2OLGA

Crystal structure of the serine protease domain of prophenoloxidase activating factor-i in a zymogen form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
276
Chain Sequence
RNRRPELLPNDCGYQVEADKILNGDDTVPEEFPWTAMIGYKNSSNFEQFACGGSLINNRYIVTAAHCVAGRVLRVVGALNKVRLGEWNTATDPDCYGAVRVCVPDKPIDLGIEETIQHPDYVDGSKDRYHDIALIRLNRQVEFTNYIRPVCLPQPNEEVQVGQRLTVVGWGRTETGQYSTIKQKLAVPVVHAEQCAKTFGAAGVRVRSSQLCAGGEKAKDSCGGDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRDWIEGNIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pro-phenoloxidase activating enzyme-I
publication title Crystal structure of the serine protease domain of prophenoloxidase activating factor-I
pubmed doi rcsb
source organism Holotrichia diomphalia
total genus 66
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA01
1YLCA 4MVNA 3STIA 1EZSC 1WV7H 4BAMB 1SOZA 3GCHC 3QZQA 7LPRA 1A1RA 5G4BA 1GMCF 2Z9JA 1N6XA 3SNEA 1DITH 1UCYK 2FP7B 2GZ8A 2XCNA 2J2UA 4E7RG 4B2CA 1RTLA 1O3AA 1OKXA 2FS9A 1CA0B 2H5DA 3RXOA 1TNKA 3C1KA 4FUEA 1GMCG 2V3OH 1VGCB 1EPTB 3TIUA 2ZFSA 1W8BH 2SFAA 3TH3H 1HAPH 1GI5A 1HJ8A 2CN0H 1GL0E 2DUCA 1O3JA 2G8TA 4ZXYH 3RUOA 4A7IB 2YNBA 1SGNE 2ZFTA 1RJXB 1TNJA 3FANA 4XBBA 3RLYH 3SU0A 1EB2A 2XBXA 1GBAA 3M35A 3MU0A 5ETXA 2ZIQH 3A81A 2QY0B 3DT0H 3NPSA 1ZHMA 1O3DA 1QRZA 3TNTA 1PPEE 1W10U 1DLEA 1O3NA 1VCWA 3MNBA 2Z3DA 5DP8A 3SZNA 3UNSA 1JWTA 3M3VA 4YOIA 1C2HA 1CO7E 1EXFA 2WV5A 1EOJA 1JXPA 1P03A 2ZPSA 1DICA 4X6PA 3D62A 1MCTA 1FN6A 2OUAA 3VB6A 4JMYA 1EJAA 4D9RA 3UTUH 1V2TT 4GCHF 5A09A 1BJUA 2FO9A 4NA7A 1SR5C 2W5EA 2VH0A 3C27B 1GJ4H 2PWXA 3ZZAA 1VR1H 3M61U 3UREA 3L3TA 2KAIB 1O35A 4Y0ZE 3BN9A 1ESBA 1VJAU 2F9VA 3K65B 2HVXA 3EA7A 4GCHG 1SGFA 3ZVAA 1BT7A 3CS0A 4NSVA 5C1YA 1LHFH 3O8BA 2FOGA 4I8JA 3ZZDA 1S6HA 2ANWA 1SFQB 4Q7ZA 4IMZA 1LVOA 3HGNA 1DY8A 2DE9A 1TBRH 2GT8A 3DFLA 2M5TA 2A0QB 2ZG0H 1EUFA 1O3IA 1UHBA 5GXPA 3A89A 2Y7ZA 1ETRH 1A46H 2FPZA 4A1XA 3E0NB 2Z9GA 3LPRA 3NXPA 1G37A 1J8AA 2NU0E 1W0YH 2A45B 2C8XB 1V2KT 3BIVH 1Q31A 1C1OA 4Y76A 2FYQA 1CSOE 2SGAA 4X6NA 1FLEE 1ZTKA 2TPIZ 4DVAU 5FBEA 4AOQA 2Z3CA 1O3CA 1HXEH 2EA3A 1G2LA 4Y7AA 3OSYA 2BZ6H 4AGKA 1M9UA 2BQ7B 3FAOA 1TYNA 2A7HA 1K1IA 4RKJB 1QR3E 1ZMJA 3AVZA 1SGCA 2ZDNA 3V3MA 2G4UA 4JYVH 3TLOA 4NIXA 4B76A 1JIMA 2Y6TA 2AYWA 2XW9A 3GY3A 1L0ZA 2R3UA 2FS8A 1GBFA 2XXLA 3K6YA 1XUJA 2QF3A 5C5NA 4X1NU 1YBWA 3GISB 2PGBB 4KTSA 4CHAB 1O3EA 4X2VA 2BD3A 3MH7A 4DW2U 4DT7B 2WUBA 3SU1A 1HDTH 1MD8A 2BMGB 2FM2A 3BTQE 2IOTA 1J16A 4CH2B 3SJIA 5B6OA 2RA3A 1S85A 3RMLH 4LZ4B 4ISIH 3SU2A 2STBE 1MTWA 4FUBA 3RXKA 1H8IH 1AWHB 2CXVA 1Z8RA 1AFQC 4JZIA 5IDKA 3RXJA 1AVWA 1GDQA 1PPZA 1OOKB 4CRAA 1JIRA 3GDVA 3CS7A 4BXSA 1C1QA 5T3HA 4Y8XA 3TPIZ 4MNVA 3NUMA 1BZXE 4ABEA 1AMHA 3SJ8A 3RXSA 1YC0A 2BD2A 2RDLA 3A8BA 1Y3UA 3SI3H 3EYDA 2ZQ1A 2EC9H 1UVUH 1VZQH 2Y5FA 3GOVB 4UEHH 4ZMAH 1S0RA 3K6ZA 2R3YA 2WPHS 1P3EA 1H1BA 1NZQH 2F9OA 1VITH 3MI4A 1P01A 1GBCA 1GBHA 4JYUH 2GZ7A 1NRQH 3Q3XA 1KTSB 2PKSB 2P8OC 1ELAA 2VIVA 3W94A 3KHVA 1LO6A 1WQSA 1UCYH 1C1RA 1C5ZB 2VIPA 2VH6A 1JBUH 1C5WB 4YOJA 3S7HB 1NRSH 3EAJA 1Y8TA 4WWYA 3URCA 1GG6C 1S5SA 4FU7A 5JB9S 1MTVA 4UONA 2BVXH 5FPSA 1WOFA 4D7FA 1MZAA 1FNIA 2HOBA 2ZA5A 1YCPM 2VU8E 1AKSB 5TCCA 2YNAA 3LGVA 1WBGB 1TBZH 1MH0A 3B23B 3ZYEA 1MKXK 3DD2H 1PFXC 1ZHPA 2PLXA 4K5ZA 3ATLA 1K1PA 1YCPK 2P3TB 3BV9B 3MH4A 3LOXA 1QIXB 1IQGA 2A4RA 2VWNA 3M5LA 1OYQA 2BDYA 3SV2H 1DVAH 5FCRA 3LGIA 1FZZA 3ZZBA 2AMDA 2GKVE 4FUFA 3SJ9A 4IMQA 4D7GA 3P8GA 4D76A 2VWOA 3KCGH 2BOKA 2OD3B 2QN5T 4ZKOU 1C2LA 2FXRA 2OQUA 1QB9A 2BDIA 2G00A 4IS5A 2UUYA 4TY6A 3NCLA 1PPHE 4XFQA 3TGJE 1AO5A 1C1PA 1ETTH 5ESTE 2P16A 1BDAA 5HM9A 2OBOA 1FONA 1BRAA 3EDXB 2BLOA 1ID5H 3PMHB 2WPJS 3M37A 1LHDH 2G81E 1HLTH 5GIBA 1EZUC 2BVRH 4UE7H 3UQOA 1SG8B 1C5QA 2W3KA 1YPHE 5EQSA 8ESTE 2GZ9A 1Z6JH 1DSTA 1KIGH 1QL8A 1EATA 3KN2A 4Y10E 2Y5GA 3QX5H 1BTHH 2CF9H 3BG4B 3ITIA 2R2MB 4OS5A 1E36B 1HIAB 4U32A 4O3TA 1SGYE 4FUJA 1C2JA 1SFIA 1A0JA 3BEFB 4O97A 1LQEA 1S0QA 5F8XA 4I8HA 1RD3B 1ZTJA 1O5GH 2P59A 1TABE 1HAZB 1QQ4A 2QC2A 4TWWA 5FX6A 2HPQH 1SGTA 1HAHH 1P10A 1V3XA 1YLDA 1S84A 2ODQA 1RXPA 2CGAA 5FHTA 6CHAB 3E91A 3TH4H 1WCZA 8LPRA 5DP9A 2XBVA 1A3EH 2NWNA 3PTBA 5DO4H 1T4VH 5DGJA 1O3MA 1XUHA 2GT7A 4GHQA 1O2PA 1A0LA 4XE4A 1P2OA 2ZKSA 2BXTH 3ZZ8A 1IQJA 2A1DB 1HJAC 3MU4A 1NRPH 3A85A 3ZV9A 5K7RA 1GMDF 4OS1A 2FI4E 1V2QT 2V35A 4K69A 1TALA 1EJMA 5GPIB 1G3DA 3RU4D 5A0CA 1P09A 4O3UA 3SHCH 1V2RT 1C1WH 1QHRB 1FN8A 1TMBH 3E1XB 4XSKU 1TGCA 4BAQB 5J4SA 1GMDG 3BF6H 4HI3A 4ZAEA 2BQ6B 5LPRA 4NCYA 1LTOA 1FAXA 5C5OA 1HB0B 1QA7A 2BY8X 2GGVB 4X6OA 2J95A 1GI3A 1C1NA 1T8NA 1KTTB 3V7TA 3LIWA 1HAXB 3BTTE 4TYDA 1GBLA 4Z0KA 1K1MA 3AW0A 2F9NA 3GY2A 4DIHH 5JBTA 1HAYB 3KQDA 3SORA 2ZCKP 1QBNA 3A8CA 1GBEA 1V6DA 1MKWH 2AIPA 3MU5A 1LCYA 2BLWA 1UK3A 2VB0A 3RXMA 1YPMH 1AZ8A 3A7ZA 4Y8YA 5T6FA 4YLQH 2FI5E 1OWKA 1O0DH 4AYYB 3U8RH 3FZDA 4J2YB 2CHAB 1ZTLA 1CA8B 1O5BB 3SQHE 1T31A 1UVSH 2Y81A 1TB6H 3V12A 1NFUA 2IPHA 4LK4A 1KXFA 2GV7A 4LXBH 3ZVCA 4MDSA 4BAHB 1CGHA 1B0FA 4FVDA 2ZGXH 1HJ9A 2ZHEH 1GVZA 2PUXB 3A7XA 1DOJA 1XX9A 1FPHH 3QO6A 1ZRBA 2F91A 2RCEA 1ABJH 1P3CA 1ANDA 1S83A 2VJ1A 1C5YB 