5LH8A

Trypsin inhibitors for the treatment of pancreatitis - cpd 8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lh8A02
4D9RA 2ZHFH 1S82A 1IQGA 2BB4A 5J4SA 2O8UA 3SGAE 1ZGVA 4AYVB 3GY8A 2H9EH 1G3EA 4AGKA 3RXBA 1C1VH 1AQ7A 1F5KU 1WU1A 5C1XA 1AGJA 2F3CE 3PYHA 5LPFA 3VGCC 4A92A 3VB6A 1S6FA 1D3TB 2ULLA 3NKKA 1C5XB 1C1QA 1O2GH 4FUHA 1ELCA 2GT8A 1C2JA 4FUJA 1DXWA 3ZZ4A 4Y6DA 5EW1H 2BQ7B 1UTOA 2FEQH 3SJ8A 1BRUP 1L1GA 1XUGA 5C1YA 2ZU5A 3GCHB 3TNSA 1KTSB 3A7XA 2OD3B 4AB9A 4Y7BA 1O2JA 4TY6A 1A1RA 3NPSA 3BG4C 1C5YB 1XXDA 2FYQA 3SNDA 3A7YA 5JBBS 4CRBA 2PV9B 2B5TB 3MO9A 4TWYA 2VINA 2ZZUH 5ESBA 4AFZA 1K2I1 2BOHB 8GCHG 3C27B 2ZGHA 1QGFA 1SSXA 2HLCA 2FI4E 1C2HA 5C1UA 4XOJA 1SGQE 1BRCE 1AKSA 3F9FA 4AG2A 5E0HA 4B2BA 3VFEA 1LHGH 3AASA 5DGJA 2Z3EA 4DGJA 2IJOB 2J95A 5CMXH 1P03A 1TRMA 5EPYA 1BBRH 1PPBH 1OYTH 5I46H 3TNTA 1BB0B 1X7AC 1IQLA 1GJDB 1AMHA 1O37A 1C4U2 3LT3A 4J2YB 3MU1A 4WXIA 3S9AA 5LPRA 1F7ZA 3A8DA 3PMAB 5L2YH 3CP7A 2QIQA 1KY9A 1ESTA 4YT7H 2Z9IA 1H1BA 2VIWA 3P92A 1GI9B 2Q6DA 2FOAA 5EGMA 1ELDE 1C5VA 3TH2H 4BAOB 2AGEX 2O8MA 3U69H 3V0XA 1AKSB 2QXIA 3A82A 1GHBF 5DP9A 5DJ7A 2FOMB 2ZFPH 3UY9A 1QBNA 3KQBA 4D7FA 1TQ7B 1ZTLA 2SGAA 1SGNE 5DG6A 3OU0A 2PTCE 5EXNA 4UFGH 1RS0A 3SJOA 1JIRA 4HGCA 4CRCA 1C1PA 1B0EA 2ILNA 4OS7A 1H8DH 1XXFA 2BYAX 1L2EA 5C3NA 3SJIA 3A89A 2BD8A 1T8MA 1LVOA 4X8SH 1QNJA 4R8TB 3M5MA 2SFAA 3CENA 5F6MA 3LGTA 3FZDA 1T31A 3SHCH 1FY1A 4JZIA 2J92A 1IQJA 2SGDE 1W13U 3M5LA 2BY7X 3OYPA 1KLTA 3G01A 1NFWA 4Y0YE 1THSH 1O2NA 4YOGA 4IBLH 1HJAB 3STJA 5EQRA 2GX4A 1XUIA 2XBYA 4D8NA 2BD3A 2JKHA 1AVWA 1TGTA 1SLVB 1BMAA 3F1SB 5FPYA 3RXOA 3BTKE 2XCFA 3FZZA 2P8OC 3O8RA 2HNTC 3T28A 5GCHG 1TNGA 2H9HA 3I77A 4B71A 1EXFA 1E35B 4YZUA 1FDPA 1VJ9U 2AS9A 3KHVA 2UUYA 1AVGH 1GHAF 2R3YA 1A2CH 4K5ZA 1DITH 1SHYA 3EA7A 3QN7A 1GHZA 2BVSH 1CBWB 1MCTA 3UOUA 3GY5A 2ZDLA 1P2NA 1SGDE 1FAKH 1TA6A 4TPIZ 2FOEA 1WAYB 2PUXB 1QR3E 2OLGA 3W95A 1EZUC 1HIAB 4D7GA 2FXRA 1DX5M 1V2TT 2Z9JA 3MNXA 2VGCC 2ZU4A 2VVVA 3LONA 1YP9A 1S85A 5A2MH 1XUJA 1OWHA 5JBTA 4BAHB 2F9OA 3SUGA 1L1NA 3KGPA 3BF6H 1WCZA 3LH3A 8LPRA 2ZWLH 3DT0H 1E34B 1V2VT 4ABBA 2XRCA 3KL6A 4K60A 1O3MA 1E38B 1G3CA 1O2IA 1SLWB 2CV3A 3QGJA 5HGGA 3ZVCA 1YPKH 1MBQA 3LH1A 4E05H 2J4IA 5A0CA 7ESTE 1GJ8B 1VITF 5C5NA 1LCYA 3FP6E 4HI3A 2FO9A 4X2XA 2B8OH 3MWIU 4AOQA 1W12U 3BTGE 1H8IH 4VGCC 1F0TA 1GHVH 2G55A 4ZH8A 1KXEA 2C8WB 1C9TA 3BTQE 4ZKNU 1F0RA 1ZSJA 4I32A 3AAVA 4ZXYH 3EDXB 2VWMA 4CRGA 1N6XA 1JBUH 2A45B 1ZSKA 1K1MA 1QL9A 1ID5H 1KYNA 4E7RG 2ZFRH 5FX5A 3BIUH 3UPEA 1S0RA 2V3OH 1MAXA 4MLFB 2FP7B 2JH5D 3P17H 1GL1A 3VGCB 3SORA 4CR9A 1LQDB 2D8WA 2A7CA 4ABIA 5E0GA 3SV6A 2FTMA 1UTJA 2GV7A 3UR6A 2C93B 3R0FA 1HFDA 1PYTC 4DW2U 1A3EH 1G3DA 6GCHG 1O3OA 4ZHAA 2PGBB 1ZHMA 1TNKA 2FM2A 1J17T 1HB0B 2Y6TA 2FLBH 4I8JA 2F9UA 1HUTH 1EZXC 5EW2H 1VCQA 4CBNA 1C1TA 1IHSH 4WH8A 3SO3A 4MPVA 4A1TA 1GBBA 2ZG0H 1RRKA 3F9GA 1LHEH 1S84A 1YPLH 5DP6A 1OYQA 1TNJA 1KIGH 4FU8A 4YM9A 3T27A 1HV7A 3ZZBA 1O32A 1CE5A 3BTHE 1GVKB 2F91A 3LIWA 1A61H 1GI1A 1FMGA 1S81A 4Y10E 1YLDA 3LC5A 3UWIA 1OP8A 3RXTA 3GY4A 2P95A 3A86A 3RDZA 2WUBA 5L6NH 3DD2H 2XC4A 4Q7YA 1TQ0B 2WUCA 3NUMA 1O2MA 5AVDA 1CHOG 3U9AH 4FXGH 1P2JA 1ZTKA 4GSOA 1CT0E 1ZYOA 3FP7E 3S69A 2G51A 2WPHS 3PTNA 3L33A 2GP9B 1TX7A 1NROH 1B0FA 2J34A 1CHGA 2OP9A 1C4V2 5GJ4B 1UVSH 1S83A 1O3NA 1AHTH 2G8TA 1GI2A 2XC0A 1VGCB 2LPRA 3RXJA 3U98H 4PROA 3BV9B 1C1NA 2IPHA 4ISOA 3LGIA 5E2PA 1SLXB 1W7GH 2VJ1A 1O5DH 4LXBH 3F9HA 3MNBA 3RXMA 2NU0E 3SW2B 2EI8A 3OTJE 2AGGX 3A85A 4X2YA 3ATIA 2BD5A 1DWCH 1TPPA 1V2ST 3TJUA 2J2UA 1T4VH 3V7TA 4FUCA 2I6QA 5ABWA 4JMYA 4GCHF 1HBTH 4MPWA 1K1PA 1P2QA 4Q7XA 3SOSA 2PHBA 1TNHA 2PSYA 1YPMH 3NCLA 1EJAA 1Q3XA 1FONA 1MTVA 2GT7A 1AO5A 1C5ZB 4ZUHA 4AORA 4FVDA 3S9BA 4INKA 2W7SA 1VCWA 3PTBA 1GBFA 5T6DA 1MQ5A 1QL8A 1FPCH 4MNXA 2WV4A 1OP2A 4IC6A 1O30A 1O5GH 1W7XH 1O2TA 1IAUA 3SJKA 2H1UA 2ANKH 1O3CA 1LO6A 3HATH 4Z0KA 5IYTA 4JK6A 5EG4A 1TNIA 3T26A 1EB2A 2C8XB 2QC2A 4X1PU 1LVYA 1C5MD 1K28D 3Q3KA 4K2YA 1V2JT 2D2DA 3HPTB 5EODA 2QF0A 2RCEA 1V2UT 1Z1JA 1A0LA 1A0HB 1Y3YA 4AG1A 5DP8A 1G30B 1O2SA 3HK6B 3HKJB 1GJ4H 2PKSB 4OS4A 3UUZA 1GCDA 1GMDG 1VCPA 1T8LA 2FOHA 7KMEH 1ORFA 2ZI2H 1PPFE 1NRSH 3SV7A 3H7TA 1UVPA 2ZGCA 2VGCB 2V35A 1ZJDA 2PGQB 2Y80A 4FUFA 1UVTH 1GHXH 1BHXB 1Q31A 1QRXA 1S6HA 4HZHA 1UCYE 3PWCA 3UQOA 2YNBA 1C2EA 1GJ7B 3A7WA 2BD7A 4A5TS 3TU7H 3ZZ3A 2ZTZA 4ABAA 1W10U 3ELAH 1MCVA 1ELGA 1GBAA 1K9OE 4ZKOU 2ZPRA 1SGRE 1XX9A 2SGPE 1F92A 3U8TH 3ZVGA 1NTPA 1O2XA 1C5TA 4A1XA 1Z6EA 2XWBI 1C5SA 3TJVA 3A8BA 1FZZA 2VNTA 1QB9A 2ZU2A 1MTUA 1QB1A 1TGSZ 3E6PH 5E8EH 3SUDA 2STBE 3RXGA 1IHTH 1HYLA 1O0DH 2BLWA 4K1EA 2XTTB 4I33A 1SGFG 3M61U 3PLKA 1FY3A 1C5OH 5A0BA 2QXHA 2EA3A 4DY7B 2ANYA 5TCCA 1P12E 3M3SA 1TWXB 4MQAA 4JZDH 4HFPB 4DVAU 1LPGB 2WYGA 1SMFE 3DA9B 2TPIZ 3D23A 2XNIA 1XMNB 4LZ4B 1ANBA 1NY22 5JYIA 3QO6A 2C3SA 1RFNA 3T25A 1ABIH 5GIBA 1INCA 2CHAC 3LGYA 1FV9A 1CT4E 1XKBC 1ZOMA 2K1QA 1J9CH 1GG6B 1QY6A 1MQ6A 2WPKS 3MU4A 1K1NA 3PMHB 3SNBA 5DP3A 3A7ZA 2FZZA 3QWCH 1GJBB 2ODYB 4I8HA 2FTLE 2BXUH 