5LH8A

Trypsin inhibitors for the treatment of pancreatitis - cpd 8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A02
4DJZB 1EZSC 1O5FH 1EAWA 2BDHA 2BLQA 1WTHD 2ZU4A 1UVPA 1DXPA 1XUFA 2FS8A 3PWCA 1D3TB 3M35A 2C3SA 4AFUA 2THFB 1Y8TA 1VGCC 2P8OC 1VCPA 3IWMA 2H9TH 4E7RG 1YC0A 4NIWA 4MNWA 1GJ4H 2SGDE 1GWAA 1UO6A 2O8LA 3LOXA 1OSSA 2F9OA 2BYAX 1QBVH 1UCYH 2R3UA 3SV2H 1QQUA 7ESTE 2R0LA 3IITA 3EAJA 1NS3A 1T7CA 3LKWA 3NK8A 1U6QA 6CHAB 2LNCA 1GBFA 1LPGB 4AB8A 2ZCHP 4NWLA 2C93B 3ITIA 6GCHF 4JK6A 1SFIA 2XCNA 4I8HA 2DE9A 4WY3A 1ZTJA 1FY5A 4O97A 1OWHA 1GVZA 3BTKE 3DFLA 2YNBA 4E05H 1UTMA 3Q00A 1KIGH 3URCA 1O2XA 3GY5A 2A2XH 1HAOH 4MQAA 1GJAB 2OCVB 2ZQ1A 1V2ST 2UUYA 5TCAA 2J94A 1XMNB 5A09A 5ABWA 1GJ9B 2CXVA 1G3EA 4XFQA 2GDEH 1ID5H 1QNJA 1YPKH 1L1GA 2ZDLA 1O3KA 3S9BA 2BD8A 3TU7H 4AG1A 3BTFE 3UR9A 3F9FA 3LU9B 1TYNA 3U69H 1PPHE 2AEIH 4K1EA 4Y8ZA 1V2TT 4ASHA 2BXUH 2Q6DA 1A2CH 2GT7A 3L6PA 1AQ7A 3M37A 2TGTA 3ZZ6A 2Y82A 1BRBE 1BBRE 1V2OT 1AI8H 1WTGH 1G32B 4AFSA 4ABHA 3PMJA 2BQ7B 3SNCA 1TMTH 2WV4A 1CA0B 1Y3XA 2J38A 3E8LA 4MPXA 1T31A 2A7HA 1A46H 1O34A 1C1PA 1C2LA 3A7WA 4D7GA 2FX4A 2WINI 5AFZH 1V2PT 4JZ1A 4TPYA 2ZDKA 3T27A 3UNQA 2Q6GA 4Y7AA 3HK6B 3RDZA 2R2WU 3U9AH 4U30A 3UNSA 2FEQH 1L2EA 2ANWA 3DD2H 5GPIB 3GYMA 1YKTA 1THRH 3M7QA 3ZZ3A 4K1TA 1J15A 4YOIA 1KLJH 3PROA 1VITF 1PFXC 5EGMA 1O5BB 3A7XA 3QUMP 1QR3E 2ALPA 2ZHDA 1RD3B 5AHGH 3BTHE 2AGEX 3ZYDA 1GHYH 3A84A 4DURA 1BMNH 4UFDH 4R0IA 2H9HA 1KYNA 1O5AB 1GBCA 1L1NA 4CBOA 4AORA 1IQLA 4RKOB 1NY22 1E37B 3TJOA 2HNTF 2VH0A 4YT7H 3LGTA 1C5QA 1K1LA 3U8TH 1S83A 2TGDA 3PO1B 1TBRH 4X6OA 4B76A 1BA8B 3F1SB 1OX1A 2XW9A 1XUHA 5E0HA 1HLTH 1ZMJA 1P9UA 1F92A 4A1XA 2AMPA 5EW1H 3A81A 1RXPA 1LHEH 4K5ZA 1Z1JA 1GMDF 1E38B 1O3IA 2HOBA 2BY9X 4Y6DA 4LK4A 4PROA 4THNH 1TGSZ 2GCHF 1F5LA 2OBOA 2ZG0H 2FYQA 3UPEA 1CBWC 1DANH 3S9AA 1RIWC 3RU4D 1A61H 1F0UA 3P8GA 1O2IA 1MCTA 2ZU2A 3MU0A 2OQ5A 1O2PA 2OC0A 3NUMA 4JYTA 2KAIB 1Q3XA 2V3HH 3LGIA 4ABJA 1SHYA 1FMGA 2OXSA 1T4VH 3UWJH 1L4ZA 1ETRH 4GPGA 1D3PB 4YLQH 1DFPA 1HB0B 4ISLA 5ESBA 2Y7ZA 4X6NA 2VIPA 1OS8A 2GD4B 3FFGA 5LH8A 2BOHB 1DPOA 3BG4B 3VFEA 2SGAA 2B9LA 2PUQH 4UEHH 3VB5A 3ZVAA 2P16A 4KP0A 4XOJA 3S69A 3OY6U 3MTYA 2ZZUH 1XVMA 1O2HA 1UVOA 1W0ZU 1UVSH 2AGIX 3RM2H 1DLKB 4AGKA 1QJ1B 1Z7KA 1OWIA 3SV8A 1LPKB 5K0HA 2A1DB 1JWTA 1HXEH 1C5NH 1Z8GA 1XKBC 4NGAH 1PQ5A 1T8OA 1IHTH 2D8WA 2W5EA 1DDJA 3QZRA 1O3JA 1P3EA 1P3CA 1S0RA 3SQEE 3W95A 2QCYA 4BANB 5BPEA 2RA0A 2BD7A 4I8JA 1BRAA 3NZIA 1ARBA 3AW1A 3RXPA 2FOEA 1LQDB 4Z6AH 1MTSA 3SNEA 1O3EA 1OWDA 1V3XA 4FUGA 1GPZA 3RXEA 1M9UA 1SFQB 4ABEA 2OC1A 2C8YB 1G30B 1ELCA 2D26C 1EUFA 1AB9C 1MMJN 1C4U2 1NFYA 2PLXA 3P8FA 3I29A 4B2BA 2XC4A 1GI0A 2R2MB 2BQWB 2V3OH 4WMFA 1WV7H 5F6MA 1EJAA 2PKAA 2PSYA 4IGDA 3MO3A 1GBMA 4LOYH 4CRAA 2OC8A 3TK5A 2Z9IA 4GSOA 1C5OH 1UK2A 1YCPH 1GGDC 1MKWK 2ZECA 4X1SU 1ZHMA 2FLRH 1O33A 2FTMA 1HJAC 1S6FA 3LT3A 3DUXH 3U8OH 4X1RU 1ELGA 3TGKE 3SUGA 3BEIB 4H4FA 3RXQA 2QF3A 2R3YA 4ISHH 1MTNB 2HALA 2PW8H 3ZVGA 6LPRA 1P9SA 2BDCA 1PPGE 3H5CB 3ESTA 1MD8A 1MKXK 3BTWE 1V2QT 3Q3YA 1SQOA 1TPPA 5TCCA 1GBIA 1A0LA 4NA8A 3RC4A 2ZTZA 3P92A 1CO7E 2F9NA 5B6OA 4YOJA 1E35B 2Z3EA 3PV4A 2P59A 1GBKA 2FOHA 1SMFE 2PFEA 1W8BH 1YYY1 1P03A 5EXMA 5AF9H 2H9EH 3BTEE 3UFAA 1QB1A 1BQYA 1CGJE 1KY9A 3GOVB 4WXIA 5A2MH 5JBBS 3SNDA 2F9UA 1RFNA 1OYQA 3Q3KA 1XUIA 2F91A 3RM0H 2BD2A 2VJ1A 1GMCG 5JBTA 1H9LB 1DUAA 1LVYA 1P2JA 5C1XA 3FP8E 1XKAC 1SVPA 2J34A 3ZZ7A 3SV7A 3M5LA 2BZAA 4Y76A 5J4SA 3NXPA 3VB7A 1GBAA 1A3BH 1K1NA 1O3MA 4O9VA 4AFQA 3ATIA 1JRTA 4CRFA 2BDYA 2VIVA 3T29A 5JB9S 2OUAA 2ALVA 1NROH 2BVXH 4TYDA 3ZZ9A 3M3SA 1GCDA 1D3QB 5GCHG 1O38A 2FM2A 2FIRH 2WUBA 2FESH 3S7HB 1MTUA 5DGJA 4GHQA 5EPNA 1TQ7B 5EODA 2BM2A 1C2KA 4BAQB 3A8CA 3KNXA 1AKSA 5H4IB 4BAMB 1EPTA 3RXBA 2FOFA 1ZMNA 4NFEA 1FAKH 1BIOA 1XXDA 1MAYA 5DG6A 2VIOA 1ELBA 2A4GA 3EYDA 4ISNA 5L30H 1QB9A 3AW0A 3MU8A 2B0FA 4X0WU 1ZRBA 1TNHA 1OWEA 2M5TA 1O3NA 1HUTH 3ELAH 5A0CA 1DY9A 1KLIH 5E2PA 3TH2H 1ARCA 3LC3A 1YCPM 5CHAB 3AAUA 3EA7A 4MTBA 1HIAA 2VU8E 3EDXB 3K9XB 2CHAC 2GP9B 3RMMH 3SORA 4IMQA 2WPJS 2QF0A 1Y5BT 1CT0E 2A2QH 1E36B 2VVVA 4IS5A 1S82A 5DPAA 2ANKH 4FU7A 4E7NA 3MMGA 1YLCA 8KME2 1GHXH 2PR3A 3VGCC 3SU3A 3GDSA 4Q7YA 4IC6A 3E91A 1C5RA 3ZZ4A 1Y3WA 1SQAA 1TGNA 3OTJE 3TK9A 1GI4A 4DVAU 1SGEE 1TOMH 1LTOA 1SC8U 1RTLA 3VXEH 5T6DA 4AGJA 2UUKB 2FI5E 1BTPA 2XXLA 3QGNB 1J17T 2I6SA 2ZFSA 1PPCE 2BLOA 1Z6JH 1YPLH 5HYOA 2FI4E 2GX4A 4ZHAA 4AG2A 1O36A 1K1OA 1SL3A 2EC9H 4INLA 1BTXA 1EP6A 2A5KA 4B73A 2ZTYA 1MQ5A 1GI6A 3U8RH 1O3OA 2AFQB 5EU8A 3W94A 1P01A 1O2OA 1AU8A 1HGTH 4FU8A 2ZTXA 2A4QA 1ANBA 4NIVA 3UTUH 1O30A 3N7OA 3HATH 3VB3A 3SJIA 1P04A 1F5RA 1ACBE 3SNBA 3MOCA 1EXFA 5FX5A 9ESTA 3F6UH 1G37A 4X2WA 4FUJA 5EXNA 3UY9A 1WU1A 4X6MA 1NRRH 1TNIA 1CHGA 1QL9A 3ZYEA 1DS2E 1V2KT 4GCHG 1A0HB 4MNYA 1FY8E 2FLBH 5A0BA 1P2IA 4CRCA 5C3NA 5JPMH 5EPYA 2PKAB 1AWHB 2ODQA 3P8NA 1VCQA 1TPAE 1AVXA 4Q7ZA 1D9IA 2UWPA 1FQ3A 2ZFQH 1C1VH 1SLWB 3LDXH 3M7TA 2Q1JA 1L0ZA 1ZGIA 1IQEA 1DX5M 1JOUB 5FXLA 1VGCB 3KEEA 4MNXA 1O2WA 1C5PA 2HPPH 