5LH8A

Trypsin inhibitors for the treatment of pancreatitis - cpd 8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A02
4X2VA 1BCUH 2BHGA 2Q6DA 3VB7A 1OOKB 1UO6A 9ESTA 1KTSB 1DY8A 3F9HA 1ARBA 1TQ7B 3E0NB 1C5XB 1E36B 2H1UA 4O03A 2FPZA 1ZPCA 1C5NH 2VGCC 4B2AA 2FYQA 1C1MA 4X2YA 1HXFH 5K0HA 1O5CB 2W7UA 2ZCKP 4U01A 1BTPA 4IMZA 1Q31A 2OLGA 2GZ8A 1K1NA 3PO1B 1P2JA 1RTFB 4X6NA 4WY3A 3ZZ4A 1TAWA 2V35A 3MNXA 4NA8A 2I6QA 3BTFE 3GDUA 3KCGH 1RXPA 1TA6A 1GJ5H 3QGJA 1N8OC 1LMWB 1XUJA 3T29A 3RLYH 1LHGH 1O3FA 2Z9KA 2F91A 1G32B 3TGKE 5T6FA 5EW2H 4A5TS 2GTBA 1QJ7B 4ABJA 1HAHH 3E1XB 8ESTE 2A5IA 2ANYA 1E34B 3ELAH 1GBKA 1AD8H 3FVFB 2HALA 2XW9A 1O3NA 4KTSA 2ZP0H 4IN2A 3MH4A 1BTWA 3STJA 1D3QB 3A7TA 2R3UA 1H8DH 4K2YA 4O97A 1QNJA 2BYAX 3SZNA 2STBE 2FZZA 3L3TA 1QRXA 1NROH 1C2KA 1ORFA 3TJNA 3ZZ7A 2W7SA 1AUTC 3ATKA 1ANCA 4K5ZA 2A5AA 5JBAS 3PLBA 3A84A 1BRUP 5DP8A 1O2TA 1EJAA 1QIXB 3BTDE 1CQQA 3UREA 2YOLA 3ENSB 1F5KU 3F68H 3BTKE 5A8YA 3RUOA 3SQHE 1GI7B 1CU1A 1CT2E 2A1DB 2G52A 2PTCE 3GY8A 7LPRA 3SOSA 1UVOA 1C4V2 2A7CA 1EPTA 5DGJA 1ZTKA 1FI8A 5I46H 1G9IE 2ANKH 2ZO3H 1DX5M 1QHRB 1LO6A 1TGSZ 4OS2A 5FBEA 2VIWA 4CRBA 4ISOA 1P2IA 1YCPM 5F8ZA 1P12E 1C4U2 1FPHH 5HM9A 4MNWA 3RMLH 1W7XH 2G5VA 3QTOH 4FUFA 3RMNH 1Z1JA 1FAXA 3MU5A 4Y0YE 4ZKRU 2UWPA 4ABAA 2RDLA 1L0ZA 3D49H 4GAWA 4AFQA 3MH6A 1FNIA 1P2OA 5SGAE 1ZZZA 2UUFB 3MMGA 4X2XA 2W5EA 4ZUHA 1FIWA 1LVBA 5HGGA 2GDDA 1YF4A 1IQNA 2FI3E 2PUQH 1S84A 2ZA5A 2WV4A 3ZVFA 1QFKH 1ZHMA 3OY5U 1BITA 1EP6A 2ZG0H 3RXPA 1XKAC 1J15A 3PTNA 1WQVH 2G55A 2SGEE 1TIOA 3A7XA 1DWCH 2ZQ1A 1MKWK 5C1XA 2HWLB 1NFXA 3TNSA 1F0TA 2BDGA 4K3JA 3VXEH 1PPCE 2XWBI 4GLYA 3GCNA 1QTFA 5H4IB 2BDAA 1JIMA 3BEFB 5GCHG 1PFXC 1UTKA 4Y76A 4K1SA 1A3EH 1ZHPA 1M9UA 3A82A 2ZGCA 3ODFA 1BHXB 1O3MA 1ZMNA 3TJVA 4BAHB 4H6TA 5BRRE 1O2WA 1NU9A 1YC0A 3NXPA 4WMFA 4TWWA 4WVPE 7GCHG 1H4WA 2HNTF 1PPHE 2Z9JA 8GCHG 2Y5HA 4NWKA 2FI5E 2SGDE 1BTZA 2CMYA 1T8LA 3VXFH 2ZQ2A 2AGIX 4X1SU 1OP2A 1FV9A 1Z6EA 1EOLA 4CBNA 2AS9A 3KN2A 3PROA 1ZJKA 3A83A 2R0LA 2QXGA 2HRVA 1L1GA 1P2NA 1XXDA 1C5OH 5J4SA 1VGCC 2VINA 1AI8H 1UHBB 1FAKH 1HAYB 1O2SA 3SUGA 3MH5A 1RGQA 4JZIA 1QA7A 4XOJA 4ZHLU 1EB2A 4J1YA 2BX4A 1UMAH 1TLDA 2FOAA 3SU2A 4D7GA 1MKWH 3D62A 1ELAA 2QXJA 1GJCB 3SNEA 5HYOA 1IQHA 1FY8E 3BIUH 3MNBA 4K8BA 1UVSH 2WPHS 5GIBA 3TJOA 3OY6U 3GCHC 1LCYA 1O2MA 2HPPH 4BXSA 2ZDAH 3E90B 1PJPA 3FFGA 4RKOB 3UFAA 4B1TA 5HXFA 3TK9A 1O3CA 2QXHA 1GHBF 2GV7A 1C2FA 3M7UA 4GUXA 3RU4D 2P3UB 2GT8A 3RXSA 3G01A 1BRCE 1DUEA 3VB3A 1GHWH 2B8OH 4NA7A 4XSKU 1GHAF 1XVMA 3BTGE 4A1XA 2TGPZ 1Y3VA 2BZAA 3EQ0H 3FZZA 1FN8A 2Z9GA 2EI6A 3UNSA 1L2EA 4XE4A 1TGTA 2A4QA 1TOCB 2H9EH 3LDXH 4B76A 3DUXH 1C1UH 1ESBA 2BD5A 2XBWA 4AG2A 1AE5A 3PWCA 3FP8E 1RIWC 1UTQA 2ZDKA 2F9OA 1OKXA 3EDXB 3PMAB 4CHAB 1O3PB 4DT7B 1A0LA 1CBWB 2VIOA 2BVSH 2ZHWH 1GBHA 1NFYA 1HAGE 1T8MA 2OC7A 1SLXB 1RJXB 2HOBA 2PR3A 5EU8A 2WINI 3Q00A 2BDBA 3V3MA 5F6MA 1N1LA 1TNGA 1C5TA 1O2YA 3ZZ8A 1GHAG 1A0HB 2R9PA 3ZV9A 1L1JA 1CSOE 1UCYK 2BQWB 3AW0A 1WCZA 4QT8C 4YOJA 3KNXA 1CGIE 5E0JA 1O30A 5AF9H 1GCTC 2XNIA 3H7OA 1FONA 2F3CE 3BIVH 3PLKA 4HI3A 4MNYA 1F0RA 3SUDA 2OP9A 2ZPRA 7ESTE 1UK3A 4MPUA 4FUHA 1BBRE 5ABWA 3DD2H 1FY5A 4AORA 5A0BA 2HVXA 2ZU2A 2A7HA 4M7GA 3RXDA 3S9CA 3DFJA 1HAZB 2G81E 4ASHA 2Z94A 4OGYA 2ZDNA 2ZFQH 3HPTB 4Q80A 1DSUA 3RXLA 3RXIA 3A88A 2D1JA 2VWMA 1VZQH 2WV5A 4WH6A 1AWHB 3OX7U 4SGBE 5IDKA 1FUJA 1Y3WA 1KYNA 2AIPA 2F9VA 2WPLS 2GCTB 1TONA 1JWTA 1ETTH 1QURH 1GHXH 4X0WU 3UQVA 5DP3A 1UCYH 3U8OH 4I33A 2EI7A 4CH2B 1QJ6B 5A8ZA 3SI4H 4YOIA 1NT1A 1DVAH 3RM0H 5GWZA 1O2VA 1O36A 1S5SA 3SUFA 2BB4A 1SOTA 4UDWH 3AW1A 1DWDH 1NRQH 3KQEA 3URCA 5FPTA 1ELBA 3F9GA 3SJ9A 4IW4E 1TALA 4FUIA 4ZH8A 3RXQA 2AYWA 1ARCA 5DKMA 5DO4H 2G4TA 1EP5A 3NPSA 2C3SA 2SGFE 3T27A 3MI4A 5C5OA 3VB5A 1DT2A 2M5TA 1DLEA 2A31A 2V6NA 3AVZA 3EGKH 1XVOA 1SC8U 3LH3A 5C5NA 3E0PB 1TPPA 1BMNH 1QL7A 3U9AH 1TMUH 2NWNA 1IQGA 1IHTH 1MQ5A 2OQUA 1ZJDA 2JH6D 1GMHF 1ZR0A 2R2MB 3I78A 1TX6A 4H42U 4KP0A 4DG4A 3UNRA 1ZGIA 2FESH 1AN1E 1FY3A 1TB6H 3C27B 1OX1A 3RU4E 4X1RU 5DP9A 1WV7H 2BD4A 2GDEH 1KXDA 1YPLH 3AAUA 4R0IA 1BOQA 5HMAA 3S9AA 3UPEA 3SBKA 4LZ1H 1D3DB 2Y6TA 2QV1A 2SGPE 1GMCG 3LGWA 4X8VH 1UK4A 1TA2A 4BAQB 1E35B 1MKXH 3SV6A 2QXIA 2JETB 1LPGB 4KELA 4FUBA 1RIWB 2ALPA 2IJOB 2VU8E 1BRAA 2ZDLA 1EOJA 1MZDA 2A45B 1J8AA 2ZFRH 2ZWLH 4MDSA 1UTPA 1H9LB 5A09A 1JBUH 4OS7A 1HBTH 3A7ZA 4INKA 1CHOG 3RMOH 1YPMH 1V2KT 2ODYB 1GBDA 1YLDA 4KTUA 4WH8A 1H1BA 1P2QA 1NRSH 3PMHB 5FBIA 4O3UA 1GHZA 5EOKA 1DLKB 2AGEX 3K9XB 1SGQE 2BLQA 1P11E 1T31A 3D65E 1C5VA 4K8YA 2P95A 2FLRH 2STAE 2FIRH 1E0FD 2G8TA 1GBEA 1HV7A 4RSPA 2J94A 2XCFA 3RMMH 1L4DA 2ZTXA 1WBGB 2G4UA 2CXVA 2HNTE 1GG6B 1O5GH 1EPTC 3LIWA 3OU0A 2O8LA 3AAVA 1KXFA 1ZPBA 3BN9A 5F8XA 1Q3XA 1V6DA 3UNQA 2FOMB 3ATMA 3MU8A 2V3HH 3T62A 3UOPA 2NU0E 4ZAEA 2OC8A 1GGDB 1BTHH 2BXUH 1GBCA 3SV9A 4ABHA 3TU7H 2VVUA 4GPGA 3TPIZ 4UONA 1BRBE 2ANWA 1D9IA 5TCCA 4AFSA 1ELEE 2ZGXH 4CREA 1C1VH 1TGCA 1PYTD 1UTNA 2PSXA 5DJ7A 1HUTH 1C2HA 3ATLA 3ZVDA 1GMHG 4F4OC 4BXWA 2PUXB 3Q3KA 4Y6DA 1GMDG 5A8XA 