3VB4A

Crystal structure of sars-cov 3c-like protease with b4z
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A02
2YOLA 2ALPA 1FY4A 2BD7A 4CRAA 1AB9C 3DHKH 1BMLA 2AMDA 1N8OC 3E91A 3NK8A 1N6YA 2GCHG 2R3YA 3QWCH 4TYDA 1QL8A 1KSNA 1AO5A 2GDEH 2UUFB 1QQ4A 4ABHA 2R2MB 3SU3A 2OD3B 2OQ5A 2PKSC 2FDAA 1NU9A 2C4FH 2ZU3A 3ESTA 2SNVA 2VIQA 1GJ9B 1UTJA 2O8MA 1SMFE 4JMYA 4KTSA 5TCAA 3LDXH 4UFGH 3SNBA 1ZHPA 5K0HA 4INHA 1OWIA 3ATMA 1E0FD 1GDNA 1ELCA 1S0QA 3UQOA 5F6MA 4BXWA 1VITG 1C2KA 1XX9A 1QGFA 2AERH 1O3EA 2C93B 1P2MA 2FEQH 3CENA 3RXJA 2JH6D 4Y76A 1RS0A 3H7OA 5T6FA 1TNHA 4AYYB 3LJOA 2ZHWH 1GWAA 1BJUA 1K1OA 3E16B 5C3NA 1BUIA 2QA9E 2J92A 2P8OB 3BTDE 2HWLB 1ANCA 4WJG2 1ELEE 3QK1A 3AW1A 5ETXA 2B5TB 2BOHB 1W8BH 3FZDA 5LPEA 1GI0A 1RTKA 2AIPA 3ZV9A 4GCHG 2G52A 1WCZA 4UD9H 2CXVA 1QHRB 2V35A 4X8SH 1XUKA 1E37B 2AMQA 1BTUA 1RIWB 1EZUC 2I6QA 1B0EA 1TRMA 2F9VA 1THRH 3SJ9A 4CRBA 1GCDA 2ZG0H 3MNSA 3HPTB 3MYWA 1NT1A 4FVBA 4HZHA 4IS5A 3SV6A 3A7ZA 3W95A 1T7CA 4R0IA 1C5NH 2TGDA 2V3HH 3TU7H 5JBAS 1F5KU 1O2GH 1H1BA 1D3QB 1O2KA 1SGIB 4FUIA 5AFZH 4E05H 1GG6B 1GBJA 2PSXA 4JYVH 1T32A 1C1OA 3ZVBA 3GYLB 4FUDA 1L0ZA 2BVRH 2WYJA 3PROA 2ANKH 1TWXB 1FIZA 2ANYA 1LHEH 1BA8B 1ID5H 1TPPA 5FHTA 4YOIA 2CHAB 3EGKH 1C1NA 2A4QA 1P2QA 2FO9A 3BSQA 1C2EA 3M3TA 4DVAU 3TGKE 4ZAEA 1RTFB 4TWYA 5JBCS 3S7HB 1YPEH 5FPSA 2BD3A 1DWBH 1TMTH 1DPOA 2A45B 1C5OH 1O31A 2HVXA 2IPHA 1OYTH 2Q6GA 3BG8A 2G51A 1KDQA 1O3CA 4HI3A 1QCPA 3RLWH 2ZDLA 3E8LA 3PLBA 1GHAF 2Z9LA 4AX9H 1KDQB 3VFEA 1GJ6A 3IG6B 1DVAH 1QB1A 1E34B 1MTNB 3F68H 3G01A 5G4BA 1C2LA 3FZZA 5C2ZA 1GBTA 1QIXB 4KTCA 1B0FA 2FXRA 1UTKA 2HNTE 1EATA 1WYKA 1MZDA 2FYRA 1GBEA 1LHCH 3CS0A 1JIRA 1K1PA 1O5BB 3P92A 2BD4A 2ZC9H 4KP0A 3RXTA 1YBWA 3SUDA 4ABDA 2FMJA 8ESTE 2H2ZA 2J34A 1C5PA 2ZHFH 3BV9B 1ZOMA 5LPFA 2BLWA 4X6OA 4SGBE 1AVGH 1JXPA 4ABEA 1AUJA 2STAE 3PWBA 1DICA 2QYIA 5A0CA 3BF6H 1KXDA 1A0LA 4NZLA 3RXBA 1XKBC 2PSYA 2ZCHP 1O34A 2HNTF 2BY6X 3STIA 3U8TH 2VWOA 3LH1A 4VGCB 4AN7A 3P95A 1V2QT 1O5FH 3TJNA 1H9HE 4XDEA 3TJUA 2F9OA 4K1SA 4ISOA 7LPRA 1FDPA 1YPHC 2PHBA 3OX7U 3O8DA 4X1PU 1W0ZU 2DE8A 1GVKB 2VIOA 1UTQA 1BOQA 1BRUP 1TRYA 4IC6A 4Y0ZE 1ELBA 5L2YH 2WPLS 5JB8S 1S81A 4XBCA 1V6DA 3V7TA 4MPUA 3CS7A 1MH0A 1QB9A 1YGCH 4ABGA 2ZNKH 5J4QA 1EQ9A 4ISLA 3UR9A 1SGDE 2BOKA 2FOCA 5FBIA 1GMHF 5I46H 2PUQH 4E7NA 5A0AE 1TNIA 2P8OC 1NRPH 2BD2A 3RDZA 4HGCA 2LNCA 4NA7A 1AQ7A 1EAIA 1V2ST 4M7GA 4BTIB 4X2XA 1DLKB 1UVOA 2NU4E 3KHVA 1TONA 1PPHE 4Q7YA 4NSVA 1GI3A 3UQVA 4FU8A 1LTOA 4OS6A 3TVJB 4ZMAH 1YPKH 4IBLH 1RIWC 2H5DA 4NG9H 2WPIS 5E0HA 4I8GA 5T6DA 4NIWA 2C3SA 1TNJA 1ZHMA 1LPKB 1MKWK 2ODPA 2WPMS 2GV6A 1T8MA 4ZKNU 1AFQB 2TGPZ 1O3LA 2BY5X 3I29A 3RXPA 1EPTA 2WINI 4DGJA 4NA9H 1AZZA 1SC8U 3SI4H 8KME2 1GG6C 3S0NA 5FXLA 3GISB 1OWEA 4FUJA 2F9BH 1GVLA 3ZZ7A 2A5KA 5C1XA 3FFGA 1D3DB 1O5GH 4I8KA 1GL1A 2CGAA 2PLXA 4IMQA 2GD4B 1ZHRA 5GWZA 2FIRH 1TGCA 2BX3A 1P10A 6LPRA 1ZMJA 2FOFA 3D49H 2R2WU 2CHAC 5EPYA 3RXMA 1O2MA 3BN9A 1AUTC 3GCTF 5HGGA 1TGSZ 4Q7ZA 3RXLA 1SGNE 1DSUA 1MU8B 1Y3UA 4ZUHA 3M5MA 1FIWA 3A82A 4YOJA 3TH2H 2Z94A 2GX4A 3M5NA 9ESTA 1W12U 2ZGJA 3GCOA 2H9HA 2P95A 3M61U 1SGCA 3O8RA 5PTPA 5FCRA 1UTNA 1QY6A 5C5NA 1ELDE 3FP6E 1RXPA 5C1YA 2FS8A 3RC5A 1D4PB 1LVOA 1AE8H 1S85A 1VJ9U 3UFAA 1A1RA 1G36A 3RM2H 2XC0A 1MKWH 1EJAA 3PLPA 1O3IA 1Z8RA 3ZZ3A 1K1MA 1LO6A 1C2GA 2EEKA 1QA7A 3A7TA 1Z7KA 1ELFA 1NC6A 1SGYE 3HK3B 4AGKA 1MTNC 3EAJA 1C2HA 1EB1H 3RMOH 2WV5A 1C1QA 1CHOF 1UK3A 1QL7A 2O8LA 8GCHG 3KF2A 1TA6A 3SNEA 2BMGB 3FVFB 5F8TA 1MD8A 1TOMH 3S69A 3M3VA 1BZXE 2GCTB 1C5LH 1OS8A 2ZECA 3M7UA 3EA7A 1C1WH 1B5GH 1SLWB 1TQ7B 1FLEE 4IN1A 2FI4E 3A8AA 4DT7B 1OP8A 2GT7A 1AZ8A 4K60A 3I78A 3HKIB 1RFNA 4X1QU 2F3CE 1BHXB 1FPCH 3FP7E 3KQCA 4RKOB 1GHBF 4VGCC 3SU2A 1O2ZA 1A5GH 3RXDA 1BB0B 3KNXA 5DJ7A 3MNCA 4AFQA 1BTHH 3OTJE 1BRCE 1H9IE 4OS1A 1RD3B 2F9NA 1ZRBA 1GI6A 1OPHB 2ILNA 3D65E 2Q1JA 2FS9A 1WTHD 2JH0D 1GL0E 1CGHA 4YESB 5JYIA 1ZTJA 6ESTA 4OGYA 3SJ8A 2Z3CA 4K1TA 5IDKA 3RUOA 4AYVB 4B76A 3GY2A 2OCVB 1FUJA 1HYLA 3TIUA 1K21H 3QX5H 2WPJS 2Q6DA 5A09A 3OY6U 3SUEA 2A1DB 4YOGA 3DA9B 3DFLA 5GIBA 4Y79A 1GDQA 1CA8B 1TX6A 3WY8A 1QJ1B 3NXPA 1HPGA 3NWUA 1W10U 5JB9S 1FV9A 1FAKH 1QRZA 3K9XB 4ZXXH 4BANB 1FZZA 2TGTA 4UONA 4MNWA 4F4OC 3BTWE 1O39A 1DWDH 4YTAA 3GOVB 3S7KB 3AAVA 5EGMA 1J16A 1D6RA 1Y5AT 1EZSC 2EI6A 1HJAB 3IITA 3VB4A 4K8YA 1UVSH 1IQHA 4ZKOU 2BQ7B 3LKWA 1SG8B 2QF3A 1C2FA 4JYUH 1PYTD 1AFQC 4XBBA 3U98H 5EW2H 1VJAU 2FESH 3UNRA 3QUMP 3RXEA 1ZPBA 4WMFA 1GBKA 1HFDA 1QTFA 3E6PH 1C5YB 1GJCB 1P2OA 2CMYA 3TK9A 4H42U 4A1VA 2A4GA 4RKJB 1MAYA 1MTSA 2W5EA 4X8TH 3MOCA 1NFYA 4AZ2B 1L1GA 2BQ6B 2OP9A 1RGQA 1LQEA 2XBXA 1B7XB 3SJIA 3NUMA 1LCYA 3SU6A 4GHQA 1QJ6B 2QV1A 3R3GB 3S9BA 5C5OA 1BTZA 1IQJA 2B9LA 3LGYA 5EQRA 3T2NA 3UREA 3ZZDA 2A7CA 3KEEA 2I6SA 3PYHA 1O2SA 5GXPA 3EA9A 3MNBA 1QNJA 1KIGH 4CR5A 3LPRA 2OQUA 1YM0A 1L4DA 3ZVDA 3TPIZ 1C2DA 1YC0A 3OSYA 2C90B 3DT0H 3PLKA 1GBAA 1K22H 2TRMA 5A8ZA 1QRWA 1NY22 4Y7BA 1EOLA 4LZ1H 5FX5A 2W3IA 5C67A 1EP5A 2BVSH 1TBRH 2J38A 1NM6A 2OC1A 3CP7A 4ISHH 