1ZPBA 5FXLA 3ZVDA 1C1UH 1WV7H 1C2LA 1YPJH 1D4PB 2F83A 4NWKA 3S7HB 1AB9B 2BVRH 5FCKA 5FBEA 4MNVA 5EOKA 1GMHG 3A83A 3MH7A 1Q2WA 2BX3A 1DS2E 3AVZA 2ZDVH 2QF3A 3ATMA 5LPEA 3UWJH 1GMCG 2ASUB 3IG6B 3QDZB 1NRPH 2G4TA 1ZJKA 2W5EA 3GY3A 3ZVBA 1QQUA 2O8TA 4MPUA 1Z1IA 3ATKA 2P94A 2PW8H 4XDEA 3P8FA 4ABEA 1O2HA 4H6TA 3TGJE 5FAHA 5BRRE 2GCHF 1A4WH 3D62A 1O5EH 2ZEBA 4H4FA 1PQ7A 1YC0A 3KQEA 2BDHA 3UFAA 1SPJA 5JDUB 4ZROA 2BLVA 1LPZB 1FAXA 3MNSA 1YF4A 2VB0A 3P95A 1AE5A 3UNSA 3K6YA 5C20A 1MBMA 7GCHF 2ZGJA 2NU3E 1DSTA 5ESTE 1HXEH 1L4DA 3K6ZA 4UEHH 3RLWH 1K22H 2QGRA 4CH2B 3SGQE 1FIZA 4B74A 1V2WT 1P57B 1UTLM 1SFQB 2FMJA 2Y5HA 3CS0A 4B75A 1Y3UA 1ZGIA 5C67A 1GVLA 1GBDA 7LPRA 5DO4H 4X6NA 2ZF0H 1HAOH 3GCNA 3FVFB 3V12A 1W0ZU 1EASA 2Q6FA 4KELA 1H4WA 1FIWA 1JRTA 4IC5A 1C2DA 3E91A 4RKOB 3JZ2B 2QAAA 3LOXA 3A87A 3U1IB 5FHTA 1O3IA 4I31A 3KIDU 4UDWH 3QZRA 1O3DA 3F9EA 3BTTE 2BXTH 2Y5FA 3P70B 4JK5A 2AEIH 1O35A 2GGVB 2C90B 2R0LA 3MH6A 1P02A 1O2ZA 1V2PT 1BTYA 2GZ8A 2Y82A 1LHCH 1OPHB 1JRSA 1KXAA 2A4RA 3ZZCA 2JETC 3PROA 5K0HA 1OWEA 1O36A 3RC5A 1WQSA 2UUFB 3FANA 4J1YA 6ESTA 2C8ZB 1C5LH 1GJ9B 3KNXA 3SU4A 1BTXA 1C5WB 4NIYA 3SU0A 4AX9H 2Z6BD 3IITA 4KTCA 2NWNA 1EAIA 2IOTA 2JH0D 4CREA 2Z9GA 1EAWA 1ETTH 1TNLA 4BTIB 2ZKSA 2THFB 2VIOA 1T8OA 2G81E 2GDDA 4NSYA 4NIXA 2VH0A 2XXLA 5PTPA 1HAYB 1DFPA 4IS5A 1ZRBA 1DWBH 3PWBA 4ABGA 3UNRA 1H9IE 4OGXA 4UFDH 1GHBG 3A7VA 1O2WA 2KAIA 3BEIB 4ISHH 1SGTA 2ZECA 1HXFH 1NU7B 2BDAA 3OY5U 2XWAA 5I25A 4MPXA 5GWZA 1GCTB 3NK8A 1NFUA 3MI4A 1KSNA 4X1SU 1YLCA 1DPOA 1NU9A 3FFGA 4B2AA 4OS1A 1FPHH 3P8NA 2ZHQH 1PQ8A 1UTNA 3BTME 1O2QA 1XUFA 2A4OA 4TPYA 1IQNA 1GHYH 1UK3A 3U8RH 2VIQA 3PO1C 1DY9A 1ANCA 2D1JA 4X2WA 1ZHRA 1YM0A 2A7HA 3LC3A 1N6YA 1TFXA 4KKDA 4DOQA 1JXPA 1P2KA 1SB1H 4YLUA 3RXSA 4AYYB 2NU2E 2KAIB 1GBMA 3MMGA 1D9IA 3R3GB 4D76A 4NA8A 2WV5A 1O3JA 1O39A 1OS8A 1QA7A 4WY3A 1AFQC 3RXCA 4MNWA 1N8OC 1UVUH 2PR3A 3SU1A 1D3PB 4X1NU 1HRTH 1MKXK 1QB6A 1OWJA 1GHAG 2CHAB 1SGIB 1PYTD 3RXLA 4Z6AH 1AUTC 1AFEH 2XBVA 1RJXB 1SVPA 4CH8B 1WYKA 1AD8H 2PSXA 1MTNB 3D65E 3RM2H 1CA0C 5K7RA 1EUFA 1P8VC 2H6MA 3TPIZ 5IDKA 3M3VA 2ZA5A 2VIVA 3ZZ9A 1AI8H 1J14A 3SV2H 2A2QH 4ZAEA 1KLIH 1TPAE 3AW0A 4RSPA 1NO9H 1OP0A 1V2LT 2FLRH 4LK4A 3SNCA 5L2ZH 2QV1A 5A0AE 1ZSLA 1ELAA 5CHAC 4Y76A 1XM1A 3Q76A 1SQOA 1ZMLA 3DFLA 1O2OA 4CBOA 3KEEA 3TIUA 1RIWC 2FOCA 1CA8B 2HPPH 5F8XA 4NIVA 2F9NA 3RXVA 1YYY1 3SI4H 2ZGXH 3PV4A 1QRWA 1UTQA 2BX4A 2VWNA 1VITG 6CHAC 2FPZA 2OC0A 5TCAA 3EE0B 3VPKA 3BEFB 1B7XB 2SNVA 3EGKH 2OXSA 1MMJN 2BDIA 2G5NA 4BAQB 1FY5A 1J8AA 4UFFH 1O3BA 2PKAA 4QT8C 2R2MB 1GDNA 2Z3DA 3LU9B 1DM4B 1DUEA 1QQ4A 1O33A 2XW9A 2AGIX 1DT2A 4D9QA 2ZHEH 4AFQA 1BMLA 3EA9A 4XBDA 1GBLA 1OSSA 2GCTC 1RGQA 2BMGB 2HGTH 3GY7A 1BHXF 2UUJB 1DANH 1XKAC 3URDA 3BTDE 3MOCA 1THPB 3T2NA 2ZTYA 1LHFH 2P93A 1C1RA 3LDXH 2FX6A 3RU4D 3ZV9A 2WYJA 3BG4B 1AN1E 1QBVH 3ZYEA 2PKAB 1YCPK 4K69A 1ELBA 1WTGH 4YLQH 2FOGA 2G00A 3E0NB 2GTBA 1QURH 4UE7H 3TK6A 4X0WU 3UR9A 1O31A 3FP8E 1SGPE 1EPTC 1K1LA 5AHGH 2A5KA 2VWLA 3SQEE 1V2KT 1M9UA 3ZZ5A 1O3HA 3PB1E 1CT2E 2J38A 1W14U 1WUNH 3H7OA 1SGYE 1WBGB 4YESB 4YOJA 3KCGH 1TPSA 2VIDA 1D6RA 4CRAA 2ZQ1A 4ASHA 4JCNA 1QBOA 4IGDA 1AE8H 1K1JA 1HCGA 5DP5A 1OKXA 2AMQA 1C2MA 2EC9H 1GDUA 1P01A 4GHQA 1V2NT 5JB9S 2BY5X 1C1WH 2UWLA 3RMOH 3BTEE 3L6PA 1EP6A 3UQVA 3O8DA 3UREA 3Q3YA 1HJ8A 1BTZA 1CGIE 1FLEE 1PPGE 3LPRA 1SGEE 2PFEA 2HNTE 4K3JA 2VVCA 3LJJA 5DP4A 1C5RA 1CO7E 4GPGA 3GYMA 3IWMA 4ZKRU 2ZPSA 1TA2A 3GYLB 1TX8A 4BXSA 1GBEA 3O8CA 3PLBA 3RU4T 1LPKB 1ZPCA 1HAIH 1EQ9A 5L30H 3RUOA 1MZAA 2TGAA 1EZQA 3ZZAA 2W7UA 1P9SA 2IN2A 2WPMS 3SV9A 3UTUH 3MU5A 1C4Y2 4X2VA 2ZTXA 1HPGA 3RP2A 3B9FH 3MU8A 1WOFA 1TALA 1A46H 1TBRH 5E2OA 3OY6U 5A8YA 1P11E 1QRZA 1Y5UT 3GOVB 1KDQA 4GCHG 1UK4A 1TMUH 2CMYA 2XBXA 1V2QT 1V2MT 1N1LA 1ARBA 2P8OB 3GCHC 1LKBA 1K1IA 2ZC9H 4GAWA 3SUEA 1MKXH 5B6OA 1SQTA 4WMFA 1HLTH 1Z8JB 5EQSA 3SU5A 4ISLA 4O03A 4K8BA 2GDEH 5FPSA 1UCYK 1O3KA 1PPZA 4IMQA 2G4UA 3P6ZB 3D49H 1Y3XA 2WPJS 3M36A 1N8OB 1BMMH 1Y59T 4O3TA 1TAWA 1O2UA 2A32A 3MFJA 1KDQB 1Z8GA 2LNCA 2SNWA 8KME2 3GCTF 1EOLA 1SR5C 5CE1A 1BTHH 1YBWA 1HAZB 5TJXA 1J15A 3SU6A 1O2VA 4INHA 4I8LA 1T7CA 5SGAE 2H5DA 4K1TA 3ZZ7A 4I8KA 2ZP0H 1CSOE 3A88A 1DUAA 2Y81A 3EYDA 3Q00A 1A5GH 3TITA 2BQ6B 4Y8ZA 4A1VA 3BTWE 3QGNB 4X8UH 4SGBE 1WQVH 2M5TA 2I6SA 5A09A 2A2XH 1DSUA 2ODQA 1DE7H 4GLYA 1HAHH 1J16A 1V3XA 5HM9A 3SN8A 2H5CA 1PJPA 1W11U 4NZLA 1RTKA 3C1KA 3F6UH 3A8AA 1NRQH 2SGFE 4IMZA 4AN7A 1AVXA 5T3HA 3RXQA 4Q7ZA 1NFYA 4VGCB 1TMTH 4DG4A 1GI0A 1GWAA 3VB5A 1TBQH 2GMTC 1GBKA 1O3LA 1C1MA 2DE8A 3E1XB 1MTWA 1D3QB 1ZR0A 1DWEH 1BBRE 3PMJA 4NA9H 1EATA 1IQIA 1O5AB 2GVFA 1BIOA 1YKTA 3HGNA 2PWXA 1HJAC 1EJMA 1EPTA 4ZHLU 1OWDA 2FI3E 1A3BH 4GVUA 2VH6A 2GCTB 1G2LA 1LKAA 1YCPH 2H9TH 2HALA 4RKJB 4XFQA 3GY2A 1SC8U 1W8BH 1Y5AT 4NWLA 1HAPH 3T29A 2CF8H 2TRMA 4OS5A 1AWHB 1ELFA 3RXUA 1S0QA 2H2ZA 1EP5A 4NGAH 2FWWA 1TIOA 3A80A 3LGVA 3RLYH 4AZ2B 4R0IA 1UHBA 1P2MA 1GBJA 2OQ5A 1HJ9A 1KLJH 2ZFTA 1C5QA 1VITH 4NA7A 5AFZH 4IN2A 4FUBA 1A5IA 1L1JA 3M7TA 3E16B 3ITIA 1GBTA 