1GJ6A 2K1QA 1EX3A 3PLPA 1LVMA 1C4Y2 2QN5T 2A0QB 1GG6C 1HJAB 1F5RA 1P2MA 4NSYA 2JKHA 2TPIZ 2Z6BD 4K60A 1Z71A 3A80A 1Z8RA 3MO3A 3ZYEA 1N8OB 1A5IA 1O5AB 2J92A 3AASA 3SNAA 1YPJH 1ZMJA 3GOVB 1HRTH 2BZ6H 4AB8A 4A92A 1CT4E 4ISNA 3FAOA 7KMEH 1BBRH 1BTYA 1S6FA 4B73A 3ODDA 2J38A 3BTTE 1G37A 5LH8A 1Y59T 1S0QA 1LVYA 1GI3A 2AEIH 4ZMAH 1WTGH 1KXAA 1EAUA 5FX5A 3ZYDA 1DDJA 2GX4A 2IPHA 2QAAA 3VEQB 1GMDF 1PYTC 3BTWE 4YOGA 3V0XA 2IN2A 4IBLH 1XUGA 3D23A 3BG4C 1C5WB 3QN7A 4YT6H 1UCYE 2CHAB 4LOYH 5E2OA 5ESTE 3KEEA 3NZIA 3Q77A 1IQFA 1IQKA 2GP9B 1F0UA 1O3BA 1DOJA 1DWEH 4OS1A 3U1IB 5AFZH 4UFEH 1GDQA 1GI2A 4Z6AH 2ODQA 1GBIA 1HJ9A 1ZSLA 4AFZA 1SHYA 2ZU1A 1W7GH 3BTQE 3E3TA 1SQTA 1GVLA 3RXCA 2PSYA 1K1MA 1MQ6A 1O5FH 2Y5GA 3TGJE 1Z1IA 4ISHH 2ZFFH 3SQEE 2ZZUH 4UFFH 3GCTG 1SFQB 1TYNA 2OCVB 3LOXA 5DP4A 5G4BA 2FX4A 2H9HA 4NA9H 2B5TB 1QY6A 2QC2A 3Q3YA 3SW2B 1NS3A 2HGTH 4DCDA 3RXVA 1FPCH 2TGDA 2A2QH 1CVWH 4CRDA 1O2LA 3GICB 1QRZA 1W14U 3F1SB 2CF8H 1SG8B 5JYIA 1GL0E 2CN0H 1W2KH 2QCYA 1HIAA 2BY9X 1CGHA 3QZRA 1QCPA 1ELVA 1GHVH 1DANH 3NKKA 3SNCA 1GJ8B 2DUCA 4OS6A 4IC5A 1TWXB 5CHAB 5FCKA 2ZFPH 4YO9A 3F9FA 5EQQA 2A2XH 2YNBA 2D8WA 1OXGA 3HKJB 3SNDA 1GJBB 4D9RA 3MO6A 4MNXA 1KLJH 1HCGA 3UTUH 1AFQC 2GCTC 4INLA 1XKBC 1ZMLA 1HB0B 2C90B 3MHWU 2PHBA 1EAXA 1SQOA 1EASA 4ABIA 3O8BA 1AMHA 2XC0A 4UE7H 5C67A 3A7VA 1PQ7A 5DK1A 2OC1A 3W94A 5FAHA 2ZDVH 3OYPA 2Q6GA 2JH5D 1AVWA 3ZZDA 1TPAE 1C5UA 2EI8A 3M3TA 4DIHH 1OWJA 5J4QA 4UD9H 4DVAU 4B75A 5CHAC 3RU4T 8LPRA 1K2I1 2ZTZA 1MH0A 2D2DA 3A8BA 2AIQA 1O3IA 2XBYA 2XC4A 3S69A 1ESTA 2BOKA 3M5MA 2TBSA 1YGCH 3TK6A 1W8BH 4OS5A 1SGTA 2V3OH 1K21H 1VITH 4ZROA 2UWLA 1XXFA 2BDCA 1C2LA 1H9HE 3STIA 4AFUA 1THPB 2VWOA 1HIAB 3LKWA 4X8UH 1A46H 2PGBB 3LGYA 1AKSA 3M37A 4GHTA 5FX6A 4BANB 4DGJA 3MU4A 2R2WU 3LGVA 3ZV8A 4I8LA 1V2TT 3H5CB 2P94A 3SU4A 1ACBE 2Y5FA 3M61U 4UFGH 1K1IA 2ZHDA 1G2MA 1LHDH 2FOFA 3SN8A 3V7TA 2ILNA 2W3IA 1NC6A 3LGTA 6LPRA 4I8GA 2NU3E 5TJXA 1T7CA 1BMLA 3SJ8A 2A7JA 1Y3UA 3PM3A 1W10U 1GCDA 1NZQH 2FS9A 4O3TA 1P57B 3FP6E 1AB9B 3NK8A 3ESTA 2WPKS 3KHVA 3A7YA 3QZQA 1QRWA 4JYTA 4B71A 1NRPH 1TGBA 4R8TB 1T4UH 2NU1E 3B8JA 3M5LA 1WYKA 1Z8GA 2A4OA 1CO7E 3DFLA 1BB0B 1E37B 1ZOMA 5GDSH 3P95A 3PWBA 3NUMA 4E7RG 2Z7FE 2UUYA 2BLWA 2ZGJA 3SU3A 3GY2A 2ZCHP 1OWEA 3LJJA 1GDNA 1W0YH 3MFJA 1RD3B 3Q3XA 1W12U 3MH7A 4OGXA 1NN6A 3SUEA 1O5DH 4GSOA 1S82A 1V2ST 2Z9LA 4FUGA 2O9QA 3IG6B 1NFUA 1VR1H 1ZSJA 4CH8B 1LPKB 1O3DA 3SU5A 1GPZA 1XUIA 3S0NA 1V2LT 3FZDA 5DPAA 2CV3A 2AH4X 3A8DA 3T28A 1EPTB 1TBZH 3QO6A 1O2JA 1SLUB 1GL1A 1SGEE 1UVTH 1GI0A 1SLWB 3TH3H 3BTEE 3GY7A 4E06H 2SFAA 1RS0A 4NGAH 4Q7YA 1TRMA 3SJIA 3M36A 4YLUA 2F9NA 2VIPA 4IGDA 5AHGH 3ZZAA 2H5DA 1O3KA 1ELDE 4BOHA 1VCPA 3H7TA 3HGPA 4NFFA 1GBAA 1WSSH 1UTJA 1TNLA 3PMJA 2BY8X 3RXBA 3U1JB 5C3NA 3RC6A 4INHA 2VGCB 4ABEA 3UOUA 1Y5AT 1JRSA 3RXFA 4MPVA 5LPFA 3TGIE 3V12A 5CE1A 1LHFH 3MOCA 1OWDA 1C5PA 1O2IA 4PROA 2F9PA 1NFWA 1GHYH 3L33A 1DFPA 1NY22 1UTMA 4IMQA 2O8TA 1HPGA 5I25A 1LQEA 1O3HA 2WYJA 1YLCA 3U98H 3RP2A 1DS2E 2KAIB 3LJOA 5EPNA 2WPJS 2G51A 6CHAC 1FLEE 2ZGBH 3U8RH 3LC5A 2BVRH 2XBXA 1BMAA 1P04A 2J4IA 1GVKB 2PW8H 1SI5H 4DW2U 1BDAA 2Z3EA 2PFEA 2FEQH 1XUHA 4ZKSU 3BV9B 1A4WH 4B74A 1MU8B 2OBQA 4WXIA 4SGAE 2AMPA 3ZZ9A 4AZ2B 4WWYA 2QA9E 4NZQA 1ZPZA 2OBOA 1BHXF 3BG4B 5JBTA 2XCNA 4X6OA 1TNHA 2TIOA 3MYWA 1G3EA 1YP9A 2C8WB 2OINA 1KXEA 1PQAA 1O3GA 2EA3A 1P2KA 2ESTE 1ZRBA 4BAKB 2BOHB 3KGPA 4CBOA 3URDA 1GJDB 4Y71A 1SGRE 2A32A 2GVFA 1MZAA 1O32A 1K1OA 2IOTA 2GCHF 2NU2E 4XFQA 1GBFA 2ZKSA 3EA7A 1LDTT 1MD7A 5PTPA 3HATH 3A87A 1MD8A 4XDEA 5T3HA 3UQOA 3SU1A 3O8RA 5FPSA 1NRRH 3RM2H 1P09A 3A89A 5CMXH 1O2HA 3EAJA 1A0JA 3QK1A 3QGNB 2Z3DA 1QB1A 1C9TA 1Z8IB 1EAWA 1GCTB 3GDSA 4TY6A 1UK2A 1RTKA 1V2OT 1E38B 1O3JA 3A85A 1VITF 1GMCF 1MAYA 4FUCA 2GT7A 1HYLA 1QB6A 2J34A 1NM6A 1TBQH 1XMNB 2SNWA 3PB1E 3ZVEA 5EQRA 1L4ZA 1UVPA 1SHHB 1QBNA 2HNTC 1P3EA 4ISLA 2ZNKH 2GCHG 4Y79A 2F9BH 2BX3A 3O8DA 1CHGA 1HAPH 3PYHA 1BUIA 4I8HA 1CHOF 3M35A 1S83A 2BD3A 1ETRH 3KF2A 1V2QT 5EQSA 4AOQA 2GV6A 1Z7KA 1SVPA 2Y7XA 1VCWA 1ZTJA 5DP5A 1JRTA 1RFNA 4ABFA 4X6PA 1O2RA 2VWNA 1SPJA 2H5CA 2PGQB 2C4FH 3C1KA 4Q7ZA 4TPIZ 3EE0B 1A61H 1Y3XA 3A86A 1UVUH 2PLXA 1B7XB 3M7QA 2Y7ZA 3TIUA 4YT7H 3ZVGA 3LU9B 1HGTH 1N6YA 1GI4A 4MVNA 2VJ1A 1K1JA 1MTUA 3TH4H 5DP7A 3P6ZB 5JBBS 1S6HA 2BQ6B 3RXGA 2EC9H 4JCNA 4JZEH 1YPEH 1SR5C 1VJ9U 4I8JA 2BY6X 4F49A 2LNCA 3RLWH 1DE7H 3GYLB 4YTAA 2VB0A 1K28D 1AE8H 2JETC 1W13U 3K6YA 4NSVA 1EJNA 2Q6FA 3KQBA 2AMQA 4FUDA 4CR5A 4LXBH 3N7OA 1FQ3A 1JIRA 1TQ0B 1ZTLA 1GDUA 1O37A 1UJ1A 1V2UT 2B0FA 1P9UA 3P70B 1MTWA 1G3CA 2WUCA 2YNAA 1MKXK 3W95A 4DURA 1AQ7A 1KDQA 3Q76A 3V13A 5E0GA 1C9PA 4KGAA 1HAIH 1HJAC 4VGCC 1WQSA 1HDTH 3QTVH 5FXLA 1OP0A 5GJ4B 3SV2H 1DXWA 1HAVA 1MCVA 3BF6H 1AHTH 4ABDA 1C5YB 2D26C 2PTNA 3ZZCA 5A2MH 1GBMA 2Y81A 4AG1A 1UTLM 2WPIS 1VITG 1HAXB 3UY9A 1QJ1B 4DIIH 5B6OA 2VNTA 2ZTYA 4FUJA 4FXGH 3RC4A 3ZZ5A 4MG3A 3CS7A 1IAUA 3RXHA 2R3YA 1SGFG 3P92A 3T26A 3SHAH 1ELCA 1GGDC 1TX7A 1XUFA 5DP6A 1TFXA 1V2JT 3P8FA 3QWCH 3RXUA 1O2QA 2RA0A 1DSTA 