5LH8A

Trypsin inhibitors for the treatment of pancreatitis - cpd 8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A02
3MU4A 2XC5A 4KGAA 3PLPA 1PPEE 1O3NA 3BTFE 3QDZB 3NPSA 4Y8ZA 1BMNH 1GJDB 3M36A 5CHAB 3ZVGA 4TYDA 1TX6A 4VGCC 1OSSA 4UDWH 1ZHPA 3PMAB 2Z9LA 3RXOA 2Y5HA 3GY2A 3RMMH 2BOKA 2FIRH 3ZV9A 2I6QA 3F9HA 3KQBA 2A5IA 2P94A 1O39A 1A5HA 1BB0B 1DFPA 3NUMA 4CBOA 3FFGA 1P0SH 3P17H 1KXFA 2P16A 1HFDA 1O2PA 1YLDA 1ZRBA 2AYWA 2VNTA 3MO3A 4XOJA 2LNCA 1Z8IB 1XUHA 1AZZA 1GCDA 2XBVA 3P8OA 2OD3B 3A8DA 1P2QA 4WY3A 1IQLA 4GSOA 1K22H 3LH1A 2C4FH 4ISHH 2PKSB 1O5EH 4X0WU 1HV7A 4Y0YE 5C67A 2P3TB 3RXAA 5L2ZH 2V35A 4NSYA 1QGFA 1SQTA 1P09A 5GXPA 1QFKH 4NFFA 1MTWA 4AYVB 1O2KA 3ATWA 2XCNA 1LO6A 1PFXC 1GI7B 2HRVA 5DP5A 1K1PA 2R9PA 5EQRA 1TMBH 1CHGA 3BG4B 1AUJA 2TGAA 4JZIA 1AN1E 2GVFA 2VINA 4B73A 1PYTD 1QHRB 2FOEA 1XUIA 2WPLS 1G3EA 5C1YA 4CRBA 3MU8A 4K1TA 4AYYB 2ZG0H 3GY6A 1O3BA 5JB9S 1DSTA 3SUDA 1O3MA 3U8TH 1TNKA 3D65E 1BRBE 1E35B 5AFYH 4E05H 4YT7H 4ZKSU 1P12E 2WINI 2ZCHP 5E8EH 3LU9B 3P8GA 2GCHG 1WAYB 1NPMA 1EJMA 4INKA 1C4U2 4AORA 1DWEH 3R0FA 3LJJA 3SJOA 1CGJE 3URCA 4E06H 3A7TA 3GDSA 1ZHRA 1OXGA 1SGQE 5L2YH 3TK5A 4XBCA 2Q1JA 1T31A 2ZNKH 4DIHH 1Y5AT 3ODFA 1GJCB 1ZPCA 4A6LA 1OWHA 2AGIX 1Z6JH 2G5VA 5GDSH 4K5ZA 2BD9A 2FOHA 2AH4X 2AGEX 2XC0A 1TGNA 1UJ1A 1ZR0A 4K2YA 1GBAA 4MPWA 2W5EA 1C9TA 3MH6A 3A80A 4JK6A 1W13U 2FXRA 1V2MT 1FY8E 5GCHF 4O9VA 1HAIH 4TPIZ 1VCQA 5DP9A 1JOUB 2FTLE 1GBDA 3G01A 4FUEA 3F9EA 4ABDA 1OS8A 2ODPA 1AI8H 1FMGA 1HAPH 3RXCA 2ZIQH 5DP3A 2BD3A 1HAZB 1SGPE 2ZP0H 4X6MA 4FUFA 1Z1IA 1SC8U 2VH0A 4ISOA 1O3KA 1NFUA 1O2OA 1QQ4A 3A84A 4LZ4B 1UVPA 1QRZA 2XC4A 2BYAX 1B0FA 1L1JA 4ZHLU 1GMHG 3E6PH 3AW1A 4A1VA 2AIPA 1AO5A 3B9FH 2SGEE 2PKAA 1GI2A 1SOTA 1SQAA 1EASA 1GCTC 5LH8A 3ITIA 2JH5D 2CF8H 3TNTA 1BMLA 3GY8A 1AB9B 3ZVFA 1O5GH 5JBBS 3SNBA 1UTQA 1BITA 1F2SE 1C5PA 3BTGE 2PKSC 1CSOE 1SLVB 3TPIZ 3E0NB 4QT8C 1V2NT 4J2YB 4OS6A 4WH6A 1DXWA 2HPQH 2VWNA 1MUEB 1PPGE 1Y59T 2OQ5A 1SGCA 3LGYA 1P03A 4OGYA 5F03A 4IN2A 2PTCE 4TY6A 1LVBA 5J4QA 2BVXH 1TA2A 1UHBB 1ELVA 1SGDE 1CT4E 3QTVH 2PTNA 3KGPA 4NG9H 1KSNA 4WMFA 4JZDH 4FU9A 2QV1A 2TGTA 1ESAA 4ABJA 1FY5A 7ESTE 2ZQ1A 1KY9A 2F91A 1TNGA 1KXBA 1ZYOA 3K2UA 1WTGH 3RXQA 1EKBB 2SGQE 5FBIA 3VB6A 2D2DA 4NFEA 2FTMA 4HFPB 1ESTA 1DDJA 4DJZB 3A7WA 4YOIA 3DFLA 1SLUB 3A7XA 3SNEA 4OS7A 1S6FA 3U1IB 1S6HA 1EPTB 3O8BA 2Y80A 4K60A 2BDBA 3UREA 4BTUB 2HNTF 1FPCH 4B76A 3A8AA 1A2CH 2C90B 3RXTA 2YNAA 4ABEA 4NIYA 9LPRA 1GDQA 5EG4A 3U8OH 1O0DH 1UTPA 2Y81A 3V0XA 2ZA5A 3GCHB 4CRDA 5C3NA 1FI8A 1UVSH 3SNDA 2R2WU 3LGUA 4GUXA 1XXDA 1EZQA 2ZU1A 4GCHF 1GGDB 1SHYA 1ZZZA 2CF9H 1QQUA 3DD2H 4DG4A 4CREA 3LDXH 3VEQB 1TPOA 1BJVA 5K0HA 2QXJA 5JPMH 3TH4H 1OKXA 1QR3E 1TQ7B 2BQ7B 4Z6AH 1GMHF 1EZUC 2FZZA 2BVRH 1XVOA 3LC3A 4NZLA 1O37A 1C5WB 2HPPH 2HVXA 4R0IA 3ZZ7A 1C5TA 1DS2E 3SQHE 1SGTA 1FJSA 1HYLA 3ODDA 2BX4A 3FANA 1O5BB 4MTBA 5AF9H 2B8OH 1BTPA 4AGKA 1V2TT 1ABIH 1QCPA 3T2NA 5CE1A 4YESB 3V13A 2RG3A 3GDVA 1GBLA 1ZSKA 1PQAA 4BOHA 1TABE 2DE8A 4CBNA 4CHAC 1JWTA 4IC5A 3TGKE 2FYRA 4NIWA 1L4DA 2BQWB 4ZKRU 1P8VC 3OYPA 5C1UA 1C2EA 1UCYK 1C5NH 1P3CA 3TITA 2WYGA 3C1KA 5LGOA 2ZGCA 2SGAA 4Y71A 1CGIE 2V3OH 1K9OE 1GBCA 1AUTC 1BHXB 3BEFB 3RXIA 1J15A 3BIUH 4IMQA 3A86A 1C5MD 1C1QA 1G2LA 2ANWA 2TBSA 3GY4A 2QY0B 4RSPA 5F6MA 1F0RA 4TWWA 3GYLB 3SN8A 1UCYH 2QYIA 1O5CB 3RXUA 3RM0H 3VB4A 1OOKB 1GL1A 4AGJA 1SGYE 3RU4T 1QJ6B 2VWLA 4Q7ZA 3FP7E 3MNXA 1ARCA 3ZZDA 1C1RA 1GMCG 1FY4A 1DWCH 1O30A 1O36A 1O2HA 3ZVEA 5EPNA 1KTSB 5DJ7A 1OYQA 1YPMH 1ZJKA 3PV4A 2H9EH 3C27B 1Y3UA 3SU2A 2XYAA 1WQSA 4X6PA 3ZZ4A 3NK8A 7KMEH 1S84A 1RJXB 1SGEE 2YNBA 2B7DH 1DANH 2NU1E 1FXYA 1IQNA 2ZFSA 3TNSA 1TIOA 1ID5H 4ABAA 2AMQA 8GCHF 2PKAB 1ELTA 2YOLA 1P2IA 1UTNA 1YCPM 2A4OA 1YF4A 4ZKOU 4U32A 2PGBB 2XBYA 4MPVA 3KL6A 1P04A 4XBDA 1GWAA 1T8NA 1C4V2 1KYNA 2FM2A 3GOVB 4ZH8A 5LPRA 1JXPA 2P3UB 2BY5X 1K1OA 1BRUP 1A1RA 1BTYA 4Y8YA 3TK6A 3OX7U 5GJ4B 2R0LA 3TH2H 1OP8A 1HBTH 3RXJA 3MH5A 5TJXA 1VCPA 3S9CA 2ULLA 3QGJA 1SR5C 1CGHA 2JETB 1VGCC 4Y0ZE 1EOLA 1GBIA 3SV8A 4Q7YA 1A0JA 1BJUA 3PM3A 3NZIA 2Z9KA 4X1QU 1C9PA 4GVUA 3HK6B 3PWBA 5AFZH 3U69H 2BDHA 3LGWA 1C1PA 3UR6A 2G5NA 4NIVA 1O2YA 1O3PB 4JYUH 4MNYA 4DW2U 2ZPQA 4Y79A 1HXEH 1EB1H 2BHGA 2BDAA 1FAKH 2P3FH 5IDKA 1SLXB 2OBOA 4D9RA 2C3SA 1O3EA 5IYTA 1HJ8A 1FDPA 4WXIA 1F5RA 1EXFA 4B1TA 2BD8A 1TBRH 1FIWA 2BVSH 4Y6DA 3BTDE 4OS4A 1C5UA 1SGFG 4NCYA 3OSYA 1V2ST 2ALVA 3HGNA 4Y10E 5A2MH 4B75A 2FI3E 1C1WH 1KXEA 1UVOA 1YLCA 4DURA 1O2ZA 2WPHS 1DUAA 2ZFQH 4CHAB 1SMFE 2GCTC 1HUTH 3GCNA 3R3GB 3RMOH 3UQVA 3NWUA 3GICB 4GHTA 3MU1A 2A7JA 5FPSA 1C1OA 3RLWH 2ZU4A 2ZWLH 2PGQB 2FX6A 3VXFH 1QL9A 3ATIA 2HNTE 1AVXA 1INCA 1HPGA 1GI3A 2NWNA 2AEIH 2CV3A 4IN1A 3SUGA 1TRNA 3ATLA 3GCOA 4UFFH 2Z3EA 1F92A 2PLXA 1GG6B 2RDLA 3E8LA 3D62A 1V2WT 2UUKB 2AIQA 1NROH 3A88A 1GI6A 2ZFFH 2HGTH 1D3PB 1N8OC 1SB1H 5JB8S 3UOUA 1D6RA 1F5KU 3RXPA 2ZHQH 3MNBA 1AVWA 1D3TB 5C20A 1GDNA 2BY7X 1J8AA 2ZHEH 3H7TA 3M5OA 1K1IA 6ESTA 1AGJA 1N8OB 1IQHA 2DE9A 3OU0A 2HLCA 3MMGA 5FXLA 2XWBI 1W12U 2WYJA 3FAOA 