2OLGA

Crystal structure of the serine protease domain of prophenoloxidase activating factor-i in a zymogen form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
276
structure length
276
Chain Sequence
RNRRPELLPNDCGYQVEADKILNGDDTVPEEFPWTAMIGYKNSSNFEQFACGGSLINNRYIVTAAHCVAGRVLRVVGALNKVRLGEWNTATDPDCYGAVRVCVPDKPIDLGIEETIQHPDYVDGSKDRYHDIALIRLNRQVEFTNYIRPVCLPQPNEEVQVGQRLTVVGWGRTETGQYSTIKQKLAVPVVHAEQCAKTFGAAGVRVRSSQLCAGGEKAKDSCGGDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRDWIEGNIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-phenoloxidase activating enzyme-I
publication title Crystal structure of the serine protease domain of prophenoloxidase activating factor-I
pubmed doi rcsb
source organism Holotrichia diomphalia
molecule tags Hydrolase
total genus 66
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2olgA01
1F5LA 1O2KA 1ZPCA 3UWIA 1ELBA 3UNQA 1UVOA 2Y7XA 3S7HB 1Q2WA 1TMTH 4D8NA 3SO3A 2WPJS 4PROA 1E38B 3CENA 1YCPK 2A1DB 4FUGA 2UWLA 3BTQE 1W13U 3JZ2B 2FX4A 1TQ0B 4CR9A 4U01A 4X8UH 5DKMA 3GCHB 1ZHMA 4FU9A 1C2FA 1QIXB 1UJ1A 1F7ZA 1O0DH 1QY6A 4YLQH 3RXHA 3P95A 1T8OA 1O3IA 5GIBA 2VIWA 1GMDF 3LC5A 3SU2A 1O2IA 1FMGA 5ESBA 1FAXA 1MTSA 2XTTB 4WY3A 1EX3A 4A6LA 1UK2A 4UFDH 3S9BA 1TBZH 3A7XA 1D6WA 4FUEA 1QFKH 1TGCA 4RKOB 1HJAC 1C4Y2 1O2UA 4Y8XA 4OGXA 3LOXA 1IQHA 1DXWA 2ANMH 3ZZ5A 1HAGE 1VCQA 2FWWA 1GJ4H 4K1TA 2KAIA 3SI3H 1CT4E 1VITF 1O35A 3MH6A 1VR1H 3E0NB 3RU4D 4DJZB 1XUJA 3T27A 5FHTA 2J4IA 1SPJA 1ANDA 4UFGH 3KL6A 1LVBA 5A09A 1WQVH 2FP7B 2Z7FE 2ZNKH 5DP3A 3U1IB 2OD3B 4HZHA 2OC8A 4JZEH 4XSKU 1OWJA 5LPRA 1ACBE 2GD4B 3RXQA 1P05A 5F8TA 2OBOA 1EZUC 1V2RT 4YOIA 3U8RH 5EQSA 3VPKA 1Y3YA 2J9NA 4E7RG 3EQ0H 3AW0A 6GCHF 2ZPRA 1H9HE 8LPRA 1V2JT 2WV5A 1O2XA 1AN1E 3KGPA 1HGTH 1BTPA 2FLBH 1A1RA 3SV9A 4YZUA 4AFQA 1HAPH 7KMEH 2GCTB 2UUYA 1H8IH 4GCHF 4H4FA 2ZEBA 2IN2A 2EA3A 2CJIA 5E0JA 1CU1A 2IPHA 2ZGHA 3B23B 1GVKB 3AW1A 1FXYA 2BY7X 1OYQA 1Z6EA 3RXTA 2M5TA 2FIRH 2QXHA 3SHCH 4BAOB 3IWMA 5LGOA 1SI5H 1FQ3A 5I25A 1ABIH 2SGEE 1HIAB 4XDEA 1KXFA 3D65E 3SNDA 4CREA 2WPMS 2W26A 2NU3E 5HYOA 1O3FA 2Y7ZA 3KIDU 1HB0B 1SHHB 1MU8B 1T7CA 1CVWH 3H7OA 2FTLE 1PPZA 1MKWK 5F6MA 1UTNA 2P94A 1GI5A 4X6NA 3OSYA 3M5NA 3UQVA 1BMMH 5J4QA 1FJSA 2ZDMA 3T62A 4AGJA 1TE0A 1IQNA 2FI4E 1UVSH 8ESTE 1O32A 2VWMA 3IITA 1P3CA 2BD3A 1T32A 3STJA 4BNRA 2AEIH 1O2QA 4B74A 1TRMA 1VZQH 1RFNA 4ABGA 5DP8A 3RXAA 3RXRA 2WPHS 4X2VA 5DPAA 1QJ7B 2VWNA 2TGAA 1GHAG 1AE8H 2ZFSA 1DITH 4JZIA 3RMMH 2BD5A 3A7YA 2PKAB 4YOGA 5JPMH 5TCCA 1LDTT 4FVDA 3TGKE 3E1XB 3OX7U 1JRTA 1GJDB 2OUAA 3P8FA 3QLPH 3A7WA 1S84A 1QURH 5HM2A 4J1YA 4GAWA 1UVPA 3MH4A 2FS8A 1C5OH 3SNAA 2G5NA 1GJAB 4I8KA 1ZHRA 2UWPA 1ELAA 1O5FH 1BRUP 1E36B 1TPOA 2VIDA 1S0QA 2VVUA 1UTPA 2OC7A 3GY3A 1GG6C 1GBMA 4H6SB 2ZTZA 3BTKE 4UFFH 4I8LA 3SJIA 1DUEA 1YGCH 1NESE 3MMGA 4ESTE 5EPYA 2AIPA 3NCLA 2G5VA 1BMAA 2ZC9H 2WPLS 1SGEE 1THSH 2R2MB 1AI8H 1O34A 1TONA 4ZROA 1S6FA 1C1TA 1L1NA 2V35A 1IQIA 2VIOA 1HCGA 2FOBA 4OS1A 2OC1A 4ABAA 2QN5T 3HGNA 4NFFA 1GI6A 1HJ8A 1AFEH 5A2MH 2BZAA 1HAXB 1ZTKA 1AMHA 1A5GH 1CBWC 2RA0A 4NA7A 2CF9H 5JBTA 3URCA 5E2PA 3P8GA 3SI4H 2Y81A 1TLDA 1YC0A 2A45B 2TRMA 3GY7A 1HAZB 3VB5A 3SUDA 1FPCH 3A7TA 3M7TA 1C5VA 4Y79A 3A7ZA 4SGAE 1A3BH 2I6QA 3A8BA 3TPIZ 1UTMA 1JMOH 1BMNH 2OCVB 2GCHG 2DUCA 5DP7A 2ZU3A 4IS5A 2ZP0H 4BANB 2D2DA 2Q6DA 1DWDH 1EXFA 1GJ8B 1A5IA 3GCHC 4BTUB 1AGJA 3LU9B 2OBQA 3URDA 1GBHA 2CF8H 2ODYB 1O3NA 2PV9B 2WYJA 3RXJA 1JBUH 4KELA 1K1JA 2CGAA 2C93B 1P09A 4H42U 2Y5HA 4X2WA 1MD8A 5T3HA 5T6DA 1V2ST 2HWLB 1GBTA 3PTNA 3ZVFA 1SL3A 3SU0A 1LPZB 2J2UA 2YNBA 4X6OA 1UTJA 3KQBA 3M61U 3U8TH 4B76A 3EA8A 3P17H 3LGTA 2QA9E 4UDWH 1J9CH 2A31A 1DPOA 4Q7YA 1HXEH 1SGFG 1ZSJA 4AGKA 2ZFQH 1C2KA 3UR6A 4ZKNU 2ODQA 4BTTB 1QR3E 3Q76A 4CR5A 1Y3UA 1TGSZ 3RC4A 1GI1A 2XBXA 2H9EH 1W12U 3QUMP 4Y8YA 4DIHH 1LVYA 5IYTA 2F9BH 1EATA 2GVFA 2JH6D 1GBBA 1UCYK 4WXIA 1O2TA 1AUTC 1ZMLA 3EE0B 2B5TB 3ODFA 1HYLA 1C4V2 1C5SA 1FAKH 4UONA 4RSPA 1IQEA 1GHYH 2XBWA 1OWDA 1V2NT 3QGJA 5A0BA 1TNGA 2H5DA 1NFYA 3VEQB 1P04A 1NO9H 2C8WB 1GCTB 5L6NH 5HXFA 1GPZA 1YPEH 3GY5A 3EA7A 1ETRH 1A0HB 4M7GA 1VITH 2VWOA 3RU4T 3ZVDA 2GCTC 1C9TA 2PKAA 1K1IA 3SGBE 1YPLH 2OLGA 2ZCKP 5G4BA 1PPEE 4IMZA 2F83A 3D49H 1GHXH 3A80A 2ANYA 5F03A 4IN1A 1V2MT 2HNTC 3ZZ4A 2Q1JA 4MNYA 1E35B 2FOEA 1FNIA 2YNAA 4ISHH 5BPEA 3MO6A 1GJ5H 4MPVA 2CXVA 2G4TA 3GCTF 2ZHEH 1NTPA 1OOKB 2RG3A 2TGDA 2BX3A 2BQWB 5GCHF 3V3MA 3BEFB 1O2NA 2A4QA 3QTVH 3GYLB 1QRZA 3M3TA 4YTAA 6ESTA 2FOGA 2D8WA 3E3TA 4AB9A 2ZDNA 1GBFA 2HALA 1NU7B 1QJ1B 1C5PA 1HUTH 3RU4E 1P2OA 5EW2H 1OKXA 1W11U 3LGUA 5HGGA 1ZSKA 1KY9A 4LZ1H 2H2ZA 4GSOA 1EUFA 1VGCB 3LIWA 4MPUA 1LHGH 2BY9X 3F9HA 2GZ9A 3EGKH 3BTME 1Q31A 1LTOA 1D4PB 3HKJB 1JIRA 2F9OA 2ANKH 5FCRA 4YESB 3PMBB 1GMHF 4ZXYH 5CMXH 4D76A 3F9GA 3MU0A 2FDAA 5FBEA 4GHQA 1O3AA 2VINA 2HNTF 2SGDE 1FLEE 1S82A 4AFZA 3AAUA 1O33A 2PR3A 2AS9A 3TNSA 4ZUHA 2BD4A 2Z9IA 4FUIA 4WF8A 1DANH 3R0FA 3RXDA 3ZYDA 3K2UA 2BY5X 3MOCA 2HOBA 3MNXA 2V6NA 2FOFA 3TITA 3TH3H 1O2RA 1RTFB 2W7UA 1AU8A 2P3TB 2BVXH 3M7UA 1GI0A 2TPIZ 1O36A 1K2I1 1AVXA 3RXOA 3MHWU 2AGIX 4ZHAA 1QQUA 3CP7A 3ZVBA 