3A7YA 4MG3A 5DP8A 5E2OA 1CHOF 4O03A 3RP2A 3HKIB 3ZV8A 1DVAH 3TJVA 4DG4A 4KKDA 1TPSA 1HAXB 1GHBF 1T8NA 1YF4A 1P11E 4AB9A 4ZUHA 2G5VA 4MDSA 1G2MA 3D23A 1TABE 1GHWH 3M3VA 3U1JB 1QBOA 2PHBA 4JZEH 3BTDE 3A86A 3DHKH 1GMDG 1UTNA 1VR1H 1FPHH 3SGAE 1V2VT 2AIPA 4X8VH 1BZXE 3ZZAA 2P3FH 5DP3A 5GCHF 2WPHS 3V12A 1PQ7A 2GCHG 1NRQH 3F9EA 3DT0H 4FUBA 2EEKA 4CHAC 1OYTH 5L2YH 2ZHQH 1BDAA 4GAWA 2WYJA 2JH5D 1SR5C 1QJ6B 3R3GB 3FZZA 4ZXYH 1P2QA 2BLVA 2CN0H 5J4QA 1HDTH 1BMAA 1TBQH 3GY2A 3OX7U 1EAXA 7GCHG 1PPBH 2G81E 2ZGHA 2XRCA 1W12U 2O8TA 2ZFRH 2HRVA 1DSTA 1HYLA 3NKKA 2HVXA 2RDLA 1JIMA 4IN2A 1TGTA 1TGCA 2W7SA 1C2HA 5TJXA 4ZMAH 5GIBA 4KTCA 4X2YA 2ULLA 1HPGA 1W7XH 3EQ0H 2FDAA 2ZWLH 5EXLA 1FNIA 2JH6D 5T3HA 3ZZDA 2ZFTA 2HNTE 2Z6BD 3RXRA 3SW2B 2AIQA 3K6YA 3UUZA 1AKSB 5E8EH 2Z9JA 3ZVCA 1EPTB 2RG3A 1NO9H 2BDBA 3PLPA 4INHA 1BRCE 2HGTH 1AUTC 3MH4A 2HLCA 1ZOMA 3BIUH 1S81A 2F9VA 1QCPA 2B7DH 3AAVA 4Q80A 4O3UA 1EKBB 1UVTH 1BITA 3TVJB 3QTVH 1WOFA 1C2MA 4U2WA 3MU4A 3STIA 4A1TA 1O2YA 1A7SA 4BAOB 4ZH8A 3G01A 1AO5A 1FUJA 2OD3B 4O3TA 1HIAB 1QRXA 2P93A 2PWXA 4OGYA 1UTLM 3BIVH 3A8BA 4FU9A 1P8VC 3EGKH 2VIQA 4MLFB 1O5GH 1CGHA 2STBE 5HM2A 4R8TB 1CVWH 5FAHA 4X1QU 1GJ8B 1SB1H 1UTKA 4BXSA 1MU8B 2VIDA 1WYKA 5C67A 3P8OA 4ZKRU 1QTFA 1RRKA 3QZQA 1C1QA 1IOEA 2TGAA 4BAKB 1NU7B 4B75A 1J8AA 1D6WA 1EB1H 1ELAA 2FOMB 2TRMA 4KTUA 1BHXF 3PYHA 4KELA 1OP0A 1HXFH 1SQTA 2BY6X 1UVUH 2F9PA 1HJ8A 3RXUA 1LKBA 3SGQE 1O2KA 4GCHF 1ZHRA 4U32A 5DP7A 1XXFA 2J92A 3T25A 5GXPA 1NTPA 1ANCA 3ATWA 4X2VA 3BEUA 3NCLA 3L3TA 1DXWA 2A31A 2FO9A 1NPMA 1G3DA 1TPOA 1P2KA 3KF2A 2UUJB 5GDSH 1C2DA 1C4V2 1CT4E 3LJJA 1CBWB 1LKAA 4F49A 1AIXH 5DP9A 1RIWB 3LH3A 1ESAA 4OS7A 3E16B 2ZU5A 2ZGBH 1O2LA 4BAHB 2NU0E 3FP6E 5DK1A 2Y7XA 5F03A 3SJ8A 4Y8XA 2DE8A 5AFYH 2CV3A 1O3LA 2VGCC 3O8DA 1C5LH 2IOTA 4ISIH 4ESTE 2Q6FA 1IAUA 1PPZA 4YO9A 2STAE 1C2GA 8LPRA 1LVMA 4Y10E 1C2EA 2GZ9A 4Y71A 1AZZA 1ELVA 2A32A 3CP7A 3RC6A 1IQNA 2PKSC 1C1MA 2ODPA 4OGXA 4E06H 1FIZA 1G3BA 4J1YA 1UMAH 2DUCA 2FMJA 1ZRKA 1MAXA 1TIOA 3RUOA 4MVNA 4DCDA 1FY4A 1NC6A 1V2JT 1MKWH 2D1JA 1K22H 3A82A 4VGCC 3MHWU 4NA9H 7GCHF 1GMHF 3AVZA 1CU1A 4ISOA 1IQFA 1F5KU 2PGBB 4FUEA 4OS5A 6ESTA 4Y0YE 1LCYA 2GV6A 1OPHB 2GCTB 1O0DH 1WCZA 2XWBI 1VITH 3QO6A 2Z3DA 1GBTA 2ILNA 4X1PU 1A3EH 2H5DA 1F7ZA 3T28A 2VVCA 3GY7A 5JDUB 1A5HA 1MKXH 3PO1C 1BTZA 1O2GH 2GTBA 3SN8A 1MTWA 3SZNA 3RLYH 4H6TA 1ETSH 1INCA 2ZU1A 3JZ1B 5FCRA 1C9PA 3S0NA 1NRNH 3ZVEA 4CR5A 1J9CH 1SGNE 2ZFPH 3KN2A 1RGQA 1S85A 1AB9B 4UD9H 1E0FD 1DY8A 2ZDNA 1O3AA 2QY0B 2BVRH 1VJAU 2JETB 2OQUA 4OS6A 2PGQB 4FUDA 2QIQA 3Q76A 4NWKA 1O3CA 1C5XB 5IDKA 3SU1A 3KQCA 4CBNA 1GG6C 4FVBA 1GGDB 4ZAEA 4I33A 1EOLA 2FP7B 5HGGA 3ZVBA 2SGPE 1O5DH 4TWYA 1OWJA 1GHZA 2O8MA 2GMTC 1HJAB 2XBVA 5DJ7A 1ZMLA 4B71A 4CRBA 2SNWA 3SI4H 1MH0A 3E90B 2HWLB 1ELDE 2FOGA 4JYVH 1V2NT 2FXRA 1GI7B 3D65E 1GJBB 1O2JA 2BXTH 3FP7E 4XE4A 4ABDA 2ZPQA 1KSNA 4Y7BA 2XYAA 2G8TA 4CRDA 1WSSH 1SG8B 1QBNA 1Q2WA 1FAXA 3O8BA 1ESTA 3PM3A 5CE1A 1DWDH 3A89A 1P05A 2C8WB 3Q3XA 4BTIB 1O32A 3PTBA 1O2MA 1GJ5H 2BDAA 1JRSA 3KHVA 4OS2A 4H6SB 5LPFA 1TMUH 3LJOA 5DP6A 1LO6A 1TQ0B 3SHCH 3LPRA 3V3MA 4IN1A 3KQDA 2XBWA 2ZP0H 1LHDH 3EE0B 2QYIA 4FUFA 1HRTH 1RS0A 3K2UA 3A7VA 1TA2A 5FPSA 5A8ZA 4I8KA 2V0BA 3SUDA 2J9NA 2W3IA 1YM0A 3SU0A 1QRWA 4WMDA 3DA9B 7LPRA 1GHAF 1BHXB 2VINA 4RN6A 1H9IE 3STJA 1ANDA 2ZDAH 4ZHLU 2K1QA 3ZVDA 1TNJA 1B0EA 3BV9B 1SLUB 1V2WT 1T4UH 4NIXA 3F68H 1XUKA 1W10U 2PTCE 2PTNA 2H5CA 1IQGA 1WAYB 1K1JA 1FV9A 1GL0E 1N6XA 2BY8X 3GCTG 1S5SA 3QTOH 1LPZB 1N1LA 1PPEE 1UK3A 2TGPZ 4KGAA 2CF9H 2EI7A 1ZSLA 4YOGA 4TPIZ 2FWWA 1QRZA 3LONA 2BHGA 3M36A 2J95A 1Q31A 2F3CE 1GBEA 2GDDA 2GGVB 1CHOG 3B23B 2PV9B 3A8AA 3HKJB 1O3PB 5G4BA 2AERH 1ZLRA 4KTSA 2BD3A 2ZHWH 3TJUA 3V0XA 5A8YA 1GHBG 4TY7A 3VEQB 1TX8A 1NU9A 4NSYA 1B7XB 5EQSA 2RCEA 5T6FA 5E0JA 2F9BH 4BOHA 1T32A 1SGCA 2AS9A 2FOCA 4NFFA 2A45B 3NWUA 4BXWA 1O2VA 2FS9A 5GWZA 1AZ8A 1SGFA 2CJIA 1TLDA 2O8UA 1GI1A 1UK4A 4WXVA 2P94A 1P02A 1ZTLA 4AFZA 4AX9H 3TIUA 3WY8A 4JK5A 4B2AA 4HI3A 1DITH 1AFQB 3GDUA 3RXCA 3TGIE 1O2ZA 3VGCB 4B74A 4DIIH 2C4FH 1B0FA 1E34B 4MPVA 2OTVA 1C1NA 3RXOA 2QXJA 1J16A 4I31A 1BBRK 2WPLS 1EJNA 2ZDMA 3MH6A 3RXDA 4AZ2B 1MUEB 1BTWA 1O2UA 5HM9A 1G2LA 3FAOA 1FY1A 4BTUB 2HNTC 1GBLA 4HTCH 1K21H 2BLWA 2QA9E 2ZPSA 2TBSA 3SI3H 4SGBE 1P2MA 1NRSH 2FOAA 4GUXA 3M5MA 1O2TA 4HGCA 3SJKA 5FPYA 1IHSH 3RU4T 4YM9A 2BTCE 1EZXC 2ANMH 1N8OC 1DUEA 2W26A 1P2OA 1QY6A 2A4OA 3UR6A 2A0QB 1C5ZB 2F83A 2ZKSA 1TMBH 1P57B 1TRMA 1P09A 3RXKA 1XM1A 4CH8B 4UONA 3H7OA 4D7FA 1P10A 2XC5A 2XC0A 1O37A 2ZCLP 2ZEBA 2LPRA 1EZQA 1MCVA 1NFXA 2G00A 1GCTC 4WVPE 3M5NA 1ZJDA 3TLOA 1YPGH 2BDGA 1Y3UA 4K8YA 1C5WB 4WF8A 1ZHPA 1HNEE 3MNBA 1C5YB 1FN6A 3IG6B 1D6RA 3ATLA 1A0JA 1TNGA 2P95A 2SNVA 1GBDA 4A1VA 2A4RA 1TRNA 2ZGCA 1TGBA 2ZNKH 1EZUC 3A87A 1NRPH 3GCNA 4Y0ZE 1GI3A 3QLPH 1JIRA 1GI8B 1YGCH 1C5VA 1MZDA 1IQHA 2G4UA 2OINA 1Y59T 4X1NU 2GT8A 2SFAA 1A4WH 3PB1E 1OP8A 3ZZCA 1WQSA 3MWIU 1C2IA 4K8BA 1Z8IB 2ZIQH 3OY5U 3SNAA 2BX4A 1HAGE 2SGQE 1XX9A 3GCOA 5IYTA 2UWOA 3GISB 2XTTB 