5DKMA 1T32A 1CBWC 5AFYH 1G2MA 1ARCA 1TOMH 1AU8A 1EPTB 5E0JA 1BTUA 3QUMP 2WPLS 2FX4A 1P9UA 1IQEA 1EX3A 4BANB 3M5OA 2Y5GA 1TLDA 1YPHE 1K1OA 2F9PA 4Q2KA 4Q80A 1C1SA 4SGAE 4ZKSU 4BOHA 1F5LA 1YPGH 4U30A 1GBHA 2FESH 4FU9A 1S5SA 1UHBB 1TE0A 1YCPM 3RM0H 2AMPA 2HPQH 2Z7FE 1LVBA 2BY9X 1C2FA 4FUIA 4WMEA 1HNEE 1W2KH 1ZTJA 1P2IA 3RC4A 1W3CA 2GCHG 4FU7A 1ELEE 1TGBA 2TGTA 1V2RT 2BZ6H 2QN5T 4NCYA 1GVZA 3GDSA 1SGCA 3GDUA 1IQMA 1GL0E 2P3UB 1KTTB 3UNQA 1BJVA 1UO6A 1O2KA 3N7OA 3RMMH 4MG3A 3L3TA 3TGIE 2BDYA 3U1JB 1IOEA 1MU6B 2RA0A 7GCHG 3MTYA 3HGPA 3ENSB 3RXHA 4LZ1H 3SZNA 3RXIA 1E37B 2V0BA 1O34A 1SOTA 2OC1A 1T4UH 4MVNA 2JH6D 1P06A 2XC5A 2TGDA 5EU8A 4MDSA 4WVPE 1NFXA 1ZMJA 4YTAA 2O8WA 1FY8E 3RXFA 3SNAA 1GJ6A 3BG8A 1AWFH 4DT7B 4DIIH 2PLXA 1ANDA 2ZHDA 1SBWA 1YGCH 1UCYH 3A7TA 1SGFA 1MZDA 2Y7ZA 4NFEA 1IQKA 1C5UA 9ESTA 4Y0ZE 4ABFA 3M3TA 2FI5E 8GCHF 3BEUA 3ODDA 1XUHA 2RG3A 2ZDMA 3SI3H 2A31A 1BA8B 2CGAA 3GDVA 4INLA 3TLOA 4WJG2 4X6OA 2BZAA 2FOFA 3B8JA 3M7QA 5FCRA 1DY8A 2QY0B 1AZ8A 1SFIA 3QTOH 2GD4B 4Y79A 1XVMA 3VEQB 1DLEA 3EQ0H 1JMOH 1AUJA 1O5BB 3K9XB 2GKVE 1SOZA 1PPHE 2BD9A 2QXJA 4ZXXH 1C2KA 1NRNH 2A5AA 2BOKA 4CHAC 2XBWA 3CS7A 1A7SA 2CF9H 1SLUB 2RDLA 3O8BA 4Y8XA 2ZCHP 3S7KB 2Z9LA 2BY6X 1GBCA 1O2PA 1TRNA 4I8GA 1MKWK 4Y11E 4WH6A 1P0SH 1PQAA 2BDGA 2OUAA 2SGEE 1XVOA 4CRDA 1LHDH 1MD8A 3TVJB 3LJOA 1TBZH 2G52A 2P16A 2ZIQH 3TK9A 3TJOA 5DP7A 1JWTA 1DVAH 1RTFB 1JIMA 3AAUA 4JZFH 4WXVA 3BN9A 1PQ5A 2FOBA 1C5PA 2BTCE 1MD7A 2V3HH 1PFXC 1VGCC 1SI5H 3PM3A 5JPMH 4Y71A 1G37A 2UWPA 4AGJA 5FX6A 3PLPA 2AIQA 2ANWA 2GMTB 2HVXA 1V6DA 1EB1H 1TGNA 1GI8B 3MO3A 2P3FH 3SV8A 1P3EA 1HGTH 1DDJA 4X8VH 4JYVH 3VXFH 1BRAA 2ZFFH 5F8ZA 2OTVA 1ZLRA 4ABDA 1A0JA 2B0FA 2J9NA 3I78A 3SJ9A 4U01A 1CQQA 1Z71A 1TPOA 5GCHF 2WPIS 1JOUB 3UOPA 4DURA 1TABE 1KXDA 3WY8A 1HIAA 1LDTT 4I7YH 3E0PB 3BTFE 5F03A 1FXYA 1KXFA 3VB7A 1GHWH 1QCPA 2B7DH 1BITA 1F0SA 3AW1A 1DLKB 1MU8B 3VB4A 3F68H 1TRYA 3ZVEA 1UTMA 2ZFQH 3ATWA 2ALPA 1Y5BT 1DICA 3K65B 3SU3A 1T8NA 2RA3A 2BD4A 2FODA 1MTSA 3LKWA 1H9HE 1QJ1B 4GUXA 4HTCH 1BJUA 2F9VA 1ETSH 2R9PA 3M7UA 2GZ9A 4DCDA 2PKSC 1LTOA 2BM2A 6LPRA 1GI7B 4XE4A 3RXPA 1GJCB 4KGAA 5HYOA 2G5VA 2YOLA 5DK1A 1VJAU 1GJ5H 1UK2A 2QCYA 3RXEA 2HNTF 3B23B 2QXGA 2O8LA 2Q1JA 3KN2A 4YOIA 1WSSH 5GDSH 1MAYA 1GI6A 4FUEA 3TH4H 4K1SA 1FN6A 4ZHMU 5T6FA 2NU1E 4IN1A 4A6LA 2ZPQA 2SGQE 3KQDA 1A5HA 5AF9H 3ZZDA 2VWOA 4X6MA 1OWIA 1UMAH 1G32B 3DUXH 1BDAA 3BSQA 1SG8B 2DUCA 1GPZA 1FI8A 5EXLA 3ZV8A 1FJSA 5JBCS 1C1OA 2HOBA 1RXPA 1ELVA 2P59A 5T6GA 3MU0A 4E7NA 2OQUA 1AIXH 5BPEA 3SUFA 1NRRH 3STIA 1C2GA 1NS3A 4XBBA 1NESE 3A81A 3MO6A 1BRBE 8ESTE 4ABHA 3SQHE 4B73A 4X8TH 4NSVA 1HAGE 4NG9H 2GV6A 1F0UA 2ZDKA 3RMLH 3ODFA 1LMWB 5C5OA 1BOQA 1OX1A 1D3DB 3QZQA 3SHAH 1CU1A 2ZCLP 4F4OC 4LOYH 6GCHF 2XYAA 2QA9E 3M37A 2AERH 5EQQA 2W3IA 1TX6A 2ZFSA 3ZZ8A 4AFSA 1W0YH 3QTVH 1ESBA 4B76A 2OC8A 1HAVA 1H9LB 4O3UA 4MNYA 1YPEH 3A84A 1GG6C 2VU8E 3VXEH 1GGDC 1QFKH 1ABJH 2ZNKH 1B5GH 1D6WA 2VVUA 4H42U 1L4ZA 1O3FA 1GI3A 2JETB 4CR5A 4ZMAH 2P3TB 1P05A 1RTLA 2XCNA 1AB9C 2C4FH 3SGBE 3VB3A 2EEKA 3NXPA 1UTPA 2ZGBH 2BY8X 1P3CA 3S0NA 2Q6GA 1P09A 1ZRKA 5JB8S 3RXRA 4E06H 1FNIA 1O2RA 1V2OT 1MKWH 3UIRA 3DFJA 2TGPZ 1CHOF 2UWOA 3QX5H 1RD3B 4CHAB 1O2YA 3NWUA 1HAVB 4Y7AA 1O2LA 3Q77A 2AFQB 3H5CB 1MUEB 3ATLA 5HM2A 4B1TA 2TBSA 2BQWB 3JZ1B 1FN8A 2QYIA 2ODPA 1C5NH 3FAOA 1O3GA 1TYNA 4JZEH 1THRH 1AY6H 1Z8IB 4FUDA 3E3TA 3TK5A 4O97A 2W26A 2A1DB 1DOJA 1NZQH 3ZZ6A 1LQEA 2A7JA 3OX7U 4BNRA 1QL7A 1SL3A 4GHTA 3ZYDA 4JZ1A 4WWYA 4U2WA 4JYTA 1G9IE 1HAXB 3ESTA 4KP0A 2A0QB 4ESTE 4OS6A 3MH5A 3TGKE 1EZSC 1KXBA 4YO9A 2AMDA 3V13A 4NZQA 5H4IB 2V6NA 3E90B 3EA8A 1PPEE 2A4GA 1CVWH 1ZMNA 3PO1B 1UVOA 1MH0A 2J94A 5LH8A 1E36B 1YPHC 3EAJA 1DXPA 4X1RU 5EPNA 3ZVAA 3T5FH 3Q3XA 1BCUH 1GBIA 1O38A 5J4QA 2ANMH 5GPIB 3P8OA 2OCVB 1P04A 1BT7A 4XSKU 3DHKH 2FS8A 1AFQB 1O3AA 1UJ1A 2OC7A 1NM6A 3PMBB 2DE9A 1Y3VA 1O3EA 2BDCA 3TJNA 3RXAA 3LGWA 3TH3H 2R3UA 4ISIH 5A8XA 2UUKB 3QK1A 5JBAS 1KXCA 1GI5A 3HKIB 3SNEA 3A8CA 1DWDH 1ESAA 1NC6A 1OOKB 1BQYA 2ZQ2A 5F8TA 2CN0H 4TYDA 2NU4E 2AIPA 3GCTG 4THNH 2ZHWH 1NN6A 2AH4X 4KTUA 1GMDF 2W3KA 3GICB 1CA0B 4NIWA 4IW4E 4TWWA 1ZHPA 3KQCA 3MNCA 2ZO3H 1BTPA 1BTWA 1QJ6B 1BUIA 3M5NA 5A8ZA 1FQ3A 1BBRK 1L0ZA 2BHGA 4TY7A 1CGHA 1EOJA 4F49A 4MTBA 4X1QU 1PPCE 2HWLB 4KTSA 5CHAB 1U6QA 2CJIA 2GZ7A 1AZZA 2BLQA 2PTNA 3E8LA 1QJ7B 1RIWB 1ZPZA 4B2CA 4OS2A 3BIVH 3S9CA 2R2WU 3W94A 4UONA 5C2ZA 3GISB 3SU2A 4H6SB 1TGCA 4NFFA 3URCA 1OWKA 1Z8RA 1FUJA 3OSYA 2ZU3A 3MH4A 6CHAB 1BZXE 2Z9KA 2YNAA 2OINA 2OBQA 1NPMA 1SQAA 3I29A 2OBOA 4U32A 4AFUA 1GI4A 2A5IA 1LVMA 3ZVFA 1QIXB 1GCTC 2ZDNA 1OXGA 4UD9H 1O3PB 1TONA 1CGJE 1C9PA 1Z7KA 3RXDA 1QHRB 3K2UA 3T62A 1IQHA 4CRFA 1EAUA 1EKBB 1F5RA 1Y8TA 2FS9A 4FVBA 1TB6H 2C8YB 5FPTA 3MYWA 1HDTH 2FIRH 3M35A 1C2IA 2BDBA 3U8OH 2ZCKP 5FBIA 2FYRA 1K21H 1P2OA 1G3BA 4YT6H 1VR1H 4M7GA 3RC6A 4ABJA 2A4QA 5HMAA 5ETXA 3V3MA 3NZIA 2WINI 2EI7A 1P10A 2ZDAH 3QLPH 2STAE 2B9LA 4BXWA 4BAMB 1GJAB 4WF8A 1Z6JH 1IQFA 2Z3CA 1GDQA 2ALVA 1VZQH 4O9VA 4RN6A 4A7IB 1E0FD 1BMNH 5EXMA 4BTUB 2BLOA 1NT1A 2CXVA 1ANEA 1ELTA 1GGDB 2BD2A 5DPAA 1GMHF 1XUKA 2TIOA 1ZZZA 3RU4E 2O9QA 4FUGA 2VIPA 1FY4A 1ETRH 3KF2A 1GMCF 2Z94A 1MTNC 4ISNA 4BAKB 4OGYA 4JYUH 4Y8YA 2D26C 3HK3B 9LPRA 2R0KA 1O5FH 5G4BA 4X6PA 2ZU1A 1O5CB 3RMNH 2HRVA 4BTTB 1ACBE 2Y7XA 1TOCB 1EAXA 4DJZB 5GXPA 1SHHB 4K8YA 3MHWU 1UTKA 4AB8A 2PUQH 2F9BH 3GCOA 3GY6A 4UFEH 2ESTE 5LGOA 3P8GA 3LGUA 2FDAA 2BVXH 4XBCA 4DIHH 5HXFA 3SBKA 1QTFA 2AYWA 2EI6A 1EJNA 3RXKA 1QA0A 1TMBH 1G36A 1Y3WA 1F2SE 1WTHD 4WMDA