2AMQA 4Y76A 3DFLA 3BTDE 2HGTH 1P8VC 1WU1A 2ZFTA 1EAWA 3GOVB 1TRYA 4WWYA 1EJAA 2JETB 4X2YA 4NWKA 8GCHG 1Z8JB 4R0IA 3QN7A 3ATKA 4NIWA 4BAQB 1CGIE 2H5CA 4ABDA 3KCGH 3A7VA 2GX4A 2G4UA 1MZAA 1P03A 2TIOA 3DD2H 1TWXB 1XKBC 2ZF0H 3RC6A 4K3JA 2PKSB 1C4U2 4CH2B 1O2ZA 4YOJA 3R3GB 1WYKA 5E0GA 2PLXA 2JH0D 2QXGA 3A86A 2QF3A 1ANBA 3QO6A 1YP9A 3TJNA 2Z94A 2Y5GA 3BTHE 1S6HA 1YPHE 4MNVA 1DWBH 1DICA 2NU1E 3ZZBA 1P9SA 4IN2A 3SU1A 1P06A 1TIOA 2THFB 5DK1A 3P70B 3UNSA 3A8CA 4AG2A 4FXGH 1H9LB 2A5KA 7LPRA 5A8ZA 5EXMA 2FPZA 1GMDG 2V3HH 4LK4A 3SUFA 3UFAA 6CHAB 3L3TA 1BIOA 4B1TA 2ZIQH 3ITIA 3U8OH 1ZJDA 3E91A 1W2KH 1V3XA 4XBDA 2WUBA 4O97A 1BTWA 2CV3A 2TGTA 3BV9B 4Z0KA 1IQJA 4AORA 1J17T 1EJNA 1HFDA 1A0LA 1P2QA 4JCNA 5FX5A 8KME2 3LPRA 4IGDA 1TRNA 3ZZ6A 2QYIA 2FOHA 4NSYA 1B7XB 1VITG 1TB6H 2FI3E 3AAVA 2Y82A 3RMOH 1IQKA 1XUKA 3E16B 1HAYB 2AGEX 1TGNA 4WMDA 3P92A 1BRBE 1F0UA 3KEEA 2ZCLP 5IDKA 1G9IE 1O3EA 1WUNH 1QGFA 3RXBA 4X6MA 2FS9A 4CRCA 2BLOA 5J4SA 4YO9A 1L4ZA 4NGAH 1DLEA 1GHVH 6GCHG 1N1LA 1QJ6B 1UK4A 3SZNA 5GXPA 2C8YB 4MTBA 1IQFA 1ELFA 4CBOA 2QV1A 2ZPSA 1AB9B 5F8XA 4XE4A 4GCHG 2QGRA 3PLBA 3ZZCA 1GCTC 1CGJE 3OYPA 4Y71A 2GV6A 2BLQA 3M3SA 1PPFE 3KF2A 2C8XB 3TLOA 1XUHA 3UTUH 1DSUA 3SHAH 1JIMA 1TBRH 3MNSA 1L2EA 1NRSH 5GJ4B 1TNIA 1Z7KA 1O5CB 2VIQA 2G8TA 3UPEA 1PPCE 5JBBS 1HXFH 2OQUA 4JZ1A 5EPNA 1WQSA 2A5IA 4MLFB 4Y0YE 4O3UA 1QL8A 1RTLA 1UMAH 1DX5M 2VNTA 1SGIB 2AH4X 4RN6A 3TH2H 1QL9A 1P57B 3M5MA 2HPQH 1AFQB 2BTCE 3PLKA 2SGQE 2XRCA 1OSSA 2Z9JA 1KTTB 1K1MA 4QT8C 5TJXA 3LGIA 1D3TB 2Z3EA 1XUFA 3QX5H 4JYUH 1C2DA 3RM0H 1TNKA 1CHGA 2BD2A 2W7SA 4XBCA 2RCEA 4INKA 5JB8S 1RJXB 2Y6TA 3VB6A 4NA8A 3SU5A 3S7KB 1T8LA 1VCWA 4ABIA 2ZTXA 3DFJA 2VB0A 1PYTC 3M36A 2H9HA 3K6ZA 3STIA 1VGCC 4X2XA 2A7CA 3PLPA 4VGCB 4Z6AH 3SV7A 3UY9A 3BTEE 1IAUA 3NUMA 2FTMA 1ZLRA 2BVSH 1Y8TA 1HBTH 1PPGE 1W0ZU 1BRAA 2ZPQA 2FEQH 1LCYA 1TBQH 2PTNA 1O2VA 4GVUA 1GI3A 5C2ZA 3SOSA 5C1XA 1HRTH 4X8SH 5L2YH 1YCPM 2FO9A 4NIYA 5L30H 1T8MA 1ORFA 4TWYA 3QGNB 1ESTA 1ZRBA 3K6YA 3ESTA 1B5GH 4HFPB 2ZWLH 1S81A 1IHSH 1L1JA 1TX7A 4AN7A 1EPTB 3A89A 1AY6H 1AVWA 1TA2A 1PQ7A 2ASUB 4Y0ZE 1UHBB 1WV7H 5C5OA 2R9PA 1AVGH 4KTCA 1TGBA 1YKTA 3WY8A 4TY7A 3QZRA 4KKDA 3RXKA 3VB7A 3LGWA 4B71A 1SQAA 3PYHA 5C20A 4IBLH 2C90B 1ZPZA 4X1QU 4I8JA 2JETC 2ZGBH 3ATIA 1BTXA 2O8MA 4AB8A 5BRRE 1MTNB 1FIZA 2ZGCA 3ATWA 3FZDA 1SGQE 1QL7A 1NRQH 2PSYA 3FAOA 1RRKA 2YOLA 2BDBA 2XC5A 2P16A 4O03A 3MWIU 1ZJKA 2PKSC 1BTHH 3EYDA 2QXIA 3U9AH 2XWAA 1TX6A 4Y6DA 1QBVH 1O39A 3PTBA 2ZDLA 1EOJA 2CMYA 2GGVB 4A92A 1W0YH 5CHAB 1GJCB 1RS0A 1FY5A 5K7RA 2SGPE 3F9EA 4GHTA 1O3JA 1O2JA 2D1JA 2F91A 2SGAA 1HPGA 4I8HA 1TAWA 2G00A 4MNXA 2A5AA 1QQ4A 1K1NA 3ZVAA 3T29A 2ZHQH 4X0WU 1T8NA 6CHAC 2JH5D 2QY0B 2BY6X 2A4RA 1QB6A 3ZZ7A 2EEKA 1AUJA 1O3OA 3HKIB 3UREA 1IQGA 1MD7A 1OXGA 1RXPA 3A84A 2FOCA 2ZFPH 3V7TA 4BAKB 1G3BA 1DXPA 1GI9B 1P2KA 4KGAA 2G81E 1O5DH 1C5WB 1YM0A 1LQDB 3E6PH 5A8YA 2Y5FA 4J2YB 4K60A 4B2CA 3MFJA 1ETTH 2BD7A 2HLCA 2AMDA 2V0BA 2Y80A 2GT7A 2ZDVH 5EU8A 1C5RA 3ZVGA 1EB2A 1INCA 4FUJA 1ZYOA 1PJPA 4ZHMU 1DLKB 1CT2E 3Q00A 5GDSH 3U69H 3DT0H 2F9UA 2R0KA 4X1NU 1L4DA 3RMLH 1A3EH 1ELVA 1AB9C 3UOPA 3Q3YA 3VB4A 1O3LA 4MG3A 1GVZA 3P8OA 1BHXB 2BOKA 3DHKH 1SBWA 1C1OA 4A1TA 1EZXC 2OTVA 2PWXA 2SGFE 3O8DA 1SLVB 2BDGA 1LPKB 3M35A 2GMTB 1OP8A 4K5ZA 3PO1B 4E7NA 1TALA 1LMWB 1LQEA 4YT6H 1QA0A 1TNLA 1KYNA 4A7IB 1GBJA 3TJUA 2BD9A 1CA0B 2ZKSA 2D26C 1MU6B 5ABWA 1C2GA 3GCTG 1GHBF 5GCHG 1GMCF 3B8JA 3BG8A 1P01A 1PFXC 1EJMA 1Z8GA 1ZTLA 3PROA 2QC2A 4WMEA 4CBNA 3F68H 1KDQB 3NXPA 1P11E 1O2LA 2R0LA 1HIAA 1MCTA 1AFQC 1Q3XA 4BAMB 3P8NA 4MVNA 3RXPA 2C4FH 5A8XA 1YF4A 3ELAH 3GY6A 1VJAU 3RXSA 2ZU1A 1XXDA 1EPTA 4OS4A 5TCAA 1J8AA 5FX6A 1F2SE 1UHBA 1FIWA 3U1JB 1FN6A 1UTLM 1AZ8A 2Z9LA 1Y59T 1Y5BT 3ZV9A 2AIQA 3MU5A 1AWHB 2AFQB 3GY2A 2LPRA 1YCPH 4K1EA 1GMHG 1O2YA 2LNCA 2BHGA 1K28D 1G3EA 1TOMH 4TPIZ 1NU9A 2BXUH 1SFIA 5EOKA 1SC8U 3GDSA 4VGCC 2R3UA 3BG4B 1Z1JA 2P3FH 2ZGXH 1C2EA 1K21H 2Z3DA 1OWHA 7GCHF 3TU7H 3PV4A 1O3DA 1NM6A 2AYWA 1G3DA 3UUZA 4WXVA 4X8TH 3RXUA 2ZA5A 2VVVA 3O8BA 4E05H 4HTCH 2VIPA 1N8OB 1PQ8A 1D3PB 1ESBA 1QCPA 1SOTA 1YPJH 2TBSA 2XNIA 1A5HA 3TH4H 2A7HA 1MH0A 2GDDA 1M9UA 1XXFA 1S0RA 2G55A 2OP9A 3SU6A 5GWZA 4ISLA 3UR9A 3UQOA 1ANCA 2FYRA 1EZSC 2BD8A 2O8LA 3L33A 1C1UH 3F1SB 3QZQA 3MO9A 3UIRA 3M7QA 4AYYB 3LC3A 4HGCA 1EPTC 4ISOA 3NZIA 1BMLA 2NU0E 3PB1E 1XM1A 4AFUA 5JBCS 3SBKA 1KLIH 1O2HA 1RGQA 1QRWA 1TX8A 2PHBA 1MKXH 1TNHA 3P6ZB 1FI8A 1W7XH 2PGBB 2WPKS 1Z8RA 1C1PA 1Z6JH 2K1QA 2BMGB 4ASHA 4D7FA 1MTNC 1F0TA 2XC4A 2OQ5A 4I8GA 3T28A 1GWAA 1S5SA 2O9QA 3HK6B 1C2MA 4TWWA 5FPSA 1C5LH 3U98H 4UEHH 3RXMA 2OINA 2VWLA 5DP4A 1C1MA 1SOZA 4I7YH 4WJG2 2XW9A 1C1WH 4UFEH 5JDUB 1X7AC 4INHA 2WPIS 1YBWA 2BOHB 1H9IE 5AF9H 2XYAA 1ELEE 2SNVA 5CHAC 5EW1H 1HAVB 3OY5U 1EAXA 3KQDA 4LXBH 1LHCH 5EG4A 1ZSLA 3T25A 4AX9H 2BB4A 3GCOA 2STBE 4B2AA 4Y8ZA 1LVOA 2PUQH 1DWEH 1UTOA 4MQAA 4F49A 3EDXB 2P93A 1O30A 1XKAC 1O3GA 5DG6A 3TVJB 3Q3KA 1C2HA 1FUJA 2HNTE 3V0XA 1MUEB 4AG1A 4JYTA 1BB0B 1ZGIA 4JK5A 1LHEH 1QA7A 3I78A 1IQLA 5EXNA 1V6DA 1H8DH 3G01A 3MH5A 1ELGA 1MKWH 1THPB 1G2LA 1J16A 1JRSA 1K1OA 2J92A 2ULLA 