2VIVA 2ZI2H 5LGOA 4WXVA 1AZZA 3UWJH 1VCQA 1J14A 1DICA 1DM4B 1T32A 1KXBA 2BDYA 2NU4E 1LTOA 1HXEH 3TVJB 1C2JA 2P8OC 2H2ZA 4HGCA 1G30B 2ZCLP 5T6DA 3R3GB 4D8NA 2R0KA 2JH0D 4A1VA 2BQ7B 4AB9A 2XYAA 3RXTA 1B0EA 2XWAA 2FP7B 1THRH 2KAIA 4X1NU 6GCHF 1EZUC 1KY9A 3JZ1B 4NIVA 2VIQA 3I29A 3QDZB 3BEIB 4NG9H 1GJ7B 2AGGX 2BLOA 2P3FH 5FPYA 3VGCC 5FHTA 2FXRA 1X7AC 1ZYOA 3HKIB 4Y8XA 3DHKH 1IQLA 1O2PA 1P9SA 2TGTA 1TPSA 1SSXA 1PPZA 4NWLA 3A8CA 3GCOA 4OS4A 2W3KA 1TNKA 1QQ4A 3FP7E 1ID5H 4HTCH 3VPKA 1A5GH 4FVDA 1IQMA 1GI5A 2OC0A 1D4PB 1ZLRA 1GI8B 1MTNC 3MU0A 1BBRK 1SBWA 1TOMH 5F8TA 3ZZ6A 1QA0A 1S85A 1C5QA 1ZRKA 1YYY1 4JK6A 4YM9A 4J2YB 1WOFA 1D3PB 1C1OA 3QX5H 2DE8A 1KIGH 4BNRA 3NWUA 1YPKH 2ZDMA 5GPIB 3VB6A 2OTVA 1YPHE 2CGAA 2FX6A 1O3EA 4GHQA 2G5NA 8KME2 4JZDH 4B2CA 3A7WA 1OPHB 3CS0A 4Z0KA 3EA8A 1YCPK 1UTOA 2DE9A 2PKSC 5L2YH 5BPEA 4ZKOU 4UFDH 1NPMA 2BD8A 1V2NT 4ABBA 1TNIA 1YKTA 4CHAC 1LPZB 4IN1A 4Y8ZA 1ZGVA 2Y82A 2ZHFH 1IHSH 2FOHA 2XTTB 3RXEA 1FIZA 2VH0A 1AY6H 2FODA 3PO1C 2O8WA 2VVCA 3GISB 2B7DH 3L6PA 3GY6A 1U6QA 2ZU5A 5E8EH 3TK5A 2SGAA 4Y7BA 3SGBE 1O2GH 3SORA 2PWXA 3B9FH 4AYYB 3K65B 1Y3YA 2ODPA 3SGQE 4Q2KA 2CJIA 1MTVA 3A8AA 1EJMA 1G3BA 1V2MT 1P8VC 2RCEA 1BTXA 5L6NH 4AGKA 1SFIA 1FY4A 2O8MA 2QIQA 4GCHF 2OXSA 4A7IB 4HFPB 4FU8A 1D6RA 4D9QA 4FVBA 4IS5A 1YCPH 1YPHC 4U30A 1F7ZA 1XUKA 2Y80A 1GVZA 1EKBB 3RXMA 2J95A 1YPGH 1NU7B 5EGMA 1AFEH 1PPBH 1QL9A 1O35A 2UUJB 1EQ9A 3BEUA 1AUJA 5EPYA 4K69A 2FOGA 1SLVB 1A5HA 2ULLA 1F0SA 1C1NA 2BDIA 3OTJE 4E7NA 5HM2A 1ABIH 1FMGA 2P8OB 3QLPH 2BY5X 5AVDA 3MWIU 1NO9H 4X1PU 1YBWA 2PKSB 5ETXA 5FCRA 4U2WA 4X8SH 2GMTC 5EXMA 3UR6A 4JYVH 1C5ZB 4A1TA 2XXLA 3TNTA 1W0ZU 3GCTF 2BY7X 1GBJA 3RXJA 3TLOA 1JXPA 2FOBA 1DPOA 1G3DA 2BMGB 4AGJA 1O0DH 2BVXH 3QUMP 5JBCS 2Q1JA 1N6XA 1DITH 1AKSB 1OWKA 1K1PA 1MBQA 3M3SA 4I31A 1FJSA 5T6GA 1GWAA 1SL3A 4XBBA 1KLIH 1J16A 1L1NA 1VGCB 1J17T 1JOUB 2B9LA 1V2PT 4JYUH 3ZZ3A 4ABGA 4KKDA 1DWBH 2ZF0H 2J2UA 1O38A 4I8KA 2FS8A 1SQAA 3TH2H 1ELGA 1O34A 2A4RA 1KSNA 2AMDA 4AN7A 3E16B 5JB9S 1OWIA 3O8CA 4ZHAA 4X1QU 2BTCE 1C2MA 1SGCA 5EXLA 2TGAA 1DUAA 2WPMS 2WUBA 5K7RA 4DY7B 3LPRA 1O2NA 2VWLA 5C20A 1CGJE 3SU6A 4ZXYH 1HJ8A 3MO9A 4DOQA 2O8UA 1W11U 2THFB 1TE0A 4LZ4B 2ZHQH 2RG3A 2LPRA 2TRMA 3SI3H 1T8OA 1PPEE 3MU1A 2QF3A 4BTTB 1P10A 2QGRA 3K2UA 1P03A 1BZXE 1YM0A 5L2ZH 5DG6A 1KLTA 3EYDA 1AGJA 2GZ7A 2XBVA 3ZVAA 4JZFH 3S9BA 1TGNA 1H8IH 3UIRA 1QBOA 3B23B 4B2BA 3TITA 2ZGHA 1C1RA 4X2WA 1EZXC 2XRCA 2ASUB 2BXTH 4WMDA 3HGNA 1SGNE 1WUNH 1F92A 1HLTH 1BJUA 3UWIA 1LQDB 2FOEA 1P05A 4U32A 3GCHB 4ZHMU 4MPXA 3KQDA 7GCHF 1A7SA 1OYQA 4AX9H 4X6MA 3ITIA 4H4FA 3RXKA 3M5NA 2HLCA 1C2GA 1ABJH 1CA0B 5LPEA 2ZU4A 1O31A 1FZZA 1MUEB 1BA8B 4IC6A 1P02A 5TCAA 2UWOA 1UHBA 1GJ9B 2V0BA 6CHAB 1QL8A 1PQ5A 3T5FH 1VJAU 1GBBA 1MCTA 2FI4E 3GY4A 1B5GH 4TYDA 3ZVBA 2BM2A 2BLVA 3BTME 1EZQA 2ZPSA 3LC3A 1BT7A 2FYRA 4TY7A 1PQ8A 1MMJN 1WAYB 1G36A 1AO5A 1GI6A 2FLBH 1T4VH 4NZLA 3PMBB 2WYGA 1XX9A 3VFEA 3SNBA 2BD2A 3S7KB 5E2PA 1H9IE 1V2VT 4HZHA 6ESTA 1ELFA 1ETSH 1BTUA 2XC5A 1A2CH 3BTHE 1CBWC 2FDAA 3FANA 2P3TB 3ATWA 3P17H 5E0HA 4BTUB 1LKAA 3RXOA 3SGAE 4MLFB 2OD3B 2BD7A 1SMFE 1OWHA 1V3XA 1PPGE 1Y5BT 2ZECA 4BTIB 1EZSC 1OP8A 4ZXXH 1TRYA 1NTPA 3EA9A 1TPOA 1SOZA 1ZSKA 1V2WT 2AFQB 1C1PA 4I7YH 4JZ1A 2ZEBA 4MPWA 3VGCB 3ZZBA 4Y8YA 4TPYA 1LVOA 1NESE 3LH1A 4FU9A 4I32A 4JMYA 5A0CA 1IOEA 3T2NA 1O2OA 4CRAA 2ALVA 3RDZA 4ISIH 3M3VA 2Z3CA 1SGYE 4XBDA 2J9NA 4O9VA 4RN6A 5LPRA 2F9UA 1SGIB 1EB1H 4WF8A 1CA8B 2CF9H 3RC5A 2ZFTA 4MNVA 2OUAA 1TRNA 3BSQA 1WTHD 1O3AA 5EODA 1O5BB 1O2XA 4Y7AA 3F9EA 1Y5UT 1CT0E 1EATA 3SV8A 1C2IA 1DXPA 1P01A 1AZ8A 4H6SB 1ESAA 2PKAA 4GCHG 4X8TH 1Y8TA 2H9TH 1K22H 4RKJB 3SHCH 2A5KA 4LK4A 4TWYA 1MBMA 3ZVCA 1C5SA 1AIXH 3F6UH 1T8NA 5IYTA 2C8XB 1EXFA 2G00A 4FUEA 3SV7A 4WMEA 1INCA 2P16A 4NIWA 4UEHH 3KQCA 1GI1A 1EAIA 3SJKA 1HFDA 2F83A 2OQ5A 4CR9A 4CRCA 1D3TB 1LHEH 1SGDE 2W26A 3LGIA 1QBVH 1LKBA 4AYVB 3JZ2B 1QR3E 4K1EA 5C2ZA 3SU0A 4KTCA 1GBTA 1FXYA 1RRKA 1TNJA 1QQUA 5AFYH 1CE5A 4A6LA 1BQYA 1O39A 1C1SA 3RXRA 5L30H 2FM2A 3NCLA 4VGCB 4MTBA 2QYIA 4NFEA 1TMTH 3M7TA 6GCHG 4DJZB 3HK6B 1TBRH 2ZIQH 3K6ZA 1FN6A 1MTSA 2ANMH 1C2EA 1ANDA 4BAMB 1NRNH 1GJ4H 5JDUB 1JMOH 5GCHF 1FDPA 2FWWA 3TJUA 1Q2WA 1ELTA 2FTLE 3E6PH 5ESBA 1AWFH 3PV4A 4CRGA 1SGFA 3P8NA 3WY8A 4XBCA 2FMJA 1C2DA 3P8GA 1HNEE 2RA3A 1EUFA 5EW1H 3U69H 1O33A 3CP7A 2PKAB 1C1WH 1B0FA 1O2KA 4MQAA 2H6MA 3PTBA 5C1YA 5GXPA 2UUKB 1S0RA 2ZFSA 2ZC9H 1C1TA 4Y11E 5JB8S 3R0FA 3GDVA 4BAOB 3VB4A 1C5LH 1SB1H 3MNSA 2SGQE 4ZKNU 2GZ9A 1K9OE 3UUZA 2FOCA 4K1TA 2P59A 2A4GA 3U8TH 1AVXA 2CHAC 1F5LA 2FO9A 2QY0B 1QGFA 3P8OA 3LT3A 1O5EH 3IWMA 1ANBA 1HAOH 1C5RA 1AFQB 2C8YB 1GHBG 1HAVB 3CENA 1G2LA 1A3BH 1GI9B 2HPQH 3E8LA 3T25A 4ESTE 4D7FA 2Z9IA 2ZU3A 2GMTB 1PPFE 2ZPQA 1OSSA 1A1RA 1TX8A 2GGVB 1D6WA 1XM1A 3DT0H 1FY1A 4NIXA 8GCHF 2BD9A 2PV9B 1LHCH 1AB9C 1IQJA 1O3OA 3KIDU 3M5OA 2C8ZB 5C1UA 4YESB 1Z8JB 3GY3A 2VVVA 2SNVA 1ZHRA 3MNCA 1P0SH 1CA0C 1MU6B 1F2SE 2AERH 2GKVE 1O2UA 2VH6A 3BG8A 2EEKA 3LONA 2C93B 1GJAB 1OYTH 4JK5A 4GVUA 4D76A 4CRFA 3RXAA 2VIDA 1MAXA 1IQIA 3OSYA 1O3LA 1ANEA 2I6SA 4Q7XA 3LGUA 5F03A 3I77A 5A0AE 3SJOA 1OS8A 5EG4A 1BIOA 3GY5A 4THNH 1C5MD 1Z6JH 1BJVA 4Y10E 1O2ZA 1DY9A 3DA9B 1AU8A 4FU7A 3HK3B 3UR9A 2QF0A 3GYMA 4NCYA 2FTMA 3KL6A 1P06A 4YLQH 1SGPE 5JPMH 4YZUA 1AVGH 1WU1A 2BDHA 4E05H 1TABE 3S7HB 1K1LA 2ZHEH 1C1QA 3ATIA 4NIYA 1KXCA 3E91A 2P93A 1V2RT 1THSH 2GD4B 1MTNB 1QB9A 3IITA 9LPRA 1KDQB 3A81A 1KTTB 1RTLA 1W3CA 4Y0ZE 1BMMH 3MTYA 4WJG2 3SO3A 1GBLA 1IQEA 1S81A 1P3CA 1TMBH 5EXNA 1J9CH
