 2THFB 2PKAA 2A32A 2XBXA 1C5VA 1ZHRA 4DJZB 1MU8B 2BQWB 1BT7A 1FAKH 4KTCA 3TJUA 3O8DA 5ESTE 1QA7A 1QJ1B 2GV6A 3RXTA 2G8TA 1AIXH 4UONA 1SGFA 1HJ8A 1O2KA 1TQ7B 2ZTZA 1O31A 2BD7A 1VITH 2C90B 3Q00A 4B71A 3A7VA 5HGGA 4E7NA 1TNJA 1GJ6A 2P3FH 2WV4A 4NZQA 3SV9A 1HXEH 5C3NA 1QFKH 1DICA 1ZPCA 3VB7A 2ZU1A 3RXQA 1K9OE 5C1UA 3MH7A 4INHA 1J17T 2ZO3H 1BMNH 1XM1A 4DIIH 4WWYA 4FUBA 1ANCA 5C1YA 1KY9A 3BTME 3RC5A 3VB5A 4WH6A 4INKA 1G2MA 4ABAA 4YOIA 1RJXB 2O9QA 1AN1E 1HDTH 4CH8B 1G30B 1GMCF 3MU5A 3UNRA 5FBEA 1KLIH 5A2MH 1Y3YA 1Z7KA 1ZTJA 1BCUH 1T8MA 1C2MA 3EGKH 5L2ZH 2O8WA 8GCHF 3A88A 1K1IA 1RTFB 3IG6B 1N1LA 4XBCA 2PKSC 2CV3A 3OY5U 3GISB 4Y10E 1AU8A 3RMMH 5TCAA 1OWJA 1WCZA 3BTGE 1O3AA 4O9VA 2H5DA 3TJNA 7LPRA 4JK6A 1BA8B 2JH0D 1UCYK 1T8LA 1H9HE 1J8AA 2XBYA 3HATH 1AFQB 1LHCH 1IAUA 4K2YA 1HUTH 1MKWH 1Y3UA 8ESTE 1NPMA 2H9HA 1W13U 3BTFE 1O5AB 3F9EA 1C4Y2 1EPTB 2V3OH 1XXFA 5GCHG 1TWXB 5T6GA 4GHQA 2IPHA 1Q3XA 3ZZ7A 2JETB 1QRXA 1FY8E 1JMOH 4X8UH 1THSH 1DXPA 3BTWE 1P3EA 1EATA 3QTVH 4BAQB 1RD3B 3TH2H 4A1TA 1O5EH 2P8OC 2BDHA 2VH6A 5E0GA 1EB2A 3MWIU 1OOKB 2BOHB 4AGKA 4Y8ZA 4AB9A 1NU7B 1O35A 3A80A 2GTBA 1KXCA 3ZVGA 1GHAG 3EDXB 4Q7ZA 1WTGH 1GI6A 5DG6A 2FESH 2J95A 2O8MA 4BANB 2QN5T 5ETXA 1YM0A 3S9AA 2ZA5A 3QZQA 1O2LA 2OBQA 4WF8A 1P2NA 2F9BH 1PYTD 1CBWC 1EASA 2DUCA 1V2ST 1LPKB 3OU0A 4UFDH 2PGBB 4UFFH 1ZMNA 5JYIA 2IJOB 2GCHG 4BXWA 2H1UA 4ZAEA 2ZG0H 2RDLA 1DX5M 1GWAA 1Z1JA 2BY9X 4A1XA 1W11U 2GZ9A 1AI8H 1QBNA 1J14A 2Y5FA 2I6QA 2UUFB 1TBQH 2A5AA 3P6ZB 3MU0A 1V2TT 5EQQA 3QWCH 3TK6A 2Z3EA 3BTKE 4CR5A 4KELA 1J16A 1CGHA 3KF2A 1GBCA 1QTFA 1TE0A 4NFEA 1P57B 2BY7X 4CHAC 5LH8A 4YT7H 4NIYA 5IDKA 1C2LA 2ODYB 1CE5A 5JBTA 1EJNA 1NFXA 2J94A 2XCNA 2AFQB 