5LH8A

Trypsin inhibitors for the treatment of pancreatitis - cpd 8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A02
1LVMA 1AB9B 2RA3A 1QBVH 2Y5FA 1CQQA 2UUFB 3BIUH 1ZHRA 1GHVH 5A09A 2IOTA 5C3NA 4ABEA 3A7TA 1K1OA 3BTME 1UVTH 2FOCA 3AASA 1ELDE 2A5IA 2XC5A 3BTHE 3A8CA 3NWUA 3W95A 2ZC9H 2Y7XA 1TABE 1PJPA 1FIZA 2R2WU 4H4FA 1BTUA 1G3EA 3K65B 3V12A 1C5YB 2WINI 2WPKS 3EA8A 5FAHA 2B5TB 1HJAC 3PV4A 1EB1H 1B0FA 1DUAA 2FS8A 1CHOF 1UTPA 2V3OH 3P8NA 4Y7AA 1MCTA 3ZZ7A 2XBYA 1A4WH 1O3KA 1A3EH 1CT0E 1LVBA 1O3AA 2FO9A 3EGKH 2VWMA 1C5UA 4CH8B 4B74A 5L30H 2A2QH 1GI5A 1Q3XA 1TWXB 1FNIA 1BMMH 1FUJA 1QQUA 2A1DB 2AGEX 3RXPA 1CHGA 1KLJH 2FOMB 1O5FH 2F3CE 3TK5A 1SC8U 1AZ8A 1D4PB 2BTCE 3MFJA 3SJ9A 3TNSA 2BHGA 1E34B 1GJ5H 1VITH 1C1QA 2CHAC 1NU9A 1C5SA 3A7XA 3M5MA 2AMPA 4Y8XA 4WJG2 5C2ZA 1C9PA 1K2I1 2VNTA 1UK2A 1QA7A 1THSH 2LPRA 2P8OC 1UMAH 4A5TS 3F1SB 1O33A 1W0YH 1NRSH 1NRQH 2ZU4A 1SMFE 1ANDA 2AERH 1GMDF 1JIRA 3LH1A 3L6PA 3QO6A 1V2MT 1WU1A 1ZTKA 3LJJA 3RM2H 1ARBA 2PKAA 5BRRE 3BTWE 3SV9A 2B0FA 3ATIA 5E8EH 3ITIA 3LOXA 4BOHA 1P9UA 1AFQC 4Y11E 1HB0B 1O2RA 1KXFA 1EAUA 1MKXH 5ETXA 4D7GA 1A5HA 1JXPA 1SI5H 1Z8IB 2P95A 1QY6A 2SGDE 3ZZ8A 3TIUA 1BMNH 1O3OA 4A1VA 1O3DA 2F9PA 1SGCA 3P70B 1TMTH 3W94A 1RJXB 2I6SA 1DS2E 1TBRH 3QZRA 1NFYA 1UCYE 3SV6A 3E90B 1SVPA 2GDEH 4PROA 3SBKA 1PQ7A 1A61H 2FZZA 3RXLA 2JETC 1OX1A 3T62A 4WMEA 4OGYA 2FTLE 2BQ6B 1DPOA 3P17H 1FV9A 2ZCKP 5L2ZH 2HPQH 3SU0A 4AG2A 1E35B 1AQ7A 2PW8H 1GCTB 1UTJA 1GI4A 3ENSB 1ABIH 4XBCA 1W11U 5SGAE 1BTHH 1V2RT 6LPRA 4J1YA 3VB3A 1YP9A 1C2LA 2HNTF 2XRCA 3ZZBA 3GY5A 2OD3B 1H8DH 3A8DA 4X1PU 4O3TA 1TOCB 1O2OA 4NFFA 1PPZA 2R3UA 2GV6A 2NU2E 1GBEA 3GCTG 1MD7A 1P2NA 1ACBE 1SGEE 1C5XB 2SNWA 3UY9A 1V3XA 1E38B 5DO4H 3UPEA 1J8AA 4CHAB 2Q6DA 1SQAA 2P3FH 4OS5A 1SBWA 1WV7H 3A83A 1FAXA 4Y79A 2H5CA 3GCOA 4ZKNU 1EATA 4KGAA 3A7YA 1XX9A 2A5KA 3JZ1B 1EPTC 4MNXA 3E0NB 3AVZA 5HYOA 2G51A 1C2MA 5TJXA 5AFYH 1IQJA 1TBQH 2KAIB 1NS3A 1QB6A 2FLBH 4NA8A 1QIXB 1ZTJA 1S84A 2PWXA 1Z71A 2UUYA 3GCNA 5EPNA 2STAE 1UTOA 3GDSA 1IQFA 3RXRA 3BG8A 1TNKA 1GI0A 1KSNA 4X6OA 2BLOA 1MU8B 2Z3CA 4AB9A 1EZSC 4RKJB 1EUFA 2TGDA 1ZR0A 2HVXA 1OYQA 1NY22 2B7DH 3VFEA 4BAQB 1BBRK 2NWNA 1MZDA 2PLXA 4I7YH 3LU9B 2HALA 2SGAA 3MWIU 1YPHC 4M7GA 1RD3B 5B6OA 3Q3XA 2QXHA 4JMYA 3ODFA 3SU1A 3RDZA 1OWEA 3RUOA 1ZRKA 2TBSA 1J14A 5DP6A 2AFQB 1CBWB 2BLVA 4DIIH 1ELVA 2P93A 1N8OB 1SL3A 5J4SA 1GMCG 1YPGH 3ZYDA 5TCAA 4CRBA 3KQDA 1DUEA 3BEIB 3A81A 2OQUA 1Z7KA 1W7XH 3S7KB 2ZDMA 1SOZA 5T6GA 1LVOA 2XC0A 3SJOA 1WCZA 1TGNA 1OOKB 1VCWA 1MTUA 2HNTC 3QZQA 3C1KA 3G01A 1TOMH 3A8BA 2P3TB 1A1RA 1EJNA 1MKWH 1FPHH 1RXPA 1C5VA 1SB1H 2GDDA 2XNIA 2BDHA 4BTIB 2PKSC 4U32A 1AWHB 3DFJA 3TPIZ 4A1XA 5E2PA 2ZGBH 2FOGA 2ZHFH 4ZXXH 4WVPE 1AGJA 1HLTH 3ZV9A 1MBQA 2XYAA 1IQNA 1YLDA 1LMWB 3A84A 1EKBB 1P3EA 2OBOA 3HK6B 1GL1A 1TPOA 1FXYA 1GHBG 1JWTA 4Y76A 2Z9IA 1OWIA 1VGCB 3NXPA 1O0DH 4I8GA 1UJ1A 1CHOG 5K7RA 2AEIH 1AMHA 4B2AA 2XBXA 2H6MA 1OP2A 1BTYA 3FP7E 1HAVA 1DANH 2GCHG 3O8RA 4ESTE 1KTTB 1H1BA 1GI9B 3UWIA 4BXWA 4DG4A 1O2JA 3MO3A 4TY7A 5FPSA 2PKAB 4K3JA 1BZXE 1TPAE 1EOLA 5EQQA 1GI8B 1OPHB 2ANKH 2FOAA 1OS8A 2ZECA 3CP7A 1GJBB 2B8OH 3SHAH 1JRTA 4ABAA 3H5CB 1XXDA 1UTKA 5T6DA 4OS1A 2VIWA 3R0FA 1GVLA 1UTNA 1CVWH 1CU1A 1O2XA 4IGDA 1IQMA 3LJOA 5FCRA 3MO9A 1ZGIA 3SQHE 1SLWB 3RXFA 1FMGA 1ANEA 4MLFB 3PROA 2XBVA 2Y7ZA 1RS0A 4ZHLU 1Z8RA 4H6TA 1SGIB 3QDZB 1NRPH 1QQ4A 3M61U 1BQYA 1BIOA 2GCHF 2BD8A 1G3DA 2C8WB 1C5NH 2VIOA 1MTNC 3QUMP 5GCHG 3TGKE 1MAXA 1LTOA 1G3BA 2FIRH 2OUAA 3P95A 1DWCH 5EOKA 7KMEH 1C1WH 2ZFTA 1AUJA 1DICA 4X8SH 5CHAC 1O3MA 4KKDA 1LPGB 1YLCA 4X1RU 2A4GA 1NPMA 1O5EH 1Y3VA 1PPBH 3STIA 3ZZ9A 4Q7XA 1O3CA 3SJ8A 4YESB 1O2IA 4O03A 4BTUB 4JZDH 1OKXA 2Y80A 2XCFA 2XWBI 3M5OA 3C27B 2J92A 3A89A 2Z3DA 4SGBE 5G4BA 3MNCA 1WOFA 4WF8A 3IG6B 4DY7B 3RXEA 5L6NH 1P12E 3UWJH 3QTVH 2WUBA 7GCHF 4ZHAA 3SU2A 4GAWA 2G55A 4K1SA 1GBLA 1O2UA 5LPFA 1QJ6B 4H6SB 3TK9A 4FU8A 3V7TA 2P16A 1YPMH 2W7UA 1GCDA 1SGPE 8GCHF 4AFUA 1DXPA 5FBEA 2PGBB 3SU4A 4TWWA 4IC6A 1LPKB 1SGTA 1ETRH 1GVZA 2OC1A 2O9QA 2F9NA 1DDJA 1O2KA 1Y3UA 4INHA 3SV2H 4AOQA 5C5NA 5HM9A 3UNQA 4B71A 3GICB 4XDEA 3QLPH 1GBCA 2R2MB 3MU0A 4GCHG 2BM2A 1P02A 3SI3H 1ETSH 4AX9H 2OLGA 3PM3A 1CO7E 4KP0A 1S85A 1YPJH 1DXWA 1HXEH 1O37A 2Z9LA 1C9TA 1GHXH 2G00A 1TONA 1O38A 2ZGJA 2V6NA 5E0JA 3LGTA 3A82A 1MTWA 4Y10E 3BTFE 1ZRBA 2AIQA 2RCEA 4FVDA 1P2JA 1W10U 4FUHA 2A31A 3M35A 1INCA 2BDYA 4INKA 1ZMNA 3ZVGA 4YLUA 1A0HB 1IQHA 5EGMA 1QL9A 3OTJE 3O8BA 1LPZB 4JZIA 4RKOB 1SR5C 5F03A 4B2CA 5EODA 2ASUB 2BLWA 3TK6A 3ZZ6A 1WAYB 1Y3WA 1ELCA 3U8TH 1OYTH 2VGCC 4XE4A 2ZEBA 2PKSB 1Z6EA 1P0SH 1DFPA 1HIAB 2QYIA 7ESTE 1T8LA 1B5GH 4JYUH 1S81A 4UFEH 1D9IA 1P01A 3LGVA 6CHAB 2WUCA 2QXJA 3FP8E 4WWYA 1ABJH 1UVOA 2FI5E 2HGTH 1T8MA 3RMOH 1JMOH 1VGCC 1BRCE 1Q31A 2STBE 2FPZA 1KDQB 2BLQA 1BBRH 1HJ8A 4I8HA 1XXFA 3LPRA 2V0BA 3SV8A 2ANWA 2D8WA 3M37A 4NSYA 2LNCA 1W8BH 1F92A 1O3PB 1XUKA 8KME2 4MPVA 3LKWA 2QIQA 2BD5A 2Y5HA 1DE7H 1GJ7B 3GY7A 1ORFA 1ZJDA 2ZDVH 3M36A 1GBMA 1GBBA 4OS7A 3TITA 5E2OA 1MZAA 