chains in the Genus database with same CATH superfamily
4D9RA 2ZHFH 3OTPA 1S82A 2EQNA 1IQGA 2BB4A 5J4SA 2JIZD 2O8UA 3SGAE 1ZGVA 4AYVB 3GY8A 2H9EH 1G3EA 1OHHD 4AGKA 3RXBA 1C1VH 1AQ7A 1F5KU 1WU1A 5F53A 3MQKC 5C1XA 1AGJA 2F3CE 3PYHA 5LPFA 3VGCC 2KZ4A 4A92A 3VB6A 1S6FA 1D3TB 2ULLA 3NKKA 1C5XB 1C1QA 1O2GH 4RT0A 4FUHA 1ELCA 2GT8A 1C2JA 4FUJA 1DXWA 3ZZ4A 4Y6DA 5EW1H 2BQ7B 1UTOA 2FEQH 3SJ8A 1BRUP 1L1GA 1XUGA 5GNDA 5C1YA 2ZU5A 3GCHB 3TNSA 1KTSB 3A7XA 2OD3B 4AB9A 4Y7BA 1O2JA 4TY6A 1A1RA 3NPSA 3BG4C 1C5YB 1XXDA 2FYQA 5HIYA 4TT3D 3SNDA 3A7YA 5JBBS 4CRBA 2PV9B 2B5TB 3MO9A 4TWYA 2VINA 2ZZUH 5ESBA 4AFZA 1K2I1 2BOHB 8GCHG 3C27B 2ZGHA 1QGFA 1SSXA 2HLCA 2FI4E 1C2HA 5C1UA 4XOJA 1SGQE 1BRCE 1AKSA 3F9FA 4AG2A 5E0HA 4B2BA 3VFEA 1LHGH 3AASA 5DGJA 2Z3EA 4DGJA 2IJOB 2J95A 5CMXH 1P03A 1TRMA 5EPYA 1BBRH 1PPBH 1OYTH 5I46H 3TNTA 1BB0B 1X7AC 1IQLA 1GJDB 1AMHA 1O37A 1C4U2 3LT3A 4J2YB 3MU1A 4WXIA 1H8ED 3S9AA 5LPRA 1F7ZA 3A8DA 3PMAB 5L2YH 3CP7A 2QIQA 1KY9A 1ESTA 4YT7H 2Z9IA 1H1BA 2VIWA 3P92A 1GI9B 2Q6DA 2FOAA 5EGMA 1ELDE 1C5VA 3TH2H 4BAOB 2AGEX 2O8MA 3U69H 3V0XA 1AKSB 2QXIA 3A82A 1GHBF 5DP9A 5DJ7A 2FOMB 2ZFPH 3UY9A 1QBNA 3KQBA 4D7FA 1TQ7B 1ZTLA 2SGAA 1SGNE 5DG6A 3OU0A 2PTCE 5EXNA 4UFGH 1RS0A 3SJOA 1JIRA 4HGCA 4CRCA 1C1PA 1B0EA 2ILNA 4OS7A 1H8DH 1XXFA 2BYAX 1L2EA 5C3NA 3SJIA 3A89A 2BD8A 1T8MA 1LVOA 4X8SH 1QNJA 4R8TB 3M5MA 2SFAA 3CENA 5F6MA 3LGTA 3FZDA 1T31A 3SHCH 1FY1A 4JZIA 2J92A 1IQJA 2SGDE 1W13U 3M5LA 2BY7X 3OYPA 1KLTA 3G01A 1NFWA 4Y0YE 1THSH 1O2NA 4YOGA 4Q4LA 4IBLH 1HJAB 3STJA 5EQRA 2GX4A 4F48B 1XUIA 2XBYA 4D8NA 2BD3A 2JKHA 1AVWA 1TGTA 1SLVB 1BMAA 3F1SB 5FPYA 3RXOA 3BTKE 2XCFA 3FZZA 2P8OC 3O8RA 2HNTC 3T28A 5GCHG 1TNGA 2H9HA 3I77A 4B71A 1EXFA 1E35B 4YZUA 1FDPA 1VJ9U 2AS9A 3KHVA 2UUYA 1AVGH 1GHAF 2R3YA 1A2CH 4K5ZA 1DITH 1SHYA 3EA7A 3QN7A 1GHZA 2BVSH 3AK5A 1CBWB 1MCTA 3UOUA 3GY5A 2ZDLA 1P2NA 1SGDE 1FAKH 1TA6A 4TPIZ 2FOEA 1WAYB 2PUXB 1QR3E 2OLGA 3W95A 1EZUC 2YMSB 1HIAB 3FO8D 4D7GA 2FXRA 1DX5M 1V2TT 2Z9JA 3MNXA 2VGCC 2ZU4A 2VVVA 3LONA 1YP9A 1S85A 5A2MH 1XUJA 1OWHA 5JBTA 4BAHB 2F9OA 3SUGA 1L1NA 3KGPA 1UW7A 3BF6H 2JDID 1WCZA 3LH3A 8LPRA 2ZWLH 3DT0H 1E34B 1V2VT 4ABBA 2XRCA 3KL6A 4K60A 1O3MA 1E38B 1G3CA 1O2IA 1SLWB 2CV3A 3QGJA 5HGGA 3ZVCA 1YPKH 1MBQA 3LH1A 4E05H 2J4IA 5A0CA 7ESTE 1GJ8B 1VITF 5C5NA 1LCYA 3FP6E 4HI3A 2FO9A 4X2XA 2B8OH 3MWIU 4AOQA 1W12U 3BTGE 1H8IH 4VGCC 1F0TA 1GHVH 2G55A 4ZH8A 1KXEA 2C8WB 1C9TA 3BTQE 4ZKNU 1F0RA 1ZSJA 4I32A 3AAVA 4ZXYH 3EDXB 2VWMA 4CRGA 1N6XA 1JBUH 2M2AA 2A45B 1ZSKA 1K1MA 1QL9A 1ID5H 1KYNA 4E7RG 2ZFRH 5FX5A 3BIUH 3UPEA 1S0RA 2V3OH 1MAXA 4MLFB 2FP7B 2JH5D 3P17H 1GL1A 3VGCB 3SORA 4CR9A 5IK2D 1LQDB 2D8WA 2A7CA 4ABIA 5E0GA 3SV6A 2FTMA 1UTJA 2GV7A 3UR6A 2C93B 3R0FA 1HFDA 1PYTC 4DW2U 1A3EH 1G3DA 6GCHG 1O3OA 4ZHAA 2PGBB 1ZHMA 1TNKA 2FM2A 1J17T 1HB0B 2Y6TA 2FLBH 4I8JA 2F9UA 1HUTH 1EZXC 5EW2H 1VCQA 4CBNA 1C1TA 1IHSH 4WH8A 3SO3A 4MPVA 4A1TA 1GBBA 2ZG0H 1RRKA 3F9GA 1LHEH 1S84A 1YPLH 5DP6A 1OYQA 1TNJA 1KIGH 4FU8A 4YM9A 3T27A 1HV7A 3ZZBA 1O32A 1CE5A 3BTHE 1GVKB 2F91A 3LIWA 1A61H 1GI1A 1FMGA 1S81A 4Y10E 1YLDA 3LC5A 3UWIA 4HG6A 1OP8A 3RXTA 3GY4A 2P95A 3A86A 3RDZA 2XNDD 2WUBA 5L6NH 3DD2H 2XC4A 4Q7YA 1TQ0B 2WUCA 3NUMA 3OAAD 1O2MA 5AVDA 1CHOG 3U9AH 4FXGH 1P2JA 1ZTKA 4GSOA 1CT0E 1ZYOA 3FP7E 4XRNA 3S69A 2G51A 2WPHS 3PTNA 3L33A 2GP9B 1TX7A 1NROH 1B0FA 2J34A 5EJ1A 1CHGA 2OP9A 1C4V2 5GJ4B 1UVSH 1S83A 1O3NA 1AHTH 2G8TA 1GI2A 2XC0A 1VGCB 2LPRA 3RXJA 3U98H 4PROA 3BV9B 1C1NA 2IPHA 4ISOA 3LGIA 5E2PA 1SLXB 1W7GH 2VJ1A 1O5DH 4LXBH 3F9HA 3MNBA 3RXMA 2NU0E 3SW2B 2EI8A 3OTJE 2AGGX 3A85A 4X2YA 3ATIA 2BD5A 1DWCH 1TPPA 1V2ST 3TJUA 2J2UA 1T4VH 3V7TA 4FUCA 2I6QA 5ABWA 4JMYA 4GCHF 1HBTH 4MPWA 1K1PA 1P2QA 4Q7XA 3SOSA 2PHBA 1TNHA 2PSYA 1YPMH 3NCLA 1EJAA 1Q3XA 1FONA 1MTVA 2GT7A 1AO5A 1C5ZB 4ZUHA 4AORA 4FVDA 3S9BA 1YWUA 4INKA 2W7SA 1VCWA 3PTBA 1GBFA 5T6DA 1MQ5A 1QL8A 1FPCH 4MNXA 2WV4A 2KFWA 2V7QD 1OP2A 4IC6A 1O30A 4B6EA 1O5GH 1NBMD 1W7XH 1O2TA 1IAUA 3SJKA 2H1UA 2EY4C 2ANKH 1O3CA 1LO6A 3HATH 4Z0KA 5IYTA 4JK6A 5EG4A 1TNIA 3T26A 1EB2A 2C8XB 2QC2A 4X1PU 1LVYA 1C5MD 1KMHB 1K28D 3Q3KA 4K2YA 1V2JT 2D2DA 3HPTB 5EODA 2QF0A 2RCEA 1V2UT 1Z1JA 1A0LA 1A0HB 1Y3YA 4AG1A 5DP8A 1G30B 1O2SA 3HK6B 3HKJB 1GJ4H 2PKSB 4OS4A 3UUZA 1GCDA 1GMDG 1VCPA 1T8LA 2FOHA 7KMEH 1ORFA 2ZI2H 1PPFE 1NRSH 3SV7A 3H7TA 1UVPA 2ZGCA 4Z1MD 2VGCB 2V35A 1ZJDA 2PGQB 2Y80A 4FUFA 3DCLA 1UVTH 1GHXH 1BHXB 1Q31A 1QRXA 1S6HA 4HZHA 1UCYE 3PWCA 3UQOA 2YNBA 1C2EA 1GJ7B 3A7WA 2BD7A 4A5TS 3TU7H 3ZZ3A 2ZTZA 4ABAA 1W10U 2L74A 3ELAH 