chains in the Genus database with same CATH superfamily
4X2VA 1BCUH 2BHGA 2Q6DA 3VB7A 1OOKB 1UO6A 9ESTA 1KTSB 1DY8A 3F9HA 1ARBA 1TQ7B 3E0NB 1C5XB 1E36B 2H1UA 4O03A 2FPZA 1ZPCA 1C5NH 2VGCC 4B2AA 2FYQA 1C1MA 4X2YA 1HXFH 5K0HA 1O5CB 2W7UA 2ZCKP 4U01A 1BTPA 4IMZA 1Q31A 2OLGA 2GZ8A 1K1NA 3PO1B 1P2JA 1RTFB 4X6NA 4WY3A 3ZZ4A 1TAWA 2V35A 1VKYA 2YMSC 3MNXA 4NA8A 2I6QA 3BTFE 3GDUA 3KCGH 1RXPA 1TA6A 1GJ5H 3QGJA 1N8OC 1LMWB 1XUJA 3T29A 3RLYH 1LHGH 1O3FA 2Z9KA 2F91A 1G32B 5IK2D 3TGKE 5T6FA 5EW2H 4A5TS 2GTBA 1QJ7B 4ABJA 1HAHH 3E1XB 8ESTE 2A5IA 2ANYA 1E34B 3ELAH 1GBKA 4FOUC 1AD8H 3FVFB 2HALA 2XW9A 1O3NA 4KTSA 2ZP0H 4IN2A 3MH4A 1BTWA 4RT0A 3STJA 1D3QB 3A7TA 2R3UA 1H8DH 4K2YA 4O97A 1QNJA 2BYAX 3SZNA 2STBE 2FZZA 3L3TA 1QRXA 1NROH 1C2KA 1ORFA 3TJNA 3ZZ7A 2W7SA 1AUTC 3ATKA 1ANCA 2GJGA 4K5ZA 2A5AA 3UAIC 5JBAS 3PLBA 3A84A 1BRUP 5DP8A 1O2TA 1EJAA 1QIXB 3BTDE 1CQQA 3UREA 2YOLA 3ENSB 1F5KU 3F68H 3BTKE 5A8YA 3RUOA 3SQHE 1GI7B 1CU1A 4Q63A 1CT2E 2A1DB 3DSPA 2G52A 2PTCE 3GY8A 7LPRA 3SOSA 1UVOA 2V7QD 1C4V2 2A7CA 1EPTA 3OEHD 5DGJA 1ZTKA 1FI8A 5I46H 1G9IE 2ANKH 2ZO3H 1DX5M 1QHRB 1LO6A 1TGSZ 4OS2A 5FBEA 2VIWA 4CRBA 4ISOA 1P2IA 1YCPM 5F8ZA 1P12E 1C4U2 1FPHH 5HM9A 4ACAA 4MNWA 3RMLH 1W7XH 2G5VA 3QTOH 4FUFA 3RMNH 1W0KD 1FAXA 1Z1JA 3MU5A 4Y0YE 4ZKRU 2UWPA 4ABAA 2RDLA 1L0ZA 3D49H 4GAWA 4AFQA 3MH6A 1FNIA 1H8HD 1P2OA 5SGAE 1ZZZA 2UUFB 3MMGA 4X2XA 2W5EA 4ZUHA 1FIWA 1LVBA 5HGGA 2GDDA 1YF4A 1IQNA 2FI3E 2K8IA 2PUQH 1S84A 2ZA5A 2WV4A 3ZVFA 1QFKH 1ZHMA 3OY5U 1BITA 1EP6A 2ZG0H 3RXPA 1XKAC 1BMFD 1J15A 3PTNA 1WQVH 2G55A 2SGEE 1TIOA 3A7XA 1DWCH 2ZQ1A 1MKWK 5C1XA 2HWLB 1NFXA 3TNSA 1F0TA 2BDGA 4K3JA 2JJ1D 1PPCE 2XWBI 4GLYA 3VXEH 3GCNA 1QTFA 5H4IB 2BDAA 1JIMA 3BEFB 5GCHG 1PFXC 1UTKA 1YLNA 4Y76A 4K1SA 1A3EH 1ZHPA 2KCPA 1M9UA 3A82A 2ZGCA 3ODFA 1BHXB 1O3MA 1ZMNA 3TJVA 4BAHB 4H6TA 5BRRE 1O2WA 1NU9A 1YC0A 3NXPA 4WMFA 4TWWA 4WVPE 7GCHG 1H4WA 2HNTF 1PPHE 2Z9JA 8GCHG 2Y5HA 4NWKA 2FI5E 2SGDE 1BTZA 2CMYA 1T8LA 3VXFH 2ZQ2A 2AGIX 4X1SU 3PRDA 1OP2A 1FV9A 1Z6EA 1EOLA 4CBNA 2AS9A 3KN2A 3PROA 4HG6A 1ZJKA 3A83A 2R0LA 2QXGA 2HRVA 1L1GA 1P2NA 1XXDA 1C5OH 5J4SA 1VGCC 2VINA 1AI8H 1UHBB 1FAKH 1HAYB 1O2SA 3SUGA 3MH5A 1RGQA 4JZIA 1QA7A 4XOJA 4ZHLU 1EB2A 4J1YA 2BX4A 1UMAH 1TLDA 2FOAA 3SU2A 4D7GA 3CNRA 1MKWH 3D62A 1ELAA 3VG8A 2QXJA 1GJCB 3SNEA 2RDEA 5HYOA 1IQHA 1FY8E 3BIUH 3MNBA 4K8BA 1UVSH 2WPHS 5GIBA 3TJOA 3OY6U 3GCHC 1LCYA 1O2MA 2HPPH 4BXSA 2ZDAH 3E90B 1PJPA 3FFGA 4RKOB 3UFAA 4B1TA 5HXFA 3TK9A 1O3CA 2QXHA 1GHBF 5FL7D 2GV7A 1C2FA 3M7UA 4GUXA 2J97A 3RU4D 2P3UB 2GT8A 3RXSA 3G01A 1BRCE 1DUEA 3VB3A 1GHWH 2B8OH 4NA7A 4XSKU 1GHAF 1XVMA 3BTGE 4A1XA 2TGPZ 1Y3VA 2BZAA 3EQ0H 3FZZA 1FN8A 2Z9GA 2EI6A 3UNSA 1L2EA 4XE4A 1TGTA 2A4QA 1TOCB 2H9EH 3LDXH 4B76A 3DUXH 1C1UH 1ESBA 2BD5A 2XBWA 2PP6A 4AG2A 1AE5A 3PWCA 3FP8E 1RIWC 1UTQA 2ZDKA 2F9OA 1OKXA 3EDXB 3PMAB 4CHAB 1O3PB 4DT7B 1A0LA 1CBWB 2VIOA 2BVSH 2ZHWH 1GBHA 1NFYA 1HAGE 1T8MA 2OC7A 1SLXB 1RJXB 2HOBA 2PR3A 5EU8A 5F53A 2WINI 3Q00A 4OM9A 2BDBA 3V3MA 5F6MA 1N1LA 1TNGA 1C5TA 1O2YA 3ZZ8A 1GHAG 1A0HB 2R9PA 3ZV9A 1L1JA 1CSOE 1UCYK 2BQWB 3AW0A 1WCZA 4QT8C 4YOJA 3KNXA 1CGIE 5E0JA 1O30A 5AF9H 1GCTC 1OHHD 2XNIA 3H7OA 1FONA 2F3CE 3MQKC 3BIVH 3PLKA 4HI3A 4MNYA 1F0RA 3SUDA 2OP9A 2ZPRA 7ESTE 1UK3A 4MPUA 4FUHA 1BBRE 5ABWA 3DD2H 1FY5A 4AORA 5A0BA 4ASUD 2HVXA 2ZU2A 2A7HA 4M7GA 3RXDA 3S9CA 3DFJA 1HAZB 3F2FA 2G81E 4ASHA 2Z94A 4OGYA 2ZDNA 2ZFQH 3HPTB 4Q80A 1DSUA 3RXLA 3RXIA 3A88A 2D1JA 2VWMA 1VZQH 2KR7A 2WV5A 4WH6A 1AWHB 3OX7U 4SGBE 5IDKA 1FUJA 1Y3WA 1KYNA 2AIPA 2F9VA 2WPLS 2GCTB 1TONA 1JWTA 1ETTH 1QURH 1GHXH 4X0WU 3UQVA 5DP3A 1UCYH 1SKYE 4I33A 2EI7A 3U8OH 1QJ6B 4CH2B 5A8ZA 3SI4H 4YOIA 1NT1A 1DVAH 3RM0H 5GWZA 1O2VA 1O36A 1S5SA 3SUFA 2BB4A 1SOTA 4UDWH 3AW1A 1DWDH 1NRQH 3KQEA 3URCA 5FPTA 1ELBA 3F9GA 3SJ9A 4IW4E 1TALA 4FUIA 4ZH8A 3RXQA 2AYWA 1ARCA 5DKMA 5DO4H 2RFKC 2G4TA 2LP6A 1EP5A 3NPSA 2C3SA 2SGFE 3T27A 1YWUA 3MI4A 5C5OA 3VB5A 1DT2A 2M5TA 1DLEA 2A31A 2V6NA 3AVZA 3EGKH 1XVOA 4B6FA 1SC8U 3LH3A 5C5NA 3E0PB 1TPPA 1BMNH 5HIYA 1QL7A 3U9AH 1TMUH 2NWNA 1IQGA 1IHTH 1MQ5A 1E1RD 1ZJDA 2OQUA 2JH6D 3KQ5A 1GMHF 1ZR0A 2R2MB 3I78A 1TX6A 4H42U 4KP0A 4DG4A 3UNRA 1ZGIA 2FESH 1AN1E 1FY3A 1TB6H 3C27B 1OX1A 3RU4E 4X1RU 5DP9A 1WV7H 3OAAD 2BD4A 2GDEH 1KXDA 1YPLH 3AAUA 4R0IA 1BOQA 5HMAA 3S9AA 3UPEA 3SBKA 4LZ1H 1D3DB 2Y6TA 2QV1A 2SGPE 1GMCG 2VBCA 3LGWA 4X8VH 1UK4A 1TA2A 1S6LA 4BAQB 1E35B 1MKXH 3SV6A 2QXIA 2JETB 1LPGB 4KELA 4FUBA 1RIWB 2ALPA 2IJOB 2VU8E 1BRAA 2ZDLA 1EOJA 1MZDA 2A45B 1J8AA 2ZFRH 2ZWLH 4MDSA 1UTPA 