2UWLA 4YTAA 3BTTE 1MBQA 1QURH 1BMMH 4D9QA 5I46H 1ORFA 1NFUA 2ZCKP 1JBUH 4WWYA 4I8LA 2R9PA 1ZYOA 3GCTF 4NZQA 4ZKOU 1TAWA 3GDVA 1Z1IA 2WPMS 3T26A 4CHAB 1FXYA 4U01A 2P8OB 1V2RT 5FBIA 4FUCA 4AOQA 2QN5T 1A5IA 2VWLA 4CRGA 2VVUA 1LVBA 2ZPRA 5FX6A 1QIXB 4K60A 2CGAA 4AYVB 1BT7A 3SOSA 1AE5A 1UJ1A 1UTQA 2ZDVH 1GJ6A 1HAHH 1SI5H 4UDWH 2XNIA 2AMQA 1FONA 2NU2E 3TGJE 2OC7A 4TWWA 1O5CB 1PPFE 4NG9H 2EI8A 1HAIH 1GBHA 3CS7A 3RXFA 2ZHFH 2ANYA 2BD9A 4K69A 3SGBE 3BTME 2EI6A 3SV9A 2AMDA 3ZZBA 3TPIZ 3O8RA 1KTTB 3HK3B 3A80A 3RXVA 3P6ZB 5JB8S 2H6MA 4GVUA 3HPTB 1Z6EA 2J4IA 3R0FA 1V2UT 3CS0A 1VJ9U 1C1RA 1GI2A 1GMHG 1Y3VA 5LPEA 3ZVFA 3ZZ5A 3GCHC 3F9GA 2QXIA 3S9CA 4JMYA 3C1KA 1L4DA 1O5EH 4JCNA 2ZHEH 2I6QA 4FUHA 3TH3H 3UOUA 4XBCA 4IBLH 2ZQ2A 1GHVH 2C90B 4K2YA 4WMEA 2JKHA 4Y11E 3SU2A 3VPKA 1EB2A 5FCKA 1SOTA 3MYWA 3SHAH 3UQOA 1BCUH 3MO9A 1O3BA 1ETTH 4GLYA 3VB4A 2G5NA 3TNSA 5L6NH 3SUEA 4I7YH 1HBTH 1DWBH 3K6ZA 4I8GA 4UE7H 3E3TA 4DOQA 2PUXB 3OU0A 4X8UH 1NZQH 4DIHH 3KQEA 1C1OA 5FHTA 1BTUA 2QAAA 1ABJH 2R0KA 3JZ2B 4HZHA 3T5FH 2AYWA 3C27B 4A6LA 4QT8C 1EQ9A 3TJNA 1UTJA 1S6HA 1HFDA 3QX5H 1TE0A 3ODFA 1SGDE 5C1YA 5A0AE 5BRRE 2BX3A 1C9TA 1QFKH 1MU6B 4FXGH 5DP5A 4UFFH 4ZROA 1HJ9A 1EASA 1KXFA 3CENA 4LXBH 2QC2A 3LGWA 3RMOH 1EOJA 1W0YH 1S0QA 3MH7A 1CE5A 6CHAC 3SUFA 3RMLH 1SLVB 4NA7A 1LHGH 8ESTE 4M7GA 4BNRA 2VH6A 1GVLA 2FOBA 2XCFA 1PYTC 1C1SA 5K7RA 1W2KH 2ZA5A 1FIWA 2VB0A 1KXEA 1F0SA 4DT7B 1ZSKA 3MNXA 3M5OA 1YPHE 2CMYA 1WBGB 1EPTC 1O3HA 3RXAA 2QXHA 2NU1E 1ZPZA 1C2JA 4D8NA 1HAPH 1C5MD 1TNKA 4J2YB 1Z71A 3SU4A 1YP9A 2VGCB 1DLEA 2P3UB 1DOJA 1KTSB 3M61U 1ELFA 3QDZB 4BTTB 3SQHE 2Y81A 3TK6A 4ABAA 4YZUA 1KXCA 1HAVA 1VZQH 2XBYA 4MPWA 3VB6A 1ZPBA 5F8XA 3UIRA 1AWFH 4X8SH 1GHAG 1P12E 2PKSB 1O31A 1W11U 4NCYA 1GDQA 2GKVE 1AY6H 2VWNA 4XBDA 2ZGJA 1UCYK 4DW2U 4I32A 4SGAE 4MNVA 1AD8H 2BVSH 4X2XA 4K1SA 4JZIA 1W7GH 4A92A 3A7TA 4VGCB 3M3TA 2BY5X 1FY3A 1SHHB 1EAIA 1ZPCA 2ZGXH 3L33A 4AN7A 1UHBA 1SBWA 5SGAE 1W3CA 1CA0C 2Z9LA 3HGPA 4ZKSU 4GHTA 4ABIA 3ZZ8A 1CGIE 5JBCS 2GVFA 1FI8A 2Y6TA 2FX6A 1UTPA 1THSH 1KDQA 3RXHA 2BDIA 8GCHF 1SGYE 1QJ7B 1KLTA 1THPB 3A8DA 1G3CA 1SOZA 1FPCH 4A7IB 3TITA 5DO4H 1DM4B 1YBWA 2FPZA 3VXFH 5LPRA 4JZFH 3GY6A 2GZ8A 3MU1A 2ZU3A 1GVKB 3EA9A 3SV6A 1LHCH 4JYUH 3A88A 1C1UH 1P06A 1NN6A 5EW2H 2OP9A 1G9IE 3LC5A 2A5AA 2Y80A 1PQAA 2OLGA 4DGJA 1FN8A 1SGFG 1H8DH 1W14U 1HAZB 1LHFH 2WYGA 1BRUP 1EAUA 2BOKA 3RXSA 1GG6B 4F4OC 4ZKNU 2VWOA 1T8LA 4B2CA 1C2FA 2C8ZB 1XUJA 1DWCH 3QN7A 5T6GA 2NU3E 4A5TS 2GMTB 5FBEA 1CT2E 2SGEE 3ZV9A 3P17H 1O2SA 4RSPA 2ODYB 1GBBA 1TBZH 1AVGH 3KL6A 4UFEH 1TNLA 2ESTE 2Z9GA 1N6YA 1QL8A 1AUJA 2EA3A 1FLEE 4CR9A 4LZ1H 1CSOE 2ZFFH 3GICB 1GJDB 2AGGX 1AHTH 1BTYA 3FANA 5EG4A 3RXJA 1JXPA 1QA7A 1QGFA 3MNCA 2XBXA 2WPKS 5C2ZA 1UTOA 3HGNA 1AFEH 4XSKU 2W7UA 1DT2A 1GI5A 3RXMA 2Y5HA 3UWIA 3BG4C 3TH4H 2GCTC 2A5IA 1NT1A 1GJ7B 5ETXA 3E0PB 1TONA 1NESE 1EJMA 4ABFA 4ZHMU 1O2RA 4B1TA 1GBJA 4X8TH 1ZR0A 1OWKA 3KGPA 5HMAA 3LH1A 3ODDA 3T62A 1EATA 1ZGVA 3MO6A 1X7AC 2V35A 3BSQA 1SGQE 5F8ZA 1D3DB 1ELEE 4ZXXH 1H4WA 5DKMA 2B5TB 2ASUB 7KMEH 2ZO3H 3U1IB 2WV5A 3S7KB 1F0TA 1V2MT 2A7CA 2OBQA 2TIOA 4LZ4B 1L1JA 1BBRH 2JETC 1NM6A 2W3KA 3KIDU 4Y79A 1B5GH 1KXDA 3PMBB 5C5OA 3SJOA 4DY7B 1LMWB 5PTPA 4YESB 3D62A 3QWCH 2PSXA 1P0SH 3E1XB 5E0GA 3A83A 3ATKA 1GDUA 3URDA 4IW4E 4AYYB 4Y8YA 3PWBA 1RTFB 1OOKB 1HV7A 4IMZA 2V6NA 5JYIA 1C5SA 4H42U 3GY4A 1ABIH 1O3GA 2GZ7A 2IJOB 2Z9KA 3E0NB 1A5GH 2VIWA 4K3JA 9LPRA 1TX6A 2B8OH 1MBMA 3I77A 1SLXB 3PLBA 3GYLB 1BMLA 2ZI2H 1F2SE 1HAVB 2Z3CA 1V2LT 3RXLA 1PJPA 5C5NA 4D9RA 2BZ6H 3H7TA 3M7UA 1K1PA 5HXFA 1K2I1 1BJUA 1GI9B 4WH6A 3TNTA 3GY8A 3UNRA 1BTHH 1EP5A 2FTLE 5C20A 5CMXH 5EOKA 1TRYA 1WUNH 3A7ZA 5DP4A 4ABBA 4Q2KA 1T8MA 1ESBA 2QV1A 1YPEH 3E6PH 1BUIA 3SJ9A 1TFXA 2XWAA 1MTNC 2G4TA 1W13U 4FVDA 1UHBB 1Z8JB 2CHAB 5A8XA 1JMOH 1HCGA 1H8IH 4Q7XA 4NIYA 1KXAA 3LGUA 2RA3A 3B8JA 1MD7A 1C4Y2 1SPJA 3T2NA 2JH0D 1O3DA 3KQBA 1TA6A 4YT6H 1O2QA 1DE7H 1Y5UT 3AASA 3SU6A 1N8OB 1KDQB 1MZAA 4ABGA 4HFPB 1AMHA 3A85A 4IC5A 1QB6A 3GY3A 2G51A 1ZJKA 1H9HE 2Z7FE 1ANEA 1AVWA 1YPJH 3I78A 3P70B 3FZDA 2P3TB 1MQ6A 1SGIB 3LGYA 1UCYE 2O8WA 1SSXA 1TWXB 4XBBA 3MH5A 1C1WH 5AVDA 3ATMA 1OKXA 5EQRA 3UREA 4OS4A 3BN9A 3PLKA 4INKA 1GCTB 3RXTA 1QHRB 1YCPK 1XUGA 1KXBA 1WQVH 3BTGE 3RLWH 5LGOA 1AN1E 1LQEA 3EA8A 3PTNA 1O39A 1TX7A 1TB6H 3KCGH 3RC5A 2Y5FA 3MI4A 1BOQA 2BQ6B 3SBKA 1O35A 1K1MA 1DICA 1SGRE 4MPUA 5C1UA 6GCHG 2GV7A 2NWNA 1NFWA 3U98H 1QL7A 2A7JA 2FI3E 1CA8B 1K28D 1OP2A 1YLDA 1J14A 1GDNA 1RJXB 2AH4X 3LGVA 1AFQC 1Y3YA 3MU5A 4FUIA 1TALA 3UQVA 3OSYA 1SGPE 2WPIS 3P95A 2IPHA 2UUFB 2H2ZA 1QA0A 2QGRA 2D2DA 3BG8A 1EX3A 1D4PB 1VCWA 2FZZA 1C5UA 2WUCA 2YOLA 1IQJA 3UOPA 1GJCB 2SGFE 1AGJA 3FVFB 5CHAC 3RXIA 1FJSA 5JBAS 3PMHB 1C5TA 1ZZZA 1ZTKA 3MNSA 2BD4A 2CF8H 4RKJB 1YPHC 1ELTA 1H1BA 3Q77A 2FYRA 2VNTA 1BB0B 1FDPA 4XDEA 4TY6A 2QXGA 2BY7X 3D49H 1BJVA 4YLUA 1YPMH 1LVOA 5FPTA 1F0RA 1ZSJA 4X6PA 1IQIA 2G52A 2VWMA 4NSVA 1C1TA 4NZLA 4JZDH 2FODA 5F8TA 2G55A 4WJG2 3OYPA 4UFGH 3F9HA 1IQMA 5ESTE 1XVOA 1DWEH 3ENSB 1O2NA 3DFJA 2J2UA 2HPQH 3LIWA 1DSUA 1OXGA 1S84A 2BD5A 3K65B 3SO3A 3QGJA 2Y5GA 3RU4E 2C8XB 5I25A 1PYTD 1QQ4A 3V13A 3V7TA 3RMNH 1VITG 5GJ4B 5L2ZH 1LDTT 1PQ8A 1K1IA 1O3FA 2IN2A 1IQKA 2ZC9H 3BEFB 1SGTA 1Y5AT 2TPIZ 1AE8H 1P2NA 1RTKA 1A1RA 2O9QA 1FZZA 3GCHB 2H1UA 1V6DA 1K9OE 4CH2B 3B9FH 1GL1A 5EQQA 4CREA 2BB4A 4Z0KA 3NPSA 1TOCB 1Z8RA 4OS1A 1G36A 1GMCF 3BF6H 2KAIA 3QK1A 3O8CA 1MTVA 3PMAB 3MFJA 3RXGA 2Z94A 4WH8A 3SU5A 2YNAA 2BMGB 2NU4E 3BTQE 1HAYB 8GCHG 2ZF0H 4D76A 1CQQA