2OXSA 4BTUB 1O2VA 1TOCB 4DURA 1EJNA 1MTUA 1OP2A 1WV7H 2OC7A 1TFXA 2AS9A 2EI8A 4MVNA 2XTTB 3ZV8A 1O3MA 3A87A 1TGTA 2PV9B 1P0SH 1J8AA 2VWLA 1KY9A 2G5NA 2GCTC 1Q3XA 4BNRA 1NFWA 4I7YH 1DLEA 2PGBB 1OOKB 3RU4E 4FUGA 5K7RA 2VIWA 1SQAA 2ZTYA 1SHYA 2G55A 3MU5A 1Y3WA 2QXGA 2RG3A 1O2WA 1N1LA 3GY7A 1WQSA 4FUFA 3MFJA 2F9UA 1ANDA 4XSKU 2ULLA 2HPPH 2ZGBH 4JZIA 1BBRK 3TH4H 1O3HA 2AFQB 2AEIH 3URDA 1DM4B 3A7XA 2ZU1A 1F0UA 1GBLA 4PROA 1FNIA 3M7QA 1HAZB 7GCHG 1SVPA 3UNQA 2C8YB 5A8YA 4ABFA 3M7TA 4YT7H 1ANEA 3SNCA 3ZZBA 2Y6TA 3BTQE 3ZYEA 1X7AC 2ANWA 1Z6EA 3SNAA 1HAXB 1ZR0A 4JK5A 4U01A 4UFFH 4I32A 1GCTB 1O3DA 4LXBH 5A0BA 1GHXH 1SLXB 2QAAA 3QLPH 1LPZB 1ANBA 1GJ4H 1P04A 3QTOH 4DOQA 1O38A 3P70B 3RLYH 1W7GH 3RXKA 1DXWA 1VR1H 2A2XH 1XXFA 4NIXA 4WH6A 2DUCA 2UUJB 1OX1A 2FM2A 3PTBA 1EZQA 2ZFQH 4INKA 1JRSA 1Y59T 4H6TA 3TJVA 4Q80A 3ZZ6A 1NS3A 2HGTH 4B73A 1MQ6A 4CRDA 2A2QH 3A88A 4J2YB 2ZO3H 1SLUB 4Y0YE 3IWMA 2BDHA 1UJ1A 4UDWH 3BEIB 4NWLA 2PKAA 4K2YA 1BTPA 2GZ7A 1E35B 3TK5A 5IYTA 1GJBB 1BTYA 2ZHQH 3LJJA 2D8WA 1HJAC 2FTMA 1BBRH 1KXEA 1C9TA 2BZ6H 1NROH 2PKAB 1HAYB 2ZTXA 5E2PA 1T4UH 1T4VH 1CU1A 3GDSA 3R0FA 4QT8C 1HAVA 1Z1IA 2HLCA 1RJXB 1YPGH 1FN6A 1PQ8A 3E1XB 3HKJB 1IHTH 1XVMA 7ESTE 4TPIZ 3UUZA 1CGJE 1C1VH 3SGAE 1HAVB 2ESTE 6GCHF 1MCVA 2ANMH 3VXFH 1O3AA 1C1MA 4B1TA 1TLDA 4D76A 2ZKSA 1PQ7A 1EAUA 3T29A 4LZ4B 2BXUH 1GMDG 4O3TA 3SGBE 4XOJA 1EB2A 3MU1A 2GDDA 1TRNA 3F6UH 1PQ5A 4AORA 1C5MD 5LPRA 1H8IH 2FODA 1G3BA 3C27B 2QIQA 1G9IE 1LKBA 1GJDB 3KIDU 2BY7X 4A1XA 3EE0B 1ORFA 2P94A 1YF4A 1MBQA 1JWTA 1BCUH 5EOKA 1SPJA 3TNSA 2BTCE 4ZXYH 3ITIA 1OSSA 3A89A 3Q00A 1AD8H 1QBOA 2BY8X 4DY7B 1YPLH 1OWJA 3BTEE 4GSOA 1BDAA 4BAMB 4ZROA 1TNLA 3A7WA 1OWKA 1V3XA 3GCNA 1ESBA 4WF8A 1FQ3A 1G30B 2GGVB 3ATIA 1D3PB 1HAIH 1G2LA 1NU7B 1Z71A 4TWWA 1OWDA 5EXLA 1SL3A 4U32A 2BLVA 3GY4A 2GZ8A 1PQAA 1O2RA 3DD2H 2Z3EA 5GCHF 4HTCH 3Q3YA 2B0FA 2ZDKA 4Z6AH 1CO7E 2XW9A 1TPOA 3SGQE 3SOSA 1ZJKA 4I8HA 1EUFA 2PTNA 1CQQA 5AVDA 5DP9A 1NFXA 1W14U 1SGFA 2VIVA 3LT3A 3HGNA 1XVOA 5DK1A 3GYMA 1C5UA 1OKXA 3SJKA 2ZFFH 4MPXA 2BVXH 4ABJA 1SGRE 1V2TT 4KGAA 4MLFB 2RA3A 3I77A 2UUKB 1O2UA 3MH6A 3SQHE 4AG1A 2SGAA 2QXJA 3TGJE 1LHDH 2ZPRA 1KXAA 1W3CA 3V13A 1GBMA 2FOAA 2IOTA 2VWMA 1Y3VA 4Y10E 1XUFA 1BJVA 3AW0A 1JBUH 1O3GA 5DP4A 3S9CA 1S84A 2BLQA 3SV8A 4YM9A 1C1TA 3O8CA 3E90B 1G37A 1QR3E 2CV3A 1P3EA 3PO1B 2BD5A 1DANH 1HAHH 2C8XB 4CBNA 1RTLA 5F03A 2ZU2A 1GI4A 3B23B 1P3CA 4UFDH 1WAYB 3SJOA 3RC6A 1MU6B 2QY0B 3LGVA 3EA8A 4WMEA 3F9HA 2R9PA 4CRFA 3U1JB 2OC0A 2VH0A 5ABWA 3FAOA 2SGPE 1IQKA 1T31A 1YPMH 2ZWLH 2SFAA 3P8OA 1P2NA 2W7UA 1GBCA 4K3JA 2ZGHA 3E3TA 1HJ8A 2AYWA 3JZ2B 4JYTA 1FAXA 3A86A 1ETRH 1MKXK 1BRAA 1LMWB 3TITA 1EJMA 1TALA 2A0QB 2Y5HA 2ZI2H 1GI5A 3SORA 4AB8A 3TLOA 4IMZA 2QCYA 4AFSA 1SB1H 4BAQB 1P57B 1TA2A 4NA8A 3UOPA 1UVUH 4XE4A 1PPCE 1C5RA 1WTGH 2XC4A 1C1PA 3TJOA 1NPMA 2QN5T 2NU2E 1Z8GA 1CT0E 1YKTA 1ABIH 2R3UA 2XXLA 1FPHH 1EPTB 1W0YH 1SGFG 4FU7A 1THPB 4ABAA 3UNSA 2F9PA 4YO9A 2O8WA 3E0PB 2VJ1A 2PFEA 5ESTE 2SGDE 1UTPA 1O2QA 2BZAA 3M37A 4JZEH 3ZVCA 6CHAB 4AG2A 2WUCA 1L2EA 2FI5E 2G00A 2ZHDA 2P59A 1ARCA 2FPZA 1UK2A 3UWJH 2OINA 1A46H 1BMMH 1C9PA 4O03A 3QO6A 1MMJN 2Y7XA 2VNTA 1GMCF 1HNEE 1O3FA 1TBZH 4BTTB 2J4IA 2H9TH 5JDUB 3JZ1B 1AY6H 4CR9A 2V3OH 1ARBA 1S0RA 2BD8A 2GCHF 1SHHB 4B71A 3MMGA 5F8XA 1L1NA 1C1SA 2HRVA 2Y80A 4Q2KA 1C4V2 2ZFRH 1ACBE 1TBQH 4X8UH 4MQAA 1SGTA 3NKKA 1JRTA 3MU0A 3F1SB 3TH3H 1XMNB 1MUEB 4ISIH 1GJ7B 2XCNA 4XFQA 1C1UH 3P8GA 2BDGA 4KELA 2FWWA 5EXNA 1C2MA 1VITF 3W94A 1LVBA 1O5DH 3Q77A 3MO6A 3U8RH 5A8XA 2HALA 3RXVA 2O8TA 4X1SU 3MU8A 4ESTE 1S82A 3VB7A 1PPGE 3S9AA 5LGOA 3AASA 1FI8A 3K65B 1CA0B 1TGNA 1KYNA 2WV4A 2BHGA 3L6PA 2CF8H 1IQFA 1MQ5A 1VGCB 3RXOA 4B2AA 1YPHE 2RA0A 3BTHE 1V2VT 4GCHF 1BRBE 2ZU5A 1O2TA 4X0WU 2XBYA 5JBBS 1G3CA 4BOHA 1UCYK 2ZA5A 1W13U 4ISNA 1O5AB 1FY3A 2W7SA 1UO6A 1TE0A 1O3KA 1MTWA 1XKAC 4YT6H 1ZMNA 5HXFA 1ETTH 1GHAG 1MBMA 1DX5M 3N7OA 2LPRA 1GPZA 1MTVA 1GDUA 2FOEA 1K1LA 1Z8IB 2VH6A 4JZDH 1THSH 5E8EH 1J9CH 2YNBA 1GHVH 5HM9A 4DIIH 4Y8XA 3U8OH 1VZQH 2GVFA 3LU9B 1V2KT 3NPSA 3PWCA 1O35A 1WQVH 3VB6A 4WXVA 1D6WA 2OBOA 3BEUA 1K1IA 1P02A 1VCQA 3PO1C 4X1RU 3B9FH 3UWIA 3KQBA 3RU4D 4D9RA 5TJXA 1JOUB 1BIOA 4ZKSU 5FPYA 1TPSA 3SHAH 3KGPA 3RMLH 4H4FA 1GHWH 5L6NH 1EX3A 1DUEA 2XCFA 2ZQ1A 3PV4A 1AFEH 3GY5A 2C8WB 3BTGE 1WBGB 3ZZ4A 2NU0E 1WSSH 2BDBA 2H9EH 3MH4A 4DJZB 4OS4A 2FI3E 1M9UA 2VB0A 1GBDA 3LIWA 1QA0A 2TPIZ 2K1QA 1FXYA 3GDVA 2H6MA 4NSYA 2FLRH 2J94A 1A7SA 2IJOB 1UCYH 1O3NA 4ZHAA 1SGPE 1DITH 1QBVH 3STJA 2Z9JA 1BTXA 4FUCA 1C1RA 1KXBA 5L2ZH 2SGQE 2ZGXH 3U1IB 1P03A 5H4IB 1V2MT 2V0BA 1UMAH 3QZRA 1V2PT 2F91A 5T6GA 2VWNA 1EPTC 2EA3A 2FYQA 4ABIA 3A8CA 3SN8A 1OXGA 1C5ZB 1F0TA 2W3KA 3KN2A 4FU9A 3LH3A 1EOJA 3RXGA 4BAKB 3HATH 1GMHG 2AIQA 3SQEE 3ZVFA 4A1TA 4GPGA 1KLIH 6CHAC 1NESE 1IQIA 4K8BA 2H1UA 1A2CH 3BTME 1SFIA 2R0LA 4ABBA 1C5SA 1HUTH 4MNYA 4JK6A 3VXEH 4X6NA 1SGQE 1KLJH 2Y5GA 2ZQ2A 3T5FH 2FTLE 5FAHA 3ZZCA 4NCYA 3RU4T 5DP6A 4CH8B 5DG6A 1IQNA 1E36B 1T8OA 2J2UA 3A83A 1LPGB 4WMDA 3BG4B 2PWXA 