1GMDF 2EI7A 5FPYA 1RTKA 2CGAA 1P9SA 1FPHH 1NFWA 4O97A 1QIXB 3ZYDA 1WTHD 1B0EA 2BZ6H 4X1SU 3W95A 1AKSB 2OINA 4IW4E 1AVGH 4Z0KA 3U1JB 4I8GA 3P6ZB 1GBKA 3M7TA 4X8TH 5DG6A 4F49A 2VJ1A 4O03A 3U9AH 1LCYA 1VJAU 1HDTH 2VVUA 3HKJB 2WUCA 1VZQH 1LVMA 3EA8A 1D6WA 2FOCA 1GBMA 4OS5A 1ZMNA 1Z8JB 1EOJA 4AFZA 1DPOA 3SGAE 3ZYEA 4NA8A 1MTNB 1V2OT 2WV4A 3A8BA 1GI1A 3V12A 3W94A 1MQ6A 3E1XB 3PTBA 2V0BA 1AQ7A 1SGNE 2FOAA 4MNWA 1Y5UT 2SGFE 4R8TB 1NFXA 4X8VH 1JRSA 1O5AB 1P06A 2HALA 2R3YA 3BIVH 1UTKA 1K2I1 4K8BA 1AB9C 2ODQA 1TBQH 1ZPBA 5HMAA 3PWCA 2VH6A 1IAUA 1G32B 1GI0A 4B2AA 2WPJS 2SNVA 1BTZA 3MU5A 1FV9A 1TX7A 5A8ZA 1FIZA 2Z94A 3A7VA 4YTAA 2XNIA 4FVDA 2G52A 1THRH 1O2MA 1C5XB 2PWXA 1GBJA 1GJBB 1PPHE 2UWOA 2ZZUH 3BTKE 3PYHA 4CR5A 3L3TA 1EAWA 2ZTYA 3SI4H 5I46H 2ZGJA 3UIRA 2JETC 1S5SA 1T4VH 2A45B 2GDDA 3S7KB 5G4BA 3SHCH 1LHCH 1GJ9B 3CENA 2QIQA 2FI4E 3ENSB 2KAIA 1HAXB 3HKIB 1V6DA 3MNSA 1XMNB 3SGQE 1TQ0B 3DUXH 3PLBA 1AE8H 2OC7A 2V6NA 2FLBH 5F8XA 3LJOA 4MG3A 3Q3XA 3TVJB 1CHOF 1HCGA 2UUYA 2OC0A 3O8CA 1C5OH 1O2WA 1SGRE 3M3VA 4BXWA 1NTPA 4Y11E 1AY6H 2Z6BD 1MTUA 2ZFRH 4DOQA 1LVYA 2Z9JA 5HXFA 5C1XA 1V3XA 3UY9A 4I7YH 1CBWB 2JH0D 3MH7A 3MO6A 4RKOB 3NKKA 3FZDA 1NRPH 1P2MA 1BDAA 3SW2B 4DVAU 1AMHA 2TGPZ 2A2QH 3A81A 3GISB 3K9XB 3PTNA 4NA7A 1HAYB 5J4SA 2VIVA 1IHTH 1EP6A 1NN6A 1W7GH 2ZI2H 1YKTA 1C1NA 3GCTG 4A5TS 1RRKA 4B2BA 1F0SA 1TGBA 3AAVA 1O31A 3M61U 1C5QA 1LHEH 3ZZ8A 3SJKA 2PR3A 1WBGB 2PSYA 2G81E 1BBRH 3RDZA 1O2VA 1NRQH 1YYY1 1MZDA 2VGCB 5FAHA 1AWFH 1HIAA 1L1NA 4NWKA 4TY7A 2HNTC 1C2DA 2W7SA 1LDTT 2BDCA 4A1TA 1NRRH 1SOZA 1IOEA 1T4UH 3M7QA 8ESTE 1DUEA 4H6TA 1P11E 1C1SA 2AFQB 3QX5H 6CHAC 1SVPA 1P02A 1XVMA 4Y76A 3T28A 1VCWA 1DVAH 1MTNC 3E90B 5DK1A 1PQ7A 1QTFA 3SUEA 2VU8E 2G4TA 1C5LH 6LPRA 1LHFH 2Z9GA 3Q3YA 1EAUA 3IWMA 4AG2A 2GMTC 1SFIA 4FVBA 4AB8A 1KXCA 1P2OA 1CT2E 1K21H 3RXFA 1O2TA 3A7ZA 4NWLA 1UVTH 1HAVA 4DT7B 1VITH 3M35A 4FUJA 4WMDA 5LPEA 4U2WA 3Q3KA 1FONA 4NSVA 1QBVH 2ZDAH 3SU6A 3TGIE 4J1YA 2CXVA 4BAKB 1OYTH 1FQ3A 4JZFH 2GCTB 4AFUA 1A0LA 1P05A 4FUCA 1YBWA 4YLUA 3UWJH 5HM9A 5CMXH 3U98H 1ETSH 4XE4A 5K7RA 1Q3XA 4ZXYH 1L2EA 4D7GA 1H4WA 1QB9A 1C5YB 1DXPA 1NY22 1RXPA 3S69A 2BTCE 3KHVA 4HI3A 2VIDA 4CR9A 5DP4A 4VGCB 1K28D 3SU0A 1S82A 4ABHA 5CHAC 1C2JA 1L0ZA 3BTQE 3DFJA 3KIDU 2UWPA 3ZZCA 1A0HB 1QJ1B 1TNHA 3CP7A 3ZVBA 2D1JA 1HNEE 1UTMA 4ABIA 3Q77A 2VGCC 4ZHMU 3UOPA 4BAOB 1XKAC 1BRCE 1UTOA 1HJAC 2W26A 1C2LA 5T6DA 2FO9A 1ACBE 2FP7B 2D26C 3LGVA 3EDXB 4MPXA 5A8XA 5EQQA 2Q6GA 2ZC9H 2XRCA 5JBCS 1MMJN 1L1GA 2A5AA 1O3FA 1XKBC 2QAAA 2WUBA 2ZHFH 1PPCE 3DT0H 2NU4E 4XDEA 3RXBA 4ESTE 1FLEE 4H42U 1ANEA 1DY9A 4WXVA 1E36B 1IQGA 2ZTZA 3UNQA 1T8OA 3T27A 5EW1H 4SGBE 1FNIA 2V3HH 2HOBA 1HXFH 1AKSA 4INLA 3SGBE 2ZDVH 2GZ9A 3A7YA 3H5CB 5JBAS 2ANMH 2FLRH 2GDEH 1J17T 5GIBA 4Y7BA 4UFGH 2PUXB 1PJPA 4X1PU 2BM2A 1UTJA 2BZAA 1O32A 1WYKA 1O2SA 1O3CA 1YPGH 5PTPA 1Q2WA 3ZZ6A 1C2HA 4H4FA 5JBTA 3MWIU 3WY8A 5C2ZA 2QN5T 4ABFA 1KDQB 1BMAA 1WOFA 4IGDA 1RTLA 2O8UA 3SHAH 1GI9B 5F8TA 1QURH 3PROA 4X2YA 3RXSA 5AVDA 3V7TA 1HLTH 1EZSC 3MO9A 3A83A 2F9VA 2F9PA 4FU7A 4YLQH 1GVLA 2C8YB 1XXFA 1MU6B 2BDYA 2Q6FA 4AB9A 4ZMAH 1ZSLA 1MKXH 4HTCH 4LOYH 5ESBA 1ZLRA 1DOJA 4MLFB 2AMDA 2OC8A 3UFAA 5JYIA 1S0QA 1TE0A 3T25A 4MVNA 3TJUA 3M7UA 1ZGIA 1N1LA 1YPHE 1P2JA 3CS7A 4ZXXH 2G51A 1TA6A 1TLDA 1EUFA 1Y3YA 3ELAH 2NU0E 3VGCC 1SBWA 1TOMH 1KDQA 2Z3CA 1Y3VA 1GJ7B 3M3TA 2WV5A 4I8LA 1AWHB 4O3TA 2R0KA 2O8TA 4D7FA 1ANBA 4B2CA 1MBQA 1BTUA 1TMUH 1H9LB 1W7XH 1LKBA 1TGSZ 4ZKNU 1ETTH 3P8NA 2AMPA 2FPZA 2GD4B 4F4OC 3DA9B 3ZZ9A 1FUJA 2SGDE 3OY6U 4AN7A 2JKHA 3O8RA 1UO6A 5A0CA 3P8FA 4CH2B 4UFDH 5LPFA 1BUIA 4MDSA 1W0ZU 3NXPA 2A1DB 2F9UA 2ZDMA 1FN6A 1HAGE 1OP0A 4DCDA 3P70B 2AS9A 1O2UA 1P9UA 1TOCB 3RXRA 3T29A 3MFJA 1AFQC 1O2NA 2NU3E 4YO9A 1C2KA 3KF2A 4KTUA 1EB2A 1O2XA 1GHBF 3MH4A 4O3UA 3QUMP 3P92A 3SI3H 3UPEA 3BEUA 3QZRA 1GBBA 4JYTA 4BANB 4TWYA 4Q80A 4BXSA 1EAXA 2A7HA 3AW0A 5A8YA 3FP6E 3TH3H 1D9IA 1LPZB 1EATA 1HJ9A 1W8BH 1E34B 1TX8A 5EGMA 2O9QA 3HK3B 1QBNA 1SGIB 1O34A 3LONA 1SG8B 4GPGA 2IOTA 8GCHG 1G30B 5T6FA 2FOBA 1CA0B 1L4ZA 3LKWA 2F83A 1XUGA 3ZZ3A 1O3OA 3K6ZA 4X2WA 1TGCA 1C2IA 3OY5U 3BTME 3RP2A 3F9GA 1EPTC 1DSUA 3RXKA 3RXDA 2XBXA 1EP5A 2ZF0H 3JZ2B 4Q2KA 1O5DH 1GJ6A 3GY3A 1BBRK 1ELGA 3BF6H 1QJ7B 2ZHDA 1ZGVA 1LHDH 4FUDA 3TGJE 2B0FA 3QO6A 1YCPK 4BAHB 1CVWH 2F9BH 4ISIH 3SUFA 3MNCA 4B71A 4X1RU 1SSXA 2A32A 1JIRA 3SNCA 5C5NA 1BIOA 4YM9A 7GCHG 5HGGA 3LPRA 4JYVH 1LMWB 1O3DA 1UHBA 2BD7A 4ABBA 1HIAB 3BTWE 4UD9H 3SQEE 3AAUA 2GV6A 3H7OA 1TPAE 1J14A 3PLKA 2LPRA 3BG8A 2BD5A 1TPSA 1H8IH 1O35A 1W11U 2QF0A 3TK9A 1TNJA 1O2QA 3MI4A 4YOGA 4WJG2 4BNRA 2VVCA 1T7CA 3A87A 1RS0A 7LPRA 3D49H 4KELA 1V2QT 4UONA 3E91A 1ZSJA 5T3HA 4SGAE 1BMMH 2SNWA 1N6XA 6GCHG 4Y7AA 3VB7A 1Y3XA 4I8HA 1D3DB 1E0FD 2TIOA 6CHAB 4IMZA 2XBWA 3GY7A 1S85A 4M7GA 1KLIH 1YPKH 7GCHF 2Y5FA 4CRCA 1X7AC 4YT6H 1W10U 2GX4A 1C2GA 1W0YH 1WCZA 1CA0C 2ALPA 1D3QB 3KEEA 3KN2A 4A92A 5ABWA 1A7SA 4E7NA 1P2NA 1VGCB 1YM0A 2ZQ2A 1YPJH 4ZROA 5L30H 1PPBH 1G9IE 3UR9A 2QXHA 1P2KA 4RN6A 3S9AA 