2OLGA

Crystal structure of the serine protease domain of prophenoloxidase activating factor-i in a zymogen form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
276
Chain Sequence
RNRRPELLPNDCGYQVEADKILNGDDTVPEEFPWTAMIGYKNSSNFEQFACGGSLINNRYIVTAAHCVAGRVLRVVGALNKVRLGEWNTATDPDCYGAVRVCVPDKPIDLGIEETIQHPDYVDGSKDRYHDIALIRLNRQVEFTNYIRPVCLPQPNEEVQVGQRLTVVGWGRTETGQYSTIKQKLAVPVVHAEQCAKTFGAAGVRVRSSQLCAGGEKAKDSCGGDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRDWIEGNIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the serine protease domain of prophenoloxidase activating factor-I
pubmed doi rcsb
source organism Holotrichia diomphalia
molecule tags Hydrolase
molecule keywords Pro-phenoloxidase activating enzyme-I
total genus 66
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA01
1BBRH 1BHXB 5FBIA 2BDAA 4FU7A 3A8DA 3TJNA 2AGIX 1RTLA 5DP4A 1PPHE 1YPLH 1TRMA 4BAMB 3UWIA 2BD9A 3KEEA 1HXFH 3E91A 3EGKH 1D3DB 2CMYA 1HAOH 1ZTLA 5FBEA 3FZDA 3D62A 1A0HB 1AZZA 3V12A 1GJAB 3EA9A 3KF2A 1GPZA 1YP9A 1CU1A 1O2KA 4DIIH 2HOBA 1C4Y2 1TRYA 3BF6H 2RDLA 3QTVH 1SGTA 1GCTB 3TGIE 1VR1H 2ZGHA 3OU0A 3SJOA 3M7UA 1O3FA 1Y3VA 3O8CA 4D7GA 1CA0C 5EW2H 5DO4H 1TGSZ 3M3SA 1IQFA 4UFFH 4AGJA 2O8MA 1C1PA 1O2LA 2A2XH 5FX6A 7LPRA 2A4OA 3M61U 1O5CB 1O3AA 1G36A 1HJAC 2FMJA 1V2NT 4YO9A 4WF8A 4O3UA 4CRDA 3RXIA 3A7TA 1KDQB 1LPGB 3ODDA 1SGQE 1O31A 1V2UT 1FONA 1EUFA 5I46H 1ELCA 5E8EH 2BB4A 4RKOB 4UEHH 3FP6E 1PPBH 4ABAA 1C5XB 1SGFG 1GJ8B 1DICA 3PLPA 1FQ3A 2Y5GA 5EXLA 1TX6A 4ISHH 5IYTA 4SGBE 4Q2KA 5TCCA 3U8RH 5F8XA 1KXFA 1V2RT 4CRAA 1PPZA 2RCEA 1GBFA 1EASA 1F2SE 1FY1A 1MQ6A 4OS2A 2PWXA 3M35A 1BDAA 1Z6JH 2OLGA 4CBOA 1UMAH 2G8TA 2BQ6B 2UUFB 2AMQA 1NO9H 3DFJA 3S7HB 1NRPH 5FPYA 1ZZZA 4I8JA 4FUHA 1SGPE 2GDEH 1HGTH 5DP9A 1SGEE 2FP7B 2HPPH 1WAYB 2TGAA 2UWPA 5FAHA 1LVBA 1HAVA 3GDUA 1B7XB 3ZV9A 2BY6X 3AW1A 1BMMH 1A5HA 1INCA 2HNTE 4X1QU 4B2BA 2RA3A 3PMHB 5DP7A 1MTSA 2DE9A 5F8ZA 1EJNA 3OSYA 2FX4A 2ZKSA 1YCPK 1XVMA 2ZFPH 1UTOA 1O30A 1UTQA 4D76A 1EZXC 4ISLA 1PYTD 1GHWH 5E2OA 1O2JA 1RRKA 3O8RA 3MHWU 1C9TA 3PM3A 5BPEA 1YLCA 5TCAA 2BD2A 2Y7XA 1HFDA 3GYMA 1A3BH 3KIDU 3LGYA 4NCYA 3ESTA 2BQ7B 3RC5A 1QNJA 4IS5A 5EODA 5HYOA 2FI3E 8GCHG 5EPYA 2ZDLA 5EPNA 1BQYA 2ZU3A 4MQAA 2ZTZA 2WPJS 4FUBA 1OYQA 1ZOMA 3F68H 3MO6A 2J2UA 2F9VA 3OY6U 2DUCA 2TIOA 3SU4A 1G32B 3TGKE 3KQDA 4NZLA 3UNQA 2QXHA 1DT2A 4Y8YA 1BTWA 3ATMA 1O2QA 2ZO3H 3BTTE 4IMZA 2A4RA 3BSQA 4FXGH 1CT0E 1C5VA 2OQUA 4ZH8A 3ZZ7A 1H9IE 1BJUA 2WPLS 2VB0A 1O34A 1IQEA 2HALA 4CR9A 5A8XA 1P9UA 3T27A 3PB1E 1TBZH 1LHGH 1HAYB 2C8YB 3ZZBA 2NU1E 2ZU4A 2STAE 1C1TA 1O5EH 1P2QA 2QIQA 2BX4A 2CN0H 4K60A 4KTUA 3GY3A 4X2VA 1L4ZA 2GZ8A 1E35B 2G51A 1OX1A 1VITH 2FO9A 1O2PA 3M36A 3TH2H 3V7TA 1P9SA 1MBQA 2BDBA 3A8AA 4BAKB 3SV6A 2ZG0H 1XUIA 3A86A 2JETC 1D4PB 1ZSKA 3MH4A 4X6PA 1BA8B 1ABJH 5C5OA 4Z0KA 1DS2E 3RDZA 1GI1A 1AO5A 2HNTF 4K1EA 4E06H 4O03A 1HJ9A 1P2OA 1TPPA 1WQSA 3NCLA 2C4FH 1AQ7A 1UHBB 2PKSB 3EDXB 2GV6A 3NXPA 4I32A 3SNCA 1W13U 2FX6A 3HGPA 1O5BB 2R0KA 1IHTH 1EATA 4BAOB 1BMAA 1GJ6A 1TWXB 1UTJA 2OTVA 3RXRA 4MPXA 2D1JA 2WYJA 4Q7ZA 4Y0YE 2QXJA 3E0PB 1EAXA 6ESTA 4JYVH 1P05A 3H7OA 2GTBA 2NU2E 5EW1H 3MU8A 5LPRA 1O2TA 1S85A 3D49H 2EEKA 3D65E 1IQGA 3GY6A 1BIOA 2ZDNA 4AFZA 3U1JB 1FUJA 2FTLE 1MZDA 1WU1A 1WYKA 2TBSA 1HB0B 1CGHA 3RMNH 2ZPQA 4BTUB 3PMBB 1LVOA 2A45B 3O8DA 1CT4E 1GG6C 1T31A 2A5IA 1FIZA 3HK6B 4F4OC 9LPRA 2Z3DA 1GVLA 3QZRA 4WMFA 3M3TA 1P10A 3SGQE 3KQBA 1N8OC 1MD8A 4GPGA 2J34A 4YOIA 2B8OH 1UVSH 1GHYH 3SHCH 4ABBA 1LHEH 1Q3XA 4CHAC 1MKWH 4CRBA 2O8LA 3SU5A 1VGCB 1QRXA 1G3BA 1Z71A 3SQEE 3ITIA 2SGQE 3BTKE 1HNEE 2QA9E 3ATWA 2I6SA 4D8NA 4INKA 4A1VA 5AVDA 4B74A 2XYAA 4Q7YA 1E36B 2FS8A 5L2YH 1BBRE 2VGCB 1V6DA 2ZFRH 1K1OA 1ABIH 1G2MA 1P2KA 1A5IA 1TNIA 2BLQA 1C2EA 1ZMNA 2OBQA 3ATIA 3R3GB 1GVZA 1O3JA 1OWJA 5LH8A 1C1UH 3RXKA 1T4VH 1LPZB 4CRFA 2AYWA 2Z7FE 1CHOF 1ZGIA 4BOHA 3DA9B 4YOGA 4WH8A 2QF0A 3QGNB 1YBWA 1JRSA 3GCHC 1UCYE 4CBNA 1PYTC 1XUJA 1ACBE 1BB0B 4J2YB 2FOFA 1DLKB 3MMGA 1GI6A 1TQ0B 2SFAA 1WTGH 1C2DA 2PV9B 1ZYOA 1O3HA 2F9OA 4JZIA 1UHBA 1CGIE 4MPVA 4SGAE 5ETXA 3UR9A 3K2UA 4DVAU 3PTNA 1XUHA 1DXPA 3DHKH 1SB1H 3GCOA 2GT7A 4DURA 1EQ9A 2THFB 4RN6A 3U8OH 2O8UA 5T3HA 1NFXA 2XNIA 3T2NA 1S5SA 2STBE 4NSYA 4FUJA 1QFKH 1CGJE 1DWBH 3ZZ3A 1YPHC 9ESTA 1P2NA 1MU6B 1PPGE 2BVRH 1TNHA 1J14A 1AKSB 3RXUA 3CP7A 4FUFA 1TMUH 2FZZA 3LH3A 3QK1A 3S9BA 4LZ1H 3LC3A 1GBDA 1GL1A 2F3CE 3EYDA 1GBLA 3L33A 3A7VA 2HRVA 1TMTH 1P57B 3MU4A 3M7QA 2A31A 1ZPCA 4CRGA 3S9CA 1EZSC 2TGTA 4NIWA 2ZI2H 1DWEH 1ANCA 2P16A 2EI7A 1ZMJA 1H9LB 4B76A 3MFJA 7GCHF 2XBXA 2ZDMA 1A0JA 3LGIA 2GZ7A 3SV2H 1UCYH 3LKWA 5F8TA 4KTCA 3M3VA 1P2IA 1ZPBA 1LKBA 1NN6A 1KXCA 3LGTA 1PPEE 3ZZ6A 5GJ4B 4MNWA 1HV7A 1V2PT 3NWUA 1GMCG 4K1TA 5TJXA 1O32A 1JWTA 3BTDE 5DJ7A 1BMNH 3P8FA 4ZXXH 2XWAA 1ID5H 3VPKA 1MTNB 2BDGA 2H6MA 1UCYK 4X6MA 4FUIA 2A0QB 1IQHA 5EOKA 1HAXB 2PSXA 3JZ1B 1BTHH 1LHDH 3QWCH 1Y3XA 3GY8A 2O9QA 2ZGJA 2GCTC 2FOEA 1JIMA 2KAIA 1AN1E 3C27B 5AHGH 2QAAA 1QBVH 3VXFH 3AVZA 5T6GA 4AG1A 3ODFA 1M9UA 4HTCH 1IQLA 1L0ZA 1GBJA 1NY22 3P95A 1BRBE 2CXVA 3QTOH 3SU0A 1NZQH 1RGQA 3RMLH 