5CMXH 5HM2A 4NFEA 2ZF0H 2OLGA 1SR5C 1BQYA 3K2UA 3MWIU 4Y11E 1KLTA 1O5EH 4DG4A 1TGBA 2O9QA 1ZYOA 1UTLM 4NGAH 5CE1A 1QB6A 2Y81A 3ZZ5A 3A80A 3ENSB 3M5OA 4ZHMU 1CE5A 2AGGX 3PMJA 1DS2E 2W26A 5BRRE 1BBRE 1ELGA 1O0DH 2QXHA 3PB1E 3QTVH 2PR3A 3K6ZA 1PJPA 5J4SA 1AIXH 1AE5A 1A5HA 1NO9H 3MH5A 3QN7A 3BTKE 3GCTG 1Y5UT 1A0HB 2TIOA 2BQWB 2HNTC 1CA0C 1EAWA 1Z8JB 3C1KA 2ZP0H 1F2SE 1F5LA 3GCHB 2B8OH 2P93A 3MHWU 2EC9H 3SBKA 1VGCC 3B8JA 3M3SA 1AKSA 1F0RA 1F5RA 4Y8ZA 2FZZA 2VVCA 4HFPB 1YCPM 2VIDA 2PW8H 3UR6A 4ASHA 3RXRA 4TY6A 1AKSB 1AVWA 2SGEE 4LOYH 1Q31A 2AGEX 1KXCA 1S6FA 3K6YA 3ODFA 1GI2A 2FOHA 1IQMA 2UUYA 1A5IA 4B74A 1HRTH 3UIRA 1HBTH 1NRNH 1O32A 1ZGIA 2SGFE 2G8TA 3UOUA 3PMHB 2GMTB 1KTSB 3ZVAA 1BITA 4ZHLU 1CHOG 1O2OA 3ATLA 2VGCB 1AWFH 5BPEA 1K28D 2C8ZB 1GI8B 1P12E 4RSPA 1BMNH 4AFZA 3ZVEA 3FP8E 3RXIA 3KQDA 1GI7B 4SGAE 1YLDA 1H8DH 1HAGE 2DE9A 4B2CA 2WPHS 1OWHA 5DKMA 1HB0B 1P2JA 2WUBA 3SUGA 1SI5H 1WOFA 5GJ4B 3Q3KA 1ZJDA 4WY3A 1ZZZA 2AH4X 4GUXA 3M5LA 1YLCA 1DY8A 4H6SB 1TAWA 2XBVA 1XUGA 3LONA 2JKHA 2Z6BD 4I8JA 1KTTB 2A4OA 2FX6A 4DIHH 5JBTA 3A8DA 4FVDA 3BIVH 1GHBG 1TB6H 5EG4A 1FMGA 1V2WT 4B2BA 3QGNB 4X1NU 1F0SA 2GZ9A 4MDSA 1UTOA 1O36A 5FCKA 3GICB 1O2JA 3T28A 3H7TA 1CHGA 1HJ9A 1ZGVA 4OGXA 3DUXH 1FY5A 2ALVA 1Z6JH 1FN8A 3Q3XA 4O3UA 3HK6B 2IN2A 4RN6A 4OS5A 3TNTA 4NWKA 1TMBH 2VIPA 2XWAA 4NFFA 2ZCKP 2NU3E 2Q6FA 1ELAA 4IW4E 1P05A 4X2VA 2FOMB 1J17T 1UVPA 4CRCA 2OBQA 1G3DA 1V2RT 5B6OA 1CSOE 2KAIA 4DW2U 3SU1A 1HCGA 1QL9A 8GCHF 3V12A 4D7FA 1Y8TA 4D8NA 4WWYA 2ODYB 2FOGA 2PTCE 3ZVGA 1TMUH 5I25A 1AMHA 2CN0H 3ZZ9A 2KAIB 2P16A 3URCA 5DP5A 1TYNA 1AI8H 1ZTKA 2R0KA 1O3PB 1A3BH 3A81A 4NZQA 3NZIA 1Y3XA 3RXQA 2ZGCA 3T62A 4CRGA 2BLOA 4MPWA 4I33A 1O3BA 1O2YA 1DT2A 4O97A 4IGDA 2BXTH 1P01A 3ODDA 1NTPA 2YNAA 1HV7A 4YLQH 1GHZA 2A7JA 4MNVA 4Y6DA 3P6ZB 2VVUA 4B75A 3P8NA 2THFB 1C5TA 2WYGA 3LGIA 3FANA 3V0XA 3BG4C 3RP2A 1ZPCA 3Q76A 1GJAB 3UPEA 1FY1A 1XUHA 2D1JA 3DFJA 1SGEE 4FUHA 1NN6A 1OYQA 2BD9A 1DDJA 3QGJA 2D26C 2A5AA 1MD7A 4AGJA 1OP0A 4ZKRU 1IHSH 2RCEA 2ZU4A 1CVWH 1XUJA 3A7YA 1QQUA 5DGJA 3RXCA 1C4U2 1ZRKA 1K2I1 2BB4A 4U2WA 4AFUA 5AFYH 3BTFE 5E0JA 1TX7A 1DUAA 3L33A 3A7VA 4OS2A 4GHTA 4CREA 1NRSH 1LQDB 1SBWA 1WUNH 2J95A 2A4RA 2A32A 4X2WA 1A3EH 1GHYH 4JZ1A 2ZDAH 1EASA 4IN2A 2JETB 1EXFA 1HXEH 3GCHC 4JZFH 5DP7A 4MPVA 5GPIB 3M36A 5A2MH 1T8NA 1P2IA 3RXAA 7KMEH 5AF9H 3SU5A 1SQTA 1CT2E 1GVZA 1HIAA 2V6NA 1H4WA 3MU4A 4U30A 2NU1E 4BXSA 4UFEH 1IQLA 2AGIX 3LGUA 1O5CB 1TNKA 4GVUA 4FXGH 3LGTA 1HIAB 2VU8E 5F8ZA 1BMAA 2F83A 2ZFTA 2BDAA 1BHXF 1Y5BT 3SW2B 1P9UA 2Y5FA 2K7XA 2RDLA 2UWLA 1N6XA 1MAXA 3LGWA 3QZQA 2ZHEH 2G5VA 5C1UA 1P09A 2GMTC 1F7ZA 1WU1A 5CHAB 1TIOA 2P3UB 2VGCC 1CT4E 1LDTT 2XRCA 1DFPA 1A61H 1GCTC 1C5XB 5L30H 3VB5A 5EU8A 1HXFH 1AU8A 1DSTA 5C20A 4D7GA 1HAOH 4F49A 1Q2WA 3F9GA 1ELTA 2BDCA 1V2UT 1MZAA 4UE7H 3SV7A 4A7IB 3T26A 1UK4A 3BIUH 3OU0A 5DP3A 4BAOB 2XWBI 1CGIE 2BYAX 1GJ5H 2M5TA 5DPAA 3F9FA 3KCGH 3A8BA 1QBNA 1UTMA 4TPYA 1O2HA 2Z9IA 1G3EA 1U6QA 2G4TA 3P8FA 2SNWA 1S83A 1DXPA 5EQQA 1QJ7B 3SNDA 1QFKH 1PPFE 1PFXC 3L3TA 5HMAA 1O33A 1VCPA 1HDTH 1YP9A 1NRRH 2Z9GA 5EXMA 1LVYA 1O2NA 1O30A 2TGAA 3ZZ8A 1HAPH 1V2LT 2CF9H 2G81E 2BX4A 4GAWA 3RXSA 5SGAE 1J15A 1ZPZA 1GI9B 4Y7AA 4X6PA 3ZZAA 3EYDA 3U69H 1AVXA 5GDSH 3VGCB 1NZQH 1NFUA 1AWHB 4ZH8A 4GLYA 4Y8YA 3MTYA 4LK4A 4CHAB 3OYPA 3ZYDA 1SLVB 3PM3A 4D9QA 1ESAA 1PPEE 1SQOA 2XYAA 2XC5A 2QC2A 1AGJA 2D2DA 1MKXH 4DCDA 4Q7XA 2A31A 1AHTH 1P8VC 4O9VA 4E06H 1O3OA 4I8LA 1RRKA 1DY9A 3BTTE 1XXDA 2ZDNA 4YZUA 3SU0A 1D9IA 3SO3A 1GGDB 3VB3A 3UTUH 1DOJA 1E38B 2CJIA 1CBWB 4A6LA 4J1YA 1C5WB 4AB9A 1K1NA 1P11E 5FBEA 3RXUA 3ATWA 2ZTZA 1UCYE 4K5ZA 2A7HA 4A92A 9LPRA 4THNH 1L1JA 7GCHF 3TGIE 1S5SA 5T3HA 3PTNA 1DE7H 1AN1E 1BTWA 3KL6A 1GBFA 2GT8A 3H5CB 3SI3H 3D23A 1SSXA 3RXFA 4MTBA 1TNGA 6GCHG 4UEHH 3LOXA 1ELVA 2GV7A 4IC5A 2O8UA 1AB9B 2STBE 1D3TB 3AAUA 1N8OB 3SZNA 2BY9X 1O2XA 2ASUB 5DO4H 5FPTA 1ESTA 5DP8A 4XBDA 1SFQB 4INLA 1YCPK 3UY9A 1O3JA 2Y7ZA 3RC4A 1GI1A 2PKSB 4FUEA 1FY8E 1ZLRA 1O2IA 1V2NT 1S6HA 4FUBA 3RMMH 1C4Y2 1NRQH 1JMOH 1H9LB 2OUAA 1UHBA 1K9OE 1W2KH 1W7XH 4CH2B 2BDIA 2XBWA 1LKAA 2LIZA 2JETC 1F92A 3SUFA 1SOZA 2GKVE 5FX6A 3U9AH 1FJSA 1C5VA 1INCA 4Z0KA 1G2MA 1UHBB 3TK6A 1GBIA 2Y82A 2VINA 3RMNH 5EW1H 3A85A 3EDXB 2VVVA 1TPAE 1C2IA 1O2PA 2Z7FE 1TX8A 1W11U 2ZDMA 1P9SA 3SV2H 1GJ8B 3EQ0H 3MO9A 4WVPE 4BAHB 4WXIA 5ESBA 2Z9KA 1ETSH 1A0JA 1ZTLA 1C5QA 4JCNA 3KQEA 1IQGA 4KTUA 3PMAB 3A84A 2BDYA 1LHGH 1GBHA 3ELAH 1T8LA 5GCHG 1HGTH 1IAUA 4MNXA 1BT7A 3SU4A 2ZFPH 5AHGH 5CHAC 1MCTA 3MNXA 1EZXC 1VITH 2JH5D 4CBOA 3GY8A 2HPQH 1GMDF 1TABE 5TCCA 3P17H 1HLTH 4K69A 1FONA 2ODQA 1PYTC 1ZSJA 1YCPH 1G32B 3D62A 2PGQB 2ZFSA 1IQEA 2QXIA 2FX4A 2QGRA 5JPMH 2WPKS 5E2OA 1DWCH 2A5IA 3ATKA 2GTBA 3O8BA 1EKBB 3HGPA 1O37A 5E0GA 4AOQA 5EODA 4NIYA 2UWPA 8LPRA 4KKDA 1ZSKA 2OC8A 3T27A 1PPBH 1A4WH 3RM0H 1O2LA 2AMPA 3OY5U 1ZSLA 4YLUA 3LC3A 3MI4A 3NCLA 2B7DH 2ZPSA 4A5TS 1Z1JA 3BEFB 3AVZA 1C2JA 4Y71A 1DWEH 1XM1A 3EBNA 4MG3A 1QRXA 3LC5A 1V2OT 2BM2A 1TQ0B 2ZPQA 3VGCC 1UVTH 5LH8A 1IOEA 2FP7B 2ZDVH 2ZEBA 3E0NB 3SHCH 1QURH 2OTVA 2G4UA 5EPNA 4OS7A 4WH8A 3PMBB 2P3TB 2UWOA 4CHAC 3GY6A 1JIMA 2ZZUH 4X8VH 5EQSA 3SV9A 3T25A 5HYOA 1J14A 1LHFH 2J9NA 1YPJH 2P3FH 4NIVA 3VEQB 3V3MA 2ZCLP 1GBBA 2NWNA 3GY3A 1EAXA 1V2JT 1GGDC 2XNIA 2QF0A 2Z3DA 1PPZA 4I31A 2GP9B 1L4ZA 3F9EA 1CBWC 2FOBA 1EP6A 4R8TB 1SOTA 1Y3YA 2EI7A 3VPKA 2HOBA 1XUIA 2PUXB 4E7RG 1P2KA 4TY7A 1VCWA 3RXHA 1K1JA 3M35A 4X6MA 3MO3A 1KXFA 1LVMA 2FLBH 1P06A 2H5CA 1ZMLA 1ABJH 3GDUA 2TBSA 3QDZB 1GMCG 3MH7A 4X2YA 4K1EA 1YYY1 2ZIQH