3TJNA 1ABJH 1TMTH 1XUJA 1SFQB 1ZPZA 2BLOA 2F3CE 1KXAA 2TRMA 2ZKSA 2ZTXA 5FHTA 5E0GA 1HB0B 1TALA 2J4IA 5HYOA 2BLWA 4B74A 2WPIS 1E38B 4MQAA 3PMHB 1KXDA 1C5RA 3F9FA 1S81A 1GBHA 2AERH 1QRWA 3M37A 2EC9H 1RGQA 4INHA 1EZXC 5GCHG 3URDA 2ILNA 4Y8XA 1LQDB 4TPYA 1DICA 3PB1E 4NIXA 1JBUH 1QB1A 2P8OC 2QC2A 2G00A 1ELCA 5EXMA 1QA0A 1DX5M 2ZFTA 1TRYA 3S7HB 5EW2H 3RXGA 2P59A 1HRTH 3LGIA 5DPAA 3I78A 1AU8A 1VJ9U 3IITA 4A7IB 1IQFA 2GGVB 2FODA 2VWOA 4UFEH 5FX6A 5TCCA 2JH6D 2ZFPH 2FOMB 3M5NA 2OCVB 2VIOA 1DE7H 2C93B 1WSSH 3RC6A 4KKDA 5EQSA 3OTJE 1RIWB 3AVZA 1GMCF 4WH8A 4FUHA 1K1MA 1FAXA 1KLTA 1SI5H 5BPEA 1J9CH 3S9BA 4JK5A 4ABGA 1SPJA 3A8CA 2GKVE 2QXGA 1WU1A 3RMLH 2XXLA 2BOHB 1G3CA 1JRTA 3LT3A 2SFAA 1OWJA 1VITG 5E0HA 5EXNA 3TU7H 1ZTLA 1T8MA 2CMYA 2BY8X 1XM1A 2IN2A 1W14U 2D8WA 3SV7A 1BQYA 1G36A 2C8WB 3T62A 5ETXA 3ZVCA 4OGXA 4BTTB 2ZU5A 3U8RH 3CS0A 2GZ8A 1C1VH 1ZMLA 5AHGH 2RA3A 3F6UH 4AZ2B 1P3EA 5DP6A 5DGJA 1CQQA 1A46H 3N7OA 4E7RG 1GJ5H 2J95A 3E3TA 4DIIH 2EI6A 5GPIB 1QNJA 1NESE 4FUBA 3E0PB 2ODYB 3M3SA 1V2VT 1GGDC 2BX3A 2J34A 1W3CA 3RXEA 1Z71A 2H9TH 4FXGH 2ZGHA 4K3JA 2OQUA 4BAMB 3GCTF 1BOQA 2IPHA 2F9NA 3BN9A 1A3BH 4KTCA 2ZU3A 1UK2A 5DP8A 2VIPA 2BQ6B 1ZMJA 4ISLA 1F5LA 1KLJH 2G55A 1GDUA 2Y7XA 2Z9IA 1HJAB 1TONA 1LKAA 3HPTB 1C1UH 3D23A 4GCHG 1GCTB 1DLEA 1MH0A 2GT7A 2QA9E 2FEQH 1SQOA 3ATKA 1H1BA 1FZZA 2A4QA 2BLQA 3GDUA 5DP7A 3RXHA 2FOFA 3EYDA 1SL3A 4D76A 4UE7H 2HWLB 1GHXH 1TPPA 1GG6C 2FESH 3VPKA 1YGCH 5SGAE 3IG6B 3EA7A 3RXMA 1CBWC 1HAOH 5GWZA 1O2RA 1YC0A 2H5DA 3QN7A 1CT0E 3DHKH 3SV2H 2BDIA 1Y3WA 4U30A 2J9NA 3SU5A 1GHAG 5H4IB 1MTSA 2ZU2A 4JCNA 1BTWA 1C5SA 1C2MA 3HATH 5I25A 2CHAC 1GJAB 1OWEA 2H1UA 1NS3A 2ASUB 5EOKA 1YPEH 4X8SH 3SV9A 5DKMA 1B7XB 5FX5A 2O8WA 3MHWU 1ZOMA 1ANDA 2STAE 3KNXA 3QZQA 5HM2A 4WMEA 4D8NA 1ELAA 2H2ZA 3VXEH 1T32A 1ZHMA 3KQCA 3MTYA 3RC5A 2XTTB 3EQ0H 2Z3DA 1Y8TA 3STJA 4WF8A 2H5CA 3M5LA 1K1LA 1O3IA 2THFB 3SORA 1DT2A 4X2XA 2VIWA 4XFQA 3KQEA 1MKXK 2J94A 2TGDA 1FN8A 1THPB 1NM6A 4D9QA 3I29A 3E16B 2BD2A 2PFEA 3BSQA 1Z1JA 1V2RT 1UK4A 4MPUA 1G3BA 1AHTH 1IQKA 1S83A 1S0RA 1YCPH 4X1NU 1EX3A 2PV9B 2FS9A 3B23B 4Q7XA 1UMAH 2H6MA 5FCRA 3L6PA 3FP8E 2FYQA 1OWDA 5JDUB 1FY3A 2UUFB 2PW8H 6GCHF 1C5VA 1ANCA 2C8XB 1O3HA 3B8JA 1UVUH 2GP9B 3GYMA 1G2MA 2CN0H 2PHBA 2ZGBH 1YPHC 3ZVAA 2A5KA 4CH8B 3TIUA 2QCYA 5FBEA 1TNIA 1QY6A 1O2GH 1H8DH 1GVKB 1NFYA 1ZJDA 2A4GA 2WPMS 1LTOA 1GHZA 3P95A 4LZ1H 2RA0A 4RKJB 3A82A 1BRAA 1RTFB 2G8TA 3GY5A 4X6NA 1PQ8A 4DY7B 1K1NA 1MKWH 1J16A 2OTVA 3KCGH 1AD8H 2ZGXH 1ELFA 4I33A 1TYNA 4YOJA 3FZZA 1CA8B 2O8MA 9ESTA 2BMGB 4JZEH 2ZCLP 4LXBH 4NGAH 2GT8A 2Q6DA 3EGKH 4ZUHA 3ZZAA 4LK4A 3K6YA 3RUOA 1Q31A 1GHAF 4AOQA 1LPKB 3ATMA 4AX9H 2J92A 1SLWB 4CRGA 2BB4A 2FOGA 3L33A 5A09A 4AG1A 2ZDNA 3SO3A 1P10A 5F8ZA 3QK1A 1TBZH 3SBKA 4YZUA 3V3MA 4IS5A 1MKWK 1A5GH 1MZAA 1NZQH 2H9HA 3HGPA 2XWAA 1SHHB 3BV9B 1QL8A 5E2OA 4X2VA 4HZHA 2ANYA 2WPKS 2K1QA 4H6SB 4ISNA 4JMYA 1IQIA 2KAIB 1O3GA 1V2JT 1PPFE 1O3JA 2OP9A 2FS8A 1C5ZB 1GI8B 2A4RA 4NA9H 1O33A 2F9OA 1MU8B 4JZ1A 1GHWH 1IQMA 1TFXA 2P8OB 4GLYA 3TJVA 4FUGA 5B6OA 1RD3B 1Z6EA 2Y7ZA 3QGNB 3SV6A 2ZECA 2A2XH 1DLKB 3QWCH 4KTSA 4U01A 1TWXB 5EPYA 1NU7B 3RU4D 1KIGH 1LHGH 1QL7A 1QB6A 1OPHB 3VFEA 2CHAB 3FVFB 1G3DA 1O3AA 2ZPSA 1BT7A 1N6YA 2J38A 4FUIA 1E37B 1F7ZA 1ZRKA 2GV7A 4AFSA 2BY9X 4KP0A 1CE5A 4OS2A 3EAJA 3UNRA 2OBQA 1A5IA 1QBOA 1OX1A 3SOSA 1P57B 2BXTH 1NC6A 4XSKU 1ZTJA 3LIWA 4I31A 1MAYA 1ELDE 2QXIA 1UK3A 1THSH 5A0AE 1AFEH 3UTUH 3ESTA 2R2MB 3Q00A 1DITH 1BHXF 1HAHH 2J2UA 4PROA 4WWYA 5L6NH 3SJ9A 2STBE 1LVOA 1O38A 2OC1A 1TGTA 4IBLH 3UUZA 3T5FH 1JMOH 2EI8A 3SU3A 1MCTA 3A89A 1TRMA 3MOCA 1DM4B 1OWIA 1C1TA 2GZ7A 2VIQA 4ZHAA 1DY8A 4FU8A 1ARBA 1ELBA 1RIWC 3SJIA 2VB0A 4XBBA 1DWBH 1O2LA 3K65B 3SNAA 1Z8GA 1NT1A 1G37A 1YPLH 1P01A 3A85A 4IC6A 4CRAA 4X8UH 5E2PA 4NZQA 3KQDA 1VR1H 1PYTC 1NU9A 1Y5BT 3EE0B 1M9UA 4UEHH 1O5FH 3ZVDA 1ESBA 4K1EA 1HAVB 1O2JA 2W7UA 2A7CA 4BAQB 4I8JA 4MNVA 1K1JA 3MYWA 3RXLA 1OP2A 2EEKA 1ETRH 2M5TA 2ZO3H 1A61H 1V2LT 5E0JA 1C2FA 1OWKA 2P93A 1W2KH 2P95A 5EU8A 3PO1B 2XW9A 4CRFA 1AE5A 2UWLA 2ZPRA 1NRNH 3TLOA 8LPRA 1PPZA 1VITF 3SJ8A 3VB5A 3NCLA 2EA3A 2PSXA 1F0UA 3STIA 3EA9A 1BCUH 1EJAA 1IHSH 2GMTB 2RCEA 1B5GH 3UQOA 5A0BA 1CHOG 4DGJA 1EJNA 4K69A 1GI4A 3SU1A 5ESTE 2G4UA 2I6SA 1ELEE 3ZZBA 3AASA 5C5OA 1IQEA 4BTIB 4GAWA 1GHBG 2OLGA 3MU0A 1T8LA 1BTXA 1BZXE 2OUAA 5T6GA 4ZAEA 5EODA 1BA8B 2Y5GA 1Z8RA 8KME2 1V2UT 3BTHE 1H9HE 3RMNH 1JIMA 1WUNH 2FX4A 4HGCA 1C4Y2 4AFQA 4K1SA 1KTTB 2CJIA 1PQ5A 1GMDG 4WVPE 2ZDKA 2ESTE 1Z7KA 3BEIB 2Y82A 5BRRE 1GI5A 1GJ8B 2GCHF 3VGCB 3QTOH 1GBTA 1H9IE 5EXLA 1XX9A 1GL0E 1YP9A 3SZNA 3BG4C 5TCAA 1MD8A 2TPIZ 1AFQB 2FDAA 1LPGB 4MNXA 3M5MA 1MBMA 2BLVA 5FPTA 3LC5A 5DO4H 3ZV8A 3SU4A 2B9LA 1ORFA 2C8ZB 1EAIA 4X6OA 1HGTH 1UCYE 1LQEA 2Z7FE 3T26A 3QLPH 2AGGX 3ZZ5A 3JZ1B 2BY6X 1XUFA 2R3UA 1V2KT 4GHQA 3LOXA 1SGFA 2ZEBA 1CO7E 4OS1A 2GTBA 2UUJB 1O2IA 3S0NA 3PMBB 2DUCA 1MCVA 1NO9H 3PO1C 3RU4E 5FCKA 2FWWA 1GHYH 1WQVH 2ZCKP 3LH3A 2ZHWH 2B5TB 1AIXH 1MQ5A 2QGRA 3TJOA 1MD7A 1TAWA 4K8YA 2W3KA 3I77A 2XCFA 1GVZA 1C1MA 1QA7A 2ANKH 1TB6H 1O3LA 2FMJA 1GJ4H 3RXVA 1IQJA 1EPTA 1FY1A 2OXSA 4THNH 3LGTA 2QF3A 3UNSA 1A3EH 4A1XA 2BXUH 1A4WH 2BD4A 3O8DA 1ZTKA 1GPZA 3F1SB 4I8KA 1BBRE 1XUKA 1MTVA 1CU1A 3BTEE 1D4PB 2Y6TA 1BTHH 1QRXA 1NRSH 3Q76A 1V2PT 3RLYH 3RM2H 1GBFA 1GBEA 3RC4A 2A31A 2VVVA 1DWDH 3GCHC 1RFNA 3BTTE 2O8LA 3F68H 1WV7H 1EQ9A 2FI5E 2ZDLA 4I32A 3UWIA 1AZ8A 1U6QA 3VB3A 1F0TA 1TNLA 2IJOB 1MAXA 2SGPE 1GHVH 1UTLM 2BDGA 3PMJA 2NU2E 4ASHA 2VWMA 2A0QB 2PUQH 2W3IA