1AIXH 1V2KT 1ELAA 1HBTH 3TLOA 4ISIH 1Z8RA 1G3EA 1GDNA 1GWAA 2XC5A 2ZA5A 2J95A 4X0WU 3M5LA 1UO6A 1VCPA 1OXGA 4DY7B 2P3UB 4GCHF 3GCNA 4LOYH 1HDTH 4AFQA 1O3KA 5L6NH 3SUGA 2O8TA 1C2JA 1AUTC 4JK6A 1FI8A 1P3CA 1S6FA 8ESTE 3E16B 1MKWK 1HIAA 2UUJB 3A8BA 2A7JA 3TVJB 4ZUHA 1T8OA 2F9NA 3BTFE 3FP7E 1UVOA 3BTGE 1FV9A 3ATKA 3ZYDA 2IJOB 3PWCA 2NU3E 5AF9H 5C20A 1P03A 3RMMH 4ZKSU 5DP5A 1SQTA 2Z94A 1TALA 5A2MH 2OUAA 1SGCA 5IDKA 2A4QA 1OWIA 4MLFB 3A89A 1EB2A 3RXBA 1SGNE 5C2ZA 1C9PA 1VITG 1SC8U 3Q76A 2P93A 4I33A 1U6QA 2Q1JA 3A84A 1Y59T 3MU5A 1V2TT 5FXLA 3UFAA 5LGOA 1YM0A 1UTMA 1V2QT 5JBAS 2BX3A 2F83A 4XDEA 4GLYA 1QQ4A 1GHVH 1G3CA 4NFFA 1E34B 1FY5A 3A82A 4DGJA 3UQVA 3TJVA 3ZVAA 2BOHB 3PMJA 1O35A 4JMYA 4MNVA 4WXIA 4ISNA 3EA7A 3BEUA 4DG4A 1GI5A 5E0HA 1TGCA 1YPJH 4H42U 1FIWA 1TA6A 1K1LA 2AFQB 1P12E 1A4WH 1LQEA 1MKXH 2FIRH 4BAQB 1CE5A 2ANMH 2BD4A 2XC0A 3K65B 3Q00A 4Q7XA 4I8HA 4JYTA 4NIVA 1YPEH 2ZZUH 4QT8C 1GDQA 3E90B 2C90B 2AEIH 1K1MA 3T29A 5DG6A 1TPAE 3T28A 5L2ZH 2EA3A 1VJAU 5PTPA 1QGFA 4H6TA 1GMHF 2BDYA 3ZZ5A 1KLJH 1VITF 1H8IH 4TY6A 4OGYA 3RXAA 1QL7A 4WXVA 2TRMA 1MU8B 2ZFTA 1PQ5A 2B9LA 3E0NB 1AB9B 3PTBA 3UQOA 4AN7A 1AI8H 2GT8A 1LVYA 3BTQE 1DSTA 1S84A 1G3DA 2A4GA 2GDDA 3P8OA 1YPKH 2PKAA 2Y7ZA 2SGAA 2GMTC 3UNSA 3BN9A 3MO3A 3QGJA 3MNSA 1MTWA 5HMAA 1K2I1 1D9IA 3WY8A 3B9FH 4CH2B 4LK4A 3BG4C 1ETRH 4H6SB 1LPKB 1OKXA 4NIYA 1E0FD 3K6ZA 1C2MA 2C8WB 4XE4A 5J4SA 4DCDA 2VIOA 1ELEE 3SORA 3HATH 2V6NA 3RXQA 5T6DA 1F0RA 3M5MA 1PJPA 1YPHE 1BTZA 2JH6D 2ZU1A 4TWYA 5EQQA 1J15A 3U9AH 1GBTA 2GX4A 3FP8E 1ARBA 1Z1JA 3RM0H 1GMHG 3KGPA 2EC9H 1NFUA 1TE0A 1GHAG 2ULLA 1CSOE 1A2CH 4D7FA 2VNTA 3DFLA 3MNCA 2PW8H 3SOSA 3RP2A 2ODPA 4D9RA 1K22H 1GI9B 1KXEA 3U1IB 1ANDA 4YZUA 1DLEA 3VB7A 4AG2A 2QXGA 5FHTA 4K8BA 1C1VH 1SLUB 1CBWB 2ZFSA 3P6ZB 1K21H 2H9TH 4X8UH 2QCYA 4ABEA 3TU7H 1QBNA 2J38A 2CV3A 2W3IA 2FDAA 2FOBA 1FPHH 2VVUA 1V2VT 4NA9H 2G52A 1C5ZB 4D9QA 2Y82A 3SJ9A 1SI5H 3AAUA 5LPFA 1DY8A 4I8LA 2P59A 4ISOA 2JH0D 2ODQA 1W14U 1L2EA 2PGQB 2YNBA 1GJCB 1DANH 1DY9A 1DXWA 5EG4A 1UVTH 5JPMH 2VJ1A 2Q6FA 1O3DA 3OX7U 2ZQ2A 3UR6A 1O39A 3HKJB 3KHVA 1S83A 1X7AC 4JCNA 1LCYA 2AMPA 4GUXA 1ELBA 3LGUA 2R0LA 1NU9A 1FJSA 3MYWA 3GY7A 4A92A 2EI6A 4UFGH 1W8BH 2ZHEH 4DT7B 1BJVA 1O5GH 2D2DA 2Q6DA 1WBGB 2WPHS 1O5DH 4YOJA 2OQ5A 3M5NA 4Y71A 1QIXB 3RXTA 3SBKA 1BTUA 3GY2A 2OXSA 3R0FA 1Z8JB 4O9VA 1TAWA 1NRNH 2K1QA 1NFWA 5K0HA 4OGXA 4U01A 1W10U 2WPIS 1YLDA 1F5KU 1A46H 2PLXA 1IQKA 1S6HA 1L4DA 1SPJA 1BRCE 4ZROA 2BD3A 2CHAB 1ZTJA 1O0DH 1ZGVA 2OINA 1B0EA 3L3TA 3BIVH 1TNJA 4MNYA 4AGKA 2G5NA 5EXMA 1QCPA 1AFEH 4A1TA 1C2KA 2SNWA 1B5GH 2ZTYA 2R2MB 1P3EA 1GBKA 1OWKA 5C3NA 1AFQC 1QJ7B 3Q3YA 1AFQB 1O38A 1TB6H 4WH6A 1CBWC 1LKAA 2CGAA 1C1NA 1SGFA 3UIRA 1GMDG 1PQAA 1A61H 4A6LA 1G2LA 1KSNA 1IAUA 4Q80A 5FPSA 1L1NA 1OP2A 2ZGXH 2JH5D 1P0SH 4A7IB 4X1RU 1RTKA 1W7GH 1MAYA 1F5LA 3A7XA 1NM6A 1VGCC 2PUQH 1LMWB 1O2OA 4AYVB 2BVXH 3UTUH 5C67A 3ZVGA 1TGNA 4WJG2 1TPOA 4X1NU 1LDTT 3ATLA 2VWLA 3STJA 3KQEA 2C93B 4JZEH 3V0XA 1OYTH 3PYHA 4K3JA 3GCTF 1ELVA 3S7KB 2ZDKA 3SU3A 3AAVA 1TYNA 1ZJDA 5GPIB 4X8VH 2BM2A 1GGDC 1Y3YA 5AFYH 4YT7H 3U98H 2JETB 1MMJN 2GMTB 3T5FH 4Y79A 3LT3A 4WY3A 1DPOA 3VGCC 1ZJKA 3MO9A 2XTTB 1FDPA 3MNBA 1UVPA 2TGPZ 2XWBI 3DUXH 3TNTA 1D3TB 1C5PA 3SW2B 5C1YA 3RU4T 1C1SA 1LTOA 1AWHB 2IN2A 1C5SA 1MQ5A 1SQOA 3BTME 5JYIA 1EOLA 3QLPH 1CVWH 3G01A 2ZWLH 1ZHRA 3SUFA 1GBBA 2ZFQH 5F03A 5JDUB 2WINI 2UWOA 1TLDA 1Y8TA 2BY8X 3A81A 1GJ5H 4ESTE 1GDUA 1Y3UA 1GI2A 3H7TA 3CS0A 1JBUH 2PTNA 5JBBS 4ZKNU 3RC6A 1YCPM 4MVNA 2PSYA 3PO1B 3FVFB 1O2GH 4I31A 1BBRK 2NU0E 2GZ9A 1TOMH 3KN2A 2G81E 3UY9A 2FS9A 1XX9A 3W95A 3SGBE 1CA8B 1QRZA 3ZV8A 3M37A 4I8GA 1MBMA 4R0IA 5A8ZA 4MNXA 3ZVDA 5G4BA 1VZQH 3GY5A 3MH5A 3OTJE 4AYYB 5GDSH 4GHTA 4I8KA 2OD3B 4KKDA 5EXNA 4NA7A 5L30H 2CHAC 1XXFA 3GISB 2WUBA 3OYPA 1Y5AT 3UOPA 3RXGA 1SOZA 4Y7AA 1SSXA 4ZKOU 1AMHA 1GBEA 2G5VA 3VXEH 3BV9B 2FESH 1TOCB 2ZCKP 1LHFH 2QY0B 3GOVB 4UE7H 4YM9A 4K69A 3PMAB 3ZVFA 1JMOH 1AE5A 3RUOA 1OWEA 4NIXA 3RMOH 1GHAF 1V2ST 2HWLB 3VGCB 1V2OT 1V2LT 1GJ7B 4ZHMU 2GKVE 2UUKB 2VIQA 1GJ9B 4LZ4B 1MCTA 2Z6BD 1O3MA 2XCFA 1BUIA 1C5LH 1IHSH 3ZZ8A 1O3EA 1EXFA 2A5KA 1EKBB 1TABE 3SU6A 1F92A 3Q3KA 1C1RA 5B6OA 2FOGA 1XKBC 2ZP0H 2Z9LA 4NA8A 5FPTA 1NROH 2WYGA 3HKIB 1GHBF 4IMQA 1E38B 3RU4D 3SZNA 2VWOA 2BZAA 1FZZA 3F9GA 3P8GA 1F0TA 3RXFA 2ZIQH 3LJOA 4ABJA 2IOTA 2VIWA 4AFSA 1V3XA 5T6FA 4R8TB 2ASUB 4B2AA 2H5DA 1EPTC 3AASA 1P02A 4XBBA 4B71A 3NZIA 5C1UA 1C2FA 3RU4E 4BTIB 1CO7E 1K1NA 1OP8A 1C5MD 1SLXB 5GCHG 1S0QA 1C5OH 3RXVA 3T62A 1KTSB 1BRAA 1A1RA 1K28D 1N8OB 5JBCS 1OP0A 3SUEA 1ANEA 3KL6A 3K9XB 2VGCC 2ZCHP 1BRUP 1F7ZA 2FODA 3OY5U 4U2WA 2YOLA 1GBHA 1G30B 4GHQA 2WUCA 3SJKA 2GGVB 1O2IA 1AUJA 2F91A 4HGCA 1SOTA 3PROA 1EJAA 1P2JA 3ENSB 2BTCE 1ZRKA 1BTYA 4TPYA 1IQIA 1AD8H 1AZ8A 2HPQH 2J9NA 1MD7A 3CENA 4WMDA 4B75A 1MTVA 1F0SA 2OC0A 4WMEA 2VIVA 1EOJA 2VINA 3FAOA 1KDQA 1TMBH 2ANYA 3BTWE 1QTFA 4ASHA 2J4IA 5A09A 3I77A 4NSVA 5LPEA 1K1IA 4U32A 3QX5H 2OC7A 1RD3B 3BTHE 2GCHG 3TK9A 1P01A 1J9CH 1HJ8A 5F6MA 5GIBA 2BDHA 2OC1A 3QN7A 3P70B 5DP6A 1O3CA 2B0FA 5FCKA 1BTPA 3MOCA 4O3TA 3FZZA 1QBOA 3RXHA 