chains in the Genus database with same CATH superfamily
2YOLA 2ALPA 1FY4A 2BD7A 4CRAA 4TSFD 1AB9C 3DHKH 1BMLA 2AMDA 1N8OC 3E91A 4RT1A 3NK8A 5T1VA 1N6YA 2GCHG 2R3YA 3QWCH 4TYDA 1QL8A 1KSNA 1AO5A 2GDEH 2UUFB 1QQ4A 4ABHA 2R2MB 3SU3A 4RI0A 2OD3B 2OQ5A 2PKSC 2FDAA 1NU9A 2C4FH 2ZU3A 3ESTA 2SNVA 2VIQA 1GJ9B 1UTJA 2O8MA 1SMFE 4JMYA 4KTSA 5TCAA 3LDXH 4UFGH 3SNBA 1ZHPA 5K0HA 4INHA 1OWIA 3ATMA 1E0FD 1GDNA 1ELCA 1S0QA 3UQOA 5F6MA 4BXWA 1VITG 1C2KA 1XX9A 1QGFA 2AERH 1O3EA 2C93B 1P2MA 2FEQH 3CENA 3RXJA 2JH6D 4Y76A 1RS0A 3H7OA 5T6FA 1TNHA 4AYYB 3LJOA 2ZHWH 1GWAA 1BJUA 1K1OA 3E16B 5C3NA 1BUIA 2QA9E 2J92A 2EY4C 2P8OB 3BTDE 2HWLB 1ANCA 4WJG2 1ELEE 3QK1A 3AW1A 5ETXA 2B5TB 2BOHB 1W8BH 3FZDA 5LPEA 1GI0A 1RTKA 2AIPA 4M9FA 3ZV9A 4GCHG 2G52A 1WCZA 4UD9H 2CXVA 1QHRB 2V35A 4X8SH 1XUKA 1E37B 2AMQA 1BTUA 1RIWB 1EZUC 2I6QA 1B0EA 1TRMA 2F9VA 1THRH 3SJ9A 4CRBA 1GCDA 2ZG0H 3MNSA 3HPTB 3MYWA 1NT1A 4FVBA 4HZHA 4IS5A 3SV6A 3A7ZA 3W95A 1T7CA 4R0IA 1C5NH 2TGDA 2V3HH 3TU7H 5JBAS 1F5KU 1O2GH 1H1BA 1D3QB 5DN6D 1O2KA 1SGIB 4FUIA 5AFZH 4E05H 1GG6B 2GJGA 2K8IA 4Q4LA 5CHBA 1GBJA 2PSXA 4JYVH 1T32A 1C1OA 3ZVBA 3GYLB 4FUDA 1L0ZA 2BVRH 2WYJA 3PROA 2ANKH 1TWXB 3KYFA 1FIZA 2ANYA 1LHEH 2CK3D 2KX4A 1BA8B 1ID5H 1TPPA 5FHTA 4YOIA 2CHAB 3EGKH 1C1NA 2A4QA 1P2QA 2FO9A 3BSQA 1C2EA 3M3TA 4DVAU 3TGKE 4ZAEA 1RTFB 4TWYA 5JBCS 3S7HB 1YPEH 5FPSA 5B6LA 2BD3A 1DWBH 1TMTH 1DPOA 2A45B 1C5OH 1O31A 2HVXA 2IPHA 1OYTH 2Q6GA 3BG8A 2G51A 1KDQA 1O3CA 4HI3A 2F4LA 1QCPA 3RLWH 2ZDLA 3E8LA 3PLBA 1GHAF 2Z9LA 4AX9H 1KDQB 3VFEA 1GJ6A 3IG6B 4YXWD 1DVAH 1QB1A 3KQ5A 1E34B 1MTNB 3F68H 3G01A 5G4BA 1C2LA 3FZZA 5C2ZA 1GBTA 1QIXB 4KTCA 1B0FA 2FXRA 1UTKA 2HNTE 1EATA 1WYKA 1MZDA 2FYRA 1GBEA 1LHCH 3CS0A 1JIRA 1K1PA 1O5BB 3P92A 2BD4A 2ZC9H 4KP0A 3RXTA 1YBWA 3SUDA 4ABDA 2FMJA 8ESTE 2H2ZA 2J34A 2HVYB 1C5PA 1E79D 2ZHFH 3BV9B 1ZOMA 5LPFA 2BLWA 4X6OA 4SGBE 1AVGH 1JXPA 4ABEA 1AUJA 2STAE 3PWBA 3GS9A 1DICA 2QYIA 5A0CA 3BF6H 1KXDA 1A0LA 3F0PA 4NZLA 3RXBA 1XKBC 2PSYA 2ZCHP 1O34A 2HNTF 2BY6X 3STIA 3U8TH 2VWOA 3LH1A 4VGCB 4AN7A 3P95A 1V2QT 1O5FH 1MABB 3TJNA 1H9HE 4XDEA 3TJUA 2F9OA 3DSPA 4ISOA 4K1SA 7LPRA 1FDPA 1YPHC 2PHBA 3OX7U 3O8DA 4X1PU 1W0ZU 2DE8A 1GVKB 2VIOA 1UTQA 1BOQA 1BRUP 1TRYA 4IC6A 4Y0ZE 1ELBA 5L2YH 2WPLS 5JB8S 1S81A 4XBCA 1V6DA 3V7TA 4MPUA 3CS7A 1MH0A 1QB9A 1YGCH 4ABGA 2ZNKH 5J4QA 1EQ9A 4ISLA 3UR9A 1SGDE 5C94A 2BOKA 2FOCA 5FBIA 1GMHF 5I46H 2PUQH 4E7NA 5A0AE 1TNIA 2P8OC 1NRPH 2BD2A 3RDZA 4HGCA 2LNCA 4NA7A 1AQ7A 1EAIA 1V2ST 4M7GA 4BTIB 4X2XA 1DLKB 1UVOA 2NU4E 3KHVA 1TONA 1PPHE 4Q7YA 4NSVA 1GI3A 3UQVA 4FU8A 1LTOA 4OS6A 3TVJB 4ZMAH 4HG6A 1YPKH 4IBLH 1RIWC 2H5DA 4NG9H 2WPIS 5E0HA 4I8GA 5T6DA 3MQKC 4NIWA 2C3SA 1TNJA 2VBCA 5C0UA 1ZHMA 1LPKB 1MKWK 2ODPA 2WPMS 2GV6A 1T8MA 4ZKNU 1AFQB 2TGPZ 1O3LA 2BY5X 3I29A 3RXPA 1EPTA 2WINI 4DGJA 4NA9H 1AZZA 1SC8U 3SI4H 8KME2 1GG6C 3S0NA 5FXLA 3GISB 1OWEA 4FUJA 2F9BH 1GVLA 3ZZ7A 2A5KA 5C1XA 3FFGA 1D3DB 1O5GH 4I8KA 1GL1A 2CGAA 2PLXA 4IMQA 2GD4B 1ZHRA 5GWZA 2FIRH 4ACBA 1TGCA 3OTPA 2BX3A 3OAAD 1P10A 6LPRA 1ZMJA 2FOFA 3D49H 2R2WU 2CHAC 5EPYA 3RXMA 1O2MA 3BN9A 2WV9A 1AUTC 3GCTF 5HGGA 1TGSZ 4Q7ZA 2K0QA 3RXLA 1SGNE 1DSUA 1MU8B 1Y3UA 4ZUHA 3M5MA 1FIWA 2F43B 3A82A 4YOJA 3TH2H 2Z94A 2GX4A 3M5NA 9ESTA 1W12U 3N7DA 2ZGJA 3GCOA 2H9HA 2P95A 3M61U 1SGCA 3O8RA 5PTPA 5FCRA 1UTNA 1QY6A 5C5NA 1ELDE 3FP6E 1RXPA 5C1YA 2FS8A 3RC5A 2EQNA 1D4PB 1LVOA 1AE8H 1S85A 1VJ9U 3UFAA 1A1RA 1G36A 3RM2H 2XC0A 1MKWH 1EJAA 3PLPA 1O3IA 1Z8RA 3ZZ3A 1K1MA 1LO6A 1C2GA 2EEKA 1QA7A 3A7TA 1Z7KA 1NBMD 1ELFA 1NC6A 1SGYE 3HK3B 4AGKA 1MTNC 3EAJA 1C2HA 1EB1H 3RMOH 2WV5A 1C1QA 1CHOF 1UK3A 1QL7A 2O8LA 8GCHG 3KF2A 1TA6A 3SNEA 2BMGB 3FVFB 4I86A 5F8TA 1MD8A 1TOMH 3S69A 3U28C 3M3VA 1BZXE 1C5LH 1OS8A 2GCTB 2ZECA 3M7UA 3EA7A 1C1WH 2JIZD 1B5GH 1SLWB 1TQ7B 1FLEE 4IN1A 2FI4E 3A8AA 4DT7B 1OP8A 2GT7A 1AZ8A 4K60A 3I78A 3HKIB 1RFNA 4X1QU 2F3CE 1BHXB 1FPCH 3FP7E 3KQCA 4RKOB 1GHBF 4VGCC 3SU2A 1O2ZA 1A5GH 3RXDA 1BB0B 3KNXA 5DJ7A 3MNCA 4AFQA 1BTHH 3OTJE 2PP6A 1BRCE 1H9IE 4OS1A 1RD3B 2F9NA 1ZRBA 1GI6A 1OPHB 2ILNA 3D65E 2Q1JA 4F55A 2WHXA 2FS9A 1WTHD 2JH0D 1GL0E 1CGHA 4YESB 5JYIA 1ZTJA 6ESTA 4OGYA 3SJ8A 2Z3CA 4K1TA 5IDKA 3RUOA 4AYVB 4B76A 3GY2A 2OCVB 1FUJA 1HYLA 3TIUA 1K21H 3QX5H 5CDFE 2WPJS 2Q6DA 5A09A 3OY6U 3SUEA 2A1DB 4YOGA 3DA9B 3DFLA 4B6FA 5GIBA 4Y79A 1GDQA 3N7EA 1CA8B 1TX6A 3WY8A 1QJ1B 3NXPA 1HPGA 3NWUA 1W10U 5JB9S 1FV9A 1FAKH 1QRZA 3K9XB 4ZXXH 4BANB 1FZZA 2TGTA 4UONA 4MNWA 4F4OC 1FX0B 3BTWE 1O39A 1DWDH 4RT0A 4YTAA 3GOVB 2KCOA 