chains in the Genus database with same CATH superfamily
3MU4A 2XC5A 4KGAA 3PLPA 1PPEE 1O3NA 3BTFE 3QDZB 2QF4A 3NPSA 4Y8ZA 1BMNH 1GJDB 3M36A 5CHAB 3ZVGA 4TYDA 1TX6A 4VGCC 1OSSA 4UDWH 1ZHPA 3PMAB 2Z9LA 2OK5A 2Y5HA 3GY2A 3RXOA 3RMMH 2BOKA 2FIRH 3ZV9A 2GJGA 2I6QA 3F9HA 3KQBA 2A5IA 2P94A 1O39A 3PV5A 1A5HA 1BB0B 1DFPA 3NUMA 4CBOA 3FFGA 1P0SH 3P17H 1KXFA 2P16A 1HFDA 1O2PA 1YLDA 1ZRBA 2AYWA 2VNTA 3MO3A 4XOJA 2LNCA 1Z8IB 1XUHA 3EE7A 1AZZA 1GCDA 2XBVA 3P8OA 2OD3B 3A8DA 1P2QA 4OM9A 4WY3A 1IQLA 4GSOA 1K22H 3LH1A 2C4FH 4ISHH 2PKSB 1O5EH 4X0WU 3VG8A 1HV7A 4Y0YE 5C67A 2P3TB 3RXAA 5L2ZH 2V35A 4NSYA 1QGFA 1SQTA 1P09A 5GXPA 1QFKH 4NFFA 1MTWA 4AYVB 1O2KA 3ZIAD 3ATWA 3NRLA 2XCNA 1LO6A 3WW7A 1PFXC 1GI7B 2HRVA 5DP5A 1K1PA 2R9PA 5EQRA 5KECA 4RI0A 1TMBH 1CHGA 3BG4B 1AUJA 2J98A 2TGAA 4JZIA 1AN1E 2GVFA 2VINA 3F0PA 1PYTD 4B73A 1QHRB 2FOEA 1XUIA 2WPLS 1G3EA 5C1YA 4CRBA 5F53A 3MU8A 4K1TA 4AYYB 2ZG0H 3GY6A 1O3BA 5JB9S 1DSTA 3SUDA 1O3MA 3U8TH 1TNKA 3D65E 1BRBE 1E35B 5AFYH 4E05H 4YT7H 4ZKSU 1P12E 2WINI 2ZCHP 5E8EH 3LU9B 3P8GA 2GCHG 1WAYB 1NPMA 1EJMA 4INKA 1C4U2 4AORA 1DWEH 3KYFA 3R0FA 3DSPA 3LJJA 3SJOA 1CGJE 3URCA 4E06H 3A7TA 3GDSA 1ZHRA 1OXGA 1SGQE 5IK2D 5L2YH 3TK5A 4XBCA 2Q1JA 1T31A 2ZNKH 4DIHH 1Y5AT 3ODFA 1GJCB 1ZPCA 4A6LA 1OWHA 2AGIX 1Z6JH 2G5VA 3SZEA 5GDSH 4K5ZA 2BD9A 2FOHA 3W1EA 2AH4X 2AGEX 2XC0A 1TGNA 1UJ1A 1ZR0A 4K2YA 1GBAA 4MPWA 2W5EA 1C9TA 1OHHD 3MH6A 3A80A 4JK6A 1W13U 2FXRA 2K0QA 1V2MT 1FY8E 5GCHF 4O9VA 1HAIH 4TPIZ 5HKKD 1S6LA 5C94A 1VCQA 5DP9A 1JOUB 2FTLE 1GBDA 3G01A 4FUEA 3F9EA 4ABDA 2J97A 1OS8A 2ODPA 1AI8H 1FMGA 5FL7D 1HAPH 3RXCA 2ZIQH 5DP3A 4F48B 2BD3A 1HAZB 1SGPE 2ZP0H 4X6MA 4FUFA 1Z1IA 1SC8U 2VH0A 4ISOA 1O3KA 1NFUA 1O2OA 1QQ4A 3A84A 4LZ4B 1UVPA 1QRZA 2XC4A 2BYAX 1B0FA 1L1JA 4ZHLU 1GMHG 3E6PH 3AW1A 4A1VA 2AIPA 1AO5A 3B9FH 2SGEE 2PKAA 2JJ1D 1GI2A 1SOTA 1SQAA 1EASA 1GCTC 5LH8A 3ITIA 2JH5D 2CF8H 3TNTA 1BMLA 3GY8A 1AB9B 3ZVFA 1O5GH 3N7DA 5JBBS 3SNBA 1UTQA 1BITA 1F2SE 1C5PA 3BTGE 2PKSC 1CSOE 1SLVB 3TPIZ 3E0NB 4QT8C 1V2NT 4J2YB 4OS6A 4WH6A 1DXWA 2HPQH 2VWNA 1MUEB 1PPGE 1Y59T 2OQ5A 1SGCA 3LGYA 3PRDA 1P03A 4OGYA 5F03A 4IN2A 2PTCE 4TY6A 1LVBA 5J4QA 2XNDD 2BVXH 1TA2A 1UHBB 1ELVA 1SGDE 1CT4E 3QTVH 2PTNA 3KGPA 4NG9H 1KSNA 4WMFA 4JZDH 2XOKD 4FU9A 2QV1A 2TGTA 1ESAA 4ABJA 1FY5A 7ESTE 2ZQ1A 1KY9A 2F91A 1TNGA 1KXBA 1ZYOA 3K2UA 1WTGH 3RXQA 1EKBB 2SGQE 5FBIA 3VB6A 2D2DA 4NFEA 2FTMA 4HFPB 1ESTA 1DDJA 4DJZB 3A7WA 2WPDD 4YOIA 3DFLA 1SLUB 3A7XA 3SNEA 4OS7A 2WZQA 1S6FA 3U1IB 1S6HA 1EPTB 3O8BA 2Y80A 4K60A 2BDBA 3UREA 4BTUB 2HNTF 1FPCH 4B76A 3A8AA 1A2CH 2C90B 1YLNA 2YNAA 3RXTA 4ABEA 4NIYA 9LPRA 1GDQA 5EG4A 3U8OH 1O0DH 1UTPA 4P02A 2Y81A 3UAIC 4B6FA 3V0XA 2ZA5A 3GCHB 4CRDA 5C3NA 1FI8A 1UVSH 5DSFA 3SNDA 2R2WU 3LGUA 4GUXA 1XXDA 1EZQA 2ZU1A 4GCHF 1GGDB 1SHYA 1ZZZA 2CF9H 1QQUA 3DD2H 4DG4A 4CREA 3LDXH 3VEQB 1TPOA 1BJVA 5K0HA 2QXJA 5JPMH 2AHME 5HIYA 2PP6A 1OKXA 1QR3E 1TQ7B 2BQ7B 1GMHF 3TH4H 4Z6AH 1EZUC 2FZZA 2BVRH 1XVOA 3LC3A 4NZLA 1O37A 1C5WB 2HPPH 2HVXA 4R0IA 3ZZ7A 1C5TA 1DS2E 2YMSC 3SQHE 1SGTA 1FJSA 1HYLA 3ODDA 2BX4A 3FANA 1O5BB 4MTBA 5AF9H 2B8OH 1BTPA 4AGKA 1V2TT 1ABIH 1QCPA 3T2NA 5CE1A 4YESB 3V13A 2RG3A 3GDVA 1GBLA 1ZSKA 1PQAA 4BOHA 1TABE 2DE8A 4CBNA 4CHAC 1JWTA 4IC5A 3TGKE 2FYRA 4NIWA 1L4DA 2BQWB 4ZKRU 1P8VC 3OYPA 5C1UA 1C2EA 1UCYK 1MABB 1C5NH 1P3CA 3TITA 2WYGA 5EJ1A 3C1KA 5LGOA 2ZGCA 2SGAA 4Y71A 1CGIE 2V3OH 1K9OE 1GBCA 1AUTC 2HVYB 1BHXB 3BEFB 3RXIA 1J15A 3BIUH 4IMQA 3A86A 3F3BA 1C5MD 1C1QA 1G2LA 2ANWA 2TBSA 3GY4A 2QY0B 4RSPA 5F6MA 1BMFD 1F0RA 4TWWA 3GYLB 3SN8A 1UCYH 2QYIA 1O5CB 3RXUA 1SQRA 3RM0H 3VB4A 1OOKB 1GL1A 4AGJA 1SGYE 3RU4T 1QJ6B 2VWLA 4Q7ZA 3FP7E 3MNXA 1ARCA 3ZZDA 1C1RA 1GMCG 1FY4A 1DWCH 1O30A 1O36A 3KQ5A 1O2HA 3ZVEA 4YXWD 5EPNA 1KTSB 5DJ7A 1OYQA 1YPMH 1ZJKA 3PV4A 2H9EH 3C27B 1Y3UA 3SU2A 2XYAA 1WQSA 4X6PA 3ZZ4A 3NK8A 7KMEH 2KZ4A 2F43B 1S84A 1RJXB 1SGEE 2YNBA 2B7DH 1DANH 2NU1E 1FXYA 2KM0A 2J5UA 1IQNA 2ZFSA 3TNSA 1TIOA 1ID5H 4ABAA 2AMQA 8GCHF 2PKAB 1ELTA 2YOLA 1P2IA 1E1QD 1UTNA 1YCPM 2A4OA 1YF4A 4ZKOU 4U32A 2PGBB 2XBYA 4MPVA 3KL6A 1P04A 4XBDA 3F2GA 1GWAA 1T8NA 1C4V2 1KYNA 2FM2A 3GOVB 4ZH8A 5LPRA 1JXPA 2P3UB 2BY5X 1K1OA 1BRUP 1A1RA 1BTYA 4Y8YA 3TK6A 3OX7U 5GJ4B 2R0LA 3TH2H 1OP8A 5C0UA 1HBTH 3RXJA 3MH5A 2EQNA 5TJXA 1VCPA 3F0OA 3OAAD 2ULLA 3QGJA 1SR5C 3S9CA 1CGHA 2JETB 1VGCC 4Y0ZE 1EOLA 1GBIA 3FO8D 3SV8A 4Q7YA 1A0JA 1BJUA 3PM3A 3NZIA 2Z9KA 4X1QU 1C9PA 4GVUA 3HK6B 3PWBA 4HG6A 5AFZH 3U69H 2BDHA 3LGWA 1C1PA 3UR6A 2G5NA 4NIVA 1O2YA 1O3PB 4JYUH 4MNYA 4AC9A 2QE7D 4DW2U 