1C1RA 1GBIA 1P2NA 3FP7E 1DOJA 1TNJA 2ZQ2A 3TK5A 1C5TA 1C1VH 1SSXA 2BQ6B 4MDSA 1C5ZB 1OP2A 4NSVA 1YLDA 1OWKA 2ZHFH 2FESH 1KDQA 1Z71A 1GJ7B 2ZU5A 2HRVA 4A5TS 3BTTE 1BBRH 3LKWA 2BDAA 3VXEH 3ZYEA 4HI3A 1QBNA 1TPAE 3ZZ8A 3L6PA 2BVRH 2BX4A 3M3VA 1YPGH 1GJ9B 2ZFFH 1AO5A 2ZQ1A 1VJ9U 3MH7A 5FPTA 1KXDA 3HPTB 3LJJA 3T2NA 2VJ1A 2P59A 3TJOA 1O2PA 1SGCA 3FZZA 3ATMA 1NT1A 5E8EH 1QBOA 5DP9A 2BDCA 2ZI2H 1AZZA 1BOQA 1WCZA 1D3DB 1NROH 1HAHH 4BOHA 3C27B 1Y5UT 4CRDA 2BY8X 1XUIA 1O5BB 2FXRA 2Q6GA 4X1SU 1NFWA 3I29A 4DCDA 2XC0A 3FFGA 1JOUB 2GMTC 1AWFH 9LPRA 4I32A 3O8CA 3PO1C 1HDTH 1ZRKA 1CA0C 3ATLA 2BLWA 4INLA 1QRXA 1SVPA 1IHTH 3RUOA 1BITA 1H1BA 2F9NA 2ZCHP 3ZV8A 5AHGH 3SUEA 1F5RA 1G32B 2ZHWH 5I46H 1KIGH 1WTGH 3D23A 4JYVH 2A4OA 1AE5A 5DJ7A 1KXEA 3E0PB 7ESTE 2STAE 4ABFA 1O5EH 3ENSB 1PQ5A 4WMFA 1H4WA 2ZGJA 2ZFRH 1W7GH 1TFXA 5FPYA 1SR5C 1ELDE 2R2WU 1BZXE 1DY9A 1TQ7B 1C5QA 1SGTA 4ZKRU 1GBAA 3MNCA 2FMJA 3SNEA 1DM4B 1O2MA 1OX1A 1PQAA 4Y10E 1ARCA 1C2LA 3FVFB 4ZHLU 1SQTA 3RXIA 4CRAA 1BHXF 4TY6A 1CHOF 1ETSH 1ZR0A 1FZZA 2FLRH 1VCPA 5JBAS 1MMJN 2J95A 4ZKOU 4CHAB 4FU7A 4FUBA 3LH3A 4YLUA 1GBLA 4K69A 2IJOB 1L0ZA 3BG4C 3ZZDA 1LPGB 1TPSA 4KTSA 1JXPA 2NU4E 2QCYA 2UUKB 4BTIB 3OTJE 1AQ7A 2BLVA 1A61H 3VXFH 4WH6A 1ZTJA 2ESTE 3W94A 3AVZA 2W3KA 2HVXA 1NRRH 3MYWA 4NFEA 1W3CA 4AZ2B 3SV2H 1C5NH 4IC6A 1N8OC 4BXSA 4GPGA 1O2WA 2QXJA 2F9VA 1NZQH 1XX9A 2GTBA 1HAVA 5H4IB 3RLWH 5EODA 9ESTA 2F3CE 2PSXA 2ALVA 1P3EA 2Z3CA 5A0CA 1C5XB 2O8TA 3SJ9A 2W5EA 1FY8E 1GL0E 3A8DA 3NK8A 2ZECA 1EP5A 1MTUA 3S0NA 4A1VA 1TYNA 3K9XB 4D9RA 2ZDAH 2NWNA 1SGPE 3F9FA 1O37A 3TK6A 1P02A 3M5LA 4NCYA 4JMYA 2XCNA 2WUCA 1RD3B 1KXAA 2ZTYA 1CGHA 3IG6B 1AIXH 3KQEA 2O8UA 2Z9GA 4JK6A 1GI8B 1YPKH 1E34B 1SMFE 1UCYH 1BA8B 1O2GH 3S9AA 2H9TH 1WSSH 2XWBI 1OP0A 1CE5A 3SJ8A 2V3OH 1MKXK 4K1SA 4BAHB 1ZGVA 1ZMJA 1WAYB 2A4GA 1EQ9A 4XOJA 4NIVA 3RXCA 1ELCA 1PPHE 3GY4A 1ZMNA 2OC0A 4ISNA 4MPXA 3MU1A 2AGGX 5HM9A 3MU4A 1S85A 3N7OA 4WVPE 3O8RA 1HV7A 4RKJB 4U30A 1F0RA 4ZKSU 1KXBA 5FAHA 2O8WA 5E0HA 1RIWB 5C67A 3VGCB 3TK9A 4TYDA 1ANEA 4I33A 1GDUA 1DFPA 3RM2H 1FPHH 1OWEA 3F6UH 1TABE 5PTPA 4YT7H 1CO7E 3A82A 1C2JA 2R3YA 1MTWA 3NPSA 1MBQA 1NC6A 3SJKA 1LO6A 1N6YA 4ISIH 3RXFA 4CRFA 2ZG0H 1A0JA 3RLYH 2BDIA 4D9QA 1L1GA 1BTUA 1XUGA 1WOFA 1UVTH 3RDZA 2UUJB 1V2QT 1KLJH 1BJUA 1DUAA 1K9OE 2GKVE 1O3BA 2OXSA 3SUGA 2VGCB 2CN0H 4LZ4B 3ZVEA 2XCFA 3M5OA 4Q80A 1FY1A 3SGAE 3BN9A 4LOYH 1FY4A 1JWTA 5LPEA 1A46H 1IOEA 2ANWA 3UOUA 3TGJE 1T31A 2GV7A 3EA9A 4DG4A 2AERH 2FODA 1B0EA 5FBIA 1MQ5A 1EAIA 1TA6A 4NG9H 1BBRK 1ID5H 1NRNH 3E90B 2FYQA 2Q6FA 1DVAH 1SGNE 3FP8E 2ZHDA 3BIUH 1GBCA 2VH0A 4DW2U 3BTWE 1O3MA 5T6FA 1LKBA 1GHBG 5C1YA 1FONA 1J15A 1GMCG 2IOTA 3SV8A 3GICB 2AMPA 2J34A 5C1UA 1N6XA 2C8ZB 2XBVA 3VFEA 1KTSB 2VH6A 2FM2A 1S83A 3A83A 3LGYA 1BQYA 4X1PU 2TGPZ 4X6PA 3W95A 3GISB 1BBRE 1EOLA 2VU8E 1C1NA 2PW8H 4IMQA 4IW4E 3SQHE 3ZZ3A 1V2KT 3ODDA 1GBKA 1KXCA 1NRPH 4SGBE 4UE7H 1FY3A 1O2SA 3RXLA 1G37A 3AASA 4DURA 3BTFE 1SLUB 3V12A 3M37A 4TPYA 4DIIH 1O31A 2ZU4A 1BTZA 5AVDA 1Y3XA 1T4VH 1UTKA 1ZZZA 3HATH 1F92A 7GCHG 1PPBH 1O3HA 4Q2KA 3CS7A 5DP5A 1CQQA 1AD8H 2B9LA 4CHAC 2W3IA 4NIXA 4XFQA 1DE7H 1GGDB 3ZZAA 1IQMA 1GI2A 1GHAF 4DVAU 2BQ7B 1DS2E 4A1XA 2G51A 2HPPH 1SQOA 1THRH 3GYMA 3GCNA 1SGFA 1U6QA 2RA3A 4K2YA 1W10U 1DWCH 3MNBA 4CRBA 1EASA 1HLTH 3LGVA 3S9CA 3SV6A 5FCKA 1Y3WA 1ZOMA 5JYIA 3KHVA 2FX6A 2Z9KA 3JZ1B 4DGJA 3NWUA 3OY6U 1NFXA 3SU4A 3ZZ9A 1DSTA 5SGAE 2P8OB 1HNEE 1EAUA 1OS8A 4B75A 1G36A 3QK1A 1P2MA 2ZDKA 3FP6E 4CH8B 1CSOE 1WBGB 3PMHB 4THNH 3SNCA 2BXTH 3SJOA 2BDYA 1BDAA 1BCUH 5ETXA 1NN6A 2CHAB 1SLWB 2FOAA 1SGRE 1TGTA 1P10A 2EC9H 1HJ9A 1MTVA 2PFEA 3V13A 1MQ6A 4ABHA 5LPFA 4YM9A 4ABEA 5EQQA 1QTFA 1J14A 3PMAB 2GZ8A 1O3KA 2G52A 4JZFH 4F4OC 1GBEA 4NZQA 1K1PA 2A2QH 1EKBB 1XMNB 5AFZH 3RXGA 1YYY1 2P3UB 4Y7BA 1GJ6A 3LJOA 1W8BH 3HK3B 1QNJA 1DT2A 2B0FA 1F5KU 5AFYH 5E2OA 2ZO3H 1E0FD 1RIWC 3VGCC 2GCHF 5DO4H 3SN8A 3NKKA 5ESTE 1V2LT 5HMAA 3C1KA 1DDJA 3D62A 4O9VA 2ODPA 1Y5AT 2UWOA 3OU0A 3QWCH 3SQEE 1KLTA 3A81A 3PWBA 1AKSB 2B7DH 3UNRA 3BEUA 3RP2A 3HGPA 2BYAX 2PUXB 5C5NA 3Q77A 1BTYA 3T5FH 1NPMA 2ALPA 2FI5E 1GI4A 1K1LA 2J94A 1C5YB 1O5GH 4ABBA 1GL1A 5F8ZA 1HJAB 1P0SH 2BZ6H 3A85A 2EI6A 3MTYA 1UCYE 1MAXA 2C3SA 2NU2E 3KN2A 3K65B 3A87A 1C2IA 2VVCA 4AYVB 1SGYE 3QDZB 1O3PB 1MCVA 1YLCA 2BM2A 1OWIA 3A8AA 2SFAA 2WINI 1LHFH 1PYTD 3Q3XA 1ESAA 1LKAA 3VB3A 2XXLA 1CT0E 1EZQA 1UO6A 2QIQA 2VGCC 4NZLA 4OS2A 4ZXXH 3A88A 2QF0A 1EB1H 1ZHPA 1Y3VA 4U32A 1GHZA 1QHRB 5FXLA 4BXWA 1F0SA 4GLYA 1GDQA 1XVOA 2A7JA 1A4WH 4OS5A 4ZMAH 3MO3A 3RMNH 1V2WT 3BTGE 4MPWA 1CA8B 1V2VT 3LDXH 2ZZUH 3QTOH 5EGMA 1YPHC 4ZH8A 4MNWA 3MU8A 1T4UH 2B8OH 1D6RA 1BRCE 4XBBA 1GVLA 1GJBB 1O3CA 3BEIB 3PMJA 1NS3A 4ABJA 4OS7A 1C1SA 4JZDH 2QAAA 3LH1A 1P2JA 4OGYA 5EXLA 3I77A 2EI7A 2BDHA 1SFQB 1Z1IA 3UWJH 3BIVH 2PTCE 1BJVA 1O2OA 5K0HA 1UVUH 5B6OA 4E06H 1SGDE 3RXEA 2GDEH 2P95A 1KSNA 4O3TA 5GPIB 3E8LA 1Z8IB 1FDPA 1TOCB 1FV9A 1EP6A 1UTQA 1V2PT 3MI4A 4Y7AA 2I6SA 1GDNA 1LHDH 2KAIB 4NA9H 3ZVCA 1LVMA 1SG8B 3B9FH 5DGJA 1RTKA 4B2BA 1B0FA 1O5AB 1FN8A 3SW2B 2F9PA 4R8TB 1MAYA 4Q7ZA 4UD9H 1UK3A 5LH8A 1NY22 1GI7B 1QB9A 