3VB4A

Crystal structure of sars-cov 3c-like protease with b4z
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
total genus 83
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A02
4MPUA 3SO3A 3QUMP 1K1NA 1CA0C 4CRGA 1EAWA 1JRSA 5JB9S 3D49H 1F0TA 4WVPE 5A8ZA 4E05H 1O2KA 2TBSA 2GZ8A 1TRYA 5EXLA 4CBOA 3VPKA 3O8DA 4U30A 1GHAF 4ISOA 4HFPB 2ASUB 1OKXA 2EC9H 4XFQA 2G52A 3F9FA 4TWYA 3E0NB 4J1YA 2EEKA 4ABFA 4XOJA 3RU4T 1CHGA 3M37A 4JZIA 4CHAB 1TMTH 2ANKH 4B76A 4WMEA 3MO9A 1YLDA 3ZVDA 1VCQA 4X2YA 4GHTA 1AU8A 4ISLA 5FAHA 5EQRA 1QQ4A 4KTUA 2C93B 3GY4A 2ZU1A 1W3CA 2RDLA 3UPEA 1P02A 1YPHE 4OS4A 1XMNB 4Y8ZA 1HAOH 1C5WB 3I77A 1EASA 1Z1JA 3A8DA 1K1MA 3ZVAA 3ZZ4A 4AG2A 3ZVBA 4Q7XA 4CR5A 3SUEA 1QR3E 1AFQC 1F0RA 4JZEH 2HALA 1LVOA 2XW9A 5DO4H 1TX6A 1HFDA 3DHKH 3SOSA 1BA8B 2D2DA 2DUCA 1TPOA 1IQKA 1IQFA 1C5OH 1BMAA 3ESTA 1BRUP 2VIWA 2SNWA 4UFFH 1C1OA 3T62A 4MPVA 4IBLH 3MTYA 3B23B 3MU0A 3TK9A 1H8DH 1SLVB 3SGAE 3L3TA 2WUBA 4RN6A 4BOHA 2R0LA 1CQQA 3ZYEA 2GT7A 5EG4A 1NROH 1MTUA 2ZPRA 3HKIB 5SGAE 1KTSB 2HNTE 1O2IA 2FI4E 2A4RA 3BTWE 2ZCLP 1A5GH 4DG4A 1OPHB 3F9GA 2BXTH 4MTBA 1O5EH 4ABHA 3RXGA 2BOKA 4BAOB 2HRVA 1GBIA 4LZ1H 4NIWA 1O3BA 1TGTA 2EI8A 4IC6A 3OU0A 2ESTE 2Q1JA 1GI9B 3FP6E 2VIPA 2FTLE 1KXEA 3O8RA 1LPGB 2J4IA 1WUNH 2ZA5A 4MVNA 2AEIH 4UFEH 1S5SA 3HK6B 3K65B 2BHGA 1ABIH 1EKBB 1XM1A 2ZPSA 3RXSA 2GZ9A 4LK4A 1W7GH 1HAVA 1C1QA 1NFWA 4TPYA 2KAIA 3NXPA 4PROA 1ZYOA 1TAWA 2QAAA 1V2TT 1V3XA 1LHDH 1LCYA 3FZDA 2CJIA 1SGYE 2UUJB 2ZPQA 2VWMA 5GJ4B 1GJCB 3QTOH 3RXPA 1EJNA 4AFSA 4JMYA 4ISHH 3SV7A 1EUFA 1RTLA 2UUFB 4NIYA 3V0XA 2J92A 3SNAA 1TMBH 1W8BH 1VCPA 1SQAA 2QYIA 4Y79A 1QL7A 4K1SA 2HNTF 4NZQA 2ANMH 1ELCA 3A7XA 1IQLA 1BCUH 5A0BA 1PJPA 4UFDH 1JIRA 1SGTA 4DCDA 5CE1A 3E6PH 3ZZ3A 1KXDA 4O9VA 2FODA 1NESE 1QJ1B 2CF8H 3QX5H 8ESTE 1NRPH 1OP8A 2ZDMA 3Q3XA 3QGNB 4ZHLU 2VVVA 1BZXE 2CHAB 2A5IA 1NRNH 2PSXA 3A88A 3KN2A 3RMMH 3RXCA 2A4GA 