2ZPQA 4Y79A 1HXEH 1EB1H 2BHGA 2BDAA 1FAKH 2P3FH 5IDKA 1SLXB 2OBOA 4D9RA 2C3SA 1O3EA 3GS9A 3OEED 5IYTA 1HJ8A 1FDPA 4WXIA 1F5RA 1EXFA 4B1TA 2BD8A 1TBRH 1FIWA 2BVSH 4Y6DA 3BTDE 4OS4A 4ACBA 1C5UA 1SGFG 4NCYA 3OSYA 5EJZA 1V2ST 2ALVA 3HGNA 4Y10E 5A2MH 4B75A 2FI3E 1H8HD 2KCOA 1C1WH 1KXEA 1UVOA 1YLCA 2W6ID 4DURA 1O2ZA 3PV2A 2WPHS 1DUAA 2ZFQH 4CHAB 1SMFE 2GCTC 1HUTH 3GCNA 3R3GB 3RMOH 3UQVA 3NWUA 3GICB 4GHTA 3MU1A 2A7JA 5FPSA 1C1OA 3RLWH 2ZU4A 2ZWLH 2PGQB 2FX6A 3VXFH 1QL9A 3ATIA 2HNTE 1AVXA 1INCA 1HPGA 1GI3A 2NWNA 2AEIH 2CV3A 4IN1A 3SUGA 1TRNA 3ATLA 3GCOA 4UFFH 2Z3EA 1F92A 2PLXA 1GG6B 2RDLA 3E8LA 3D62A 1V2WT 2UUKB 2AIQA 1NROH 3A88A 1GI6A 2ZFFH 2HGTH 1D3PB 1N8OC 1SB1H 5EIYA 1COWD 5JB8S 3UOUA 1D6RA 1F5KU 3RXPA 2ZHQH 3MNBA 1AVWA 1D3TB 5C20A 1GDNA 2BY7X 2KFWA 1EFRD 1J8AA 2ZHEH 3H7TA 3M5OA 1K1IA 6ESTA 1AGJA 1N8OB 4RT0A 1IQHA 2DE9A 3OU0A 2HLCA 3MMGA 5FXLA 2XWBI 1W12U 2WYJA 3FAOA 1GMDF 2EI7A 5FPYA 1RTKA 2CGAA 1P9SA 1FPHH 1NFWA 4O97A 1QIXB 3ZYDA 1WTHD 1B0EA 2BZ6H 5C17A 4X1SU 3W95A 1AKSB 2OINA 4IW4E 1AVGH 4Z0KA 3U1JB 4I8GA 3FN8A 1GBKA 3P6ZB 3M7TA 4I86A 4X8TH 5DG6A 4F49A 2VJ1A 4O03A 3U9AH 1LCYA 1VJAU 1HDTH 2VVUA 3HKJB 2WUCA 1VZQH 1LVMA 3EA8A 1D6WA 2FOCA 1GBMA 4OS5A 1ZMNA 1Z8JB 1EOJA 4AFZA 1DPOA 3SGAE 3ZYEA 4NA8A 1MTNB 1V2OT 2WV4A 3A8BA 1GI1A 3V12A 3W94A 1MQ6A 2L6OA 3E1XB 3PTBA 2V0BA 1AQ7A 1SGNE 2FOAA 4MNWA 1Y5UT 2SGFE 4R8TB 1NFXA 4X8VH 1JRSA 1O5AB 1P06A 2HALA 2R3YA 2KCYA 3BIVH 1UTKA 1K2I1 4K8BA 1AB9C 2ODQA 1TBQH 1ZPBA 5HMAA 2M2AA 2VH6A 3PWCA 1IAUA 4M9FA 1G32B 1GI0A 4B2AA 2WPJS 2SNVA 1BTZA 3MU5A 1FV9A 1TX7A 5A8ZA 1FIZA 2Z94A 3A7VA 4YTAA 2XNIA 4FVDA 2G52A 1THRH 1O2MA 1C5XB 2PWXA 1GBJA 1GJBB 1PPHE 2UWOA 2ZZUH 1QZ8A 3BTKE 3PYHA 4CR5A 3L3TA 1EAWA 2ZTYA 3SI4H 5I46H 2ZGJA 3UIRA 2JETC 1S5SA 1T4VH 2A45B 2GDDA 3S7KB 5G4BA 3SHCH 1LHCH 1GJ9B 3CENA 2QIQA 2FI4E 1E79D 3ENSB 2KAIA 1HAXB 3HKIB 1V6DA 3MNSA 1XMNB 3SGQE 1TQ0B 3DUXH 3PLBA 1AE8H 2OC7A 2V6NA 2FLBH 5F8XA 3LJOA 4MG3A 3Q3XA 3TVJB 1CHOF 1HCGA 2UUYA 2OC0A 3O8CA 1C5OH 1O2WA 1SGRE 3M3VA 4BXWA 1NTPA 4Y11E 1AY6H 2Z6BD 1MTUA 2ZFRH 4DOQA 1LVYA 2Z9JA 5HXFA 5C1XA 1V3XA 3UY9A 4I7YH 1CBWB 2JH0D 3MH7A 3MO6A 4RKOB 3NKKA 3FZDA 1NRPH 1P2MA 1BDAA 3SW2B 4DVAU 1AMHA 2TGPZ 2A2QH 3A81A 3GISB 3K9XB 3PTNA 4NA7A 1HAYB 5J4SA 2VIVA 1IHTH 1EP6A 1NN6A 1W7GH 2ZI2H 1YKTA 1C1NA 3GCTG 4A5TS 1RRKA 4B2BA 1F0SA 1TGBA 3AAVA 1O31A 3M61U 1C5QA 1LHEH 3ZZ8A 3SJKA 2PR3A 1WBGB 2PSYA 2G81E 1BBRH 3RDZA 1O2VA 1NRQH 1YYY1 1MZDA 2VGCB 5FAHA 1AWFH 1HIAA 1L1NA 4NWKA 4TY7A 2HNTC 1C2DA 2W7SA 1LDTT 2BDCA 2JJ2D 4A1TA 1NRRH 1SOZA 1IOEA 1T4UH 3M7QA 5CHBA 8ESTE 1DUEA 4H6TA 1P11E 1YY3A 1C1SA 2KCPA 2AFQB 3QX5H 6CHAC 1SVPA 1P02A 1XVMA 4Y76A 3T28A 1VCWA 1DVAH 1MTNC 3E90B 5DK1A 1PQ7A 1QTFA 3SUEA 2VU8E 2G4TA 1C5LH 6LPRA 1LHFH 2Z9GA 3Q3YA 1EAUA 3IWMA 4AG2A 2GMTC 1SFIA 4FVBA 4XD7D 4AB8A 1KXCA 1P2OA 1CT2E 1K21H 3RXFA 1O2TA 3A7ZA 4NWLA 1UVTH 1HAVA 4DT7B 1VITH 3M35A 4FUJA 4WMDA 5LPEA 4U2WA 3Q3KA 1FONA 4NSVA 1QBVH 2LP6A 2ZDAH 3SU6A 3TGIE 4J1YA 2CXVA 4BAKB 1OYTH 1FQ3A 4JZFH 2GCTB 4AFUA 1A0LA 4DT4A 1P05A 4TT3D 4FUCA 1YBWA 4YLUA 3UWJH 5HM9A 2JDID 5CMXH 3U98H 1ETSH 4XE4A 3OE7D 5K7RA 1Q3XA 4ZXYH 2CK3D 1L2EA 4D7GA 1H4WA 1QB9A 1C5YB 1DXPA 1NY22 1RXPA 3S69A 2BTCE 3KHVA 4HI3A 2VIDA 4CR9A 5DP4A 4VGCB 1K28D 3SU0A 1S82A 4ABHA 3OEHD 5CHAC 1C2JA 1L0ZA 3BTQE 3DFJA 3KIDU 2UWPA 3ZZCA 1A0HB 1QJ1B 1FX0B 1TNHA 3CP7A 3ZVBA 2D1JA 1SKYE 1HNEE 1UTMA 4ABIA 3Q77A 2VGCC 4ZHMU 3UOPA 4BAOB 1XKAC 1BRCE 1UTOA 1HJAC 2W26A 1C2LA 4XRNA 5T6DA 2FO9A 1ACBE 2FP7B 2D26C 3LGVA 2F4LA 3EDXB 4MPXA 5A8XA 5EQQA 2Q6GA 2ZC9H 2XRCA 5JBCS 1MMJN 1L1GA 2A5AA 1O3FA 1XKBC 2QAAA 2WUBA 2ZHFH 1PPCE 3DT0H 2NU4E 4XDEA 3RXBA 4ESTE 1FLEE 4H42U 1ANEA 1DY9A 4WXVA 1E36B 1IQGA 2ZTZA 3UNQA 1T8OA 3T27A 5EW1H 4SGBE 1FNIA 2V3HH 2HOBA 1HXFH 2KX4A 1AKSA 4INLA 3SGBE 2ZDVH 2GZ9A 3A7YA 3H5CB 3DSGA 5JBAS 2ANMH 2FLRH 2GDEH 1J17T 5GIBA 4Y7BA 4UFGH 2PUXB 1PJPA 4X1PU 2BM2A 1UTJA 2BZAA 1O32A 1WYKA 1O2SA 1O3CA 1YPGH 5PTPA 1Q2WA 3ZZ6A 1C2HA 5GNDA 4H4FA 5JBTA 3MWIU 3WY8A 5C2ZA 2QN5T 4ABFA 1KDQB 1BMAA 1WOFA 4IGDA 1RTLA 2O8UA 3SHAH 1GI9B 5F8TA 4F55A 1QURH 3PROA 4X2YA 3RXSA 5AVDA 3V7TA 1HLTH 1EZSC 3MO9A 3A83A 5B6LA 2RFKC 2F9VA 2F9PA 4FU7A 4YLQH 1GVLA 2C8YB 3N7EA 1XXFA 1MU6B 2BDYA 2Q6FA 4AB9A 4ZMAH 1ZSLA 1MKXH 4HTCH 4LOYH 5ESBA 1ZLRA 1DOJA 4MLFB 2AMDA 2OC8A 3UFAA 5JYIA 1S0QA 1TE0A 3T25A 4MVNA 3TJUA 3M7UA 1ZGIA 1N1LA 1YPHE 1P2JA 3CNRA 3CS7A 4ZXXH 2G51A 1TA6A 1TLDA 1EUFA 1Y3YA 3ELAH 2NU0E 3VGCC 1SBWA 1TOMH 1KDQA 2Z3CA 1Y3VA 1GJ7B 3M3TA 2WV5A 4I8LA 1AWHB 4O3TA 2R0KA 2O8TA 4D7FA 1ANBA 4B2CA 1MBQA 3SYJA 1BTUA 1TMUH 1H9LB 1W7XH 5EJLA 1LKBA 1TGSZ 4ZKNU 1ETTH 3P8NA 2AMPA 2FPZA 2GD4B 4F4OC 3DA9B 3ZZ9A 1FUJA 3OTPA 2SGDE 3OY6U 4AN7A 2JKHA 3O8RA 1UO6A 5A0CA 3P8FA 4CH2B 4UFDH 5LPFA 1BUIA 3F2HA 4MDSA 1W0ZU 3NXPA 2A1DB 2F9UA 2ZDMA 1H8ED 3DCLA 1FN6A 1HAGE 1OP0A 4DCDA 3P70B 2AS9A 1O2UA 1P9UA 1TOCB 3RXRA 3T29A 3MFJA 1AFQC 1O2NA 2NU3E 4YO9A 1C2KA 3KF2A 4KTUA 1EB2A 1O2XA 1GHBF 3MH4A 4O3UA 3QUMP 3P92A 1YWUA 3SI3H 3UPEA 3BEUA 3QZRA 1GBBA 