4E06H 3GY6A 2FTLE 1O5EH 1LDTT 4K3JA 3SNAA 1NM6A 4X8TH 3A80A 4FUIA 2A5KA 1O2OA 1UMAH 3SW2B 3Q76A 3MMGA 2Z9LA 1OWIA 2OINA 3MH6A 3BTEE 4GVUA 1G2MA 3BTDE 1BMLA 1IQIA 1O3GA 3ATKA 4INHA 1D6WA 2OC7A 1ETSH 3D65E 3O8RA 1EPTA 1C2FA 3AW1A 5A8YA 1C5NH 1YCPH 4KTUA 1C2IA 3MWIU 3F1SB 1QBOA 2BB4A 5E2OA 1SQOA 3VB4A 4X1RU 4JZDH 2LNCA 3VGCC 1P11E 1K2I1 4D8NA 3PMBB 3RXAA 5I25A 2FOEA 2WINI 3LH3A 4K8YA 1GCTC 1PJPA 5AVDA 1YPGH 2FLRH 1O2IA 1BRBE 3L6PA 3A7WA 2VGCB 4ABGA 1C5XB 2ZECA 2ZFPH 2A2QH 1AB9C 1BHXB 1KXBA 2WV4A 1U6QA 3W95A 2OC8A 2BHGA 2QGRA 1MUEB 1DWBH 1DFPA 1C2EA 2TGDA 1A5IA 3D49H 4OS4A 4AFQA 4VGCC 1MTNC 3VXEH 4NIVA 1EASA 2ESTE 3A84A 3UOPA 4F4OC 3RXVA 2H9TH 2HALA 2R2WU 1EP5A 2P3FH 4GHTA 1W12U 1TRNA 3T26A 2PV9B 5EQRA 4O03A 1HAVA 3F6UH 3SV7A 4UD9H 3PLKA 1A5HA 2ZFQH 1NRRH 2D26C 3P70B 1H8DH 3I29A 2ZHQH 2XCFA 4NFFA 3RXHA 5GJ4B 1C9TA 3JZ2B 2HWLB 2Z9IA 4AZ2B 4A1TA 1KLIH 1KDQB 1C5TA 5FPYA 3ZVDA 2O8TA 1V2NT 1GDNA 1OSSA 1LHGH 1GBMA 5A0BA 4I7YH 4WXVA 1LVBA 1TLDA 1TIOA 1C4Y2 3BTWE 1RIWB 1GPZA 3LONA 3RXRA 4NIYA 1IAUA 3ZZ9A 1SGRE 1Z8IB 2ZGCA 1BQYA 1C5UA 1FV9A 2AFQB 3UR9A 9LPRA 1L2EA 3CP7A 2VVUA 4U01A 1K1OA 2O8UA 3GCNA 1HXFH 1XMNB 2D8WA 2RA0A 1JRTA 1C1MA 3ATIA 3GCTF 1ZSJA 3HK6B 2XBYA 4LOYH 3DHKH 3MFJA 4ZROA 1FAKH 3ZVGA 1P2KA 2XWAA 3BG8A 3TK9A 2XC5A 1LVYA 3MU8A 1ELFA 4CRFA 2PKAA 2GCTB 1O3FA 4I8LA 1OWEA 3MNCA 3KIDU 3SHAH 1Y5UT 4SGAE 2A32A 2HNTF 3GCTG 2EEKA 2WPKS 4B75A 4UFEH 1ZOMA 4DIIH 4CRDA 1HAIH 1C2MA 3EA9A 3RXIA 8GCHF 1BBRE 3I77A 2O8WA 3SUEA 2C8YB 2W3IA 3F9EA 1BCUH 5AFYH 1CGIE 3OX7U 2G51A 3P6ZB 4GSOA 2ODYB 1TFXA 2FOAA 3GDUA 1XUIA 5EOKA 1E37B 8GCHG 1CA0C 1J9CH 1CHGA 2XRCA 4AB8A 2UUKB 2C4FH 2GX4A 1CGJE 2QIQA 1N6YA 3P8FA 1EPTC 2BDBA 2EI6A 1GGDB 2ZQ2A 5F8ZA 4TPIZ 3T2NA 1D4PB 3ESTA 3D23A 2A5AA 2H2ZA 1BHXF 1P2JA 1TRYA 1Z71A 1GJ6A 2BVSH 3PO1B 2ANYA 1QY6A 4MG3A 1Y3XA 2FI3E 4I31A 3KQBA 4UFFH 8KME2 3SJKA 2ZGHA 2VNTA 3GCOA 2ZU3A 1MD7A 1GJ5H 1A61H 2BD9A 1O30A 5EODA 3A7YA 4BOHA 4YT6H 3MU1A 2O8MA 5E0JA 1ZGVA 1O2MA 1NTPA 1QB1A 1C5OH 2OBQA 2AGIX 2FODA 3RXBA 1AD8H 1A4WH 1MU8B 1TONA 2V3HH 4X2YA 1GI4A 1PPFE 3U8TH 1WU1A 3RMOH 4E7NA 3PMJA 4WVPE 5DP4A 2C8ZB 4FUGA 3ZZ6A 1UO6A 1BB0B 2ZU4A 4IW4E 5HYOA 2QA9E 4I33A 1ZJKA 1F5RA 5JB8S 4CH8B 5EXLA 2PGQB 3RXPA 1QL9A 1GJBB 3TJUA 2FX4A 4NA8A 1QQUA 1BTYA 2ZDAH 1O34A 2ALVA 4TWYA 4IN1A 4M7GA 3EQ0H 2FEQH 4X8UH 2A7CA 3NZIA 1BIOA 1LKAA 2JETB 1BRUP 1FDPA 1LPKB 1DE7H 1KLJH 4FU8A 2ZHWH 4FU9A 4WJG2 3RP2A 1SQTA 3IG6B 3SNDA 3S9AA 4ABIA 1NY22 2W7UA 5CHAB 2W26A 1O2HA 3U8OH 1O2TA 4CRGA 5DKMA 2B7DH 4ABAA 1UHBB 3SU4A 6ESTA 3UIRA 3O8DA 1ARBA 1EOLA 1UK2A 1A2CH 1TGNA 3U1IB 3QK1A 4IBLH 1J15A 5TJXA 1BMNH 7KMEH 3M5MA 3P8NA 3E3TA 3SQEE 1K28D 1YPEH 5LPEA 2ZP0H 3ENSB 3U69H 2I6SA 1V2OT 3RXCA 3TVJB 1YPJH 3UFAA 1CHOF 3ZZ7A 4H4FA 5GDSH 1FY1A 1K1LA 4MNYA 2ODPA 2J9NA 2BY5X 2BD4A 4R8TB 2A4QA 5F03A 3A83A 2J34A 3GY8A 3UR6A 1C5PA 1CHOG 3KQCA 3ODDA 5JBCS 2LPRA 2BD8A 1D3QB 5FAHA 2ZDMA 3UPEA 5EGMA 1HIAA 1RS0A 5I46H 2PW8H 1CQQA 3LDXH 5HM2A 1EJNA 1QL7A 3SNBA 5E2PA 2Q6FA 1G32B 4O9VA 2ZCLP 3RC4A 2DE8A 4YO9A 3BSQA 4GPGA 1Y3YA 2ZWLH 3BEIB 3RXFA 4CHAC 2FOMB 1H9IE 1Y59T 1C1VH 3QZRA 3FFGA 1Z6EA 3PB1E 3M5NA 4HGCA 4ZKSU 1ANEA 2A5IA 1MQ6A 1NO9H 5FBIA 1G9IE 4ABFA 2HLCA 1INCA 2BY6X 3FVFB 1TGSZ 4NZQA 3HPTB 2ASUB 1TGTA 3SU6A 1CVWH 2I6QA 3RM0H 4AFZA 4YESB 4ISLA 2Y82A 4FXGH 2IN2A 4IGDA 1W14U 4Q7YA 1DM4B 3BTHE 3TH2H 5CMXH 1SQAA 3KEEA 3PLPA 1TX6A 2J92A 1PPCE 1D3TB 4NZLA 1GHZA 4FUDA 3VXFH 2GCHF 1A7SA 2GDDA 3A7VA 3BTFE 3SV9A 1C2KA 4OS7A 2QYIA 4A5TS 3GY4A 3M3SA 4HFPB 2VVVA 5E0HA 1EP6A 2PTNA 2FLBH 4Y11E 2V6NA 2CV3A 1F0TA 2H9EH 2ZO3H 1OWJA 1NT1A 1V2UT 3UNRA 2ZTZA 1J17T 2GCHG 1CBWC 1O39A 1UTOA 2WUCA 2GVFA 5AHGH 4B2AA 2BDAA 2IJOB 2XWBI 3QTVH 2QV1A 3LJOA 2PKSC 1O2NA 1NRNH 2Q1JA 5DP7A 3F9GA 3TGKE 3SI4H 3T29A 3BEUA 2BLQA 1HAOH 4Y79A 4QT8C 4Y8ZA 2OXSA 3R0FA 3QTOH 2PFEA 5JDUB 2VINA 5CE1A 2ZFFH 5FXLA 3QLPH 4BTUB 1EKBB 2BTCE 3T28A 4RN6A 2ILNA 1K21H 4Z6AH 4ABJA 2QF0A 5C20A 1FJSA 5ABWA 4I8KA 1MTSA 3FZZA 1LKBA 4BTIB 5T6GA 1T4UH 3OYPA 2FOBA 1QRXA 2H5CA 1T7CA 3E90B 1MTUA 1KLTA 3UUZA 5LPFA 1ZSKA 1SGFG 4E05H 3GICB 1NFXA 4MPVA 3PYHA 1V2PT 1W7XH 4JZ1A 2R0KA 3MH5A 4JZFH 3SV8A 3FP8E 2GV6A 5FCKA 2CMYA 2O8LA 2BY9X 4MNXA 5EXMA 3S7KB 2Y7XA 3NKKA 1THSH 2PR3A 4A1VA 1RGQA 2TGTA 4ZH8A 1MAYA 9ESTA 1EAUA 5TCAA 3A82A 1PPBH 3SNCA 1RTKA 1D9IA 1FY3A 3T25A 1GJDB 1CT4E 1XUGA 3MTYA 1PYTC 1BBRK 1ELTA 1G3EA 3TNSA 3SBKA 2WPIS 1ARCA 2C3SA 4H6SB 1SOTA 3EE0B 3UY9A 1L4DA 3DUXH 5DG6A 3F68H 1O38A 3LC3A 2GMTB 1TPPA 1KSNA 1GBJA 1IHTH 1QB6A 2FOFA 1WYKA 2F83A 5EXNA 3RC5A 3OTJE 1ORFA 4MLFB 4DGJA 5K0HA 2C8WB 1TNIA 1TRMA 3UQVA 3LH1A 4GUXA 1MBQA 3HGPA 4K1EA 1F0SA 3DA9B 2B8OH 4X1SU 1HUTH 1H9LB 2XNIA 3ZV8A 1IQMA 4RSPA 1O2KA 1E38B 3SV6A 2VWMA 5GWZA 4X1QU 3HATH 1HYLA 3GY5A 2TIOA 3H5CB 2ZI2H 1ZMLA 2BQWB 1GVKB 4Y6DA 1AGJA 1DX5M 4CRBA 1GJ9B 1BOQA 4WMFA 5L30H 1AE8H 3PWBA 3SGBE 4X8VH 5A8XA 1SGPE 1E35B 3BG4C 1UJ1A 4NWKA 1IQHA 1HCGA 1EAIA 1TGBA 1W11U 4KTCA 4NWLA 3BTGE 1O5DH 3RXGA 2GDEH 1XKAC 3Q77A 1GHAF 1DWEH 2ZDKA 4ISOA 4DOQA 3RXTA 1TA2A 3UWIA 4JCNA 3SUDA 6CHAC 4NSYA 2PSYA 2AMQA 2PSXA 4XBDA 4INKA 2BDGA 