3S7KB 3AAVA 5EGMA 1J16A 1D6RA 1Y5AT 1EZSC 2EI6A 1HJAB 3IITA 3VB4A 4K8YA 1UVSH 1IQHA 4ZKOU 2BQ7B 3LKWA 2LELA 1SG8B 2QF3A 1C2FA 4JYUH 1PYTD 1AFQC 4XBBA 3U98H 5EW2H 1VJAU 2FESH 3UNRA 4AC9A 3QUMP 3RXEA 1ZPBA 4WMFA 1GBKA 1HFDA 1QTFA 3E6PH 1C5YB 1GJCB 3DSOA 1P2OA 2CMYA 3TK9A 4H42U 4A1VA 2A4GA 4RKJB 1MAYA 1MTSA 2W5EA 4X8TH 2JJ2D 3MOCA 1NFYA 4AZ2B 1L1GA 2BQ6B 2OP9A 1RGQA 1LQEA 2XBXA 1B7XB 3SJIA 3NUMA 1LCYA 3SU6A 3CNRA 4GHQA 1QJ6B 2QV1A 3R3GB 3S9BA 5C5OA 1BTZA 1IQJA 2B9LA 3LGYA 5EQRA 3T2NA 3UREA 3ZZDA 2A7CA 1E1QD 3KEEA 2I6SA 3PYHA 1O2SA 5GXPA 3EA9A 3MNBA 1QNJA 1KIGH 4CR5A 3LPRA 2OQUA 5HIZA 1YM0A 1L4DA 3ZVDA 3TPIZ 1C2DA 2XNDD 1YC0A 3OSYA 2C90B 3DT0H 2YMSD 3PLKA 1GBAA 1K22H 2TRMA 5A8ZA 1QRWA 1NY22 4Y7BA 1EOLA 4LZ1H 5FX5A 2W3IA 5C67A 1EP5A 2BVSH 5HKKD 1SQRA 1TBRH 2J38A 2KCAA 1NM6A 2OC1A 3CP7A 4ISHH 2OXSA 4BTUB 1O2VA 1TOCB 4DURA 1EJNA 4P02A 1MTUA 1OP2A 1WV7H 2OC7A 1TFXA 2AS9A 2EI8A 4MVNA 2XTTB 3ZV8A 1O3MA 3A87A 1TGTA 2PV9B 1P0SH 1J8AA 2VWLA 1KY9A 2G5NA 5GNDA 2GCTC 1Q3XA 4BNRA 1NFWA 4I7YH 1DLEA 2PGBB 3DCLA 1OOKB 3RU4E 4FUGA 5K7RA 2VIWA 1SQAA 2ZTYA 1SHYA 2G55A 3MU5A 1Y3WA 2QXGA 2RG3A 1O2WA 1N1LA 3GY7A 4FOUC 1WQSA 4FUFA 3MFJA 2F9UA 5EIYA 1ANDA 4XSKU 2ULLA 2HPPH 2ZGBH 4JZIA 2OK5A 1BBRK 4B6EA 3TH4H 1O3HA 2AFQB 2AEIH 3URDA 1DM4B 3A7XA 2ZU1A 1F0UA 1GBLA 4PROA 1FNIA 3M7QA 1HAZB 7GCHG 1SVPA 3UNQA 2C8YB 5A8YA 3UAIC 4ABFA 3M7TA 2QF4A 4YT7H 1ANEA 3SNCA 3ZZBA 2Y6TA 3BTQE 3ZYEA 1X7AC 3F2GA 2ANWA 1Z6EA 3SNAA 1HAXB 1ZR0A 4JK5A 4U01A 4UFFH 4I32A 1GCTB 1O3DA 4LXBH 5A0BA 1GHXH 1SLXB 2QAAA 3QLPH 1LPZB 1ANBA 1GJ4H 1P04A 3QTOH 4DOQA 1O38A 3P70B 3RLYH 1W7GH 3RXKA 1DXWA 1VR1H 5C0TA 2A2XH 1XXFA 4NIXA 4WH6A 2DUCA 2UUJB 1OX1A 2FM2A 3PTBA 1EZQA 2ZFQH 4INKA 1JRSA 1Y59T 4H6TA 3TJVA 4Q80A 3ZZ6A 1NS3A 2RDEA 2HGTH 4B73A 1MQ6A 4CRDA 2A2QH 3A88A 2IJD1 4J2YB 2ZO3H 1SLUB 4Y0YE 3IWMA 2BDHA 1UJ1A 3PRBA 4UDWH 3BEIB 4NWLA 2PKAA 4K2YA 1BTPA 2GZ7A 1E35B 3TK5A 5IYTA 1GJBB 1BTYA 2ZHQH 3LJJA 2D8WA 1HJAC 2FTMA 1BBRH 1KXEA 1C9TA 2BZ6H 1NROH 2PKAB 1HAYB 2ZTXA 5E2PA 1T4UH 1T4VH 1CU1A 3GDSA 3R0FA 4QT8C 1HAVA 1Z1IA 2HLCA 1RJXB 1YPGH 1FN6A 1PQ8A 3E1XB 3HKJB 1IHTH 1XVMA 7ESTE 4TPIZ 3UUZA 1CGJE 1C1VH 3SGAE 1HAVB 2ESTE 6GCHF 1MCVA 2ANMH 3VXFH 1O3AA 1C1MA 4B1TA 1TLDA 4D76A 2ZKSA 1PQ7A 1EAUA 3T29A 4LZ4B 2BXUH 1GMDG 4O3TA 3SGBE 4XOJA 1EB2A 3MU1A 2GDDA 1TRNA 3F6UH 1PQ5A 4AORA 1C5MD 5LPRA 1H8IH 2FODA 1G3BA 3C27B 2QIQA 1G9IE 1LKBA 4ASUD 1GJDB 3KIDU 2BY7X 4A1XA 3EE0B 1ORFA 2P94A 1YF4A 3H09A 1MBQA 1JWTA 1BCUH 5EOKA 1SPJA 3TNSA 2BTCE 4ZXYH 3ITIA 1OSSA 3A89A 3Q00A 1AD8H 1QBOA 2BY8X 2W6ID 1YPLH 1OWJA 4DY7B 1E1RD 3BTEE 4GSOA 1BDAA 4BAMB 4ZROA 1TNLA 3A7WA 1OWKA 1V3XA 3GCNA 1ESBA 4WF8A 1FQ3A 1G30B 2GGVB 3ATIA 1D3PB 1HAIH 1G2LA 1NU7B 1Z71A 4TWWA 1OWDA 5EXLA 1SL3A 4U32A 2BLVA 3GY4A 2GZ8A 1PQAA 1O2RA 3DD2H 2Z3EA 5GCHF 4HTCH 3Q3YA 2B0FA 2ZDKA 4Z6AH 1CO7E 2XW9A 1TPOA 3SGQE 3SOSA 1ZJKA 4I8HA 1EUFA 2PTNA 1CQQA 5AVDA 5DP9A 1NFXA 1W14U 1COWD 1SGFA 2VIVA 3HGNA 3LT3A 4ZCNA 1XVOA 5DK1A 3GYMA 1C5UA 1OKXA 3SJKA 2ZFFH 4MPXA 2WSSD 2BVXH 4ABJA 1SGRE 1V2TT 4KGAA 4MLFB 2RA3A 3I77A 2UUKB 1O2UA 3MH6A 3SQHE 4AG1A 2SGAA 2QXJA 3TGJE 2KCPA 1LHDH 2ZPRA 1KXAA 1W3CA 3V13A 1GBMA 2FOAA 2IOTA 2VWMA 1Y3VA 4Y10E 1XUFA 1BJVA 1YLNA 3AW0A 1JBUH 1O3GA 5DP4A 3S9CA 1S84A 2BLQA 3SV8A 4YM9A 1C1TA 3O8CA 3E90B 1G37A 1QR3E 2CV3A 1P3EA 3PO1B 2BD5A 1DANH 1HAHH 2C8XB 4CBNA 1RTLA 5F03A 2ZU2A 1GI4A 3B23B 1P3CA 4UFDH 1WAYB 3SJOA 3RC6A 1MU6B 2QY0B 3LGVA 3EA8A 4WMEA 3WWFA 3F9HA 2R9PA 4CRFA 3U1JB 2OC0A 2VH0A 5ABWA 3FAOA 2SGPE 1IQKA 1T31A 1YPMH 2ZWLH 2SFAA 3P8OA 1P2NA 2W7UA 1GBCA 4K3JA 2ZGHA 1SKYE 3E3TA 1HJ8A 2AYWA 3JZ2B 4JYTA 1FAXA 3A86A 1ETRH 3OEED 1MKXK 1BRAA 1H8HD 1LMWB 3TITA 1EJMA 1TALA 2A0QB 2Y5HA 2ZI2H 1GI5A 3SORA 4AB8A 3TLOA 4IMZA 2QCYA 4AFSA 1SB1H 4BAQB 1P57B 1TA2A 1W0KD 4NA8A 3UOPA 1UVUH 4XE4A 1PPCE 1C5RA 1WTGH 2XC4A 1C1PA 3TJOA 1NPMA 2QN5T 2NU2E 1Z8GA 1CT0E 1YKTA 1ABIH 2R3UA 2XXLA 1FPHH 1EPTB 1W0YH 1SGFG 4FU7A 1THPB 2QF5A 4ABAA 2AHME 3UNSA 2F9PA 4YO9A 2O8WA 5FL7D 3E0PB 2VJ1A 2PFEA 5ESTE 2SGDE 1UTPA 1O2QA 2BZAA 3M37A 4JZEH 3ZVCA 6CHAB 4AG2A 2WUCA 1L2EA 2FI5E 2G00A 2ZHDA 2P59A 1ARCA 2FPZA 1UK2A 3UWJH 2OINA 1A46H 1BMMH 1C9PA 4O03A 3QO6A 1MMJN 2Y7XA 2VNTA 1GMCF 1HNEE 1VKYA 1OHHD 1O3FA 1TBZH 4BTTB 2J4IA 2H9TH 5JDUB 3JZ1B 1AY6H 4CR9A 2V3OH 1ARBA 1S0RA 2BD8A 2GCHF 1SHHB 4B71A 3MMGA 5F8XA 5EJ1A 1L1NA 1C1SA 2HRVA 2V3MA 2Y80A 4Q2KA 1C4V2 5C17A 3N99A 2ZFRH 1ACBE 1TBQH 4X8UH 4MQAA 1SGTA 3NKKA 1JRTA 3MU0A 3F1SB 3TH3H 1XMNB 3AK5A 1MUEB 4ISIH 1GJ7B 3UB0A 2XCNA 4XFQA 1C1UH 3P8GA 2RFKC 2BDGA 4KELA 2FWWA 5EXNA 1C2MA 1VITF 3W94A 1LVBA 1O5DH 3Q77A 3MO6A 3U8RH 5A8XA 2HALA 3RXVA 2O8TA 4X1SU 3MU8A 4ESTE 1S82A 3VB7A 1PPGE 3S9AA 5LGOA 3AASA 1FI8A 3K65B 1CA0B 1TGNA 1KYNA 2WV4A 4XD7D 2BHGA 3L6PA 2CF8H 1IQFA 1MQ5A 1VGCB 3RXOA 4B2AA 1YPHE 2RA0A 3BTHE 1V2VT 4GCHF 1BRBE 2ZU5A 1O2TA 4OM9A 4X0WU 2XBYA 5JBBS 1G3CA 4BOHA 1UCYK 2KFWA 2ZA5A 1W13U 4ISNA 1O5AB 1FY3A 2W7SA 1UO6A 1TE0A 1O3KA 1MTWA 1XKAC 4YT6H 1ZMNA 5HXFA 1ETTH 1GHAG 1MBMA 