chains in the Genus database with same CATH superfamily
4DJZB 1EZSC 1O5FH 5EIYA 1EAWA 2BDHA 2BLQA 4F48B 1WTHD 2ZU4A 1UVPA 1DXPA 1XUFA 2FS8A 3PWCA 4ASUD 1D3TB 3M35A 2C3SA 4AFUA 2THFB 1Y8TA 1VGCC 2P8OC 1VCPA 3IWMA 2H9TH 4E7RG 1YC0A 4NIWA 4MNWA 1GJ4H 3ZIAD 2SGDE 1GWAA 1UO6A 2O8LA 3LOXA 1OSSA 2F9OA 3PV5A 2BYAX 1QBVH 1UCYH 2R3UA 2YMSD 3SV2H 3AK5A 1QQUA 7ESTE 2R0LA 3IITA 3SYJA 3EAJA 1NS3A 1T7CA 3LKWA 3NK8A 1U6QA 6CHAB 2LNCA 1GBFA 1LPGB 4AB8A 2ZCHP 4NWLA 2C93B 3ITIA 3KQ5A 6GCHF 4JK6A 4I86A 1SFIA 2XCNA 4I8HA 2DE9A 4WY3A 1ZTJA 1FY5A 4O97A 1OWHA 1GVZA 3BTKE 3DFLA 2YNBA 4E05H 1UTMA 3Q00A 1KIGH 3URCA 1O2XA 3GY5A 2A2XH 1HAOH 4MQAA 1GJAB 2OCVB 2ZQ1A 1V2ST 5C0TA 2UUYA 5TCAA 2J94A 1XMNB 5A09A 5ABWA 5KEDA 1GJ9B 2CXVA 1G3EA 4XFQA 2GDEH 1ID5H 1QNJA 1YPKH 1L1GA 5F53A 2ZDLA 1O3KA 3S9BA 2BD8A 3TU7H 4AG1A 3BTFE 3UR9A 3F9FA 3LU9B 1TYNA 3U69H 1PPHE 2AEIH 4K1EA 4Y8ZA 3H09A 1V2TT 4ASHA 2BXUH 2Q6DA 1A2CH 2GT7A 3L6PA 1AQ7A 3M37A 2TGTA 3ZZ6A 2Y82A 1BRBE 1BBRE 1V2OT 1AI8H 1WTGH 1G32B 4AFSA 4ABHA 3PMJA 2BQ7B 3SNCA 1TMTH 2WV4A 1CA0B 5IK2D 1Y3XA 2J38A 3E8LA 4MPXA 1T31A 2A7HA 1A46H 1O34A 1C1PA 1C2LA 3A7WA 4Q4LA 4D7GA 2FX4A 2WINI 5AFZH 1V2PT 4JZ1A 4TPYA 2ZDKA 3T27A 3UNQA 2YMSB 4Y7AA 3HK6B 2Q6GA 2R2WU 3RDZA 3U9AH 4U30A 3UNSA 2FEQH 1L2EA 2ANWA 3DD2H 5GPIB 3GYMA 1YKTA 1THRH 3M7QA 3ZZ3A 1WDIA 4K1TA 1J15A 4ACAA 4YOIA 1KLJH 3PROA 1VITF 1PFXC 5EGMA 1O5BB 3A7XA 3QUMP 1QR3E 2ALPA 2ZHDA 1RD3B 5AHGH 3BTHE 2AGEX 3ZYDA 1GHYH 3A84A 4DURA 1BMNH 4UFDH 4R0IA 2H9HA 1KYNA 1O5AB 1GBCA 1L1NA 4CBOA 4AORA 1IQLA 4RKOB 1NY22 1E37B 3TJOA 2HNTF 2VH0A 3DSOA 3LGTA 4YT7H 1C5QA 1K1LA 3U8TH 1S83A 2TGDA 3PO1B 1TBRH 4X6OA 4B76A 1BA8B 3F1SB 1OX1A 2XW9A 1XUHA 5E0HA 1HLTH 1ZMJA 1P9UA 1F92A 4A1XA 2AMPA 5EW1H 3A81A 1RXPA 1LHEH 4K5ZA 1Z1JA 1GMDF 1E38B 2F4LA 1O3IA 2HOBA 2BY9X 4Y6DA 4LK4A 4PROA 4THNH 1TGSZ 2GCHF 1F5LA 3OAAD 2OBOA 2ZG0H 2FYQA 3UPEA 1CBWC 1DANH 3S9AA 1RIWC 3RU4D 1A61H 1F0UA 3P8GA 1O2IA 1MCTA 2ZU2A 3MU0A 2OQ5A 3OE7D 1O2PA 2OC0A 3NUMA 4JYTA 2KAIB 5KECA 1Q3XA 2V3HH 3LGIA 4ABJA 1SHYA 1FMGA 2OXSA 1T4VH 2L74A 3UWJH 1L4ZA 1ETRH 4GPGA 1D3PB 4YLQH 1DFPA 1HB0B 4ISLA 5ESBA 2Y7ZA 4X6NA 2VIPA 1OS8A 2GD4B 3FFGA 5LH8A 2BOHB 1DPOA 3BG4B 3VFEA 2SGAA 2B9LA 2PUQH 4UEHH 3VB5A 3ZVAA 2WPDD 2WSSD 2P16A 4KP0A 4XOJA 3S69A 3OY6U 3MTYA 2ZZUH 1XVMA 1O2HA 1UVOA 1W0ZU 1UVSH 2AGIX 3RM2H 1DLKB 4AGKA 1QJ1B 1Z7KA 1OWIA 3SV8A 1LPKB 5K0HA 2A1DB 1JWTA 1HXEH 1C5NH 1Z8GA 1XKBC 4NGAH 1PQ5A 1T8OA 1OHHD 1IHTH 2D8WA 2W5EA 1DDJA 3QZRA 1O3JA 1P3EA 1P3CA 1S0RA 3SQEE 3W95A 2QCYA 4BANB 5BPEA 2RA0A 2BD7A 4I8JA 1BRAA 3NZIA 1ARBA 3AW1A 3RXPA 2L6OA 2FOEA 1LQDB 4Z6AH 5B6LA 1MTSA 3SNEA 1O3EA 1OWDA 1V3XA 4FUGA 1GPZA 3RXEA 4B6EA 1M9UA 1SFQB 4ABEA 2OC1A 2C8YB 1G30B 1ELCA 2D26C 1EUFA 1AB9C 1MMJN 1C4U2 1NFYA 2PLXA 3P8FA 3I29A 4B2BA 2XC4A 1GI0A 2R2MB 2BQWB 2V3OH 3F2FA 4WMFA 1WV7H 5F6MA 1EJAA 1BMFD 2PKAA 2PSYA 4IGDA 3MO3A 1GBMA 4LOYH 4CRAA 2OC8A 3TK5A 2J98A 2Z9IA 4GSOA 1C5OH 1UK2A 1YCPH 1GGDC 1MKWK 2ZECA 4X1SU 1ZHMA 2FLRH 1O33A 2FTMA 1HJAC 1S6FA 2IJD1 3LT3A 3DUXH 3U8OH 4X1RU 1ELGA 3TGKE 3SUGA 3BEIB 4H4FA 3RXQA 2QF3A 2R3YA 4ISHH 1MTNB 2HALA 2PW8H 3ZVGA 6LPRA 2F43B 1P9SA 2BDCA 1PPGE 3H5CB 3ESTA 1MD8A 1MKXK 3BTWE 1V2QT 3Q3YA 1SQOA 1TPPA 5TCCA 1GBIA 1A0LA 4NA8A 3RC4A 2ZTZA 3P92A 1CO7E 2F9NA 5B6OA 4YOJA 1E35B 2Z3EA 3PV4A 2P59A 1GBKA 2FOHA 1SMFE 2PFEA 1W8BH 1YYY1 1P03A 5EXMA 5AF9H 2H9EH 3BTEE 3UFAA 1QB1A 1BQYA 1CGJE 1KY9A 2VBCA 3GOVB 4WXIA 5A2MH 5JBBS 3SNDA 2F9UA 3DSPA 1RFNA 1OYQA 3Q3KA 1XUIA 2F91A 3RM0H 2BD2A 2VJ1A 1GMCG 2JDID 5JBTA 1H9LB 1DUAA 1LVYA 1P2JA 5C1XA 3FP8E 3N99A 1XKAC 1SVPA 2J34A 3ZZ7A 3MQKC 3SV7A 3M5LA 2BZAA 4Y76A 5J4SA 3NXPA 3VB7A 2RFKC 1GBAA 1A3BH 1K1NA 1O3MA 4O9VA 4AFQA 3ATIA 1JRTA 4CRFA 2BDYA 2VIVA 3T29A 5JB9S 2OUAA 2ALVA 1NROH 2BVXH 4TYDA 3ZZ9A 3M3SA 1GCDA 1D3QB 5GCHG 1O38A 2FM2A 2FIRH 3FO8D 2KCOA 2WUBA 2FESH 3S7HB 2WV9A 1MTUA 5DGJA 4GHQA 5EPNA 1TQ7B 1H8ED 2BM2A 5EODA 1C2KA 4BAQB 3A8CA 3KNXA 1AKSA 5H4IB 4BAMB 1EPTA 3RXBA 2FOFA 1ZMNA 4NFEA 1FAKH 1BIOA 1XXDA 1MAYA 5DG6A 2VIOA 1ELBA 2A4GA 3EYDA 4ISNA 5L30H 1QB9A 3AW0A 3MU8A 2B0FA 4X0WU 1ZRBA 1TNHA 1OWEA 1O3NA 2M5TA 1HUTH 3ELAH 5A0CA 1DY9A 1KLIH 5E2PA 3TH2H 1ARCA 3LC3A 1YCPM 5CHAB 3AAUA 3EA7A 4MTBA 1HIAA 2VU8E 3EDXB 3K9XB 2CHAC 2GP9B 3RMMH 3SORA 4IMQA 2WPJS 2QF0A 1Y5BT 1CT0E 2A2QH 1E36B 2VVVA 4IS5A 1S82A 5DPAA 2ANKH 4FU7A 4E7NA 3MMGA 1YLCA 8KME2 1GHXH 2PR3A 3VGCC 3SU3A 3GDSA 4Q7YA 4IC6A 3E91A 1C5RA 3ZZ4A 1Y3WA 1SQAA 1TGNA 3OTJE 3TK9A 1GI4A 4DVAU 1SGEE 1TOMH 1LTOA 1SC8U 1RTLA 3VXEH 5T6DA 