1MCVA 1ELGA 1GBAA 1K9OE 4ZKOU 2ZPRA 1SGRE 1XX9A 2SGPE 1F92A 3U8TH 3ZVGA 1NTPA 1O2XA 1C5TA 4A1XA 1Z6EA 2XWBI 1C5SA 3TJVA 3A8BA 1FZZA 2VNTA 1QB9A 2ZU2A 1MTUA 1QB1A 1TGSZ 3E6PH 5E8EH 3SUDA 2STBE 3RXGA 1IHTH 1HYLA 1O0DH 2BLWA 4K1EA 2XTTB 4I33A 1SGFG 3M61U 3PLKA 1FY3A 1C5OH 5A0BA 2QXHA 2EA3A 4DY7B 2ANYA 5TCCA 1P12E 3M3SA 1TWXB 4MQAA 4JZDH 4HFPB 4DVAU 1LPGB 5DN6D 2WYGA 1SMFE 1S6LA 3DA9B 2TPIZ 3D23A 2XNIA 1XMNB 4LZ4B 1ANBA 1NY22 5B6LA 5JYIA 3QO6A 2C3SA 1RFNA 3T25A 1ABIH 5GIBA 1INCA 2CHAC 3LGYA 1FV9A 1CT4E 1XKBC 1ZOMA 2K1QA 1J9CH 1GG6B 1QY6A 1MQ6A 2WPKS 3MU4A 1K1NA 3PMHB 3SNBA 5DP3A 3A7ZA 2FZZA 3QWCH 5EJZA 1GJBB 2ODYB 4I8HA 2FTLE 2BXUH 1ZPBA 5FXLA 3ZVDA 1C1UH 1WV7H 1C2LA 1YPJH 1D4PB 2F83A 4NWKA 3S7HB 1AB9B 2BVRH 5FCKA 5FBEA 4MNVA 5EOKA 1GMHG 3A83A 3MH7A 1Q2WA 2BX3A 1DS2E 2LELA 3AVZA 2ZDVH 2QF3A 3ATMA 5LPEA 3UWJH 1GMCG 2ASUB 3IG6B 3QDZB 1NRPH 2G4TA 1ZJKA 2W5EA 3GY3A 3ZVBA 1QQUA 2O8TA 4MPUA 1Z1IA 3ATKA 2P94A 2PW8H 4XDEA 3P8FA 4ABEA 1O2HA 4H6TA 3TGJE 5FAHA 5BRRE 2GCHF 1A4WH 3D62A 1O5EH 2ZEBA 4H4FA 1PQ7A 1BMFD 1YC0A 3KQEA 3F2FA 2BDHA 3UFAA 1SPJA 5JDUB 4ZROA 2BLVA 1LPZB 1FAXA 3MNSA 1YF4A 2VB0A 2KCOA 3P95A 1AE5A 3UNSA 3K6YA 5C20A 1MBMA 7GCHF 2ZGJA 2NU3E 1DSTA 5ESTE 1HXEH 1L4DA 3K6ZA 4UEHH 3RLWH 1K22H 2QGRA 4CH2B 3SGQE 1FIZA 4B74A 1V2WT 4AC9A 1P57B 1UTLM 1SFQB 2FMJA 2Y5HA 3CS0A 4B75A 1Y3UA 1ZGIA 5C67A 1GVLA 1GBDA 7LPRA 5DO4H 4X6NA 2ZF0H 1HAOH 3GCNA 3FVFB 3V12A 1W0ZU 1EASA 2Q6FA 4KELA 1H4WA 1FIWA 1JRTA 4IC5A 1C2DA 3E91A 4RKOB 3ZIAD 3JZ2B 2QAAA 3LOXA 3A87A 3U1IB 5FHTA 1O3IA 4I31A 3KIDU 4UDWH 1YY3A 3QZRA 1O3DA 3F9EA 3BTTE 2BXTH 5C0TA 2Y5FA 3P70B 3F0PA 4JK5A 2AEIH 1O35A 2GGVB 2C90B 2R0LA 4P00A 3MH6A 1P02A 1O2ZA 1V2PT 1BTYA 2GZ8A 2JJ1D 5C17A 2Y82A 1LHCH 1OPHB 1JRSA 5HIZA 1KXAA 2A4RA 3ZZCA 2JETC 1SKYE 3PROA 5K0HA 1OWEA 1O36A 3RC5A 1WQSA 2UUFB 3FANA 4J1YA 6ESTA 2C8ZB 1C5LH 1GJ9B 3KNXA 3SU4A 2JJ2D 1BTXA 1C5WB 4NIYA 3SU0A 4AX9H 2Z6BD 3IITA 4KTCA 2NWNA 1EAIA 2IOTA 2JH0D 4CREA 2Z9GA 1EAWA 1ETTH 4FETA 1TNLA 2QF4A 4BTIB 2ZKSA 2THFB 2VIOA 1T8OA 2G81E 2GDDA 4NSYA 4NIXA 2VH0A 3WWFA 2XXLA 5PTPA 1HAYB 1DFPA 4IS5A 1ZRBA 1DWBH 3PWBA 4ABGA 5KECA 3UNRA 1H9IE 4OGXA 4UFDH 1GHBG 3A7VA 4ACBA 1O2WA 2KAIA 3BEIB 4ISHH 1SGTA 2ZECA 1HXFH 1NU7B 2BDAA 3OY5U 2XWAA 5I25A 4MPXA 5GWZA 1GCTB 3NK8A 1NFUA 3MI4A 1KSNA 4X1SU 1YLCA 1DPOA 1NU9A 3FFGA 1W0JD 4B2AA 4OS1A 1FPHH 3P8NA 2ZHQH 1PQ8A 1UTNA 3BTME 1O2QA 1XUFA 2A4OA 4TPYA 1IQNA 1GHYH 1UK3A 3U8RH 3CNRA 2VIQA 3PO1C 1DY9A 1ANCA 2D1JA 4X2WA 1ZHRA 1YM0A 2A7HA 3LC3A 1N6YA 1TFXA 4KKDA 4DOQA 4RT1A 1JXPA 1P2KA 3DSGA 1SB1H 4YLUA 3RXSA 4ACAA 4AYYB 2NU2E 2KAIB 1GBMA 3SZEA 3MMGA 1D9IA 3R3GB 4D76A 4NA8A 2WV5A 1O3JA 1WXRA 1O39A 1OS8A 1QA7A 4WY3A 1AFQC 3RXCA 4MNWA 1N8OC 1UVUH 2PR3A 3SU1A 1D3PB 4X1NU 1HRTH 1MKXK 1QB6A 1OWJA 1GHAG 2CHAB 1SGIB 1PYTD 3RXLA 4Z6AH 1AUTC 1AFEH 2XBVA 1RJXB 1SVPA 4CH8B 1WYKA 1AD8H 2PSXA 2CK3D 1MTNB 3D65E 3RM2H 1CA0C 5K7RA 1EUFA 1P8VC 2H6MA 3TPIZ 5IDKA 3M3VA 2ZA5A 2VIVA 3ZZ9A 3WWBA 1AI8H 1J14A 3SV2H 2A2QH 4ZAEA 1KLIH 1TPAE 3AW0A 4RSPA 1NO9H 1OP0A 1V2LT 2FLRH 4LK4A 3SNCA 5L2ZH 2QV1A 5A0AE 1ZSLA 1ELAA 5CHAC 4Y76A 1XM1A 3Q76A 1SQOA 1ZMLA 2L6OA 3DFLA 1O2OA 4CBOA 2WPDD 3KEEA 3TIUA 1RIWC 2FOCA 2F43B 1CA8B 2HPPH 5F8XA 4NIVA 2F9NA 3RXVA 1YYY1 3SI4H 2ZGXH 2HLDD 3PV4A 1QRWA 1UTQA 2BX4A 2VWNA 1VITG 6CHAC 2FPZA 2OC0A 5TCAA 3EE0B 3VPKA 3BEFB 1B7XB 2SNVA 3EGKH 1MMJN 2OXSA 2BDIA 2G5NA 3FKSD 4BAQB 1FY5A 1J8AA 4UFFH 1O3BA 2PKAA 4QT8C 2R2MB 1GDNA 2Z3DA 3LU9B 1DM4B 1DUEA 1QQ4A 1O33A 2XW9A 3OEED 2AGIX 1DT2A 4D9QA 2ZHEH 4AFQA 1BMLA 3EA9A 4XBDA 1GBLA 1OSSA 2GCTC 1RGQA 2BMGB 2HGTH 3GY7A 1BHXF 2UUJB 1DANH 1XKAC 3URDA 3BTDE 3MOCA 1THPB 3T2NA 2ZTYA 1LHFH 2P93A 4F55A 1C1RA 3LDXH 2FX6A 3RU4D 3ZV9A 2J97A 2WYJA 3OEHD 3BG4B 1AN1E 1QBVH 3ZYEA 2PKAB 1YCPK 4K69A 1ELBA 1WTGH 5C94A 4YLQH 2FOGA 2G00A 3E0NB 2GTBA 1QURH 4DT4A 4UE7H 3TK6A 4X0WU 3UR9A 1O31A 3FP8E 1SGPE 1EPTC 1K1LA 5AHGH 2A5KA 2VWLA 3SQEE 1V2KT 1M9UA 3ZZ5A 1O3HA 3PB1E 1CT2E 2J38A 1W14U 1WUNH 3H7OA 1SGYE 1WBGB 4YESB 4YOJA 3KCGH 1TPSA 2VIDA 1D6RA 4CRAA 2ZQ1A 4ASHA 4JCNA 1E1QD 1QBOA 4IGDA 1AE8H 1K1JA 1HCGA 5DP5A 1OKXA 2OK5A 2AMQA 1C2MA 2EC9H 1GDUA 1P01A 4GHQA 1V2NT 2WV9A 5JB9S 2BY5X 1C1WH 2UWLA 3RMOH 3BTEE 3L6PA 1EP6A 3UQVA 3O8DA 3UREA 3Q3YA 1HJ8A 1BTZA 1CGIE 1FLEE 1PPGE 3LPRA 1SGEE 2PFEA 2HNTE 2LP6A 2VVCA 3LJJA 4K3JA 5DP4A 1C5RA 1CO7E 4GPGA 3GYMA 3IWMA 4ZKRU 2ZPSA 1TA2A 3GYLB 1TX8A 4BXSA 1GBEA 5DSFA 3O8CA 3PLBA 3RU4T 1LPKB 1ZPCA 1HAIH 1EQ9A 5L30H 3RUOA 1MZAA 2TGAA 1EZQA 3ZZAA 2W7UA 1P9SA 2IN2A 1WDIA 2WPMS 3SV9A 3UTUH 3MU5A 3KYFA 1C4Y2 4X2VA 2ZTXA 1HPGA 3RP2A 3B9FH 4I86A 3MU8A 1WOFA 1TALA 1A46H 1TBRH 5E2OA 3OY6U 5A8YA 1P11E 2VBCA 1QRZA 1Y5UT 3GOVB 1KDQA 4GCHG 2KCYA 1UK4A 1TMUH 2CMYA 2XBXA 1V2QT 1V2MT 1N1LA 1ARBA 2P8OB 3GCHC 1LKBA 1K1IA 2ZC9H 2KR7A 4GAWA 3SUEA 1MKXH 2QE7D 5B6OA 1SQTA 4WMFA 1HLTH 1Z8JB 5EQSA 3SU5A 4ISLA 4O03A 4K8BA 2GDEH 5FPSA 1UCYK 1O3KA 1PPZA 4IMQA 2G4UA 3P6ZB 3D49H 1Y3XA 2WPJS 3M36A 1N8OB 1BMMH 1Y59T 4O3TA 1TAWA 1O2UA 2A32A 3MFJA 1KDQB 