1SLVB 2UUJB 4R0IA 5A8XA 1DSUA 4TPYA 2WPHS 3KN2A 2B9LA 2G55A 1NRNH 3E16B 4GCHG 1BIOA 4B73A 5LPFA 3GCHC 5DP6A 1FY3A 1GBIA 3O8CA 4TWWA 1C4U2 1PQ7A 3K65B 1FY4A 2UUKB 4YLQH 4IMQA 5DO4H 3H7TA 2PLXA 1O3OA 3UWJH 1DM4B 1W10U 2DE8A 1C2EA 1GHBF 4ABJA 2JH5D 1CHGA 1OX1A 3OTJE 3LGYA 3PROA 2BTCE 3K6ZA 2BY8X 1ELCA 3QLPH 2VVVA 1ZJDA 3ELAH 4D9QA 4A7IB 4YZUA 1DANH 1CU1A 1RIWB 1TMBH 1SGRE 3VB3A 2WINI 5TCCA 1LQDB 3BG4B 3PYHA 3U8OH 1LVOA 1SB1H 3GY8A 1ETSH 2BOKA 1F92A 2XCFA 3O8RA 1E35B 3SJ8A 3TIUA 4BAHB 1C5XB 1TB6H 1O3NA 1EZUC 3ZZCA 5DP8A 3TJOA 1TBZH 3D23A 5AHGH 3SJIA 2VIOA 1O2HA 3MI4A 1GJDB 1O2PA 2QA9E 2F83A 1SFIA 5HYOA 4CREA 3OY6U 2FTMA 4A6LA 3UNSA 1ZTLA 1Z6EA 2BD5A 1ELVA 1X7AC 2BHGA 1NZQH 1DY9A 5E8EH 3QZRA 1C9TA 1HXFH 5L2YH 3E8LA 4IN1A 1SOTA 3SU3A 3SW2B 1PPCE 1O38A 2HNTF 1V2OT 2VB0A 2VWLA 2Z7FE 4IS5A 1JIMA 1AUJA 4JCNA 1FONA 2VWNA 2M5TA 1GCTC 2OC1A 1IQMA 3HPTB 2ZI2H 1O3KA 1EJAA 1JIRA 3LJJA 3ZV9A 1AD8H 6CHAB 3SGQE 3P8FA 5HXFA 4A92A 5A8ZA 1Z8IB 2CGAA 1Z6JH 2EI7A 3GDVA 3K9XB 1HJ9A 4IW4E 3TK9A 3LGTA 4DOQA 2TGDA 2WPJS 1Z8GA 1K21H 3EE0B 4VGCC 2ZHEH 2AIPA 1CA8B 4GAWA 2CXVA 5AF9H 1C5QA 1EAIA 2GDDA 1AWFH 1O2QA 1ZSJA 4U32A 1VITF 1BTWA 5A09A 4ISHH 5FCRA 1C2DA 1D6WA 1EAUA 1PPBH 2AYWA 1NN6A 1JRSA 1AWHB 4K3JA 2OC0A 1TNKA 2QXJA 2CN0H 4O3TA 1TQ0B 3LGIA 1GGDC 4X8VH 4TWYA 5F8XA 5I25A 4MNYA 5A8YA 2LPRA 2GGVB 1C1VH 1LHFH 3PMBB 5C2ZA 2H6MA 4X8SH 1DE7H 4K5ZA 3W95A 2QC2A 1P2KA 1C1WH 1N8OB 2ZTXA 5A0CA 2C93B 5FCKA 3FAOA 2Y6TA 1A4WH 1A0HB 1L1GA 2O8UA 1WSSH 1EJMA 2ZU5A 3NWUA 1QGFA 1L4DA 2FIRH 3KL6A 1W2KH 1HAVA 5C5NA 1A5HA 1K1LA 1A2CH 2ZCLP 1CT0E 2QAAA 1LHEH 5EXNA 2ZFSA 3RC6A 1HB0B 2FYQA 2Y5GA 1C4V2 3MU1A 2WUCA 5A0AE 1P2OA 1AB9C 1UVUH 1AZ8A 3B23B 