3ATMA 1ELAA 1HAXB 1Z8JB 3SJOA 1BQYA 1U6QA 3B8JA 5IYTA 2AGIX 5DP9A 4TWWA 4X6OA 5CHAC 3KHVA 1PQ5A 2WYGA 4E7RG 1HLTH 1H9IE 1GI1A 1MTWA 2NU4E 4YLUA 5A0CA 1O5DH 4FUBA 4D8NA 5JYIA 1IQJA 2ZFRH 5L6NH 1NRQH 1YF4A 1OWEA 2LIZA 1HDTH 1T4UH 3QTVH 1OX1A 1ZPCA 3HKJB 4OS1A 2IJOB 5IDKA 1C1UH 4YT6H 1UCYE 3KEEA 3E16B 1VITG 4OGXA 5LPEA 4I7YH 1L4ZA 1XUIA 1OWJA 1GHYH 1AO5A 4XBCA 1O2YA 1KXCA 1GBFA 1G3DA 2A7CA 2K1QA 2XC4A 3A87A 1V2OT 5EW1H 1RGQA 1M9UA 3SW2B 3TGIE 2P59A 3K9XB 1T8LA 5JB8S 3P95A 4I8GA 1D9IA 2TGTA 1AKSB 3RXQA 2ANWA 1OWHA 1OYTH 1ZTJA 4FUGA 4MNWA 2NU0E 1Y5BT 2WPLS 3RLWH 1LHCH 4XDEA 1V2ST 3EQ0H 1H8IH 1GGDB 2NU1E 3VB4A 1C2KA 1O2TA 3OTJE 4FVDA 3M3TA 4NIXA 2STAE 1ESAA 1NTPA 1HPGA 3QN7A 1P2KA 2Z3CA 1YGCH 3A7YA 3GYMA 1SGDE 2Z9KA 1TGCA 2P3FH 1D4PB 2YNBA 2AMQA 1T8MA 1C1NA 1NPMA 1G9IE 1TABE 4ABJA 4JZ1A 3A7VA 2GCTC 1UTLM 1D3TB 2WV5A 2GMTB 3V7TA 3L6PA 5TCAA 4I8KA 2O8TA 4FUJA 1A61H 1ZGVA 3TH3H 1TBZH 1C5XB 1G36A 3PMBB 5FX5A 3QGJA 1E37B 4Q2KA 3P8FA 1L1JA 5E0JA 3P8GA 3RXJA 5EQSA 3Q76A 1A5IA 2PR3A 2G81E 3SUDA 5C67A 5EU8A 5F03A 4UFGH 3SV9A 2FYQA 1FXYA 2IOTA 2Z9JA 1XUFA 1C2FA 2VGCB 4JK5A 2Z9IA 2Z94A 2VINA 3MI4A 1P2OA 4X8UH 1RIWB 1YKTA 3BIVH 2BDAA 2TPIZ 3LH3A 1HAGE 2SGQE 4NWKA 2BQ7B 2Z9LA 1SGNE 3RMNH 3E91A 3M5MA 4BXSA 4Z0KA 1TYNA 1S84A 2BXUH 4ESTE 2OD3B 3KL6A 1DSUA 2JH5D 3R0FA 1OYQA 1TQ7B 1IOEA 3RXLA 3V12A 3MU5A 3A7WA 4KTCA 2WYJA 2ZDKA 2WUCA 3SNEA 4NA8A 2BD3A 2ZU2A 2F9BH 2ZFPH 5FPYA 1O37A 1K2I1 2QN5T 4OS6A 4X1QU 1FAXA 1UVOA 3UOPA 3H7TA 4H6TA 1MKWH 2AS9A 1BMMH 3K6ZA 3MYWA 1QRXA 4BAMB 3RXAA 1GHXH 3GDUA 4A1XA 2QXIA 2Z7FE 2AMDA 1CA8B 5EODA 1AZZA 1WQSA 2Y5GA 4K3JA 2JH0D 2ZFFH 5A8XA 1SGQE 4I32A 1HNEE 1NM6A 1O5AB 2BD9A 1Y59T 1QB1A 4YTAA 4IMZA 5DP3A 2ZQ2A 4AB9A 1C5PA 1K1IA 1SBWA 2Y5HA 2ZP0H 3MH5A 5GCHF 5G4BA 5T6DA 3EA7A 2FDAA 1GBLA 1THRH 3F9HA 2HLCA 3EAJA 2GV6A 1KIGH 2QF0A 3S9BA 1SGPE 3BTME 1S85A 1ETRH 3FANA 4WWYA 2CV3A 8KME2 1QCPA 2PGQB 