1H9LB 5A09A 1JBUH 4OS7A 1HBTH 3A7ZA 4INKA 1CHOG 3RMOH 5C0UA 1YPMH 1V2KT 2ODYB 4RT1A 1GBDA 1YLDA 4KTUA 4WH8A 1H1BA 4ACBA 1P2QA 1NRSH 3PMHB 5FBIA 2F43B 4O3UA 1GHZA 4P00A 5EOKA 1DLKB 2AGEX 3K9XB 1SGQE 2BLQA 1P11E 1T31A 3D65E 1C5VA 4K8YA 2P95A 2FLRH 2STAE 2FIRH 1E0FD 2EQNA 2G8TA 1GBEA 1HV7A 4RSPA 2J94A 2XCFA 3RMMH 1L4DA 2ZTXA 1WBGB 2G4UA 2CXVA 2HNTE 1GG6B 1O5GH 1EPTC 3LIWA 3OU0A 2O8LA 3AAVA 3DSGA 1KXFA 1ZPBA 3BN9A 5F8XA 1Q3XA 1V6DA 3UNQA 2FOMB 3ATMA 3MU8A 2V3HH 3T62A 3UOPA 2NU0E 4ZAEA 2KX4A 2OC8A 1GGDB 1BTHH 2BXUH 1GBCA 3SV9A 4ABHA 3TU7H 2VVUA 4GPGA 3TPIZ 4UONA 2WV9A 1BRBE 2ANWA 1D9IA 5TCCA 4AFSA 1E1QD 1ELEE 2ZGXH 4CREA 1C1VH 1TGCA 2IJD1 5DN6D 2HLDD 1PYTD 1UTNA 2PSXA 5DJ7A 1HUTH 1C2HA 3ATLA 3ZVDA 1GMHG 1NBME 4F4OC 2V3MA 2PUXB 3Q3KA 4Y6DA 1GMDG 4BXWA 4F55A 5A8XA 1GJ6A 2K1QA 1EX3A 3PLPA 1LVMA 1C4Y2 2QN5T 4FETA 2A0QB 1GG6C 1HJAB 1F5RA 1P2MA 4NSYA 2JKHA 2TPIZ 2Z6BD 4K60A 1Z71A 3A80A 1Z8RA 3MO3A 3ZYEA 1N8OB 3DCLA 1A5IA 1O5AB 2J92A 3AASA 3SNAA 1YPJH 1ZMJA 3GOVB 1HRTH 2BZ6H 4AB8A 4A92A 1CT4E 4ISNA 3FAOA 7KMEH 1BBRH 1BTYA 3PV2A 1S6FA 2LELA 4B73A 3ODDA 2J38A 3BTTE 1G37A 5LH8A 1Y59T 1S0QA 3OEED 1LVYA 1GI3A 2AEIH 4ZMAH 1WTGH 1KXAA 1EAUA 5FX5A 3ZYDA 1DDJA 2GX4A 2IPHA 2QAAA 3VEQB 1GMDF 4TSFD 1PYTC 3BTWE 4YOGA 3V0XA 2EY4C 2IN2A 4IBLH 1XUGA 3D23A 3BG4C 1C5WB 3QN7A 4YT6H 1UCYE 2CHAB 4LOYH 5E2OA 5ESTE 3KEEA 3NZIA 3Q77A 1IQFA 1IQKA 2GP9B 1F0UA 1O3BA 1DOJA 1DWEH 4OS1A 3U1IB 5AFZH 4UFEH 1GDQA 1GI2A 4Z6AH 2ODQA 1GBIA 1HJ9A 1ZSLA 2WZQA 3GS9A 4AFZA 1SHYA 3OE7D 2ZU1A 1W7GH 3BTQE 3E3TA 1SQTA 1GVLA 5KECA 3RXCA 2PSYA 1K1MA 1MQ6A 1WDIA 1O5FH 2Y5GA 3TGJE 3W1EA 1Z1IA 4ISHH 2ZFFH 3SQEE 2ZZUH 4UFFH 3GCTG 1SFQB 1TYNA 2OCVB 3LOXA 5DP4A 5G4BA 2FX4A 2H9HA 4NA9H 2B5TB 1QY6A 2QC2A 3Q3YA 3SW2B 1NS3A 2HGTH 4DCDA 3RXVA 1FPCH 2TGDA 2A2QH 1CVWH 4CRDA 1O2LA 3GICB 1QRZA 2CK3D 1W14U 3F1SB 2CF8H 1SG8B 5JYIA 1GL0E 2CN0H 1W2KH 2QCYA 1HIAA 2BY9X 1CGHA 3QZRA 1QCPA 1ELVA 1GHVH 1DANH 3NKKA 3SNCA 1GJ8B 2DUCA 4OS6A 2L6OA 4IC5A 1TWXB 5CHAB 5FCKA 2ZFPH 4YO9A 3F9FA 5EQQA 2A2XH 2YNBA 2D8WA 1OXGA 3HKJB 3SNDA 1GJBB 4D9RA 3MO6A 4MNXA 1KLJH 1HCGA 3UTUH 1AFQC 3F0OA 2GCTC 4INLA 1XKBC 1ZMLA 1HB0B 2C90B 3MHWU 3N7DA 2PHBA 1EAXA 1SQOA 3NRLA 1EASA 4ABIA 3O8BA 1AMHA 2L74A 2XC0A 4UE7H 5C67A 2WPDD 3A7VA 1PQ7A 5DK1A 2OC1A 3W94A 5FAHA 2ZDVH 3OYPA 2Q6GA 2JH5D 1AVWA 3ZZDA 1TPAE 2JJ2D 1C5UA 2EI8A 3M3TA 1QZ8A 1OWJA 5J4QA 4DIHH 4UD9H 4DVAU 4B75A 5CHAC 3RU4T 3U28C 8LPRA 1K2I1 2ZTZA 1MH0A 2D2DA 3A8BA 2AIQA 2KZ4A 1O3IA 2XBYA 2XC4A 3S69A 1ESTA 2BOKA 3M5MA 2TBSA 1YGCH 3TK6A 1W8BH 4OS5A 1SGTA 2V3OH 1K21H 1VITH 3EE7A 4ZROA 2UWLA 1XXFA 2BDCA 1C2LA 1H9HE 3STIA 4AFUA 1THPB 2VWOA 1HIAB 3LKWA 4X8UH 1A46H 2PGBB 3LGYA 1AKSA 3M37A 4GHTA 5FX6A 4BANB 4DGJA 3MU4A 2R2WU 3LGVA 3ZV8A 4I8LA 1V2TT 3H5CB 2P94A 3SU4A 1ACBE 2Y5FA 3M61U 4UFGH 1K1IA 2ZHDA 1G2MA 1LHDH 2FOFA 3SN8A 3V7TA 2ILNA 2W3IA 1NC6A 3LGTA 6LPRA 4I8GA 2NU3E 5TJXA 1T7CA 1BMLA 3SJ8A 2A7JA 1Y3UA 3PM3A 1W10U 1GCDA 1NZQH 3FO8D 2FS9A 4O3TA 1P57B 3FP6E 4F48B 1AB9B 3NK8A 3ESTA 2WPKS 3KHVA 3A7YA 3QZQA 1QRWA 4JYTA 4B71A 1NRPH 1TGBA 4R8TB 1T4UH 2NU1E 3B8JA 3M5LA 1WYKA 1Z8GA 2A4OA 1CO7E 3DFLA 1BB0B 1E37B 1ZOMA 5GDSH 3P95A 3PWBA 3NUMA 4E7RG 2Z7FE 2UUYA 2BLWA 2ZGJA 3SU3A 3GY2A 2ZCHP 1OWEA 3LJJA 1GDNA 1W0YH 3MFJA 1RD3B 3Q3XA 1W12U 3MH7A 4OGXA 1NN6A 3SUEA 1O5DH 4GSOA 1S82A 1V2ST 2Z9LA 4FUGA 2O9QA 3IG6B 1NFUA 1VR1H 1ZSJA 4CH8B 1LPKB 1O3DA 3N99A 3SU5A 1GPZA 1XUIA 3S0NA 1V2LT 3FZDA 5DPAA 2CV3A 2AH4X 3A8DA 3T28A 1EPTB 1TBZH 3QO6A 1O2JA 1SLUB 1GL1A 1SGEE 1UVTH 1GI0A 1SLWB 3TH3H 3BTEE 3GY7A 4E06H 2SFAA 1RS0A 4NGAH 4Q7YA 1TRMA 3SJIA 3M36A 2WSSD 4YLUA 2F9NA 2VIPA 4IGDA 5AHGH 3ZZAA 2H5DA 1O3KA 1ELDE 4BOHA 1VCPA 3H7TA 3HGPA 4NFFA 1GBAA 1WSSH 1UTJA 1TNLA 3PMJA 2BY8X 3RXBA 3U1JB 2KM0A 5C3NA 3RC6A 4INHA 2VGCB 4ABEA 3UOUA 1Y5AT 1JRSA 3RXFA 4MPVA 5LPFA 3TGIE 3V12A 5CE1A 1LHFH 3MOCA 1OWDA 1C5PA 1O2IA 4PROA 2F9PA 1NFWA 1GHYH 3L33A 1DFPA 1NY22 1UTMA 4IMQA 2O8TA 1HPGA 3KYGA 5I25A 1LQEA 1O3HA 2WYJA 1YLCA 3U98H 3RP2A 1DS2E 2KAIB 3LJOA 5EPNA 2WPJS 5C0TA 2G51A 6CHAC 1FLEE 2YMSB 2ZGBH 3U8RH 3LC5A 2BVRH 2XBXA 1BMAA 1P04A 2J4IA 1GVKB 2PW8H 4ZCNA 3H09A 1SI5H 4DW2U 1BDAA 2Z3EA 2PFEA 2FEQH 1XUHA 4ZKSU 3BV9B 1A4WH 4B74A 1MU8B 2OBQA 4WXIA 4SGAE 2AMPA 2J98A 3ZZ9A 4AZ2B 4WWYA 2QA9E 4NZQA 1ZPZA 2OBOA 1BHXF 3BG4B 5JBTA 2XCNA 4X6OA 1TNHA 2TIOA 3MYWA 1G3EA 1YP9A 2C8WB 2OINA 1KXEA 1PQAA 1O3GA 2EA3A 1P2KA 5KGOA 2ESTE 1ZRBA 2F4LA 4BAKB 2BOHB 3KGPA 4CBOA 3URDA 1GJDB 4Y71A 1SGRE 2A32A 2GVFA 1MZAA 1O32A 1K1OA 2IOTA 2GCHF 2NU2E 2JIZD 4XFQA 1GBFA 2ZKSA 3EA7A 1LDTT 1MD7A 5PTPA 3HATH 3A87A 1MD8A 1K0HA 4XDEA 5T3HA 3UQOA 3SU1A 3O8RA 5FPSA 1NRRH 3RM2H 1P09A 3A89A 5CMXH 1O2HA 2W6ID 3EAJA 1A0JA 3QK1A 3QGNB 2Z3DA 1QB1A 5HKKD 1C9TA 1Z8IB 1EAWA 1GCTB 3GDSA 1NBMD 4TY6A 1UK2A 1RTKA 1V2OT 1E38B 1O3JA 3A85A 1VITF 1GMCF 1MAYA 4FUCA 2GT7A 1HYLA 1QB6A 2J34A 1NM6A 1TBQH 1XMNB 2SNWA 3PB1E 3ZVEA 5CDFE 5EQRA 1L4ZA 1UVPA 1SHHB 1QBNA 2HNTC 1P3EA 3FOAA 4ISLA 2ZNKH 2GCHG 4Y79A 2F9BH 2BX3A 3O8DA 1CHGA 2WHXA 1HAPH 