3A7ZA 3RMLH 1ESAA 1TX7A 1QB9A 1GBDA 2OXSA 3ZZ3A 2FI5E 2XWBI 2CF9H 3L33A 2BY6X 2ZCKP 3GCHB 2EEKA 1IQEA 1P11E 2ZPRA 1HAIH 2SGQE 1EUFA 5AVDA 1HGTH 3R3GB 4THNH 1DWEH 1XUKA 3P92A 1MMJN 5CHAB 1PQ5A 4YTAA 3GY6A 3BSQA 5FPYA 2ZPQA 1ABIH 1UHBB 3E90B 4Q2KA 4YM9A 2G81E 1C5NH 5F03A 1O5CB 1IHTH 1FUJA 2F9UA 2OUAA 3CS7A 4B76A 1CA0B 2XXLA 5CMXH 1O3HA 2AEIH 2Z6BD 1C1MA 4AFUA 1KXDA 4XFQA 3AAUA 2OCVB 2OC7A 3A86A 1ESBA 3RU4T 2ZHFH 4Y79A 4X1SU 4IC5A 2NU1E 2PV9B 4O03A 4OGYA 1E0FD 1D3QB 3M3SA 3D65E 4KGAA 1RXPA 1AMHA 4LOYH 3Q76A 1CHOG 1O2UA 2BZ6H 1FNIA 3VEQB 3RXLA 2PUXB 1UK4A 5K0HA 2W5EA 3M7UA 2SGAA 3MO3A 3T27A 3V12A 2FWWA 4ABDA 3M5OA 1CT4E 4DGJA 3ZVDA 1OWEA 4CRDA 4CRFA 2C3SA 2P16A 2OTVA 5DPAA 4ASHA 4FVDA 4AOQA 3DD2H 1F7ZA 2Z3CA 1KDQA 4NFFA 1F5LA 1AVXA 5J4QA 3VXEH 1UTKA 1UVPA 1A3BH 1Z8RA 4PROA 2FPZA 1E36B 1V2MT 1K22H 2HGTH 4X2VA 1C5SA 1O5FH 4CBNA 1BHXF 1TX8A 1KXEA 1O2XA 4DT7B 4NA8A 3SU1A 5FHTA 4GLYA 1PPGE 1Q31A 1LQEA 3A8BA 1YCPK 1BBRE 2F9VA 3SNEA 3SU0A 3TH3H 3UOPA 3VXFH 5PTPA 1V2VT 1AUTC 1OKXA 4I33A 5GDSH 2A0QB 2B0FA 2FX4A 1O3JA 1FIWA 3DA9B 4D9RA 1RGQA 4GVUA 1L1NA 3RLWH 4X6NA 4BOHA 1YPLH 2FM2A 3MNXA 1H9LB 3UIRA 1DOJA 1TNHA 1MTWA 2FS8A 1D3DB 4OGXA 1NFYA 2W7SA 2ANYA 2WYGA 1BDAA 4WMEA 3I29A 1XVOA 5JBCS 1C1PA 2BLVA 3RU4D 4AG2A 3QGJA 2OP9A 1SLXB 4FUEA 1BTXA 1O3PB 1CHOF 1SGCA 3SNDA 1ZMLA 1T8OA 1HLTH 1GL1A 1TX6A 1QR3E 5DKMA 1C1TA 4D76A 1JOUB 3MMGA 1LTOA 2D2DA 1LKBA 2BZAA 4ZHMU 1GMCG 3LDXH 1XKBC 2ZIQH 1GBHA 2EC9H 4WMFA 1L0ZA 3GYLB 2UWLA 3A82A 3F1SB 4MNVA 2ZGBH 4K8BA 1A1RA 1V2WT 2ALVA 1O2YA 1ELFA 5ABWA 3B8JA 8GCHG 1P2IA 1IOEA 1G2LA 2FOAA 3PLPA 1O2IA 1LPGB 4A5TS 3SV2H 3I78A 1C5RA 1B5GH 4ABEA 1GG6C 1UVOA 3KGPA 1AY6H 3LIWA 5DP5A 2FLBH