5CMXH 1GJDB 3S0NA 1EPTC 1SHHB 4ASHA 2BVRH 2I6SA 3MHWU 1C4Y2 5DGJA 2SGAA 1G2LA 5EXMA 1TE0A 1TA6A 2Y5FA 1UVUH 1AB9B 1AMHA 3SHAH 1W13U 4AG1A 1ZRKA 1BRAA 4Y7AA 5JBBS 1SLXB 2AIQA 9ESTA 5DP5A 1C1MA 5LPRA 1C1SA 3MOCA 1V2JT 1GMDF 4AOQA 2XBVA 1YPMH 1E38B 1WOFA 3BTTE 1GJ6A 1Y3VA 2F3CE 2F9PA 3D65E 4MPXA 1O2UA 3MH7A 1HXFH 1IQMA 1GG6B 2C8ZB 1K1JA 5B6OA 1BRCE 4H42U 2H1UA 3KQBA 4Y8XA 3T2NA 1AIXH 1XXDA 2GP9B 1TPPA 1MH0A 1SB1H 5JDUB 1DS2E 1RS0A 2A1DB 5AHGH 1BBRK 1MCVA 1P57B 1ZR0A 3PMHB 1WCZA 4MNXA 2W7SA 8LPRA 1FQ3A 3DA9B 3RXEA 1BTUA 1EJMA 3A7TA 1O2VA 2BDBA 1DLEA 1BUIA 3GY7A 1DXPA 2KAIB 4A7IB 2ODPA 1NC6A 1IHTH 4MNVA 3A89A 3ZVCA 1GCTC 1K22H 3MNCA 1SPJA 4DT7B 6CHAB 4ZXYH 1AUJA 4K5ZA 1P11E 1ZPBA 1K21H 3PMJA 1FN6A 1MUEB 1JIMA 5DK1A 1A2CH 1N8OB 1QRWA 3RP2A 2DE9A 1ANDA 5PTPA 3UWIA 4GPGA 1S6HA 1GI8B 1TFXA 1YCPK 1GVKB 1P2IA 4MG3A 1Z6JH 5C1UA 1GDUA 2ZNKH 1DWDH 3PTNA 3U9AH 1Z71A 2OTVA 3ZVFA 1ZJDA 2W26A 1A0LA 2P93A 2Y80A 4BAKB 2FOBA 2P8OC 4RKOB 2UWOA 3SUFA 1ARBA 1W14U 1IAUA 3UNRA 3E3TA 4K1TA 2ZGXH 3TH2H 3GCHC 2QGRA 2XCFA 1MTSA 1GPZA 2FX6A 1C5QA 1VGCB 2A7JA 1GBCA 3BG4C 4GUXA 4AGKA 1YP9A 1B7XB 1NN6A 4NZLA 1UHBA 2OBQA 1C2GA 1H1BA 1UTKA 3SN8A 2I6QA 1TA2A 1O2WA 4ABGA 2W3IA 1NFUA 1O5BB 2A4OA 4DOQA 4I8JA 3SU0A 3M7UA 1AI8H 2HPQH 3P6ZB 4FUEA 1Y8TA 2ZIQH 1O39A 3URCA 1TB6H 4VGCB 5DP7A 3LC5A 3SI3H 3RXBA 1FN8A 1F5KU 1UTQA 2WPJS 5JBTA 1IQEA 1AWFH 3FP8E 2ZHEH 3M3VA 1DSTA 4CHAC 4B74A 1GI7B 3LU9B 9LPRA 2BVXH 1AGJA 1NFXA 5EPYA 1GJAB 3M61U 1UTNA 2G4UA 2XCNA 3T27A 1XUHA 2F83A 1CHOF 1L1GA 5T6FA 2ZFQH 1UK2A 4BAQB 2SFAA 1GDQA 1P3CA 1BDAA 2F9VA 2UUKB 4AX9H 2QY0B 3Q3KA 3IITA 3EYDA 6GCHF 1DE7H 1F5LA 3OSYA 2ZKSA 2OCVB 1D3DB 5L2YH 1C2JA 1HJ8A 5C2ZA 2QA9E 3UNQA 2BLVA 3TJNA 3RXOA 4X1RU 2J95A 1BBRH 1DFPA 1AN1E 1AZ8A 1KYNA 1NRSH 2FMJA 1FLEE 4K60A 2V3HH 1HYLA 4A5TS 1SL3A 3AAVA 1CT0E 1O3OA 2BLWA 3KCGH 2ZHQH 1WYKA 3NUMA 1O3EA 1P01A 1C5TA 1GHVH 3SU2A 2W3KA 1B0FA 