1DWDH 3FP7E 3T62A 1TX8A 1G3CA 2Y5HA 1P05A 2BX4A 4MPXA 1MTNB 1GHAG 2THFB 1GL1A 3GCHB 2OC0A 1A5GH 3RDZA 3RU4T 1P2NA 2B9LA 4WMDA 2UWLA 2ZDVH 4IC5A 2BM2A 2OTVA 1XVMA 1UK4A 1ZZZA 4B1TA 5C3NA 1DSUA 2FOHA 1X7AC 2QXGA 2ZGBH 4MNWA 1T8OA 3MNXA 1KXEA 2UUJB 1OWDA 1WQVH 1MKXH 1DLKB 1O2XA 1PYTD 4TPYA 3B9FH 5EW1H 3R3GB 1VITG 3E8LA 3TJNA 2ANMH 2ZC9H 2QCYA 2SGQE 4KGAA 3URDA 1RRKA 1FUJA 2BY7X 4BANB 5C1UA 1NPMA 4F49A 3M5OA 5LGOA 1HAGE 1LHCH 4KELA 2WPLS 4X2XA 1KDQA 2EI8A 1GJAB 1QGFA 1DWCH 2WYGA 4GAWA 1AUTC 1CT2E 1QJ1B 1S82A 2UWOA 4AX9H 3O8CA 4ZKRU 3QGJA 2A4OA 1AVGH 1AZZA 4J1YA 4SGBE 1YYY1 1AE5A 1O2VA 4AFUA 2ZU2A 3QDZB 4MPWA 3MNSA 3PLBA 1K1NA 1P9UA 4YTAA 3KL6A 1O5AB 2CHAC 1FQ3A 1HV7A 1NC6A 1ELVA 3RMNH 5EW2H 1O5FH 2AGGX 2AMPA 3RC6A 1C4U2 4ISNA 1P02A 3ZZCA 4FUCA 5AFZH 1Y5BT 1FMGA 3OY6U 1CE5A 1PQ5A 1C9PA 2ZTYA 3Q00A 1G3BA 3M3TA 4A92A 5DP3A 1FIWA 3RXQA 1YPKH 2PUQH 1O3HA 4NIWA 2BD5A 2KAIA 4U2WA 4OGXA 7GCHG 2FMJA 3TJVA 4U30A 1TX7A 1MMJN 2ULLA 3QN7A 1F0RA 2Z3EA 2ANKH 4Q7XA 5DPAA 4CR5A 1AU8A 1YKTA 4XBCA 5DK1A 3K9XB 2ZPQA 1ZMNA 1NESE 4MQAA 1K1JA 4AGJA 7ESTE 3PV4A 1BTUA 4K1SA 4AFSA 4IN2A 5BRRE 3MHWU 2HNTC 3E0PB 3NK8A 5C2ZA 1O2WA 1TBQH 3RM2H 1C2GA 2SGDE 4PROA 1H9HE 2Q6DA 4NG9H 2Q6GA 3PWCA 4I32A 2R0LA 3VEQB 3LC5A 1VJ9U 2AERH 4YZUA 3ZZ5A 2NU1E 3IWMA 1NS3A 1XVOA 3QGNB 2YOLA 4Q2KA 1UTJA 4ABDA 1O3BA 1P57B 1P06A 1CT0E 5A0AE 1RFNA 1SLWB 2AH4X 1OS8A 1PQ7A 1BBRH 2UWPA 3SU5A 4UDWH 2OQ5A 1W13U 2P94A 1TE0A 1XUKA 1YPLH 2CJIA 2ZHFH 2VGCC 2A4GA 5EU8A 5EG4A 3P92A 3WY8A 6GCHF 1AIXH 4X2WA 3RXLA 4CBOA 2QXJA 1OPHB 4WXIA 4DURA 2B5TB 1UVOA 1WTHD 3JZ1B 5J4QA 1SB1H 2SNWA 6GCHG 2C90B 1C5MD 1N8OC 5EQQA 1TOCB 3VB3A 5C1XA 1O2SA 3Q3KA 1FI8A 3A86A 1O2QA 4MTBA 1XUFA 2BX3A 1P04A 2F9PA 1F0UA 4Y71A 1DUEA 4JYTA 3T27A 2TGAA 3LGYA 1V2VT 3F9HA 2AGEX 1AWFH 1THRH 1HAVB 3S69A 1AFQB 1L1JA 5E8EH 3SU3A 2ZU1A 2NU4E 1VGCC 4I8GA 1GBBA 4Y0YE 1O31A 2AEIH 2BDCA 3F9FA 5JYIA 1O33A 3KQEA 2OP9A 1F5KU 2BXUH 1SGEE 3BTME 3Q3YA 4UFGH 4ABBA 1EAXA 4THNH 1C1SA 1GVLA 1D6RA 1P2IA 2TRMA 3H7OA 1MQ5A 1FY8E 3G01A 2WYJA 4FUHA 1F2SE 2FOCA 1TAWA 1IQFA 1D3DB 1K22H 3LJJA 3UOUA 2XTTB 1ZGIA 1ZSLA 1S81A 1EZQA 1RIWC 5AF9H 1GBKA 1E0FD 5F6MA 2P8OB 1HNEE 3QUMP 4AG1A 4AG2A 3KGPA 3U1JB 3M36A 3RU4E 2G5NA 3DFJA 1B7XB 3E16B 1Y3WA 5EPYA 2SGPE 5LH8A 1KXCA 1SVPA 1YGCH 3A88A 1ABIH 1GG6B 3VFEA 1BTWA 2F9BH 2GCTC 3ZVBA 1GI1A 1F7ZA 1LPGB 2D2DA 2PKAB 1SLXB 3A87A 1WAYB 3MO9A 2TGPZ 1Z8JB 1AKSA 3LKWA 1BUIA 4AB9A 2GTBA 4Q80A 1OYTH 4YT7H 2V0BA 1AI8H 4XOJA 1JRSA 1A3BH 5DP6A 2ZGJA 1ZR0A 1QRWA 1EZXC 1OP8A 3V13A 4NFEA 3ZVEA 1QFKH 3PMAB 4ASHA 1EQ9A 1O3LA 2C93B 3AAUA 1W0ZU 3V0XA 1IOEA 5L2ZH 3BTKE 3M7TA 1C5VA 3PM3A 4YOGA 1TPAE 1IQNA 1UTMA 1AUJA 1EB1H 1QCPA 4OGYA 3AASA 3M7QA 2HPPH 3STJA 1ZHRA 1QJ7B 1QURH 1HPGA 1GMHF 1AHTH 1MKWK 1T8MA 3SGAE 1L4ZA 1ANBA 1GGDC 2VIQA 3LGTA 1GI2A 1J14A 1HGTH 2BDHA 1YF4A 1AN1E 2XYAA 5T6DA 5JBAS 1V2WT 3ATWA 1GMHG 4B74A 1ELDE 3PO1C 2ZTXA 2RG3A 3TGIE 1QA0A 3UWJH 4DY7B 4ESTE 2JKHA 3RXEA 5DP5A 1IQLA 2G4TA 1CBWB 1ELCA 2F3CE 1O36A 3P95A 6LPRA 3EGKH 1UTLM 4DG4A 1LMWB 3RXUA 3VPKA 1HBTH 1TWXB 3IITA 2G5VA 2STAE 1WSSH 4AN7A 3VB5A 1TNGA 3S9BA 3MO3A 4WY3A 2ZCHP 2PHBA 5DJ7A 5FPTA 2BYAX 1L1NA 1DY9A 1A0HB 1GHYH 1V2MT 1DUAA 1GCDA 1LHEH 2HGTH 5ESBA 1P8VC 1P0SH 2F9UA 4GLYA 3PTNA 4CRCA 1FY4A 3BIUH 1QBVH 2G55A 3N7OA 1HRTH 1W2KH 1ZJDA 2G52A 2JH5D 2UUFB 1O2LA 3A8AA 1ZLRA 1KYNA 1WUNH 1UVPA 3TITA 2SNVA 3GDSA 4JZEH 1TQ0B 1FIZA 4ZXXH 3B8JA 4K2YA 1XKBC 3KNXA 3P8OA 5L6NH 1UCYE 3SOSA 1B0EA 2H6MA 1SPJA 4H42U 4IC6A 1ESTA 2JETC 4A6LA 1SGQE 4FVBA 1HJAB 1O3OA 1Z1IA 1AVXA 1NN6A 2BD7A 2TBSA 2SGFE 1OXGA 2Z9KA 2ZNKH 3ZYDA 5EPNA 5CHAC 3RXDA 2BLVA 1DT2A 4INLA 1UTPA 4DJZB 5IYTA 1GI8B 3ATMA 3I78A 1OP0A 2WPMS 4AYVB 4BNRA 1DXWA 4R0IA 1BMMH 1PQ8A 1DPOA 1LVMA 5A8ZA 1MZDA 5F8TA 2K1QA 1C2DA 1EX3A 2FESH 3A7TA 2FDAA 2OLGA 1ZRKA 3OU0A 4ABHA 3ZZ3A 1QJ6B 2A7JA 4K60A 1F5LA 1GJ8B 1PQAA 2FZZA 1Y5AT 2PTCE 3HK3B 1YP9A 1TPSA 1ESAA 1SHYA 3KF2A 3TJOA 3HKJB 1IQKA 2GD4B 1BTPA 3K2UA 1SGIB 1BTZA 5H4IB 1UTQA 1FPCH 2SGEE 4NA9H 2J4IA 5JBBS 4KP0A 2GP9B 4JK6A 2BOHB 1N1LA 2J94A 4NGAH 1O32A 3MO6A 1TNHA 1THPB 1ZPCA 1G30B 4WH8A 1O37A 1AY6H 2ALPA 2XBWA 2JH0D 4X1PU 1XXFA 1C1TA 1C4V2 1GHBF 1XXDA 4ZKNU 3SO3A 3CENA 2P3UB 1C5LH 1GJCB 2O9QA 2B0FA 1P9SA 2R9PA 5SGAE 1V2JT 3P17H 1B5GH 2FYRA 2NU2E 1NU7B 2H1UA 1HFDA 2Y80A 3MOCA 1AQ7A 1D3PB 1BRCE 2ZU5A 1GHBG 1O5CB 1GBIA 4CBNA 1O2ZA 1SSXA 3LU9B 4Y7BA 4X6MA 1LQDB 4B2BA 1DANH 4CR9A 1MAXA 4K1TA 1VCPA 3LGWA 1Z7KA 1LPZB 1GI6A 1ZYOA 1O2GH 2A31A 2Z7FE 4YLUA 1W3CA 3HKIB 5FX5A 1UTKA 3SJOA 1EAWA 4ISHH 2AS9A 4MPUA 3GYMA 4ZUHA 2AIQA 3ELAH 1YM0A 4BAKB 4TY7A 5PTPA 4ZHAA 2W7SA 2ZHDA 2VIOA 1IHSH 3E6PH 1NU9A 2FTMA 1KXDA 5L2YH 1JMOH 1MU6B 1V2ST 2QXHA 2J38A 3FP6E 3VGCB 1GHXH 1QNJA 1BMAA 1KXAA 1NROH 4OS2A 1C5RA 1F92A 1OWHA 4JK5A 2H9HA 1GCTB 4WMEA 3PROA 4HZHA 1MCVA 1Z1JA 1GBTA 3M7UA 3S9CA 1O2RA 3A8DA 1Q2WA 1GHVH 3LGUA 1GHWH 1T8LA 1Z8GA 1TMUH 3RMMH 1AB9B 1TOMH 1FY5A 1XM1A 4LZ1H 2CF8H 4ZHMU 1GDUA 1NFWA 2HNTE 1Q3XA 2VIDA 1T32A 2ZF0H 1O2UA 1SMFE 1FXYA 1RTFB 4H6TA 1PPGE 1SL3A 5E0GA 1CU1A 2JH6D 1IQEA 4BTTB 5GCHF 2P95A 4VGCB 1BTXA 2QXIA 