1Z8GA 2LNCA 2SNWA 8KME2 3GCTF 1EOLA 1SR5C 5CE1A 1BTHH 1YBWA 1H8HD 1HAZB 5TJXA 1J15A 3SU6A 1O2VA 4INHA 3W1EA 4I8LA 1T7CA 5SGAE 2H5DA 4K1TA 3ZZ7A 4I8KA 2ZP0H 1CSOE 3A88A 1DUAA 2Y81A 3EYDA 3Q00A 1A5GH 3TITA 2WHXA 2BQ6B 4Y8ZA 4A1VA 3BTWE 3QGNB 3F0OA 4X8UH 4SGBE 1WQVH 2M5TA 2I6SA 5A09A 2A2XH 1DSUA 2ODQA 1DE7H 4GLYA 1HAHH 1J16A 1V3XA 5HM9A 3SN8A 2H5CA 1PJPA 1W11U 3PRDA 4NZLA 1FX0B 1RTKA 3C1KA 3F6UH 3A8AA 1NRQH 2SGFE 4IMZA 4AN7A 1AVXA 5T3HA 3RXQA 4Q7ZA 1NFYA 4VGCB 1TMTH 4DG4A 1GI0A 1GWAA 3VB5A 1TBQH 2GMTC 2J5UA 1GBKA 1O3LA 1C1MA 2DE8A 3E1XB 1MTWA 1D3QB 1ZR0A 1DWEH 1BBRE 3PMJA 4NA9H 2IJD1 1EATA 1IQIA 1O5AB 2GVFA 1BIOA 1YKTA 3HGNA 2PWXA 1HJAC 3KQ5A 1EJMA 1EPTA 4ZHLU 1OWDA 2FI3E 1A3BH 4GVUA 2VH6A 3PV5A 2GCTB 1G2LA 1LKAA 1YCPH 2H9TH 2HALA 4RKJB 4XFQA 3GY2A 1SC8U 1W8BH 1Y5AT 4NWLA 5FL7D 1HAPH 3T29A 2CF8H 2TRMA 4OS5A 1AWHB 1ELFA 3RXUA 1S0QA 2H2ZA 1EP5A 4NGAH 2FWWA 1TIOA 3A80A 3LGVA 3RLYH 4AZ2B 4R0IA 1UHBA 1P2MA 1GBJA 2OQ5A 1HJ9A 1KLJH 2ZFTA 1C5QA 1VITH 4NA7A 5AFZH 4IN2A 4FUBA 4TSFD 1A5IA 1L1JA 3M7TA 3E16B 3ITIA 1GBTA 5DKMA 1T32A 1CBWC 5AFYH 1G2MA 1ARCA 1TOMH 1AU8A 1VKYA 1EPTB 5E0JA 1BTUA 3QUMP 2WPLS 2FX4A 1P9UA 2YMSC 1IQEA 1EX3A 4BANB 3M5OA 2Y5GA 1TLDA 1YPHE 1K1OA 2F9PA 4Q2KA 4Q80A 1C1SA 4SGAE 4ZKSU 4BOHA 1F5LA 4RI0A 1YPGH 4U30A 1GBHA 2FESH 4FU9A 1S5SA 1UHBB 1TE0A 1YCPM 3RM0H 2AMPA 2HPQH 2Z7FE 1LVBA 2BY9X 1C2FA 4FUIA 2KCAA 1HNEE 4WMEA 1W2KH 5EIYA 1ZTJA 1P2IA 3RC4A 1W3CA 2GCHG 4FU7A 1ELEE 1TGBA 2TGTA 1V2RT 2BZ6H 2QN5T 4NCYA 3U28C 1GVZA 2RFKC 3GDSA 1SGCA 3GDUA 1YLNA 1IQMA 1GL0E 1KTTB 2P3UB 3UNQA 1BJVA 1UO6A 1EFRD 1O2KA 3N7OA 3RMMH 4MG3A 3L3TA 3TGIE 2BDYA 3U1JB 1IOEA 1MU6B 2RA0A 7GCHG 3MTYA 3HGPA 3ENSB 3RXHA 4LZ1H 3SZNA 3PRBA 3RXIA 1E37B 3KYGA 2V0BA 1O34A 1SOTA 2OC1A 1T4UH 4MVNA 2AHME 2JH6D 1P06A 2XC5A 2TGDA 5EU8A 5HKKD 4MDSA 4WVPE 1NFXA 1ZMJA 4YTAA 2O8WA 1FY8E 3RXFA 3SNAA 1GJ6A 3BG8A 3N7DA 1AWFH 4DT7B 4DIIH 2PLXA 1ANDA 2ZHDA 1SBWA 1YGCH 1UCYH 3VG8A 3A7TA 1SGFA 1MZDA 2Y7ZA 3EE7A 4NFEA 1IQKA 1C5UA 9ESTA 4Y0ZE 4ABFA 3M3TA 2FI5E 8GCHF 3BEUA 3ODDA 1XUHA 2RG3A 2ZDMA 3SI3H 2A31A 1BA8B 2CGAA 3GDVA 4INLA 3TLOA 4WJG2 4X6OA 5CDFE 2BZAA 2FOFA 3B8JA 3M7QA 5FCRA 1DY8A 2QY0B 1AZ8A 1SFIA 3QTOH 2GD4B 4Y79A 1XVMA 3VEQB 1DLEA 3EQ0H 1JMOH 1AUJA 1O5BB 3K9XB 2GKVE 1NBME 1SOZA 1PPHE 2BD9A 2QXJA 5KEDA 4ZXXH 1C2KA 1NRNH 2A5AA 2BOKA 4CHAC 2XBWA 3CS7A 1A7SA 2CF9H 1SLUB 2RDLA 3O8BA 4Y8XA 2ZCHP 3S7KB 2Z9LA 2BY6X 1GBCA 1O2PA 1TRNA 4I8GA 1MKWK 4Y11E 4Q63A 4WH6A 1P0SH 1PQAA 2BDGA 2OUAA 2SGEE 1XVOA 4CRDA 1LHDH 2PP6A 1MD8A 3TVJB 4ZCNA 3LJOA 1TBZH 2G52A 2P16A 2ZIQH 3TK9A 3TJOA 5DP7A 1JWTA 1DVAH 1RTFB 1JIMA 3AAUA 3N7EA 4JZFH 3BN9A 4WXVA 1PQ5A 2FOBA 1C5PA 2BTCE 4P02A 1MD7A 2V3HH 1PFXC 1VGCC 1SI5H 3PM3A 5JPMH 4XD7D 4Y71A 5EJLA 1G37A 2UWPA 4AGJA 5FX6A 3PLPA 2AIQA 2ANWA 2V3MA 2GMTB 2HVXA 1V6DA 1EB1H 1TGNA 1GI8B 3MO3A 2P3FH 3SV8A 1P3EA 1HGTH 1DDJA 4X8VH 4JYVH 3WW7A 3VXFH 1BRAA 2ZFFH 5F8ZA 2OTVA 1ZLRA 4ABDA 1A0JA 4M9FA 2B0FA 3F2GA 2J9NA 3I78A 3SJ9A 4U01A 1CQQA 1Z71A 1TPOA 5GCHF 2WPIS 1JOUB 4ASUD 3UOPA 4DURA 1COWD 1TABE 1KXDA 3WY8A 1HIAA 1LDTT 4I7YH 1K0HA 3E0PB 3BTFE 5F03A 5T1VA 1FXYA 1KXFA 3VB7A 1GHWH 1QCPA 2W6ID 2B7DH 1BITA 1F0SA 3AW1A 1DLKB 1MU8B 3VB4A 3F68H 1TRYA 3ZVEA 1UTMA 2ZFQH 3ATWA 2ALPA 1Y5BT 1DICA 3K65B 3SU3A 1SQRA 1T8NA 2RA3A 2BD4A 2FODA 2K0QA 1MTSA 3LKWA 1H9HE 1QJ1B 2K8IA 4GUXA 4HTCH 1BJUA 5C0UA 2F9VA 1ETSH 2R9PA 3M7UA 2GZ9A 4DCDA 2PKSC 1LTOA 2BM2A 6LPRA 1E1RD 1GI7B 4XE4A 3RXPA 1GJCB 4KGAA 5HYOA 2G5VA 2YOLA 2WZQA 5DK1A 1VJAU 1GJ5H 1UK2A 2QCYA 3RXEA 2HNTF 3B23B 2QXGA 2O8LA 2Q1JA 3KN2A 4YOIA 1WSSH 3OE7D 5GDSH 1MAYA 1GI6A 4FUEA 3TH4H 4K1SA 1FN6A 4ZHMU 5T6FA 2NU1E 2KM0A 4IN1A 4A6LA 2ZPQA 2SGQE 3KQDA 1A5HA 5AF9H 3ZZDA 2VWOA 4X6MA 1OWIA 1UMAH 1G32B 3DUXH 1BDAA 3BSQA 1SG8B 2DUCA 1GPZA 1FI8A 5EXLA 3ZV8A 1FJSA 5JBCS 1C1OA 2HOBA 1RXPA 1ELVA 2P59A 5T6GA 3MU0A 4E7NA 2OQUA 1AIXH 5BPEA 3SUFA 1NRRH 3STIA 1C2GA 1NS3A 2XOKD 4XBBA 1NESE 3A81A 3MO6A 1BRBE 2J98A 8ESTE 4ABHA 2RDEA 3SQHE 4B73A 4X8TH 4NSVA 1HAGE 4NG9H 2GV6A 1F0UA 2ZDKA 3RMLH 3ODFA 1LMWB 5C5OA 1BOQA 1OX1A 1D3DB 3QZQA 3SHAH 1CU1A 1E79D 2ZCLP 4LOYH 4F4OC 6GCHF 2XYAA 2QA9E 3M37A 2AERH 5EQQA 2W3IA 4OM9A 1TX6A 2ZFSA 3ZZ8A 4AFSA 1W0YH 3QTVH 1ESBA 4B76A 2OC8A 1HAVA 1H9LB 4O3UA 4MNYA 1YPEH 3A84A 1GG6C 2VU8E 3VXEH 1GGDC 3N99A 2J98B 1QFKH 1ABJH 2ZNKH 1B5GH 2F4LA 1D6WA 2VVUA 4H42U 1L4ZA 1O3FA 1GI3A 2JETB 4CR5A 4ZMAH 2P3TB 1P05A 3UAIC 1RTLA 2XCNA 1AB9C 3UB0A 2C4FH 3SGBE 3VB3A 2EEKA 3NXPA 1UTPA 2ZGBH 2BY8X 1P3CA 3S0NA 1MABB 2Q6GA 1P09A 1ZRKA 5JB8S 3RXRA 4E06H 1FNIA 1O2RA 1V2OT 1MKWH 3UIRA 3DFJA 2TGPZ 1CHOF 2UWOA 3QX5H 1RD3B 4CHAB 1O2YA 3NWUA 1HAVB 4Y7AA 1O2LA 3Q77A 2AFQB 3H5CB 1MUEB 3ATLA 5HM2A 4B1TA 2TBSA 3OFND 2BQWB 3JZ1B 1FN8A 2QYIA 2ODPA 1C5NH 3FAOA 1O3GA 1TYNA 4JZEH 1THRH 3DSOA 1AY6H 1Z8IB 4FUDA 3E3TA 3TK5A 4O97A 2W26A 2A1DB 1DOJA 1NZQH 3ZZ6A 1LQEA 2A7JA 3FOAA 2KX4A 3OX7U 4YXWD 2W6JD 4BNRA 1QL7A 1SL3A 3DSPA 4GHTA 3ZYDA 4JZ1A 2KCPA 4WWYA 4U2WA 4JYTA 1G9IE 1HAXB 3ESTA 4KP0A 2A0QB 4ESTE 4OS6A 