3TJVA 2DE8A 3BSQA 1MBMA 1WTHD 4FUDA 1GBDA 4B73A 4NWLA 1G2MA 5L2ZH 2PGQB 3DUXH 4OS6A 1O38A 1V2OT 3FANA 3GDUA 4I31A 3S69A 1QB1A 2FZZA 1XVMA 4H6TA 1NFUA 2H6MA 1CHOG 3KQCA 4DY7B 4X8VH 6LPRA 1C9PA 3H5CB 3PWCA 2GT8A 4X1RU 3TGIE 1ELTA 1A2CH 4Y11E 1BT7A 2A0QB 2UUFB 3RXVA 1ABJH 1SLXB 1P12E 1P9UA 4FUCA 3EAJA 2Z6BD 1GGDC 2SNWA 3LONA 4Q7XA 2A32A 3LT3A 3RC5A 3T26A 4FUFA 2H1UA 1GHWH 4WH8A 2J38A 1MZDA 2WV4A 2GZ7A 3TIUA 1C5MD 5DP6A 4ZAEA 1BUIA 1V2UT 2VIVA 1D3QB 3TNTA 1ARBA 1C1QA 4K8YA 4DOQA 4KP0A 2EI8A 1HAIH 5T6GA 5C3NA 1HAOH 3SNBA 1A7SA 2XBYA 1E37B 4GUXA 2WYGA 1GG6B 2A2XH 1TMBH 1GCDA 3DA9B 3SGQE 2DE9A 5A0AE 1G3CA 1ZPBA 3GY8A 4U2WA 1G30B 4KTUA 1D9IA 1V2TT 4FUHA 3SU3A 4AOQA 5CE1A 1TMUH 2P8OC 1AKSA 2ILNA 4AFSA 3KNXA 1DY8A 1OYTH 1W14U 5JB9S 1OPHB 2GP9B 4D7GA 2RDLA 1C5UA 4FVBA 1P2IA 3GDVA 3SORA 1YPMH 2FOMB 3PM3A 2ZU2A 1SB1H 3BF6H 4K8BA 1K22H 4DT7B 5EQRA 1CBWB 8GCHF 3H7TA 1SHYA 1TPPA 2CHAC 2JKHA 4FU8A 4IC5A 1AHTH 4CRGA 3CS0A
chains in the Genus database with same CATH superfamily
1F5LA 1O2KA 1ZPCA 3UWIA 4F55A 1ELBA 3UNQA 1UVOA 2Y7XA 3S7HB 1Q2WA 1TMTH 4D8NA 3SO3A 2WPJS 4PROA 1E38B 3CENA 1YCPK 2A1DB 5HIYA 4FUGA 2WV9A 4Q63A 2UWLA 3BTQE 1W13U 3JZ2B 1EFRD 2FX4A 5KGOA 1TQ0B 4CR9A 4U01A 4X8UH 5DKMA 3GCHB 1ZHMA 4FU9A 1C2FA 1QIXB 1UJ1A 1F7ZA 1O0DH 1QY6A 4YLQH 3RXHA 3P95A 1T8OA 1O3IA 5GIBA 2IPQX 2VIWA 1GMDF 3LC5A 3SU2A 1O2IA 1FMGA 5ESBA 1FAXA 1MTSA 2XTTB 4WY3A 1YWUA 1EX3A 4A6LA 1UK2A 4UFDH 3S9BA 1TBZH 3A7XA 2KCYA 1D6WA 4FUEA 1QFKH 1TGCA 3F2HA 4RKOB 1HJAC 1C4Y2 1O2UA 4Y8XA 4OGXA 3LOXA 1IQHA 1DXWA 2ANMH 3ZZ5A 1HAGE 1VCQA 2FWWA 1GJ4H 4K1TA 2KAIA 3SI3H 1CT4E 1VITF 1O35A 3MH6A 1VR1H 3E0NB 3RU4D 4DJZB 1XUJA 3T27A 5FHTA 2J4IA 1SPJA 1ANDA 4UFGH 3KL6A 1LVBA 5A09A 1WQVH 2FP7B 2Z7FE 2ZNKH 5DP3A 3U1IB 2OD3B 4HZHA 2OC8A 4JZEH 4B6FA 2KCPA 1OWJA 4XSKU 5LPRA 1ACBE 2GD4B 3RXQA 1P05A 5F8TA 2OBOA 1EZUC 1V2RT 4YOIA 3U8RH 5EQSA 3VPKA 1Y3YA 2J9NA 4E7RG 3EQ0H 3AW0A 6GCHF 2ZPRA 1H9HE 8LPRA 1V2JT 2WV5A 1O2XA 1AN1E 3KGPA 5CDFE 1HGTH 1BTPA 2FLBH 1A1RA 3SV9A 4YZUA 4AFQA 1HAPH 7KMEH 2GCTB 2UUYA 1H8IH 5CHBA 4GCHF 4H4FA 2ZEBA 2IN2A 2EA3A 2CJIA 5E0JA 1CU1A 2IPHA 3OFND 2ZGHA 3B23B 1GVKB 3AW1A 1FXYA 2BY7X 1OYQA 1Z6EA 3RXTA 2M5TA 2FIRH 2QXHA 3SHCH 4BAOB 3IWMA 5LGOA 1SI5H 1FQ3A 5I25A 1ABIH 2SGEE 1HIAB 4HG6A 4XDEA 1KXFA 3D65E 3SNDA 4CREA 2WPMS 1E79D 2W26A 2NU3E 5HYOA 1O3FA 2Y7ZA 3KIDU 1HB0B 1SHHB 1MU8B 1T7CA 1CVWH 3H7OA 2FTLE 1PPZA 1MKWK 5F6MA 1UTNA 2P94A 1GI5A 4X6NA 3OSYA 5T1VA 3M5NA 3UQVA 1BMMH 5J4QA 1FJSA 2ZDMA 3T62A 4AGJA 2GJGA 1TE0A 1IQNA 2FI4E 1UVSH 8ESTE 1O32A 2VWMA 3IITA 1P3CA 2BD3A 1T32A 3STJA 4BNRA 2AEIH 1O2QA 4B74A 1TRMA 1VZQH 1RFNA 4ABGA 5DP8A 3RXAA 3RXRA 2WPHS 4X2VA 5DPAA 1QJ7B 2VWNA 2TGAA 1GHAG 1AE8H 2ZFSA 1DITH 4JZIA 3RMMH 2BD5A 3A7YA 2PKAB 4YOGA 5JPMH 5TCCA 1LDTT 4FVDA 3TGKE 3E1XB 3OX7U 1JRTA 1GJDB 2OUAA 3P8FA 3QLPH 3A7WA 1S84A 1QURH 5HM2A 4J1YA 4GAWA 1SQRA 1UVPA 3MH4A 2FS8A 1C5OH 3SNAA 2G5NA 1GJAB 4I8KA 1ZHRA 2UWPA 1ELAA 1O5FH 1BRUP 1E36B 1TPOA 2VIDA 1S0QA 3WWFA 2VVUA 1UTPA 2OC7A 3GY3A 1GG6C 1GBMA 4H6SB 2ZTZA 3BTKE 4UFFH 4I8LA 3SJIA 1DUEA 1YGCH 1NESE 3MMGA 4ESTE 5EPYA 2AIPA 3NCLA 2G5VA 1BMAA 2ZC9H 2WPLS 1SGEE 1THSH 2R2MB 1AI8H 1O34A 1TONA 4ZROA 1S6FA 1C1TA 1L1NA 2V35A 1IQIA 2VIOA 1HCGA 1VKYA 2FOBA 4OS1A 2OC1A 4ABAA 2QN5T 3HGNA 4NFFA 1GI6A 1HJ8A 1AFEH 5A2MH 1H8HD 2BZAA 1ZTKA 1HAXB 1AMHA 1A5GH 1CBWC 2RA0A 4NA7A 2CF9H 4RT0A 3VG8A 3URCA 5E2PA 3P8GA 5JBTA 3SI4H 2Y81A 1TLDA 1YC0A 2A45B 2TRMA 3GY7A 1HAZB 3VB5A 3SUDA 1FPCH 3A7TA 3M7TA 1C5VA 4Y79A 3A7ZA 4SGAE 1A3BH 2I6QA 3A8BA 3TPIZ 1UTMA 1JMOH 1BMNH 2LELA 2OCVB 2GCHG 2DUCA 5DP7A 2ZU3A 4IS5A 3OE7D 2ZP0H 4BANB 2D2DA 2Q6DA 1MABB 1DWDH 1EXFA 1GJ8B 1A5IA 3GCHC 4BTUB 1AGJA 3LU9B 2OBQA 3URDA 1GBHA 2CF8H 2ODYB 3UB0A 1O3NA 2PV9B 2WYJA 3F3BA 3RXJA 1JBUH 4KELA 1K1JA 2CGAA 2C93B 1P09A 4H42U 2Y5HA 4X2WA 1MD8A 5T3HA 4ACBA 5T6DA 1V2ST 2HWLB 1GBTA 3PTNA 3ZVFA 4XRNA 1SL3A 3NRLA 3SU0A 1LPZB 2J2UA 2YNBA 4X6OA 1UTJA 3KQBA 3M61U 3U8TH 4B76A 3EA8A 3P17H 3LGTA 4XD7D 2QA9E 2EY4C 4UDWH 1J9CH 2A31A 1DPOA 4Q7YA 1HXEH 1SGFG 1ZSJA 4AGKA 2ZFQH 1C2KA 3UR6A 4ZKNU 2ODQA 4BTTB 1QR3E 3Q76A 4CR5A 1Y3UA 1TGSZ 3RC4A 1GI1A 2XBXA 2H9EH 1W12U 3QUMP 4Y8YA 4DIHH 1LVYA 5IYTA 2F9BH 1EATA 2GVFA 2WPDD 2JH6D 1GBBA 1UCYK 2F4LA 4WXIA 1O2TA 1AUTC 1ZMLA 3EE0B 2B5TB 3ODFA 1HYLA 1C4V2 1C5SA 1FAKH 4UONA 4RSPA 1IQEA 1GHYH 2XBWA 1OWDA 1V2NT 3QGJA 5A0BA 1TNGA 2H5DA 3FO8D 1NFYA 3VEQB 1P04A 1NO9H 2C8WB 1GCTB 5IK2D 5L6NH 5HXFA 1GPZA 1YPEH 3GY5A 3EA7A 1ETRH 1A0HB 4M7GA 1VITH 2VWOA 3RU4T 3ZVDA 2GCTC 1C9TA 2M2AA 2PKAA 1K1IA 3SGBE 1YPLH 2OLGA 2ZCKP 5G4BA 1PPEE 4IMZA 2F83A 3D49H 2KM0A 1GHXH 3A80A 2ANYA 3DSPA 4IN1A 5F03A 1V2MT 2HNTC 3ZZ4A 2Q1JA 4MNYA 1E35B 2FOEA 1FNIA 2YNAA 4ISHH 5BPEA 3MO6A 1GJ5H 4MPVA 2CXVA 2G4TA 3GCTF 2ZHEH 1NTPA 1OOKB 2RG3A 2TGDA 2BX3A 2BQWB 5GCHF 3V3MA 3BEFB 1O2NA 2A4QA 3QTVH 3GYLB 1QRZA 3M3TA 4YTAA 6ESTA 2FOGA 2D8WA 3E3TA 4AB9A 2ZDNA 1GBFA 2HALA 1NU7B 1QJ1B 1C5PA 1HUTH 3RU4E 1P2OA 5EW2H 1OKXA 1W11U 3LGUA 5HGGA 1ZSKA 1KY9A 4LZ1H 2H2ZA 4GSOA 1EUFA 1VGCB 3LIWA 4MPUA 1LHGH 2BY9X 3F9HA 2GZ9A 3EGKH 3BTME 1Q31A 1LTOA 1D4PB 3HKJB 