4AGJA 2UUKB 2FI5E 4ZCNA 1BTPA 2XXLA 3QGNB 1J17T 2I6SA 2ZFSA 3GS9A 1PPCE 2BLOA 3SZEA 1Z6JH 1YPLH 5HYOA 2FI4E 2GX4A 4ZHAA 4AG2A 1O36A 1K1OA 1SL3A 2EC9H 4INLA 1BTXA 1W0KD 1EP6A 2A5KA 4B73A 2ZTYA 1MQ5A 1GI6A 3U8RH 1O3OA 2AFQB 5EU8A 3W94A 1P01A 1O2OA 2KR7A 1AU8A 1HGTH 4FU8A 2ZTXA 2A4QA 1ANBA 4NIVA 3UTUH 1O30A 3N7OA 3HATH 3VB3A 3SJIA 1P04A 1F5RA 1ACBE 3SNBA 3MOCA 1EXFA 3OTPA 5FX5A 9ESTA 3F6UH 1G37A 4X2WA 4FUJA 5EXNA 3UY9A 1WU1A 4X6MA 1NRRH 1TNIA 1CHGA 1QL9A 3ZYEA 2KM0A 1DS2E 1V2KT 4GCHG 1A0HB 4MNYA 1FY8E 2FLBH 5A0BA 1P2IA 4CRCA 5C3NA 5JPMH 5EPYA 2PKAB 2CK3D 1AWHB 2ODQA 3P8NA 2J98B 1VCQA 1TPAE 1AVXA 4Q7ZA 1D9IA 2UWPA 1FQ3A 2ZFQH 1W0JD 1C1VH 1SLWB 3LDXH 3M7TA 2Q1JA 1L0ZA 1ZGIA 1IQEA 1DX5M 1JOUB 5FXLA 1VGCB 3KEEA 4MNXA 5EJ1A 1O2WA 1C5PA 2HPPH 3A7YA 4MG3A 5DP8A 5E2OA 1CHOF 4O03A 3RP2A 3HKIB 3ZV8A 1DVAH 3TJVA 4DG4A 4KKDA 1TPSA 1HAXB 1GHBF 1T8NA 1YF4A 1P11E 4AB9A 4ZUHA 2G5VA 5C94A 4MDSA 1G2MA 3D23A 1TABE 1GHWH 3M3VA 3U1JB 1QBOA 2PHBA 4JZEH 3BTDE 3A86A 3DHKH 1GMDG 1UTNA 1VR1H 1FPHH 3SGAE 1V2VT 2AIPA 4X8VH 1BZXE 3ZZAA 2P3FH 5DP3A 5GCHF 2WPHS 3V12A 1PQ7A 2GCHG 1NRQH 3F9EA 3F0PA 3DT0H 4FUBA 2EEKA 4CHAC 1OYTH 5L2YH 2ZHQH 1BDAA 4XRNA 4GAWA 2WYJA 2JH5D 5CHBA 1SR5C 1QJ6B 3R3GB 3FZZA 4ZXYH 1P2QA 2BLVA 2CN0H 5J4QA 1HDTH 1BMAA 1TBQH 3GY2A 3OX7U 1EAXA 7GCHG 1PPBH 2G81E 2ZGHA 2XRCA 1W12U 2O8TA 2ZFRH 2HRVA 1DSTA 1HYLA 3NKKA 2HVXA 2RDLA 1JIMA 4IN2A 2KZ4A 1TGTA 1TGCA 2W7SA 1C2HA 2K8IA 3KYGA 5TJXA 4ZMAH 4DT4A 5GIBA 4FETA 4KTCA 4X2YA 2ULLA 1HPGA 1W7XH 5HIZA 3EQ0H 2FDAA 2ZWLH 5EXLA 1FNIA 2JH6D 5T3HA 3ZZDA 2ZFTA 2HNTE 2Z6BD 3RXRA 3SW2B 2AIQA 3K6YA 3UUZA 3NRLA 1AKSB 5E8EH 2Z9JA 3ZVCA 1EPTB 2RG3A 1NO9H 2BDBA 3PLPA 4INHA 1BRCE 2HGTH 1AUTC 3MH4A 2HLCA 1ZOMA 3BIUH 1S81A 2F9VA 1QCPA 2B7DH 3AAVA 4Q80A 4O3UA 1EKBB 1UVTH 1BITA 3TVJB 3QTVH 1WOFA 1C2MA 4U2WA 3MU4A 3STIA 4A1TA 1O2YA 1A7SA 4BAOB 4ZH8A 3G01A 1AO5A 1FUJA 2OD3B 4O3TA 1HIAB 1QRXA 2P93A 2PWXA 4OGYA 1UTLM 3BIVH 3A8BA 4FU9A 1P8VC 3EGKH 2VIQA 4MLFB 1O5GH 1CGHA 2STBE 5HM2A 4R8TB 1CVWH 5FAHA 4X1QU 1GJ8B 1SB1H 1UTKA 4BXSA 1MU8B 1SQRA 2VIDA 1WYKA 5C67A 3P8OA 4ZKRU 1QTFA 1RRKA 3QZQA 1C1QA 1IOEA 2TGAA 2J97A 4BAKB 1K0HA 1NU7B 4B75A 1J8AA 1D6WA 1EB1H 3FKSD 1ELAA 2FOMB 2TRMA 4KTUA 1BHXF 3PYHA 4KELA 1OP0A 1HXFH 1VKYA 1SQTA 2BY6X 1UVUH 2AHME 1HJ8A 2F9PA 1LKBA 3RXUA 3SGQE 3F2GA 1O2KA 4GCHF 1ZHRA 4U32A 5DP7A 1XXFA 2J92A 3T25A 5GXPA 4YXWD 1NTPA 1ANCA 3ATWA 4X2VA 3BEUA 3NCLA 3L3TA 1DXWA 2A31A 2FO9A 1NPMA 1G3DA 1TPOA 1P2KA 3KF2A 2UUJB 5GDSH 1C2DA 1C4V2 1CT4E 2V7QD 3LJJA 1CBWB 1LKAA 4F49A 1AIXH 5DP9A 1RIWB 3LH3A 1ESAA 4OS7A 2EQNA 2LP6A 3E16B 2ZU5A 2ZGBH 1O2LA 4BAHB 2NU0E 3FP6E 5DK1A 2Y7XA 5F03A 3SJ8A 4Y8XA 2DE8A 5AFYH 2CV3A 1O3LA 2VGCC 3O8DA 1C5LH 2IOTA 4ISIH 4ESTE 2Q6FA 5HKKD 1IAUA 1PPZA 4YO9A 2STAE 1C2GA 8LPRA 1LVMA 4Y10E 1C2EA 2GZ9A 4Y71A 1AZZA 1ELVA 2A32A 3CP7A 3RC6A 1IQNA 2PKSC 1C1MA 2ODPA 4OGXA 4E06H 1FIZA 1G3BA 4J1YA 1UMAH 2DUCA 2FMJA 4XD7D 1ZRKA 1MAXA 1TIOA 3RUOA 1E1RD 4MVNA 4OM9A 4DCDA 1FY4A 1NC6A 1V2JT 1MKWH 2D1JA 1K22H 3A82A 4VGCC 3MHWU 4NA9H 7GCHF 1GMHF 3AVZA 1CU1A 4ISOA 1IQFA 1F5KU 2PGBB 4FUEA 4OS5A 6ESTA 2HLDD 4Y0YE 1LCYA 2GV6A 1OPHB 2GCTB 1O0DH 1WCZA 2XWBI 1VITH 3QO6A 2Z3DA 1GBTA 2ILNA 4X1PU 1A3EH 2H5DA 1F7ZA 3T28A 2VVCA 3GY7A 5JDUB 1A5HA 1MKXH 3PO1C 1BTZA 1O2GH 2GTBA 3SN8A 1MTWA 3SZNA 3RLYH 4H6TA 1ETSH 1INCA 2ZU1A 3JZ1B 5FCRA 1C9PA 3S0NA 1NRNH 3ZVEA 4CR5A 1J9CH 1SGNE 2ZFPH 3KN2A 1RGQA 1S85A 1NBME 1AB9B 4UD9H 1E0FD 2XOKD 1DY8A 2ZDNA 1O3AA 2QY0B 2PP6A 2BVRH 1VJAU 2JETB 2V3MA 2OQUA 4OS6A 2PGQB 4FUDA 2QIQA 3Q76A 4NWKA 1O3CA 1C5XB 5IDKA 3SU1A 3KQCA 4CBNA 1GG6C 4FVBA 1GGDB 4ZAEA 4I33A 1EOLA 2FP7B 5HGGA 3ZVBA 1S6LA 2SGPE 1O5DH 4TWYA 1OWJA 1GHZA 2O8MA 3WWBA 2GMTC 3F0OA 1HJAB 2XBVA 5DJ7A 1ZMLA 4B71A 2JIZD 4CRBA 2SNWA 3SI4H 1MH0A 3E90B 2HWLB 1ELDE 2FOGA 4JYVH 1V2NT 2FXRA 1GI7B 3D65E 1GJBB 1O2JA 2BXTH 2JJ1D 3FP7E 4XE4A 4ABDA 2ZPQA 1KSNA 4Y7BA 2XYAA 2G8TA 4CRDA 1WSSH 1SG8B 1QBNA 1Q2WA 1FAXA 3O8BA 1ESTA 3PM3A 4B6FA 5CE1A 1DWDH 3A89A 1P05A 2C8WB 3Q3XA 4BTIB 1O32A 3PTBA 1O2MA 1GJ5H 2BDAA 1JRSA 3KHVA 4OS2A 4H6SB 5LPFA 1TMUH 3LJOA 5DP6A 1LO6A 1TQ0B 3SHCH 3LPRA 3V3MA 4IN1A 3KQDA 2XBWA 2J5UA 1LHDH 2ZP0H 2QYIA 3EE0B 4FUFA 1HRTH 1RS0A 3K2UA 3A7VA 1TA2A 5FPSA 5A8ZA 4I8KA 2V0BA 3SUDA 2WHXA 2J9NA 2W3IA 1YM0A 3SU0A 1QRWA 4WMDA 3DA9B 7LPRA 1GHAF 1BHXB 2VINA 4RN6A 1H9IE 3STJA 1ANDA 2ZDAH 4ZHLU 2K1QA 3ZVDA 1TNJA 1B0EA 3BV9B 1SLUB 1V2WT 1T4UH 4NIXA 3F68H 1XUKA 4RT1A 1W10U 2PTCE 2PTNA 2H5CA 1IQGA 1WAYB 1K1JA 1FV9A 1GL0E 1N6XA 2BY8X 3GCTG 1S5SA 3QTOH 5CDFE 1LPZB 1N1LA 1PPEE 1UK3A 2TGPZ 4KGAA 2CF9H 2EI7A 1ZSLA 4YOGA 4AC9A 4TPIZ 2FWWA 1QRZA 3LONA 2BHGA 3M36A 2J95A 1Q31A 2GJGA 2F3CE 1GBEA 2GDDA 2GGVB 1CHOG 3B23B 2PV9B 3A8AA 3HKJB 1YY3A 1O3PB 5G4BA 1WXRA 2AERH 1ZLRA 4KTSA 2BD3A 2ZHWH 3TJUA 3V0XA 5A8YA 1GHBG 4TY7A 3VEQB 1TX8A 4RT0A 1NU9A 4NSYA 1B7XB 5EQSA 2RCEA 5T6FA 5E0JA 2F9BH 4BOHA 1T32A 1SGCA 2AS9A 2LELA 2FOCA 4NFFA 2A45B 1SKYE 3NWUA 4BXWA 1O2VA 2FS9A 5FL7D 5GWZA 1AZ8A 1SGFA 2CJIA 1TLDA 2O8UA 5C17A 