1K9OE 2H1UA 1TRNA 1MH0A 1ORFA 1C1WH 2UWLA 2ZTXA 1H9HE 1TA2A 1GMDF 1GMCF 1RIWB 2W7UA 2I6QA 2HNTC 4O97A 1OSSA 1C1MA 4E05H 3U69H 2R9PA 4KELA 3EQ0H 5GXPA 3RXJA 1CHOG 3EA8A 3E8LA 1XMNB 5H4IB 2H9HA 2XBYA 1A0LA 1CT2E 1MZAA 2BY9X 3V3MA 4CH8B 1HAGE 4NWKA 2PTCE 2F9BH 2ZGBH 1O2XA 1Q31A 1W7XH 1O2MA 4Y8XA 4X2XA 2H5CA 1Z7KA 3PV4A 4AX9H 3SJ8A 1XM1A 2Z9KA 4Y6DA 2AGGX 5C5NA 3UOUA 4IBLH 3ZVEA 1C5WB 4LXBH 3P92A 1JXPA 1O3IA 1QJ1B 2PGBB 3GCTG 3SI3H 5ABWA 2PR3A 1GJDB 1TONA 3SV8A 3TNSA 2J92A 5FCRA 4AFUA 3LGWA 4UFEH 3B23B 1SFIA 3ZZCA 2R2WU 2AMDA 2SGDE 1PQ8A 2XBVA 2QF3A 4E7NA 1O2YA 3RC4A 4YTAA 4H4FA 1ZSLA 2AIPA 2FOAA 2PUXB 1BTXA 2ALVA 2VIDA 5K7RA 2FI5E 1SHYA 2FXRA 3SNDA 1UTPA 1QJ6B 3LPRA 1LQDB 4KP0A 1XUKA 3TITA 1TGBA 2AIQA 1PPFE 7GCHG 1KY9A 4RKJB 3ZZDA 1O2NA 1XXDA 1P06A 2Y80A 1FN6A 2W26A 3QDZB 1GI0A 3BG4B 1MAXA 2ZU2A 1GGDB 3SGAE 1L1JA 1QL8A 2F9PA 3RXSA 1SGIB 2OP9A 2FPZA 3SUDA 5CMXH 1SQAA 4JZFH 1QL9A 1THPB 3PLKA 1EJMA 2BY7X 1NT1A 1C5TA 2UUYA 3GDVA 1C4U2 3UWJH 1KLIH 2BLWA 1N6YA 2FEQH 2C8XB 1TBRH 4ZKRU 1NTPA 5J4QA 1EZUC 1UVUH 2BXUH 4ZMAH 4CR5A 1TNKA 3E3TA 4OS1A 4IW4E 3NKKA 3QO6A 5DPAA 1GI3A 1ESTA 1YPGH 4WWYA 4U30A 1O36A 2FOHA 4XFQA 3A80A 1A3EH 3A7YA 1UJ1A 3UNRA 3A85A 1K1PA 2B5TB 3I29A 1DM4B 3TIUA 1D6WA 2H9EH 1TFXA 1GI4A 3CS7A 3ELAH 1D6RA 6GCHF 1WOFA 3MH6A 1RXPA 4FUGA 2D8WA 1J8AA 5JB8S 7KMEH 4GCHG 1O2VA 3RLYH 1TX7A 1FN8A 3U8TH 1HCGA 1RS0A 1TPSA 3ZZAA 2TGDA 1DVAH 5E2PA 4DW2U 4FUCA 1QURH 2Z9IA 1Z1IA 5EU8A 1AHTH 4DOQA 3BEFB 2FLRH 1SR5C 3HPTB 3W94A 3TH4H 4VGCC 2C3SA 1IQNA 2VVVA 3VFEA 8LPRA 1HRTH 3GYLB 4OS6A 3NPSA 2KAIB 1KXDA 3I78A 3UREA 1ZR0A 6CHAC 1AWFH 3F9EA 3F9FA 1D3PB 1CA0B 1T8NA 4RSPA 2HLCA 4A1XA 1NC6A 3RXCA 1GCTC 3L6PA 1IOEA 3SV9A 1V2WT 1AGJA 4NFEA 1BOQA 3ZVBA 2WV4A 4NZQA 8KME2 2Y81A 1FAXA 1P2MA 4X2YA 4NWLA 1ELDE 1KXBA 1J17T 1EB1H 1C5QA 4X8SH 1W0YH 1MTUA 3D23A 1TGTA 3URCA 3SNBA 1BHXF 1Z8IB 1P09A 1AVXA 1ESAA 1QA0A 2FOMB 1GVKB 8GCHF 1Y5UT 1NU7B 2ZPSA 4Y7BA 1QHRB 3PWBA 3S9AA 1C5YB 1ELFA 1HIAB 1NESE 1H8DH 2RG3A 1O2WA 2NWNA 2R3UA 1GBMA 1O37A 1W2KH 1EAIA 4AB9A 2BD5A 2ANWA 1IQJA 2H2ZA 2ZC9H 2ANKH 2PKSC 3IWMA 4A5TS 1EPTA 1DITH 4TWWA 4BNRA 2ZNKH 1N1LA 1WSSH 1VCWA 1W11U 1O3BA 2CF9H 1WQVH 2OCVB 1XVOA 1GHZA 4M7GA 1YGCH 4IGDA 1THSH 1MKXK 2VWNA 3Q3XA 1AVWA 1A5GH 1J16A 1NPMA 3IG6B 1TX8A 2ZEBA 1ARCA 1QB9A 3LC5A 3RXPA 2G00A 1ZPZA 2BXTH 1FNIA 4IC6A 1ZMLA 2FI4E 1SMFE 3SHAH 1DWCH 4CRCA 1SL3A 1T8LA 4UDWH 3LONA 4Y11E 1C5RA 4CHAB 2M5TA 2Y5HA 3LOXA 1GJ4H 1S82A 1HUTH 7ESTE 1FMGA 2ZPRA 1NRSH 1AU8A 3MWIU 4FU9A 1O5AB 5GWZA 1FY3A 1FY8E 1O2ZA 1EZQA 3SI4H 1Y3WA 1ELGA 2NU4E 1GCDA 3SV7A 4Y8ZA 4X6NA 2P8OC 1AKSA 4XOJA 2FYRA 6CHAB 3RXEA 1NS3A 1QB1A 3O8BA 2EI8A 1C2IA 1UK2A 2ZHDA 1HLTH 1UTKA 2BOKA 3RXLA 3F9HA 3F1SB 1V2MT 3UUZA 3A7WA 4BTTB 4YESB 2GD4B 2IPHA 3K6YA 1ZTKA 3EE0B 2ZECA 1O3PB 1XUGA 4F49A 3F6UH 4OS7A 2ODYB 4AORA 4AB8A 2BVSH 1C2HA 2Y5FA 3GDSA 5DP3A 5E0GA 4B73A 1H1BA 4JZ1A 4ABFA 3MU0A 2W7SA 1TIOA 2P94A 3UPEA 4CREA 3E1XB 4HFPB 4MDSA 1DDJA 1OOKB 3LDXH 3NUMA 2W5EA 3BG8A 1ESBA 2VH6A 1VJ9U 2HGTH 1JOUB 4FVBA 1KXAA 1DOJA 2FTMA 1PPCE 1SGYE 1T7CA 1C1QA 2P3FH 2SGEE 3TK5A 3MTYA 4IN1A 1UTLM 1C4V2 1GI7B 2BLVA 1HAHH 4FU8A 3M5OA 4FVDA 2BLOA 1O3OA 1YCPH 1MTNC 4Y0ZE 1KIGH 1YYY1 6GCHG 2PHBA 2J94A 1EX3A 1ZSJA 4YLQH 3STIA 4JK5A 5EGMA 4XBDA 4Y10E 2D26C 4B1TA 2QN5T 2V35A 4FUDA 1HAZB 5GCHF 2Z3EA 5JB9S 1AVGH 2AS9A 3TK6A 2PFEA 3LJJA 4JYUH 1O3LA 4ZHAA 1C5UA 2ZDVH 2BYAX 5HGGA 1DSUA 2TPIZ 2ILNA 3KQCA 3DT0H 4DIHH 2WPMS 2VU8E 2XW9A 3RXMA 4ABDA 3SU2A 2FYQA 3VB3A 1O2RA 1G9IE 2O8WA 5A0CA 2Y6TA 1DWDH 1GBCA 4MPUA 1AB9C 4TYDA 1HAIH 1HYLA 1RJXB 2CF8H 4NG9H 4K1SA 3SNAA 1KYNA 5DP8A 3A87A 1RTFB 3KNXA 1CHGA 1O2UA 4K5ZA 1DUAA 3TJOA 1Z6EA 2BMGB 4K2YA 1WUNH 3QUMP 4HZHA 1W12U 3ZZ9A 1GL0E 1P11E 2GVFA 3V13A 4GSOA 1Q2WA 1GG6B 1WCZA 2WPKS 2QXIA 4X2WA 2V0BA 2V3HH 4IC5A 3SU1A 4E7RG 3MI4A 2G55A 3A83A 1LVMA 2BDCA 3HK3B 4VGCB 3FANA 1UK3A 1QR3E 4J1YA 4B2CA 1GI8B 1HXEH 1PQ7A 5EQRA 4AOQA 5A0AE 1ZLRA 1RFNA 5JBTA 5HM2A 2VVCA 3TJUA 1KTTB 1BMLA 4DJZB 2XRCA 1FAKH 3VB5A 2B7DH 2BD8A 2ZHQH 2P3TB 4YLUA 1Z8GA 5ESBA 1XKAC 2VH0A 1HJAB 2R3YA 1O33A 3C1KA 2BQWB 4X6OA 4ABHA 1P04A 4GAWA 3SO3A 5CE1A 1HAPH 1UTNA 1QY6A 2Z3CA 4UONA 1O2SA 1YKTA 3LGVA 2CJIA 2ZQ1A 4TPIZ 2BDIA 3LIWA 2GV7A 1S81A 2A1DB 4BAHB 1GBIA 1EP6A 2SGFE 5CHAB 1DUEA 1DE7H 4K8YA 1B0FA 3FFGA 3RM2H 1JRTA 4UFDH 1JIRA 2P95A 3URDA 1MUEB 3LU9B 1QA7A 2A7HA 4ABGA 5A8YA 2FLBH 1FXYA 3JZ2B 3S69A 3KCGH 1ZHPA 2QGRA 3BTEE 1O2HA 2FWWA 2JKHA 1P8VC 2PKAB 2XXLA 1HAVB 1GBAA 3BIUH 1SBWA 1AE8H 4YT6H 4THNH 1YF4A 4INHA 5DKMA 3NK8A 2QC2A 1EP5A 4KTSA 3VEQB 4BANB 1C1OA 2LPRA 1SVPA 1G37A 1BCUH 1EPTB 1W3CA 2ALPA 2ESTE 1S0RA 1YC0A 1TNGA 3HGNA 2ZFFH 3E6PH 2A32A 1LO6A 1ELTA 1ETTH 3B8JA 3TPIZ 3A88A 4NGAH 2OC8A 4OS4A 2ZCLP 1QQUA 1V2JT 2GCHF 3N7OA 2A7CA 2OBOA 4ABIA 4KGAA 1TQ7B 3ZYEA 1ANBA 3T26A 4UD9H 3T25A 2XBWA 2GCTB 1AY6H 1Y5BT 1F5RA 2Z9JA 3VB4A 3H5CB 1SGDE 3MU1A 2LNCA 1BZXE 3MH7A 4X1SU 1L1GA 4BXWA 1ETSH 3QZQA 5ESTE 5SGAE 3GICB 1GJBB 1SLVB 2ZHWH 1MCVA 1PFXC 2SGPE 1C2GA 2BZ6H 2A2QH 4OS5A 2QV1A 1THRH 1BT7A 4IN2A 3SJIA 2FOCA 1N6XA 4BXSA 1SG8B 4GVUA 2AGEX 1NRQH 1GHBG 