1ZPZA 3L33A 3OY5U 3U9AH 1YPHC 2QAAA 3ZVFA 1O3KA 3MYWA 1BA8B 1QTFA 1TMTH 4K8BA 1GWAA 4WH6A 1DS2E 1TA6A 2EI7A 1KY9A 1VITF 2FX6A 2ZPRA 4DCDA 3U98H 4UFDH 1G36A 4HTCH 3SUGA 1AFEH 5GCHG 5HXFA 2Z6BD 2FIRH 3LT3A 3T5FH 1ANCA 4X0WU 4B71A 3S0NA 5BPEA 1DXPA 1E34B 1L1GA 2ZDLA 1GJ7B 1ELGA 1TQ7B 4BAOB 1SBWA 2OC1A 1W7GH 5A2MH 2XC4A 1ELBA 4XDEA 1C5SA 1V2LT 3GYLB 1O2JA 1K9OE 2GMTC 1OP2A 3EA8A 2Z94A 2ZEBA 4B73A 3GY7A 1ZPBA 4X8SH 2D1JA 1GI9B 2FWWA 5HGGA 3SGQE 2OCVB 1DDJA 1ELEE 3TK6A 1TNLA 1ACBE 2XC0A 3TU7H 4D9QA 4ZHLU 1SGDE 4OS6A 3UNQA 2A2XH 1S6FA 4RKOB 1UTNA 1H4WA 4BXWA 4WF8A 1GBDA 1BITA 3ZZ4A 2BZAA 1SHHB 1WTGH 1TPOA 1UVTH 3QWCH 4YM9A 3SN8A 1C1UH 1P2QA 1NFYA 2ZZUH 1MBMA 2ZFRH 3SUFA 5C67A 7GCHF 1GI0A 3VB7A 1O2YA 3TK5A 1O3PB 1P2MA 2VVCA 5HMAA 3ODFA 3H7TA 3AAVA 2NU3E 4KKDA 5JPMH 2P93A 1SI5H 1BJVA 1GI7B 3RLWH 4CREA 1SC8U 2VWLA 1OX1A 2VIWA 1P12E 1SLVB 1JOUB 2HRVA 1VCQA 4AORA 1N8OB 1Y3VA 3NWUA 1SLUB
chains in the Genus database with same CATH superfamily
1YLCA 4MVNA 3STIA 1EZSC 1WV7H 4B6FA 4BAMB 1SOZA 3GCHC 3QZQA 7LPRA 1A1RA 5G4BA 1GMCF 2Z9JA 1N6XA 3SNEA 1DITH 1UCYK 2FP7B 2GZ8A 2XCNA 2J2UA 4E7RG 4B2CA 1RTLA 1O3AA 1OKXA 2FS9A 3OE7D 1CA0B 2H5DA 3RXOA 1TNKA 3C1KA 4FUEA 1GMCG 2AHME 2V3OH 1VGCB 1EPTB 3TIUA 5C0UA 2ZFSA 1W8BH 2SFAA 3DSPA 3TH3H 1HAPH 4M9FA 1GI5A 1HJ8A 2CN0H 1GL0E 2DUCA 1O3JA 2G8TA 4ZXYH 3RUOA 4A7IB 2YNBA 1SGNE 2ZFTA 1RJXB 1TNJA 3FANA 1BMFD 3DSGA 4XBBA 3RLYH 3SU0A 1EB2A 2XBXA 1GBAA 2WHXA 3M35A 3MU0A 5ETXA 2ZIQH 3A81A 2QY0B 3DT0H 3NPSA 1ZHMA 1O3DA 1QRZA 3TNTA 1PPEE 1W10U 1DLEA 1O3NA 1VCWA 3MNBA 2Z3DA 5DP8A 3SZNA 3UNSA 1JWTA 3M3VA 4YOIA 3F2GA 3U28C 1C2HA 1CO7E 4AC9A 1EXFA 2WV5A 1EOJA 1JXPA 1P03A 2ZPSA 1DICA 4X6PA 3D62A 1MCTA 1FN6A 2OUAA 3VB6A 4JMYA 1EJAA 4D9RA 3ZIAD 3UTUH 1V2TT 4GCHF 5A09A 1BJUA 2FO9A 4NA7A 1SR5C 2W5EA 2VH0A 3C27B 1GJ4H 2PWXA 1YY3A 3ZZAA 1VR1H 3M61U 3UREA 3L3TA 2KAIB 1O35A 4Y0ZE 3BN9A 1ESBA 1VJAU 2F9VA 3K65B 2HVXA 3EA7A 4GCHG 1SGFA 3ZVAA 1BT7A 3CS0A 4NSVA 5C1YA 1LHFH 3O8BA 2FOGA 4I8JA 3ZZDA 1S6HA 1QZ8A 2ANWA 1SFQB 4Q7ZA 4IMZA 1LVOA 3HGNA 1DY8A 2DE9A 1TBRH 2GT8A 3DFLA 2M5TA 2A0QB 2ZG0H 1EUFA 1O3IA 1UHBA 5GXPA 3A89A 2Y7ZA 1ETRH 1A46H 2FPZA 4I86A 1EFRD 4A1XA 4FETA 3E0NB 2Z9GA 3LPRA 3NXPA 1G37A 1J8AA 2NU0E 1W0YH 2A45B 2C8XB 1V2KT 3BIVH 1Q31A 1C1OA 3KQ5A 4Y76A 2FYQA 1CSOE 2SGAA 4X6NA 1FLEE 5T1VA 1ZTKA 2TPIZ 2KR7A 4DVAU 5FBEA 4AOQA 2Z3CA 1O3CA 1HXEH 2EA3A 1G2LA 4Y7AA 3OSYA 2BZ6H 4AGKA 1M9UA 2BQ7B 1H8HD 3FAOA 1TYNA 2A7HA 1K1IA 4RKJB 1QR3E 1ZMJA 3AVZA 1SGCA 2ZDNA 3V3MA 2G4UA 4JYVH 3TLOA 4NIXA 4B76A 1JIMA 2Y6TA 2AYWA 2XW9A 3GY3A 1L0ZA 2R3UA 2FS8A 1GBFA 2XXLA 3K6YA 5C0TA 1XUJA 2QF3A 2KCPA 5C5NA 4X1NU 5C94A 1YBWA 3GISB 2PGBB 4KTSA 4CHAB 1O3EA 4X2VA 2BD3A 3MH7A 4DW2U 4DT7B 2WUBA 3SU1A 1HDTH 1MD8A 2BMGB 2FM2A 3BTQE 2IOTA 1J16A 4CH2B 3SJIA 5B6OA 2RA3A 1S85A 3RMLH 4LZ4B 4ISIH 3SU2A 2STBE 1MTWA 4FUBA 3RXKA 1H8IH 1AWHB 2CXVA 1Z8RA 1AFQC 4JZIA 5IDKA 3RXJA 1AVWA 1GDQA 1PPZA 1OOKB 4CRAA 1JIRA 3GDVA 3CS7A 4BXSA 1C1QA 5T3HA 4Y8XA 3TPIZ 4MNVA 3NUMA 1BZXE 4ABEA 1AMHA 3SJ8A 2EQNA 3RXSA 1YC0A 2BD2A 2RDLA 3A8BA 1Y3UA 3SI3H 3EYDA 2ZQ1A 5DSFA 2EC9H 1UVUH 3PRBA 1VZQH 2Y5FA 3GOVB 4UEHH 4ZMAH 1S0RA 3N7EA 3K6ZA 2R3YA 2WPHS 1P3EA 1H1BA 1NZQH 2F9OA 1VITH 3MI4A 3SYJA 1P01A 1GBCA 1GBHA 4JYUH 2GZ7A 1NRQH 3Q3XA 4P02A 1KTSB 2PKSB 2P8OC 1ELAA 2VIVA 3W94A 3KHVA 1LO6A 1WQSA 1UCYH 1C1RA 1C5ZB 2VIPA 2VH6A 1JBUH 4ASUD 1C5WB 4YOJA 3S7HB 2QF4A 1NRSH 3EAJA 1Y8TA 4WWYA 3URCA 1GG6C 1S5SA 4FU7A 5JB9S 1MTVA 4UONA 2BVXH 5FPSA 1WOFA 4D7FA 1MZAA 1FNIA 2HOBA 2ZA5A 1YCPM 2VU8E 1AKSB 5TCCA 2YNAA 3LGVA 1WBGB 1TBZH 1MH0A 3B23B 3ZYEA 1MKXK 3DD2H 1PFXC 1ZHPA 2PLXA 4K5ZA 3ATLA 1K1PA 1YCPK 2P3TB 3BV9B 3MH4A 3LOXA 1QIXB 1IQGA 2A4RA 2VWNA 2WV9A 1OYQA 3M5LA 2BDYA 3SV2H 1DVAH 5FCRA 3LGIA 1FZZA 3ZZBA 2AMDA 2GKVE 4FUFA 3SJ9A 4IMQA 4D7GA 3P8GA 4D76A 2VWOA 5F53A 3KCGH 2BOKA 2OD3B 2QN5T 4ZKOU 1C2LA 2FXRA 2OQUA 1QB9A 2BDIA 2G00A 4IS5A 2UUYA 4TY6A 3NCLA 1PPHE 4XFQA 3TGJE 1AO5A 1C1PA 1ETTH 5ESTE 2P16A 1BDAA 2K0QA 5HM9A 2OBOA 1FONA 1BRAA 3EDXB 2BLOA 1ID5H 3PMHB 2WPJS 3M37A 1LHDH 5HIZA 2G81E 1HLTH 5GIBA 1EZUC 2BVRH 4UE7H 3UQOA 1SG8B 1C5QA 2W3KA 1YPHE 5EQSA 8ESTE 2GZ9A 1Z6JH 1DSTA 1KIGH 1QL8A 1EATA 3KN2A 4Y10E 2Y5GA 1NBME 3QX5H 1BTHH 2CF9H 3BG4B 3ITIA 2R2MB 4OS5A 1E36B 1HIAB 4U32A 4O3TA 1SGYE 4FUJA 1C2JA 1SFIA 1A0JA 3BEFB 4O97A 1LQEA 1S0QA 5F8XA 4I8HA 2WZQA 1RD3B 1ZTJA 1O5GH 2P59A 1TABE 1HAZB 1QQ4A 2QC2A 4TWWA 5FX6A 2HPQH 1SGTA 1HAHH 1P10A 1V3XA 1YLDA 1S84A 5EJZA 2K8IA 1RXPA 2CGAA 2ODQA 5FHTA 6CHAB 3E91A 3TH4H 1WCZA 8LPRA 5DP9A 2XBVA 1A3EH 2NWNA 3PTBA 5DO4H 1T4VH 5DGJA 1O3MA 1XUHA 2GT7A 4GHQA 1O2PA 1A0LA 4XE4A 1P2OA 2ZKSA 1WXRA 2BXTH 3ZZ8A 1IQJA 2A1DB 1HJAC 3MU4A 1NRPH 3A85A 3ZV9A 5K7RA 1GMDF 5IK2D 4OS1A 2FI4E 1V2QT 2V35A 4K69A 1TALA 2M2AA 1EJMA 5GPIB 1G3DA 3RU4D 5A0CA 3WWBA 3F2FA 1P09A 4O3UA 3SHCH 1V2RT 1C1WH 1QHRB 1FN8A 1TMBH 3E1XB 4XSKU 1TGCA 4BAQB 5J4SA 1GMDG 3BF6H 4HI3A 4ZAEA 2BQ6B 5LPRA 4NCYA 1LTOA 1FAXA 5C5OA 1HB0B 1QA7A 2BY8X 2GGVB 4X6OA 2J95A 1GI3A 1C1NA 1T8NA 1KTTB 3V7TA 3LIWA 1HAXB 3BTTE 4TYDA 1GBLA 4Z0KA 5KEDA 1K1MA 3AW0A 2F9NA 