3PYHA 1BUIA 4I8HA 1CHOF 3M35A 1S83A 2BD3A 1ETRH 3KF2A 1V2QT 5EQSA 4AOQA 2GV6A 1Z7KA 1SVPA 2Y7XA 1VCWA 1ZTJA 5DP5A 1JRTA 1RFNA 4ABFA 4X6PA 1O2RA 2VWNA 1SPJA 2H5CA 2PGQB 2C4FH 3C1KA 4I86A 4Q7ZA 4TPIZ 3EE0B 1A61H 1Y3XA 3A86A 1UVUH 2PLXA 1B7XB 3M7QA 2Y7ZA 3TIUA 4YT7H 3ZVGA 3LU9B 1HGTH 1N6YA 1GI4A 4MVNA 2VJ1A 5B6LA 1K1JA 1MTUA 3TH4H 3UB0A 1SQRA 5DP7A 3P6ZB 5JBBS 1S6HA 2BQ6B 3RXGA 2EC9H 4JCNA 3KYFA 4JZEH 1YPEH 1SR5C 1VJ9U 4I8JA 2BY6X 4F49A 2LNCA 3RLWH 1DE7H 3GYLB 4YTAA 2VB0A 1K28D 1AE8H 2JETC 1W13U 3K6YA 4NSVA 1EJNA 2Q6FA 3KQBA 2AMQA 4FUDA 4CR5A 4LXBH 3N7OA 1FQ3A 1JIRA 1TQ0B 1ZTLA 1GDUA 1O37A 1UJ1A 1V2UT 2B0FA 1P9UA 3P70B 1MTWA 1G3CA 1MABB 2WUCA 2YNAA 1MKXK 3W95A 4DURA 1AQ7A 1KDQA 3Q76A 3V13A 5E0GA 1C9PA 4KGAA 1HAIH 1HJAC 4VGCC 1WQSA 1HDTH 3QTVH 5FXLA 1OP0A 5GJ4B 3SV2H 1DXWA 1HAVA 1MCVA 3BF6H 1AHTH 4ABDA 1WXRA 1C5YB 2D26C 2PTNA 3ZZCA 5A2MH 1GBMA 2Y81A 4AG1A 1UTLM 2WPIS 1VITG 1HAXB 3UY9A 1QJ1B 4DIIH 5B6OA 2VNTA 3N7EA 2ZTYA 4FUJA 4FXGH 3RC4A 3ZZ5A 4MG3A 3CS7A 1IAUA 3RXHA 2R3YA 1SGFG 3P92A 3T26A 3SHAH 1ELCA 1GGDC 1TX7A 1XUFA 5DP6A 1TFXA 1V2JT 3P8FA 3QWCH 3RXUA 1O2QA 2RA0A 1DSTA 2VIVA 2ZI2H 5LGOA 4WXVA 1AZZA 3UWJH 1VCQA 1J14A 1DICA 5HIZA 5KEDA 1DM4B 3PRBA 1T32A 1KXBA 2BDYA 2NU4E 1LTOA 1HXEH 3TVJB 1C2JA 2P8OC 2H2ZA 4HGCA 1G30B 2ZCLP 5T6DA 3R3GB 1EFRD 4D8NA 2R0KA 2JH0D 4A1VA 2BQ7B 4AB9A 2XYAA 3RXTA 1B0EA 2XWAA 2FP7B 1THRH 2JDID 2KAIA 4X1NU 1EZUC 6GCHF 1KY9A 3JZ1B 4NIVA 2VIQA 3I29A 3QDZB 3BEIB 4NG9H 1GJ7B 2AGGX 2BLOA 2P3FH 5FPYA 3VGCC 5FHTA 2FXRA 1X7AC 1ZYOA 3HKIB 4Y8XA 3DHKH 1IQLA 1O2PA 1P9SA 2TGTA 1TPSA 1SSXA 1PPZA 3F3BA 4NWLA 3A8CA 3GCOA 4OS4A 2W3KA 1TNKA 1QQ4A 3FP7E 1ID5H 4HTCH 3VPKA 1A5GH 2J98B 4FVDA 3ZIAD 5CHBA 1IQMA 1GI5A 2OC0A 1D4PB 1ZLRA 1GI8B 2YMSD 1MTNC 3MU0A 1BBRK 1SBWA 1TOMH 5F8TA 3ZZ6A 1W0JD 1QA0A 1S85A 1C5QA 1ZRKA 1YYY1 4JK6A 3DSOA 1COWD 4J2YB 4YM9A 1WOFA 1D3PB 1C1OA 3QX5H 2DE8A 1KIGH 4BNRA 3NWUA 1YPKH 2ZDMA 5GPIB 2KFWA 3VB6A 2OTVA 1YPHE 2CGAA 2FX6A 1O3EA 4GHQA 2G5NA 8KME2 4JZDH 4B2CA 3A7WA 1OPHB 3CS0A 4Z0KA 3EA8A 1YCPK 1UTOA 2KCAA 3SZEA 2DE9A 2PKSC 5L2YH 5BPEA 4ZKOU 4UFDH 1NPMA 2BD8A 1V2NT 5GNDA 4ABBA 1TNIA 1YKTA 4CHAC 1LPZB 4IN1A 4Y8ZA 1ZGVA 2Y82A 2ZHFH 1IHSH 2FOHA 2XTTB 3RXEA 1FIZA 2VH0A 1AY6H 2FODA 3PO1C 2O8WA 2VVCA 3GISB 2B7DH 3L6PA 5C94A 3GY6A 1U6QA 2ZU5A 5E8EH 3TK5A 2SGAA 4Y7BA 3SGBE 1O2GH 3SORA 2PWXA 3B9FH 4AYYB 3K65B 1Y3YA 2ODPA 3SGQE 4Q2KA 2CJIA 1MTVA 3A8AA 1EJMA 1G3BA 1V2MT 1P8VC 2RCEA 4RI0A 1BTXA 5L6NH 4AGKA 1SFIA 1FY4A 2O8MA 2QIQA 4GCHF 3F0PA 4P02A 2OXSA 4A7IB 4HFPB 4FU8A 1D6RA 4D9QA 4FVBA 4IS5A 1YCPH 1YPHC 4U30A 1F7ZA 1XUKA 2KCYA 2Y80A 1GVZA 1EKBB 3RXMA 2J95A 1YPGH 1NU7B 5EGMA 1AFEH 1PPBH 1QL9A 1O35A 2UUJB 1EQ9A 3BEUA 1AUJA 5EPYA 4K69A 2FOGA 1SLVB 1A5HA 2ULLA 1F0SA 2HVYB 1C1NA 2BDIA 3OTJE 4E7NA 5HM2A 1ABIH 1FMGA 2P8OB 5C17A 3QLPH 2BY5X 5AVDA 3MWIU 1NO9H 4X1PU 1YBWA 2PKSB 5ETXA 5FCRA 4U2WA 4X8SH 2GMTC 5EXMA 3UR6A 4JYVH 1C5ZB 4A1TA 2XXLA 3TNTA 1W0ZU 3GCTF 2BY7X 1GBJA 3RXJA 3TLOA 1JXPA 2FOBA 1DPOA 1G3DA 2BMGB 4AGJA 1O0DH 2BVXH 3QUMP 5JBCS 2Q1JA 1N6XA 1DITH 1AKSB 1OWKA 1K1PA 1MBQA 3M3SA 4I31A 1FJSA 5T6GA 1GWAA 1SL3A 4XBBA 1KLIH 1J16A 1L1NA 1VGCB 1J17T 1JOUB 2B9LA 1V2PT 4JYUH 3ZZ3A 4ABGA 4KKDA 1DWBH 2ZF0H 2J2UA 1O38A 4I8KA 2FS8A 1SQAA 3TH2H 1ELGA 1O34A 2A4RA 1KSNA 2AMDA 4AN7A 3E16B 3AK5A 5JB9S 1OWIA 2QE7D 3O8CA 4ZHAA 4X1QU 2BTCE 2OK5A 1C2MA 1SGCA 5EXLA 2TGAA 1DUAA 2WPMS 2WUBA 5K7RA 4TT3D 4DY7B 3LPRA 1O2NA 2VWLA 5C20A 1CGJE 3SU6A 4ZXYH 4M9FA 1HJ8A 3MO9A 4DOQA 2O8UA 1W11U 2THFB 1TE0A 4LZ4B 2ZHQH 2RG3A 2LPRA 2TRMA 4Q4LA 3SI3H 1T8OA 1PPEE 3MU1A 2QF3A 4BTTB 1P10A 2QGRA 2J5UA 3K2UA 1P03A 1BZXE 1YM0A 5L2ZH 5DG6A 1KLTA 3EYDA 1AGJA 2GZ7A 2XBVA 3ZVAA 4AC9A 4JZFH 2K0QA 3S9BA 1TGNA 1H8IH 3UIRA 1QBOA 3B23B 4B2BA 3F2GA 3TITA 2ZGHA 1C1RA 4X2WA 1EZXC 2XRCA 2ASUB 2BXTH 4WMDA 3HGNA 1SGNE 1WUNH 1F92A 1HLTH 1BJUA 2AHME 3UWIA 1LQDB 2FOEA 1P05A 4U32A 3GCHB 4ZHMU 4MPXA 3KQDA 7GCHF 1A7SA 1OYQA 4AX9H 4X6MA 3ITIA 4H4FA 3RXKA 3M5NA 2HLCA 1C2GA 1ABJH 1CA0B 2W6JD 5LPEA 2ZU4A 1O31A 1FZZA 1MUEB 1BA8B 4IC6A 1P02A 5TCAA 2UWOA 1UHBA 1GJ9B 2V0BA 6CHAB 1QL8A 1PQ5A 3T5FH 1VJAU 1GBBA 1MCTA 2FI4E 3GY4A 1B5GH 4TYDA 3ZVBA 2BM2A 2BLVA 3BTME 1EZQA 2ZPSA 3LC3A 1BT7A 2FYRA 4TY7A 1PQ8A 1MMJN 1WAYB 1G36A 1AO5A 1GI6A 2FLBH 1T4VH 4NZLA 3PMBB 2WYGA 1XX9A 3VFEA 3SNBA 2BD2A 3S7KB 5E2PA 1H9IE 1V2VT 4HZHA 6ESTA 1ELFA 1ETSH 1BTUA 2XC5A 1A2CH 3BTHE 3WWBA 1CBWC 2FDAA 3FANA 2P3TB 3ATWA 3P17H 5E0HA 4BTUB 1LKAA 3RXOA 3SGAE 4MLFB 2OD3B 2BD7A 1SMFE 1OWHA 1V3XA 1PPGE 1Y5BT 2ZECA 4BTIB 1EZSC 1OP8A 4ZXXH 1TRYA 1NTPA 3EA9A 1TPOA 1SOZA 1ZSKA 2AFQB 1V2WT 1C1PA 3PV5A 4I7YH 4JZ1A 2ZEBA 4MPWA 3VGCB 3ZZBA 4Y8YA 4TPYA 1LVOA 1NESE 3LH1A 4FU9A 4I32A 4JMYA 5A0CA 1IOEA 3T2NA 1O2OA 4CRAA 2ALVA 3RDZA 4ISIH 3M3VA 2Z3CA 1SGYE 1UW7A 2J9NA 4O9VA 4RN6A 4XBDA 2F9UA 5LPRA 1SGIB 1EB1H 4WF8A 1KMHB 4YXWD 1CA8B 2CF9H 3RC5A 2ZFTA 4MNVA 2OUAA 1TRNA 3BSQA 1WTHD 1O3AA 5EODA 1O5BB 1O2XA 4Y7AA 3F9EA 1Y5UT 1CT0E 1EATA 3SV8A 1C2IA 1DXPA 1P01A 1AZ8A 4H6SB 1ESAA 2PKAA 