1FY4A 1CQQA 3M7TA 3S0NA 1UK4A 1K1JA 2YNAA 5AFZH 3SQHE 4WVPE 3RXDA 3EAJA 3ZVCA 1QB6A 2C8ZB 3GCHB 1XUFA 5DK1A 1EAUA 2VWMA 2W3KA 1SFQB 1WTHD 2XC4A 4X8TH 1T4UH 3A7ZA 2AH4X 1D3QB 3SNEA 4I7YH 1OWHA 3ZZ4A 1YPMH 1BITA 5I25A 2V3OH 1SGRE 2WV5A 1W0ZU 4Y76A 3MNXA 1T8MA 1A7SA 1NRRH 1T32A 4ZHLU 1H4WA 1HPGA 2G4UA 4HI3A 4INLA 2ZGCA 3TGJE 1OPHB 2QYIA 5A0BA 3SN8A 2BD7A 3AW0A 3BEIB 4JZDH 3DD2H 5FX5A 3A8CA 3TH3H 4MTBA 3RXOA 1O5FH 2SNVA 3VB6A 2P8OB 4PROA 1TBQH 1GHXH 4FUEA 3LH1A 1O3GA 2AERH 3PO1C 4ZAEA 3PLBA 2GP9B 2F9UA 3RLWH 1FPCH 4AZ2B 3IITA 1C5NH 1SLWB 2XCNA 5HXFA 2ZU5A 4XSKU 2RA0A 3Q77A 5C1XA 5DGJA 5BRRE 1VCQA 1IQMA 1LHCH 2ZF0H 6LPRA 4XBCA 1ZHMA 3P17H 4TY7A 1DFPA 2ZDAH 1OS8A 4X1PU 1O3NA 2VIPA 2FM2A 1E37B 1EAWA 1ZRBA 5EQSA 2BY5X 1TNLA 2ZHFH 2HVXA 5CHAC 3GY4A 2DE8A 1RIWC 2G4TA 1FLEE 2Q6GA 1DX5M 1F0UA 1WV7H 1NFYA 5HM9A 4MG3A 1SHHB 1C2LA 4ZXYH 2Z9GA 4Z6AH 1KLTA 5E0JA 1QRWA 2BHGA 1OWDA 3P8NA 4MPWA 2A5AA
chains in the Genus database with same CATH superfamily
1BBRH 1BHXB 5FBIA 2BDAA 4FU7A 3A8DA 3TJNA 2AGIX 1RTLA 5DP4A 1PPHE 1YPLH 1TRMA 4BAMB 3UWIA 2BD9A 1VKYA 1HXFH 3E91A 3EGKH 1D3DB 3KEEA 2CMYA 1HAOH 1ZTLA 4I86A 5FBEA 3FZDA 3D62A 1A0HB 1AZZA 3V12A 1GJAB 3EA9A 1YY3A 1GPZA 3KF2A 3OEHD 1YP9A 1CU1A 1O2KA 1S6LA 4DIIH 2HOBA 1C4Y2 1TRYA 3BF6H 2RDLA 3QTVH 1SGTA 1GCTB 3TGIE 1VR1H 2ZGHA 3OU0A 3SJOA 3M7UA 1O3FA 4TSFD 4DT4A 1Y3VA 3O8CA 4D7GA 1CA0C 5EW2H 5DO4H 1TGSZ 3M3SA 1IQFA 4UFFH 4AGJA 2O8MA 1C1PA 1O2LA 2A2XH 5FX6A 7LPRA 2A4OA 3M61U 1O5CB 1O3AA 3KYFA 1G36A 1HJAC 2FMJA 1V2NT 4YO9A 4WF8A 4O3UA 4CRDA 3RXIA 3A7TA 1KDQB 1LPGB 3ODDA 1SGQE 1O31A 1V2UT 1FONA 1EUFA 5I46H 1ELCA 5E8EH 2BB4A 4RKOB 4UEHH 3FP6E 1PPBH 2J98A 4ABAA 1C5XB 1SGFG 1GJ8B 1DICA 3PLPA 1FQ3A 2Y5GA 3PV2A 5EXLA 1TX6A 4ISHH 5IYTA 4SGBE 4Q2KA 5TCCA 3U8RH 5F8XA 1KXFA 1V2RT 4CRAA 1PPZA 2RCEA 1GBFA 1EASA 1F2SE 1FY1A 1MQ6A 4OS2A 3N7EA 2PWXA 3M35A 1BDAA 1Z6JH 2OLGA 4CBOA 1UMAH 2G8TA 2BQ6B 5CHBA 2UUFB 2AMQA 1NO9H 3DFJA 3S7HB 1NRPH 5FPYA 1ZZZA 4I8JA 4FUHA 1SGPE 2GDEH 1HGTH 5DP9A 1SGEE 2FP7B 2HPPH 1WAYB 2TGAA 2UWPA 5FAHA 1LVBA 1HAVA 3GDUA 1B7XB 3ZV9A 2BY6X 3AW1A 1BMMH 1A5HA 1INCA 2HNTE 4X1QU 4B2BA 2RA3A 3PMHB 5DP7A 1MTSA 2DE9A 5F8ZA 1EJNA 4ZCNA 3OSYA 2FX4A 2ZKSA 1YCPK 1XVMA 2ZFPH 1UTOA 1O30A 5EIYA 1UTQA 4D76A 1EZXC 4ISLA 1PYTD 1GHWH 5E2OA 1O2JA 2W6JD 1RRKA 1YWUA 3MHWU 1C9TA 3PM3A 5BPEA 4M9FA 3O8RA 1YLCA 5TCAA 2BD2A 2Y7XA 1HFDA 3GYMA 1A3BH 3KIDU 3LGYA 4NCYA 1BMFD 3ESTA 2BQ7B 3RC5A 1QNJA 4IS5A 5EODA 5HYOA 2FI3E 8GCHG 5EPYA 2ZDLA 5EPNA 1BQYA 2ZU3A 2OK5A 4MQAA 2ZTZA 2WPJS 4FUBA 1OYQA 1ZOMA 3F68H 3MO6A 2F43B 2F9VA 2J2UA 3OY6U 2DUCA 2TIOA 3SU4A 1G32B 3TGKE 3KQDA 4NZLA 3UNQA 1K0HA 2QXHA 1DT2A 4Y8YA 1BTWA 3ATMA 1O2QA 2ZO3H 3BTTE 4IMZA 2A4RA 3BSQA 3F2HA 1CT0E 4FXGH 1C5VA 2OQUA 4ZH8A 3ZZ7A 1H9IE 1BJUA 2WPLS 2VB0A 1NBMD 3OFND 1O34A 1IQEA 2HALA 4CR9A 5A8XA 1P9UA 3T27A 3PB1E 1TBZH 1LHGH 1HAYB 2C8YB 3ZZBA 2NU1E 2ZU4A 2STAE 1C1TA 1O5EH 1P2QA 2QIQA 2BX4A 2CN0H 4K60A 4KTUA 3GY3A 4X2VA 1L4ZA 2GZ8A 1E35B 2G51A 1OX1A 5EJ1A 1VITH 2FO9A 1EFRD 1O2PA 3M36A 3TH2H 3V7TA 1P9SA 1MBQA 2BDBA 3A8AA 4BAKB 3SV6A 2ZG0H 1XUIA 3A86A 2JETC 1D4PB 1ZSKA 3MH4A 4X6PA 1BA8B 1ABJH 5C5OA 4Z0KA 1DS2E 3RDZA 1GI1A 1AO5A 2HNTF 4K1EA 4E06H 3CNRA 4O03A 1HJ9A 1P2OA 1TPPA 1WQSA 3NCLA 2C4FH 1AQ7A 1UHBB 2PKSB 3EDXB 2GV6A 3NXPA 4I32A 3SNCA 1W13U 1WDIA 2FX6A 3HGPA 1O5BB 2R0KA 5HIZA 1IHTH 1EATA 4BAOB 1BMAA 1GJ6A 1TWXB 1UTJA 2OTVA 3RXRA 4MPXA 2D1JA 2WYJA 4Q7ZA 4Y0YE 2QXJA 3E0PB 1EAXA 6ESTA 4JYVH 5EJLA 1P05A 3H7OA 2GTBA 2NU2E 5EW1H 3MU8A 5LPRA 1O2TA 1S85A 3D49H 2EEKA 3D65E 1IQGA 3GY6A 1BIOA 2ZDNA 2RDEA 4AFZA 3U1JB 1FUJA 2FTLE 1MZDA 2TBSA 1WU1A 1WYKA 1HB0B 1CGHA 3RMNH 2ZPQA 4BTUB 3PMBB 1LVOA 2A45B 3O8DA 1CT4E 1GG6C 1T31A 2A5IA 1FIZA 3HK6B 4F4OC 9LPRA 2Z3DA 1GVLA 3QZRA 4WMFA 3M3TA 1P10A 3SGQE 3KQBA 1N8OC 1MD8A 4GPGA 2J34A 4YOIA 2B8OH 1UVSH 1GHYH 3SHCH 4ABBA 1LHEH 2EY4C 1Q3XA 4CHAC 1MKWH 4CRBA 2O8LA 3SU5A 1VGCB 1QRXA 1G3BA 1Z71A 3SQEE 3ITIA 2SGQE 3BTKE 1HNEE 2QA9E 3ATWA 2I6SA 4D8NA 4INKA 4A1VA 5AVDA 4B74A 3UB0A 2XYAA 4Q7YA 1E36B 2FS8A 5L2YH 1BBRE 2VGCB 1V6DA 2ZFRH 2YMSB 1K1OA 1ABIH 1G2MA 1P2KA 1A5IA 1TNIA 2BLQA 1C2EA 1ZMNA 2OBQA 3ATIA 3R3GB 1GVZA 1O3JA 1OWJA 5LH8A 1C1UH 3RXKA 1T4VH 1LPZB 4CRFA 2AYWA 2Z7FE 1CHOF 1ZGIA 4BOHA 3DA9B 4YOGA 4WH8A 2QF0A 3QGNB 1YBWA 1JRSA 3GCHC 1UCYE 3OE7D 1PYTC 4CBNA 1XUJA 1ACBE 1BB0B 4J2YB 2FOFA 1DLKB 3MMGA 1GI6A 2V3MA 1TQ0B 2SFAA 1WTGH 1C2DA 2PV9B 1ZYOA 1O3HA 2F9OA 4JZIA 1UHBA 1CGIE 4MPVA 4SGAE 5ETXA 3UR9A 3K2UA 4DVAU 3PTNA 1XUHA 1SQRA 1DXPA 3DHKH 1SB1H 3GCOA 2GT7A 4DURA 1EQ9A 3FOAA 2THFB 4RN6A 3U8OH 2O8UA 5T3HA 4P00A 1NFXA 2XNIA 3T2NA 1S5SA 2STBE 2KCOA 4NSYA 4FUJA 1QFKH 1CGJE 1DWBH 3ZZ3A 1YPHC 9ESTA 1P2NA 1MU6B 1PPGE 2BVRH 1TNHA 1J14A 1AKSB 3RXUA 3CP7A 4FUFA 1TMUH 2FZZA 3LH3A 3QK1A 3S9BA 4LZ1H 3LC3A 1GBDA 1GL1A 2F3CE 3EYDA 1GBLA 3L33A 3A7VA 2HRVA 1TMTH 1P57B 3MU4A 3M7QA 2A31A 3DSOA 1ZPCA 4CRGA 3F0PA 2EQNA 3S9CA 1EZSC 2TGTA 2WV9A 4NIWA 2ZI2H 1DWEH 2KX4A 1ANCA 2P16A 2EI7A 1ZMJA 1H9LB 5KGOA 4B76A 3MFJA 7GCHF 2XBXA 2ZDMA 1A0JA 3LGIA 2GZ7A 3SV2H 1UCYH 3LKWA 5F8TA 4KTCA 3M3VA 1P2IA 1ZPBA 