1DX5M 3N7OA 2LPRA 1GPZA 1MTVA 1GDUA 2FOEA 1K1LA 3F0OA 1Z8IB 2VH6A 4JZDH 1THSH 3OEHD 5E8EH 1J9CH 2YNBA 1GHVH 5HM9A 4DIIH 4Y8XA 3U8OH 1VZQH 2GVFA 3LU9B 1V2KT 3NPSA 3PWCA 1O35A 1WQVH 3VB6A 4WXVA 1D6WA 2OBOA 3BEUA 1K1IA 1P02A 1VCQA 3PO1C 4X1RU 2WZQA 3B9FH 3UWIA 3KQBA 3RU4D 4D9RA 5TJXA 1JOUB 1BIOA 4ZKSU 5FPYA 1TPSA 3DSGA 3SHAH 3KGPA 3RMLH 4H4FA 1GHWH 5L6NH 1EX3A 1DUEA 2XCFA 2ZQ1A 3PV4A 1AFEH 3GY5A 2C8WB 3F3BA 3BTGE 1WBGB 3ZZ4A 2NU0E 1WSSH 2BDBA 2H9EH 3MH4A 4DJZB 4OS4A 2FI3E 1M9UA 2VB0A 1GBDA 3LIWA 1QA0A 2IPQX 2TPIZ 2KCYA 2K1QA 1FXYA 3GDVA 2H6MA 4NSYA 2FLRH 2J94A 1A7SA 2IJOB 1UCYH 1O3NA 4ZHAA 1SGPE 1DITH 1QBVH 3STJA 2Z9JA 1BTXA 4FUCA 1C1RA 1KXBA 5L2ZH 2SGQE 2ZGXH 3PV2A 3U1IB 1P03A 5H4IB 1V2MT 2V0BA 1UMAH 3QZRA 1V2PT 2F91A 5T6GA 2VWNA 1EPTC 2EA3A 2FYQA 4ABIA 3A8CA 3SN8A 1BMFD 1OXGA 1C5ZB 1F0TA 2W3KA 3KN2A 4FU9A 3WW7A 3LH3A 1EOJA 3RXGA 4BAKB 3HATH 1GMHG 2AIQA 3SQEE 3ZVFA 4A1TA 4GPGA 2KR7A 1EFRD 1KLIH 6CHAC 1NESE 1IQIA 4K8BA 2H1UA 1A2CH 3BTME 1SFIA 2R0LA 4ABBA 1C5SA 1HUTH 5F53A 4MNYA 4JK6A 3WWBA 3VXEH 4X6NA 1SGQE 1KLJH 2Y5GA 2ZQ2A 3T5FH 5EJLA 2KZ4A 2FTLE 5FAHA 3ZZCA 3OFND 4NCYA 3RU4T 5DP6A 4CH8B 5DG6A 1IQNA 1E36B 1T8OA 2J2UA 3A83A 1QZ8A 1LPGB 4WMDA 2W6JD 2PWXA 3BG4B 5HM2A 4NFEA 5CMXH 3NRLA 2ZF0H 2OLGA 1SR5C 1BQYA 3K2UA 3MWIU 4Y11E 1KLTA 1O5EH 4DG4A 1TGBA 2O9QA 1ZYOA 1UTLM 4NGAH 5CE1A 1QB6A 2Y81A 3ZZ5A 3A80A 3ENSB 3M5OA 4ZHMU 1CE5A 2AGGX 3PMJA 1DS2E 1W0JD 2W26A 5BRRE 1BBRE 1ELGA 1O0DH 2QXHA 3PB1E 3QTVH 2PR3A 3K6ZA 1PJPA 5J4SA 1AIXH 1AE5A 1A5HA 1NO9H 3MH5A 3QN7A 3BTKE 3GCTG 1Y5UT 1A0HB 2TIOA 2BQWB 2HNTC 1CA0C 1EAWA 1Z8JB 3W1EA 3C1KA 2ZP0H 1F2SE 1F5LA 3GCHB 2B8OH 2P93A 3MHWU 2EC9H 3SBKA 1VGCC 3B8JA 3M3SA 1AKSA 1F0RA 1F5RA 4Y8ZA 2FZZA 2VVCA 4HFPB 1YCPM 2VIDA 2PW8H 3UR6A 4ASHA 3RXRA 4TY6A 1AKSB 1AVWA 2SGEE 4LOYH 1Q31A 2AGEX 1KXCA 1S6FA 3K6YA 3ODFA 1GI2A 2FOHA 1IQMA 2UUYA 1A5IA 4B74A 1HRTH 3UIRA 1HBTH 1NRNH 1O32A 1ZGIA 2SGFE 2G8TA 3UOUA 3PMHB 4XRNA 2GMTB 1KTSB 3ZVAA 1BITA 4ZHLU 1CHOG 1O2OA 3ATLA 2VGCB 1AWFH 5BPEA 1K28D 2C8ZB 1GI8B 1P12E 4RSPA 1BMNH 4AFZA 3ZVEA 3FP8E 3RXIA 3KQDA 1GI7B 4SGAE 1YLDA 1H8DH 1HAGE 2DE9A 4B2CA 2WPHS 1OWHA 5DKMA 1HB0B 1P2JA 2WUBA 3SUGA 1SI5H 3FO8D 1WOFA 5GJ4B 3Q3KA 1ZJDA 4WY3A 1ZZZA 2AH4X 4GUXA 3M5LA 1YLCA 1DY8A 4H6SB 1TAWA 2XBVA 1XUGA 3LONA 2JKHA 2Z6BD 4I8JA 1KTTB 2A4OA 2FX6A 4DIHH 5JBTA 3A8DA 4FVDA 3BIVH 1GHBG 1TB6H 5EG4A 1FMGA 1V2WT 4B2BA 3QGNB 4X1NU 1F0SA 2GZ9A 4MDSA 1UTOA 1O36A 5FCKA 3GICB 1O2JA 3T28A 3H7TA 1CHGA 1HJ9A 3FN8A 1ZGVA 4OGXA 3DUXH 1FY5A 2ALVA 1Z6JH 1FN8A 3Q3XA 4O3UA 4P00A 3HK6B 2IN2A 4RN6A 4OS5A 3TNTA 4NWKA 1TMBH 2VIPA 2XWAA 4NFFA 2ZCKP 2NU3E 2Q6FA 1ELAA 4IW4E 1P05A 4X2VA 2FOMB 1J17T 1UVPA 4CRCA 2OBQA 1G3DA 1V2RT 5B6OA 1CSOE 2KAIA 4DW2U 3SU1A 1HCGA 1QL9A 8GCHF 3V12A 4D7FA 4Q63A 1Y8TA 4D8NA 4WWYA 2ODYB 2FOGA 2PTCE 3ZVGA 1TMUH 5I25A 1AMHA 2CN0H 3ZZ9A 2KAIB 2P16A 3URCA 5DP5A 1TYNA 1AI8H 1ZTKA 2R0KA 1O3PB 1A3BH 3A81A 4NZQA 3NZIA 1Y3XA 3RXQA 2ZGCA 3T62A 4CRGA 2BLOA 4MPWA 4I33A 1O3BA 1O2YA 1DT2A 4O97A 4IGDA 2BXTH 1P01A 3ODDA 1NTPA 2YNAA 1HV7A 4DT4A 4YLQH 1GHZA 2A7JA 4MNVA 4Y6DA 3P6ZB 2VVUA 4B75A 3P8NA 2THFB 1C5TA 2WYGA 3LGIA 3FANA 3V0XA 3BG4C 3RP2A 1K0HA 1ZPCA 3Q76A 1GJAB 3UPEA 1FY1A 1XUHA 2D1JA 3DFJA 1SGEE 4FUHA 1NN6A 1OYQA 2BD9A 1DDJA 3QGJA 2D26C 2A5AA 1MD7A 4AGJA 1OP0A 4ZKRU 1IHSH 2RCEA 2ZU4A 1CVWH 1XUJA 3A7YA 1QQUA 5DGJA 3RXCA 1C4U2 1ZRKA 1K2I1 2BB4A 4U2WA 4AFUA 5AFYH 3BTFE 3SZEA 5IK2D 5E0JA 1TX7A 1DUAA 3L33A 3FOAA 3A7VA 4OS2A 4GHTA 4CREA 1NRSH 1LQDB 1SBWA 1WUNH 2J95A 2A4RA 2A32A 4X2WA 1A3EH 1GHYH 4JZ1A 2ZDAH 1EASA 4IN2A 2JETB 2M2AA 1EXFA 1HXEH 3GCHC 4FETA 4JZFH 5DP7A 4MPVA 5GPIB 2WPDD 3M36A 5A2MH 1T8NA 1P2IA 3RXAA 7KMEH 5AF9H 3SU5A 1SQTA 1CT2E 1GVZA 1HIAA 2V6NA 1H4WA 3MU4A 4U30A 2NU1E 4BXSA 4UFEH 1IQLA 2AGIX 3LGUA 1O5CB 1TNKA 4GVUA 4FXGH 3LGTA 1HIAB 2VU8E 5F8ZA 1BMAA 2F83A 2ZFTA 4ACAA 2BDAA 1BHXF 1Y5BT 3SW2B 1P9UA 2Y5FA 2K7XA 2RDLA 2UWLA 1N6XA 1MAXA 3LGWA 3QZQA 2ZHEH 2G5VA 5C1UA 1P09A 2GMTC 1F7ZA 1WU1A 5CHAB 1TIOA 2P3UB 2VGCC 1CT4E 1LDTT 2XRCA 1DFPA 1A61H 1GCTC 1C5XB 3EE7A 5L30H 3VB5A 5EU8A 1HXFH 1AU8A 1DSTA 5C20A 4D7GA 1HAOH 4F49A 1Q2WA 5DSFA 3F9GA 1ELTA 2BDCA 2J98A 1V2UT 1MZAA 4UE7H 3SV7A 4A7IB 3T26A 1UK4A 3BIUH 3OU0A 5DP3A 4BAOB 2XWBI 1CGIE 2BYAX 1GJ5H 2J98B 2M5TA 5DPAA 3KYGA 3F9FA 3KCGH 3A8BA 1QBNA 1UTMA 4TPYA 1O2HA 2Z9IA 1G3EA 1U6QA 2G4TA 3P8FA 2SNWA 1S83A 1DXPA 5EQQA 1QJ7B 3SNDA 1QFKH 1PPFE 1PFXC 3L3TA 5HMAA 4Z1MD 1O33A 1VCPA 1HDTH 1YP9A 1NRRH 2Z9GA 5EXMA 1LVYA 1O2NA 1O30A 2TGAA 3ZZ8A 3OE7D 5KEDA 1HAPH 1V2LT 2CF9H 2G81E 2BX4A 4GAWA 3RXSA 5SGAE 1J15A 1ZPZA 1GI9B 4Y7AA 4X6PA 3ZZAA 3EYDA 3U69H 1AVXA 4TT3D 5GDSH 3VGCB 1NZQH 1NFUA 1AWHB 4ZH8A 4GLYA 4Y8YA 3MTYA 4LK4A 4CHAB 3OYPA 3ZYDA 1SLVB 3PM3A 4D9QA 2YMSB 1ESAA 1PPEE 1SQOA 2XYAA 2XC5A 2QC2A 1AGJA 2D2DA 2L74A 1MKXH 4DCDA 4Q7XA 2JJ1D 2A31A 1AHTH 1P8VC 4O9VA 4E06H 1O3OA 4I8LA 1RRKA 1DY9A 3BTTE 1XXDA 2ZDNA 4YZUA 3SU0A 1D9IA 2L6OA 3SO3A 1GGDB 3VB3A 5EJZA 3UTUH 1DOJA 2V7QD 1E38B 2CJIA 1CBWB 2QE7D 4A6LA 4J1YA 