5ESBA 1QGFA 3QGJA 1P2IA 2IJOB 1CGJE 2DE8A 4IMZA 1RIWC 3D62A 3QGNB 2G5NA 4Q80A 3DT0H 2WPLS 3M7QA 1A0JA 1GBKA 2TGTA 1M9UA 3AW0A 3BTKE 1PPEE 1BTXA 1THPB 4YOIA 1MKWK 1YC0A 3TH3H 1DWDH 2W26A 3SUGA 1C2GA 4I31A 1W3CA 4HGCA 1YKTA 1XVMA 4WXVA 3F68H 1A2CH 5EG4A 4GHTA 1T7CA 1AE5A 5FHTA 2AMDA 2PFEA 3QWCH 2A7HA 4YT7H 2FOHA 3B23B 1F5KU 3GY3A 1VCPA 2ZFRH 3LIWA 2M5TA 4E7NA 1ZSLA 1K21H 2ZHEH 1GI7B 4MQAA 1CGHA 1XUHA 1C5QA 3SNEA 1C1PA 2Z94A 3PO1B 3LGUA 1XUIA 2SFAA 2FWWA 1EAXA 2GGVB 5EXMA 4K5ZA 5H4IB 4U30A 2G4UA 3LH3A 2ZF0H 1ZMLA 4D9RA 3MO6A 4AG1A 2Z9GA 4CBNA 3NPSA 3FANA 2ODYB 3BV9B 2ZTYA 3SO3A 3VB4A 1Z1IA 2JH6D 3T27A 1L0ZA 1ELAA 4ZMAH 2QC2A 5DG6A 5EPYA 1SPJA 1NC6A 1C1MA 1BRBE 3P6ZB 5AFZH 2P59A 2GX4A 5DKMA 2JETB 3KCGH 1N1LA 2F9OA 1GBIA 1V2JT 1S6FA 1EP6A 4JK6A 1GL0E 1BB0B 1RTKA 1ZMJA 2EC9H 4YT6H 3BTQE 4JZFH 3P8FA 5FBIA 1K1MA 1SOTA 5ABWA 2PSXA 1MTVA 1QR3E 3VPKA 1FY8E 3BSQA 4X8VH 1C5ZB 3AW1A 3STJA 4I33A 1J16A 2C4FH 2FI3E 2BXTH 3ESTA 2P94A 1DM4B 2Z6BD 5GIBA 1TLDA 2VWNA 4BAHB 5FX6A 2VH6A 1TX7A 2HNTE 4CRDA 2GCTC 4FUFA 3RC5A 4D76A 2UWPA 3QN7A 2H9HA 1FY4A 4VGCB 3GDVA 3FP6E 3KHVA 1BJVA 1K1NA 3Q3YA 1LVYA 3SGBE 2A7JA 1ZTLA 8ESTE 3VGCC 1NT1A 1O2YA 3NCLA 3LC3A 4X2WA 2Q6FA 1TNGA 4ZKRU 1TIOA 4MVNA 4XBDA 3VXEH 3PYHA 1V2WT 3JZ2B 4Y8YA 1TQ0B 3SNDA 1TQ7B 2BD7A 2P8OB 2RA0A 2FM2A 3RXTA 1DWEH 4NIXA 1LHGH 4BAOB 4QT8C 4GPGA 2TRMA 3U69H 3VXFH 2HOBA 3EQ0H 1W14U 1ARCA 3Q77A 4FUEA 3RXCA 4Q7ZA 1O2TA 1C1NA 1N6YA 2BDIA 1GI2A 3SUDA 2UWLA 3M3TA 2BY8X 1Y3YA 3K9XB 3SN8A 1BMAA 1MU6B 1UK4A 2ZPRA 4B75A 4B1TA 3BEUA 4K1EA 2GZ9A 1RFNA 1AFEH 1XKBC 1S0QA 1GMHF 1O3GA 1B7XB 2QAAA 1MUEB 1C4V2 3R3GB 2F9UA 4ABGA 5LH8A 3OX7U 2ZFPH 1UVSH 1XUJA 1AY6H 3LGWA 2BVRH 4NGAH 3S69A 2BQWB 3F6UH 1D6WA 4ZHMU 2I6QA 4LZ1H 1QCPA 4MDSA 4NIYA 3GY6A 3TVJB 4J2YB 3BTTE 5EXNA 4JYVH 3A80A 4FUJA 1PPFE 1ZPCA 3U1JB 1HUTH 1WSSH 1RTFB 3KQBA 4MTBA 1UTMA 4AYVB 4Y71A 4UDWH 1BHXB 4IBLH 4LXBH 1TNIA 1YPLH 4NCYA 2ZU3A 2A4RA 2PGQB 3KQCA 1IQIA 2ZFQH 4GCHF 5ESTE 3MNXA 3PTNA 1O31A 3URDA 2ULLA 1P04A 2GT7A 1S6HA 1JRSA 5GJ4B 5AHGH 3A7VA 2AS9A 1IQGA 2TGAA 1HV7A 1GJAB 1DVAH 1ZPZA 2PUXB 3MTYA 2ANYA 1Z6JH 1Z8GA 1Y5UT 1P2MA 1FONA 1MBMA 8GCHG 3GY2A 2HPPH 2JKHA 4AFQA 4CBOA 2W3KA 1TE0A 1MD8A 1HJ9A 1P2OA 4O9VA 4FXGH 3SU5A 2C8XB 3PB1E 4X8UH 1UVPA 3VB5A 1WTGH 1O2QA 3DA9B 1SGDE 4CREA 4UEHH 5A0AE 3QTOH 2A45B 2VWOA 2XC4A 3HGPA 1AE8H 2DE9A 1E37B 1K22H 2QXGA 1X7AC 1WBGB 3LC5A 3V3MA 1P05A 1L4ZA 4NSVA 3Q76A 4ZKOU 1TBZH 1P09A 1V2NT 2VVVA 1UHBA 1AB9C 1G36A 4X0WU 1NESE 4Y6DA 1YBWA 4RN6A 1HBTH 1C5PA 1HAOH 3MOCA 1KDQA 1G2LA 2OC7A 2R0KA 3UTUH 3UFAA 2FXRA 3AAUA 3GY8A 1GVKB 4YOJA 1AVXA 3VB6A 2NU1E 2UUKB 1C4U2 1CBWC 1BTZA 4MG3A 1K1LA 2J9NA 5EQSA 1SGRE 2QY0B 2QCYA 1EJAA 1RRKA 2WPMS 1QNJA 5A8XA 1A3BH 2H2ZA 3M5LA 4X1NU 1TPPA 4NIWA 5DP3A 3EA9A 1JBUH 1C2DA 1QA0A 2XTTB 1AHTH 5FXLA 3VB7A 1C5WB 4CR9A 1EAIA 2W3IA 4XSKU 1S82A 3UOUA 1BHXF 3KL6A 5F8XA 3A86A 1GI1A 1O2WA 4IS5A 1SQTA 1HNEE 1N8OC 2HRVA 1ZLRA 5GDSH 2ALPA 1NFWA 1ZGVA 2ODPA 3K6ZA 3ZVFA 1TAWA 3SOSA 1G9IE 4UFGH 2Y81A 5C1UA 5DP9A 1NM6A 4AGJA 1N6XA 1L1JA 3UNRA 2FMJA 1ZOMA 4BNRA 3RLYH 1ELBA 1VCQA 1BMLA 5JB8S 4OS2A 5EW1H 1OP8A 2YOLA 2ZFSA 4GVUA 2G52A 1TPSA 5T3HA 1K28D 4ZAEA 2CGAA 3SQEE 1TNHA 1QTFA 1QRXA 1NFXA 3E16B 2A4QA 6ESTA 1BA8B 2GV7A 5AF9H 4FUBA 1WQSA 4WH8A 1T8OA 2ZGXH 1GBFA 1L1NA 1BTPA 4E05H 4YZUA 2R0LA 2BD2A 3RMNH 1BBRE 1L2EA 1P2QA 3S9BA 2SGFE 4A7IB 1K1JA 3FVFB 1AIXH 4NG9H 2Y82A 1GHAG 4AFZA 1C2EA 5E0HA 1J17T 1EAWA 3MU5A 2Y6TA 7LPRA 1FY3A 4Z0KA 1HGTH 3I29A 3RXMA 1ZSKA 3E3TA 3TLOA 1MQ5A 4WMDA 2Y5GA 4X6NA 1XKAC 4WXIA 1BRAA 5C67A 4BTTB 2QF3A 4ZXYH 2XCNA 1DSTA 4ZUHA 4INLA 5L2YH 4UONA 3F9EA 1W12U 2FOBA 1P06A 4NIVA 2BDCA 3RXSA 1TRYA 1QBNA 3KF2A 1GJCB 2O8LA 1AO5A 4MPUA 2VINA 5DP5A 1AN1E 1IQKA 1D3PB 2OINA 2VJ1A 1HAHH 3TH2H 5LPEA 1GG6C 2ZCHP 4R8TB 2GCTB 4YOGA 1GHZA 1Y8TA 1TFXA 4Z6AH 5JBBS 3SUEA 1EZQA 2FLRH 3OU0A 1GJ9B 2C8ZB 5GXPA 4AZ2B 1V2ST 2BVSH 4GLYA 2A32A 4AN7A 1PPGE 1Y3XA 2PV9B 2FODA 2VVCA 3BTGE 5K0HA 3PMJA 1LDTT 2BDGA 4BXSA 1UVUH 5FX5A 2FX4A 3BN9A 4H42U 5DK1A 3UNSA 1FDPA 3TU7H 1MCVA 1XVOA 3F9FA 1GJ8B 2J95A 1TMBH 4VGCC 3U8RH 3ZZ3A 1C1TA 4MPXA 4LOYH 4Y8ZA 1ELGA 2THFB 1ELFA 1XUFA 1EASA 1AKSA 3ZZ5A 1ELEE 4Y7BA 1O2HA 1O2ZA 3SNBA 1TRMA 1Z8JB 4OS6A 1YPEH 1GMDG 1UTQA 4ABDA 2UWOA 3URCA 1KXCA 2WYJA 2Z3EA 4TPYA 3WY8A 2NU0E 5F8ZA 2ZI2H 1SLXB 2CN0H 2FESH 1T4UH 4WY3A 3RXOA 5LPRA 1VR1H 1GHYH 1TMUH 5C20A 4ASHA 3RC4A 1NFUA 1PQ5A 1ETTH 3ATMA 1FN8A 1TALA 2ZA5A 3T26A 2BZ6H 3AAVA 2NU3E 2XXLA 2ZNKH 2ZU1A 5DP8A 4X2XA 2ILNA 3HGNA 1CGIE 1F2SE 1PPCE 4TY6A 3RXQA 4ISIH 1BJUA 4ABFA 3MI4A 4JCNA 1C1RA 1TNLA 1SGYE 2WPJS 1SHHB 3OYPA 3OY6U 1EPTA 1PQ8A 1E36B 4DOQA 3P92A 5F8TA 1HDTH 3A7ZA 1GJDB 5E0GA 3MYWA 1TGSZ 3BG4B 3PLKA 3UQOA 2F9BH 4U2WA 1SFIA 3SZNA 1W13U 2ZHDA 3BEFB 4U01A 1GCTC 5JBAS 2ZDNA 2ZFFH 1SGFA 1YPKH 1XUGA 1WYKA 4NWKA 1O5CB 3GYLB 3GY4A 3U1IB 3M3SA 1EOJA 3F9HA 3LT3A 1A5IA 2ZPQA 1EX3A 1C1VH 1YPHE 2GMTC 3UUZA 5JYIA 3PWCA 4ISHH 3RM0H 1HAGE 2Q1JA 5EQRA 1RIWB 3B8JA 1GHWH 1TA6A 2XBWA 2P3UB 1O5GH 2QF0A 