4GCHG 4X8TH 5T1VA 1Y8TA 1YY3A 2H9TH 1K22H 4RKJB 3SHCH 2A5KA 4LK4A 4TWYA 1MBMA 3ZVCA 5EIYA 1C5SA 2KCOA 1AIXH 3F6UH 1T8NA 5IYTA 2C8XB 1EXFA 2G00A 4FUEA 4DT4A 3SV7A 4WMEA 1INCA 2P16A 4NIWA 4UEHH 3KQCA 1GI1A 1EAIA 3SJKA 3WW7A 1HFDA 2F83A 2OQ5A 4CR9A 4CRCA 1D3TB 1LHEH 1SGDE 2W26A 3LGIA 1QBVH 1LKBA 4AYVB 3JZ2B 1QR3E 4K1EA 5C2ZA 3SU0A 4KTCA 1GBTA 1FXYA 2QF5A 1RRKA 1TNJA 1QQUA 5AFYH 1CE5A 4A6LA 1BQYA 1FX0B 1O39A 1C1SA 3RXRA 5L30H 2FM2A 3NCLA 3FN8A 4MTBA 4VGCB 2QYIA 4NFEA 1TMTH 3M7TA 6GCHG 4DJZB 3HK6B 3SYJA 1TBRH 2ZIQH 3K6ZA 1FN6A 1MTSA 2ANMH 1C2EA 1ANDA 4BAMB 1NRNH 1GJ4H 5JDUB 1JMOH 5GCHF 1FDPA 2FWWA 3TJUA 1Q2WA 1ELTA 2FTLE 3E6PH 5ESBA 1AWFH 3PV4A 4CRGA 1SGFA 3P8NA 3WY8A 4XBCA 2FMJA 1C2DA 3P8GA 1HNEE 2RA3A 1EUFA 5EW1H 3U69H 1O33A 3CP7A 2PKAB 1C1WH 1B0FA 1O2KA 4MQAA 2H6MA 3PTBA 5C1YA 5GXPA 2UUKB 1S0RA 2ZFSA 2ZC9H 1C1TA 4Y11E 5JB8S 3R0FA 3GDVA 4BAOB 3F2HA 3VB4A 1C5LH 1SB1H 3MNSA 2SGQE 4ZKNU 2GZ9A 1K9OE 3UUZA 2FOCA 1H8ED 4K1TA 2P59A 2A4GA 3U8TH 1AVXA 2CHAC 1F5LA 2FO9A 2QY0B 1QGFA 3P8OA 3LT3A 1O5EH 3IWMA 4XD7D 1ANBA 1HAOH 1C5RA 1AFQB 2C8YB 1GHBG 1HAVB 3CENA 1G2LA 1A3BH 1GI9B 2HPQH 3E8LA 5EJZA 3T25A 4ESTE 4D7FA 2Z9IA 4Z1MD 2ZU3A 2GMTB 1PPFE 2ZPQA 1OSSA 5EJLA 1A1RA 1TX8A 2GGVB 1D6WA 1XM1A 3DT0H 1FY1A 4NIXA 8GCHF 2BD9A 2PV9B 5EJ1A 1LHCH 2XNDD 1AB9C 1IQJA 1O3OA 3KIDU 3M5OA 2C8ZB 2XOKD 5C1UA 4YESB 1Z8JB 2IPQX 3GY3A 2VVVA 2SNVA 3WWFA 1ZHRA 4XRNA 3MNCA 3OTPA 1P0SH 1CA0C 1MU6B 1F2SE 2AERH 2GKVE 1O2UA 2VH6A 3BG8A 2EEKA 3LONA 2C93B 1GJAB 1OYTH 4JK5A 4GVUA 4D76A 4CRFA 3RXAA 2VIDA 1MAXA 1IQIA 3OSYA 1O3LA 1ANEA 2I6SA 4Q7XA 3LGUA 5F03A 3I77A 5A0AE 3SJOA 1OS8A 5EG4A 1BIOA 3GY5A 4THNH 3FKSD 1C5MD 2M2AA 1Z6JH 1BJVA 4Y10E 1O2ZA 1DY9A 3DA9B 1AU8A 4FU7A 3HK3B 4B6EA 3UR9A 2QF0A 1E79D 3GYMA 4NCYA 2FTMA 3KL6A 1P06A 4YLQH 1SGPE 5JPMH 4YZUA 1AVGH 1WU1A 2BDHA 4E05H 1TABE 3S7HB 2QF4A 1K1LA 2ZHEH 1C1QA 3ATIA 4NIYA 1KXCA 3E91A 2P93A 1V2RT 1THSH 2GD4B 1MTNB 1QB9A 3IITA 9LPRA 1KDQB 3A81A 1KTTB 1RTLA 1W3CA 4Y0ZE 3OFND 1BMMH 3MTYA 4WJG2 3SO3A 1GBLA 1IQEA 1S81A 1P3CA 1TMBH 5DSFA 5EXNA 1J9CH
chains in the Genus database with same CATH topology
4X2VA 1BCUH 2BHGA 2Q6DA 3VB7A 1OOKB 1UO6A 9ESTA 1KTSB 1DY8A 3F9HA 1ARBA 1TQ7B 3E0NB 1C5XB 1E36B 2H1UA 4O03A 2FPZA 1ZPCA 1C5NH 2VGCC 4B2AA 2FYQA 1C1MA 4X2YA 1HXFH 5K0HA 1O5CB 2W7UA 2ZCKP 4U01A 1BTPA 4IMZA 1Q31A 2OLGA 2GZ8A 1K1NA 3PO1B 1P2JA 1RTFB 4X6NA 4WY3A 3ZZ4A 1TAWA 2V35A 3MNXA 4NA8A 2I6QA 3BTFE 3GDUA 3KCGH 1RXPA 1TA6A 1GJ5H 3QGJA 1N8OC 1LMWB 1XUJA 3T29A 3RLYH 1LHGH 1O3FA 2Z9KA 2F91A 1G32B 3TGKE 5T6FA 5EW2H 4A5TS 2GTBA 1QJ7B 4ABJA 1HAHH 3E1XB 8ESTE 2A5IA 2ANYA 1E34B 3ELAH 1GBKA 1AD8H 3FVFB 2HALA 2XW9A 1O3NA 4KTSA 2ZP0H 4IN2A 3MH4A 1BTWA 3STJA 1D3QB 3A7TA 2R3UA 1H8DH 4K2YA 4O97A 1QNJA 2BYAX 3SZNA 2STBE 2FZZA 3L3TA 1QRXA 1NROH 1C2KA 1ORFA 3TJNA 3ZZ7A 2W7SA 1AUTC 3ATKA 1ANCA 4K5ZA 2A5AA 5JBAS 3PLBA 3A84A 1BRUP 5DP8A 1O2TA 1EJAA 1QIXB 3BTDE 1CQQA 3UREA 2YOLA 3ENSB 1F5KU 3F68H 3BTKE 5A8YA 3RUOA 3SQHE 1GI7B 1CU1A 1CT2E 2A1DB 2G52A 2PTCE 3GY8A 7LPRA 3SOSA 1UVOA 1C4V2 2A7CA 1EPTA 5DGJA 1ZTKA 1FI8A 5I46H 1G9IE 2ANKH 2ZO3H 1DX5M 1QHRB 1LO6A 1TGSZ 4OS2A 5FBEA 2VIWA 4CRBA 4ISOA 1P2IA 1YCPM 5F8ZA 1P12E 1C4U2 1FPHH 5HM9A 4MNWA 3RMLH 1W7XH 2G5VA 3QTOH 4FUFA 3RMNH 1Z1JA 1FAXA 3MU5A 4Y0YE 4ZKRU 2UWPA 4ABAA 2RDLA 1L0ZA 3D49H 4GAWA 4AFQA 3MH6A 1FNIA 1P2OA 5SGAE 1ZZZA 2UUFB 3MMGA 4X2XA 2W5EA 4ZUHA 1FIWA 1LVBA 5HGGA 2GDDA 1YF4A 1IQNA 2FI3E 2PUQH 1S84A 2ZA5A 2WV4A 3ZVFA 1QFKH 1ZHMA 3OY5U 1BITA 1EP6A 2ZG0H 3RXPA 1XKAC 1J15A 3PTNA 1WQVH 2G55A 2SGEE 1TIOA 3A7XA 1DWCH 2ZQ1A 1MKWK 5C1XA 2HWLB 1NFXA 3TNSA 1F0TA 2BDGA 4K3JA 3VXEH 1PPCE 2XWBI 4GLYA 3GCNA 1QTFA 5H4IB 2BDAA 1JIMA 3BEFB 5GCHG 1PFXC 1UTKA 4Y76A 4K1SA 1A3EH 1ZHPA 1M9UA 3A82A 2ZGCA 3ODFA 1BHXB 1O3MA 1ZMNA 3TJVA 4BAHB 4H6TA 5BRRE 1O2WA 1NU9A 1YC0A 3NXPA 4WMFA 4TWWA 4WVPE 7GCHG 1H4WA 2HNTF 1PPHE 2Z9JA 8GCHG 2Y5HA 4NWKA 2FI5E 2SGDE 1BTZA 2CMYA 1T8LA 3VXFH 2ZQ2A 2AGIX 4X1SU 1OP2A 1FV9A 1Z6EA 1EOLA 4CBNA 2AS9A 3KN2A 3PROA 1ZJKA 3A83A 2R0LA 2QXGA 2HRVA 1L1GA 1P2NA 1XXDA 1C5OH 5J4SA 1VGCC 2VINA 1AI8H 1UHBB 1FAKH 1HAYB 1O2SA 3SUGA 3MH5A 1RGQA 4JZIA 1QA7A 4XOJA 4ZHLU 1EB2A 4J1YA 2BX4A 1UMAH 1TLDA 2FOAA 3SU2A 4D7GA 1MKWH 3D62A 1ELAA 2QXJA 1GJCB 3SNEA 5HYOA 1IQHA 1FY8E 3BIUH 3MNBA 4K8BA 1UVSH 2WPHS 5GIBA 3TJOA 3OY6U 3GCHC 1LCYA 1O2MA 2HPPH 4BXSA 2ZDAH 3E90B 1PJPA 3FFGA 4RKOB 3UFAA 4B1TA 5HXFA 3TK9A 1O3CA 2QXHA 1GHBF 2GV7A 1C2FA 3M7UA 4GUXA 3RU4D 2P3UB 2GT8A 3RXSA 3G01A 1BRCE 1DUEA 3VB3A 1GHWH 2B8OH 4NA7A 4XSKU 1GHAF 1XVMA 3BTGE 4A1XA 2TGPZ 1Y3VA 2BZAA 3EQ0H 3FZZA 1FN8A 2Z9GA 2EI6A 3UNSA 1L2EA 4XE4A 1TGTA 2A4QA 1TOCB 2H9EH 3LDXH 4B76A 3DUXH 1C1UH 1ESBA 2BD5A 2XBWA 4AG2A 1AE5A 3PWCA 3FP8E 1RIWC 1UTQA 2ZDKA 2F9OA 1OKXA 3EDXB 3PMAB 4CHAB 1O3PB 4DT7B 1A0LA 1CBWB 2VIOA 2BVSH 2ZHWH 1GBHA 1NFYA 1HAGE 1T8MA 2OC7A 1SLXB 1RJXB 2HOBA 2PR3A 5EU8A 2WINI 3Q00A 2BDBA 3V3MA 5F6MA 1N1LA 1TNGA 1C5TA 1O2YA 3ZZ8A 1GHAG 1A0HB 2R9PA 3ZV9A 1L1JA 1CSOE 1UCYK 2BQWB 3AW0A 1WCZA 4QT8C 4YOJA 