3MH5A 3TGKE 1EZSC 1KXBA 4YO9A 2AMDA 3V13A 4NZQA 5H4IB 2V6NA 3E90B 3EA8A 1PPEE 2A4GA 1CVWH 1ZMNA 3PO1B 3FN8A 1UVOA 1MH0A 2J94A 5LH8A 1E36B 1YPHC 3EAJA 1DXPA 4X1RU 5EPNA 3ZVAA 3T5FH 3Q3XA 1BCUH 1GBIA 1O38A 5J4QA 4FOUC 2ANMH 5GPIB 3P8OA 2OCVB 1P04A 1BT7A 4XSKU 2QF5A 3DHKH 2FS8A 1AFQB 1O3AA 1UJ1A 2OC7A 1NM6A 3PMBB 2DE9A 1Y3VA 1O3EA 2BDCA 3TJNA 3RXAA 2GJGA 3LGWA 3TH3H 2R3UA 4ISIH 5A8XA 2UUKB 3QK1A 5JBAS 1KXCA 1GI5A 3HKIB 3SNEA 3A8CA 1DWDH 1ESAA 1NC6A 2WSSD 1OOKB 1BQYA 2ZQ2A 5F8TA 2CN0H 4TYDA 2NU4E 2AIPA 3GCTG 4THNH 2ZHWH 1NN6A 2AH4X 4KTUA 1GMDF 2W3KA 3GICB 1CA0B 4NIWA 4IW4E 4TWWA 1ZHPA 3KQCA 3MNCA 2ZO3H 1BTPA 1BTWA 1QJ6B 1BUIA 3M5NA 5A8ZA 1FQ3A 1BBRK 1L0ZA 2BHGA 3F3BA 4TY7A 1CGHA 1EOJA 4F49A 4MTBA 4X1QU 1PPCE 2HWLB 4KTSA 5CHAB 1U6QA 2IPQX 2CJIA 2GZ7A 1AZZA 2BLQA 2PTNA 2YMSD 3E8LA 1QJ7B 1RIWB 1ZPZA 4B2CA 4OS2A 3BIVH 3S9CA 2R2WU 3W94A 4UONA 5C2ZA 3GISB 3SU2A 4H6SB 1TGCA 4NFFA 3URCA 1OWKA 1Z8RA 1FUJA 3OSYA 2ZU3A 3MH4A 6CHAB 1BZXE 2Z9KA 2YNAA 2OBQA 2OINA 1NPMA 1SQAA 3I29A 3SYJA 3H09A 2OBOA 4U32A 4AFUA 1GI4A 2A5IA 1LVMA 3ZVFA 1QIXB 1GCTC 2ZDNA 1OXGA 4UD9H 1O3PB 1TONA 1CGJE 1C9PA 1Z7KA 3RXDA 1QHRB 3K2UA 3T62A 1IQHA 4CRFA 1EAUA 1EKBB 1F5RA 1Y8TA 2FS9A 4FVBA 1TB6H 2C8YB 5FPTA 3MYWA 1HDTH 2FIRH 3M35A 1C2IA 2BDBA 3U8OH 2ZCKP 2HVYB 3GS9A 5FBIA 2FYRA 1K21H 1W0KD 1P2OA 1G3BA 4YT6H 5KGOA 1VR1H 4M7GA 3RC6A 4ABJA 2A4QA 5HMAA 5ETXA 3V3MA 3NZIA 2WINI 2EI7A 1P10A 2ZDAH 3QLPH 2STAE 2B9LA 4BXWA 4BAMB 1GJAB 4WF8A 1Z6JH 1IQFA 2Z3CA 1GDQA 2ALVA 1VZQH 4O9VA 4RN6A 4A7IB 1E0FD 1BMNH 5EXMA 4BTUB 2BLOA 1NT1A 2CXVA 1ANEA 1ELTA 1GGDB 2BD2A 5DPAA 1GMHF 1XUKA 2TIOA 1ZZZA 3RU4E 2O9QA 4FUGA 2VIPA 1FY4A 1ETRH 3KF2A 5CHBA 1GMCF 2Z94A 1MTNC 4ISNA 4BAKB 4OGYA 4JYUH 4Y8YA 2D26C 3HK3B 9LPRA 2R0KA 1O5FH 5G4BA 4X6PA 2ZU1A 1O5CB 3RMNH 2HRVA 4BTTB 1ACBE 2Y7XA 1TOCB 1EAXA 4DJZB 5GXPA 1SHHB 4K8YA 3MHWU 1UTKA 4AB8A 2PUQH 2F9BH 3GCOA 1QZ8A 3GY6A 3PV2A 2ESTE 4UFEH 5LGOA 3P8GA 3LGUA 2FDAA 4B6FA 2BVXH 4XBCA 4DIHH 5HXFA 3SBKA 1QTFA 2AYWA 2EI6A 1EJNA 3RXKA 1QA0A 1TMBH 3F2HA 1G36A 1Y3WA 3NRLA 1F2SE 1WTHD 4WMDA
chains in the Genus database with same CATH topology
4D9RA 2ZHFH 1S82A 1IQGA 2BB4A 5J4SA 2O8UA 3SGAE 1ZGVA 4AYVB 3GY8A 2H9EH 1G3EA 4AGKA 3RXBA 1C1VH 1AQ7A 1F5KU 1WU1A 5C1XA 1AGJA 2F3CE 3PYHA 5LPFA 3VGCC 4A92A 3VB6A 1S6FA 1D3TB 2ULLA 3NKKA 1C5XB 1C1QA 1O2GH 4FUHA 1ELCA 2GT8A 1C2JA 4FUJA 1DXWA 3ZZ4A 4Y6DA 5EW1H 2BQ7B 1UTOA 2FEQH 3SJ8A 1BRUP 1L1GA 1XUGA 5C1YA 2ZU5A 3GCHB 3TNSA 1KTSB 3A7XA 2OD3B 4AB9A 4Y7BA 1O2JA 4TY6A 1A1RA 3NPSA 3BG4C 1C5YB 1XXDA 2FYQA 3SNDA 3A7YA 5JBBS 4CRBA 2PV9B 2B5TB 3MO9A 4TWYA 2VINA 2ZZUH 5ESBA 4AFZA 1K2I1 2BOHB 8GCHG 3C27B 2ZGHA 1QGFA 1SSXA 2HLCA 2FI4E 1C2HA 5C1UA 4XOJA 1SGQE 1BRCE 1AKSA 3F9FA 4AG2A 5E0HA 4B2BA 3VFEA 1LHGH 3AASA 5DGJA 2Z3EA 4DGJA 2IJOB 2J95A 5CMXH 1P03A 1TRMA 5EPYA 1BBRH 1PPBH 1OYTH 5I46H 3TNTA 1BB0B 1X7AC 1IQLA 1GJDB 1AMHA 1O37A 1C4U2 3LT3A 4J2YB 3MU1A 4WXIA 3S9AA 5LPRA 1F7ZA 3A8DA 3PMAB 5L2YH 3CP7A 2QIQA 1KY9A 1ESTA 4YT7H 2Z9IA 1H1BA 2VIWA 3P92A 1GI9B 2Q6DA 2FOAA 5EGMA 1ELDE 1C5VA 3TH2H 4BAOB 2AGEX 2O8MA 3U69H 3V0XA 1AKSB 2QXIA 3A82A 1GHBF 5DP9A 5DJ7A 2FOMB 2ZFPH 3UY9A 1QBNA 3KQBA 4D7FA 1TQ7B 1ZTLA 2SGAA 1SGNE 5DG6A 3OU0A 2PTCE 5EXNA 4UFGH 1RS0A 3SJOA 1JIRA 4HGCA 4CRCA 1C1PA 1B0EA 2ILNA 4OS7A 1H8DH 1XXFA 2BYAX 1L2EA 5C3NA 3SJIA 3A89A 2BD8A 1T8MA 1LVOA 4X8SH 1QNJA 4R8TB 3M5MA 2SFAA 3CENA 5F6MA 3LGTA 3FZDA 1T31A 3SHCH 1FY1A 4JZIA 2J92A 1IQJA 2SGDE 1W13U 3M5LA 2BY7X 3OYPA 1KLTA 3G01A 1NFWA 4Y0YE 1THSH 1O2NA 4YOGA 4IBLH 1HJAB 3STJA 5EQRA 2GX4A 1XUIA 2XBYA 4D8NA 2BD3A 2JKHA 1AVWA 1TGTA 1SLVB 1BMAA 3F1SB 5FPYA 3RXOA 3BTKE 2XCFA 3FZZA 2P8OC 3O8RA 2HNTC 3T28A 5GCHG 1TNGA 2H9HA 3I77A 4B71A 1EXFA 1E35B 4YZUA 1FDPA 1VJ9U 2AS9A 3KHVA 2UUYA 1AVGH 1GHAF 2R3YA 1A2CH 4K5ZA 1DITH 1SHYA 3EA7A 3QN7A 1GHZA 2BVSH 1CBWB 1MCTA 3UOUA 3GY5A 2ZDLA 1P2NA 1SGDE 1FAKH 1TA6A 4TPIZ 2FOEA 1WAYB 2PUXB 1QR3E 2OLGA 3W95A 1EZUC 1HIAB 4D7GA 2FXRA 1DX5M 1V2TT 2Z9JA 3MNXA 2VGCC 2ZU4A 2VVVA 3LONA 1YP9A 1S85A 5A2MH 1XUJA 1OWHA 5JBTA 4BAHB 2F9OA 3SUGA 1L1NA 3KGPA 3BF6H 1WCZA 3LH3A 8LPRA 2ZWLH 3DT0H 1E34B 1V2VT 4ABBA 2XRCA 3KL6A 4K60A 1O3MA 1E38B 1G3CA 1O2IA 1SLWB 2CV3A 3QGJA 5HGGA 3ZVCA 1YPKH 1MBQA 3LH1A 4E05H 2J4IA 5A0CA 7ESTE 1GJ8B 1VITF 5C5NA 1LCYA 3FP6E 4HI3A 2FO9A 4X2XA 2B8OH 3MWIU 4AOQA 1W12U 3BTGE 1H8IH 4VGCC 1F0TA 1GHVH 2G55A 4ZH8A 1KXEA 2C8WB 1C9TA 3BTQE 4ZKNU 1F0RA 1ZSJA 4I32A 3AAVA 4ZXYH 3EDXB 2VWMA 4CRGA 1N6XA 1JBUH 2A45B 1ZSKA 1K1MA 1QL9A 1ID5H 1KYNA 4E7RG 2ZFRH 5FX5A 3BIUH 3UPEA 1S0RA 2V3OH 1MAXA 4MLFB 2FP7B 2JH5D 3P17H 1GL1A 3VGCB 3SORA 4CR9A 1LQDB 2D8WA 2A7CA 4ABIA 5E0GA 3SV6A 2FTMA 1UTJA 2GV7A 3UR6A 2C93B 3R0FA 1HFDA 1PYTC 4DW2U 1A3EH 1G3DA 6GCHG 1O3OA 4ZHAA 2PGBB 1ZHMA 1TNKA 2FM2A 1J17T 1HB0B 2Y6TA 2FLBH 4I8JA 2F9UA 1HUTH 1EZXC 5EW2H 1VCQA 4CBNA 1C1TA 1IHSH 4WH8A 3SO3A 4MPVA 4A1TA 1GBBA 2ZG0H 1RRKA 3F9GA 1LHEH 1S84A 1YPLH 5DP6A 1OYQA 1TNJA 1KIGH 4FU8A 4YM9A 3T27A 1HV7A 3ZZBA 1O32A 1CE5A 3BTHE 1GVKB 2F91A 3LIWA 1A61H 1GI1A 