2ZTXA 3S9AA 2VIQA 5A0BA 1EQ9A 2QXIA 3I78A 1GBJA 3PMBB 2PUQH 3I77A 3MH7A 4UFFH 1O30A 1QBOA 2GTBA 4O97A 1MTNB 1Y5AT 2R9PA 2Z9KA 6CHAC 1QB9A 1O2SA 1A5GH 3ATWA 1GG6B 1KXBA 1MKXK 1CE5A 1ANCA 1AVGH 3SU3A 4B76A 1P10A 2BD9A 1AUTC 4ZROA 1HAZB 4A6LA 1KTSB 2CXVA 1FIWA 4B73A 1EZXC 1P57B 2FOEA 1KIGH 1TRNA 1KY9A 3O8DA 5A8ZA 5JBTA 4F4OC 2ZGHA 1FI8A 5DP4A 1O2LA 1GDQA 1EB2A 3TH4H 6GCHG 5CHAB 1OWJA 3PLPA 1Y59T 1GDUA 4I8LA 1SQOA 1S83A 2CF9H 5EXLA 3RXIA 3SNAA 2GD4B 4LK4A 4CRCA 5PTPA 2HWLB 2D26C 4E7RG 4AYYB 1C1OA 2WV5A 1SGQE 2AIPA 3E6PH 2BY5X 1V2OT 3PMAB 2ZZUH 1WQVH 5I25A 4UFDH 4K8BA 1WUNH 1O39A 4MPWA 3LDXH 3NUMA 3MU4A 2VU8E 3UR6A 3ZZ4A 5CMXH 2OCVB 2ALVA 1W0ZU 1NTPA 2VWLA 1AU8A 1OXGA 2ODQA 1GWAA 3ZZCA 4BAMB 4K8YA 2G5VA 1RGQA 1P8VC 1T8NA 2BY9X 1FN6A 3OSYA 3M3VA 1PYTC 2A0QB 1HPGA 1BTWA 2F9VA 3FAOA 3GCHC 1TGTA 2J34A 3PLBA 2OXSA 2VIVA 2EEKA 2ZDKA 5J4QA 2SGPE 7GCHG 4ABJA 1K1IA 3HPTB 1GDNA 1O2GH 3A88A 3MNBA 4JYTA 1VJ9U 4NA9H 1EJMA 2PTCE 2O8WA 3MNSA 2F91A 3RXJA 4CRAA 2EA3A 1LHDH 3V13A 1UCYH 1BDAA 1CA8B 3LGYA 1HCGA 3UIRA 3RU4T 1DT2A 2ZKSA 4YTAA 2QV1A 1CT2E 2GKVE 4JZEH 3KGPA 2TIOA 4X6PA 3KQEA 5DP7A 2FP7B 1KXDA 1TA2A 1U6QA 1GHBF 1AWFH 3SI4H 2AYWA 1QB1A 3IITA 5EW2H 1F0UA 1LQDB 5A0CA 3TGIE 1ID5H 1ZJKA 1ESBA 1NRRH 1GJ4H 3K6YA 3T5FH 1GMHG 3TJVA 1V2LT 2FS9A 3ELAH 3TGJE 1Y5BT 1KXEA 1O5DH 2JH5D 3EE0B 2SGQE 1O3JA 2ZU2A 2ZCLP 3RXBA 5GWZA 3UREA 2OTVA 3SJIA 1C5RA 1TGCA 1O5AB 4GUXA 4WMFA 1BCUH 4FUCA 1ZYOA 1NROH 2G81E 4D9QA 1HRTH 2VVUA 4X2YA 1CA0B 1D3TB 9ESTA 3A87A 3ODDA 1KXAA 3T2NA 3BG4C 3SV7A 1C4Y2 3FFGA 1D6RA 3SGAE 2ZP0H 1YYY1 1YCPM 5C1XA 2GT8A 3VGCB 4A1TA 1QFKH 2BVXH 1JIMA 3F9GA 4FUGA 1YF4A 3ATKA 4SGAE 2VH0A 3ATLA 2NU4E 1DOJA 1GMCF 1ZHPA 2O8MA 3HK3B 1QJ7B 3Q3KA 4X1SU 1DY9A 3A7WA 2BYAX 3OY5U 1K1PA 3RXDA 1HAYB 3QX5H 2IN2A 2SNVA 4XOJA 2ZDAH 3RXHA 1QRZA 4FU9A 4IMQA 2FYQA 1GGDC 1T31A 1J15A 4DIHH 1TX6A 2Z7FE 3GOVB 1A0LA 1ZPBA 3T29A 3L3TA 3SNCA 4CRGA 4R0IA 1O3IA 4DJZB 1MMJN 3ZVAA 3DFLA 2ZGCA 3ZVBA 4ZH8A 1LHCH 1O2PA 1V2QT 5JB9S 3UR9A 1PYTD 1IHTH 3CS0A 3EA7A 1V2UT 1FZZA 2EI8A 4FUDA 3KIDU 3S0NA 1O5BB 2QA9E 1GBTA 1IAUA 1H9LB 1EPTB 1OWHA 1O3BA 5HGGA 2D2DA 1C2IA 3DD2H 1DLEA 1FQ3A 1C1UH 2PTNA 1PFXC 4HTCH 1K9OE 3MU8A 3EYDA 2A2XH 1LCYA 4K2YA 1DY8A 4XBBA 1GI6A 2A5AA 1DSUA 4Y0YE 4KTCA 2BY6X 2BB4A 2W5EA 3IWMA 3NKKA 3RC6A 3PO1C 3A85A 4Y0ZE 1DX5M 4IN1A 1ESTA 1CSOE 1TX8A 4ISLA 2BX3A 4CH2B 4I8KA 1EXFA 3MU1A 2FDAA 2Z9JA 1C5MD 2BZAA 1V2KT 1O3EA 4CRFA 3P8OA 2CV3A 1SGNE 1A7SA 1ZZZA 1AFQB 2F83A 2FYRA 1GHAF 4YO9A 2CJIA 1QL8A 2AGGX 5BPEA 1NU7B 2C93B 2H1UA 2IPHA 1QJ1B 3PMHB 4ISNA 5TCCA 1SLUB 2V35A 1OSSA 3SHCH 2ZPSA 1V2TT 3RXUA 6GCHF 4AGKA 4FUIA 3SORA 2RG3A 1PQAA 4B2BA 4KTSA 3RP2A 4JK5A 2ZWLH 3SGQE 3ZYEA 3K2UA 1NO9H 4ISOA 3MH5A 4THNH 2ZQ2A 1O3NA 2OBQA 4NFEA 3LONA 2GMTB 1C2FA 3B9FH 2C3SA 1JOUB 4X8TH 2VIDA 1NZQH 3LGIA 4MNYA 1BUIA 5A2MH 4IW4E 4BAKB 3CENA 2C90B 1F5LA 1RTLA 4ABIA 2ZQ1A 2GZ7A 3FZZA 1VJAU 4O3UA 3L33A 5T6FA 2FTMA 3RXVA 2O8UA 4ZKSU 4HFPB 4ABBA 3BTEE 5LGOA 1YM0A 1OP0A 2VIPA 1W2KH 1DLKB 3UOPA 1F0SA 1EP5A 4KTUA 3MH4A 3SW2B 1GJ6A 4X2VA 1SG8B 3GCTF 1W7GH 3BF6H 1F0TA 4AFSA 1P3CA 1YCPH 2PHBA 2OQ5A 2H9TH 4OS4A 5IDKA 1TGBA 1UO6A 1G30B 1UHBB 2CHAB 1BITA 3D65E 3M5NA 2BDBA 2H5DA 1TB6H 4JZ1A 1GI3A 3V0XA 1AVWA 1PPHE 5DGJA 1O34A 4ABHA 1FY5A 4X6MA 3KNXA 3SUFA 1KYNA 3D49H 1WTHD 2O8TA 2GVFA 1XM1A 1F5RA 4CHAC 4DCDA 5CE1A 1O3LA 1AZZA 1LKBA 3SJKA 1ESAA 1UK3A 2FI4E 3H7OA 2UUJB 1QHRB 3RLWH 1FAKH 2J94A 4DT7B 5C1YA 1SGFG 3MH6A 1GBDA 2FEQH 1MAYA 3TJNA 1KLIH 1BOQA 1ZHMA 1AD8H 1HYLA 1O32A 1O2NA 4Q2KA 4DURA 2J4IA 1SSXA 1YCPK 2PR3A 3ZVDA 1VITG 5F6MA 1C5LH 1MQ6A 1O35A 1F7ZA 4FVBA 1L1GA 1L4DA 3NK8A 5GCHF 4E06H 2FX6A 1G3CA 1TNJA 4K60A 3VEQB 1TYNA 3E1XB 1BRUP 4LZ4B 2ZHWH 3ZVEA 1LKAA 1FY1A 3BTDE 1THRH 5HM2A 4RSPA 5HMAA 1UCYK 3H7TA 1HXFH 1V6DA 4D7FA 5FPTA 1VZQH 3PTBA 3N7OA 1IQLA 4UE7H 3GYMA 4YM9A 3E91A 1T32A 1NN6A 4DGJA 1S5SA 3SU6A 1IHSH 3RMLH 2BXUH 4F49A 2WPHS 2KAIA 2C8YB 3EAJA 2ZO3H 4WH6A 3FZDA 2BOKA 1C1SA 1QRWA 1GPZA 3D23A 1J9CH 1MTSA 2EI7A 4NZLA 1MH0A 1LQEA 3KN2A 3QK1A 1AKSB 1FLEE 2VGCB 4K69A 5I46H 4MNVA 1ELTA 1C5TA 4XFQA 1S0RA 2PSYA 1Q2WA 2AGIX 5JPMH 5A8YA 2ESTE 1V2PT 1D3QB 2GZ8A 1CT4E 4MNWA 1UTLM 4IN2A 2G8TA 2ZIQH 2ZDLA 5DJ7A 1H9IE 2OC8A 1LO6A 2WPIS 3GCHB 5FPYA 2B9LA 3RXKA 2OP9A 1B0EA 5DPAA 1H8IH 1E0FD 2K1QA 4HZHA 2ZU5A 2BD3A 3A8AA 4GSOA 1SLVB 3U9AH 3KEEA 3CS7A 4HI3A 4TWYA 1Z1JA 1QURH 3GISB 4DVAU 2TPIZ 1FPCH 5IYTA 1C2HA 2BDAA 4FU7A 4NWLA 5HXFA 2OC0A 1C2KA 2J2UA 4D8NA 4I32A 3E8LA 1GGDB 1HAXB 5C5OA 1O3HA 4DW2U 4I8JA 3RU4E 1DITH 3DUXH 3T25A 3M7UA 3UQVA 2ZHQH 3RXGA 2HLCA 2VB0A 1P9SA 2BX4A 1P03A 3TJOA 4BANB 4TYDA 2BY7X 2ZTZA 2J38A 2BMGB 1HFDA 2YNAA 2WV4A 2G4TA 4AORA 1XMNB 4A92A 2EI6A 1F0RA 3O8CA 2WYGA 2AMQA 1H9HE 1T4VH 2A7CA 3ZZDA 3E0PB 1O36A 1HJAB 1GBHA 1YGCH 4NA7A 5GPIB 3M7TA 2JH0D 3RXAA 3DHKH 1CA0C 2BD4A 9LPRA 1DWBH 1ANBA 3Q00A 1KLTA 2BQ7B 4AB8A 1HIAA 3TJUA 1G37A 3RMMH 1C2JA 1EZUC 1IOEA 3PWBA 5AVDA 2R3YA 3HATH 1BT7A 1V2VT 2ANMH 2CMYA 2GP9B 1LHEH 2BOHB 5EU8A 1FJSA 3T28A 2QGRA 2YNBA 4TPIZ 5JBCS 1O2MA 4NZQA 1VITF 1G2MA 1OWDA 2RDLA 3HKIB 2H9EH 1IQEA 1A46H 2XWAA 4K1TA 3U8OH 3S7HB 1QL7A 2ZG0H 2D1JA 3S9CA 2A4OA 2SGEE 3HKJB 4CR5A 1G32B 3U98H 4KELA 1O3FA 2W7SA 3ZZAA 1NRNH 3RU4D 1GBAA 3BIVH 1P11E 4X1QU 2V3HH 1SHYA 4UD9H 1SFQB 4IC5A 3MHWU 2DUCA 1O2VA 2TGPZ 3GDUA 3TNTA 1AI8H 1HAIH 4GHQA 3EDXB 1C5OH 2Q6GA 8LPRA 2XW9A 2FOFA 1HAVB 1ZSJA 2QN5T 1P2KA 1D3DB 2CF8H 4YLQH 1H4WA 4Q7YA 1OWKA 5FCKA 3NZIA 5JDUB 3ZV8A 3P8GA 4OGXA 1LHFH 1HAPH 2AH4X 3MMGA 3ZVCA