4JYTA 4BANB 4TWYA 4Q80A 4BXSA 1EAXA 2A7HA 3AW0A 5A8YA 3FP6E 3TH3H 1D9IA 1LPZB 1EATA 1HJ9A 1W8BH 1E34B 1TX8A 5EGMA 2O9QA 3HK3B 1QBNA 1SGIB 1O34A 3LONA 1SG8B 4GPGA 2IOTA 8GCHG 1G30B 5T6FA 2FOBA 1CA0B 1L4ZA 3LKWA 4ZCNA 2F83A 1XUGA 3ZZ3A 1O3OA 3K6ZA 4X2WA 1TGCA 1C2IA 3OY5U 3BTME 3RP2A 3F9GA 1EPTC 1DSUA 3RXKA 5DN6D 3RXDA 2XBXA 1EP5A 2ZF0H 3JZ2B 4Q2KA 1O5DH 1GJ6A 3GY3A 1BBRK 1ELGA 3BF6H 1QJ7B 3F2FA 2ZHDA 1ZGVA 1LHDH 4FUDA 3TGJE 2B0FA 3QO6A 1VKYA 1YCPK 4BAHB 1CVWH 2F9BH 4ISIH 3SUFA 3MNCA 4B71A 4X1RU 1SSXA 2A32A 1JIRA 3SNCA 5C5NA 1BIOA 4YM9A 7GCHG 5HGGA 3LPRA 4JYVH 1LMWB 1O3DA 1UHBA 5C0TA 2BD7A 4ABBA 1HIAB 3BTWE 4UD9H 3SQEE 3AAUA 4TSFD 2GV6A 3H7OA 1TPAE 1J14A 3PLKA 2LPRA 3BG8A 2BD5A 1TPSA 1H8IH 1O35A 1W11U 2QF0A 3TK9A 1TNJA 1O2QA 3MI4A 4YOGA 4WJG2 4BNRA 2VVCA 1T7CA 3A87A 1RS0A 4ASUD 3D49H 7LPRA 4KELA 1V2QT 4UONA 3E91A 1ZSJA 5T3HA 4SGAE 1BMMH 2SNWA 1N6XA 6GCHG 4Y7AA 3VB7A 1Y3XA 4I8HA 4RT1A 1D3DB 1E0FD 2TIOA 6CHAB 1WXRA 4IMZA 2XBWA 3GY7A 1S85A 4M7GA 1KLIH 1YPKH 7GCHF 2Y5FA 4CRCA 1X7AC 4YT6H 1W10U 2GX4A 1C2GA 1W0YH 1WCZA 1CA0C 2ALPA 1D3QB 3KEEA 3KN2A 4A92A 5ABWA 1A7SA 4E7NA 1P2NA 1VGCB 1YM0A 2ZQ2A 1YPJH 4ZROA 5L30H 1PPBH 1G9IE 3UR9A 2QXHA 1P2KA 4RN6A 3FOAA 3S9AA 3TJNA 1ABJH 1TMTH 1XUJA 1SFQB 1ZPZA 2BLOA 2F3CE 1KXAA 2TRMA 2ZKSA 2ZTXA 5FHTA 5E0GA 1HB0B 1TALA 2J4IA 5HYOA 2BLWA 4B74A 2WPIS 1E38B 4MQAA 3PMHB 1KXDA 3FKSD 1C5RA 3F9FA 1S81A 1GBHA 2AERH 1QRWA 3M37A 2EC9H 1RGQA 4INHA 1EZXC 5GCHG 3URDA 2ILNA 4Y8XA 2WV9A 1LQDB 4TPYA 2EY4C 1DICA 3PB1E 4NIXA 1JBUH 1QB1A 2P8OC 2QC2A 2G00A 1ELCA 2YMSD 5EXMA 1QA0A 1DX5M 2ZFTA 1TRYA 3S7HB 5EW2H 3RXGA 2P59A 1HRTH 3LGIA 5DPAA 3I78A 1AU8A 1VJ9U 3IITA 4A7IB 1IQFA 2GGVB 2FODA 2J98B 2VWOA 4UFEH 5FX6A 5TCCA 2JH6D 2ZFPH 2FOMB 3M5NA 2OCVB 2VIOA 1DE7H 2C93B 1WSSH 3RC6A 4KKDA 5EQSA 3OTJE 1RIWB 3AVZA 1GMCF 4WH8A 4FUHA 1K1MA 1FAXA 1KLTA 1SI5H 4Q4LA 5BPEA 1J9CH 3S9BA 4JK5A 4ABGA 1SPJA 3A8CA 2GKVE 2QXGA 1WU1A 3RMLH 2XXLA 2BOHB 1G3CA 1JRTA 2IJD1 3LT3A 2SFAA 1OWJA 1VITG 5E0HA 5EXNA 3TU7H 1ZTLA 1T8MA 2CMYA 2BY8X 1XM1A 2IN2A 1W14U 2D8WA 3SV7A 1BQYA 1G36A 2C8WB 3T62A 5ETXA 3ZVCA 4OGXA 4BTTB 2ZU5A 3U8RH 3CS0A 2GZ8A 1C1VH 1ZMLA 5AHGH 2RA3A 3F6UH 4AZ2B 1P3EA 5DP6A 5DGJA 1CQQA 1A46H 3N7OA 4E7RG 1GJ5H 1E1RD 2J95A 3E3TA 4DIIH 2EI6A 5GPIB 1QNJA 1NESE 4FUBA 3E0PB 2ODYB 3M3SA 1V2VT 1GGDC 2BX3A 2J34A 1W3CA 3RXEA 1Z71A 2H9TH 4FXGH 2ZGHA 4K3JA 2OQUA 4BAMB 3GCTF 1BOQA 2IPHA 2F9NA 3BN9A 1A3BH 2V7QD 4KTCA 2ZU3A 1UK2A 5DP8A 2VIPA 2BQ6B 1ZMJA 4ISLA 1F5LA 1KLJH 2G55A 1GDUA 2Y7XA 2Z9IA 1HJAB 1TONA 1W0KD 1LKAA 3HPTB 1C1UH 3D23A 4GCHG 1GCTB 1DLEA 1MH0A 2GT7A 2QA9E 2FEQH 1SQOA 3ATKA 1H1BA 1FZZA 2A4QA 2BLQA 3GDUA 5DP7A 3RXHA 2FOFA 3EYDA 1SL3A 4D76A 4UE7H 2HWLB 1GHXH 3DSOA 1TPPA 2W6JD 1GG6C 2FESH 3VPKA 1YGCH 5SGAE 3IG6B 3EA7A 3RXMA 1CBWC 1HAOH 5GWZA 1O2RA 1YC0A 2H5DA 3QN7A 1CT0E 3DHKH 3SV2H 2BDIA 2RDEA 1Y3WA 4U30A 2J9NA 3SU5A 1GHAG 5H4IB 1MTSA 2ZU2A 4JCNA 1BTWA 1C5SA 1C2MA 3HATH 5I25A 5HIZA 2CHAC 1GJAB 2LELA 2QF5A 1K0HA 1OWEA 2H1UA 1NS3A 2ASUB 5EOKA 1YPEH 4X8SH 3SV9A 5DKMA 1B7XB 5FX5A 2O8WA 3MHWU 1ZOMA 1ANDA 2STAE 3KNXA 3QZQA 5HM2A 4WMEA 4D8NA 1ELAA 2H2ZA 3VXEH 1T32A 3KYGA 1ZHMA 3KQCA 3MTYA 3RC5A 2XTTB 3EQ0H 2Z3DA 5T1VA 1Y8TA 3STJA 4WF8A 2H5CA 3M5LA 1K1LA 1O3IA 2THFB 3SORA 1DT2A 4X2XA 2VIWA 4XFQA 3KQEA 1MKXK 2J94A 2TGDA 1FN8A 1THPB 1NM6A 4D9QA 3I29A 3E16B 2BD2A 2PFEA 3BSQA 1Z1JA 1V2RT 1UK4A 4MPUA 1G3BA 1AHTH 1IQKA 1S83A 1S0RA 1YCPH 4X1NU 1EX3A 2PV9B 2FS9A 3B23B 4Q7XA 1UMAH 2H6MA 5FCRA 3L6PA 3FP8E 2FYQA 1OWDA 5JDUB 4Z1MD 1FY3A 2UUFB 2PW8H 6GCHF 1C5VA 1ANCA 2C8XB 1O3HA 3B8JA 1UVUH 2GP9B 3GYMA 1G2MA 2CN0H 2PHBA 2ZGBH 1YPHC 3ZVAA 2A5KA 4CH8B 3TIUA 2QCYA 5FBEA 1TNIA 1QY6A 1O2GH 1H8DH 1GVKB 1NFYA 1ZJDA 2A4GA 2WPMS 1LTOA 1GHZA 3P95A 4LZ1H 2KR7A 2RA0A 4RKJB 3A82A 1BRAA 1RTFB 2G8TA 3GY5A 4X6NA 1PQ8A 4DY7B 1K1NA 1MKWH 1J16A 2OTVA 3KCGH 1AD8H 2ZGXH 1ELFA 4I33A 1TYNA 4YOJA 3FZZA 1CA8B 2O8MA 9ESTA 2BMGB 4JZEH 2ZCLP 4LXBH 4NGAH 4ACAA 2GT8A 2Q6DA 3EGKH 4ZUHA 3ZZAA 4FETA 4LK4A 4B6EA 3K6YA 3RUOA 2V3MA 1Q31A 1GHAF 4AOQA 1LPKB 3ATMA 2IPQX 4AX9H 2J92A 1SLWB 4CRGA 2BB4A 2FOGA 3L33A 5A09A 4AG1A 2ZDNA 3SO3A 1P10A 2JIZD 5F8ZA 3QK1A 1TBZH 3SBKA 4YZUA 3V3MA 4IS5A 1MKWK 1A5GH 1MZAA 1NZQH 2H9HA 3HGPA 2XWAA 3U28C 1SHHB 3BV9B 1QL8A 5E2OA 4X2VA 4HZHA 2ANYA 2WPKS 2K1QA 4H6SB 4ISNA 4JMYA 1IQIA 2KAIB 1O3GA 1V2JT 1PPFE 1O3JA 2OP9A 2FS8A 1C5ZB 1GI8B 2A4RA 4NA9H 1O33A 2F9OA 1MU8B 4JZ1A 1GHWH 1IQMA 1TFXA 2P8OB 4GLYA 3TJVA 4FUGA 5B6OA 1RD3B 1Z6EA 2Y7ZA 3QGNB 3SV6A 2ZECA 2A2XH 1DLKB 3QWCH 4KTSA 4U01A 1TWXB 5EPYA 1NU7B 3RU4D 1KIGH 1W0JD 1LHGH 1QL7A 2K8IA 1QB6A 1OPHB 3VFEA 2CHAB 3FVFB 1G3DA 1O3AA 2ZPSA 1BT7A 2WHXA 1N6YA 2J38A 4FUIA 1E37B 1F7ZA 1ZRKA 2GV7A 4AFSA 2BY9X 4KP0A 1CE5A 4OS2A 3EAJA 3UNRA 2OBQA 1A5IA 1QBOA 1OX1A 2L74A 3UB0A 3SOSA 1P57B 2BXTH 2YMSB 1NC6A 4XSKU 1ZTJA 3LIWA 4I31A 1MAYA 1ELDE 2QXIA 1UK3A 1THSH 5A0AE 1AFEH 3UTUH 3ESTA 2R2MB 3Q00A 1DITH 1BHXF 1HAHH 2J2UA 4PROA 4WWYA 5L6NH 3SJ9A 2STBE 4FOUC 1LVOA 1O38A 2OC1A 1TGTA 4IBLH 3UUZA 