1GI1A 1UK4A 4WXVA 2P94A 1P02A 1ZTLA 4AFZA 4AX9H 3TIUA 3WY8A 4JK5A 4B2AA 4HI3A 1DITH 1AFQB 3GDUA 3RXCA 3TGIE 1O2ZA 3VGCB 4B74A 4DIIH 2C4FH 1B0FA 5KGOA 1E34B 4MPVA 2OTVA 1C1NA 3RXOA 2QXJA 1J16A 4I31A 1BBRK 2WPLS 1EJNA 4RI0A 2ZDMA 3MH6A 3RXDA 4AZ2B 1MUEB 1BTWA 1O2UA 5HM9A 1G2LA 3FAOA 1FY1A 4BTUB 2HNTC 3PRDA 1QZ8A 1GBLA 4HTCH 1K21H 2BLWA 2QA9E 2ZPSA 2TBSA 3SI3H 4SGBE 1P2MA 1NRSH 2FOAA 1FX0B 4GUXA 3M5MA 1O2TA 4HGCA 3SJKA 5FPYA 1IHSH 3RU4T 4YM9A 2BTCE 1EZXC 2ANMH 1N8OC 1DUEA 2W26A 1P2OA 1QY6A 2A4OA 3UR6A 2A0QB 1C5ZB 2F83A 2ZKSA 1TMBH 2QE7D 1P57B 1TRMA 1P09A 3RXKA 1XM1A 4CH8B 4UONA 3H7OA 4D7FA 1P10A 2XC5A 2XC0A 1O37A 2ZCLP 2ZEBA 2LPRA 1EZQA 1MCVA 1NFXA 2G00A 1GCTC 4WVPE 3M5NA 1ZJDA 3TLOA 1YPGH 2BDGA 1Y3UA 4K8YA 1C5WB 4WF8A 3EE7A 1ZHPA 1HNEE 3MNBA 1C5YB 1NBMD 1FN6A 3IG6B 1D6RA 3ATLA 1A0JA 1TNGA 2P95A 2SNVA 1GBDA 1YLNA 2A4RA 1TRNA 2ZGCA 4A1VA 1TGBA 2ZNKH 1EZUC 3A87A 1NRPH 3GCNA 4Y0ZE 1GI3A 3QLPH 1JIRA 1GI8B 1YGCH 1C5VA 1MZDA 1IQHA 2G4UA 2OINA 1Y59T 4X1NU 2GT8A 3N7EA 2SFAA 1A4WH 3PB1E 1OP8A 3ZZCA 1WQSA 3MWIU 2RDEA 1C2IA 4K8BA 1Z8IB 2ZIQH 3OY5U 3SNAA 2BX4A 1HAGE 2SGQE 1XX9A 3GCOA 5IYTA 2UWOA 3GISB 2XTTB 2UWLA 4YTAA 3BTTE 1MBQA 1QURH 1BMMH 4D9QA 5I46H 1ORFA 1NFUA 2ZCKP 1JBUH 4WWYA 4I8LA 2R9PA 1ZYOA 3GCTF 4NZQA 4ZKOU 5DSFA 1TAWA 3GDVA 1Z1IA 2WPMS 3T26A 4CHAB 1FXYA 4U01A 2P8OB 1V2RT 5FBIA 4FUCA 4AOQA 2QN5T 1A5IA 2VWLA 4CRGA 2VVUA 1LVBA 2ZPRA 5FX6A 1QIXB 4K60A 2CGAA 4AYVB 1BT7A 3SOSA 2HVYB 1AE5A 1UJ1A 1UTQA 2ZDVH 1GJ6A 1HAHH 1SI5H 4UDWH 2QF5A 2XNIA 2AMQA 1FONA 2NU2E 4P02A 3TGJE 2OC7A 4HG6A 4TWWA 1O5CB 1PPFE 4NG9H 2EI8A 1HAIH 1GBHA 3CS7A 3RXFA 2ZHFH 2ANYA 2BD9A 4K69A 3SGBE 3BTME 2EI6A 3SV9A 2AMDA 3ZZBA 3TPIZ 3O8RA 1KTTB 3HK3B 4P00A 3A80A 3RXVA 3P6ZB 5JB8S 2H6MA 2KCPA 4GVUA 3HPTB 1Z6EA 2J4IA 3PRBA 3R0FA 1V2UT 3CS0A 1VJ9U 1C1RA 1GI2A 1GMHG 1Y3VA 5LPEA 3ZVFA 3ZZ5A 3GCHC 3F9GA 2QXIA 3S9CA 4JMYA 3C1KA 1L4DA 1O5EH 4JCNA 2ZHEH 2I6QA 4FUHA 3TH3H 3UOUA 4XBCA 4IBLH 2ZQ2A 1GHVH 2C90B 4K2YA 4WMEA 2JKHA 4Y11E 3SU2A 3VPKA 4Z1MD 1EB2A 5FCKA 1SOTA 3MYWA 3SHAH 3UQOA 1BCUH 3DCLA 3MO9A 4TSFD 1O3BA 1ETTH 4GLYA 3VB4A 2G5NA 3TNSA 5L6NH 3SUEA 4FOUC 4I7YH 1HBTH 1DWBH 3K6ZA 4I8GA 4UE7H 3E3TA 4DOQA 2PUXB 3OU0A 4X8UH 1NZQH 4DIHH 3KQEA 1C1OA 5FHTA 1BTUA 2QAAA 1ABJH 2R0KA 3JZ2B 4HZHA 3T5FH 2K0QA 2AYWA 3C27B 4A6LA 4QT8C 1EQ9A 3TJNA 1UTJA 1S6HA 1HFDA 3QX5H 1TE0A 3ODFA 1SGDE 5C1YA 5A0AE 5BRRE 3PV2A 2BX3A 1C9TA 1QFKH 1MU6B 4FXGH 5DP5A 4UFFH 4ZROA 1HJ9A 1EASA 1KXFA 3CENA 4LXBH 2QC2A 3LGWA 3RMOH 1EOJA 1W0YH 1S0QA 3MH7A 3DSGA 5C0UA 1CE5A 6CHAC 3SUFA 3RMLH 1SLVB 4NA7A 1LHGH 8ESTE 4M7GA 4BNRA 2VH6A 1GVLA 2FOBA 2XCFA 1PYTC 1C1SA 5K7RA 1W2KH 2ZA5A 1FIWA 2VB0A 1KXEA 1F0SA 4DT7B 1ZSKA 3MNXA 3FN8A 3M5OA 1YPHE 3WW7A 2CMYA 1WBGB 1EPTC 1O3HA 2W6ID 3RXAA 2QXHA 2NU1E 1ZPZA 1C2JA 4D8NA 1HAPH 1C5MD 1TNKA 4J2YB 1Z71A 2M2AA 3SU4A 1YP9A 2VGCB 1DLEA 2P3UB 1DOJA 1KTSB 3M61U 3CNRA 1ELFA 3QDZB 4BTTB 3SQHE 2Y81A 3TK6A 4ABAA 4YZUA 1KXCA 1HAVA 1VZQH 2XBYA 4MPWA 3VB6A 1ZPBA 5F8XA 3UIRA 1AWFH 4X8SH 1GHAG 1P12E 3UB0A 2PKSB 1O31A 1W11U 4NCYA 1GDQA 2GKVE 1AY6H 2VWNA 4XBDA 2ZGJA 1UCYK 4DW2U 4I32A 4SGAE 4MNVA 1AD8H 2BVSH 4X2XA 4K1SA 4JZIA 1W7GH 4A92A 3A7TA 4VGCB 3M3TA 3OEHD 2BY5X 4Q63A 1FY3A 1SHHB 1EAIA 1ZPCA 2ZGXH 3L33A 4AN7A 1UHBA 1SBWA 5SGAE 1W3CA 1CA0C 2Z9LA 3UAIC 3HGPA 4ZKSU 4GHTA 2QF4A 4ABIA 3ZZ8A 1CGIE 2YMSC 5JBCS 2GVFA 1FI8A 2Y6TA 2FX6A 1UTPA 1THSH 1KDQA 3RXHA 2BDIA 8GCHF 1UW7A 1SGYE 1QJ7B 1KLTA 1THPB 3A8DA 1G3CA 1SOZA 1FPCH 4A7IB 3TITA 5DO4H 1DM4B 1YBWA 2FPZA 3VXFH 5LPRA 4JZFH 3GY6A 2GZ8A 3MU1A 2ZU3A 1GVKB 3EA9A 3SV6A 1LHCH 4JYUH 3A88A 1C1UH 1P06A 1NN6A 5EW2H 2OP9A 1G9IE 3LC5A 2A5AA 2Y80A 1PQAA 2OLGA 4DGJA 1FN8A 1SGFG 1H8DH 1W14U 1HAZB 1LHFH 2WYGA 1BRUP 1EAUA 2BOKA 3RXSA 1YWUA 1GG6B 4F4OC 5DN6D 4ZKNU 2VWOA 1T8LA 4B2CA 1C2FA 2C8ZB 1XUJA 1DWCH 3QN7A 5T6GA 2NU3E 4A5TS 2GMTB 3OEED 5FBEA 1CT2E 2SGEE 3ZV9A 3P17H 1O2SA 4RSPA 2ODYB 1GBBA 1TBZH 1AVGH 3KL6A 4UFEH 1TNLA 3F2HA 2ESTE 2Z9GA 1N6YA 1QL8A 1AUJA 3U28C 2EA3A 1FLEE 4CR9A 4LZ1H 1CSOE 2ZFFH 3GICB 1GJDB 2AGGX 1AHTH 1BTYA 3FANA 5EG4A 3RXJA 5T1VA 1JXPA 1QA7A 1QGFA 3MNCA 2XBXA 2WPKS 3KYFA 5C2ZA 1UTOA 3HGNA 1AFEH 4XSKU 2W7UA 1DT2A 1GI5A 3RXMA 2Y5HA 3UWIA 3BG4C 3TH4H 2GCTC 2A5IA 3WWFA 1NT1A 1GJ7B 5ETXA 3E0PB 1TONA 1NESE 1EJMA 4ABFA 4ZHMU 1O2RA 4B1TA 1E1QD 2KX4A 1GBJA 4X8TH 1ZR0A 1OWKA 3KGPA 5HMAA 3LH1A 3ODDA 3T62A 1EATA 1ZGVA 3MO6A 1X7AC 2V35A 3BSQA 1SGQE 5F8ZA 1D3DB 1ELEE 4ZXXH 1H4WA 5DKMA 2B5TB 2ASUB 2IPQX 7KMEH 2ZO3H 3U1IB 2WV5A 3S7KB 1F0TA 1V2MT 2A7CA 2OBQA 2TIOA 4LZ4B 1L1JA 1BBRH 2JETC 1NM6A 2W3KA 3KIDU 4Y79A 1B5GH 1KXDA 3PMBB 5C5OA 3SJOA 4DY7B 1LMWB 1KMHB 5PTPA 4YESB 3D62A 3QWCH 2PSXA 1P0SH 3E1XB 5E0GA 3A83A 3ATKA 1GDUA 3URDA 4IW4E 4AYYB 4Y8YA 3PWBA 1RTFB 1OOKB 3OFND 1HV7A 4IMZA 2V6NA 5JYIA 1C5SA 4H42U 3GY4A 1ABIH 1O3GA 2GZ7A 2IJOB 2Z9KA 3E0NB 1A5GH 2VIWA 4K3JA 9LPRA 3FOAA 1TX6A 2B8OH 1MBMA 3I77A 1SLXB 3PLBA 3GYLB 1BMLA 2ZI2H 1F2SE 1HAVB 2Z3CA 1V2LT 3RXLA 1PJPA 5C5NA 4D9RA 2BZ6H 3H7TA 3M7UA 1K1PA 5HXFA 1K2I1 1BJUA 