1JIRA 2F9OA 2ANKH 2RFKC 5FCRA 4YESB 3PMBB 1GMHF 4ZXYH 5CMXH 4D76A 3F9GA 3MU0A 2FDAA 5FBEA 4GHQA 1O3AA 2VINA 2HNTF 2SGDE 1FLEE 1S82A 4AFZA 3FKSD 3AAUA 1O33A 2PR3A 2AS9A 3TNSA 4ZUHA 2VBCA 2BD4A 2Z9IA 4FUIA 4WF8A 1DANH 3R0FA 3RXDA 3ZYDA 3K2UA 2LP6A 2BY5X 3MOCA 2HOBA 3MNXA 2V6NA 2FOFA 3TITA 3TH3H 1O2RA 1RTFB 2W7UA 1AU8A 2P3TB 2BVXH 3M7UA 1GI0A 2TPIZ 1O36A 1K2I1 2V7QD 1AVXA 3RXOA 3MHWU 2AGIX 4ZHAA 1QQUA 3CP7A 3ZVBA 2AMQA 4Y76A 3DFLA 3BTDE 2HGTH 1P8VC 1WU1A 2ZFTA 1EAWA 3GOVB 1TRYA 4WWYA 1EJAA 2JETB 4X2YA 4NWKA 8GCHG 1Z8JB 4R0IA 3QN7A 3ATKA 4NIWA 4BAQB 1CGIE 2H5CA 4ABDA 3KCGH 3A7VA 2GX4A 2G4UA 1MZAA 1P03A 2J97A 2TIOA 3DD2H 1TWXB 1XKBC 2WZQA 2ZF0H 3RC6A 4K3JA 2PKSB 1C4U2 4CH2B 1O2ZA 4YOJA 3R3GB 3AK5A 1WYKA 5E0GA 2PLXA 2JH0D 2QXGA 3A86A 2QF3A 1ANBA 3QO6A 1YP9A 3TJNA 3FN8A 2Z94A 2Y5GA 3BTHE 2J98A 1S6HA 1YPHE 4MNVA 1DWBH 1DICA 2NU1E 3ZZBA 1P9SA 4IN2A 3SU1A 1P06A 1TIOA 2THFB 5DK1A 3P70B 3UNSA 5C0UA 3A8CA 4AG2A 4FXGH 3WWBA 1H9LB 2A5KA 4AC9A 7LPRA 5A8ZA 5EXMA 2FPZA 3ZIAD 1GMDG 2V3HH 4LK4A 3SUFA 3UFAA 6CHAB 3L3TA 1BIOA 4B1TA 2ZIQH 3ITIA 3U8OH 1ZJDA 1OHHD 3E91A 1W2KH 1V3XA 4XBDA 2WUBA 4O97A 1BTWA 2CV3A 2TGTA 3BV9B 4Z0KA 1IQJA 4AORA 1J17T 1EJNA 1HFDA 1A0LA 1P2QA 4JCNA 5FX5A 8KME2 3LPRA 2HLDD 4IGDA 1TRNA 3ZZ6A 2QYIA 2FOHA 4NSYA 1B7XB 1VITG 1TB6H 2FI3E 3AAVA 3FOAA 2Y82A 3RMOH 1IQKA 1XUKA 3E16B 1HAYB 2AGEX 1TGNA 4WMDA 3P92A 1BRBE 1F0UA 3KEEA 2ZCLP 5IDKA 1G9IE 1O3EA 1WUNH 1QGFA 3RXBA 4X6MA 2FS9A 4CRCA 2BLOA 5J4SA 4YO9A 3GS9A 1L4ZA 4NGAH 1DLEA 1GHVH 6GCHG 1N1LA 1QJ6B 1UK4A 3SZNA 5GXPA 2C8YB 4MTBA 1IQFA 1ELFA 4TT3D 4CBOA 2QV1A 2ZPSA 1AB9B 2JJ1D 5F8XA 4XE4A 4GCHG 2QGRA 3PLBA 2CK3D 3ZZCA 1GCTC 1CGJE 3OYPA 4Y71A 2GV6A 2BLQA 3M3SA 1PPFE 3KF2A 2C8XB 3TLOA 1XUHA 3UTUH 1DSUA 3OTPA 3SHAH 1JIMA 1TBRH 3MNSA 1L2EA 1NRSH 5GJ4B 1TNIA 1Z7KA 1O5CB 2VIQA 2G8TA 3UPEA 1PPCE 5KECA 2WHXA 5JBBS 1HXFH 2OQUA 4JZ1A 5EPNA 1WQSA 2A5IA 4MLFB 4Y0YE 1NBMD 1QL8A 4O3UA 5GNDA 1RTLA 1UMAH 1DX5M 2VNTA 1SGIB 3H09A 2AH4X 4RN6A 3TH2H 1QL9A 1P57B 3M5MA 2HPQH 1AFQB 2BTCE 3PLKA 2SGQE 2XRCA 1OSSA 2Z9JA 4OM9A 1KTTB 1K1MA 4QT8C 5TJXA 3LGIA 3PRDA 1D3TB 2Z3EA 1XUFA 3QX5H 4JYUH 1C2DA 3RM0H 1TNKA 1CHGA 2BD2A 2W7SA 4XBCA 2RCEA 4INKA 5JB8S 1RJXB 2Y6TA 3VB6A 4NA8A 3SU5A 3S7KB 1T8LA 1VCWA 4ABIA 2ZTXA 3DFJA 2VB0A 1PYTC 4FETA 3M36A 2H9HA 3K6ZA 3STIA 1VGCC 4X2XA 2A7CA 3PLPA 4VGCB 4Z6AH 3SV7A 2OK5A 3PV2A 3UY9A 3BTEE 1IAUA 3NUMA 1ZLRA 2FTMA 2BVSH 1Y8TA 1HBTH 1PPGE 1W0ZU 1BRAA 2ZPQA 2FEQH 1LCYA 1TBQH 2PTNA 5C17A 1O2VA 4GVUA 1GI3A 5C2ZA 3SOSA 5C1XA 1HRTH 4X8SH 5L2YH 1YCPM 2FO9A 4NIYA 5L30H 1T8MA 1ORFA 4TWYA 3QGNB 1ESTA 1ZRBA 3K6YA 3ESTA 2WSSD 1WXRA 1B5GH 4HFPB 2ZWLH 1S81A 1IHSH 1L1JA 1TX7A 4AN7A 1EPTB 3A89A 1AY6H 1AVWA 1TA2A 1PQ7A 2ASUB 4Y0ZE 1UHBB 1WV7H 2V3MA 5C5OA 2R9PA 1AVGH 4KTCA 1TGBA 1YKTA 3WY8A 4TY7A 1BMFD 3QZRA 4KKDA 4M9FA 3RXKA 3LGWA 3VB7A 4B71A 1SQAA 3PYHA 5C20A 4IBLH 2C90B 1ZPZA 4X1QU 4I8JA 2JETC 2ZGBH 3ATIA 1BTXA 2O8MA 4AB8A 5BRRE 1MTNB 1FIZA 2ZGCA 3ATWA 3FZDA 1SGQE 1QL7A 1NRQH 2PSYA 3FAOA 1RRKA 2YOLA 2BDBA 2XC5A 2P16A 4O03A 3MWIU 1QZ8A 1ZJKA 2PKSC 2XOKD 1BTHH 3EYDA 2QXIA 3U9AH 2XWAA 1TX6A 4Y6DA 1QBVH 1O39A 3PTBA 2ZDLA 1EOJA 2CMYA 2GGVB 4A92A 1W0YH 5CHAB 1GJCB 1RS0A 1FY5A 5K7RA 2SGPE 3F9EA 4GHTA 1O3JA 1O2JA 2D1JA 2F91A 2SGAA 2KR7A 1HPGA 4I8HA 1TAWA 2G00A 4MNXA 4ACAA 2A5AA 1QQ4A 1K1NA 3ZVAA 3T29A 2ZHQH 4X0WU 1T8NA 6CHAC 2JH5D 2QY0B 2BY6X 2A4RA 1QB6A 3ZZ7A 2EEKA 1AUJA 1O3OA 3HKIB 3UREA 1IQGA 1MD7A 1OXGA 1RXPA 3A84A 2FOCA 5EIYA 4ASUD 2ZFPH 3V7TA 4BAKB 1G3BA 1DXPA 1GI9B 1P2KA 1E1RD 4KGAA 2G81E 1O5DH 1C5WB 1YM0A 1LQDB 3E6PH 5A8YA 2Y5FA 4J2YB 4K60A 4B2CA 3MFJA 1ETTH 2BD7A 2HLCA 2AMDA 2V0BA 2Y80A 2GT7A 2ZDVH 5EU8A 1C5RA 3KYGA 3ZVGA 1EB2A 1INCA 4FUJA 1ZYOA 1PJPA 4ZHMU 1DLKB 1CT2E 3Q00A 5GDSH 3U69H 3DT0H 2F9UA 2R0KA 4X1NU 1L4DA 3RMLH 1A3EH 1ELVA 3DSOA 1AB9C 3UOPA 2W6JD 3Q3YA 3VB4A 1O3LA 4MG3A 1GVZA 4TSFD 3P8OA 1BHXB 2BOKA 3DHKH 1SBWA 1C1OA 3N99A 4A1TA 1EZXC 2OTVA 2PWXA 2SGFE 3O8DA 5F53A 1SLVB 2BDGA 1LPKB 3M35A 2GMTB 1OP8A 3OAAD 4K5ZA 3PO1B 4E7NA 5DN6D 1TALA 1LMWB 4Q4LA 1LQEA 4YT6H 1QA0A 1TNLA 1KYNA 4A7IB 1GBJA 3TJUA 2BD9A 1CA0B 2ZKSA 2D26C 2KCAA 1MU6B 5ABWA 1C2GA 3GCTG 1GHBF 5GCHG 1GMCF 3B8JA 3BG8A 1P01A 1PFXC 1EJMA 1Z8GA 1ZTLA 3PROA 2QC2A 4WMEA 4CBNA 3F68H 1KDQB 3NXPA 1P11E 1O2LA 2R0LA 1HIAA 1MCTA 4RT1A 1AFQC 1Q3XA 4BAMB 3P8NA 4MVNA 3RXPA 2C4FH 5A8XA 1YF4A 3ELAH 3GY6A 1VJAU 3RXSA 2ZU1A 3OEED 1XXDA 1EPTA 4OS4A 5TCAA 1J8AA 5FX6A 1F2SE 1UHBA 1FIWA 3U1JB 1FN6A 1UTLM 1AZ8A 2Z9LA 1Y59T 1Y5BT 3ZV9A 2QE7D 2AIQA 3MU5A 1AWHB 2AFQB 3GY2A 2LPRA 1YCPH 4K1EA 1GMHG 1O2YA 2LNCA 2BHGA 1K28D 1G3EA 1TOMH 4TPIZ 1NU9A 2BXUH 1SFIA 5EOKA 1SC8U 3GDSA 4VGCC 5C94A 2R3UA 3BG4B 1Z1JA 2P3FH 2ZGXH 1C2EA 1K21H 2Z3DA 1OWHA 7GCHF 3TU7H 3PV4A 1O3DA 1NM6A 2AYWA 3DSGA 1G3DA 3UUZA 4WXVA 2IJD1 4X8TH 3RXUA 2ZA5A 2VVVA 3O8BA 4E05H 4HTCH 2VIPA 1N8OB 1PQ8A 1D3PB 1ESBA 1QCPA 1SOTA 1YPJH 1KMHB 2TBSA 2XNIA 1A5HA 3TH4H 2A7HA 1MH0A 2GDDA 1M9UA 1XXFA 1S0RA 2G55A 2OP9A 3SU6A 5GWZA 4ISLA 3UR9A 3UQOA 1ANCA 2FYRA 1EZSC 2BD8A 2O8LA 3L33A 1C1UH 3F1SB 1NBME 3QZQA 3MO9A 3UIRA 3M7QA 3F2FA 4AYYB 3LC3A 