chains in the Genus database with same CATH superfamily
1LVMA 1AB9B 2RA3A 1QBVH 2Y5FA 1CQQA 2UUFB 3BIUH 1ZHRA 1GHVH 5A09A 2IOTA 5C3NA 4ABEA 3A7TA 1K1OA 3BTME 1H8ED 1UVTH 2FOCA 3AASA 1ELDE 2A5IA 2XC5A 3BTHE 3A8CA 3NWUA 3W95A 2ZC9H 2Y7XA 1TABE 1PJPA 1FIZA 2R2WU 4H4FA 1BTUA 1G3EA 3K65B 3V12A 1C5YB 2WINI 2WPKS 3EA8A 5FAHA 2B5TB 1HJAC 3PV4A 1EB1H 1B0FA 1DUAA 2WHXA 2FS8A 1CHOF 1UTPA 2V3OH 2QF5A 3P8NA 4Y7AA 1MCTA 3ZZ7A 2XBYA 3F0OA 1A4WH 2KCYA 1O3KA 1A3EH 1CT0E 1LVBA 1O3AA 2FO9A 3EGKH 2VWMA 1C5UA 4CH8B 4B74A 5L30H 2A2QH 1GI5A 1Q3XA 1TWXB 1FNIA 1BMMH 1FUJA 1QQUA 2A1DB 2YMSC 2AGEX 3RXPA 1CHGA 1KLJH 2FOMB 1O5FH 2F3CE 3TK5A 1SC8U 1AZ8A 1D4PB 3F3BA 2BTCE 3MFJA 3SJ9A 3TNSA 2BHGA 1E34B 1GJ5H 1VITH 1C1QA 2CHAC 1NU9A 1C5SA 3A7XA 3M5MA 2AMPA 4Y8XA 4WJG2 5C2ZA 1C9PA 4FOUC 1K2I1 2VNTA 1UK2A 1QA7A 1THSH 2LPRA 2P8OC 1UMAH 2KZ4A 4A5TS 2HVYB 3F1SB 1O33A 1W0YH 5T1VA 1NRSH 5EJLA 1NRQH 2ZU4A 1SMFE 4XRNA 1ANDA 2AERH 1GMDF 1JIRA 3LH1A 3L6PA 3QO6A 1V2MT 1WU1A 1ZTKA 3LJJA 3RM2H 1ARBA 2PKAA 5BRRE 3BTWE 3SV9A 4TSFD 2B0FA 3ATIA 5E8EH 3ITIA 3LOXA 4BOHA 1P9UA 3F2GA 1AFQC 4Y11E 1HB0B 1O2RA 1KXFA 1EAUA 1MKXH 5ETXA 4D7GA 1A5HA 1JXPA 1SI5H 4Q63A 1Z8IB 2P95A 1QY6A 2SGDE 3ZZ8A 3TIUA 1BMNH 1O3OA 4A1VA 1QZ8A 1O3DA 2F9PA 1SGCA 3P70B 1TMTH 3W94A 1RJXB 2I6SA 1DS2E 1TBRH 3QZRA 1NFYA 1UCYE 3SV6A 3E90B 1SVPA 2GDEH 4PROA 3SBKA 1PQ7A 1A61H 2FZZA 3RXLA 2JETC 1OX1A 3T62A 4WMEA 4OGYA 2FTLE 2BQ6B 1DPOA 3P17H 1FV9A 2ZCKP 5L2ZH 2HPQH 3SU0A 4AG2A 1E35B 1AQ7A 2PW8H 1GCTB 1UTJA 1GI4A 3ENSB 1ABIH 4XBCA 2JJ1D 1W11U 5SGAE 1BTHH 1V2RT 6LPRA 4J1YA 3VB3A 1YP9A 1C2LA 2HNTF 2XRCA 3ZZBA 3GY5A 2OD3B 1H8DH 3A8DA 4X1PU 5KECA 4O3TA 1TOCB 1O2OA 4NFFA 1PPZA 2JDID 2R3UA 2GV6A 2NU2E 1GBEA 3GCTG 1MD7A 1P2NA 1ACBE 1SGEE 1C5XB 2SNWA 3UY9A 1V3XA 1E38B 5DO4H 3DSOA 3UPEA 1J8AA 4CHAB 2Q6DA 1SQAA 2P3FH 4OS5A 1SBWA 1WV7H 3A83A 1FAXA 4Y79A 2H5CA 3GCOA 4ZKNU 1EATA 4KGAA 3A7YA 1XX9A 2A5KA 3JZ1B 1EPTC 4MNXA 3E0NB 3AVZA 2EY4C 5IK2D 5HYOA 2G51A 1C2MA 5TJXA 5AFYH 1IQJA 1TBQH 2KAIB 1NS3A 1QB6A 2FLBH 4NA8A 1QIXB 3U28C 1ZTJA 1S84A 2PWXA 1Z71A 2UUYA 3GCNA 5EPNA 2STAE 1UTOA 3GDSA 1IQFA 3RXRA 3BG8A 1TNKA 1GI0A 1KSNA 5C17A 4X6OA 2BLOA 1MU8B 2Z3CA 2JJ2D 4AB9A 1EZSC 4RKJB 1EUFA 2TGDA 1ZR0A 2HVXA 1OYQA 1NY22 2B7DH 3VFEA 4BAQB 1BBRK 2NWNA 1MZDA 2PLXA 4I7YH 3GS9A 3LU9B 2HALA 2SGAA 3MWIU 1YPHC 4M7GA 1RD3B 5B6OA 3Q3XA 2QXHA 4JMYA 3ODFA 3SU1A 3RDZA 1OWEA 3RUOA 1ZRKA 2TBSA 1J14A 5DP6A 2AFQB 1CBWB 2BLVA 2KCAA 4B6EA 4DIIH 1ELVA 2P93A 1N8OB 1SL3A 5J4SA 1GMCG 1YPGH 5HIZA 3ZYDA 5TCAA 4CRBA 3KQDA 1DUEA 3BEIB 3A81A 2OQUA 1Z7KA 1W7XH 3S7KB 2ZDMA 1SOZA 5T6GA 1LVOA 2XC0A 3SJOA 1WCZA 1TGNA 1OOKB 1VCWA 3EE7A 1MTUA 2HNTC 1WDIA 3QZQA 3C1KA 3G01A 1TOMH 3A8BA 2P3TB 1A1RA 1EJNA 1MKWH 1FPHH 1RXPA 1C5VA 1SB1H 2GDDA 2XNIA 2BDHA 4P02A 4BTIB 2PKSC 4U32A 2KCPA 1AWHB 3DFJA 3TPIZ 4A1XA 5E2PA 2ZGBH 2FOGA 2ZHFH 4ZXXH 4WVPE 1AGJA 1HLTH 3ZV9A 1MBQA 2XYAA 1IQNA 1YLDA 1LMWB 5FL7D 3A84A 1EKBB 1P3EA 2OBOA 3HK6B 1GL1A 1TPOA 1FXYA 3WW7A 1GHBG 1JWTA 4Y76A 2Z9IA 1OWIA 1VGCB 3NXPA 1O0DH 4I8GA 1UJ1A 1CHOG 5K7RA 2AEIH 1AMHA 4B2AA 2XBXA 2H6MA 1OP2A 1BTYA 3FP7E 1HAVA 1DANH 2GCHG 3O8RA 4ESTE 1KTTB 1H1BA 1GI9B 3UWIA 4RI0A 4BXWA 4DG4A 1O2JA 3MO3A 4TY7A 5FPSA 2PKAB 4K3JA 1BZXE 1TPAE 1EOLA 2KCOA 5EQQA 1GI8B 1OPHB 2ANKH 2FOAA 1OS8A 2ZECA 3CP7A 1GJBB 2B8OH 3SHAH 1JRTA 1E79D 4ABAA 3H5CB 1XXDA 1UTKA 5T6DA 4OS1A 2VIWA 3R0FA 1GVLA 1UTNA 1CVWH 1CU1A 1O2XA 4IGDA 1IQMA 3LJOA 5FCRA 3MO9A 1ZGIA 3SQHE 4F48B 1SLWB 3RXFA 1FMGA 1ANEA 4MLFB 3PROA 2XBVA 2Y7ZA 1RS0A 4ZHLU 1Z8RA 4H6TA 1SGIB 3QDZB 1NRPH 1QQ4A 3M61U 1BQYA 1BIOA 2GCHF 2BD8A 1G3DA 2C8WB 1C5NH 2VIOA 1MTNC 3QUMP 4I86A 5GCHG 1MAXA 3DSPA 3TGKE 1LTOA 1G3BA 2FIRH 2OUAA 3P95A 1DWCH 5EOKA 7KMEH 1C1WH 2ZFTA 1AUJA 1DICA 4X8SH 5CHAC 1O3MA 4TT3D 4ACAA 5C94A 4KKDA 1LPGB 1YLCA 4X1RU 2A4GA 1NPMA 1O5EH 1Y3VA 1PPBH 3STIA 3ZZ9A 4Q7XA 1O3CA 3SJ8A 4YESB 1O2IA 4O03A 4BTUB 4JZDH 1OKXA 2Y80A 2XCFA 2XWBI 3M5OA 3C27B 2J92A 3A89A 2Z3DA 4SGBE 2RFKC 5G4BA 3MNCA 1WOFA 4WF8A 3IG6B 4DY7B 3RXEA 5L6NH 1P12E 3UWJH 3QTVH 2W6ID 2WUBA 7GCHF 4ZHAA 3SU2A 4GAWA 2G55A 4K1SA 1GBLA 1COWD 2PP6A 1O2UA 5LPFA 1QJ6B 4H6SB 3TK9A 4FU8A 3V7TA 2P16A 1YPMH 2W7UA 1GCDA 1SGPE 8GCHF 4AFUA 2YMSD 1DXPA 5FBEA 2PGBB 3SU4A 4TWWA 4IC6A 1LPKB 1SGTA 1ETRH 1GVZA 2OC1A 2O9QA 2F9NA 1DDJA 1O2KA 1Y3UA 4INHA 3SV2H 4AOQA 5C5NA 5HM9A 3UNQA 4B71A 3GICB 4XDEA 3QLPH 1E1QD 1GBCA 2R2MB 3MU0A 4GCHG 2BM2A 1P02A 3SI3H 1ETSH 4AX9H 2OLGA 3PM3A 1CO7E 4KP0A 1S85A 1YPJH 1DXWA 1HXEH 1O37A 2Z9LA 1C9TA 1GHXH 1SQRA 1YWUA 