3T5FH 1NBME 1JMOH 2EI8A 3SU3A 1MCTA 3A89A 1TRMA 3MOCA 1DM4B 1OWIA 1C1TA 2GZ7A 2HLDD 2VIQA 4ZHAA 1DY8A 4FU8A 1ARBA 1ELBA 1RIWC 3SJIA 2VB0A 4XBBA 1DWBH 1O2LA 3K65B 3SNAA 1Z8GA 1NT1A 1G37A 1YPLH 1P01A 3A85A 4IC6A 4CRAA 4X8UH 5E2PA 3H09A 4NZQA 3KQDA 1VR1H 1PYTC 1NU9A 1KMHB 1Y5BT 3EE0B 1M9UA 4UEHH 1O5FH 3ZVDA 1ESBA 4K1EA 1HAVB 1O2JA 2W7UA 2A7CA 4BAQB 4I8JA 4MNVA 1K1JA 3MYWA 3RXLA 1OP2A 2EEKA 1ETRH 2M5TA 2ZO3H 1A61H 1V2LT 5E0JA 4P00A 1C2FA 1OWKA 2P93A 1W2KH 2P95A 5EU8A 5CDFE 3PO1B 2XW9A 4CRFA 1AE5A 2UWLA 2ZPRA 1NRNH 3TLOA 8LPRA 1PPZA 1VITF 3SJ8A 3VB5A 3NCLA 2EA3A 2PSXA 1F0UA 3STIA 3EA9A 1BCUH 1EJAA 1IHSH 2GMTB 2RCEA 1B5GH 3UQOA 5A0BA 1CHOG 4DGJA 1EJNA 4K69A 1GI4A 3SU1A 5ESTE 2G4UA 2I6SA 1ELEE 3ZZBA 3AASA 5C5OA 1IQEA 4BTIB 4GAWA 1GHBG 2OLGA 3MU0A 1T8LA 1BTXA 1BZXE 2OUAA 5T6GA 4ZAEA 5EODA 1BA8B 2Y5GA 1Z8RA 8KME2 1V2UT 3BTHE 1H9HE 3RMNH 5KEDA 1JIMA 1WUNH 2FX4A 4HGCA 1C4Y2 4AFQA 4K1SA 1KTTB 2CJIA 1PQ5A 1GMDG 4WVPE 2ZDKA 2ESTE 1Z7KA 3BEIB 1WDIA 2Y82A 5BRRE 1GI5A 1GJ8B 2GCHF 3VGCB 3QTOH 1GBTA 1H9IE 5EXLA 1XX9A 2WSSD 1GL0E 1YP9A 3SZNA 3BG4C 5TCAA 1MD8A 2TPIZ 1AFQB 2FDAA 2VBCA 3MQKC 1LPGB 4MNXA 3M5MA 1MBMA 2BLVA 5FPTA 3LC5A 1UW7A 5DO4H 3ZV8A 3SU4A 2B9LA 1ORFA 2C8ZB 1EAIA 4X6OA 1HGTH 1UCYE 1LQEA 4Q63A 2Z7FE 3T26A 3QLPH 2AGGX 3ZZ5A 3JZ1B 2BY6X 1XUFA 2R3UA 5KGOA 1V2KT 4GHQA 3LOXA 1SGFA 2ZEBA 1CO7E 4OS1A 2GTBA 2UUJB 1O2IA 3N99A 3PMBB 2DUCA 3S0NA 1MCVA 1NO9H 3PO1C 3RU4E 5FCKA 2FWWA 1GHYH 1WQVH 2ZCKP 3LH3A 2ZHWH 2B5TB 1AIXH 1MQ5A 2QGRA 3TJOA 1MD7A 1TAWA 4K8YA 2W3KA 3I77A 2XCFA 1GVZA 1C1MA 1QA7A 2ANKH 1TB6H 2KCAA 1O3LA 2FMJA 1GJ4H 3RXVA 1IQJA 1EPTA 2OXSA 1FY1A 4THNH 3LGTA 2QF3A 3UNSA 1A3EH 4A1XA 2BXUH 1A4WH 2BD4A 3O8DA 1ZTKA 1GPZA 3F1SB 4I8KA 1BBRE 1XUKA 1MTVA 1CU1A 3BTEE 1D4PB 1BTHH 1QRXA 2Y6TA 3PRBA 1NRSH 3Q76A 1V2PT 3RLYH 3RM2H 1GBFA 1GBEA 3RC4A 2A31A 2VVVA 1DWDH 3GCHC 1RFNA 3BTTE 2O8LA 3F68H 1WV7H 1EQ9A 2FI5E 2ZDLA 3WWFA 4I32A 3UWIA 1AZ8A 1U6QA 3VB3A 1F0TA 1TNLA 2IJOB 1MAXA 2SGPE 1GHVH 1UTLM 2BDGA 3WWBA 1NBMD 3OFND 3PMJA 2NU2E 4ASHA 3AK5A 2VWMA 2A0QB 2PUQH 2W3IA
chains in the Genus database with same CATH topology
3MU4A 2XC5A 4KGAA 3PLPA 1PPEE 1O3NA 3BTFE 3QDZB 3NPSA 4Y8ZA 1BMNH 1GJDB 3M36A 5CHAB 3ZVGA 4TYDA 1TX6A 4VGCC 1OSSA 4UDWH 1ZHPA 3PMAB 2Z9LA 3RXOA 2Y5HA 3GY2A 3RMMH 2BOKA 2FIRH 3ZV9A 2I6QA 3F9HA 3KQBA 2A5IA 2P94A 1O39A 1A5HA 1BB0B 1DFPA 3NUMA 4CBOA 3FFGA 1P0SH 3P17H 1KXFA 2P16A 1HFDA 1O2PA 1YLDA 1ZRBA 2AYWA 2VNTA 3MO3A 4XOJA 2LNCA 1Z8IB 1XUHA 1AZZA 1GCDA 2XBVA 3P8OA 2OD3B 3A8DA 1P2QA 4WY3A 1IQLA 4GSOA 1K22H 3LH1A 2C4FH 4ISHH 2PKSB 1O5EH 4X0WU 1HV7A 4Y0YE 5C67A 2P3TB 3RXAA 5L2ZH 2V35A 4NSYA 1QGFA 1SQTA 1P09A 5GXPA 1QFKH 4NFFA 1MTWA 4AYVB 1O2KA 3ATWA 2XCNA 1LO6A 1PFXC 1GI7B 2HRVA 5DP5A 1K1PA 2R9PA 5EQRA 1TMBH 1CHGA 3BG4B 1AUJA 2TGAA 4JZIA 1AN1E 2GVFA 2VINA 4B73A 1PYTD 1QHRB 2FOEA 1XUIA 2WPLS 1G3EA 5C1YA 4CRBA 3MU8A 4K1TA 4AYYB 2ZG0H 3GY6A 1O3BA 5JB9S 1DSTA 3SUDA 1O3MA 3U8TH 1TNKA 3D65E 1BRBE 1E35B 5AFYH 4E05H 4YT7H 4ZKSU 1P12E 2WINI 2ZCHP 5E8EH 3LU9B 3P8GA 2GCHG 1WAYB 1NPMA 1EJMA 4INKA 1C4U2 4AORA 1DWEH 3R0FA 3LJJA 3SJOA 1CGJE 3URCA 4E06H 3A7TA 3GDSA 1ZHRA 1OXGA 1SGQE 5L2YH 3TK5A 4XBCA 2Q1JA 1T31A 2ZNKH 4DIHH 1Y5AT 3ODFA 1GJCB 1ZPCA 4A6LA 1OWHA 2AGIX 1Z6JH 2G5VA 5GDSH 4K5ZA 2BD9A 2FOHA 2AH4X 2AGEX 2XC0A 1TGNA 1UJ1A 1ZR0A 4K2YA 1GBAA 4MPWA 2W5EA 1C9TA 3MH6A 3A80A 4JK6A 1W13U 2FXRA 1V2MT 1FY8E 5GCHF 4O9VA 1HAIH 4TPIZ 1VCQA 5DP9A 1JOUB 2FTLE 1GBDA 3G01A 4FUEA 3F9EA 4ABDA 1OS8A 2ODPA 1AI8H 1FMGA 1HAPH 3RXCA 2ZIQH 5DP3A 2BD3A 1HAZB 1SGPE 2ZP0H 4X6MA 4FUFA 1Z1IA 1SC8U 2VH0A 4ISOA 1O3KA 1NFUA 1O2OA 1QQ4A 3A84A 4LZ4B 1UVPA 1QRZA 2XC4A 2BYAX 1B0FA 1L1JA 4ZHLU 1GMHG 3E6PH 3AW1A 4A1VA 2AIPA 1AO5A 3B9FH 2SGEE 2PKAA 1GI2A 1SOTA 1SQAA 1EASA 1GCTC 5LH8A 3ITIA 2JH5D 2CF8H 3TNTA 1BMLA 3GY8A 1AB9B 3ZVFA 1O5GH 5JBBS 3SNBA 1UTQA 1BITA 1F2SE 1C5PA 3BTGE 2PKSC 1CSOE 1SLVB 3TPIZ 3E0NB 4QT8C 1V2NT 4J2YB 4OS6A 4WH6A 1DXWA 2HPQH 2VWNA 1MUEB 1PPGE 1Y59T 2OQ5A 1SGCA 3LGYA 1P03A 4OGYA 5F03A 4IN2A 2PTCE 4TY6A 1LVBA 5J4QA 2BVXH 1TA2A 1UHBB 1ELVA 1SGDE 1CT4E 3QTVH 2PTNA 3KGPA 4NG9H 1KSNA 4WMFA 4JZDH 4FU9A 2QV1A 2TGTA 1ESAA 4ABJA 1FY5A 7ESTE 2ZQ1A 1KY9A 2F91A 1TNGA 1KXBA 1ZYOA 3K2UA 1WTGH 3RXQA 1EKBB 2SGQE 5FBIA 3VB6A 2D2DA 4NFEA 2FTMA 4HFPB 1ESTA 1DDJA 4DJZB 3A7WA 4YOIA 3DFLA 1SLUB 3A7XA 3SNEA 4OS7A 1S6FA 3U1IB 1S6HA 1EPTB 3O8BA 2Y80A 4K60A 2BDBA 3UREA 4BTUB 2HNTF 1FPCH 4B76A 3A8AA 1A2CH 2C90B 3RXTA 2YNAA 4ABEA 4NIYA 9LPRA 1GDQA 5EG4A 3U8OH 1O0DH 1UTPA 2Y81A 3V0XA 2ZA5A 3GCHB 4CRDA 5C3NA 1FI8A 1UVSH 3SNDA 2R2WU 3LGUA 4GUXA 1XXDA 1EZQA 2ZU1A 4GCHF 1GGDB 1SHYA 1ZZZA 2CF9H 1QQUA 3DD2H 4DG4A 4CREA 3LDXH 3VEQB 1TPOA 1BJVA 5K0HA 2QXJA 5JPMH 3TH4H 1OKXA 1QR3E 1TQ7B 2BQ7B 4Z6AH 1GMHF 1EZUC 2FZZA 2BVRH 1XVOA 3LC3A 4NZLA 1O37A 1C5WB 2HPPH 2HVXA 4R0IA 3ZZ7A 1C5TA 1DS2E 3SQHE 1SGTA 1FJSA 1HYLA 3ODDA 2BX4A 3FANA 1O5BB 4MTBA 5AF9H 2B8OH 1BTPA 4AGKA 1V2TT 1ABIH 1QCPA 3T2NA 5CE1A 4YESB 3V13A 2RG3A 3GDVA 1GBLA 1ZSKA 1PQAA 4BOHA 1TABE 2DE8A 