1LKBA 1NN6A 1KXCA 3LGTA 1PPEE 3ZZ6A 5GJ4B 4MNWA 1HV7A 1V2PT 3NWUA 1GMCG 4K1TA 5TJXA 1O32A 1JWTA 3BTDE 5DJ7A 1BMNH 3P8FA 4ZXXH 2XWAA 4FETA 1ID5H 3VPKA 1MTNB 2BDGA 2H6MA 1UCYK 4X6MA 4FUIA 2A0QB 1IQHA 5EOKA 1HAXB 2PSXA 3JZ1B 1BTHH 1LHDH 3F3BA 1Y3XA 3QWCH 3GY8A 2O9QA 2ZGJA 2GCTC 2FOEA 1JIMA 2KAIA 1AN1E 3C27B 5AHGH 2QAAA 1QBVH 3VXFH 3AVZA 5T6GA 4AG1A 3ODFA 1M9UA 3N99A 4HTCH 2VBCA 1IQLA 1L0ZA 1GBJA 1NY22 3P95A 1BRBE 2CXVA 3QTOH 3SU0A 1NZQH 1RGQA 3RMLH 1AIXH 1V2KT 1ELAA 1HBTH 3TLOA 4ISIH 1Z8RA 1G3EA 1GDNA 1GWAA 2XC5A 4Q4LA 2ZA5A 2J95A 4X0WU 3M5LA 1UO6A 1VCPA 1OXGA 4DY7B 2P3UB 4GCHF 3GCNA 4LOYH 1HDTH 4AFQA 1O3KA 5L6NH 3SUGA 2O8TA 1C2JA 1AUTC 4JK6A 1FI8A 1P3CA 1S6FA 8ESTE 3E16B 1MKWK 1HIAA 2J97A 2UUJB 3A8BA 2A7JA 3TVJB 4ZUHA 1T8OA 2F9NA 3BTFE 3FP7E 1UVOA 3PRBA 3BTGE 1FV9A 3ATKA 3ZYDA 2IJOB 3W1EA 3PWCA 2NU3E 5GNDA 5AF9H 5C20A 1P03A 3RMMH 4ZKSU 5DP5A 1SQTA 2Z94A 1TALA 5A2MH 2OUAA 1SGCA 5IDKA 2A4QA 1OWIA 4MLFB 3A89A 1EB2A 2KFWA 1SGNE 3RXBA 1C9PA 1VITG 5C2ZA 1SC8U 3Q76A 2P93A 4I33A 1U6QA 2Q1JA 3A84A 1Y59T 3MU5A 1V2TT 5FXLA 3UFAA 5LGOA 1YM0A 1UTMA 1V2QT 5JBAS 2BX3A 2F83A 4ACBA 4XDEA 4GLYA 1QQ4A 1GHVH 1G3CA 4NFFA 1E34B 1FY5A 3A82A 4Q63A 4DGJA 5C0UA 3UQVA 3TJVA 2XOKD 3ZVAA 2BOHB 3PMJA 1O35A 4JMYA 4MNVA 4WXIA 4ISNA 3EA7A 3BEUA 4DG4A 1GI5A 3DSPA 5E0HA 1TGCA 1YPJH 4H42U 1FIWA 1MABB 1TA6A 1K1LA 4B6EA 2AFQB 1P12E 1A4WH 1LQEA 1MKXH 2FIRH 4BAQB 1CE5A 2ANMH 2BD4A 2XC0A 3K65B 3Q00A 4Q7XA 4I8HA 4JYTA 4NIVA 1YPEH 2ZZUH 4QT8C 1GDQA 3E90B 2C90B 2AEIH 1K1MA 3T29A 2KCYA 5DG6A 1TPAE 2KZ4A 3T28A 5L2ZH 2EA3A 1VJAU 5PTPA 1QGFA 4H6TA 1GMHF 2BDYA 3ZZ5A 1KLJH 1VITF 1H8IH 4TY6A 4OGYA 3RXAA 1QL7A 4WXVA 2TRMA 1MU8B 2ZFTA 1PQ5A 2B9LA 3E0NB 1AB9B 3PTBA 3UQOA 4AN7A 1AI8H 2GT8A 1LVYA 3BTQE 1DSTA 1S84A 1G3DA 2A4GA 2GDDA 3P8OA 1YPKH 1UW7A 2PKAA 2Y7ZA 2SGAA 2GMTC 3UNSA 3BN9A 3MO3A 3QGJA 3MNSA 1MTWA 5HMAA 1K2I1 1D9IA 3WY8A 3B9FH 4CH2B 4LK4A 3BG4C 1ETRH 4H6SB 1LPKB 1OKXA 4NIYA 1E0FD 3K6ZA 1C2MA 2C8WB 4XE4A 5J4SA 4DCDA 2VIOA 2PP6A 1ELEE 3SORA 3HATH 2V6NA 3RXQA 5T6DA 1F0RA 3M5MA 1PJPA 1YPHE 1BTZA 2JH6D 2ZU1A 4TWYA 5EQQA 1J15A 3U9AH 1GBTA 2GX4A 3FP8E 1ARBA 1Z1JA 3RM0H 1GMHG 3KGPA 2EC9H 1NFUA 1TE0A 1GHAG 2ULLA 2WZQA 1CSOE 1A2CH 4D7FA 2VNTA 3DFLA 3MNCA 2PW8H 3SOSA 3RP2A 2ODPA 4D9RA 1K22H 1GI9B 4FOUC 1KXEA 3U1IB 1ANDA 4YZUA 1DLEA 3VB7A 4AG2A 2QXGA 5FHTA 4K8BA 1C1VH 3N7DA 1SLUB 1CBWB 2ZFSA 3P6ZB 1K21H 3KYGA 2H9TH 4X8UH 2QCYA 4ABEA 3TU7H 1QBNA 2J38A 2CV3A 2W3IA 2FDAA 2FOBA 1FPHH 5C94A 2VVUA 1V2VT 2WSSD 4NA9H 2G52A 1C5ZB 3F2FA 2Y82A 3SJ9A 1SI5H 4D9QA 3AAUA 5LPFA 1DY8A 4I8LA 2P59A 4ISOA 5HKKD 2JH0D 2WHXA 2ODQA 1W14U 1L2EA 2PGQB 2YNBA 1GJCB 4AC9A 1DANH 1DY9A 4XD7D 1DXWA 5EG4A 1UVTH 5JPMH 2VJ1A 2Q6FA 1O3DA 3OX7U 2ZQ2A 3UR6A 1O39A 3HKJB 3KHVA 1S83A 1X7AC 4JCNA 1LCYA 2AMPA 4GUXA 1ELBA 3LGUA 3OTPA 2R0LA 1NU9A 1FJSA 3MYWA 3GY7A 4A92A 2EI6A 4UFGH 1W8BH 2ZHEH 4DT7B 1BJVA 1O5GH 2D2DA 2Q6DA 1WBGB 2WPHS 1O5DH 4YOJA 2OQ5A 3M5NA 4Y71A 1QIXB 3RXTA 3SBKA 1BTUA 3GY2A 2OXSA 3R0FA 1Z8JB 4O9VA 1TAWA 1NRNH 2K1QA 1NFWA 5K0HA 4OGXA 4U01A 1W10U 2WPIS 1YLDA 1F5KU 1A46H 2PLXA 1IQKA 1S6HA 1L4DA 1SPJA 1BRCE 4ZROA 2BD3A 2CHAB 1ZTJA 1O0DH 1ZGVA 2OINA 1B0EA 1E1QD 3L3TA 3BIVH 1TNJA 4MNYA 4AGKA 2G5NA 5EXMA 1QCPA 1AFEH 4A1TA 2J5UA 1C2KA 2SNWA 1B5GH 2ZTYA 2R2MB 1P3EA 1GBKA 1OWKA 5C3NA 1AFQC 1QJ7B 3Q3YA 1AFQB 1O38A 1TB6H 4WH6A 1CBWC 1LKAA 2CGAA 1C1NA 1SGFA 2HLDD 3UIRA 1GMDG 1PQAA 3PV5A 1A61H 4A6LA 1G2LA 1KSNA 4OM9A 1IAUA 4Q80A 5FPSA 1L1NA 1OP2A 2ZGXH 2JH5D 1P0SH 4A7IB 4X1RU 4HG6A 1RTKA 1W7GH 1MAYA 1F5LA 3A7XA 1NM6A 1VGCC 2PUQH 1LMWB 1O2OA 4AYVB 2BVXH 3UTUH 5C67A 3ZVGA 1TGNA 4WJG2 1TPOA 4X1NU 1LDTT 3ATLA 2VWLA 3STJA 3KQEA 2C93B 4JZEH 3V0XA 1OYTH 3PYHA 4K3JA 3GCTF 2WPDD 1ELVA 3S7KB 2ZDKA 3SU3A 3AAVA 1TYNA 1ZJDA 5GPIB 4X8VH 2BM2A 1GGDC 1Y3YA 5AFYH 4YT7H 3U98H 3EE7A 2JETB 1MMJN 2GMTB 3T5FH 4Y79A 3LT3A 4WY3A 1DPOA 3VGCC 1ZJKA 3MO9A 2XTTB 1FDPA 3MNBA 1UVPA 2TGPZ 2XWBI 3DUXH 3TNTA 1D3TB 1C5PA 3SW2B 5C1YA 3RU4T 1C1SA 1LTOA 1AWHB 4RT0A 2IN2A 1C5SA 1MQ5A 1SQOA 3BTME 5JYIA 1EOLA 3QLPH 1CVWH 3G01A 2ZWLH 1ZHRA 3SUFA 1GBBA 2ZFQH 5F03A 5JDUB 2WINI 2UWOA 1TLDA 1Y8TA 2BY8X 3A81A 1GJ5H 4ESTE 1WXRA 1GDUA 1Y3UA 1GI2A 2YMSD 3CS0A 3H7TA 1JBUH 1YLNA 2PTNA 5JBBS 4ZKNU 3RC6A 1YCPM 4MVNA 5T1VA 2PSYA 3PO1B 3FVFB 1O2GH 4I31A 1BBRK 2NU0E 2GZ9A 1TOMH 3KN2A 4RT1A 2G81E 2JJ2D 3UY9A 2FS9A 1XX9A 3W95A 3SGBE 1CA8B 1QRZA 3ZV8A 3M37A 4I8GA 1MBMA 4R0IA 5A8ZA 4MNXA 3ZVDA 5G4BA 1VZQH 3GY5A 3MH5A 3OTJE 4AYYB 5GDSH 2LP6A 4GHTA 4I8KA 2OD3B 4KKDA 5EXNA 3DSGA 4NA7A 1SKYE 5L30H 2CHAC 1XXFA 3GISB 2WUBA 3OYPA 3PRDA 1Y5AT 3UOPA 3RXGA 1SOZA 4Y7AA 1SSXA 4ZKOU 1AMHA 1GBEA 2G5VA 3VXEH 3BV9B 2FESH 1TOCB 2ZCKP 2KR7A 1LHFH 2QY0B 3GOVB 4UE7H 4YM9A 4K69A 3PMAB 3ZVFA 1JMOH 1AE5A 3RUOA 1OWEA 4NIXA 3RMOH 1GHAF 1V2ST 2HWLB 3VGCB 1V2OT 1V2LT 1GJ7B 1H8HD 4ZHMU 2GKVE 2UUKB 2VIQA 1GJ9B 4LZ4B 1MCTA 2Z6BD 1O3MA 2XCFA 1BUIA 1C5LH 1IHSH 3ZZ8A 1O3EA 1EXFA 2A5KA 1EKBB 1TABE 3SU6A 1F92A 3Q3KA 1C1RA 5B6OA 2FOGA 1XKBC 2ZP0H 2Z9LA 4NA8A 5FPTA 1NROH 2WYGA 3HKIB 1GHBF 4IMQA 1E38B 3RU4D 3SZNA 2VWOA 2BZAA 1FZZA 3F9GA 3P8GA 1F0TA 3RXFA 