2G00A 1TONA 1O38A 2ZGJA 2V6NA 5E0JA 3LGTA 3A82A 1MTWA 4Y10E 3BTFE 1ZRBA 2AIQA 2RCEA 4FVDA 5C0UA 1P2JA 1W10U 4FUHA 2A31A 3M35A 1INCA 2BDYA 4INKA 1ZMNA 3ZVGA 4YLUA 3OEED 1A0HB 1IQHA 3PV2A 2J97A 5EGMA 1QL9A 3OTJE 3O8BA 1LPZB 3N99A 4JZIA 4RKOB 1SR5C 2WSSD 5F03A 4B2CA 5EODA 2ASUB 2BLWA 3TK6A 3ZZ6A 2J98A 1WAYB 1Y3WA 1ELCA 3U8TH 1OYTH 2VGCC 4XE4A 2ZEBA 2PKSB 1Z6EA 1P0SH 1DFPA 1HIAB 2QYIA 7ESTE 1T8LA 1B5GH 2W6JD 4JYUH 1S81A 4UFEH 1D9IA 1P01A 3LGVA 6CHAB 2WUCA 2QXJA 3FP8E 4WWYA 1ABJH 1UVOA 2FI5E 2HGTH 1T8MA 3RMOH 1JMOH 1VGCC 1BRCE 1Q31A 2STBE 2FPZA 1KDQB 2BLQA 1BBRH 1HJ8A 4I8HA 1XXFA 3LPRA 2V0BA 3SV8A 2ANWA 2D8WA 3M37A 4NSYA 2LNCA 1W8BH 1F92A 1O3PB 1XUKA 8KME2 4MPVA 3LKWA 2QIQA 2BD5A 2Y5HA 1DE7H 1GJ7B 3GY7A 1ORFA 1ZJDA 2ZDVH 3M36A 1GBMA 1GBBA 4OS7A 3TITA 5E2OA 1MZAA 5ESBA 1QGFA 3QGJA 1P2IA 2IJOB 1CGJE 2DE8A 4IMZA 1RIWC 3D62A 3QGNB 2G5NA 4Q80A 5DSFA 3DT0H 2XNDD 2WPLS 3M7QA 1A0JA 1GBKA 2TGTA 1M9UA 3AW0A 3BTKE 1PPEE 1BTXA 1THPB 4YOIA 1MKWK 1YC0A 2QF4A 3TH3H 1DWDH 2W26A 3SUGA 1C2GA 4I31A 1W3CA 4HGCA 1YKTA 1XVMA 4WXVA 3F68H 1A2CH 5EG4A 4GHTA 1T7CA 1AE5A 5FHTA 2AMDA 2PFEA 3QWCH 2A7HA 3DCLA 4YT7H 2FOHA 3B23B 1F5KU 3GY3A 1VCPA 2ZFRH 3LIWA 2M5TA 3KYGA 4E7NA 1ZSLA 1K21H 2ZHEH 1GI7B 4MQAA 1CGHA 1XUHA 1C5QA 3SNEA 1C1PA 2Z94A 3PO1B 3WWFA 3LGUA 1XUIA 2SFAA 2FWWA 1EAXA 1YLNA 2GGVB 2M2AA 5EXMA 4K5ZA 5H4IB 4U30A 2G4UA 3LH3A 2KM0A 2ZF0H 1ZMLA 4D9RA 3MO6A 4AG1A 2Z9GA 4CBNA 3NPSA 3FANA 2ODYB 3BV9B 2ZTYA 3SO3A 3VB4A 1VKYA 1Z1IA 2JH6D 3T27A 1L0ZA 1ELAA 4ZMAH 2QC2A 5DG6A 5EPYA 1SPJA 1NC6A 1W0JD 1C1MA 1BRBE 3P6ZB 5AFZH 2P59A 2GX4A 5DKMA 2JETB 3KCGH 1N1LA 2F9OA 1GBIA 1V2JT 1S6FA 1EP6A 4JK6A 1GL0E 2WPDD 1BB0B 1RTKA 1ZMJA 2EC9H 4XD7D 4YT6H 3BTQE 4JZFH 3P8FA 5FBIA 1K1MA 2GJGA 1SOTA 5ABWA 2PSXA 1MTVA 1QR3E 3VPKA 1FY8E 3BSQA 4X8VH 1C5ZB 3AW1A 3STJA 4I33A 1J16A 2C4FH 2FI3E 2BXTH 3ESTA 2P94A 1DM4B 2Z6BD 5GIBA 1TLDA 2VWNA 3NRLA 4BAHB 5FX6A 2VH6A 1TX7A 2HNTE 4CRDA 2GCTC 4FUFA 3RC5A 4D76A 2UWPA 3QN7A 2H9HA 1FY4A 4VGCB 3GDVA 3FP6E 3KHVA 1W0KD 1BJVA 1K1NA 3Q3YA 1LVYA 3SGBE 2A7JA 1ZTLA 8ESTE 3VGCC 1NT1A 1O2YA 3NCLA 3LC3A 4X2WA 2Q6FA 1TNGA 4ZKRU 1TIOA 4MVNA 4XBDA 3VXEH 3PYHA 1V2WT 3JZ2B 4Y8YA 1TQ0B 3SNDA 1TQ7B 2BD7A 2P8OB 2RA0A 2FM2A 3RXTA 1DWEH 4NIXA 1LHGH 4BAOB 4QT8C 4GPGA 2TRMA 3U69H 3VXFH 2HOBA 3EQ0H 1W14U 1ARCA 3Q77A 4FUEA 3RXCA 4Q7ZA 1UW7A 1O2TA 1C1NA 1N6YA 2BDIA 1GI2A 3SUDA 2UWLA 3M3TA 2BY8X 1Y3YA 3K9XB 3SN8A 1BMAA 1MU6B 1UK4A 2ZPRA 4B75A 4B1TA 4B6FA 3BEUA 4K1EA 2GZ9A 1RFNA 1AFEH 1XKBC 1S0QA 1GMHF 1O3GA 1B7XB 2QAAA 1MUEB 2V7QD 1C4V2 3R3GB 2F9UA 4ABGA 5C0TA 5LH8A 3OX7U 2ZFPH 1UVSH 1XUJA 1AY6H 3LGWA 2BVRH 4NGAH 3S69A 2BQWB 3F6UH 1D6WA 4ZHMU 2I6QA 4LZ1H 1QCPA 2HLDD 4MDSA 4NIYA 3GY6A 4DT4A 3TVJB 4J2YB 3BTTE 5CHBA 5EXNA 4JYVH 3A80A 4FUJA 1PPFE 1ZPCA 3U1JB 1HUTH 1WSSH 1RTFB 3KQBA 4MTBA 1UTMA 4AYVB 4Y71A 4UDWH 1BHXB 4IBLH 4LXBH 1TNIA 1YPLH 4NCYA 2ZU3A 2A4RA 2PGQB 3KQCA 1IQIA 2ZFQH 4GCHF 5ESTE 3MNXA 3PTNA 1O31A 3URDA 2ULLA 1P04A 2GT7A 1S6HA 1JRSA 5GJ4B 5AHGH 3A7VA 2AS9A 2VBCA 1IQGA 2TGAA 1HV7A 1GJAB 1DVAH 1ZPZA 2PUXB 3MTYA 2ANYA 1Z6JH 5HKKD 1Z8GA 1Y5UT 1P2MA 1FONA 1MBMA 8GCHG 3GY2A 2HPPH 2JKHA 4AFQA 4CBOA 2W3KA 1TE0A 1MD8A 1HJ9A 1P2OA 4O9VA 4FXGH 3SU5A 2C8XB 3PB1E 4X8UH 1UVPA 3SYJA 3VB5A 1WTGH 1O2QA 3DA9B 1SGDE 4CREA 4UEHH 5A0AE 3PV5A 2A45B 3QTOH 2VWOA 2XC4A 3HGPA 1AE8H 2DE9A 1E37B 1K22H 2QXGA 1X7AC 1WBGB 3LC5A 3V3MA 1P05A 1L4ZA 4NSVA 3Q76A 4ZKOU 1TBZH 1P09A 1V2NT 2VVVA 1UHBA 1AB9C 1G36A 4X0WU 1NESE 4Y6DA 1YBWA 4RN6A 1HBTH 3UB0A 1C5PA 1HAOH 3MOCA 1KDQA 1G2LA 2OC7A 2R0KA 3UTUH 3UFAA 2FXRA 3AAUA 3GY8A 1GVKB 4YOJA 1AVXA 3VB6A 3PRBA 2NU1E 2UUKB 1C4U2 1CBWC 1BTZA 4MG3A 2V3MA 1K1LA 2J9NA 5EQSA 1SGRE 2QY0B 2QCYA 1EJAA 1RRKA 2WPMS 1QNJA 5A8XA 1A3BH 2H2ZA 3M5LA 4X1NU 1TPPA 4NIWA 5DP3A 3EA9A 1JBUH 1C2DA 1QA0A 2XTTB 1AHTH 5FXLA 3VB7A 1C5WB 4CR9A 1EAIA 2W3IA 4XSKU 1S82A 3UOUA 1BHXF 3KL6A 5F8XA 3A86A 1GI1A 1O2WA 4IS5A 4ACBA 1SQTA 1HNEE 1N8OC 2HRVA 1ZLRA 5GDSH 2ALPA 1NFWA 1ZGVA 2ODPA 3K6ZA 3ZVFA 1TAWA 3SOSA 1G9IE 4UFGH 2Y81A 5C1UA 5DP9A 1FX0B 1NM6A 1N6XA 4AGJA 3F2FA 1L1JA 3UNRA 2FMJA 1ZOMA 4BNRA 3RLYH 1ELBA 1VCQA 1BMLA 5JB8S 4OS2A 5EW1H 1OP8A 2YOLA 2ZFSA 4GVUA 2G52A 1TPSA 3AK5A 5T3HA 1K28D 4ZAEA 2CGAA 3SQEE 1TNHA 1QTFA 3FN8A 1QRXA 1NFXA 3E16B 2A4QA 6ESTA 1BA8B 2GV7A 5AF9H 4FUBA 1WQSA 4WH8A 1T8OA 2ZGXH 1GBFA 1L1NA 1BTPA 4E05H 4YZUA 2R0LA 2BD2A 3RMNH 1BBRE 1L2EA 1P2QA 5B6LA 3S9BA 2SGFE 4A7IB 3KQ5A 1K1JA 3FVFB 1AIXH 1OHHD 4NG9H 2Y82A 1GHAG 4AFZA 1C2EA 5E0HA 1J17T 1EAWA 3MU5A 2Y6TA 7LPRA 1FY3A 4Z0KA 1HGTH 2WV9A 3F2HA 3I29A 3RXMA 1ZSKA 3E3TA 3TLOA 1MQ5A 3KYFA 2Y5GA 4WMDA 4X6NA 1XKAC 4WXIA 1BRAA 5C67A 4BTTB 2QF3A 4ZXYH 2XCNA 1DSTA 4ZUHA 4INLA 5L2YH 4UONA 3F9EA 1W12U 2FOBA 1P06A 2RDEA 1NBME 2BDCA 3OTPA 4NIVA 3RXSA 1TRYA 1QBNA 3KF2A 1GJCB 2O8LA 1AO5A 4MPUA 2VINA 5DP5A 1AN1E 1IQKA 1D3PB 3OFND 2OINA 2VJ1A 1HAHH 3TH2H 5LPEA 1GG6C 2ZCHP 4R8TB 2GCTB 4YOGA 1GHZA 1Y8TA 1TFXA 4Z6AH 5JBBS 3SUEA 1EZQA 1NBMD 2FLRH 3OU0A 1GJ9B 2C8ZB 5GXPA 4AZ2B 1V2ST 2BVSH 4GLYA 