1RRKA 1UK4A 1BTXA 2HPPH 1HUTH 1A4WH 1QTFA 1BTPA 2WV4A 5HM2A 2R9PA 3LIWA 1ABJH 1PPFE 4O3TA 2VH6A 3UUZA 3A8CA 1GBKA 1QB6A 3PWBA 3UTUH 1TGBA 1YCPH 2BMGB 1P09A 4A1TA 3AAUA 1P2MA 3AW0A 1YCPM 2QXGA 2OC1A 1XKBC 3R3GB 4B1TA 1C5SA 4ZHMU 3DD2H 1L2EA 1V2UT 2PW8H 1HXEH 1THPB 1BITA 4B2CA 2BQ6B 5JBAS 1A1RA 3FFGA 4ISIH 5HGGA 1ZSJA 3LJJA 1OSSA 1QNJA 4AN7A 2BX3A 3MU4A 5EPNA 3SUGA 1C1VH 1ETSH 2GT8A 2BVSH 4WH8A 2ZU5A 2D26C 3A8AA 3LDXH 1AE8H 1MCTA 3JZ1B 3PTBA 2GD4B 1UVSH 3ZZBA 1C1PA 2ANYA 2G8TA 1AUTC 1EP5A 1XX9A 2R3UA 1O5GH 1FV9A 4D9RA 4WH6A 2XXLA 2GTBA 1J17T 1T8NA 5JBCS 4Y76A 1ELVA 2O8WA 2FEQH 4ZKNU 1LO6A 1C9PA 4FUIA 4FVBA 3P92A 3BN9A 1Y5AT 4GVUA 1J9CH 1L4DA 5C5NA 2A31A 3GYLB 4IW4E 2FESH 2BDCA 4LOYH 3M3SA 1WTHD 2BDHA 1TGSZ 2FX4A 1ESBA 2FZZA 2OQUA 1ZTKA 1MMJN 2UWLA 2VB0A 1QY6A 4ABEA 2ZHDA 3CP7A 4O03A 1EPTA 2SGDE 1YPEH 3RXUA 2NWNA 4NFEA 4DW2U 2XTTB 3UNSA 3EBNA 3E90B 2HGTH 3H5CB 3BIUH 4LXBH 3F1SB 1S83A 4ABAA 2ZHWH 2BDGA 3MH4A 4NWLA 4ZXXH 2CHAC 4B73A 1UCYK 2ZZUH 1EZUC 4X8SH 1P04A 2FOGA 3LGIA 1DUAA 1MQ6A 1QHRB 1P2JA 1ANCA 4D9QA 4IN1A 2ZDLA 1YPHC 2ZCHP 4Y8YA 1ZGIA 5TCCA 5F6MA 2ZFSA 1JWTA 1PQ7A 2GX4A 1EOLA 1GBAA 2NU3E 1GBTA 5LPFA 2BD4A 5EXNA 3SU5A 2C4FH 3A8BA 3VGCB 2H9HA 1QBOA 4B71A 1HIAA 6LPRA 1O3KA 1FPHH 1BOQA 1DICA 2OXSA 3M5LA 3VB7A 2TGPZ 3VEQB 1ANBA 5LGOA 2ZEBA 1O30A 4CRAA 2LPRA 1HJ9A 4JZDH 3BTHE 2Q6GA 1MZAA 3WY8A 4AYYB 1ZSKA 4Y71A 5FX6A 3RXVA 2FM2A 2JETC 4AB8A 1FIZA 1P8VC 1BMNH 1EX3A 3T5FH 2CF9H 1C2HA 1ZTLA 4FUHA 2WPIS 1SG8B 1GVLA 5EW2H 2HNTC 1S0RA 2XNIA 1Z7KA 3M5OA 1JXPA 2H6MA 3Q00A 1P9UA 1O32A 1W0YH 4FU7A 2Z3DA 1J16A 2V0BA 3PWCA 1O3HA 3W95A 4CBNA 1SSXA 5E2OA 1O3MA 1QL9A 4YO9A 3F9EA 1QBVH 4WJG2 7LPRA 7GCHG 1A0JA 1LDTT 2ZFTA 1F0UA 4GLYA 1DANH 2AH4X 1BT7A 1UVTH 4JZFH 2Y7XA 3ATLA 2ZHFH 1QURH 1GGDC 3A80A 3PLPA 2C3SA 4H4FA 1GI5A 1K1LA 3ZV8A 1OP0A 1H4WA 1P3EA 2OINA 4X2VA 1MD7A 1FJSA 1IQIA 1MD8A 4DVAU 1O2RA 3GICB 1LQEA 