4HGCA 1EPTC 4ISOA 3NZIA 1BMLA 2NU0E 3PB1E 1XM1A 4AFUA 5JBCS 3SBKA 1KLIH 1O2HA 1RGQA 1QRWA 1TX8A 2PHBA 1MKXH 1TNHA 2YMSB 1FI8A 1W7XH 2L74A 2PGBB 3P6ZB 2WPKS 1Z8RA 4P02A 1C1PA 1Z6JH 2K1QA 2BMGB 4ASHA 4D7FA 1MTNC 1F0TA 2XC4A 2OQ5A 4I8GA 3T28A 1GWAA 1S5SA 4DT4A 2O9QA 3HK6B 1C2MA 4TWWA 5FPSA 1C5LH 3U98H 4UEHH 3RXMA 1K0HA 2OINA 2VWLA 4FOUC 5DP4A 1C1MA 1SOZA 4I7YH 4WJG2 2XW9A 1C1WH 4UFEH 2KCOA 5JDUB 1X7AC 4INHA 2WPIS 1YBWA 2BOHB 1H9IE 5AF9H 2XYAA 1ELEE 2SNVA 5CHAC 5EW1H 1S6LA 1HAVB 3OY5U 1EAXA 3KQDA 4LXBH 1LHCH 5EG4A 1ZSLA 3T25A 4AX9H 2BB4A 3GCOA 2STBE 3SZEA 4B2AA 4Y8ZA 1LVOA 2PUQH 4B6EA 1DWEH 1UTOA 4MQAA 4F49A 3EDXB 2P93A 1O30A 1XKAC 1O3GA 5DG6A 3TVJB 3Q3KA 1C2HA 1FUJA 2HNTE 3V0XA 1MUEB 4AG1A 4JYTA 1BB0B 1ZGIA 4JK5A 1LHEH 1QA7A 3I78A 1IQLA 5EXNA 1V6DA 1H8DH 3G01A 3MH5A 1ELGA 1MKWH 1THPB 1G2LA 1J16A 1JRSA 1K1OA 2J92A 2ULLA 1C1RA 1GBIA 2AHME 1P2NA 3FP7E 1DOJA 1TNJA 2ZQ2A 3TK5A 1C5TA 3KYFA 1C1VH 1SSXA 2BQ6B 4MDSA 1C5ZB 1OP2A 4NSVA 1YLDA 1OWKA 2JJ2D 2ZHFH 2FESH 1KDQA 1Z71A 1GJ7B 2ZU5A 2HRVA 4A5TS 3BTTE 1BBRH 3LKWA 2BDAA 3VXEH 3ZYEA 4HI3A 1QBNA 1TPAE 3ZZ8A 3L6PA 2K0QA 1W0JD 2BVRH 2BX4A 3M3VA 1YPGH 1GJ9B 2ZFFH 1AO5A 2ZQ1A 1VJ9U 3MH7A 5FPTA 1KXDA 3HPTB 3LJJA 3T2NA 2VJ1A 2P59A 3TJOA 1O2PA 1SGCA 3FZZA 3ATMA 1NT1A 5E8EH 1QBOA 5DP9A 2BDCA 2ZI2H 1AZZA 1BOQA 1WCZA 1D3DB 1NROH 1HAHH 4BOHA 3C27B 1Y5UT 4CRDA 2BY8X 1XUIA 1O5BB 2FXRA 2Q6GA 4X1SU 1NFWA 3I29A 4DCDA 2XC0A 3FFGA 1JOUB 2GMTC 1AWFH 9LPRA 4I32A 3O8CA 3PO1C 1HDTH 1YLNA 1ZRKA 1CA0C 3ATLA 2BLWA 4INLA 1QRXA 1SVPA 1IHTH 3RUOA 1BITA 1H1BA 2F9NA 2ZCHP 3ZV8A 5AHGH 3SUEA 1F5RA 1G32B 2ZHWH 5I46H 1KIGH 1WTGH 3D23A 4JYVH 2A4OA 1AE5A 5DJ7A 1KXEA 3E0PB 7ESTE 2STAE 4ABFA 1O5EH 3ENSB 1PQ5A 4WMFA 1COWD 1H4WA 2ZGJA 2ZFRH 1W7GH 1TFXA 5FPYA 1SR5C 1ELDE 2R2WU 1BZXE 1DY9A 1TQ7B 1C5QA 1SGTA 4ZKRU 1GBAA 1YY3A 3MNCA 2FMJA 3SNEA 1DM4B 1O2MA 1OX1A 1PQAA 4Y10E 1ARCA 1C2LA 5KEDA 3FVFB 4ZHLU 1SQTA 3RXIA 4CRAA 1BHXF 4TY6A 1CHOF 1ETSH 1ZR0A 1FZZA 2FLRH 1VCPA 5JBAS 1MMJN 2J95A 4ZKOU 4CHAB 3EE7A 4FU7A 4FUBA 3LH3A 4YLUA 1GBLA 4K69A 2IJOB 1L0ZA 2JDID 3BG4C 3ZZDA 1LPGB 1TPSA 4KTSA 1JXPA 2NU4E 2QCYA 2UUKB 4BTIB 3OTJE 1AQ7A 2BLVA 1A61H 3VXFH 4WH6A 1ZTJA 2ESTE 2PP6A 3W94A 3AVZA 2W3KA 2HVXA 1NRRH 3MYWA 4NFEA 1W3CA 4AZ2B 1SKYE 3SV2H 1C5NH 4IC6A 1N8OC 4BXSA 4GPGA 1O2WA 2QXJA 2F9VA 1NZQH 1XX9A 2GTBA 1HAVA 5H4IB 3RLWH 3WW7A 5EODA 9ESTA 2F3CE 2PSXA 2ALVA 1P3EA 2Z3CA 3N7EA 5A0CA 4ZCNA 1C5XB 2O8TA 3SJ9A 2W5EA 1FY8E 1GL0E 3A8DA 3NK8A 2ZECA 1EP5A 1MTUA 3S0NA 4A1VA 1TYNA 3K9XB 4D9RA 2ZDAH 2NWNA 2L6OA 1SGPE 3F9FA 5FL7D 1O37A 3TK6A 1P02A 3M5LA 4NCYA 4JMYA 2XCNA 2WUCA 1RD3B 1KXAA 2ZTYA 3F2GA 1CGHA 3IG6B 1AIXH 3KQEA 2O8UA 2Z9GA 4JK6A 1GI8B 2YMSC 1YPKH 1E34B 1SMFE 1UCYH 1BA8B 1O2GH 3S9AA 2H9TH 1WSSH 2XWBI 4Z1MD 4P00A 1OP0A 5EJLA 1CE5A 3SJ8A 2V3OH 1MKXK 4K1SA 4BAHB 1ZGVA 1ZMJA 1WAYB 2A4GA 1EQ9A 4XOJA 4NIVA 3RXCA 1ELCA 1PPHE 3GY4A 1ZMNA 2OC0A 4ISNA 4MPXA 3MU1A 2AGGX 5HM9A 3MU4A 1S85A 3N7OA 4WVPE 3O8RA 3MQKC 1HV7A 4RKJB 4U30A 1F0RA 4ZKSU 3UAIC 1KXBA 5FAHA 2O8WA 5E0HA 1RIWB 5C67A 3VGCB 3TK9A 4TYDA 1ANEA 4I33A 1GDUA 1DFPA 3RM2H 1FPHH 1OWEA 3F6UH 1TABE 5PTPA 4YT7H 1CO7E 1WDIA 3A82A 1C2JA 2R3YA 1MTWA 3NPSA 1MBQA 1NC6A 3SJKA 1LO6A 1N6YA 4ISIH 3RXFA 4CRFA 2ZG0H 1A0JA 3RLYH 2BDIA 4D9QA 3KQ5A 1L1GA 1BTUA 1XUGA 4I86A 1WOFA 5DSFA 1UVTH 3RDZA 2UUJB 1V2QT 1KLJH 1BJUA 1DUAA 1K9OE 2GKVE 1O3BA 2OXSA 5EJZA 3SUGA 2VGCB 2CN0H 4LZ4B 3F0OA 3ZVEA 2XCFA 3M5OA 4Q80A 1FY1A 3SGAE 3BN9A 4LOYH 1FY4A 1JWTA 5LPEA 1A46H 1IOEA 2ANWA 3UOUA 3TGJE 1T31A 2GV7A 3EA9A 4DG4A 2AERH 2FODA 1B0EA 5FBIA 1MQ5A 1EAIA 1TA6A 4NG9H 1BBRK 2HVYB 1ID5H 1NRNH 3E90B 2FYQA 2Q6FA 1DVAH 1SGNE 3FP8E 2ZHDA 3OEHD 3BIUH 1GBCA 2VH0A 4DW2U 3BTWE 1O3MA 5T6FA 1LKBA 1GHBG 5C1YA 1FONA 1J15A 1GMCG 2IOTA 3SV8A 3GICB 2AMPA 2J34A 5C1UA 1N6XA 2C8ZB 2XBVA 3VFEA 1KTSB 2VH6A 2FM2A 1S83A 3A83A 3LGYA 3W1EA 1BQYA 4X1PU 2TGPZ 4X6PA 3W95A 3GISB 1BBRE 1EOLA 3SYJA 2VU8E 1C1NA 2PW8H 4IMQA 4IW4E 3SQHE 3ZZ3A 1V2KT 3ODDA 1GBKA 1KXCA 1NRPH 4SGBE 4UE7H 1FY3A 1O2SA 3RXLA 1G37A 3AASA 4DURA 3BTFE 1SLUB 3V12A 3M37A 4TPYA 2W6ID 2XNDD 1O31A 4DIIH 2ZU4A 1BTZA 5AVDA 1Y3XA 1T4VH 1UTKA 1ZZZA 3HATH 1F92A 7GCHG 1PPBH 1O3HA 4Q2KA 3CS7A 5DP5A 1CQQA 1AD8H 2B9LA 4CHAC 2W3IA 4NIXA 4XFQA 1DE7H 1GGDB 3ZZAA 1IQMA 1GI2A 1GHAF 4DVAU 2BQ7B 1DS2E 4A1XA 2G51A 2HPPH 1SQOA 1THRH 3GYMA 3GCNA 1SGFA 1U6QA 2RA3A 2EQNA 4K2YA 1W10U 1DWCH 3MNBA 4CRBA 1EASA 1HLTH 3LGVA 3S9CA 3SV6A 5FCKA 1Y3WA 1ZOMA 5JYIA 3KHVA 2FX6A 2Z9KA 3JZ1B 4RI0A 4DGJA 3NWUA 3OY6U 1NFXA 3SU4A 3ZZ9A 1DSTA 5SGAE 2P8OB 1HNEE 1EAUA 1OS8A 4B75A 4F48B 1G36A 3QK1A 1P2MA 2ZDKA 3FP6E 4CH8B 1CSOE 1WBGB 3PMHB 4THNH 3SNCA 2BXTH 3SJOA 2BDYA 1BDAA 1BCUH 5ETXA 1NN6A 2CHAB 1SLWB 2FOAA 1SGRE 1TGTA 1P10A 2EC9H 1HJ9A 1MTVA 2PFEA 3V13A 1MQ6A 4ABHA 2J98B 5LPFA 4YM9A 4ABEA 5EQQA 1QTFA 1J14A 2RDEA 3PMAB 2GZ8A 1O3KA 2G52A 4JZFH 4F4OC 1GBEA 4NZQA 1K1PA 3PV5A 2A2QH 1EKBB 1XMNB 5AFZH 3CNRA 3RXGA 1YYY1 2P3UB 4Y7BA 1GJ6A 3LJOA 1W8BH 3HK3B 1QNJA 1DT2A 2B0FA 1F5KU 5AFYH 5E2OA 2ZO3H 1FX0B 1E0FD 1RIWC 2QF5A 3VGCC 2GCHF 5DO4H 3SN8A 3NKKA 5ESTE 1V2LT 5HMAA 3C1KA 1DDJA 3D62A 