3GY2A 4DIHH 5JBTA 1HAYB 3KQDA 3SORA 2ZCKP 1QBNA 3A8CA 1GBEA 1V6DA 1MKWH 2KFWA 2AIPA 3MU5A 1LCYA 2BLWA 1UK3A 2VB0A 3RXMA 2WSSD 1YPMH 1AZ8A 3A7ZA 4Y8YA 5T6FA 2KCOA 4YLQH 2FI5E 1OWKA 1O0DH 4AYYB 3U8RH 3FZDA 4J2YB 2CHAB 1ZTLA 1CA8B 1O5BB 2JJ2D 3SQHE 1T31A 1UVSH 2Y81A 1TB6H 3V12A 1NFUA 2IPHA 4LK4A 1KXFA 2GV7A 4LXBH 3ZVCA 1YWUA 4MDSA 4BAHB 1CGHA 1B0FA 4FVDA 2ZGXH 1HJ9A 2ZHEH 1GVZA 2PUXB 3A7XA 1DOJA 1XX9A 1FPHH 3QO6A 1ZRBA 2F91A 2RCEA 1ABJH 1P3CA 1ANDA 1S83A 2VJ1A 1C5YB 4E06H 3GY6A 2FTLE 1O5EH 4TT3D 1LDTT 4K3JA 3SNAA 1NM6A 3F3BA 4X8TH 3A80A 4FUIA 2A5KA 1O2OA 1UMAH 3SW2B 3Q76A 3MMGA 2Z9LA 1OWIA 2OINA 3MH6A 3BTEE 4GVUA 1G2MA 3BTDE 1BMLA 1IQIA 1O3GA 3ATKA 4INHA 2J98A 1D6WA 2OC7A 1ETSH 3D65E 3O8RA 1EPTA 1C2FA 3AW1A 5A8YA 1C5NH 1YCPH 4KTUA 1C2IA 3MWIU 3F1SB 1QBOA 2BB4A 5E2OA 1UW7A 1SQOA 3VB4A 4X1RU 4JZDH 5HKKD 2LNCA 3VGCC 4HG6A 1P11E 1K2I1 4D8NA 3PMBB 3RXAA 5I25A 2FOEA 2WINI 3LH3A 4K8YA 2RDEA 1GCTC 1PJPA 5AVDA 1YPGH 2FLRH 1O2IA 1BRBE 3L6PA 3A7WA 2VGCB 4ABGA 1C5XB 1MABB 2ZECA 2ZFPH 2A2QH 2HVYB 1AB9C 1BHXB 1KXBA 2WV4A 1U6QA 3W95A 2OC8A 2BHGA 2QGRA 3SZEA 1MUEB 1DWBH 1DFPA 1C2EA 2TGDA 1A5IA 3D49H 4OS4A 4F48B 4AFQA 4VGCC 1MTNC 3VXEH 4NIVA 1EASA 2ESTE 3A84A 2CK3D 3UOPA 4F4OC 3RXVA 2H9TH 2HALA 2R2WU 1EP5A 2P3FH 4GHTA 1W12U 1TRNA 3T26A 4FOUC 2PV9B 5EQRA 3F0PA 4O03A 1HAVA 3F6UH 3SV7A 4UD9H 3CNRA 3PLKA 1A5HA 2ZFQH 1NRRH 2D26C 3P70B 1H8DH 3I29A 2ZHQH 2XCFA 4NFFA 3RXHA 5GJ4B 1C9TA 3JZ2B 2W6JD 2HWLB 2Z9IA 4AZ2B 4A1TA 1KLIH 1KDQB 1C5TA 5FPYA 3ZVDA 2O8TA 1V2NT 1GDNA 1OSSA 1LHGH 4Z1MD 1GBMA 5A0BA 4I7YH 4WXVA 1LVBA 1TLDA 1TIOA 1C4Y2 3BTWE 1RIWB 2EY4C 1GPZA 3LONA 3RXRA 4NIYA 1IAUA 3ZZ9A 1SGRE 1Z8IB 2W6ID 2ZGCA 1BQYA 1C5UA 1FV9A 2AFQB 3UR9A 9LPRA 1L2EA 3CP7A 2VVUA 4U01A 1K1OA 2O8UA 3GCNA 1HXFH 1XMNB 1S6LA 2D8WA 2RA0A 1JRTA 1C1MA 3ATIA 3GCTF 1ZSJA 3HK6B 2XBYA 4LOYH 3DHKH 3MFJA 4ZROA 1FAKH 3ZVGA 1P2KA 2XWAA 3BG8A 3TK9A 2XC5A 1LVYA 3MU8A 1ELFA 4CRFA 2PKAA 2GCTB 1O3FA 4I8LA 1OWEA 3MNCA 3KIDU 3SHAH 1Y5UT 4SGAE 2A32A 2HNTF 3GCTG 2EEKA 2WPKS 3OEED 4B75A 4UFEH 1ZOMA 4DIIH 4CRDA 1HAIH 1C2MA 3EA9A 3RXIA 8GCHF 1BBRE 3I77A 2O8WA 3SUEA 2C8YB 2W3IA 3F9EA 1BCUH 5AFYH 1CGIE 3OX7U 2G51A 3P6ZB 4GSOA 2ODYB 1TFXA 2FOAA 3GDUA 4B6EA 1XUIA 2GJGA 5EOKA 1E37B 8GCHG 1CA0C 1J9CH 1CHGA 2XRCA 4AB8A 2UUKB 2C4FH 2GX4A 1CGJE 2QIQA 1N6YA 3P8FA 1EPTC 2BDBA 5EJ1A 2EI6A 1GGDB 2ZQ2A 5F8ZA 4TPIZ 3T2NA 1D4PB 4XD7D 5KGOA 3ESTA 3D23A 2A5AA 2H2ZA 1BHXF 1P2JA 1TRYA 1Z71A 1GJ6A 2BVSH 3PO1B 2ANYA 1QY6A 4MG3A 1Y3XA 2FI3E 4I31A 3KQBA 4UFFH 8KME2 3SJKA 2ZGHA 2VNTA 3GCOA 2ZU3A 1MD7A 1GJ5H 1A61H 2BD9A 1O30A 5EODA 3A7YA 4BOHA 4YT6H 3MU1A 2O8MA 5E0JA 5EJLA 1ZGVA 1O2MA 1NTPA 1QB1A 1C5OH 2OBQA 2AGIX 4Q63A 2FODA 3RXBA 1AD8H 1A4WH 1MU8B 1TONA 2V3HH 4X2YA 1E79D 1GI4A 2QF5A 1PPFE 1OHHD 2J5UA 1WU1A 3RMOH 3U8TH 4E7NA 3PMJA 4WVPE 5DP4A 2C8ZB 4FUGA 3ZZ6A 1UO6A 1BB0B 2ZU4A 4IW4E 5HYOA 2QA9E 4I33A 1ZJKA 1F5RA 5JB8S 4CH8B 5EXLA 2PGQB 3RXPA 1QL9A 1GJBB 3TJUA 2FX4A 4NA8A 1QQUA 1BTYA 2ZDAH 2V7QD 1O34A 2ALVA 4Q4LA 4TWYA 4IN1A 4M7GA 3EQ0H 2FEQH 4X8UH 2A7CA 2OK5A 3NZIA 1BIOA 1LKAA 2JETB 1BRUP 1FDPA 1LPKB 1DE7H 1KLJH 4FU8A 2ZHWH 4FU9A 4WJG2 3RP2A 1SQTA 3IG6B 3SNDA 3S9AA 4ABIA 1NY22 2W7UA 1SQRA 2XNDD 5CHAB 2W26A 1O2HA 3U8OH 1O2TA 4CRGA 5DKMA 2B7DH 4ABAA 1UHBB 3SU4A 6ESTA 3UIRA 3O8DA 1ARBA 1EOLA 1UK2A 1FX0B 1A2CH 1TGNA 3U1IB 3QK1A 4IBLH 1J15A 5TJXA 1BMNH 7KMEH 3M5MA 3P8NA 3E3TA 3SQEE 1K28D 4YXWD 1YPEH 5LPEA 2ZP0H 3ENSB 3U69H 2I6SA 1V2OT 2IPQX 3RXCA 3TVJB 1YPJH 3UFAA 1CHOF 3ZZ7A 4H4FA 5GDSH 1FY1A 1K1LA 4MNYA 2ODPA 2J9NA 2BY5X 2BD4A 4R8TB 2J97A 2A4QA 5F03A 3A83A 2J34A 2YMSB 3GY8A 3UR6A 1C5PA 1CHOG 3KQCA 3ODDA 2F4LA 5JBCS 2LPRA 2BD8A 1D3QB 5FAHA 2ZDMA 3UPEA 5EGMA 1HIAA 1RS0A 5I46H 2PW8H 1CQQA 3LDXH 5HM2A 1EJNA 1QL7A 3SNBA 5E2PA 2Q6FA 1G32B 4O9VA 2ZCLP 3RC4A 2DE8A 4YO9A 3BSQA 4GPGA 1Y3YA 2ZWLH 3BEIB 3RXFA 4CHAC 2FOMB 1H9IE 1Y59T 1C1VH 3QZRA 3FFGA 1Z6EA 3PB1E 3M5NA 4HGCA 4ZKSU 1ANEA 2A5IA 1MQ6A 1NO9H 5FBIA 1G9IE 4ABFA 2HLCA 1INCA 2BY6X 3FVFB 1TGSZ 4NZQA 3HPTB 2ASUB 1TGTA 3SU6A 1CVWH 2I6QA 3RM0H 4AFZA 2KZ4A 4YESB 4ISLA 2Y82A 4FXGH 2IN2A 4IGDA 1W14U 3OEHD 4Q7YA 1DM4B 3BTHE 3TH2H 5CMXH 1SQAA 3KEEA 3PLPA 1TX6A 2J92A 1PPCE 1D3TB 4NZLA 1GHZA 4FUDA 3VXFH 2GCHF 1A7SA 2GDDA 3A7VA 3BTFE 3SV9A 1C2KA 4OS7A 2QYIA 4A5TS 3GY4A 3M3SA 1E1RD 4HFPB 2VVVA 3WWFA 5E0HA 1EP6A 2PTNA 2FLBH 4Y11E 2V6NA 2CV3A 1F0TA 2H9EH 2ZO3H 1OWJA 1NT1A 1V2UT 3UNRA 2ZTZA 1J17T 2GCHG 1CBWC 1O39A 1UTOA 2WUCA 2GVFA 5AHGH 4B2AA 2BDAA 2IJOB 2XWBI 3QTVH 2QV1A 3LJOA 2PKSC 3AK5A 1O2NA 1NRNH 2Q1JA 5DP7A 3F9GA 3TGKE 3SI4H 3T29A 3BEUA 2BLQA 1HAOH 4Y79A 4QT8C 4Y8ZA 3F2HA 2OXSA 3R0FA 3QTOH 2PFEA 5JDUB 1YLNA 2VINA 2ZFFH 5CE1A 2V3MA 5FXLA 3QLPH 4BTUB 1EKBB 2BTCE 3T28A 4RN6A 2ILNA 1K21H 2KM0A 4Z6AH 4ABJA 2QF0A 5C20A 1FJSA 5ABWA 4I8KA 1MTSA 3FZZA 1LKBA 4BTIB 5T6GA 1T4UH 3OYPA 2FOBA 1QRXA 2H5CA 1T7CA 3E90B 1MTUA 1KLTA 3UUZA 5LPFA 1ZSKA 1SGFG 1E1QD 4E05H 3GICB 1NFXA 4MPVA 3PYHA 1V2PT 1W7XH 2WPDD 4JZ1A 2R0KA 3MH5A 4JZFH 3SV8A 3FP8E 2GV6A 3KYGA 5FCKA 2CMYA 2O8LA 2BY9X 4MNXA 5EXMA 3S7KB 2Y7XA 3NKKA 1THSH 2PR3A 4A1VA 1RGQA 2TGTA 4ZH8A 