1E1RD 2A32A 4AN7A 1PPGE 1Y3XA 2PV9B 2FODA 2VVCA 3BTGE 5K0HA 3PMJA 1LDTT 2BDGA 2K0QA 4OM9A 4BXSA 1UVUH 5FX5A 2LP6A 2FX4A 3BN9A 4H42U 5DK1A 2F43B 3UNSA 1FDPA 3TU7H 1MCVA 1XVOA 3F9FA 1GJ8B 2J95A 1TMBH 4VGCC 3U8RH 3ZZ3A 1C1TA 4MPXA 4LOYH 4Y8ZA 1ELGA 2THFB 1ELFA 3OEHD 1XUFA 1EASA 1AKSA 3ZZ5A 1ELEE 4Y7BA 1O2HA 1O2ZA 3SNBA 1TRMA 1Z8JB 4OS6A 1YPEH 1GMDG 1UTQA 2K8IA 3UAIC 4ABDA 2UWOA 3URCA 1KXCA 2WYJA 2Z3EA 4TPYA 3WY8A 2NU0E 5F8ZA 2ZI2H 1SLXB 2CN0H 2FESH 1T4UH 4WY3A 3RXOA 5LPRA 1VR1H 1GHYH 1TMUH 5C20A 4ASHA 3RC4A 1S6LA 5DN6D 1NFUA 1PQ5A 1ETTH 3ATMA 1FN8A 4YXWD 1TALA 2ZA5A 3T26A 2BZ6H 3AAVA 2NU3E 2XXLA 2ZNKH 2ZU1A 5DP8A 4X2XA 2ILNA 3FOAA 3HGNA 1CGIE 2YMSB 1F2SE 1PPCE 4TY6A 3RXQA 4ISIH 1BJUA 4ABFA 3MI4A 4JCNA 1C1RA 1TNLA 1SGYE 2WPJS 1SHHB 3OYPA 3OY6U 1EPTA 1PQ8A 1E36B 4DOQA 3P92A 5F8TA 1HDTH 3A7ZA 1GJDB 5E0GA 2EQNA 3MYWA 1TGSZ 3BG4B 3PLKA 3UQOA 2F9BH 5EJ1A 4U2WA 1SFIA 3SZNA 1W13U 2ZHDA 3BEFB 4U01A 1GCTC 5JBAS 2ZDNA 2ZFFH 1SGFA 1YPKH 1XUGA 5EIYA 1WYKA 4NWKA 1O5CB 3GYLB 3GY4A 3U1IB 3M3SA 1EOJA 3F9HA 3LT3A 1A5IA 2ZPQA 3VG8A 1EX3A 1C1VH 1YPHE 2GMTC 3UUZA 5JYIA 3PWCA 4ISHH 3RM0H 1HAGE 2Q1JA 5EQRA 1RIWB 3B8JA 1GHWH 1TA6A 2P3UB 1O5GH 2XBWA 2QF0A 2ZTXA 3S9AA 2VIQA 5A0BA 1EQ9A 2QXIA 3I78A 1GBJA 3PMBB 2PUQH 3I77A 3MH7A 4UFFH 1O30A 1QBOA 2GTBA 4O97A 1MTNB 1Y5AT 2R9PA 2Z9KA 6CHAC 1QB9A 1O2SA 1A5GH 3ATWA 1GG6B 1KXBA 1MKXK 1CE5A 1ANCA 1AVGH 3SU3A 4B76A 1P10A 2BD9A 1AUTC 4ZROA 1HAZB 5F53A 4A6LA 1KTSB 2CXVA 1FIWA 4B73A 1EZXC 1P57B 2FOEA 1KIGH 1TRNA 1KY9A 3O8DA 5A8ZA 5JBTA 4F4OC 2ZGHA 1FI8A 5DP4A 1O2LA 1GDQA 1EB2A 3TH4H 6GCHG 5CHAB 1OWJA 3PLPA 1Y59T 1GDUA 4I8LA 1SQOA 1S83A 2CF9H 5EXLA 3RXIA 3SNAA 2GD4B 4LK4A 2L74A 4CRCA 5PTPA 2HWLB 2D26C 4E7RG 4AYYB 1C1OA 2WV5A 1SGQE 2AIPA 3E6PH 2BY5X 1V2OT 3PMAB 2ZZUH 1WQVH 5I25A 4UFDH 4K8BA 1WUNH 1O39A 4MPWA 3LDXH 3NUMA 3MU4A 2VU8E 3UR6A 3ZZ4A 5CMXH 2OCVB 2ALVA 1W0ZU 1NTPA 1AU8A 1OXGA 2ODQA 2VWLA 1GWAA 3W1EA 3ZZCA 4BAMB 4K8YA 2G5VA 1RGQA 1P8VC 1T8NA 2BY9X 1FN6A 3OSYA 3M3VA 1PYTC 2A0QB 1HPGA 1BTWA 2F9VA 3FAOA 3GCHC 1TGTA 2J34A 3PLBA 2OXSA 2VIVA 2EEKA 2ZDKA 5J4QA 2SGPE 1SKYE 2L6OA 7GCHG 4ABJA 1K1IA 3HPTB 1GDNA 1O2GH 3A88A 3MNBA 4JYTA 1VJ9U 4NA9H 1EJMA 2PTCE 2O8WA 3MNSA 2F91A 3RXJA 4CRAA 2EA3A 1LHDH 3V13A 1UCYH 1BDAA 1CA8B 3LGYA 1HCGA 3UIRA 3RU4T 1DT2A 2ZKSA 4YTAA 2QV1A 1CT2E 2GKVE 4JZEH 4RT1A 1BMFD 3KGPA 2TIOA 4X6PA 3KQEA 5DP7A 5GNDA 2FP7B 1KXDA 1TA2A 1U6QA 1GHBF 1AWFH 3SI4H 2AYWA 1QB1A 3WWBA 3IITA 5EW2H 1F0UA 1LQDB 5A0CA 3ZIAD 3TGIE 1ID5H 1ZJKA 1ESBA 1NRRH 1GJ4H 3K6YA 3T5FH 1GMHG 3TJVA 1V2LT 2FS9A 3ELAH 3TGJE 1Y5BT 1KXEA 1O5DH 2JH5D 3EE0B 3SZEA 2SGQE 1O3JA 2ZU2A 2ZCLP 3RXBA 5GWZA 3UREA 2AHME 2OTVA 3SJIA 1C5RA 1TGCA 1O5AB 4GUXA 4WMFA 1BCUH 4FUCA 1ZYOA 1NROH 4ZCNA 2G81E 4D9QA 1HRTH 2VVUA 4X2YA 1CA0B 1D3TB 9ESTA 3A87A 3ODDA 1KXAA 3T2NA 3BG4C 3SV7A 1C4Y2 3FFGA 1D6RA 3SGAE 2ZP0H 1YYY1 1YCPM 5C1XA 2GT8A 3VGCB 4A1TA 1QFKH 2BVXH 1JIMA 3F9GA 4FUGA 1YF4A 3ATKA 4SGAE 2VH0A 3ATLA 2NU4E 1DOJA 1GMCF 1ZHPA 2O8MA 2XOKD 3HK3B 1QJ7B 3Q3KA 4X1SU 1DY9A 3A7WA 2BYAX 3OY5U 1H8HD 1K1PA 3RXDA 4Z1MD 1HAYB 3QX5H 2IN2A 2SNVA 4XOJA 2ZDAH 3RXHA 1QRZA 4FU9A 4IMQA 2FYQA 2KFWA 1GGDC 1T31A 1J15A 4DIHH 1TX6A 2Z7FE 3GOVB 1A0LA 1ZPBA 3T29A 3FO8D 3L3TA 3SNCA 4CRGA 4R0IA 1O3IA 4M9FA 4DJZB 1MMJN 3ZVAA 3DFLA 2ZGCA 3ZVBA 4ZH8A 1LHCH 1O2PA 1V2QT 5JB9S 3UR9A 1PYTD 1IHTH 3CS0A 3EA7A 1V2UT 1FZZA 2EI8A 4FUDA 3KIDU 3S0NA 1K0HA 1O5BB 2QA9E 1GBTA 1IAUA 1H9LB 4ASUD 1EPTB 1OWHA 1O3BA 5HGGA 2D2DA 1C2IA 3DD2H 1DLEA 1FQ3A 1C1UH 2PTNA 1PFXC 4HTCH 1K9OE 3MU8A 3EYDA 2A2XH 1LCYA 4K2YA 1DY8A 4XBBA 1GI6A 2A5AA 1DSUA 4Y0YE 4KTCA 2BY6X 2BB4A 2W5EA 3IWMA 3NKKA 3RC6A 3PO1C 3A85A 4Y0ZE 1DX5M 2LELA 4IN1A 1ESTA 1CSOE 1WXRA 1TX8A 4ISLA 3OAAD 2BX3A 4CH2B 4I8KA 3OE7D 1EXFA 3MU1A 2FDAA 2Z9JA 1C5MD 2BZAA 1V2KT 1O3EA 4CRFA 3P8OA 2CV3A 1SGNE 1A7SA 1ZZZA 1AFQB 2F83A 2FYRA 1GHAF 4YO9A 2CJIA 1MABB 1QL8A 2AGGX 3CNRA 5BPEA 1NU7B 2C93B 2H1UA 2IPHA 1QJ1B 3PMHB 4ISNA 5TCCA 1SLUB 2V35A 1OSSA 3SHCH 2ZPSA 1V2TT 5EJZA 3RXUA 6GCHF 4AGKA 4FUIA 3SORA 2RG3A 4Q4LA 1PQAA 4B2BA 2KX4A 4KTSA 3RP2A 4JK5A 2ZWLH 3SGQE 3ZYEA 3K2UA 1NO9H 4ISOA 3MH5A 4THNH 1KMHB 2ZQ2A 1O3NA 2OBQA 4NFEA 3LONA 2GMTB 1C2FA 5KGOA 5HIYA 3B9FH 2C3SA 1JOUB 2OK5A 4X8TH 2VIDA 1NZQH 3LGIA 4MNYA 1BUIA 5A2MH 4IW4E 4BAKB 3CENA 2C90B 1F5LA 1RTLA 4ABIA 2ZQ1A 2GZ7A 3PRDA 3FZZA 1VJAU 4O3UA 3L33A 5T6FA 2FTMA 3RXVA 2O8UA 4ZKSU 4HFPB 4ABBA 3BTEE 5LGOA 1YM0A 1OP0A 2VIPA 1W2KH 1DLKB 3UOPA 1F0SA 1EP5A 4KTUA 3MH4A 3SW2B 1GJ6A 4X2VA 1SG8B 3GCTF 1W7GH 3BF6H 1F0TA 4AFSA 1P3CA 1YCPH 2PHBA 2OQ5A 2H9TH 4OS4A 5IDKA 1TGBA 1UO6A 1G30B 1UHBB 2CHAB 1BITA 3D65E 3M5NA 2BDBA 2H5DA 1TB6H 4JZ1A 1GI3A 3V0XA 1AVWA 1PPHE 5DGJA 1O34A 4ABHA 1FY5A 4X6MA 3KNXA 3SUFA 1KYNA 3D49H 1WTHD 2O8TA 2GVFA 1XM1A 1F5RA 4CHAC 4DCDA 5CE1A 1O3LA 1AZZA 1LKBA 2F4LA 3SJKA 1ESAA 1UK3A 2FI4E 3H7OA 2UUJB 1QHRB 3RLWH 1FAKH 2J94A 4DT7B 5C1YA 1SGFG 3MH6A 1GBDA 2FEQH 1MAYA 3TJNA 1KLIH 1BOQA 1ZHMA 1AD8H 1HYLA 1O32A 1O2NA 4Q2KA 4DURA 2J4IA 1SSXA 1YCPK 2PR3A 3H09A 