4O9VA 2KFWA 2ODPA 1Y5AT 2UWOA 3OU0A 3QWCH 3SQEE 1KLTA 3A81A 3PWBA 1AKSB 2B7DH 3UNRA 3BEUA 3RP2A 3HGPA 2BYAX 2PUXB 5C5NA 3Q77A 1BTYA 3T5FH 1NPMA 2ALPA 2FI5E 1GI4A 1K1LA 2J94A 1C5YB 1O5GH 4ABBA 1GL1A 5F8ZA 1HJAB 1P0SH 2BZ6H 3A85A 2EI6A 3MTYA 1UCYE 1MAXA 2C3SA 2NU2E 3KN2A 3K65B 3A87A 1C2IA 2VVCA 4AYVB 5HKKD 1SGYE 3QDZB 1O3PB 1MCVA 1YLCA 2BM2A 1OWIA 3A8AA 2J5UA 2SFAA 1LHFH 2WINI 2YMSD 1PYTD 3Q3XA 1ESAA 1LKAA 3VB3A 2XXLA 1CT0E 1EZQA 1UO6A 2QIQA 2VGCC 4NZLA 4OS2A 4ZXXH 3A88A 2QF0A 1EB1H 1ZHPA 1Y3VA 4U32A 1GHZA 1QHRB 5FXLA 4BXWA 1F0SA 4GLYA 1GDQA 1XVOA 2A7JA 1A4WH 4OS5A 4ZMAH 3MO3A 3RMNH 1V2WT 3BTGE 4MPWA 1CA8B 1V2VT 3LDXH 2ZZUH 3QTOH 5EGMA 1YPHC 4ZH8A 4MNWA 3MU8A 1T4UH 2B8OH 1D6RA 1BRCE 4XBBA 3F0PA 1GVLA 1GJBB 1O3CA 3BEIB 3PMJA 1NS3A 4ABJA 4OS7A 1C1SA 4JZDH 2QAAA 3LH1A 1P2JA 4OGYA 5EXLA 3I77A 1UW7A 2EI7A 2K8IA 2BDHA 1SFQB 1Z1IA 1W0KD 3UWJH 3BIVH 2PTCE 1BJVA 1O2OA 1H8ED 5K0HA 1UVUH 5B6OA 4E06H 1SGDE 3RXEA 2GDEH 2P95A 1KSNA 4O3TA 5GPIB 3E8LA 1Z8IB 1FDPA 1TOCB 1FV9A 1EP6A 1UTQA 1V2PT 3MI4A 4Y7AA 2I6SA 1GDNA 1LHDH 2JIZD 2KAIB 4NA9H 3ZVCA 2F43B 1LVMA 1SG8B 3B9FH 5DGJA 1RTKA 4B2BA 1B0FA 1O5AB 1FN8A 2QF4A 3N7DA 2F9PA 4R8TB 3SW2B 1MAYA 4Q7ZA 4UD9H 1UK3A 5LH8A 1NY22 1GI7B 1QB9A 3TJVA 2DE8A 3BSQA 1MBMA 1WTHD 4FUDA 1GBDA 4B73A 4NWLA 1E1QD 3U28C 1G2MA 5L2ZH 2KX4A 2PGQB 3DUXH 4OS6A 1O38A 1V2OT 3FANA 3GDUA 4I31A 3S69A 5HIZA 1QB1A 2FZZA 1XVMA 4H6TA 1NFUA 2H6MA 1CHOG 3KQCA 4DY7B 4X8VH 6LPRA 1C9PA 3H5CB 3PWCA 2GT8A 4X1RU 3TGIE 1ELTA 1A2CH 4Y11E 1BT7A 2A0QB 2UUFB 3RXVA 1ABJH 1SLXB 1P12E 2KZ4A 1P9UA 4FUCA 3EAJA 2Z6BD 1GGDC 2SNWA 3LONA 4Q7XA 3PRBA 2A32A 3LT3A 3RC5A 3T26A 4FUFA 2H1UA 1GHWH 4WH8A 2J38A 1MZDA 2WV4A 2GZ7A 3TIUA 3DCLA 1C5MD 5DP6A 4ZAEA 1BUIA 1V2UT 2VIVA 1D3QB 3TNTA 1ARBA 1C1QA 4K8YA 4DOQA 4KP0A 2EI8A 1HAIH 5T6GA 5C3NA 1HAOH 3SNBA 1A7SA 2XBYA 1E37B 4GUXA 2WYGA 1GG6B 2A2XH 1TMBH 1GCDA 3DA9B 3SGQE 2DE9A 5C0TA 5A0AE 1G3CA 1ZPBA 3GY8A 4U2WA 1G30B 4KTUA 1D9IA 1V2TT 4FUHA 3SU3A 4AOQA 5CE1A 1TMUH 2P8OC 1AKSA 2ILNA 4AFSA 3KNXA 1DY8A 1OYTH 1W14U 5JB9S 1OPHB 2GP9B 4D7GA 2RDLA 1C5UA 4YXWD 4FVBA 5EJ1A 1P2IA 3GDVA 3SORA 1YPMH 2FOMB 3PM3A 2ZU2A 1SB1H 3BF6H 4K8BA 5B6LA 1K22H 4DT7B 5EQRA 1CBWB 8GCHF 3H7TA 1SHYA 1TPPA 2CHAC 2JKHA 4FU8A 4IC5A 1AHTH 4CRGA 3CS0A
chains in the Genus database with same CATH topology
1F5LA 1O2KA 1ZPCA 3UWIA 1ELBA 3UNQA 1UVOA 2Y7XA 3S7HB 1Q2WA 1TMTH 4D8NA 3SO3A 2WPJS 4PROA 1E38B 3CENA 1YCPK 2A1DB 4FUGA 2UWLA 3BTQE 1W13U 3JZ2B 2FX4A 1TQ0B 4CR9A 4U01A 4X8UH 5DKMA 3GCHB 1ZHMA 4FU9A 1C2FA 1QIXB 1UJ1A 1F7ZA 1O0DH 1QY6A 4YLQH 3RXHA 3P95A 1T8OA 1O3IA 5GIBA 2VIWA 1GMDF 3LC5A 3SU2A 1O2IA 1FMGA 5ESBA 1FAXA 1MTSA 2XTTB 4WY3A 1EX3A 4A6LA 1UK2A 4UFDH 3S9BA 1TBZH 3A7XA 1D6WA 4FUEA 1QFKH 1TGCA 4RKOB 1HJAC 1C4Y2 1O2UA 4Y8XA 4OGXA 3LOXA 1IQHA 1DXWA 2ANMH 3ZZ5A 1HAGE 1VCQA 2FWWA 1GJ4H 4K1TA 2KAIA 3SI3H 1CT4E 1VITF 1O35A 3MH6A 1VR1H 3E0NB 3RU4D 4DJZB 1XUJA 3T27A 5FHTA 2J4IA 1SPJA 1ANDA 4UFGH 3KL6A 1LVBA 5A09A 1WQVH 2FP7B 2Z7FE 2ZNKH 5DP3A 3U1IB 2OD3B 4HZHA 2OC8A 4JZEH 4XSKU 1OWJA 5LPRA 1ACBE 2GD4B 3RXQA 1P05A 5F8TA 2OBOA 1EZUC 1V2RT 4YOIA 3U8RH 5EQSA 3VPKA 1Y3YA 2J9NA 4E7RG 3EQ0H 3AW0A 6GCHF 2ZPRA 1H9HE 8LPRA 1V2JT 2WV5A 1O2XA 1AN1E 3KGPA 1HGTH 1BTPA 2FLBH 1A1RA 3SV9A 4YZUA 4AFQA 1HAPH 7KMEH 2GCTB 2UUYA 1H8IH 4GCHF 4H4FA 2ZEBA 2IN2A 2EA3A 2CJIA 5E0JA 1CU1A 2IPHA 2ZGHA 3B23B 1GVKB 3AW1A 1FXYA 2BY7X 1OYQA 1Z6EA 3RXTA 2M5TA 2FIRH 2QXHA 3SHCH 4BAOB 3IWMA 5LGOA 1SI5H 1FQ3A 5I25A 1ABIH 2SGEE 1HIAB 4XDEA 1KXFA 3D65E 3SNDA 4CREA 2WPMS 2W26A 2NU3E 5HYOA 1O3FA 2Y7ZA 3KIDU 1HB0B 1SHHB 1MU8B 1T7CA 1CVWH 3H7OA 2FTLE 1PPZA 1MKWK 5F6MA 1UTNA 2P94A 1GI5A 4X6NA 3OSYA 3M5NA 3UQVA 1BMMH 5J4QA 1FJSA 2ZDMA 3T62A 4AGJA 1TE0A 1IQNA 2FI4E 1UVSH 8ESTE 1O32A 2VWMA 3IITA 1P3CA 2BD3A 1T32A 3STJA 4BNRA 2AEIH 1O2QA 4B74A 1TRMA 1VZQH 1RFNA 4ABGA 5DP8A 3RXAA 3RXRA 2WPHS 4X2VA 5DPAA 1QJ7B 2VWNA 2TGAA 1GHAG 1AE8H 2ZFSA 1DITH 4JZIA 3RMMH 2BD5A 3A7YA 2PKAB 4YOGA 5JPMH 5TCCA 1LDTT 4FVDA 3TGKE 3E1XB 3OX7U 1JRTA 1GJDB 2OUAA 3P8FA 3QLPH 3A7WA 1S84A 1QURH 5HM2A 4J1YA 4GAWA 1UVPA 3MH4A 2FS8A 1C5OH 3SNAA 2G5NA 1GJAB 4I8KA 1ZHRA 2UWPA 1ELAA 1O5FH 1BRUP 1E36B 1TPOA 2VIDA 1S0QA 2VVUA 1UTPA 2OC7A 3GY3A 1GG6C 1GBMA 4H6SB 2ZTZA 3BTKE 4UFFH 4I8LA 3SJIA 1DUEA 1YGCH 1NESE 3MMGA 4ESTE 5EPYA 2AIPA 3NCLA 2G5VA 1BMAA 2ZC9H 2WPLS 1SGEE 1THSH 2R2MB 1AI8H 1O34A 1TONA 4ZROA 1S6FA 1C1TA 1L1NA 2V35A 1IQIA 2VIOA 1HCGA 2FOBA 4OS1A 2OC1A 4ABAA 2QN5T 3HGNA 4NFFA 1GI6A 1HJ8A 1AFEH 5A2MH 2BZAA 1HAXB 1ZTKA 1AMHA 1A5GH 1CBWC 2RA0A 4NA7A 2CF9H 5JBTA 3URCA 5E2PA 3P8GA 3SI4H 2Y81A 1TLDA 1YC0A 2A45B 2TRMA 3GY7A 1HAZB 3VB5A 3SUDA 1FPCH 3A7TA 3M7TA 1C5VA 4Y79A 3A7ZA 4SGAE 1A3BH 2I6QA 3A8BA 3TPIZ 1UTMA 1JMOH 1BMNH 2OCVB 2GCHG 2DUCA 5DP7A 2ZU3A 4IS5A 2ZP0H 4BANB 2D2DA 2Q6DA 1DWDH 1EXFA 1GJ8B 1A5IA 3GCHC 4BTUB 1AGJA 3LU9B 2OBQA 3URDA 1GBHA 2CF8H 2ODYB 1O3NA 2PV9B 2WYJA 3RXJA 1JBUH 4KELA 1K1JA 2CGAA 2C93B 1P09A 4H42U 2Y5HA 4X2WA 1MD8A 5T3HA 5T6DA 1V2ST 2HWLB 1GBTA 3PTNA 3ZVFA 1SL3A 3SU0A 1LPZB 2J2UA 2YNBA 4X6OA 1UTJA 3KQBA 3M61U 3U8TH 4B76A 3EA8A 3P17H 3LGTA 2QA9E 4UDWH 