1FMGA 1S81A 4Y10E 1YLDA 3LC5A 3UWIA 1OP8A 3RXTA 3GY4A 2P95A 3A86A 3RDZA 2WUBA 5L6NH 3DD2H 2XC4A 4Q7YA 1TQ0B 2WUCA 3NUMA 1O2MA 5AVDA 1CHOG 3U9AH 4FXGH 1P2JA 1ZTKA 4GSOA 1CT0E 1ZYOA 3FP7E 3S69A 2G51A 2WPHS 3PTNA 3L33A 2GP9B 1TX7A 1NROH 1B0FA 2J34A 1CHGA 2OP9A 1C4V2 5GJ4B 1UVSH 1S83A 1O3NA 1AHTH 2G8TA 1GI2A 2XC0A 1VGCB 2LPRA 3RXJA 3U98H 4PROA 3BV9B 1C1NA 2IPHA 4ISOA 3LGIA 5E2PA 1SLXB 1W7GH 2VJ1A 1O5DH 4LXBH 3F9HA 3MNBA 3RXMA 2NU0E 3SW2B 2EI8A 3OTJE 2AGGX 3A85A 4X2YA 3ATIA 2BD5A 1DWCH 1TPPA 1V2ST 3TJUA 2J2UA 1T4VH 3V7TA 4FUCA 2I6QA 5ABWA 4JMYA 4GCHF 1HBTH 4MPWA 1K1PA 1P2QA 4Q7XA 3SOSA 2PHBA 1TNHA 2PSYA 1YPMH 3NCLA 1EJAA 1Q3XA 1FONA 1MTVA 2GT7A 1AO5A 1C5ZB 4ZUHA 4AORA 4FVDA 3S9BA 4INKA 2W7SA 1VCWA 3PTBA 1GBFA 5T6DA 1MQ5A 1QL8A 1FPCH 4MNXA 2WV4A 1OP2A 4IC6A 1O30A 1O5GH 1W7XH 1O2TA 1IAUA 3SJKA 2H1UA 2ANKH 1O3CA 1LO6A 3HATH 4Z0KA 5IYTA 4JK6A 5EG4A 1TNIA 3T26A 1EB2A 2C8XB 2QC2A 4X1PU 1LVYA 1C5MD 1K28D 3Q3KA 4K2YA 1V2JT 2D2DA 3HPTB 5EODA 2QF0A 2RCEA 1V2UT 1Z1JA 1A0LA 1A0HB 1Y3YA 4AG1A 5DP8A 1G30B 1O2SA 3HK6B 3HKJB 1GJ4H 2PKSB 4OS4A 3UUZA 1GCDA 1GMDG 1VCPA 1T8LA 2FOHA 7KMEH 1ORFA 2ZI2H 1PPFE 1NRSH 3SV7A 3H7TA 1UVPA 2ZGCA 2VGCB 2V35A 1ZJDA 2PGQB 2Y80A 4FUFA 1UVTH 1GHXH 1BHXB 1Q31A 1QRXA 1S6HA 4HZHA 1UCYE 3PWCA 3UQOA 2YNBA 1C2EA 1GJ7B 3A7WA 2BD7A 4A5TS 3TU7H 3ZZ3A 2ZTZA 4ABAA 1W10U 3ELAH 1MCVA 1ELGA 1GBAA 1K9OE 4ZKOU 2ZPRA 1SGRE 1XX9A 2SGPE 1F92A 3U8TH 3ZVGA 1NTPA 1O2XA 1C5TA 4A1XA 1Z6EA 2XWBI 1C5SA 3TJVA 3A8BA 1FZZA 2VNTA 1QB9A 2ZU2A 1MTUA 1QB1A 1TGSZ 3E6PH 5E8EH 3SUDA 2STBE 3RXGA 1IHTH 1HYLA 1O0DH 2BLWA 4K1EA 2XTTB 4I33A 1SGFG 3M61U 3PLKA 1FY3A 1C5OH 5A0BA 2QXHA 2EA3A 4DY7B 2ANYA 5TCCA 1P12E 3M3SA 1TWXB 4MQAA 4JZDH 4HFPB 4DVAU 1LPGB 2WYGA 1SMFE 3DA9B 2TPIZ 3D23A 2XNIA 1XMNB 4LZ4B 1ANBA 1NY22 5JYIA 3QO6A 2C3SA 1RFNA 3T25A 1ABIH 5GIBA 1INCA 2CHAC 3LGYA 1FV9A 1CT4E 1XKBC 1ZOMA 2K1QA 1J9CH 1GG6B 1QY6A 1MQ6A 2WPKS 3MU4A 1K1NA 3PMHB 3SNBA 5DP3A 3A7ZA 2FZZA 3QWCH 1GJBB 2ODYB 4I8HA 2FTLE 2BXUH 1ZPBA 5FXLA 3ZVDA 1C1UH 1WV7H 1C2LA 1YPJH 1D4PB 2F83A 4NWKA 3S7HB 1AB9B 2BVRH 5FCKA 5FBEA 4MNVA 5EOKA 1GMHG 3A83A 3MH7A 1Q2WA 2BX3A 1DS2E 3AVZA 2ZDVH 2QF3A 3ATMA 5LPEA 3UWJH 1GMCG 2ASUB 3IG6B 3QDZB 1NRPH 2G4TA 1ZJKA 2W5EA 3GY3A 3ZVBA 1QQUA 2O8TA 4MPUA 1Z1IA 3ATKA 2P94A 2PW8H 4XDEA 3P8FA 4ABEA 1O2HA 4H6TA 3TGJE 5FAHA 5BRRE 2GCHF 1A4WH 3D62A 1O5EH 2ZEBA 4H4FA 1PQ7A 1YC0A 3KQEA 2BDHA 3UFAA 1SPJA 5JDUB 4ZROA 2BLVA 1LPZB 1FAXA 3MNSA 1YF4A 2VB0A 3P95A 1AE5A 3UNSA 3K6YA 5C20A 1MBMA 7GCHF 2ZGJA 2NU3E 1DSTA 5ESTE 1HXEH 1L4DA 3K6ZA 4UEHH 3RLWH 1K22H 2QGRA 4CH2B 3SGQE 1FIZA 4B74A 1V2WT 1P57B 1UTLM 1SFQB 2FMJA 2Y5HA 3CS0A 4B75A 1Y3UA 1ZGIA 5C67A 1GVLA 1GBDA 7LPRA 5DO4H 4X6NA 2ZF0H 1HAOH 3GCNA 3FVFB 3V12A 1W0ZU 1EASA 2Q6FA 4KELA 1H4WA 1FIWA 1JRTA 4IC5A 1C2DA 3E91A 4RKOB 3JZ2B 2QAAA 3LOXA 3A87A 3U1IB 5FHTA 1O3IA 4I31A 3KIDU 4UDWH 3QZRA 1O3DA 3F9EA 3BTTE 2BXTH 2Y5FA 3P70B 4JK5A 2AEIH 1O35A 2GGVB 2C90B 2R0LA 3MH6A 1P02A 1O2ZA 1V2PT 1BTYA 2GZ8A 2Y82A 1LHCH 1OPHB 1JRSA 1KXAA 2A4RA 3ZZCA 2JETC 3PROA 5K0HA 1OWEA 1O36A 3RC5A 1WQSA 2UUFB 3FANA 4J1YA 6ESTA 2C8ZB 1C5LH 1GJ9B 3KNXA 3SU4A 1BTXA 1C5WB 4NIYA 3SU0A 4AX9H 2Z6BD 3IITA 4KTCA 2NWNA 1EAIA 2IOTA 2JH0D 4CREA 2Z9GA 1EAWA 1ETTH 1TNLA 4BTIB 2ZKSA 2THFB 2VIOA 1T8OA 2G81E 2GDDA 4NSYA 4NIXA 2VH0A 2XXLA 5PTPA 1HAYB 1DFPA 4IS5A 1ZRBA 1DWBH 3PWBA 4ABGA 3UNRA 1H9IE 4OGXA 4UFDH 1GHBG 3A7VA 1O2WA 2KAIA 3BEIB 4ISHH 1SGTA 2ZECA 1HXFH 1NU7B 2BDAA 3OY5U 2XWAA 5I25A 4MPXA 5GWZA 1GCTB 3NK8A 1NFUA 3MI4A 1KSNA 4X1SU 1YLCA 1DPOA 1NU9A 3FFGA 4B2AA 4OS1A 1FPHH 3P8NA 2ZHQH 1PQ8A 1UTNA 3BTME 1O2QA 1XUFA 2A4OA 4TPYA 1IQNA 1GHYH 1UK3A 3U8RH 2VIQA 3PO1C 1DY9A 1ANCA 2D1JA 4X2WA 1ZHRA 1YM0A 2A7HA 3LC3A 1N6YA 1TFXA 4KKDA 4DOQA 1JXPA 1P2KA 1SB1H 4YLUA 3RXSA 4AYYB 2NU2E 2KAIB 1GBMA 3MMGA 1D9IA 3R3GB 4D76A 4NA8A 2WV5A 1O3JA 1O39A 1OS8A 1QA7A 4WY3A 1AFQC 3RXCA 4MNWA 1N8OC 1UVUH 2PR3A 3SU1A 1D3PB 4X1NU 1HRTH 1MKXK 1QB6A 1OWJA 1GHAG 2CHAB 1SGIB 1PYTD 3RXLA 4Z6AH 1AUTC 1AFEH 2XBVA 1RJXB 1SVPA 4CH8B 1WYKA 1AD8H 2PSXA 1MTNB 3D65E 3RM2H 1CA0C 5K7RA 1EUFA 1P8VC 2H6MA 3TPIZ 5IDKA 3M3VA 2ZA5A 2VIVA 3ZZ9A 1AI8H 1J14A 3SV2H 2A2QH 4ZAEA 1KLIH 1TPAE 3AW0A 4RSPA 1NO9H 1OP0A 1V2LT 2FLRH 4LK4A 3SNCA 5L2ZH 2QV1A 5A0AE 1ZSLA 1ELAA 5CHAC 4Y76A 1XM1A 3Q76A 1SQOA 1ZMLA 3DFLA 1O2OA 4CBOA 3KEEA 3TIUA 1RIWC 2FOCA 1CA8B 2HPPH 5F8XA 4NIVA 2F9NA 3RXVA 1YYY1 3SI4H 2ZGXH 3PV4A 1QRWA 1UTQA 2BX4A 2VWNA 1VITG 6CHAC 2FPZA 2OC0A 5TCAA 3EE0B 3VPKA 3BEFB 1B7XB 2SNVA 3EGKH 2OXSA 1MMJN 2BDIA 2G5NA 4BAQB 1FY5A 1J8AA 4UFFH 1O3BA 2PKAA 4QT8C 2R2MB 1GDNA 2Z3DA 3LU9B 1DM4B 1DUEA 1QQ4A 1O33A 2XW9A 2AGIX 1DT2A 4D9QA 2ZHEH 4AFQA 1BMLA 3EA9A 4XBDA 1GBLA 1OSSA 2GCTC 1RGQA 2BMGB 2HGTH 3GY7A 1BHXF 2UUJB 1DANH 1XKAC 3URDA 3BTDE 3MOCA 1THPB 3T2NA 2ZTYA 1LHFH 2P93A 1C1RA 3LDXH 2FX6A 3RU4D 3ZV9A 2WYJA 3BG4B 1AN1E 1QBVH 3ZYEA 2PKAB 1YCPK 4K69A 1ELBA 1WTGH 4YLQH 2FOGA 2G00A 3E0NB 2GTBA 1QURH 4UE7H 3TK6A 4X0WU 3UR9A 1O31A 3FP8E 1SGPE 1EPTC 1K1LA 5AHGH 2A5KA 2VWLA 3SQEE