3ZVDA 1VITG 5F6MA 1C5LH 4FETA 1MQ6A 1O35A 1F7ZA 4FVBA 1L1GA 1L4DA 1EFRD 3NK8A 5GCHF 4E06H 2FX6A 1G3CA 1TNJA 4K60A 3VEQB 1TYNA 3E1XB 1BRUP 4LZ4B 2ZHWH 3ZVEA 1LKAA 1FY1A 3BTDE 1THRH 5HM2A 4RSPA 5HMAA 1UCYK 3H7TA 1HXFH 1V6DA 4D7FA 5FPTA 1VZQH 3PTBA 3N7OA 1IQLA 4UE7H 3GYMA 4YM9A 3E91A 1T32A 1NN6A 4DGJA 1S5SA 3SU6A 1IHSH 3RMLH 2BXUH 4F49A 2WPHS 2KAIA 2C8YB 3EAJA 2ZO3H 4WH6A 5CDFE 3FKSD 2IPQX 3FZDA 2BOKA 1C1SA 1QRWA 1GPZA 3D23A 1J9CH 2IJD1 1MTSA 2EI7A 4NZLA 1MH0A 2JIZD 1LQEA 3KN2A 3QK1A 1AKSB 1FLEE 2VGCB 4K69A 5I46H 4MNVA 1ELTA 1C5TA 3N7EA 4XFQA 1S0RA 2PSYA 1Q2WA 2AGIX 5JPMH 5A8YA 2ESTE 1V2PT 1D3QB 2GZ8A 1CT4E 4MNWA 1UTLM 4IN2A 2G8TA 2ZIQH 2ZDLA 5DJ7A 1H9IE 2OC8A 1LO6A 2WPIS 3GCHB 5FPYA 2B9LA 3RXKA 2OP9A 1B0EA 5DPAA 1H8IH 1E0FD 2K1QA 4HZHA 2ZU5A 2BD3A 3A8AA 2KR7A 4GSOA 1SLVB 3U9AH 3KEEA 3CS7A 4HI3A 4TWYA 1Z1JA 1QURH 3GISB 4DVAU 2TPIZ 1FPCH 5IYTA 1C2HA 3N7DA 2BDAA 4FU7A 4NWLA 5HXFA 2OC0A 1C2KA 2J2UA 4D8NA 4I32A 2J5UA 3E8LA 1GGDB 1HAXB 5C5OA 1O3HA 4DW2U 4I8JA 3RU4E 1DITH 3DUXH 3T25A 3M7UA 3UQVA 2ZHQH 3RXGA 2HLCA 2VB0A 1P9SA 2BX4A 1P03A 3TJOA 4BANB 4TYDA 2BY7X 2ZTZA 2J38A 4RT0A 2BMGB 1HFDA 2YNAA 2WV4A 2G4TA 4AORA 1XMNB 4A92A 2EI6A 1F0RA 3O8CA 4P00A 2WYGA 2AMQA 4F55A 1H9HE 1T4VH 2A7CA 3ZZDA 3E0PB 1O36A 1HJAB 1GBHA 1YGCH 4NA7A 5GPIB 3M7TA 2JH0D 3RXAA 3DHKH 1CA0C 2BD4A 9LPRA 1DWBH 1ANBA 3Q00A 1KLTA 2BQ7B 4AB8A 1HIAA 3TJUA 1G37A 3RMMH 1C2JA 1EZUC 1IOEA 3PWBA 2CK3D 5AVDA 2R3YA 3HATH 1BT7A 1V2VT 2ANMH 2CMYA 2GP9B 1LHEH 2BOHB 5EU8A 1FJSA 3T28A 2J98B 2QGRA 2YNBA 4TPIZ 5JBCS 1O2MA 2QE7D 4NZQA 1VITF 1G2MA 1OWDA 2RDLA 3HKIB 2H9EH 1IQEA 1A46H 2XWAA 4K1TA 3U8OH 3S7HB 1QL7A 2ZG0H 2D1JA 3S9CA 2A4OA 2SGEE 3HKJB 5KEDA 4CR5A 4AC9A 1G32B 3U98H 4KELA 1O3FA 2W7SA 3ZZAA 1NRNH 3RU4D 1GBAA 3BIVH 1P11E 4X1QU 2V3HH 1SHYA 4UD9H 1SFQB 4IC5A 3MHWU 2DUCA 4HG6A 1O2VA 2TGPZ 3GDUA 3TNTA 1AI8H 1HAIH 4GHQA 3EDXB 1C5OH 2Q6GA 8LPRA 2XW9A 2FOFA 1HAVB 1ZSJA 2QN5T 1P2KA 1D3DB 3F0PA 2CF8H 1YY3A 4YLQH 1H4WA 4Q7YA 1OWKA 5FCKA 3NZIA 5JDUB 3ZV8A 3DSGA 3P8GA 4OGXA 1LHFH 1HAPH 2AH4X 3MQKC 3MMGA 2WZQA 3ZVCA
chains in the Genus database with same CATH topology
1LVMA 1AB9B 2RA3A 1QBVH 2Y5FA 1CQQA 2UUFB 3BIUH 1ZHRA 1GHVH 5A09A 2IOTA 5C3NA 4ABEA 3A7TA 1K1OA 3BTME 1UVTH 2FOCA 3AASA 1ELDE 2A5IA 2XC5A 3BTHE 3A8CA 3NWUA 3W95A 2ZC9H 2Y7XA 1TABE 1PJPA 1FIZA 2R2WU 4H4FA 1BTUA 1G3EA 3K65B 3V12A 1C5YB 2WINI 2WPKS 3EA8A 5FAHA 2B5TB 1HJAC 3PV4A 1EB1H 1B0FA 1DUAA 2FS8A 1CHOF 1UTPA 2V3OH 3P8NA 4Y7AA 1MCTA 3ZZ7A 2XBYA 1A4WH 1O3KA 1A3EH 1CT0E 1LVBA 1O3AA 2FO9A 3EGKH 2VWMA 1C5UA 4CH8B 4B74A 5L30H 2A2QH 1GI5A 1Q3XA 1TWXB 1FNIA 1BMMH 1FUJA 1QQUA 2A1DB 2AGEX 3RXPA 1CHGA 1KLJH 2FOMB 1O5FH 2F3CE 3TK5A 1SC8U 1AZ8A 1D4PB 2BTCE 3MFJA 3SJ9A 3TNSA 2BHGA 1E34B 1GJ5H 1VITH 1C1QA 2CHAC 1NU9A 1C5SA 3A7XA 3M5MA 2AMPA 4Y8XA 4WJG2 5C2ZA 1C9PA 1K2I1 2VNTA 1UK2A 1QA7A 1THSH 2LPRA 2P8OC 1UMAH 4A5TS 3F1SB 1O33A 1W0YH 1NRSH 1NRQH 2ZU4A 1SMFE 1ANDA 2AERH 1GMDF 1JIRA 3LH1A 3L6PA 3QO6A 1V2MT 1WU1A 1ZTKA 3LJJA 3RM2H 1ARBA 2PKAA 5BRRE 3BTWE 3SV9A 2B0FA 3ATIA 5E8EH 3ITIA 3LOXA 4BOHA 1P9UA 1AFQC 4Y11E 1HB0B 1O2RA 1KXFA 1EAUA 1MKXH 5ETXA 4D7GA 1A5HA 1JXPA 1SI5H 1Z8IB 2P95A 1QY6A 2SGDE 3ZZ8A 3TIUA 1BMNH 1O3OA 4A1VA 1O3DA 2F9PA 1SGCA 3P70B 1TMTH 3W94A 1RJXB 2I6SA 1DS2E 1TBRH 3QZRA 1NFYA 1UCYE 3SV6A 3E90B 1SVPA 2GDEH 4PROA 3SBKA 1PQ7A 1A61H 2FZZA 3RXLA 2JETC 1OX1A 3T62A 4WMEA 4OGYA 2FTLE 2BQ6B 1DPOA 3P17H 1FV9A 2ZCKP 5L2ZH 2HPQH 3SU0A 4AG2A 1E35B 1AQ7A 2PW8H 1GCTB 1UTJA 1GI4A 3ENSB 1ABIH 4XBCA 1W11U 5SGAE 1BTHH 1V2RT 6LPRA 4J1YA 3VB3A 1YP9A 1C2LA 2HNTF 2XRCA 3ZZBA 3GY5A 2OD3B 1H8DH 3A8DA 4X1PU 4O3TA 1TOCB 1O2OA 4NFFA 1PPZA 2R3UA 2GV6A 2NU2E 1GBEA 3GCTG 1MD7A 1P2NA 1ACBE 1SGEE 1C5XB 2SNWA 3UY9A 1V3XA 1E38B 5DO4H 3UPEA 1J8AA 4CHAB 2Q6DA 1SQAA 2P3FH 4OS5A 1SBWA 1WV7H 3A83A 1FAXA 4Y79A 2H5CA 3GCOA 4ZKNU 1EATA 4KGAA 3A7YA 1XX9A 2A5KA 3JZ1B 1EPTC 4MNXA 3E0NB 3AVZA 5HYOA 2G51A 1C2MA 5TJXA 5AFYH 1IQJA 1TBQH 2KAIB 1NS3A 1QB6A 2FLBH 4NA8A 1QIXB 1ZTJA 1S84A 2PWXA 1Z71A 2UUYA 3GCNA 5EPNA 2STAE 1UTOA 3GDSA 1IQFA 3RXRA 3BG8A 1TNKA 1GI0A 1KSNA 4X6OA 2BLOA 1MU8B 2Z3CA 4AB9A 1EZSC 4RKJB 1EUFA 2TGDA 1ZR0A 2HVXA 1OYQA 1NY22 2B7DH 3VFEA 4BAQB 1BBRK 2NWNA 1MZDA 2PLXA 4I7YH 3LU9B 2HALA 2SGAA 3MWIU 1YPHC 4M7GA 1RD3B 5B6OA 3Q3XA 2QXHA 4JMYA 3ODFA 3SU1A 3RDZA 1OWEA 3RUOA 1ZRKA 2TBSA 1J14A 5DP6A 2AFQB 1CBWB 2BLVA 4DIIH 1ELVA 2P93A 1N8OB 1SL3A 5J4SA 1GMCG 1YPGH 3ZYDA 5TCAA 4CRBA 3KQDA 1DUEA 3BEIB 3A81A 2OQUA 1Z7KA 1W7XH 3S7KB 2ZDMA 1SOZA 5T6GA 1LVOA 2XC0A 3SJOA 1WCZA 1TGNA 1OOKB 1VCWA 1MTUA 2HNTC 3QZQA 3C1KA 3G01A 1TOMH 3A8BA 2P3TB 1A1RA 1EJNA 1MKWH 1FPHH 1RXPA 1C5VA 1SB1H 2GDDA 2XNIA 2BDHA 4BTIB 2PKSC 4U32A 1AWHB 3DFJA 3TPIZ 4A1XA 5E2PA 2ZGBH 2FOGA 2ZHFH 4ZXXH 4WVPE 1AGJA 1HLTH 3ZV9A 1MBQA 2XYAA 1IQNA 1YLDA 1LMWB 3A84A 1EKBB 1P3EA 2OBOA 3HK6B 1GL1A 1TPOA 1FXYA 1GHBG 1JWTA 4Y76A 2Z9IA 1OWIA 1VGCB 3NXPA 1O0DH 4I8GA 1UJ1A 1CHOG 5K7RA 2AEIH 1AMHA 4B2AA 2XBXA 2H6MA 1OP2A 1BTYA 3FP7E 1HAVA 1DANH 2GCHG 3O8RA 4ESTE 1KTTB 1H1BA 