1MAYA 9ESTA 1EAUA 5TCAA 3A82A 1PPBH 3SNCA 1RTKA 1D9IA 1FY3A 3T25A 1GJDB 1CT4E 1XUGA 3MTYA 1PYTC 1BBRK 1ELTA 1G3EA 3TNSA 3SBKA 2WPIS 1ARCA 2C3SA 4H6SB 1SOTA 3EE0B 3UY9A 1L4DA 3DUXH 5DG6A 3F68H 1O38A 3LC3A 2GMTB 2L6OA 1TPPA 1KSNA 1GBJA 1IHTH 1QB6A 2FOFA 1WYKA 2F83A 5EXNA 3RC5A 3OTJE 1ORFA 4MLFB 4DGJA 5K0HA 2C8WB 1TNIA 1TRMA 3UQVA 3LH1A 4GUXA 1MBQA 3HGPA 4K1EA 1F0SA 3DA9B 2B8OH 4X1SU 1HUTH 1H9LB 2XNIA 3ZV8A 1IQMA 4RSPA 1O2KA 1E38B 3SV6A 2VWMA 5GWZA 4X1QU 3HATH 1HYLA 3GY5A 2TIOA 3H5CB 2ZI2H 1ZMLA 2BQWB 1GVKB 4Y6DA 2JDID 1AGJA 1DX5M 4CRBA 1GJ9B 1BOQA 4WMFA 5L30H 1AE8H 3PWBA 2PP6A 3SGBE 4X8VH 5A8XA 1SGPE 1E35B 3BG4C 5B6LA 1UJ1A 4NWKA 1IQHA 1HCGA 1W0JD 1EAIA 1TGBA 4TSFD 1W11U 4KTCA 4NWLA 3BTGE 1O5DH 3RXGA 2GDEH 1XKAC 3Q77A 1GHAF 1DWEH 2ZDKA 4ISOA 4DOQA 3RXTA 1TA2A 3UWIA 4JCNA 3SUDA 5CHBA 6CHAC 4NSYA 2PSYA 2AMQA 2PSXA 4XBDA 4INKA 2BDGA 1DWDH 3FP7E 3T62A 1TX8A 1G3CA 2Y5HA 1P05A 2BX4A 4MPXA 1MTNB 1GHAG 2THFB 1GL1A 3GCHB 2OC0A 1A5GH 3RDZA 3RU4T 1P2NA 2B9LA 4WMDA 2UWLA 2ZDVH 4IC5A 2BM2A 2OTVA 1XVMA 1UK4A 1ZZZA 4B1TA 5C3NA 1DSUA 2FOHA 1X7AC 2QXGA 3UAIC 2ZGBH 4MNWA 1T8OA 3MNXA 1KXEA 2UUJB 1OWDA 1WQVH 1MKXH 1DLKB 1O2XA 1PYTD 4P00A 4TPYA 3B9FH 5EW1H 3R3GB 1VITG 3E8LA 3TJNA 2ANMH 2ZC9H 2QCYA 2SGQE 4KGAA 3URDA 1RRKA 1FUJA 2BY7X 4BANB 5C1UA 1NPMA 4F49A 3M5OA 5LGOA 1HAGE 1LHCH 4KELA 2WPLS 4X2XA 1KDQA 2EI8A 1GJAB 2HLDD 1QGFA 1DWCH 2WYGA 4GAWA 1AUTC 1CT2E 1QJ1B 1S82A 2IJD1 2UWOA 4AX9H 3O8CA 4ZKRU 3QGJA 2A4OA 1AVGH 1AZZA 4J1YA 4SGBE 1YYY1 1AE5A 1O2VA 4AFUA 2ZU2A 3QDZB 4MPWA 3MNSA 3PLBA 1K1NA 1P9UA 4YTAA 3KL6A 1O5AB 2CHAC 1FQ3A 1HV7A 1NC6A 1ELVA 3RMNH 5EW2H 1O5FH 2AGGX 2AMPA 2KX4A 3RC6A 1C4U2 4ISNA 3VG8A 1P02A 3ZZCA 4ZCNA 4FUCA 5AFZH 1Y5BT 1FMGA 3OY6U 3PV5A 1CE5A 1PQ5A 1C9PA 2ZTYA 3Q00A 1G3BA 3M3TA 3PV2A 4A92A 5DP3A 1FIWA 3RXQA 1YPKH 3FN8A 2PUQH 1O3HA 4NIWA 2BD5A 2KAIA 3W1EA 4U2WA 4OGXA 7GCHG 2FMJA 3TJVA 4U30A 1TX7A 1MMJN 2ULLA 3QN7A 1F0RA 2Z3EA 2ANKH 4Q7XA 5DPAA 4CR5A 1AU8A 1YKTA 4XBCA 5DK1A 3K9XB 3N7DA 2ZPQA 1ZMNA 1NESE 4MQAA 1K1JA 4AGJA 7ESTE 3PV4A 1BTUA 4K1SA 4AFSA 4IN2A 5BRRE 3MHWU 2HNTC 3E0PB 3NK8A 1NBMD 5DN6D 5C2ZA 1O2WA 1TBQH 3RM2H 1C2GA 2SGDE 4PROA 2J98B 1H9HE 2Q6DA 4NG9H 2Q6GA 3PWCA 4I32A 2R0LA 3VEQB 3LC5A 5FL7D 1VJ9U 2AERH 4YZUA 3ZZ5A 2NU1E 3IWMA 1NS3A 1XVOA 3QGNB 2YOLA 4Q2KA 1UTJA 4ABDA 1O3BA 1P57B 1P06A 5EIYA 1CT0E 5A0AE 1RFNA 1SLWB 2AH4X 1OS8A 1PQ7A 1BBRH 2UWPA 3SU5A 4UDWH 2OQ5A 1W13U 1W0KD 2P94A 1TE0A 1XUKA 1YPLH 2CJIA 2ZHFH 2VGCC 2A4GA 5EU8A 5EG4A 3P92A 3WY8A 6GCHF 1AIXH 4X2WA 3RXLA 4CBOA 2QXJA 1OPHB 4WXIA 4DURA 2B5TB 1UVOA 1WTHD 5C17A 3JZ1B 5J4QA 1SB1H 3OTPA 2SNWA 6GCHG 2C90B 1C5MD 1N8OC 5EQQA 1TOCB 2RFKC 3VB3A 3EE7A 5C1XA 1O2SA 3Q3KA 1FI8A 3A86A 1O2QA 4MTBA 1XUFA 3NRLA 2BX3A 1P04A 2F9PA 1F0UA 4Y71A 1DUEA 4JYTA 3T27A 2TGAA 3LGYA 1V2VT 3F9HA 2AGEX 1AWFH 1THRH 1HAVB 3S69A 1AFQB 1L1JA 5E8EH 3SU3A 2ZU1A 2NU4E 1VGCC 4I8GA 1GBBA 4Y0YE 1O31A 2AEIH 2BDCA 3F9FA 5JYIA 1O33A 3KQEA 2OP9A 1F5KU 2BXUH 1SGEE 3BTME 3Q3YA 2KCAA 4UFGH 1WDIA 4ABBA 2JJ1D 1EAXA 4THNH 1C1SA 1GVLA 3OFND 1D6RA 1P2IA 2TRMA 3H7OA 1MQ5A 1FY8E 3G01A 2WYJA 4FUHA 1F2SE 2FOCA 1TAWA 1IQFA 1D3DB 1K22H 3LJJA 3UOUA 2XTTB 1ZGIA 1ZSLA 1S81A 1EZQA 1RIWC 5AF9H 1GBKA 1E0FD 5F6MA 2P8OB 1HNEE 3QUMP 4AG1A 4AG2A 3KGPA 3U1JB 3M36A 3RU4E 2G5NA 3DFJA 1B7XB 3E16B 1Y3WA 5EPYA 2SGPE 5LH8A 3FO8D 1KXCA 1SVPA 1YGCH 3A88A 1ABIH 1GG6B 3VFEA 1BTWA 2F9BH 2GCTC 3ZVBA 1GI1A 1F7ZA 1LPGB 2D2DA 2PKAB 1SLXB 3A87A 1WAYB 3MO9A 2TGPZ 5CDFE 2JIZD 1Z8JB 1AKSA 3LKWA 1BUIA 4AB9A 2GTBA 4Q80A 1OYTH 4YT7H 1K0HA 2V0BA 1AI8H 4XOJA 1JRSA 1A3BH 5DP6A 2ZGJA 1ZR0A 1QRWA 1EZXC 1OP8A 3V13A 4NFEA 3ZVEA 1QFKH 3PMAB 4ASHA 1EQ9A 1O3LA 2C93B 3AAUA 1W0ZU 3V0XA 1IOEA 5L2ZH 3BTKE 3F0OA 3M7TA 1C5VA 3PM3A 4YOGA 1TPAE 1IQNA 1UTMA 1AUJA 1EB1H 1QCPA 4OGYA 4XRNA 3AASA 3M7QA 2HPPH 3STJA 1ZHRA 1QJ7B 1QURH 1HPGA 1GMHF 1AHTH 1MKWK 1T8MA 3SGAE 1L4ZA 1ANBA 1GGDC 2VIQA 5GNDA 3LGTA 1GI2A 1J14A 1HGTH 1SKYE 2BDHA 1YF4A 1AN1E 2XYAA 5T6DA 5JBAS 1V2WT 2L74A 3ATWA 5HIYA 1GMHG 4B74A 1ELDE 3PO1C 4ACAA 2ZTXA 2RG3A 3TGIE 1QA0A 3UWJH 4DY7B 4ESTE 1H8ED 2JKHA 3RXEA 5DP5A 1IQLA 2G4TA 1CBWB 1ELCA 2F3CE 1O36A 3P95A 6LPRA 3EGKH 1UTLM 4DG4A 1LMWB 3RXUA 3VPKA 1HBTH 1TWXB 3IITA 2G5VA 2STAE 1WSSH 4AN7A 3VB5A 1TNGA 3S9BA 3MO3A 4WY3A 2ZCHP 2PHBA 5DJ7A 5FPTA 2BYAX 1L1NA 1DY9A 1A0HB 1GHYH 1V2MT 1DUAA 1GCDA 1LHEH 2HGTH 5ESBA 1P8VC 1P0SH 2F9UA 4GLYA 3PTNA 4CRCA 1FY4A 3BIUH 1QBVH 2G55A 3N7OA 1HRTH 1W2KH 1ZJDA 2G52A 2JH5D 2UUFB 1O2LA 3A8AA 1ZLRA 1KYNA 1WUNH 1UVPA 3TITA 2SNVA 3GDSA 4JZEH 1TQ0B 1FIZA 4ZXXH 3B8JA 4K2YA 1XKBC 3KNXA 3P8OA 5L6NH 1UCYE 3SOSA 1B0EA 2H6MA 1SPJA 4H42U 4IC6A 1ESTA 2JETC 4A6LA 1SGQE 4FVBA 1HJAB 1O3OA 1Z1IA 1AVXA 1NN6A 2BD7A 2TBSA 2SGFE 3MQKC 1OXGA 2Z9KA 2ZNKH 3ZYDA 5EPNA 5CHAC 3RXDA 2BLVA 1DT2A 4INLA 1UTPA 4DJZB 5IYTA 1GI8B 3ATMA 3I78A 1OP0A 2WPMS 4AYVB 4BNRA 1DXWA 1VKYA 4R0IA 1BMMH 1PQ8A 1DPOA 1LVMA 5A8ZA 1MZDA 5F8TA 2K1QA 1C2DA 1EX3A 2FESH 3A7TA 2FDAA 2OLGA 1ZRKA 3OU0A 4ABHA 3ZZ3A 1QJ6B 2A7JA 4K60A 1F5LA 1GJ8B 1PQAA 2FZZA 3UB0A 1Y5AT 2PTCE 3HK3B 1YP9A 1TPSA 1ESAA 1SHYA 3KF2A 3TJOA 3HKJB 2LELA 1IQKA 