3KNXA 1CGIE 5E0JA 1O30A 5AF9H 1GCTC 2XNIA 3H7OA 1FONA 2F3CE 3BIVH 3PLKA 4HI3A 4MNYA 1F0RA 3SUDA 2OP9A 2ZPRA 7ESTE 1UK3A 4MPUA 4FUHA 1BBRE 5ABWA 3DD2H 1FY5A 4AORA 5A0BA 2HVXA 2ZU2A 2A7HA 4M7GA 3RXDA 3S9CA 3DFJA 1HAZB 2G81E 4ASHA 2Z94A 4OGYA 2ZDNA 2ZFQH 3HPTB 4Q80A 1DSUA 3RXLA 3RXIA 3A88A 2D1JA 2VWMA 1VZQH 2WV5A 4WH6A 1AWHB 3OX7U 4SGBE 5IDKA 1FUJA 1Y3WA 1KYNA 2AIPA 2F9VA 2WPLS 2GCTB 1TONA 1JWTA 1ETTH 1QURH 1GHXH 4X0WU 3UQVA 5DP3A 1UCYH 3U8OH 4I33A 2EI7A 4CH2B 1QJ6B 5A8ZA 3SI4H 4YOIA 1NT1A 1DVAH 3RM0H 5GWZA 1O2VA 1O36A 1S5SA 3SUFA 2BB4A 1SOTA 4UDWH 3AW1A 1DWDH 1NRQH 3KQEA 3URCA 5FPTA 1ELBA 3F9GA 3SJ9A 4IW4E 1TALA 4FUIA 4ZH8A 3RXQA 2AYWA 1ARCA 5DKMA 5DO4H 2G4TA 1EP5A 3NPSA 2C3SA 2SGFE 3T27A 3MI4A 5C5OA 3VB5A 1DT2A 2M5TA 1DLEA 2A31A 2V6NA 3AVZA 3EGKH 1XVOA 1SC8U 3LH3A 5C5NA 3E0PB 1TPPA 1BMNH 1QL7A 3U9AH 1TMUH 2NWNA 1IQGA 1IHTH 1MQ5A 2OQUA 1ZJDA 2JH6D 1GMHF 1ZR0A 2R2MB 3I78A 1TX6A 4H42U 4KP0A 4DG4A 3UNRA 1ZGIA 2FESH 1AN1E 1FY3A 1TB6H 3C27B 1OX1A 3RU4E 4X1RU 5DP9A 1WV7H 2BD4A 2GDEH 1KXDA 1YPLH 3AAUA 4R0IA 1BOQA 5HMAA 3S9AA 3UPEA 3SBKA 4LZ1H 1D3DB 2Y6TA 2QV1A 2SGPE 1GMCG 3LGWA 4X8VH 1UK4A 1TA2A 4BAQB 1E35B 1MKXH 3SV6A 2QXIA 2JETB 1LPGB 4KELA 4FUBA 1RIWB 2ALPA 2IJOB 2VU8E 1BRAA 2ZDLA 1EOJA 1MZDA 2A45B 1J8AA 2ZFRH 2ZWLH 4MDSA 1UTPA 1H9LB 5A09A 1JBUH 4OS7A 1HBTH 3A7ZA 4INKA 1CHOG 3RMOH 1YPMH 1V2KT 2ODYB 1GBDA 1YLDA 4KTUA 4WH8A 1H1BA 1P2QA 1NRSH 3PMHB 5FBIA 4O3UA 1GHZA 5EOKA 1DLKB 2AGEX 3K9XB 1SGQE 2BLQA 1P11E 1T31A 3D65E 1C5VA 4K8YA 2P95A 2FLRH 2STAE 2FIRH 1E0FD 2G8TA 1GBEA 1HV7A 4RSPA 2J94A 2XCFA 3RMMH 1L4DA 2ZTXA 1WBGB 2G4UA 2CXVA 2HNTE 1GG6B 1O5GH 1EPTC 3LIWA 3OU0A 2O8LA 3AAVA 1KXFA 1ZPBA 3BN9A 5F8XA 1Q3XA 1V6DA 3UNQA 2FOMB 3ATMA 3MU8A 2V3HH 3T62A 3UOPA 2NU0E 4ZAEA 2OC8A 1GGDB 1BTHH 2BXUH 1GBCA 3SV9A 4ABHA 3TU7H 2VVUA 4GPGA 3TPIZ 4UONA 1BRBE 2ANWA 1D9IA 5TCCA 4AFSA 1ELEE 2ZGXH 4CREA 1C1VH 1TGCA 1PYTD 1UTNA 2PSXA 5DJ7A 1HUTH 1C2HA 3ATLA 3ZVDA 1GMHG 4F4OC 4BXWA 2PUXB 3Q3KA 4Y6DA 1GMDG 5A8XA 1GJ6A 2K1QA 1EX3A 3PLPA 1LVMA 1C4Y2 2QN5T 2A0QB 1GG6C 1HJAB 1F5RA 1P2MA 4NSYA 2JKHA 2TPIZ 2Z6BD 4K60A 1Z71A 3A80A 1Z8RA 3MO3A 3ZYEA 1N8OB 1A5IA 1O5AB 2J92A 3AASA 3SNAA 1YPJH 1ZMJA 3GOVB 1HRTH 2BZ6H 4AB8A 4A92A 1CT4E 4ISNA 3FAOA 7KMEH 1BBRH 1BTYA 1S6FA 4B73A 3ODDA 2J38A 3BTTE 1G37A 5LH8A 1Y59T 1S0QA 1LVYA 1GI3A 2AEIH 4ZMAH 1WTGH 1KXAA 1EAUA 5FX5A 3ZYDA 1DDJA 2GX4A 2IPHA 2QAAA 3VEQB 1GMDF 1PYTC 3BTWE 4YOGA 3V0XA 2IN2A 4IBLH 1XUGA 3D23A 3BG4C 1C5WB 3QN7A 4YT6H 1UCYE 2CHAB 4LOYH 5E2OA 5ESTE 3KEEA 3NZIA 3Q77A 1IQFA 1IQKA 2GP9B 1F0UA 1O3BA 1DOJA 1DWEH 4OS1A 3U1IB 5AFZH 4UFEH 1GDQA 1GI2A 4Z6AH 2ODQA 1GBIA 1HJ9A 1ZSLA 4AFZA 1SHYA 2ZU1A 1W7GH 3BTQE 3E3TA 1SQTA 1GVLA 3RXCA 2PSYA 1K1MA 1MQ6A 1O5FH 2Y5GA 3TGJE 1Z1IA 4ISHH 2ZFFH 3SQEE 2ZZUH 4UFFH 3GCTG 1SFQB 1TYNA 2OCVB 3LOXA 5DP4A 5G4BA 2FX4A 2H9HA 4NA9H 2B5TB 1QY6A 2QC2A 3Q3YA 3SW2B 1NS3A 2HGTH 4DCDA 3RXVA 1FPCH 2TGDA 2A2QH 1CVWH 4CRDA 1O2LA 3GICB 1QRZA 1W14U 3F1SB 2CF8H 1SG8B 5JYIA 1GL0E 2CN0H 1W2KH 2QCYA 1HIAA 2BY9X 1CGHA 3QZRA 1QCPA 1ELVA 1GHVH 1DANH 3NKKA 3SNCA 1GJ8B 2DUCA 4OS6A 4IC5A 1TWXB 5CHAB 5FCKA 2ZFPH 4YO9A 3F9FA 5EQQA 2A2XH 2YNBA 2D8WA 1OXGA 3HKJB 3SNDA 1GJBB 4D9RA 3MO6A 4MNXA 1KLJH 1HCGA 3UTUH 1AFQC 2GCTC 4INLA 1XKBC 1ZMLA 1HB0B 2C90B 3MHWU 2PHBA 1EAXA 1SQOA 1EASA 4ABIA 3O8BA 1AMHA 2XC0A 4UE7H 5C67A 3A7VA 1PQ7A 5DK1A 2OC1A 3W94A 5FAHA 2ZDVH 3OYPA 2Q6GA 2JH5D 1AVWA 3ZZDA 1TPAE 1C5UA 2EI8A 3M3TA 4DIHH 1OWJA 5J4QA 4UD9H 4DVAU 4B75A 5CHAC 3RU4T 8LPRA 1K2I1 2ZTZA 1MH0A 2D2DA 3A8BA 2AIQA 1O3IA 2XBYA 2XC4A 3S69A 1ESTA 2BOKA 3M5MA 2TBSA 1YGCH 3TK6A 1W8BH 4OS5A 1SGTA 2V3OH 1K21H 1VITH 4ZROA 2UWLA 1XXFA 2BDCA 1C2LA 1H9HE 3STIA 4AFUA 1THPB 2VWOA 1HIAB 3LKWA 4X8UH 1A46H 2PGBB 3LGYA 1AKSA 3M37A 4GHTA 5FX6A 4BANB 4DGJA 3MU4A 2R2WU 3LGVA 3ZV8A 4I8LA 1V2TT 3H5CB 2P94A 3SU4A 1ACBE 2Y5FA 3M61U 4UFGH 1K1IA 2ZHDA 1G2MA 1LHDH 2FOFA 3SN8A 3V7TA 2ILNA 2W3IA 1NC6A 3LGTA 6LPRA 4I8GA 2NU3E 5TJXA 1T7CA 1BMLA 3SJ8A 2A7JA 1Y3UA 3PM3A 1W10U 1GCDA 1NZQH 2FS9A 4O3TA 1P57B 3FP6E 1AB9B 3NK8A 3ESTA 2WPKS 3KHVA 3A7YA 3QZQA 1QRWA 4JYTA 4B71A 1NRPH 1TGBA 4R8TB 1T4UH 2NU1E 3B8JA 3M5LA 1WYKA 1Z8GA 2A4OA 1CO7E 3DFLA 1BB0B 1E37B 1ZOMA 5GDSH 3P95A 3PWBA 3NUMA 4E7RG 2Z7FE 2UUYA 2BLWA 2ZGJA 3SU3A 3GY2A 2ZCHP 1OWEA 3LJJA 1GDNA 1W0YH 3MFJA 1RD3B 3Q3XA 1W12U 3MH7A 4OGXA 1NN6A 3SUEA 1O5DH 4GSOA 1S82A 1V2ST 2Z9LA 4FUGA 2O9QA 3IG6B 1NFUA 1VR1H 1ZSJA 4CH8B 1LPKB 1O3DA 3SU5A 1GPZA 1XUIA 3S0NA 1V2LT 3FZDA 5DPAA 2CV3A 2AH4X 3A8DA 3T28A 1EPTB 1TBZH 3QO6A 1O2JA 1SLUB 1GL1A 1SGEE 1UVTH 1GI0A 1SLWB 3TH3H 3BTEE 3GY7A 4E06H 2SFAA 1RS0A 4NGAH 4Q7YA 1TRMA 3SJIA 3M36A 4YLUA 2F9NA 2VIPA 4IGDA 5AHGH 3ZZAA 2H5DA 1O3KA 1ELDE 4BOHA 1VCPA 3H7TA 3HGPA 4NFFA 1GBAA 1WSSH 1UTJA 1TNLA 3PMJA 2BY8X 3RXBA 3U1JB 5C3NA 3RC6A 4INHA 2VGCB 4ABEA 3UOUA 1Y5AT 1JRSA 3RXFA 4MPVA 5LPFA 3TGIE 3V12A 5CE1A 1LHFH 3MOCA 1OWDA 1C5PA 1O2IA 4PROA 2F9PA 1NFWA 1GHYH 3L33A 1DFPA 1NY22 1UTMA 4IMQA 2O8TA 1HPGA 5I25A 1LQEA 1O3HA 2WYJA 1YLCA 3U98H 3RP2A 1DS2E