1GI9B 4WH6A 3TNTA 2KCAA 3GY8A 3UNRA 1BTHH 1EP5A 2FTLE 5C20A 5CMXH 5EOKA 1TRYA 1WUNH 3A7ZA 5DP4A 1E79D 4ABBA 4Q2KA 1T8MA 5HIYA 1ESBA 2QV1A 1YPEH 3E6PH 1EFRD 4F55A 5GNDA 1BUIA 3SJ9A 1TFXA 2XWAA 1MTNC 2G4TA 3F3BA 1W13U 4FVDA 1UHBB 1Z8JB 2CHAB 5A8XA 1MABB 1JMOH 1HCGA 1H8IH 4Q7XA 3W1EA 4NIYA 1KXAA 3LGUA 2RA3A 3B8JA 1MD7A 1C4Y2 1SPJA 3T2NA 2JH0D 1O3DA 3KQBA 1TA6A 4YT6H 1O2QA 5EJZA 1DE7H 1Y5UT 3AASA 3SU6A 1N8OB 1KDQB 1MZAA 4ABGA 4HFPB 1AMHA 3A85A 4IC5A 1QB6A 3GY3A 2G51A 1ZJKA 1H9HE 2Z7FE 1ANEA 1AVWA 1YPJH 3I78A 3P70B 3FZDA 2P3TB 1MQ6A 1SGIB 3LGYA 1UCYE 2O8WA 1SSXA 1TWXB 4XBBA 3MH5A 1C1WH 5AVDA 3ATMA 1OKXA 5EQRA 3UREA 4OS4A 3BN9A 3PLKA 4INKA 1GCTB 3RXTA 2KCYA 1QHRB 1YCPK 1XUGA 1KXBA 1WQVH 3BTGE 3RLWH 5LGOA 1AN1E 1LQEA 3EA8A 3PTNA 1O39A 1TX7A 1TB6H 2WZQA 3KCGH 3RC5A 2Y5FA 3MI4A 1BOQA 2BQ6B 3SBKA 1O35A 1K1MA 1DICA 1SGRE 1H8HD 4MPUA 5C1UA 6GCHG 2EY4C 2GV7A 2NWNA 1NFWA 3U98H 1QL7A 2A7JA 2FI3E 1CA8B 1K28D 1OP2A 1YLDA 1J14A 1GDNA 1RJXB 2AH4X 3LGVA 1AFQC 1Y3YA 3MU5A 4FUIA 1TALA 3UQVA 3OSYA 3VG8A 1SGPE 2WPIS 1COWD 3P95A 2IPHA 2UUFB 2H2ZA 1QA0A 2QGRA 2D2DA 3BG8A 1EX3A 1D4PB 1VCWA 2FZZA 1C5UA 2WUCA 2YOLA 1IQJA 3UOPA 1GJCB 2SGFE 1AGJA 3FVFB 5CHAC 3RXIA 1FJSA 3N7DA 5JBAS 3PMHB 1C5TA 1ZZZA 1ZTKA 3MNSA 2BD4A 2CF8H 4RKJB 4M9FA 1YPHC 1ELTA 1H1BA 3Q77A 2FYRA 2VNTA 1BB0B 1FDPA 4XDEA 4TY6A 2QXGA 2BY7X 3D49H 1BJVA 4YLUA 1YPMH 1LVOA 5FPTA 1F0RA 1ZSJA 4X6PA 1IQIA 2G52A 2VWMA 4NSVA 1C1TA 4NZLA 4JZDH 2FODA 5F8TA 2G55A 4WJG2 3OYPA 4UFGH 3F9HA 1IQMA 5ESTE 1XVOA 1DWEH 3ENSB 1O2NA 3DFJA 2J2UA 2HPQH 3LIWA 1DSUA 1OXGA 1S84A 2BD5A 3K65B 3SO3A 3QGJA 2Y5GA 3RU4E 2C8XB 5I25A 1PYTD 2JJ2D 2W6JD 1QQ4A 3V13A 3V7TA 3RMNH 1VITG 5GJ4B 2XNDD 5L2ZH 1LDTT 1PQ8A 2OK5A 1K1IA 1O3FA 2IN2A 1IQKA 2ZC9H 3BEFB 5EJLA 1SGTA 1Y5AT 2TPIZ 1AE8H 1P2NA 1RTKA 1A1RA 2O9QA 1FZZA 3GCHB 2H1UA 1V6DA 1K9OE 4CH2B 3B9FH 1GL1A 5EQQA 4CREA 2BB4A 4Z0KA 3NPSA 1TOCB 1Z8RA 4TT3D 4ACBA 4OS1A 1G36A 1GMCF 3BF6H 2KAIA 3QK1A 3O8CA 1MTVA 3PMAB 2KFWA 3MFJA 3RXGA 2Z94A 4WH8A 3SU5A 2YNAA 2BMGB 2NU4E 3BTQE 1HAYB 8GCHG 2ZF0H 4D76A 1CQQA
chains in the Genus database with same CATH topology
4DJZB 1EZSC 1O5FH 1EAWA 2BDHA 2BLQA 1WTHD 2ZU4A 1UVPA 1DXPA 1XUFA 2FS8A 3PWCA 1D3TB 3M35A 2C3SA 4AFUA 2THFB 1Y8TA 1VGCC 2P8OC 1VCPA 3IWMA 2H9TH 4E7RG 1YC0A 4NIWA 4MNWA 1GJ4H 2SGDE 1GWAA 1UO6A 2O8LA 3LOXA 1OSSA 2F9OA 2BYAX 1QBVH 1UCYH 2R3UA 3SV2H 1QQUA 7ESTE 2R0LA 3IITA 3EAJA 1NS3A 1T7CA 3LKWA 3NK8A 1U6QA 6CHAB 2LNCA 1GBFA 1LPGB 4AB8A 2ZCHP 4NWLA 2C93B 3ITIA 6GCHF 4JK6A 1SFIA 2XCNA 4I8HA 2DE9A 4WY3A 1ZTJA 1FY5A 4O97A 1OWHA 1GVZA 3BTKE 3DFLA 2YNBA 4E05H 1UTMA 3Q00A 1KIGH 3URCA 1O2XA 3GY5A 2A2XH 1HAOH 4MQAA 1GJAB 2OCVB 2ZQ1A 1V2ST 2UUYA 5TCAA 2J94A 1XMNB 5A09A 5ABWA 1GJ9B 2CXVA 1G3EA 4XFQA 2GDEH 1ID5H 1QNJA 1YPKH 1L1GA 2ZDLA 1O3KA 3S9BA 2BD8A 3TU7H 4AG1A 3BTFE 3UR9A 3F9FA 3LU9B 1TYNA 3U69H 1PPHE 2AEIH 4K1EA 4Y8ZA 1V2TT 4ASHA 2BXUH 2Q6DA 1A2CH 2GT7A 3L6PA 1AQ7A 3M37A 2TGTA 3ZZ6A 2Y82A 1BRBE 1BBRE 1V2OT 1AI8H 1WTGH 1G32B 4AFSA 4ABHA 3PMJA 2BQ7B 3SNCA 1TMTH 2WV4A 1CA0B 1Y3XA 2J38A 3E8LA 4MPXA 1T31A 2A7HA 1A46H 1O34A 1C1PA 1C2LA 3A7WA 4D7GA 2FX4A 2WINI 5AFZH 1V2PT 4JZ1A 4TPYA 2ZDKA 3T27A 3UNQA 2Q6GA 4Y7AA 3HK6B 3RDZA 2R2WU 3U9AH 4U30A 3UNSA 2FEQH 1L2EA 2ANWA 3DD2H 5GPIB 3GYMA 1YKTA 1THRH 3M7QA 3ZZ3A 4K1TA 1J15A 4YOIA 1KLJH 3PROA 1VITF 1PFXC 5EGMA 1O5BB 3A7XA 3QUMP 1QR3E 2ALPA 2ZHDA 1RD3B 5AHGH 3BTHE 2AGEX 3ZYDA 1GHYH 3A84A 4DURA 1BMNH 4UFDH 4R0IA 2H9HA 1KYNA 1O5AB 1GBCA 1L1NA 4CBOA 4AORA 1IQLA 4RKOB 1NY22 1E37B 3TJOA 2HNTF 2VH0A 4YT7H 3LGTA 1C5QA 1K1LA 3U8TH 1S83A 2TGDA 3PO1B 1TBRH 4X6OA 4B76A 1BA8B 3F1SB 1OX1A 2XW9A 1XUHA 5E0HA 1HLTH 1ZMJA 1P9UA 1F92A 4A1XA 2AMPA 5EW1H 3A81A 1RXPA 1LHEH 4K5ZA 1Z1JA 1GMDF 1E38B 1O3IA 2HOBA 2BY9X 4Y6DA 4LK4A 4PROA 4THNH 1TGSZ 2GCHF 1F5LA 2OBOA 2ZG0H 2FYQA 3UPEA 1CBWC 1DANH 3S9AA 1RIWC 3RU4D 1A61H 1F0UA 3P8GA 1O2IA 1MCTA 2ZU2A 3MU0A 2OQ5A 1O2PA 2OC0A 3NUMA 4JYTA 2KAIB 1Q3XA 2V3HH 3LGIA 4ABJA 1SHYA 1FMGA 2OXSA 1T4VH 3UWJH 1L4ZA 1ETRH 4GPGA 1D3PB 4YLQH 1DFPA 1HB0B 4ISLA 5ESBA 2Y7ZA 4X6NA 2VIPA 1OS8A 2GD4B 3FFGA 5LH8A 2BOHB 1DPOA 3BG4B 3VFEA 2SGAA 2B9LA 2PUQH 4UEHH 3VB5A 3ZVAA 2P16A 4KP0A 4XOJA 3S69A 3OY6U 3MTYA 2ZZUH 1XVMA 1O2HA 1UVOA 1W0ZU 1UVSH 2AGIX 3RM2H 1DLKB 4AGKA 1QJ1B 1Z7KA 1OWIA 3SV8A 1LPKB 5K0HA 2A1DB 1JWTA 1HXEH 1C5NH 1Z8GA 1XKBC 4NGAH 1PQ5A 1T8OA 1IHTH 2D8WA 2W5EA 1DDJA 3QZRA 1O3JA 1P3EA 1P3CA 1S0RA 3SQEE 3W95A 2QCYA 4BANB 5BPEA 2RA0A 2BD7A 4I8JA 1BRAA 3NZIA 1ARBA 3AW1A 3RXPA 2FOEA 1LQDB 4Z6AH 1MTSA 3SNEA 1O3EA 1OWDA 1V3XA 4FUGA 1GPZA 3RXEA 1M9UA 1SFQB 4ABEA 2OC1A 2C8YB 1G30B 1ELCA 2D26C 1EUFA 1AB9C 1MMJN 1C4U2 1NFYA 2PLXA 3P8FA 3I29A 4B2BA 2XC4A 1GI0A 2R2MB 2BQWB 2V3OH 4WMFA 1WV7H 5F6MA 1EJAA 2PKAA 2PSYA 4IGDA 3MO3A 1GBMA 4LOYH 4CRAA 2OC8A 3TK5A 2Z9IA 4GSOA 1C5OH 1UK2A 1YCPH 1GGDC 1MKWK 2ZECA 4X1SU 1ZHMA 2FLRH 1O33A 2FTMA 1HJAC 1S6FA 3LT3A 3DUXH 3U8OH 4X1RU 1ELGA 3TGKE 3SUGA 3BEIB 4H4FA 3RXQA 2QF3A 2R3YA 4ISHH 1MTNB 2HALA 2PW8H 3ZVGA 6LPRA 1P9SA 2BDCA 