4CBNA 4CHAC 1JWTA 4IC5A 3TGKE 2FYRA 4NIWA 1L4DA 2BQWB 4ZKRU 1P8VC 3OYPA 5C1UA 1C2EA 1UCYK 1C5NH 1P3CA 3TITA 2WYGA 3C1KA 5LGOA 2ZGCA 2SGAA 4Y71A 1CGIE 2V3OH 1K9OE 1GBCA 1AUTC 1BHXB 3BEFB 3RXIA 1J15A 3BIUH 4IMQA 3A86A 1C5MD 1C1QA 1G2LA 2ANWA 2TBSA 3GY4A 2QY0B 4RSPA 5F6MA 1F0RA 4TWWA 3GYLB 3SN8A 1UCYH 2QYIA 1O5CB 3RXUA 3RM0H 3VB4A 1OOKB 1GL1A 4AGJA 1SGYE 3RU4T 1QJ6B 2VWLA 4Q7ZA 3FP7E 3MNXA 1ARCA 3ZZDA 1C1RA 1GMCG 1FY4A 1DWCH 1O30A 1O36A 1O2HA 3ZVEA 5EPNA 1KTSB 5DJ7A 1OYQA 1YPMH 1ZJKA 3PV4A 2H9EH 3C27B 1Y3UA 3SU2A 2XYAA 1WQSA 4X6PA 3ZZ4A 3NK8A 7KMEH 1S84A 1RJXB 1SGEE 2YNBA 2B7DH 1DANH 2NU1E 1FXYA 1IQNA 2ZFSA 3TNSA 1TIOA 1ID5H 4ABAA 2AMQA 8GCHF 2PKAB 1ELTA 2YOLA 1P2IA 1UTNA 1YCPM 2A4OA 1YF4A 4ZKOU 4U32A 2PGBB 2XBYA 4MPVA 3KL6A 1P04A 4XBDA 1GWAA 1T8NA 1C4V2 1KYNA 2FM2A 3GOVB 4ZH8A 5LPRA 1JXPA 2P3UB 2BY5X 1K1OA 1BRUP 1A1RA 1BTYA 4Y8YA 3TK6A 3OX7U 5GJ4B 2R0LA 3TH2H 1OP8A 1HBTH 3RXJA 3MH5A 5TJXA 1VCPA 3S9CA 2ULLA 3QGJA 1SR5C 1CGHA 2JETB 1VGCC 4Y0ZE 1EOLA 1GBIA 3SV8A 4Q7YA 1A0JA 1BJUA 3PM3A 3NZIA 2Z9KA 4X1QU 1C9PA 4GVUA 3HK6B 3PWBA 5AFZH 3U69H 2BDHA 3LGWA 1C1PA 3UR6A 2G5NA 4NIVA 1O2YA 1O3PB 4JYUH 4MNYA 4DW2U 2ZPQA 4Y79A 1HXEH 1EB1H 2BHGA 2BDAA 1FAKH 2P3FH 5IDKA 1SLXB 2OBOA 4D9RA 2C3SA 1O3EA 5IYTA 1HJ8A 1FDPA 4WXIA 1F5RA 1EXFA 4B1TA 2BD8A 1TBRH 1FIWA 2BVSH 4Y6DA 3BTDE 4OS4A 1C5UA 1SGFG 4NCYA 3OSYA 1V2ST 2ALVA 3HGNA 4Y10E 5A2MH 4B75A 2FI3E 1C1WH 1KXEA 1UVOA 1YLCA 4DURA 1O2ZA 2WPHS 1DUAA 2ZFQH 4CHAB 1SMFE 2GCTC 1HUTH 3GCNA 3R3GB 3RMOH 3UQVA 3NWUA 3GICB 4GHTA 3MU1A 2A7JA 5FPSA 1C1OA 3RLWH 2ZU4A 2ZWLH 2PGQB 2FX6A 3VXFH 1QL9A 3ATIA 2HNTE 1AVXA 1INCA 1HPGA 1GI3A 2NWNA 2AEIH 2CV3A 4IN1A 3SUGA 1TRNA 3ATLA 3GCOA 4UFFH 2Z3EA 1F92A 2PLXA 1GG6B 2RDLA 3E8LA 3D62A 1V2WT 2UUKB 2AIQA 1NROH 3A88A 1GI6A 2ZFFH 2HGTH 1D3PB 1N8OC 1SB1H 5JB8S 3UOUA 1D6RA 1F5KU 3RXPA 2ZHQH 3MNBA 1AVWA 1D3TB 5C20A 1GDNA 2BY7X 1J8AA 2ZHEH 3H7TA 3M5OA 1K1IA 6ESTA 1AGJA 1N8OB 1IQHA 2DE9A 3OU0A 2HLCA 3MMGA 5FXLA 2XWBI 1W12U 2WYJA 3FAOA 1GMDF 2EI7A 5FPYA 1RTKA 2CGAA 1P9SA 1FPHH 1NFWA 4O97A 1QIXB 3ZYDA 1WTHD 1B0EA 2BZ6H 4X1SU 3W95A 1AKSB 2OINA 4IW4E 1AVGH 4Z0KA 3U1JB 4I8GA 3P6ZB 1GBKA 3M7TA 4X8TH 5DG6A 4F49A 2VJ1A 4O03A 3U9AH 1LCYA 1VJAU 1HDTH 2VVUA 3HKJB 2WUCA 1VZQH 1LVMA 3EA8A 1D6WA 2FOCA 1GBMA 4OS5A 1ZMNA 1Z8JB 1EOJA 4AFZA 1DPOA 3SGAE 3ZYEA 4NA8A 1MTNB 1V2OT 2WV4A 3A8BA 1GI1A 3V12A 3W94A 1MQ6A 3E1XB 3PTBA 2V0BA 1AQ7A 1SGNE 2FOAA 4MNWA 1Y5UT 2SGFE 4R8TB 1NFXA 4X8VH 1JRSA 1O5AB 1P06A 2HALA 2R3YA 3BIVH 1UTKA 1K2I1 4K8BA 1AB9C 2ODQA 1TBQH 1ZPBA 5HMAA 3PWCA 2VH6A 1IAUA 1G32B 1GI0A 4B2AA 2WPJS 2SNVA 1BTZA 3MU5A 1FV9A 1TX7A 5A8ZA 1FIZA 2Z94A 3A7VA 4YTAA 2XNIA 4FVDA 2G52A 1THRH 1O2MA 1C5XB 2PWXA 1GBJA 1GJBB 1PPHE 2UWOA 2ZZUH 3BTKE 3PYHA 4CR5A 3L3TA 1EAWA 2ZTYA 3SI4H 5I46H 2ZGJA 3UIRA 2JETC 1S5SA 1T4VH 2A45B 2GDDA 3S7KB 5G4BA 3SHCH 1LHCH 1GJ9B 3CENA 2QIQA 2FI4E 3ENSB 2KAIA 1HAXB 3HKIB 1V6DA 3MNSA 1XMNB 3SGQE 1TQ0B 3DUXH 3PLBA 1AE8H 2OC7A 2V6NA 2FLBH 5F8XA 3LJOA 4MG3A 3Q3XA 3TVJB 1CHOF 1HCGA 2UUYA 2OC0A 3O8CA 1C5OH 1O2WA 1SGRE 3M3VA 4BXWA 1NTPA 4Y11E 1AY6H 2Z6BD 1MTUA 2ZFRH 4DOQA 1LVYA 2Z9JA 5HXFA 5C1XA 1V3XA 3UY9A 4I7YH 1CBWB 2JH0D 3MH7A 3MO6A 4RKOB 3NKKA 3FZDA 1NRPH 1P2MA 1BDAA 3SW2B 4DVAU 1AMHA 2TGPZ 2A2QH 3A81A 3GISB 3K9XB 3PTNA 4NA7A 1HAYB 5J4SA 2VIVA 1IHTH 1EP6A 1NN6A 1W7GH 2ZI2H 1YKTA 1C1NA 3GCTG 4A5TS 1RRKA 4B2BA 1F0SA 1TGBA 3AAVA 1O31A 3M61U 1C5QA 1LHEH 3ZZ8A 3SJKA 2PR3A 1WBGB 2PSYA 2G81E 1BBRH 3RDZA 1O2VA 1NRQH 1YYY1 1MZDA 2VGCB 5FAHA 1AWFH 1HIAA 1L1NA 4NWKA 4TY7A 2HNTC 1C2DA 2W7SA 1LDTT 2BDCA 4A1TA 1NRRH 1SOZA 1IOEA 1T4UH 3M7QA 8ESTE 1DUEA 4H6TA 1P11E 1C1SA 2AFQB 3QX5H 6CHAC 1SVPA 1P02A 1XVMA 4Y76A 3T28A 1VCWA 1DVAH 1MTNC 3E90B 5DK1A 1PQ7A 1QTFA 3SUEA 2VU8E 2G4TA 1C5LH 6LPRA 1LHFH 2Z9GA 3Q3YA 1EAUA 3IWMA 4AG2A 2GMTC 1SFIA 4FVBA 4AB8A 1KXCA 1P2OA 1CT2E 1K21H 3RXFA 1O2TA 3A7ZA 4NWLA 1UVTH 1HAVA 4DT7B 1VITH 3M35A 4FUJA 4WMDA 5LPEA 4U2WA 3Q3KA 1FONA 4NSVA 1QBVH 2ZDAH 3SU6A 3TGIE 4J1YA 2CXVA 4BAKB 1OYTH 1FQ3A 4JZFH 2GCTB 4AFUA 1A0LA 1P05A 4FUCA 1YBWA 4YLUA 3UWJH 5HM9A 5CMXH 3U98H 1ETSH 4XE4A 5K7RA 1Q3XA 4ZXYH 1L2EA 4D7GA 1H4WA 1QB9A 1C5YB 1DXPA 1NY22 1RXPA 3S69A 2BTCE 3KHVA 4HI3A 2VIDA 4CR9A 5DP4A 4VGCB 1K28D 3SU0A 1S82A 4ABHA 5CHAC 1C2JA 1L0ZA 3BTQE 3DFJA 3KIDU 2UWPA 3ZZCA 1A0HB 1QJ1B 1TNHA 3CP7A 3ZVBA 2D1JA 1HNEE 1UTMA 4ABIA 3Q77A 2VGCC 4ZHMU 3UOPA 4BAOB 1XKAC 1BRCE 1UTOA 1HJAC 2W26A 1C2LA 5T6DA 2FO9A 1ACBE 2FP7B 2D26C 3LGVA 3EDXB 4MPXA 5A8XA 5EQQA 2Q6GA 2ZC9H 2XRCA 5JBCS 1MMJN 1L1GA 2A5AA 1O3FA 1XKBC 2QAAA 2WUBA 2ZHFH 1PPCE 3DT0H 2NU4E 4XDEA 3RXBA 4ESTE 1FLEE 4H42U 1ANEA 1DY9A 4WXVA 1E36B 1IQGA 2ZTZA 3UNQA 1T8OA 3T27A 5EW1H 4SGBE 1FNIA 2V3HH 2HOBA 1HXFH 1AKSA 4INLA 3SGBE 2ZDVH 2GZ9A 3A7YA 3H5CB 5JBAS 2ANMH 2FLRH 2GDEH 1J17T 5GIBA 4Y7BA 4UFGH 2PUXB 1PJPA 4X1PU 2BM2A 1UTJA 2BZAA 1O32A 1WYKA 1O2SA 1O3CA 1YPGH 5PTPA 1Q2WA 3ZZ6A 1C2HA 4H4FA 5JBTA 3MWIU 3WY8A 5C2ZA 2QN5T 4ABFA 1KDQB 1BMAA 1WOFA 4IGDA 1RTLA 2O8UA 3SHAH 1GI9B 5F8TA 1QURH 3PROA 4X2YA