2ZIQH 3LJOA 4ABJA 2CK3D 2IOTA 2VIWA 4AFSA 1V3XA 5T6FA 5C17A 4R8TB 2ASUB 4B2AA 2H5DA 1EPTC 3AASA 1P02A 4XBBA 4B71A 3NZIA 5C1UA 1C2FA 3RU4E 4BTIB 1CO7E 1K1NA 1OP8A 1C5MD 1SLXB 5GCHG 1S0QA 1C5OH 3RXVA 3T62A 1KTSB 2L74A 1BRAA 1A1RA 1K28D 1N8OB 5JBCS 1OP0A 3SUEA 1ANEA 3KL6A 3K9XB 2VGCC 2ZCHP 1BRUP 1F7ZA 2FODA 3OY5U 4U2WA 2YOLA 1GBHA 1G30B 4GHQA 2WUCA 3SJKA 2GGVB 1O2IA 1AUJA 2F91A 4HGCA 1SOTA 3PROA 1EJAA 1P2JA 3ENSB 2BTCE 1ZRKA 1BTYA 4TPYA 1IQIA 4Z1MD 1AD8H 1AZ8A 2HPQH 2J9NA 1MD7A 3CENA 4WMDA 4B75A 1MTVA 1F0SA 2OC0A 4WMEA 2VINA 1EOJA 2VIVA 3FAOA 1KDQA 1TMBH 2ANYA 3BTWE 1QTFA 3NRLA 4ASHA 2J4IA 5A09A 3I77A 4NSVA 4YXWD 1K1IA 5LPEA 4U32A 3QX5H 2OC7A 1RD3B 3BTHE 2GCHG 3F0OA 3TK9A 1P01A 5KECA 1J9CH 1HJ8A 5F6MA 5GIBA 3UAIC 2BDHA 2M2AA 2OC1A 3QN7A 3P70B 5DP6A 1O3CA 2B0FA 5FCKA 1BTPA 3MOCA 4O3TA 3FZZA 1QBOA 3RXHA 1K9OE 2H1UA 1TRNA 1MH0A 1ORFA 1C1WH 2UWLA 3GS9A 2ZTXA 1H9HE 1TA2A 1GMDF 1GMCF 1RIWB 2W7UA 2I6QA 3F2GA 5B6LA 2HNTC 4O97A 1OSSA 1C1MA 4E05H 3U69H 2R9PA 4KELA 3EQ0H 5GXPA 3RXJA 1CHOG 3EA8A 3E8LA 1XMNB 5H4IB 2H9HA 2XBYA 1A0LA 1CT2E 1MZAA 2BY9X 3V3MA 4CH8B 1HAGE 2W6ID 4NWKA 2PTCE 2F9BH 2ZGBH 2JIZD 2JJ1D 1O2XA 1Q31A 1W7XH 1O2MA 4Y8XA 4X2XA 2H5CA 1Z7KA 3PV4A 4AX9H 3SJ8A 1XM1A 2Z9KA 4Y6DA 2AGGX 5C5NA 3UOUA 4IBLH 3ZVEA 1C5WB 4F48B 4LXBH 3P92A 1JXPA 1O3IA 1QJ1B 2PGBB 3GCTG 3SI3H 5ABWA 3FKSD 2PR3A 1GJDB 1TONA 3SV8A 3TNSA 2J92A 5FCRA 4AFUA 3LGWA 2QE7D 4UFEH 3B23B 1SFIA 3ZZCA 2R2WU 2AMDA 2SGDE 1PQ8A 2XBVA 2QF3A 4E7NA 2HVYB 1O2YA 3RC4A 1W0KD 4YTAA 4H4FA 1ZSLA 2AIPA 2FOAA 1E1RD 2PUXB 1BTXA 2ALVA 2VIDA 5K7RA 3MQKC 2FI5E 1SHYA 2FXRA 3SNDA 1UTPA 1QJ6B 3LPRA 1LQDB 4KP0A 1XUKA 3TITA 1TGBA 2AIQA 1PPFE 7GCHG 1KY9A 4RKJB 3ZZDA 1O2NA 1XXDA 1P06A 2Y80A 1FN6A 2W26A 3QDZB 3KQ5A 1GI0A 3BG4B 1MAXA 2ZU2A 1GGDB 3SGAE 1L1JA 1QL8A 2F9PA 3RXSA 1SGIB 2OP9A 2FPZA 3SUDA 5CMXH 1SQAA 4JZFH 1QL9A 1THPB 3PLKA 4RI0A 1EJMA 4B6FA 2BY7X 1NT1A 1C5TA 2UUYA 3GDVA 1C4U2 3UWJH 1KLIH 2BLWA 1N6YA 2FEQH 2C8XB 1TBRH 4ZKRU 1NTPA 5J4QA 1EZUC 1UVUH 2BXUH 4ZMAH 4CR5A 1TNKA 3E3TA 4OS1A 4IW4E 3NKKA 3QO6A 5DPAA 5HIYA 1GI3A 3VG8A 1ESTA 1YPGH 3DCLA 4U30A 4WWYA 1O36A 2FOHA 4XFQA 3A80A 1A3EH 3A7YA 1UJ1A 3UNRA 3A85A 1K1PA 2B5TB 3I29A 1DM4B 3TIUA 1D6WA 2H9EH 1TFXA 1GI4A 3CS7A 3ELAH 1D6RA 3FO8D 1WOFA 3MH6A 6GCHF 1RXPA 4FUGA 2D8WA 1J8AA 5JB8S 7KMEH 4GCHG 4F55A 1O2VA 3RLYH 1TX7A 1FN8A 3U8TH 1HCGA 1RS0A 1TPSA 3ZZAA 2TGDA 1DVAH 5E2PA 4DW2U 4FUCA 1QURH 2Z9IA 1Z1IA 5EU8A 3OEED 1AHTH 4DOQA 3BEFB 2FLRH 2F4LA 1SR5C 3HPTB 3W94A 3TH4H 4VGCC 2C3SA 1IQNA 2VVVA 3VFEA 8LPRA 1HRTH 3GYLB 1COWD 4OS6A 3NPSA 2KAIB 1KXDA 3I78A 3UREA 1ZR0A 6CHAC 1AWFH 3F9EA 3F9FA 1D3PB 1CA0B 1T8NA 4RSPA 2HLCA 4A1XA 1NC6A 1W0JD 3RXCA 1GCTC 3L6PA 1IOEA 3SV9A 1V2WT 1AGJA 4NFEA 1BOQA 3ZVBA 2WV4A 4NZQA 8KME2 2Y81A 1FAXA 1P2MA 4X2YA 4NWLA 1ELDE 1KXBA 1J17T 2RFKC 1EB1H 1C5QA 4X8SH 1W0YH 1MTUA 3D23A 1TGTA 3URCA 3SNBA 1BHXF 1Z8IB 1P09A 1AVXA 1ESAA 1QA0A 2FOMB 1GVKB 8GCHF 1Y5UT 1NU7B 2ZPSA 4Y7BA 1QHRB 3PWBA 3S9AA 1C5YB 1ELFA 1HIAB 1NESE 1H8DH 2RG3A 1O2WA 2NWNA 2R3UA 1GBMA 1O37A 1W2KH 1EAIA 4AB9A 2BD5A 2ANWA 1IQJA 2H2ZA 2ZC9H 2ANKH 2PKSC 3IWMA 4A5TS 1EPTA 1DITH 4TWWA 4BNRA 2K8IA 2ZNKH 1N1LA 5F53A 1WSSH 1VCWA 1W11U 1O3BA 2CF9H 1WQVH 2OCVB 1XVOA 1GHZA 4M7GA 1YGCH 4IGDA 1THSH 1MKXK 2VWNA 3Q3XA 1AVWA 1A5GH 2YMSC 1J16A 1NPMA 3IG6B 1TX8A 2ZEBA 1ARCA 1QB9A 3LC5A 3RXPA 2G00A 1ZPZA 2V7QD 2BXTH 1FNIA 4IC6A 1ZMLA 2FI4E 1SMFE 3SHAH 1DWCH 4CRCA 1SL3A 1T8LA 4UDWH 3LONA 4Y11E 1C5RA 4CHAB 2M5TA 2Y5HA 3LOXA 1GJ4H 1S82A 1HUTH 7ESTE 1FMGA 2ZPRA 1NRSH 1AU8A 1E79D 3MWIU 1O5AB 4FU9A 5GWZA 1FY3A 1FY8E 1O2ZA 1EZQA 3SI4H 1QZ8A 1Y3WA 1ELGA 2NU4E 1GCDA 3SV7A 4Y8ZA 4X6NA 2P8OC 1AKSA 4XOJA 2FYRA 6CHAB 3RXEA 1NS3A 1QB1A 2GJGA 3O8BA 2EI8A 1C2IA 1UK2A 2ZHDA 1HLTH 1UTKA 2BOKA 3RXLA 3F9HA 3F1SB 1V2MT 3UUZA 3WWFA 3A7WA 3FN8A 4BTTB 4YESB 2GD4B 2IPHA 3K6YA 4ACAA 1ZTKA 3EE0B 4XRNA 2ZECA 1O3PB 1XUGA 4F49A 3F6UH 4OS7A 2ODYB 4AORA 4AB8A 2BVSH 1C2HA 2Y5FA 3GDSA 5DP3A 5E0GA 4B73A 1H1BA 4JZ1A 4ABFA 3MU0A 2W7SA 1TIOA 2P94A 3UPEA 4CREA 3E1XB 4HFPB 4MDSA 4P02A 1DDJA 1OOKB 3LDXH 3NUMA 2W5EA 3BG8A 1ESBA 2VH6A 1VJ9U 2HGTH 1JOUB 4FVBA 1KXAA 1DOJA 2FTMA 1PPCE 1SGYE 1T7CA 1C1QA 2P3FH 2SGEE 3TK5A 3MTYA 4IN1A 1UTLM 1C4V2 1GI7B 2BLVA 1HAHH 4FU8A 3M5OA 4FVDA 2BLOA 1O3OA 1YCPH 1MTNC 4Y0ZE 1KIGH 1YYY1 2K0QA 6GCHG 2PHBA 4ASUD 2J94A 1EX3A 1ZSJA 4YLQH 3STIA 4JK5A 2KCAA 5EGMA 3ZIAD 4XBDA 4Y10E 2D26C 4B1TA 2QN5T 2V35A 4FUDA 1HAZB 5GCHF 2JDID 2Z3EA 5JB9S 1AVGH 2AS9A 2IJD1 2PFEA 3TK6A 3LJJA 4JYUH 1O3LA 5IK2D 4ZHAA 1C5UA 2ZDVH 2BYAX 5HGGA 1DSUA 2TPIZ 2ILNA 3KQCA 3DT0H 4DIHH 2WPMS 2VU8E 2XW9A 4TT3D 3RXMA 4ABDA 3SU2A 5C0TA 2FYQA 3VB3A 1O2RA 1G9IE 2O8WA 5A0CA 2Y6TA 1DWDH 1GBCA 4MPUA 1AB9C 4TYDA 1HAIH 1HYLA 1RJXB 2CF8H 4NG9H 4K1SA 3SNAA 1KYNA 5DP8A 3A87A 1RTFB 3KNXA 1CHGA 1O2UA 4K5ZA 1DUAA 3TJOA 1Z6EA 2BMGB 4K2YA 1WUNH 3QUMP 4HZHA 1W12U 3ZZ9A 1GL0E 1P11E 2GVFA 3V13A 4GSOA 1Q2WA 1OHHD 3OAAD 1GG6B 1WCZA 2WPKS 2QXIA 4X2WA 2V0BA 2V3HH 4IC5A 3SU1A 4E7RG 3MI4A 2G55A 3A83A 1LVMA 2BDCA 3HK3B 4VGCB 3FANA 1UK3A 1QR3E 4J1YA 4B2CA 1GI8B 1HXEH 1PQ7A 5EQRA 3SZEA 4AOQA 