1PPGE 3H5CB 3ESTA 1MD8A 1MKXK 3BTWE 1V2QT 3Q3YA 1SQOA 1TPPA 5TCCA 1GBIA 1A0LA 4NA8A 3RC4A 2ZTZA 3P92A 1CO7E 2F9NA 5B6OA 4YOJA 1E35B 2Z3EA 3PV4A 2P59A 1GBKA 2FOHA 1SMFE 2PFEA 1W8BH 1YYY1 1P03A 5EXMA 5AF9H 2H9EH 3BTEE 3UFAA 1QB1A 1BQYA 1CGJE 1KY9A 3GOVB 4WXIA 5A2MH 5JBBS 3SNDA 2F9UA 1RFNA 1OYQA 3Q3KA 1XUIA 2F91A 3RM0H 2BD2A 2VJ1A 1GMCG 5JBTA 1H9LB 1DUAA 1LVYA 1P2JA 5C1XA 3FP8E 1XKAC 1SVPA 2J34A 3ZZ7A 3SV7A 3M5LA 2BZAA 4Y76A 5J4SA 3NXPA 3VB7A 1GBAA 1A3BH 1K1NA 1O3MA 4O9VA 4AFQA 3ATIA 1JRTA 4CRFA 2BDYA 2VIVA 3T29A 5JB9S 2OUAA 2ALVA 1NROH 2BVXH 4TYDA 3ZZ9A 3M3SA 1GCDA 1D3QB 5GCHG 1O38A 2FM2A 2FIRH 2WUBA 2FESH 3S7HB 1MTUA 5DGJA 4GHQA 5EPNA 1TQ7B 5EODA 2BM2A 1C2KA 4BAQB 3A8CA 3KNXA 1AKSA 5H4IB 4BAMB 1EPTA 3RXBA 2FOFA 1ZMNA 4NFEA 1FAKH 1BIOA 1XXDA 1MAYA 5DG6A 2VIOA 1ELBA 2A4GA 3EYDA 4ISNA 5L30H 1QB9A 3AW0A 3MU8A 2B0FA 4X0WU 1ZRBA 1TNHA 1OWEA 2M5TA 1O3NA 1HUTH 3ELAH 5A0CA 1DY9A 1KLIH 5E2PA 3TH2H 1ARCA 3LC3A 1YCPM 5CHAB 3AAUA 3EA7A 4MTBA 1HIAA 2VU8E 3EDXB 3K9XB 2CHAC 2GP9B 3RMMH 3SORA 4IMQA 2WPJS 2QF0A 1Y5BT 1CT0E 2A2QH 1E36B 2VVVA 4IS5A 1S82A 5DPAA 2ANKH 4FU7A 4E7NA 3MMGA 1YLCA 8KME2 1GHXH 2PR3A 3VGCC 3SU3A 3GDSA 4Q7YA 4IC6A 3E91A 1C5RA 3ZZ4A 1Y3WA 1SQAA 1TGNA 3OTJE 3TK9A 1GI4A 4DVAU 1SGEE 1TOMH 1LTOA 1SC8U 1RTLA 3VXEH 5T6DA 4AGJA 2UUKB 2FI5E 1BTPA 2XXLA 3QGNB 1J17T 2I6SA 2ZFSA 1PPCE 2BLOA 1Z6JH 1YPLH 5HYOA 2FI4E 2GX4A 4ZHAA 4AG2A 1O36A 1K1OA 1SL3A 2EC9H 4INLA 1BTXA 1EP6A 2A5KA 4B73A 2ZTYA 1MQ5A 1GI6A 3U8RH 1O3OA 2AFQB 5EU8A 3W94A 1P01A 1O2OA 1AU8A 1HGTH 4FU8A 2ZTXA 2A4QA 1ANBA 4NIVA 3UTUH 1O30A 3N7OA 3HATH 3VB3A 3SJIA 1P04A 1F5RA 1ACBE 3SNBA 3MOCA 1EXFA 5FX5A 9ESTA 3F6UH 1G37A 4X2WA 4FUJA 5EXNA 3UY9A 1WU1A 4X6MA 1NRRH 1TNIA 1CHGA 1QL9A 3ZYEA 1DS2E 1V2KT 4GCHG 1A0HB 4MNYA 1FY8E 2FLBH 5A0BA 1P2IA 4CRCA 5C3NA 5JPMH 5EPYA 2PKAB 1AWHB 2ODQA 3P8NA 1VCQA 1TPAE 1AVXA 4Q7ZA 1D9IA 2UWPA 1FQ3A 2ZFQH 1C1VH 1SLWB 3LDXH 3M7TA 2Q1JA 1L0ZA 1ZGIA 1IQEA 1DX5M 1JOUB 5FXLA 1VGCB 3KEEA 4MNXA 1O2WA 1C5PA 2HPPH 3A7YA 4MG3A 5DP8A 5E2OA 1CHOF 4O03A 3RP2A 3HKIB 3ZV8A 1DVAH 3TJVA 4DG4A 4KKDA 1TPSA 1HAXB 1GHBF 1T8NA 1YF4A 1P11E 4AB9A 4ZUHA 2G5VA 4MDSA 1G2MA 3D23A 1TABE 1GHWH 3M3VA 3U1JB 1QBOA 2PHBA 4JZEH 3BTDE 3A86A 3DHKH 1GMDG 1UTNA 1VR1H 1FPHH 3SGAE 1V2VT 2AIPA 4X8VH 1BZXE 3ZZAA 2P3FH 5DP3A 5GCHF 2WPHS 3V12A 1PQ7A 2GCHG 1NRQH 3F9EA 3DT0H 4FUBA 2EEKA 4CHAC 1OYTH 5L2YH 2ZHQH 1BDAA 4GAWA 2WYJA 2JH5D 1SR5C 1QJ6B 3R3GB 3FZZA 4ZXYH 1P2QA 2BLVA 2CN0H 5J4QA 1HDTH 1BMAA 1TBQH 3GY2A 3OX7U 1EAXA 7GCHG 1PPBH 2G81E 2ZGHA 2XRCA 1W12U 2O8TA 2ZFRH 2HRVA 1DSTA 1HYLA 3NKKA 2HVXA 2RDLA 1JIMA 4IN2A 1TGTA 1TGCA 2W7SA 1C2HA 5TJXA 4ZMAH 5GIBA 4KTCA 4X2YA 2ULLA 1HPGA 1W7XH 3EQ0H 2FDAA 2ZWLH 5EXLA 1FNIA 2JH6D 5T3HA 3ZZDA 2ZFTA 2HNTE 2Z6BD 3RXRA 3SW2B 2AIQA 3K6YA 3UUZA 1AKSB 5E8EH 2Z9JA 3ZVCA 1EPTB 2RG3A 1NO9H 2BDBA 3PLPA 4INHA 1BRCE 2HGTH 1AUTC 3MH4A 2HLCA 1ZOMA 3BIUH 1S81A 2F9VA 1QCPA 2B7DH 3AAVA 4Q80A 4O3UA 1EKBB 1UVTH 1BITA 3TVJB 3QTVH 1WOFA 1C2MA 4U2WA 3MU4A 3STIA 4A1TA 1O2YA 1A7SA 4BAOB 4ZH8A 3G01A 1AO5A 1FUJA 2OD3B 4O3TA 1HIAB 1QRXA 2P93A 2PWXA 4OGYA 1UTLM 3BIVH 3A8BA 4FU9A 1P8VC 3EGKH 2VIQA 4MLFB 1O5GH 1CGHA 2STBE 5HM2A 4R8TB 1CVWH 5FAHA 4X1QU 1GJ8B 1SB1H 1UTKA 4BXSA 1MU8B 2VIDA 1WYKA 5C67A 3P8OA 4ZKRU 1QTFA 1RRKA 3QZQA 1C1QA 1IOEA 2TGAA 4BAKB 1NU7B 4B75A 1J8AA 1D6WA 1EB1H 1ELAA 2FOMB 2TRMA 4KTUA 1BHXF 3PYHA 4KELA 1OP0A 1HXFH 1SQTA 2BY6X 1UVUH 2F9PA 1HJ8A 3RXUA 1LKBA 3SGQE 1O2KA 4GCHF 1ZHRA 4U32A 5DP7A 1XXFA 2J92A 3T25A 5GXPA 1NTPA 1ANCA 3ATWA 4X2VA 3BEUA 3NCLA 3L3TA 1DXWA 2A31A 2FO9A 1NPMA 1G3DA 1TPOA 1P2KA 3KF2A 2UUJB 5GDSH 1C2DA 1C4V2 1CT4E 3LJJA 1CBWB 1LKAA 4F49A 1AIXH 5DP9A 1RIWB 3LH3A 1ESAA 4OS7A 3E16B 2ZU5A 2ZGBH 1O2LA 4BAHB 2NU0E 3FP6E 5DK1A 2Y7XA 5F03A 3SJ8A 4Y8XA 2DE8A 5AFYH 2CV3A 1O3LA 2VGCC 3O8DA 1C5LH 2IOTA 4ISIH 4ESTE 2Q6FA 1IAUA 1PPZA 4YO9A 2STAE 1C2GA 8LPRA 1LVMA 4Y10E 1C2EA 2GZ9A 4Y71A 1AZZA 1ELVA 2A32A 3CP7A 3RC6A 1IQNA 2PKSC 1C1MA 2ODPA 4OGXA 4E06H 1FIZA 1G3BA 4J1YA 1UMAH 2DUCA 2FMJA 1ZRKA 1MAXA 1TIOA 3RUOA 4MVNA 4DCDA 1FY4A 1NC6A 1V2JT 1MKWH 2D1JA 1K22H 3A82A 4VGCC 3MHWU 4NA9H 7GCHF 1GMHF 3AVZA 1CU1A 4ISOA 1IQFA 1F5KU 2PGBB 4FUEA 4OS5A 6ESTA 4Y0YE 1LCYA 2GV6A 1OPHB 2GCTB 1O0DH 1WCZA 2XWBI 1VITH 3QO6A 2Z3DA 1GBTA 2ILNA 4X1PU 1A3EH 2H5DA 1F7ZA 3T28A 2VVCA 3GY7A 5JDUB 1A5HA 1MKXH 3PO1C 1BTZA 1O2GH 2GTBA 3SN8A 1MTWA 3SZNA 3RLYH 4H6TA 1ETSH 1INCA 2ZU1A 3JZ1B 5FCRA 1C9PA 3S0NA 1NRNH 3ZVEA 4CR5A 1J9CH 1SGNE 2ZFPH 3KN2A 1RGQA 1S85A 1AB9B 4UD9H 1E0FD 1DY8A 2ZDNA 1O3AA 2QY0B 2BVRH 1VJAU 2JETB 2OQUA 4OS6A 2PGQB 4FUDA 2QIQA 3Q76A 4NWKA 1O3CA 1C5XB 5IDKA 3SU1A 3KQCA 4CBNA 1GG6C 4FVBA 1GGDB 4ZAEA 4I33A 1EOLA 2FP7B 5HGGA 3ZVBA 2SGPE 1O5DH 4TWYA 1OWJA 1GHZA 2O8MA 2GMTC 1HJAB 2XBVA 5DJ7A 1ZMLA 4B71A 4CRBA 2SNWA 3SI4H 1MH0A 3E90B 2HWLB 1ELDE 2FOGA 4JYVH 1V2NT 2FXRA 1GI7B 3D65E 1GJBB 1O2JA 2BXTH 3FP7E 4XE4A 4ABDA 2ZPQA 1KSNA 4Y7BA 2XYAA 2G8TA 4CRDA 1WSSH 1SG8B 1QBNA 1Q2WA 1FAXA 3O8BA 1ESTA 3PM3A 5CE1A 1DWDH 3A89A 1P05A 2C8WB 3Q3XA </