1GI9B 3UWIA 4BXWA 4DG4A 1O2JA 3MO3A 4TY7A 5FPSA 2PKAB 4K3JA 1BZXE 1TPAE 1EOLA 5EQQA 1GI8B 1OPHB 2ANKH 2FOAA 1OS8A 2ZECA 3CP7A 1GJBB 2B8OH 3SHAH 1JRTA 4ABAA 3H5CB 1XXDA 1UTKA 5T6DA 4OS1A 2VIWA 3R0FA 1GVLA 1UTNA 1CVWH 1CU1A 1O2XA 4IGDA 1IQMA 3LJOA 5FCRA 3MO9A 1ZGIA 3SQHE 1SLWB 3RXFA 1FMGA 1ANEA 4MLFB 3PROA 2XBVA 2Y7ZA 1RS0A 4ZHLU 1Z8RA 4H6TA 1SGIB 3QDZB 1NRPH 1QQ4A 3M61U 1BQYA 1BIOA 2GCHF 2BD8A 1G3DA 2C8WB 1C5NH 2VIOA 1MTNC 3QUMP 5GCHG 3TGKE 1MAXA 1LTOA 1G3BA 2FIRH 2OUAA 3P95A 1DWCH 5EOKA 7KMEH 1C1WH 2ZFTA 1AUJA 1DICA 4X8SH 5CHAC 1O3MA 4KKDA 1LPGB 1YLCA 4X1RU 2A4GA 1NPMA 1O5EH 1Y3VA 1PPBH 3STIA 3ZZ9A 4Q7XA 1O3CA 3SJ8A 4YESB 1O2IA 4O03A 4BTUB 4JZDH 1OKXA 2Y80A 2XCFA 2XWBI 3M5OA 3C27B 2J92A 3A89A 2Z3DA 4SGBE 5G4BA 3MNCA 1WOFA 4WF8A 3IG6B 4DY7B 3RXEA 5L6NH 1P12E 3UWJH 3QTVH 2WUBA 7GCHF 4ZHAA 3SU2A 4GAWA 2G55A 4K1SA 1GBLA 1O2UA 5LPFA 1QJ6B 4H6SB 3TK9A 4FU8A 3V7TA 2P16A 1YPMH 2W7UA 1GCDA 1SGPE 8GCHF 4AFUA 1DXPA 5FBEA 2PGBB 3SU4A 4TWWA 4IC6A 1LPKB 1SGTA 1ETRH 1GVZA 2OC1A 2O9QA 2F9NA 1DDJA 1O2KA 1Y3UA 4INHA 3SV2H 4AOQA 5C5NA 5HM9A 3UNQA 4B71A 3GICB 4XDEA 3QLPH 1GBCA 2R2MB 3MU0A 4GCHG 2BM2A 1P02A 3SI3H 1ETSH 4AX9H 2OLGA 3PM3A 1CO7E 4KP0A 1S85A 1YPJH 1DXWA 1HXEH 1O37A 2Z9LA 1C9TA 1GHXH 2G00A 1TONA 1O38A 2ZGJA 2V6NA 5E0JA 3LGTA 3A82A 1MTWA 4Y10E 3BTFE 1ZRBA 2AIQA 2RCEA 4FVDA 1P2JA 1W10U 4FUHA 2A31A 3M35A 1INCA 2BDYA 4INKA 1ZMNA 3ZVGA 4YLUA 1A0HB 1IQHA 5EGMA 1QL9A 3OTJE 3O8BA 1LPZB 4JZIA 4RKOB 1SR5C 5F03A 4B2CA 5EODA 2ASUB 2BLWA 3TK6A 3ZZ6A 1WAYB 1Y3WA 1ELCA 3U8TH 1OYTH 2VGCC 4XE4A 2ZEBA 2PKSB 1Z6EA 1P0SH 1DFPA 1HIAB 2QYIA 7ESTE 1T8LA 1B5GH 4JYUH 1S81A 4UFEH 1D9IA 1P01A 3LGVA 6CHAB 2WUCA 2QXJA 3FP8E 4WWYA 1ABJH 1UVOA 2FI5E 2HGTH 1T8MA 3RMOH 1JMOH 1VGCC 1BRCE 1Q31A 2STBE 2FPZA 1KDQB 2BLQA 1BBRH 1HJ8A 4I8HA 1XXFA 3LPRA 2V0BA 3SV8A 2ANWA 2D8WA 3M37A 4NSYA 2LNCA 1W8BH 1F92A 1O3PB 1XUKA 8KME2 4MPVA 3LKWA 2QIQA 2BD5A 2Y5HA 1DE7H 1GJ7B 3GY7A 1ORFA 1ZJDA 2ZDVH 3M36A 1GBMA 1GBBA 4OS7A 3TITA 5E2OA 1MZAA 5ESBA 1QGFA 3QGJA 1P2IA 2IJOB 1CGJE 2DE8A 4IMZA 1RIWC 3D62A 3QGNB 2G5NA 4Q80A 3DT0H 2WPLS 3M7QA 1A0JA 1GBKA 2TGTA 1M9UA 3AW0A 3BTKE 1PPEE 1BTXA 1THPB 4YOIA 1MKWK 1YC0A 3TH3H 1DWDH 2W26A 3SUGA 1C2GA 4I31A 1W3CA 4HGCA 1YKTA 1XVMA 4WXVA 3F68H 1A2CH 5EG4A 4GHTA 1T7CA 1AE5A 5FHTA 2AMDA 2PFEA 3QWCH 2A7HA 4YT7H 2FOHA 3B23B 1F5KU 3GY3A 1VCPA 2ZFRH 3LIWA 2M5TA 4E7NA 1ZSLA 1K21H 2ZHEH 1GI7B 4MQAA 1CGHA 1XUHA 1C5QA 3SNEA 1C1PA 2Z94A 3PO1B 3LGUA 1XUIA 2SFAA 2FWWA 1EAXA 2GGVB 5EXMA 4K5ZA 5H4IB 4U30A 2G4UA 3LH3A 2ZF0H 1ZMLA 4D9RA 3MO6A 4AG1A 2Z9GA 4CBNA 3NPSA 3FANA 2ODYB 3BV9B 2ZTYA 3SO3A 3VB4A 1Z1IA 2JH6D 3T27A 1L0ZA 1ELAA 4ZMAH 2QC2A 5DG6A 5EPYA 1SPJA 1NC6A 1C1MA 1BRBE 3P6ZB 5AFZH 2P59A 2GX4A 5DKMA 2JETB 3KCGH 1N1LA 2F9OA 1GBIA 1V2JT 1S6FA 1EP6A 4JK6A 1GL0E 1BB0B 1RTKA 1ZMJA 2EC9H 4YT6H 3BTQE 4JZFH 3P8FA 5FBIA 1K1MA 1SOTA 5ABWA 2PSXA 1MTVA 1QR3E 3VPKA 1FY8E 3BSQA 4X8VH 1C5ZB 3AW1A 3STJA 4I33A 1J16A 2C4FH 2FI3E 2BXTH 3ESTA 2P94A 1DM4B 2Z6BD 5GIBA 1TLDA 2VWNA 4BAHB 5FX6A 2VH6A 1TX7A 2HNTE 4CRDA 2GCTC 4FUFA 3RC5A 4D76A 2UWPA 3QN7A 2H9HA 1FY4A 4VGCB 3GDVA 3FP6E 3KHVA 1BJVA 1K1NA 3Q3YA 1LVYA 3SGBE 2A7JA 1ZTLA 8ESTE 3VGCC 1NT1A 1O2YA 3NCLA 3LC3A 4X2WA 2Q6FA 1TNGA 4ZKRU 1TIOA 4MVNA 4XBDA 3VXEH 3PYHA 1V2WT 3JZ2B 4Y8YA 1TQ0B 3SNDA 1TQ7B 2BD7A 2P8OB 2RA0A 2FM2A 3RXTA 1DWEH 4NIXA 1LHGH 4BAOB 4QT8C 4GPGA 2TRMA 3U69H 3VXFH 2HOBA 3EQ0H 1W14U 1ARCA 3Q77A 4FUEA 3RXCA 4Q7ZA 1O2TA 1C1NA 1N6YA 2BDIA 1GI2A 3SUDA 2UWLA 3M3TA 2BY8X 1Y3YA 3K9XB 3SN8A 1BMAA 1MU6B 1UK4A 2ZPRA 4B75A 4B1TA 3BEUA 4K1EA 2GZ9A 1RFNA 1AFEH 1XKBC 1S0QA 1GMHF 1O3GA 1B7XB 2QAAA 1MUEB 1C4V2 3R3GB 2F9UA 4ABGA 5LH8A 3OX7U 2ZFPH 1UVSH 1XUJA 1AY6H 3LGWA 2BVRH 4NGAH 3S69A 2BQWB 3F6UH 1D6WA 4ZHMU 2I6QA 4LZ1H 1QCPA 4MDSA 4NIYA 3GY6A 3TVJB 4J2YB 3BTTE 5EXNA 4JYVH 3A80A 4FUJA 1PPFE 1ZPCA 3U1JB 1HUTH 1WSSH 1RTFB 3KQBA 4MTBA 1UTMA 4AYVB 4Y71A 4UDWH 1BHXB 4IBLH 4LXBH 1TNIA 1YPLH 4NCYA 2ZU3A 2A4RA 2PGQB 3KQCA 1IQIA 2ZFQH 4GCHF 5ESTE 3MNXA 3PTNA 1O31A 3URDA 2ULLA 1P04A 2GT7A 1S6HA 1JRSA 5GJ4B 5AHGH 3A7VA 2AS9A 1IQGA 2TGAA 1HV7A 1GJAB 1DVAH 1ZPZA 2PUXB 3MTYA 2ANYA 1Z6JH 1Z8GA 1Y5UT 1P2MA 1FONA 1MBMA 8GCHG 3GY2A 2HPPH 2JKHA 4AFQA 4CBOA 2W3KA 1TE0A 1MD8A 1HJ9A 1P2OA 4O9VA 4FXGH 3SU5A 2C8XB 3PB1E 4X8UH 1UVPA 3VB5A 1WTGH 1O2QA 3DA9B 1SGDE 4CREA 4UEHH 5A0AE 3QTOH 2A45B 2VWOA 2XC4A 3HGPA 1AE8H 2DE9A 1E37B 1K22H 2QXGA 1X7AC 1WBGB 3LC5A 3V3MA 1P05A 1L4ZA 4NSVA 3Q76A 4ZKOU 1TBZH 1P09A 1V2NT 2VVVA 1UHBA 1AB9C 1G36A 4X0WU 1NESE 4Y6DA 1YBWA 4RN6A 1HBTH 1C5PA 1HAOH 3MOCA 1KDQA 1G2LA 2OC7A 2R0KA 3UTUH 3UFAA 2FXRA 3AAUA 3GY8A 1GVKB 4YOJA 1AVXA 3VB6A 2NU1E 2UUKB 1C4U2 1CBWC 1BTZA 4MG3A 1K1LA 2J9NA 5EQSA 1SGRE 2QY0B 2QCYA 1EJAA 1RRKA 2WPMS 1QNJA 5A8XA 1A3BH 2H2ZA 3M5LA 4X1NU 1TPPA 4NIWA 5DP3A 3EA9A 1JBUH 1C2DA 1QA0A 2XTTB 1AHTH 5FXLA 3VB7A 1C5WB 4CR9A 1EAIA 2W3IA 4XSKU 1S82A 3UOUA 1BHXF 3KL6A 5F8XA 3A86A 1GI1A 1O2WA 4IS5A 1SQTA 1HNEE 1N8OC 2HRVA 1ZLRA 5GDSH 2ALPA 1NFWA 1ZGVA 2ODPA 3K6ZA 3ZVFA 1TAWA