1J9CH 2A31A 1DPOA 4Q7YA 1HXEH 1SGFG 1ZSJA 4AGKA 2ZFQH 1C2KA 3UR6A 4ZKNU 2ODQA 4BTTB 1QR3E 3Q76A 4CR5A 1Y3UA 1TGSZ 3RC4A 1GI1A 2XBXA 2H9EH 1W12U 3QUMP 4Y8YA 4DIHH 1LVYA 5IYTA 2F9BH 1EATA 2GVFA 2JH6D 1GBBA 1UCYK 4WXIA 1O2TA 1AUTC 1ZMLA 3EE0B 2B5TB 3ODFA 1HYLA 1C4V2 1C5SA 1FAKH 4UONA 4RSPA 1IQEA 1GHYH 2XBWA 1OWDA 1V2NT 3QGJA 5A0BA 1TNGA 2H5DA 1NFYA 3VEQB 1P04A 1NO9H 2C8WB 1GCTB 5L6NH 5HXFA 1GPZA 1YPEH 3GY5A 3EA7A 1ETRH 1A0HB 4M7GA 1VITH 2VWOA 3RU4T 3ZVDA 2GCTC 1C9TA 2PKAA 1K1IA 3SGBE 1YPLH 2OLGA 2ZCKP 5G4BA 1PPEE 4IMZA 2F83A 3D49H 1GHXH 3A80A 2ANYA 5F03A 4IN1A 1V2MT 2HNTC 3ZZ4A 2Q1JA 4MNYA 1E35B 2FOEA 1FNIA 2YNAA 4ISHH 5BPEA 3MO6A 1GJ5H 4MPVA 2CXVA 2G4TA 3GCTF 2ZHEH 1NTPA 1OOKB 2RG3A 2TGDA 2BX3A 2BQWB 5GCHF 3V3MA 3BEFB 1O2NA 2A4QA 3QTVH 3GYLB 1QRZA 3M3TA 4YTAA 6ESTA 2FOGA 2D8WA 3E3TA 4AB9A 2ZDNA 1GBFA 2HALA 1NU7B 1QJ1B 1C5PA 1HUTH 3RU4E 1P2OA 5EW2H 1OKXA 1W11U 3LGUA 5HGGA 1ZSKA 1KY9A 4LZ1H 2H2ZA 4GSOA 1EUFA 1VGCB 3LIWA 4MPUA 1LHGH 2BY9X 3F9HA 2GZ9A 3EGKH 3BTME 1Q31A 1LTOA 1D4PB 3HKJB 1JIRA 2F9OA 2ANKH 5FCRA 4YESB 3PMBB 1GMHF 4ZXYH 5CMXH 4D76A 3F9GA 3MU0A 2FDAA 5FBEA 4GHQA 1O3AA 2VINA 2HNTF 2SGDE 1FLEE 1S82A 4AFZA 3AAUA 1O33A 2PR3A 2AS9A 3TNSA 4ZUHA 2BD4A 2Z9IA 4FUIA 4WF8A 1DANH 3R0FA 3RXDA 3ZYDA 3K2UA 2BY5X 3MOCA 2HOBA 3MNXA 2V6NA 2FOFA 3TITA 3TH3H 1O2RA 1RTFB 2W7UA 1AU8A 2P3TB 2BVXH 3M7UA 1GI0A 2TPIZ 1O36A 1K2I1 1AVXA 3RXOA 3MHWU 2AGIX 4ZHAA 1QQUA 3CP7A 3ZVBA 2AMQA 4Y76A 3DFLA 3BTDE 2HGTH 1P8VC 1WU1A 2ZFTA 1EAWA 3GOVB 1TRYA 4WWYA 1EJAA 2JETB 4X2YA 4NWKA 8GCHG 1Z8JB 4R0IA 3QN7A 3ATKA 4NIWA 4BAQB 1CGIE 2H5CA 4ABDA 3KCGH 3A7VA 2GX4A 2G4UA 1MZAA 1P03A 2TIOA 3DD2H 1TWXB 1XKBC 2ZF0H 3RC6A 4K3JA 2PKSB 1C4U2 4CH2B 1O2ZA 4YOJA 3R3GB 1WYKA 5E0GA 2PLXA 2JH0D 2QXGA 3A86A 2QF3A 1ANBA 3QO6A 1YP9A 3TJNA 2Z94A 2Y5GA 3BTHE 1S6HA 1YPHE 4MNVA 1DWBH 1DICA 2NU1E 3ZZBA 1P9SA 4IN2A 3SU1A 1P06A 1TIOA 2THFB 5DK1A 3P70B 3UNSA 3A8CA 4AG2A 4FXGH 1H9LB 2A5KA 7LPRA 5A8ZA 5EXMA 2FPZA 1GMDG 2V3HH 4LK4A 3SUFA 3UFAA 6CHAB 3L3TA 1BIOA 4B1TA 2ZIQH 3ITIA 3U8OH 1ZJDA 3E91A 1W2KH 1V3XA 4XBDA 2WUBA 4O97A 1BTWA 2CV3A 2TGTA 3BV9B 4Z0KA 1IQJA 4AORA 1J17T 1EJNA 1HFDA 1A0LA 1P2QA 4JCNA 5FX5A 8KME2 3LPRA 4IGDA 1TRNA 3ZZ6A 2QYIA 2FOHA 4NSYA 1B7XB 1VITG 1TB6H 2FI3E 3AAVA 2Y82A 3RMOH 1IQKA 1XUKA 3E16B 1HAYB 2AGEX 1TGNA 4WMDA 3P92A 1BRBE 1F0UA 3KEEA 2ZCLP 5IDKA 1G9IE 1O3EA 1WUNH 1QGFA 3RXBA 4X6MA 2FS9A 4CRCA 2BLOA 5J4SA 4YO9A 1L4ZA 4NGAH 1DLEA 1GHVH 6GCHG 1N1LA 1QJ6B 1UK4A 3SZNA 5GXPA 2C8YB 4MTBA 1IQFA 1ELFA 4CBOA 2QV1A 2ZPSA 1AB9B 5F8XA 4XE4A 4GCHG 2QGRA 3PLBA 3ZZCA 1GCTC 1CGJE 3OYPA 4Y71A 2GV6A 2BLQA 3M3SA 1PPFE 3KF2A 2C8XB 3TLOA 1XUHA 3UTUH 1DSUA 3SHAH 1JIMA 1TBRH 3MNSA 1L2EA 1NRSH 5GJ4B 1TNIA 1Z7KA 1O5CB 2VIQA 2G8TA 3UPEA 1PPCE 5JBBS 1HXFH 2OQUA 4JZ1A 5EPNA 1WQSA 2A5IA 4MLFB 4Y0YE 4O3UA 1QL8A 1RTLA 1UMAH 1DX5M 2VNTA 1SGIB 2AH4X 4RN6A 3TH2H 1QL9A 1P57B 3M5MA 2HPQH 1AFQB 2BTCE 3PLKA 2SGQE 2XRCA 1OSSA 2Z9JA 1KTTB 1K1MA 4QT8C 5TJXA 3LGIA 1D3TB 2Z3EA 1XUFA 3QX5H 4JYUH 1C2DA 3RM0H 1TNKA 1CHGA 2BD2A 2W7SA 4XBCA 2RCEA 4INKA 5JB8S 1RJXB 2Y6TA 3VB6A 4NA8A 3SU5A 3S7KB 1T8LA 1VCWA 4ABIA 2ZTXA 3DFJA 2VB0A 1PYTC 3M36A 2H9HA 3K6ZA 3STIA 1VGCC 4X2XA 2A7CA 3PLPA 4VGCB 4Z6AH 3SV7A 3UY9A 3BTEE 1IAUA 3NUMA 2FTMA 1ZLRA 2BVSH 1Y8TA 1HBTH 1PPGE 1W0ZU 1BRAA 2ZPQA 2FEQH 1LCYA 1TBQH 2PTNA 1O2VA 4GVUA 1GI3A 5C2ZA 3SOSA 5C1XA 1HRTH 4X8SH 5L2YH 1YCPM 2FO9A 4NIYA 5L30H 1T8MA 1ORFA 4TWYA 3QGNB 1ESTA 1ZRBA 3K6YA 3ESTA 1B5GH 4HFPB 2ZWLH 1S81A 1IHSH 1L1JA 1TX7A 4AN7A 1EPTB 3A89A 1AY6H 1AVWA 1TA2A 1PQ7A 2ASUB 4Y0ZE 1UHBB 1WV7H 5C5OA 2R9PA 1AVGH 4KTCA 1TGBA 1YKTA 3WY8A 4TY7A 3QZRA 4KKDA 3RXKA 3VB7A 3LGWA 4B71A 1SQAA 3PYHA 5C20A 4IBLH 2C90B 1ZPZA 4X1QU 4I8JA 2JETC 2ZGBH 3ATIA 1BTXA 2O8MA 4AB8A 5BRRE 1MTNB 1FIZA 2ZGCA 3ATWA 3FZDA 1SGQE 1QL7A 1NRQH 2PSYA 3FAOA 1RRKA 2YOLA 2BDBA 2XC5A 2P16A 4O03A 3MWIU 1ZJKA 2PKSC 1BTHH 3EYDA 2QXIA 3U9AH 2XWAA 1TX6A 4Y6DA 1QBVH 1O39A 3PTBA 2ZDLA 1EOJA 2CMYA 2GGVB 4A92A 1W0YH 5CHAB 1GJCB 1RS0A 1FY5A 5K7RA 2SGPE 3F9EA 4GHTA 1O3JA 1O2JA 2D1JA 2F91A 2SGAA 1HPGA 4I8HA 1TAWA 2G00A 4MNXA 2A5AA 1QQ4A 1K1NA 3ZVAA 3T29A 2ZHQH 4X0WU 1T8NA 6CHAC 2JH5D 2QY0B 2BY6X 2A4RA 1QB6A 3ZZ7A 2EEKA 1AUJA 1O3OA 3HKIB 3UREA 1IQGA 1MD7A 1OXGA 1RXPA 3A84A 2FOCA 2ZFPH 3V7TA 4BAKB 1G3BA 1DXPA 1GI9B 1P2KA 4KGAA 2G81E 1O5DH 1C5WB 1YM0A 1LQDB 3E6PH 5A8YA 2Y5FA 4J2YB 4K60A 4B2CA 3MFJA 1ETTH 2BD7A 2HLCA 2AMDA 2V0BA 2Y80A 2GT7A 2ZDVH 5EU8A 1C5RA 3ZVGA 1EB2A 1INCA 4FUJA 1ZYOA 1PJPA 4ZHMU 1DLKB 1CT2E 3Q00A 5GDSH 3U69H 3DT0H 2F9UA 2R0KA 4X1NU 1L4DA 3RMLH 1A3EH 1ELVA 1AB9C 3UOPA 3Q3YA 3VB4A 1O3LA 4MG3A 1GVZA 3P8OA 1BHXB 2BOKA 3DHKH 1SBWA 1C1OA 4A1TA 1EZXC 2OTVA 2PWXA 2SGFE 3O8DA 1SLVB 2BDGA 1LPKB 3M35A 2GMTB 1OP8A 4K5ZA 3PO1B 4E7NA 1TALA 1LMWB 1LQEA 4YT6H 1QA0A 1TNLA 1KYNA 4A7IB 1GBJA 3TJUA 2BD9A 1CA0B 2ZKSA 2D26C 1MU6B 5ABWA 1C2GA 3GCTG 1GHBF 5GCHG 1GMCF 3B8JA 3BG8A 1P01A 1PFXC 1EJMA 1Z8GA 1ZTLA 3PROA 2QC2A 4WMEA 4CBNA 3F68H 1KDQB 3NXPA 1P11E 1O2LA 2R0LA 1HIAA 1MCTA 1AFQC 1Q3XA 4BAMB 3P8NA 4MVNA 3RXPA 2C4FH 5A8XA 1YF4A 3ELAH 3GY6A 1VJAU 3RXSA 2ZU1A 1XXDA 1EPTA