2YMSC 2GD4B 1BTPA 3K2UA 1SGIB 1BTZA 5H4IB 1UTQA 1FPCH 2SGEE 4NA9H 2J4IA 4RT0A 5JBBS 4KP0A 2GP9B 4JK6A 2BOHB 1N1LA 2J94A 4NGAH 1O32A 3MO6A 1TNHA 1THPB 1ZPCA 1G30B 4WH8A 1O37A 1AY6H 2ALPA 2XBWA 2JH0D 4X1PU 1XXFA 1C1TA 1C4V2 1GHBF 1XXDA 4RT1A 4ZKNU 3H09A 3SO3A 3CENA 3KYFA 2P3UB 3PRDA 2XOKD 1C5LH 1GJCB 2O9QA 2B0FA 1P9SA 2R9PA 5SGAE 1V2JT 3FKSD 3P17H 1B5GH 2FYRA 2NU2E 1NU7B 2H1UA 1HFDA 2Y80A 3MOCA 3DSOA 1AQ7A 1D3PB 1BRCE 2ZU5A 1GHBG 1O5CB 1GBIA 4CBNA 1O2ZA 1SSXA 3LU9B 4Y7BA 4X6MA 1LQDB 4B2BA 1DANH 4CR9A 1MAXA 4K1TA 1VCPA 3LGWA 1Z7KA 1LPZB 1COWD 1GI6A 1ZYOA 1O2GH 2A31A 2Z7FE 3N99A 1W3CA 3HKIB 4YLUA 5FX5A 1UTKA 3SJOA 1EAWA 4ISHH 2AS9A 4MPUA 2LP6A 3GYMA 4ZUHA 4OM9A 2AIQA 3ELAH 1YM0A 4BAKB 4TY7A 5PTPA 4ZHAA 2W7SA 2ZHDA 2VIOA 1IHSH 3E6PH 1NU9A 2FTMA 1KXDA 5L2YH 1JMOH 1MU6B 1V2ST 2QXHA 2J38A 3FP6E 3VGCB 1GHXH 1QNJA 1BMAA 3WW7A 1KXAA 1NROH 4OS2A 1C5RA 1F92A 1OWHA 4JK5A 2H9HA 1GCTB 4WMEA 3PROA 4HZHA 1MCVA 1Z1JA 1GBTA 3M7UA 3S9CA 1O2RA 3A8DA 1Q2WA 1GHVH 3LGUA 1GHWH 1T8LA 1Z8GA 1TMUH 3RMMH 1AB9B 1TOMH 1FY5A 1XM1A 4LZ1H 2YMSD 2CF8H 4ZHMU 1GDUA 1NFWA 2HNTE 1Q3XA 2VIDA 1T32A 2ZF0H 1O2UA 3OAAD 1SMFE 1FXYA 1RTFB 4H6TA 1PPGE 1SL3A 5E0GA 1CU1A 2JH6D 1IQEA 4BTTB 5GCHF 2P95A 4VGCB 1BTXA 2KCYA 2QXIA 1ZPZA 3L33A 3OY5U 3U9AH 1YPHC 2QAAA 3ZVFA 1O3KA 3MYWA 1BA8B 1QTFA 1TMTH 4K8BA 1GWAA 4WH6A 1DS2E 1TA6A 2EI7A 1KY9A 1VITF 2FX6A 2ZPRA 4DCDA 3U98H 4UFDH 1G36A 4HTCH 3SUGA 1AFEH 5GCHG 5HXFA 2Z6BD 2FIRH 3LT3A 3T5FH 1ANCA 4X0WU 4B71A 2VBCA 3S0NA 5BPEA 1DXPA 1E34B 1L1GA 2ZDLA 1GJ7B 1ELGA 1TQ7B 4BAOB 1SBWA 2OC1A 1W7GH 5A2MH 2XC4A 1ELBA 4XDEA 1C5SA 1V2LT 3GYLB 1O2JA 1K9OE 2GMTC 1KMHB 1OP2A 3EA8A 2Z94A 2ZEBA 4B73A 3GY7A 1ZPBA 4X8SH 2D1JA 1GI9B 2FWWA 4RI0A 5HGGA 3SGQE 2OCVB 1DDJA 1ELEE 3TK6A 1TNLA 1ACBE 2XC0A 3TU7H 4D9QA 4ZHLU 1SGDE 4OS6A 3UNQA 2A2XH 1S6FA 4RKOB 1UTNA 1H4WA 4DT4A 4BXWA 4WF8A 3GS9A 5KECA 1GBDA 1BITA 3ZZ4A 2BZAA 1SHHB 1WTGH 1TPOA 3DCLA 1UVTH 3QWCH 4YM9A 3SN8A 1C1UH 1P2QA 2F43B 1NFYA 2ZZUH 4ACBA 1MBMA 2ZFRH 3SUFA 5C67A 7GCHF 1GI0A 3VB7A 1O2YA 3TK5A 1O3PB 1P2MA 2VVCA 5HMAA 3ODFA 3H7TA 3AAVA 2NU3E 4KKDA 5JPMH 2P93A 1SI5H 1BJVA 1GI7B 3RLWH 3FOAA 4CREA 4F55A 1SC8U 2QE7D 2VWLA 1OX1A 2VIWA 1P12E 1SLVB 1JOUB 2HRVA 1VCQA 4AORA 1N8OB 1Y3VA 3NWUA 1SLUB
chains in the Genus database with same CATH topology
1YLCA 4MVNA 3STIA 1EZSC 1WV7H 4BAMB 1SOZA 3GCHC 3QZQA 7LPRA 1A1RA 5G4BA 1GMCF 2Z9JA 1N6XA 3SNEA 1DITH 1UCYK 2FP7B 2GZ8A 2XCNA 2J2UA 4E7RG 4B2CA 1RTLA 1O3AA 1OKXA 2FS9A 1CA0B 2H5DA 3RXOA 1TNKA 3C1KA 4FUEA 1GMCG 2V3OH 1VGCB 1EPTB 3TIUA 2ZFSA 1W8BH 2SFAA 3TH3H 1HAPH 1GI5A 1HJ8A 2CN0H 1GL0E 2DUCA 1O3JA 2G8TA 4ZXYH 3RUOA 4A7IB 2YNBA 1SGNE 2ZFTA 1RJXB 1TNJA 3FANA 4XBBA 3RLYH 3SU0A 1EB2A 2XBXA 1GBAA 3M35A 3MU0A 5ETXA 2ZIQH 3A81A 2QY0B 3DT0H 3NPSA 1ZHMA 1O3DA 1QRZA 3TNTA 1PPEE 1W10U 1DLEA 1O3NA 1VCWA 3MNBA 2Z3DA 5DP8A 3SZNA 3UNSA 1JWTA 3M3VA 4YOIA 1C2HA 1CO7E 1EXFA 2WV5A 1EOJA 1JXPA 1P03A 2ZPSA 1DICA 4X6PA 3D62A 1MCTA 1FN6A 2OUAA 3VB6A 4JMYA 1EJAA 4D9RA 3UTUH 1V2TT 4GCHF 5A09A 1BJUA 2FO9A 4NA7A 1SR5C 2W5EA 2VH0A 3C27B 1GJ4H 2PWXA 3ZZAA 1VR1H 3M61U 3UREA 3L3TA 2KAIB 1O35A 4Y0ZE 3BN9A 1ESBA 1VJAU 2F9VA 3K65B 2HVXA 3EA7A 4GCHG 1SGFA 3ZVAA 1BT7A 3CS0A 4NSVA 5C1YA 1LHFH 3O8BA 2FOGA 4I8JA 3ZZDA 1S6HA 2ANWA 1SFQB 4Q7ZA 4IMZA 1LVOA 3HGNA 1DY8A 2DE9A 1TBRH 2GT8A 3DFLA 2M5TA 2A0QB 2ZG0H 1EUFA 1O3IA 1UHBA 5GXPA 3A89A 2Y7ZA 1ETRH 1A46H 2FPZA 4A1XA 3E0NB 2Z9GA 3LPRA 3NXPA 1G37A 1J8AA 2NU0E 1W0YH 2A45B 2C8XB 1V2KT 3BIVH 1Q31A 1C1OA 4Y76A 2FYQA 1CSOE 2SGAA 4X6NA 1FLEE 1ZTKA 2TPIZ 4DVAU 5FBEA 4AOQA 2Z3CA 1O3CA 1HXEH 2EA3A 1G2LA 4Y7AA 3OSYA 2BZ6H 4AGKA 1M9UA 2BQ7B 3FAOA 1TYNA 2A7HA 1K1IA 4RKJB 1QR3E 1ZMJA 3AVZA 1SGCA 2ZDNA 3V3MA 2G4UA 4JYVH 3TLOA 4NIXA 4B76A 1JIMA 2Y6TA 2AYWA 2XW9A 3GY3A 1L0ZA 2R3UA 2FS8A 1GBFA 2XXLA 3K6YA 1XUJA 2QF3A 5C5NA 4X1NU 1YBWA 3GISB 2PGBB 4KTSA 4CHAB 1O3EA 4X2VA 2BD3A 3MH7A 4DW2U 4DT7B 2WUBA 3SU1A 1HDTH 1MD8A 2BMGB 2FM2A 3BTQE 2IOTA 1J16A 4CH2B 3SJIA 5B6OA 2RA3A 1S85A 3RMLH 4LZ4B 4ISIH 3SU2A 2STBE 1MTWA 4FUBA 3RXKA 1H8IH 1AWHB 2CXVA 1Z8RA 1AFQC 4JZIA 5IDKA 3RXJA 1AVWA 1GDQA 1PPZA 1OOKB 4CRAA 1JIRA 3GDVA 3CS7A 4BXSA 1C1QA 5T3HA 4Y8XA 3TPIZ 4MNVA 3NUMA 1BZXE 4ABEA 1AMHA 3SJ8A 3RXSA 1YC0A 2BD2A 2RDLA 3A8BA 1Y3UA 3SI3H 3EYDA 2ZQ1A 2EC9H 1UVUH 1VZQH 2Y5FA 3GOVB 4UEHH 4ZMAH 1S0RA 3K6ZA 2R3YA 2WPHS 1P3EA 1H1BA 1NZQH 2F9OA 1VITH 3MI4A 1P01A 1GBCA 1GBHA 4JYUH 2GZ7A 1NRQH 3Q3XA 1KTSB 2PKSB 2P8OC 1ELAA 2VIVA 3W94A 3KHVA 1LO6A 1WQSA 1UCYH 1C1RA 1C5ZB 2VIPA 2VH6A 1JBUH 1C5WB 4YOJA 3S7HB 1NRSH 3EAJA 1Y8TA 4WWYA 3URCA 1GG6C 1S5SA 4FU7A 5JB9S 1MTVA 4UONA 2BVXH 5FPSA 1WOFA 4D7FA 1MZAA 1FNIA 2HOBA 2ZA5A 1YCPM 2VU8E 1AKSB 5TCCA 2YNAA 3LGVA 1WBGB 1TBZH 1MH0A 3B23B 3ZYEA 1MKXK 3DD2H 1PFXC 1ZHPA 2PLXA 4K5ZA 3ATLA 1K1PA 1YCPK 2P3TB 3BV9B 3MH4A 3LOXA 1QIXB 1IQGA 2A4RA 2VWNA 3M5LA 1OYQA 2BDYA 3SV2H 1DVAH 5FCRA 3LGIA 1FZZA 3ZZBA 2AMDA 2GKVE 4FUFA 3SJ9A 4IMQA 4D7GA 3P8GA 4D76A 2VWOA 3KCGH 2BOKA 2OD3B 2QN5T 4ZKOU 1C2LA 2FXRA 2OQUA 1QB9A 2BDIA 2G00A 4IS5A 2UUYA 4TY6A 3NCLA 1PPHE 4XFQA 3TGJE 1AO5A 1C1PA 1ETTH 5ESTE 2P16A 1BDAA 