1C5WB 4AB9A 1K1NA 1P11E 2JDID 5FBEA 3RXUA 3ATWA 2ZTZA 1UCYE 4K5ZA 2A7HA 2LP6A 4A92A 9LPRA 4THNH 1L1JA 7GCHF 3TGIE 1S5SA 5T3HA 3PTNA 1DE7H 1AN1E 1BTWA 3KL6A 1GBFA 2GT8A 3H5CB 3FKSD 3SI3H 3D23A 1SSXA 3RXFA 4MTBA 1TNGA 6GCHG 4UEHH 3LOXA 1ELVA 2GV7A 4IC5A 2O8UA 1AB9B 2STBE 1D3TB 3AAUA 1N8OB 3SZNA 2BY9X 1O2XA 2ASUB 5KECA 5FPTA 1ESTA 5DO4H 5DP8A 4XBDA 1SFQB 4INLA 1YCPK 3UY9A 1WXRA 1O3JA 3SYJA 2Y7ZA 3RC4A 1GI1A 2PKSB 3PV5A 4FUEA 1FY8E 1ZLRA 1O2IA 1V2NT 1S6HA 4FUBA 3RMMH 1C4Y2 2HLDD 1NRQH 1JMOH 1H9LB 2OUAA 1UHBA 1K9OE 1W2KH 1W7XH 4CH2B 2BDIA 2XBWA 1LKAA 2LIZA 2JETC 1F92A 3SUFA 1SOZA 2GKVE 5FX6A 3U9AH 1FJSA 1C5VA 1INCA 4Z0KA 1G2MA 1UHBB 3TK6A 1GBIA 2Y82A 2VINA 3RMNH 5EW1H 3A85A 3EDXB 2VVVA 1TPAE 1C2IA 1O2PA 2Z7FE 1TX8A 1W11U 2ZDMA 1P9SA 3SV2H 1GJ8B 1YY3A 3EQ0H 3MO9A 4WVPE 4BAHB 1UW7A 4WXIA 5ESBA 1YWUA 2Z9KA 1ETSH 1A0JA 1ZTLA 1C5QA 4JCNA 3KQEA 2XOKD 1IQGA 4KTUA 3PMAB 3A84A 2BDYA 1LHGH 1GBHA 3ELAH 1T8LA 5GCHG 1HGTH 1IAUA 4MNXA 1BT7A 3SU4A 2ZFPH 5AHGH 5CHAC 4F48B 1MCTA 3MNXA 1EZXC 1VITH 2JH5D 4CBOA 3GY8A 2HPQH 1GMDF 1TABE 5TCCA 3P17H 1HLTH 4K69A 1FONA 2ODQA 1PYTC 1ZSJA 1YCPH 1G32B 3D62A 2PGQB 2ZFSA 1IQEA 2QXIA 2FX4A 2QGRA 5JPMH 2WPKS 5E2OA 1DWCH 2A5IA 3ATKA 2GTBA 3O8BA 1EKBB 3VG8A 2J5UA 1H8ED 3HGPA 1O37A 5E0GA 4AOQA 5EODA 4NIYA 2UWPA 8LPRA 4KKDA 1ZSKA 2OC8A 3T27A 1PPBH 1A4WH 3RM0H 1O2LA 2AMPA 3OY5U 1ZSLA 4YLUA 3LC3A 3MI4A 3NCLA 2B7DH 2ZPSA 4A5TS 1Z1JA 3BEFB 3AVZA 1C2JA 1WDIA 4Y71A 5KGOA 1DWEH 1XM1A 3EBNA 4MG3A 1QRXA 3F2HA 3LC5A 2KM0A 1V2OT 2BM2A 1TQ0B 2ZPQA 3VGCC 1UVTH 5LH8A 1IOEA 2FP7B 2ZDVH 2ZEBA 3E0NB 3SHCH 1QURH 2OTVA 1NBME 2G4UA 1KMHB 5EPNA 4OS7A 4WH8A 3PMBB 2P3TB 2UWOA 4CHAC 3GY6A 1S6LA 1JIMA 2ZZUH 4X8VH 5EQSA 3SV9A 2J97A 3T25A 2YMSC 5HYOA 1J14A 1LHFH 2J9NA 1YPJH 2P3FH 4NIVA 3VEQB 3V3MA 2ZCLP 1GBBA 2NWNA 3GY3A 3ZIAD 1EAXA 1V2JT 1GGDC 2XNIA 2QF0A 3PRDA 2Z3DA 1PPZA 4I31A 2GP9B 1L4ZA 3F9EA 1CBWC 2FOBA 5HIYA 1EP6A 4R8TB 1SOTA 1Y3YA 2EI7A 3VPKA 2HOBA 1XUIA 2PUXB 4E7RG 1P2KA 4TY7A 1VCWA 3RXHA 1K1JA 3M35A 4X6MA 3MO3A 2FLBH 1KXFA 1LVMA 1P06A 3F2FA 2H5CA 1ZMLA 1ABJH 3GDUA 2TBSA 3QDZB 1GMCG 3MH7A 4X2YA 4K1EA 1YYY1 2ZIQH
chains in the Genus database with same CATH topology
2YOLA 2ALPA 1FY4A 2BD7A 4CRAA 1AB9C 3DHKH 1BMLA 2AMDA 1N8OC 3E91A 3NK8A 1N6YA 2GCHG 2R3YA 3QWCH 4TYDA 1QL8A 1KSNA 1AO5A 2GDEH 2UUFB 1QQ4A 4ABHA 2R2MB 3SU3A 2OD3B 2OQ5A 2PKSC 2FDAA 1NU9A 2C4FH 2ZU3A 3ESTA 2SNVA 2VIQA 1GJ9B 1UTJA 2O8MA 1SMFE 4JMYA 4KTSA 5TCAA 3LDXH 4UFGH 3SNBA 1ZHPA 5K0HA 4INHA 1OWIA 3ATMA 1E0FD 1GDNA 1ELCA 1S0QA 3UQOA 5F6MA 4BXWA 1VITG 1C2KA 1XX9A 1QGFA 2AERH 1O3EA 2C93B 1P2MA 2FEQH 3CENA 3RXJA 2JH6D 4Y76A 1RS0A 3H7OA 5T6FA 1TNHA 4AYYB 3LJOA 2ZHWH 1GWAA 1BJUA 1K1OA 3E16B 5C3NA 1BUIA 2QA9E 2J92A 2P8OB 3BTDE 2HWLB 1ANCA 4WJG2 1ELEE 3QK1A 3AW1A 5ETXA 2B5TB 2BOHB 1W8BH 3FZDA 5LPEA 1GI0A 1RTKA 2AIPA 3ZV9A 4GCHG 2G52A 1WCZA 4UD9H 2CXVA 1QHRB 2V35A 4X8SH 1XUKA 1E37B 2AMQA 1BTUA 1RIWB 1EZUC 2I6QA 1B0EA 1TRMA 2F9VA 1THRH 3SJ9A 4CRBA 1GCDA 2ZG0H 3MNSA 3HPTB 3MYWA 1NT1A 4FVBA 4HZHA 4IS5A 3SV6A 3A7ZA 3W95A 1T7CA 4R0IA 1C5NH 2TGDA 2V3HH 3TU7H 5JBAS 1F5KU 1O2GH 1H1BA 1D3QB 1O2KA 1SGIB 4FUIA 5AFZH 4E05H 1GG6B 1GBJA 2PSXA 4JYVH 1T32A 1C1OA 3ZVBA 3GYLB 4FUDA 1L0ZA 2BVRH 2WYJA 3PROA 2ANKH 1TWXB 1FIZA 2ANYA 1LHEH 1BA8B 1ID5H 1TPPA 5FHTA 4YOIA 2CHAB 3EGKH 1C1NA 2A4QA 1P2QA 2FO9A 3BSQA 1C2EA 3M3TA 4DVAU 3TGKE 4ZAEA 1RTFB 4TWYA 5JBCS 3S7HB 1YPEH 5FPSA 2BD3A 1DWBH 1TMTH 1DPOA 2A45B 1C5OH 1O31A 2HVXA 2IPHA 1OYTH 2Q6GA 3BG8A 2G51A 1KDQA 1O3CA 4HI3A 1QCPA 3RLWH 2ZDLA 3E8LA 3PLBA 1GHAF 2Z9LA 4AX9H 1KDQB 3VFEA 1GJ6A 3IG6B 1DVAH 1QB1A 1E34B 1MTNB 3F68H 3G01A 5G4BA 1C2LA 3FZZA 5C2ZA 1GBTA 1QIXB 4KTCA 1B0FA 2FXRA 1UTKA 2HNTE 1EATA 1WYKA 1MZDA 2FYRA 1GBEA 1LHCH 3CS0A 1JIRA 1K1PA 1O5BB 3P92A 2BD4A 2ZC9H 4KP0A 3RXTA 1YBWA 3SUDA 4ABDA 2FMJA 8ESTE 2H2ZA 2J34A 1C5PA 2ZHFH 3BV9B 1ZOMA 5LPFA 2BLWA 4X6OA 4SGBE 1AVGH 1JXPA 4ABEA 1AUJA 2STAE 3PWBA 1DICA 2QYIA 5A0CA 3BF6H 1KXDA 1A0LA 4NZLA 3RXBA 1XKBC 2PSYA 2ZCHP 1O34A 2HNTF 2BY6X 3STIA 3U8TH 2VWOA 3LH1A 4VGCB 4AN7A 3P95A 1V2QT 1O5FH 3TJNA 1H9HE 4XDEA 3TJUA 2F9OA 4K1SA 4ISOA 7LPRA 1FDPA 1YPHC 2PHBA 3OX7U 3O8DA 4X1PU 1W0ZU 2DE8A 1GVKB 2VIOA 1UTQA 1BOQA 1BRUP 1TRYA 4IC6A 4Y0ZE 1ELBA 5L2YH 2WPLS 5JB8S 1S81A 4XBCA 1V6DA 3V7TA 4MPUA 3CS7A 1MH0A 1QB9A 1YGCH 4ABGA 2ZNKH 5J4QA 1EQ9A 4ISLA 3UR9A 1SGDE 2BOKA 2FOCA 5FBIA 1GMHF 5I46H 2PUQH 4E7NA 5A0AE 1TNIA 2P8OC 1NRPH 2BD2A 3RDZA 4HGCA 2LNCA 4NA7A 1AQ7A 1EAIA 1V2ST 4M7GA 4BTIB 4X2XA 1DLKB 1UVOA 2NU4E 3KHVA 1TONA 1PPHE 4Q7YA 4NSVA 1GI3A 3UQVA 4FU8A 1LTOA 4OS6A 3TVJB 4ZMAH 1YPKH 4IBLH 1RIWC 2H5DA 4NG9H 2WPIS 5E0HA 4I8GA 5T6DA 4NIWA 2C3SA 1TNJA 1ZHMA 1LPKB 1MKWK 2ODPA 2WPMS 2GV6A 1T8MA 4ZKNU 1AFQB 2TGPZ 1O3LA 2BY5X 3I29A 3RXPA 1EPTA 2WINI 4DGJA 4NA9H 1AZZA 1SC8U 3SI4H 8KME2 1GG6C 3S0NA 5FXLA 3GISB 1OWEA 4FUJA 2F9BH 1GVLA 3ZZ7A 2A5KA 5C1XA 3FFGA 1D3DB 1O5GH 4I8KA 1GL1A 2CGAA 2PLXA 4IMQA 2GD4B 1ZHRA 5GWZA 2FIRH 1TGCA 2BX3A 1P10A 6LPRA 1ZMJA 2FOFA 3D49H 2R2WU 2CHAC 