5A0AE 5CDFE 1FX0B 1RFNA 1ZLRA 5JBTA 5HM2A 2VVCA 3TJUA 1KTTB 1BMLA 2IPQX 4DJZB 2XRCA 1FAKH 3VB5A 2B7DH 2BD8A 2ZHQH 2P3TB 4YLUA 1Z8GA 5ESBA 2L6OA 1XKAC 2VH0A 1HJAB 2J98B 1O33A 2R3YA 3C1KA 2BQWB 4X6OA 4ABHA 5FL7D 1P04A 4GAWA 3SO3A 5CE1A 1HAPH 1UTNA 1QY6A 2Z3CA 4UONA 1O2SA 1YKTA 3LGVA 2QF5A 2CJIA 2ZQ1A 4TPIZ 2BDIA 3LIWA 2GV7A 1S81A 2A1DB 4BAHB 1GBIA 1EP6A 2SGFE 5CHAB 1DUEA 1DE7H 2QF4A 4K8YA 1B0FA 3FFGA 3RM2H 5DN6D 1JRTA 4UFDH 1JIRA 2P95A 3URDA 1MUEB 3LU9B 1QA7A 2A7HA 4ABGA 5A8YA 2FLBH 1FXYA 3JZ2B 3S69A 3KCGH 1ZHPA 2QGRA 3BTEE 1O2HA 2FWWA 2JKHA 1P8VC 2PKAB 2XXLA 3U28C 1HAVB 1GBAA 3BIUH 1SBWA 1AE8H 4YT6H 4THNH 1YF4A 4INHA 3AK5A 5DKMA 3NK8A 2QC2A 1EP5A 4KTSA 5DSFA 3VEQB 1C1OA 4BANB 2LPRA 3WW7A 1SVPA 1G37A 1BCUH 1EPTB 1W3CA 2ALPA 2ESTE 1S0RA 1YC0A 1TNGA 3HGNA 2ZFFH 3E6PH 2A32A 1LO6A 2KCPA 1ELTA 1ETTH 3B8JA 3TPIZ 3A88A 4NGAH 2OC8A 4OS4A 2ZCLP 1QQUA 1V2JT 2GCHF 1KMHB 3N7OA 3WWBA 2A7CA 2OBOA 4ABIA 4KGAA 1TQ7B 3ZYEA 1ANBA 3T26A 4UD9H 3T25A 2XBWA 2GCTB 1AY6H 1Y5BT 1F5RA 2Z9JA 3VB4A 3H5CB 1SGDE 3H09A 3MU1A 2LNCA 1BZXE 3MH7A 4X1SU 1L1GA 4BXWA 1ETSH 3QZQA 5ESTE 5SGAE 3GICB 1GJBB 2AHME 1SLVB 2ZHWH 1MCVA 5KEDA 1PFXC 2SGPE 1C2GA 2BZ6H 2A2QH 4OS5A 2QV1A 1THRH 1BT7A 4IN2A 3SJIA 2FOCA 1N6XA 4BXSA 1SG8B 4GVUA 2AGEX 1NRQH 1GHBG 1FY4A 1CQQA 3M7TA 3S0NA 1UK4A 1K1JA 2YNAA 5AFZH 3SQHE 4WVPE 3RXDA 3EAJA 3ZVCA 1QB6A 2C8ZB 3GCHB 1XUFA 5DK1A 1EAUA 2VWMA 2W3KA 1SFQB 1WTHD 2XC4A 4X8TH 1T4UH 3A7ZA 2AH4X 1D3QB 3SNEA 4I7YH 1OWHA 3ZZ4A 1H8ED 1YPMH 1BITA 5I25A 2V3OH 1SGRE 2WV5A 1W0ZU 2KM0A 4Y76A 3MNXA 1T8MA 1A7SA 1NRRH 1T32A 4ZHLU 1H4WA 1HPGA 2G4UA 4HI3A 4INLA 2ZGCA 3TGJE 1OPHB 2QYIA 5A0BA 3SN8A 2BD7A 3AW0A 3BEIB 1NBME 4JZDH 3DD2H 5FX5A 3A8CA 3TH3H 4MTBA 3RXOA 1O5FH 2SNVA 3VB6A 2P8OB 4PROA 1TBQH 1GHXH 4FUEA 3LH1A 1O3GA 2AERH 3PO1C 4ZAEA 3PLBA 2GP9B 2F9UA 3RLWH 1FPCH 4AZ2B 3IITA 1C5NH 1SLWB 2XCNA 5EJZA 5HXFA 2ZU5A 4XSKU 2RA0A 3Q77A 5C1XA 5DGJA 5BRRE 1VCQA 1IQMA 1LHCH 2LELA 2ZF0H 6LPRA 4XBCA 1ZHMA 3P17H 4TY7A 1DFPA 2ZDAH 1OS8A 4X1PU 1O3NA 2VIPA 2FM2A 1E37B 1EAWA 2XNDD 1ZRBA 5EQSA 2BY5X 1TNLA 2ZHFH 2HVXA 5CHAC 3GY4A 2DE8A 1RIWC 2G4TA 1FLEE 2Q6GA 1DX5M 1F0UA 1WV7H 1NFYA 5HM9A 4MG3A 3SYJA 1SHHB 1C2LA 4ZXYH 2Z9GA 4Z6AH 1KLTA 5E0JA 1QRWA 2BHGA 1OWDA 3P8NA 4MPWA 2A5AA
chains in the Genus database with same CATH topology
1BBRH 1BHXB 5FBIA 2BDAA 4FU7A 3A8DA 3TJNA 2AGIX 1RTLA 5DP4A 1PPHE 1YPLH 1TRMA 4BAMB 3UWIA 2BD9A 3KEEA 1HXFH 3E91A 3EGKH 1D3DB 2CMYA 1HAOH 1ZTLA 5FBEA 3FZDA 3D62A 1A0HB 1AZZA 3V12A 1GJAB 3EA9A 3KF2A 1GPZA 1YP9A 1CU1A 1O2KA 4DIIH 2HOBA 1C4Y2 1TRYA 3BF6H 2RDLA 3QTVH 1SGTA 1GCTB 3TGIE 1VR1H 2ZGHA 3OU0A 3SJOA 3M7UA 1O3FA 1Y3VA 3O8CA 4D7GA 1CA0C 5EW2H 5DO4H 1TGSZ 3M3SA 1IQFA 4UFFH 4AGJA 2O8MA 1C1PA 1O2LA 2A2XH 5FX6A 7LPRA 2A4OA 3M61U 1O5CB 1O3AA 1G36A 1HJAC 2FMJA 1V2NT 4YO9A 4WF8A 4O3UA 4CRDA 3RXIA 3A7TA 1KDQB 1LPGB 3ODDA 1SGQE 1O31A 1V2UT 1FONA 1EUFA 5I46H 1ELCA 5E8EH 2BB4A 4RKOB 4UEHH 3FP6E 1PPBH 4ABAA 1C5XB 1SGFG 1GJ8B 1DICA 3PLPA 1FQ3A 2Y5GA 5EXLA 1TX6A 4ISHH 5IYTA 4SGBE 4Q2KA 5TCCA 3U8RH 5F8XA 1KXFA 1V2RT 4CRAA 1PPZA 2RCEA 1GBFA 1EASA 1F2SE 1FY1A 1MQ6A 4OS2A 2PWXA 3M35A 1BDAA 1Z6JH 2OLGA 4CBOA 1UMAH 2G8TA 2BQ6B 2UUFB 2AMQA 1NO9H 3DFJA 3S7HB 1NRPH 5FPYA 1ZZZA 4I8JA 4FUHA 1SGPE 2GDEH 1HGTH 5DP9A 1SGEE 2FP7B 2HPPH 1WAYB 2TGAA 2UWPA 5FAHA 1LVBA 1HAVA 3GDUA 1B7XB 3ZV9A 2BY6X 3AW1A 1BMMH 1A5HA 1INCA 2HNTE 4X1QU 4B2BA 2RA3A 3PMHB 5DP7A 1MTSA 2DE9A 5F8ZA 1EJNA 3OSYA 2FX4A 2ZKSA 1YCPK 1XVMA 2ZFPH 1UTOA 1O30A 1UTQA 4D76A 1EZXC 4ISLA 1PYTD 1GHWH 5E2OA 1O2JA 1RRKA 3O8RA 3MHWU 1C9TA 3PM3A 5BPEA 1YLCA 5TCAA 2BD2A 2Y7XA 1HFDA 3GYMA 1A3BH 3KIDU 3LGYA 4NCYA 3ESTA 2BQ7B 3RC5A 1QNJA 4IS5A 5EODA 5HYOA 2FI3E 8GCHG 5EPYA 2ZDLA 5EPNA 1BQYA 2ZU3A 4MQAA 2ZTZA 2WPJS 4FUBA 1OYQA 1ZOMA 3F68H 3MO6A 2J2UA 2F9VA 3OY6U 2DUCA 2TIOA 3SU4A 1G32B 3TGKE 3KQDA 4NZLA 3UNQA 2QXHA 1DT2A 4Y8YA 1BTWA 3ATMA 1O2QA 2ZO3H 3BTTE 4IMZA 2A4RA 3BSQA 4FXGH 1CT0E 1C5VA 2OQUA 4ZH8A 3ZZ7A 1H9IE 1BJUA 2WPLS 2VB0A 1O34A 1IQEA 2HALA 4CR9A 5A8XA 1P9UA 3T27A 3PB1E 1TBZH 1LHGH 1HAYB 2C8YB 3ZZBA 2NU1E 2ZU4A 2STAE 1C1TA 1O5EH 1P2QA 2QIQA 2BX4A 2CN0H 4K60A 4KTUA 3GY3A 4X2VA 1L4ZA 2GZ8A 1E35B 2G51A 1OX1A 1VITH 2FO9A 1O2PA 3M36A 3TH2H 3V7TA 1P9SA 1MBQA 2BDBA 3A8AA 4BAKB 3SV6A 2ZG0H 1XUIA 3A86A 2JETC 1D4PB 1ZSKA 3MH4A 4X6PA 1BA8B 1ABJH 5C5OA 4Z0KA 1DS2E 3RDZA 1GI1A 1AO5A 2HNTF 4K1EA 4E06H 4O03A 1HJ9A 1P2OA 1TPPA 1WQSA 3NCLA 2C4FH 1AQ7A 1UHBB 2PKSB 3EDXB 2GV6A 3NXPA 4I32A 3SNCA 1W13U 2FX6A 3HGPA 1O5BB 2R0KA 1IHTH 1EATA 4BAOB 1BMAA 1GJ6A 1TWXB 1UTJA 2OTVA 3RXRA 4MPXA 2D1JA 2WYJA 4Q7ZA 4Y0YE 2QXJA 3E0PB 1EAXA 6ESTA 4JYVH 1P05A 3H7OA 2GTBA 2NU2E 5EW1H 3MU8A 5LPRA 1O2TA 1S85A 3D49H 2EEKA 3D65E 1IQGA 3GY6A 1BIOA 2ZDNA 4AFZA 3U1JB 1FUJA 2FTLE 1MZDA 1WU1A 1WYKA 2TBSA 1HB0B 1CGHA 3RMNH 2ZPQA 4BTUB 3PMBB 1LVOA 2A45B 3O8DA 1CT4E 1GG6C 1T31A 2A5IA 1FIZA 3HK6B 4F4OC 9LPRA 2Z3DA 1GVLA 3QZRA 4WMFA 3M3TA 1P10A 3SGQE 3KQBA 1N8OC 1MD8A 4GPGA 2J34A 4YOIA 2B8OH 1UVSH 1GHYH 3SHCH 4ABBA 1LHEH 1Q3XA 4CHAC 1MKWH 4CRBA 2O8LA 3SU5A 1VGCB 1QRXA 1G3BA 1Z71A 3SQEE 3ITIA 2SGQE 3BTKE 1HNEE 2QA9E 