5HM9A 2OBOA 1FONA 1BRAA 3EDXB 2BLOA 1ID5H 3PMHB 2WPJS 3M37A 1LHDH 2G81E 1HLTH 5GIBA 1EZUC 2BVRH 4UE7H 3UQOA 1SG8B 1C5QA 2W3KA 1YPHE 5EQSA 8ESTE 2GZ9A 1Z6JH 1DSTA 1KIGH 1QL8A 1EATA 3KN2A 4Y10E 2Y5GA 3QX5H 1BTHH 2CF9H 3BG4B 3ITIA 2R2MB 4OS5A 1E36B 1HIAB 4U32A 4O3TA 1SGYE 4FUJA 1C2JA 1SFIA 1A0JA 3BEFB 4O97A 1LQEA 1S0QA 5F8XA 4I8HA 1RD3B 1ZTJA 1O5GH 2P59A 1TABE 1HAZB 1QQ4A 2QC2A 4TWWA 5FX6A 2HPQH 1SGTA 1HAHH 1P10A 1V3XA 1YLDA 1S84A 2ODQA 1RXPA 2CGAA 5FHTA 6CHAB 3E91A 3TH4H 1WCZA 8LPRA 5DP9A 2XBVA 1A3EH 2NWNA 3PTBA 5DO4H 1T4VH 5DGJA 1O3MA 1XUHA 2GT7A 4GHQA 1O2PA 1A0LA 4XE4A 1P2OA 2ZKSA 2BXTH 3ZZ8A 1IQJA 2A1DB 1HJAC 3MU4A 1NRPH 3A85A 3ZV9A 5K7RA 1GMDF 4OS1A 2FI4E 1V2QT 2V35A 4K69A 1TALA 1EJMA 5GPIB 1G3DA 3RU4D 5A0CA 1P09A 4O3UA 3SHCH 1V2RT 1C1WH 1QHRB 1FN8A 1TMBH 3E1XB 4XSKU 1TGCA 4BAQB 5J4SA 1GMDG 3BF6H 4HI3A 4ZAEA 2BQ6B 5LPRA 4NCYA 1LTOA 1FAXA 5C5OA 1HB0B 1QA7A 2BY8X 2GGVB 4X6OA 2J95A 1GI3A 1C1NA 1T8NA 1KTTB 3V7TA 3LIWA 1HAXB 3BTTE 4TYDA 1GBLA 4Z0KA 1K1MA 3AW0A 2F9NA 3GY2A 4DIHH 5JBTA 1HAYB 3KQDA 3SORA 2ZCKP 1QBNA 3A8CA 1GBEA 1V6DA 1MKWH 2AIPA 3MU5A 1LCYA 2BLWA 1UK3A 2VB0A 3RXMA 1YPMH 1AZ8A 3A7ZA 4Y8YA 5T6FA 4YLQH 2FI5E 1OWKA 1O0DH 4AYYB 3U8RH 3FZDA 4J2YB 2CHAB 1ZTLA 1CA8B 1O5BB 3SQHE 1T31A 1UVSH 2Y81A 1TB6H 3V12A 1NFUA 2IPHA 4LK4A 1KXFA 2GV7A 4LXBH 3ZVCA 4MDSA 4BAHB 1CGHA 1B0FA 4FVDA 2ZGXH 1HJ9A 2ZHEH 1GVZA 2PUXB 3A7XA 1DOJA 1XX9A 1FPHH 3QO6A 1ZRBA 2F91A 2RCEA 1ABJH 1P3CA 1ANDA 1S83A 2VJ1A 1C5YB 4E06H 3GY6A 2FTLE 1O5EH 1LDTT 4K3JA 3SNAA 1NM6A 4X8TH 3A80A 4FUIA 2A5KA 1O2OA 1UMAH 3SW2B 3Q76A 3MMGA 2Z9LA 1OWIA 2OINA 3MH6A 3BTEE 4GVUA 1G2MA 3BTDE 1BMLA 1IQIA 1O3GA 3ATKA 4INHA 1D6WA 2OC7A 1ETSH 3D65E 3O8RA 1EPTA 1C2FA 3AW1A 5A8YA 1C5NH 1YCPH 4KTUA 1C2IA 3MWIU 3F1SB 1QBOA 2BB4A 5E2OA 1SQOA 3VB4A 4X1RU 4JZDH 2LNCA 3VGCC 1P11E 1K2I1 4D8NA 3PMBB 3RXAA 5I25A 2FOEA 2WINI 3LH3A 4K8YA 1GCTC 1PJPA 5AVDA 1YPGH 2FLRH 1O2IA 1BRBE 3L6PA 3A7WA 2VGCB 4ABGA 1C5XB 2ZECA 2ZFPH 2A2QH 1AB9C 1BHXB 1KXBA 2WV4A 1U6QA 3W95A 2OC8A 2BHGA 2QGRA 1MUEB 1DWBH 1DFPA 1C2EA 2TGDA 1A5IA 3D49H 4OS4A 4AFQA 4VGCC 1MTNC 3VXEH 4NIVA 1EASA 2ESTE 3A84A 3UOPA 4F4OC 3RXVA 2H9TH 2HALA 2R2WU 1EP5A 2P3FH 4GHTA 1W12U 1TRNA 3T26A 2PV9B 5EQRA 4O03A 1HAVA 3F6UH 3SV7A 4UD9H 3PLKA 1A5HA 2ZFQH 1NRRH 2D26C 3P70B 1H8DH 3I29A 2ZHQH 2XCFA 4NFFA 3RXHA 5GJ4B 1C9TA 3JZ2B 2HWLB 2Z9IA 4AZ2B 4A1TA 1KLIH 1KDQB 1C5TA 5FPYA 3ZVDA 2O8TA 1V2NT 1GDNA 1OSSA 1LHGH 1GBMA 5A0BA 4I7YH 4WXVA 1LVBA 1TLDA 1TIOA 1C4Y2 3BTWE 1RIWB 1GPZA 3LONA 3RXRA 4NIYA 1IAUA 3ZZ9A 1SGRE 1Z8IB 2ZGCA 1BQYA 1C5UA 1FV9A 2AFQB 3UR9A 9LPRA 1L2EA 3CP7A 2VVUA 4U01A 1K1OA 2O8UA 3GCNA 1HXFH 1XMNB 2D8WA 2RA0A 1JRTA 1C1MA 3ATIA 3GCTF 1ZSJA 3HK6B 2XBYA 4LOYH 3DHKH 3MFJA 4ZROA 1FAKH 3ZVGA 1P2KA 2XWAA 3BG8A 3TK9A 2XC5A 1LVYA 3MU8A 1ELFA 4CRFA 2PKAA 2GCTB 1O3FA 4I8LA 1OWEA 3MNCA 3KIDU 3SHAH 1Y5UT 4SGAE 2A32A 2HNTF 3GCTG 2EEKA 2WPKS 4B75A 4UFEH 1ZOMA 4DIIH 4CRDA 1HAIH 1C2MA 3EA9A 3RXIA 8GCHF 1BBRE 3I77A 2O8WA 3SUEA 2C8YB 2W3IA 3F9EA 1BCUH 5AFYH 1CGIE 3OX7U 2G51A 3P6ZB 4GSOA 2ODYB 1TFXA 2FOAA 3GDUA 1XUIA 5EOKA 1E37B 8GCHG 1CA0C 1J9CH 1CHGA 2XRCA 4AB8A 2UUKB 2C4FH 2GX4A 1CGJE 2QIQA 1N6YA 3P8FA 1EPTC 2BDBA 2EI6A 1GGDB 2ZQ2A 5F8ZA 4TPIZ 3T2NA 1D4PB 3ESTA 3D23A 2A5AA 2H2ZA 1BHXF 1P2JA 1TRYA 1Z71A 1GJ6A 2BVSH 3PO1B 2ANYA 1QY6A 4MG3A 1Y3XA 2FI3E 4I31A 3KQBA 4UFFH 8KME2 3SJKA 2ZGHA 2VNTA 3GCOA 2ZU3A 1MD7A 1GJ5H 1A61H 2BD9A 1O30A 5EODA 3A7YA 4BOHA 4YT6H 3MU1A 2O8MA 5E0JA 1ZGVA 1O2MA 1NTPA 1QB1A 1C5OH 2OBQA 2AGIX 2FODA 3RXBA 1AD8H 1A4WH 1MU8B 1TONA 2V3HH 4X2YA 1GI4A 1PPFE 3U8TH 1WU1A 3RMOH 4E7NA 3PMJA 4WVPE 5DP4A 2C8ZB 4FUGA 3ZZ6A 1UO6A 1BB0B 2ZU4A 4IW4E 5HYOA 2QA9E 4I33A 1ZJKA 1F5RA 5JB8S 4CH8B 5EXLA 2PGQB 3RXPA 1QL9A 1GJBB 3TJUA 2FX4A 4NA8A 1QQUA 1BTYA 2ZDAH 1O34A 2ALVA 4TWYA 4IN1A 4M7GA 3EQ0H 2FEQH 4X8UH 2A7CA 3NZIA 1BIOA 1LKAA 2JETB 1BRUP 1FDPA 1LPKB 1DE7H 1KLJH 4FU8A 2ZHWH 4FU9A 4WJG2 3RP2A 1SQTA 3IG6B 3SNDA 3S9AA 4ABIA 1NY22 2W7UA 5CHAB 2W26A 1O2HA 3U8OH 1O2TA 4CRGA 5DKMA 2B7DH 4ABAA 1UHBB 3SU4A 6ESTA 3UIRA 3O8DA 1ARBA 1EOLA 1UK2A 1A2CH 1TGNA 3U1IB 3QK1A 4IBLH 1J15A 5TJXA 1BMNH 7KMEH 3M5MA 3P8NA 3E3TA 3SQEE 1K28D 1YPEH 5LPEA 2ZP0H 3ENSB 3U69H 2I6SA 1V2OT 3RXCA 3TVJB 1YPJH 3UFAA 1CHOF 3ZZ7A 4H4FA 5GDSH 1FY1A 1K1LA 4MNYA 2ODPA 2J9NA 2BY5X 2BD4A 4R8TB 2A4QA 5F03A 3A83A 2J34A 3GY8A 3UR6A 1C5PA 1CHOG 3KQCA 3ODDA 5JBCS 2LPRA 2BD8A 1D3QB 5FAHA 2ZDMA 3UPEA 5EGMA 1HIAA 1RS0A 5I46H 2PW8H 1CQQA 3LDXH 5HM2A 1EJNA 1QL7A 3SNBA 5E2PA 2Q6FA 1G32B 4O9VA 2ZCLP 3RC4A 2DE8A 4YO9A 3BSQA 4GPGA 1Y3YA 2ZWLH 3BEIB 3RXFA 4CHAC 2FOMB 1H9IE 1Y59T 1C1VH 3QZRA 3FFGA 1Z6EA 3PB1E 3M5NA 4HGCA 4ZKSU 1ANEA 2A5IA 1MQ6A 1NO9H 5FBIA 1G9IE 4ABFA 2HLCA 1INCA 2BY6X 3FVFB 1TGSZ 4NZQA 3HPTB 2ASUB 1TGTA 3SU6A 1CVWH 2I6QA 3RM0H 4AFZA 4YESB 4ISLA 2Y82A 4FXGH 2IN2A 4IGDA 1W14U 4Q7YA 1DM4B 3BTHE 3TH2H 5CMXH 1SQAA 3KEEA 3PLPA 1TX6A 2J92A 1PPCE 1D3TB 4NZLA 1GHZA 4FUDA 3VXFH 2GCHF 1A7SA 2GDDA 3A7VA 3BTFE 3SV9A 1C2KA 4OS7A 2QYIA 4A5TS 3GY4A 3M3SA 4HFPB 2VVVA 5E0HA 1EP6A 2PTNA 2FLBH 4Y11E 2V6NA 2CV3A 1F0TA 2H9EH 2ZO3H 1OWJA 1NT1A 1V2UT