5EPYA 3RXMA 1O2MA 3BN9A 1AUTC 3GCTF 5HGGA 1TGSZ 4Q7ZA 3RXLA 1SGNE 1DSUA 1MU8B 1Y3UA 4ZUHA 3M5MA 1FIWA 3A82A 4YOJA 3TH2H 2Z94A 2GX4A 3M5NA 9ESTA 1W12U 2ZGJA 3GCOA 2H9HA 2P95A 3M61U 1SGCA 3O8RA 5PTPA 5FCRA 1UTNA 1QY6A 5C5NA 1ELDE 3FP6E 1RXPA 5C1YA 2FS8A 3RC5A 1D4PB 1LVOA 1AE8H 1S85A 1VJ9U 3UFAA 1A1RA 1G36A 3RM2H 2XC0A 1MKWH 1EJAA 3PLPA 1O3IA 1Z8RA 3ZZ3A 1K1MA 1LO6A 1C2GA 2EEKA 1QA7A 3A7TA 1Z7KA 1ELFA 1NC6A 1SGYE 3HK3B 4AGKA 1MTNC 3EAJA 1C2HA 1EB1H 3RMOH 2WV5A 1C1QA 1CHOF 1UK3A 1QL7A 2O8LA 8GCHG 3KF2A 1TA6A 3SNEA 2BMGB 3FVFB 5F8TA 1MD8A 1TOMH 3S69A 3M3VA 1BZXE 2GCTB 1C5LH 1OS8A 2ZECA 3M7UA 3EA7A 1C1WH 1B5GH 1SLWB 1TQ7B 1FLEE 4IN1A 2FI4E 3A8AA 4DT7B 1OP8A 2GT7A 1AZ8A 4K60A 3I78A 3HKIB 1RFNA 4X1QU 2F3CE 1BHXB 1FPCH 3FP7E 3KQCA 4RKOB 1GHBF 4VGCC 3SU2A 1O2ZA 1A5GH 3RXDA 1BB0B 3KNXA 5DJ7A 3MNCA 4AFQA 1BTHH 3OTJE 1BRCE 1H9IE 4OS1A 1RD3B 2F9NA 1ZRBA 1GI6A 1OPHB 2ILNA 3D65E 2Q1JA 2FS9A 1WTHD 2JH0D 1GL0E 1CGHA 4YESB 5JYIA 1ZTJA 6ESTA 4OGYA 3SJ8A 2Z3CA 4K1TA 5IDKA 3RUOA 4AYVB 4B76A 3GY2A 2OCVB 1FUJA 1HYLA 3TIUA 1K21H 3QX5H 2WPJS 2Q6DA 5A09A 3OY6U 3SUEA 2A1DB 4YOGA 3DA9B 3DFLA 5GIBA 4Y79A 1GDQA 1CA8B 1TX6A 3WY8A 1QJ1B 3NXPA 1HPGA 3NWUA 1W10U 5JB9S 1FV9A 1FAKH 1QRZA 3K9XB 4ZXXH 4BANB 1FZZA 2TGTA 4UONA 4MNWA 4F4OC 3BTWE 1O39A 1DWDH 4YTAA 3GOVB 3S7KB 3AAVA 5EGMA 1J16A 1D6RA 1Y5AT 1EZSC 2EI6A 1HJAB 3IITA 3VB4A 4K8YA 1UVSH 1IQHA 4ZKOU 2BQ7B 3LKWA 1SG8B 2QF3A 1C2FA 4JYUH 1PYTD 1AFQC 4XBBA 3U98H 5EW2H 1VJAU 2FESH 3UNRA 3QUMP 3RXEA 1ZPBA 4WMFA 1GBKA 1HFDA 1QTFA 3E6PH 1C5YB 1GJCB 1P2OA 2CMYA 3TK9A 4H42U 4A1VA 2A4GA 4RKJB 1MAYA 1MTSA 2W5EA 4X8TH 3MOCA 1NFYA 4AZ2B 1L1GA 2BQ6B 2OP9A 1RGQA 1LQEA 2XBXA 1B7XB 3SJIA 3NUMA 1LCYA 3SU6A 4GHQA 1QJ6B 2QV1A 3R3GB 3S9BA 5C5OA 1BTZA 1IQJA 2B9LA 3LGYA 5EQRA 3T2NA 3UREA 3ZZDA 2A7CA 3KEEA 2I6SA 3PYHA 1O2SA 5GXPA 3EA9A 3MNBA 1QNJA 1KIGH 4CR5A 3LPRA 2OQUA 1YM0A 1L4DA 3ZVDA 3TPIZ 1C2DA 1YC0A 3OSYA 2C90B 3DT0H 3PLKA 1GBAA 1K22H 2TRMA 5A8ZA 1QRWA 1NY22 4Y7BA 1EOLA 4LZ1H 5FX5A 2W3IA 5C67A 1EP5A 2BVSH 1TBRH 2J38A 1NM6A 2OC1A 3CP7A 4ISHH 2OXSA 4BTUB 1O2VA 1TOCB 4DURA 1EJNA 1MTUA 1OP2A 1WV7H 2OC7A 1TFXA 2AS9A 2EI8A 4MVNA 2XTTB 3ZV8A 1O3MA 3A87A 1TGTA 2PV9B 1P0SH 1J8AA 2VWLA 1KY9A 2G5NA 2GCTC 1Q3XA 4BNRA 1NFWA 4I7YH 1DLEA 2PGBB 1OOKB 3RU4E 4FUGA 5K7RA 2VIWA 1SQAA 2ZTYA 1SHYA 2G55A 3MU5A 1Y3WA 2QXGA 2RG3A 1O2WA 1N1LA 3GY7A 1WQSA 4FUFA 3MFJA 2F9UA 1ANDA 4XSKU 2ULLA 2HPPH 2ZGBH 4JZIA 1BBRK 3TH4H 1O3HA 2AFQB 2AEIH 3URDA 1DM4B 3A7XA 2ZU1A 1F0UA 1GBLA 4PROA 1FNIA 3M7QA 1HAZB 7GCHG 1SVPA 3UNQA 2C8YB 5A8YA 4ABFA 3M7TA 4YT7H 1ANEA 3SNCA 3ZZBA 2Y6TA 3BTQE 3ZYEA 1X7AC 2ANWA 1Z6EA 3SNAA 1HAXB 1ZR0A 4JK5A 4U01A 4UFFH 4I32A 1GCTB 1O3DA 4LXBH 5A0BA 1GHXH 1SLXB 2QAAA 3QLPH 1LPZB 1ANBA 1GJ4H 1P04A 3QTOH 4DOQA 1O38A 3P70B 3RLYH 1W7GH 3RXKA 1DXWA 1VR1H 2A2XH 1XXFA 4NIXA 4WH6A 2DUCA 2UUJB 1OX1A 2FM2A 3PTBA 1EZQA 2ZFQH 4INKA 1JRSA 1Y59T 4H6TA 3TJVA 4Q80A 3ZZ6A 1NS3A 2HGTH 4B73A 1MQ6A 4CRDA 2A2QH 3A88A 4J2YB 2ZO3H 1SLUB 4Y0YE 3IWMA 2BDHA 1UJ1A 4UDWH 3BEIB 4NWLA 2PKAA 4K2YA 1BTPA 2GZ7A 1E35B 3TK5A 5IYTA 1GJBB 1BTYA 2ZHQH 3LJJA 2D8WA 1HJAC 2FTMA 1BBRH 1KXEA 1C9TA 2BZ6H 1NROH 2PKAB 1HAYB 2ZTXA 5E2PA 1T4UH 1T4VH 1CU1A 3GDSA 3R0FA 4QT8C 1HAVA 1Z1IA 2HLCA 1RJXB 1YPGH 1FN6A 1PQ8A 3E1XB 3HKJB 1IHTH 1XVMA 7ESTE 4TPIZ 3UUZA 1CGJE 1C1VH 3SGAE 1HAVB 2ESTE 6GCHF 1MCVA 2ANMH 3VXFH 1O3AA 1C1MA 4B1TA 1TLDA 4D76A 2ZKSA 1PQ7A 1EAUA 3T29A 4LZ4B 2BXUH 1GMDG 4O3TA 3SGBE 4XOJA 1EB2A 3MU1A 2GDDA 1TRNA 3F6UH 1PQ5A 4AORA 1C5MD 5LPRA 1H8IH 2FODA 1G3BA 3C27B 2QIQA 1G9IE 1LKBA 1GJDB 3KIDU 2BY7X 4A1XA 3EE0B 1ORFA 2P94A 1YF4A 1MBQA 1JWTA 1BCUH 5EOKA 1SPJA 3TNSA 2BTCE 4ZXYH 3ITIA 1OSSA 3A89A 3Q00A 1AD8H 1QBOA 2BY8X 4DY7B 1YPLH 1OWJA 3BTEE 4GSOA 1BDAA 4BAMB 4ZROA 1TNLA 3A7WA 1OWKA 1V3XA 3GCNA 1ESBA 4WF8A 1FQ3A 1G30B 2GGVB 3ATIA 1D3PB 1HAIH 1G2LA 1NU7B 1Z71A 4TWWA 1OWDA 5EXLA 1SL3A 4U32A 2BLVA 3GY4A 2GZ8A 1PQAA 1O2RA 3DD2H 2Z3EA 5GCHF 4HTCH 3Q3YA 2B0FA 2ZDKA 4Z6AH 1CO7E 2XW9A 1TPOA 3SGQE 3SOSA 1ZJKA 4I8HA 1EUFA 2PTNA 1CQQA 5AVDA 5DP9A 1NFXA 1W14U 1SGFA 2VIVA 3LT3A 3HGNA 1XVOA 5DK1A 3GYMA 1C5UA 1OKXA 3SJKA 2ZFFH 4MPXA 2BVXH 4ABJA 1SGRE 1V2TT 4KGAA 4MLFB 2RA3A 3I77A 2UUKB 1O2UA 3MH6A 3SQHE 4AG1A 2SGAA 2QXJA 3TGJE 1LHDH 2ZPRA 1KXAA 1W3CA 3V13A 1GBMA 2FOAA 2IOTA 2VWMA 1Y3VA 4Y10E 1XUFA 1BJVA 3AW0A 1JBUH 1O3GA 5DP4A 3S9CA 1S84A 2BLQA 3SV8A 4YM9A 1C1TA 3O8CA 3E90B 1G37A 1QR3E 2CV3A 1P3EA 3PO1B 2BD5A 1DANH 1HAHH 2C8XB 4CBNA 1RTLA 5F03A 2ZU2A 1GI4A 3B23B 1P3CA 4UFDH 1WAYB 3SJOA 3RC6A 1MU6B 2QY0B 3LGVA 3EA8A 4WMEA 3F9HA 2R9PA 4CRFA 3U1JB 2OC0A 2VH0A 5ABWA 3FAOA 2SGPE 1IQKA 1T31A 1YPMH 2ZWLH 2SFAA 3P8OA 1P2NA 2W7UA 1GBCA 4K3JA 2ZGHA 3E3TA 1HJ8A 2AYWA 3JZ2B 4JYTA 1FAXA 3A86A 1ETRH 1MKXK 1BRAA 1LMWB 3TITA 1EJMA 1TALA 2A0QB 2Y5HA 2ZI2H 1GI5A 3SORA 4AB8A 3TLOA 4IMZA 2QCYA 4AFSA 1SB1H 4BAQB 1P57B 1TA2A 4NA8A 3UOPA 1UVUH 4XE4A 1PPCE 1C5RA 1WTGH 2XC4A 1C1PA 3TJOA 1NPMA 2QN5T 2NU2E 1Z8GA 1CT0E 1YKTA 1ABIH 2R3UA 2XXLA 1FPHH 1EPTB 1W0YH 1SGFG 4FU7A 1THPB