3ATWA 2I6SA 4D8NA 4INKA 4A1VA 5AVDA 4B74A 2XYAA 4Q7YA 1E36B 2FS8A 5L2YH 1BBRE 2VGCB 1V6DA 2ZFRH 1K1OA 1ABIH 1G2MA 1P2KA 1A5IA 1TNIA 2BLQA 1C2EA 1ZMNA 2OBQA 3ATIA 3R3GB 1GVZA 1O3JA 1OWJA 5LH8A 1C1UH 3RXKA 1T4VH 1LPZB 4CRFA 2AYWA 2Z7FE 1CHOF 1ZGIA 4BOHA 3DA9B 4YOGA 4WH8A 2QF0A 3QGNB 1YBWA 1JRSA 3GCHC 1UCYE 4CBNA 1PYTC 1XUJA 1ACBE 1BB0B 4J2YB 2FOFA 1DLKB 3MMGA 1GI6A 1TQ0B 2SFAA 1WTGH 1C2DA 2PV9B 1ZYOA 1O3HA 2F9OA 4JZIA 1UHBA 1CGIE 4MPVA 4SGAE 5ETXA 3UR9A 3K2UA 4DVAU 3PTNA 1XUHA 1DXPA 3DHKH 1SB1H 3GCOA 2GT7A 4DURA 1EQ9A 2THFB 4RN6A 3U8OH 2O8UA 5T3HA 1NFXA 2XNIA 3T2NA 1S5SA 2STBE 4NSYA 4FUJA 1QFKH 1CGJE 1DWBH 3ZZ3A 1YPHC 9ESTA 1P2NA 1MU6B 1PPGE 2BVRH 1TNHA 1J14A 1AKSB 3RXUA 3CP7A 4FUFA 1TMUH 2FZZA 3LH3A 3QK1A 3S9BA 4LZ1H 3LC3A 1GBDA 1GL1A 2F3CE 3EYDA 1GBLA 3L33A 3A7VA 2HRVA 1TMTH 1P57B 3MU4A 3M7QA 2A31A 1ZPCA 4CRGA 3S9CA 1EZSC 2TGTA 4NIWA 2ZI2H 1DWEH 1ANCA 2P16A 2EI7A 1ZMJA 1H9LB 4B76A 3MFJA 7GCHF 2XBXA 2ZDMA 1A0JA 3LGIA 2GZ7A 3SV2H 1UCYH 3LKWA 5F8TA 4KTCA 3M3VA 1P2IA 1ZPBA 1LKBA 1NN6A 1KXCA 3LGTA 1PPEE 3ZZ6A 5GJ4B 4MNWA 1HV7A 1V2PT 3NWUA 1GMCG 4K1TA 5TJXA 1O32A 1JWTA 3BTDE 5DJ7A 1BMNH 3P8FA 4ZXXH 2XWAA 1ID5H 3VPKA 1MTNB 2BDGA 2H6MA 1UCYK 4X6MA 4FUIA 2A0QB 1IQHA 5EOKA 1HAXB 2PSXA 3JZ1B 1BTHH 1LHDH 3QWCH 1Y3XA 3GY8A 2O9QA 2ZGJA 2GCTC 2FOEA 1JIMA 2KAIA 1AN1E 3C27B 5AHGH 2QAAA 1QBVH 3VXFH 3AVZA 5T6GA 4AG1A 3ODFA 1M9UA 4HTCH 1IQLA 1L0ZA 1GBJA 1NY22 3P95A 1BRBE 2CXVA 3QTOH 3SU0A 1NZQH 1RGQA 3RMLH 1AIXH 1V2KT 1ELAA 1HBTH 3TLOA 4ISIH 1Z8RA 1G3EA 1GDNA 1GWAA 2XC5A 2ZA5A 2J95A 4X0WU 3M5LA 1UO6A 1VCPA 1OXGA 4DY7B 2P3UB 4GCHF 3GCNA 4LOYH 1HDTH 4AFQA 1O3KA 5L6NH 3SUGA 2O8TA 1C2JA 1AUTC 4JK6A 1FI8A 1P3CA 1S6FA 8ESTE 3E16B 1MKWK 1HIAA 2UUJB 3A8BA 2A7JA 3TVJB 4ZUHA 1T8OA 2F9NA 3BTFE 3FP7E 1UVOA 3BTGE 1FV9A 3ATKA 3ZYDA 2IJOB 3PWCA 2NU3E 5AF9H 5C20A 1P03A 3RMMH 4ZKSU 5DP5A 1SQTA 2Z94A 1TALA 5A2MH 2OUAA 1SGCA 5IDKA 2A4QA 1OWIA 4MLFB 3A89A 1EB2A 3RXBA 1SGNE 5C2ZA 1C9PA 1VITG 1SC8U 3Q76A 2P93A 4I33A 1U6QA 2Q1JA 3A84A 1Y59T 3MU5A 1V2TT 5FXLA 3UFAA 5LGOA 1YM0A 1UTMA 1V2QT 5JBAS 2BX3A 2F83A 4XDEA 4GLYA 1QQ4A 1GHVH 1G3CA 4NFFA 1E34B 1FY5A 3A82A 4DGJA 3UQVA 3TJVA 3ZVAA 2BOHB 3PMJA 1O35A 4JMYA 4MNVA 4WXIA 4ISNA 3EA7A 3BEUA 4DG4A 1GI5A 5E0HA 1TGCA 1YPJH 4H42U 1FIWA 1TA6A 1K1LA 2AFQB 1P12E 1A4WH 1LQEA 1MKXH 2FIRH 4BAQB 1CE5A 2ANMH 2BD4A 2XC0A 3K65B 3Q00A 4Q7XA 4I8HA 4JYTA 4NIVA 1YPEH 2ZZUH 4QT8C 1GDQA 3E90B 2C90B 2AEIH 1K1MA 3T29A 5DG6A 1TPAE 3T28A 5L2ZH 2EA3A 1VJAU 5PTPA 1QGFA 4H6TA 1GMHF 2BDYA 3ZZ5A 1KLJH 1VITF 1H8IH 4TY6A 4OGYA 3RXAA 1QL7A 4WXVA 2TRMA 1MU8B 2ZFTA 1PQ5A 2B9LA 3E0NB 1AB9B 3PTBA 3UQOA 4AN7A 1AI8H 2GT8A 1LVYA 3BTQE 1DSTA 1S84A 1G3DA 2A4GA 2GDDA 3P8OA 1YPKH 2PKAA 2Y7ZA 2SGAA 2GMTC 3UNSA 3BN9A 3MO3A 3QGJA 3MNSA 1MTWA 5HMAA 1K2I1 1D9IA 3WY8A 3B9FH 4CH2B 4LK4A 3BG4C 1ETRH 4H6SB 1LPKB 1OKXA 4NIYA 1E0FD 3K6ZA 1C2MA 2C8WB 4XE4A 5J4SA 4DCDA 2VIOA 1ELEE 3SORA 3HATH 2V6NA 3RXQA 5T6DA 1F0RA 3M5MA 1PJPA 1YPHE 1BTZA 2JH6D 2ZU1A 4TWYA 5EQQA 1J15A 3U9AH 1GBTA 2GX4A 3FP8E 1ARBA 1Z1JA 3RM0H 1GMHG 3KGPA 2EC9H 1NFUA 1TE0A 1GHAG 2ULLA 1CSOE 1A2CH 4D7FA 2VNTA 3DFLA 3MNCA 2PW8H 3SOSA 3RP2A 2ODPA 4D9RA 1K22H 1GI9B 1KXEA 3U1IB 1ANDA 4YZUA 1DLEA 3VB7A 4AG2A 2QXGA 5FHTA 4K8BA 1C1VH 1SLUB 1CBWB 2ZFSA 3P6ZB 1K21H 2H9TH 4X8UH 2QCYA 4ABEA 3TU7H 1QBNA 2J38A 2CV3A 2W3IA 2FDAA 2FOBA 1FPHH 2VVUA 1V2VT 4NA9H 2G52A 1C5ZB 4D9QA 2Y82A 3SJ9A 1SI5H 3AAUA 5LPFA 1DY8A 4I8LA 2P59A 4ISOA 2JH0D 2ODQA 1W14U 1L2EA 2PGQB 2YNBA 1GJCB 1DANH 1DY9A 1DXWA 5EG4A 1UVTH 5JPMH 2VJ1A 2Q6FA 1O3DA 3OX7U 2ZQ2A 3UR6A 1O39A 3HKJB 3KHVA 1S83A 1X7AC 4JCNA 1LCYA 2AMPA 4GUXA 1ELBA 3LGUA 2R0LA 1NU9A 1FJSA 3MYWA 3GY7A 4A92A 2EI6A 4UFGH 1W8BH 2ZHEH 4DT7B 1BJVA 1O5GH 2D2DA 2Q6DA 1WBGB 2WPHS 1O5DH 4YOJA 2OQ5A 3M5NA 4Y71A 1QIXB 3RXTA 3SBKA 1BTUA 3GY2A 2OXSA 3R0FA 1Z8JB 4O9VA 1TAWA 1NRNH 2K1QA 1NFWA 5K0HA 4OGXA 4U01A 1W10U 2WPIS 1YLDA 1F5KU 1A46H 2PLXA 1IQKA 1S6HA 1L4DA 1SPJA 1BRCE 4ZROA 2BD3A 2CHAB 1ZTJA 1O0DH 1ZGVA 2OINA 1B0EA 3L3TA 3BIVH 1TNJA 4MNYA 4AGKA 2G5NA 5EXMA 1QCPA 1AFEH 4A1TA 1C2KA 2SNWA 1B5GH 2ZTYA 2R2MB 1P3EA 1GBKA 1OWKA 5C3NA 1AFQC 1QJ7B 3Q3YA 1AFQB 1O38A 1TB6H 4WH6A 1CBWC 1LKAA 2CGAA 1C1NA 1SGFA 3UIRA 1GMDG 1PQAA 1A61H 4A6LA 1G2LA 1KSNA 1IAUA 4Q80A 5FPSA 1L1NA 1OP2A 2ZGXH 2JH5D 1P0SH 4A7IB 4X1RU 1RTKA 1W7GH 1MAYA 1F5LA 3A7XA 1NM6A 1VGCC 2PUQH 1LMWB 1O2OA 4AYVB 2BVXH 3UTUH 5C67A 3ZVGA 1TGNA 4WJG2 1TPOA 4X1NU 1LDTT 3ATLA 2VWLA 3STJA 3KQEA 2C93B 4JZEH 3V0XA 1OYTH 3PYHA 4K3JA 3GCTF 1ELVA 3S7KB 2ZDKA 3SU3A 3AAVA 1TYNA 1ZJDA 5GPIB 4X8VH 2BM2A 1GGDC 1Y3YA 5AFYH 4YT7H 3U98H 2JETB 1MMJN 2GMTB 3T5FH 4Y79A 3LT3A 4WY3A 1DPOA 3VGCC 1ZJKA 3MO9A 2XTTB 1FDPA 3MNBA 1UVPA 2TGPZ 2XWBI 3DUXH 3TNTA 1D3TB 1C5PA 3SW2B 5C1YA 3RU4T 1C1SA 1LTOA 1AWHB 2IN2A 1C5SA 1MQ5A 1SQOA 3BTME 5JYIA 1EOLA 3QLPH 1CVWH 3G01A 2ZWLH 1ZHRA 3SUFA 1GBBA 2ZFQH 5F03A 5JDUB 2WINI 2UWOA 1TLDA 1Y8TA 2BY8X 3A81A 1GJ5H 4ESTE 1GDUA 1Y3UA 1GI2A 3H7TA 3CS0A 1JBUH 2PTNA 5JBBS 4ZKNU 3RC6A 1YCPM 4MVNA 2PSYA 3PO1B 3FVFB 1O2GH 4I31A 1BBRK 2NU0E 2GZ9A 1TOMH 3KN2A 2G81E 3UY9A 2FS9A 1XX9A 3W95A 3SGBE