2C90B 2ZDAH 2GMTC 5C1YA 3UOUA 1C5UA 2JKHA 1QFKH 1SOZA 3LGYA 4MLFB 2VIOA 2FS9A 2O8UA 2A5AA 3E1XB 4CH8B 2BY7X 3LONA 1GBJA 3SU3A 1BB0B 2QIQA 2ZGBH 4U2WA 3EGKH 1SLWB 1BHXF 5LH8A 2FWWA 1ZMJA 1B5GH 4K2YA 3SJKA 3L33A 5DPAA 2AIPA 5I46H 1CT4E 2FLBH 1O3LA 5JPMH 2BY6X 2EI6A 4SGAE 4E7NA 3TU7H 1TRMA 1NS3A 1LMWB 2XBXA 1C5VA 2Z3EA 3GCOA 3ODDA 1DWEH 1CBWB 1UCYH 4K8BA 8GCHG 4TY6A 1KTTB 4AYVB 1UHBB 1MAXA 2ILNA 2ZTXA 3SGBE 1TGNA 1CGIE 3TK5A 2H9EH 1P9SA 1FUJA 1T8OA 1A46H 1GJ4H 1MTNB 3B9FH 5F8TA 4B75A 7GCHF 1XVOA 1Y3YA 3FVFB 3TNTA 1PPBH 2TGAA 1ZSLA 2CMYA 4AFQA 4CH2B 5FCRA 2AERH 2H5CA 1W10U 1VITH 4ZKOU 1KY9A 3STIA 5GCHG 2P95A 3E8LA 4FU9A 3RXIA 1O2SA 4ISNA 4UONA 3GY2A 3S69A 4Y0YE 3CS0A 1TIOA 2XRCA 2AYWA 3BTQE 3V13A 4XBBA 1G32B 1QQUA 1TNIA 2IN2A 2QXJA 2SNVA 4OGYA 3KQEA 3I29A 1EB2A 3O8BA 3F6UH 4JYVH 3RC6A 1TBRH 1BMLA 1C1RA 4ZUHA 3E0PB 1BTYA 3MNXA 1FY3A 3HATH 2ZGCA 1DT2A 2ALPA 3ATKA 3MFJA 3EE0B 4FU8A 1V2NT 1BHXB 1HGTH 5DKMA 1BRBE 1YPLH 1F2SE 2G51A 1WAYB 1GMDG 2PLXA 1W0ZU 1SOTA 1RD3B 3SQEE 1EAIA 1ORFA 1KLJH 1O2ZA 1C1WH 2BOHB 2F9OA 3VFEA 3TITA 1G30B 1MKXK 1ZLRA 4DIHH 3BV9B 4Y0ZE 3ZZAA 1RXPA 1EJAA 1XUGA 1BTWA 1YM0A 8GCHF 4KP0A 3P8NA 1MBMA 5C20A 1N1LA 2B0FA 4ZMAH 3BEFB 1GJ9B 2ODQA 5GXPA 1DY8A 1P10A 3U8OH 1O31A 1SMFE 4RKJB 5HMAA 3TGKE 1G3EA 4MDSA 1AB9C 2VIVA 2ZG0H 4B2AA 5FBIA 3UQOA 1RFNA 1SQOA 2VWLA 5FPSA 4AGJA 2OC8A 4NGAH 5A09A 1NFYA 2AMPA 2K7XA 1TPSA 2G5VA 5TJXA 1HCGA 3ZZ7A 2QV1A 3U69H 3NKKA 1J15A 3SGQE 4D7GA 3DT0H 4BTTB 2TGDA 1OS8A 5F8ZA 2V35A 3STJA 1LPZB 4TY7A 4YESB 2AGGX 1YPJH 1GG6C 1SGEE 5C5OA 4HZHA 1BJUA 1LKAA 1O3GA 2OUAA 3AVZA 2Q6DA 3LJOA 1HB0B 3P70B 1O2MA 1K1PA 1GBHA 1DPOA 3PROA 1DVAH 2HWLB 1FIWA 1NY22 1AFEH 1MTVA 3SNDA 3P17H 5A8YA 1JBUH 1UMAH 2PKSB 1D6RA 4ABBA 3I78A 4FXGH 3RC4A 1G2MA 1CO7E 3UY9A 1GI0A 1FY5A 3QZRA 3N7OA 4TPIZ 1GWAA 4I8HA 5T6GA 3HK3B 2P16A 1PPCE 2R2WU 2ZO3H 4XE4A 3RM0H 2C8XB 6CHAC 4HI3A 2A4QA 3VB5A 2QC2A 1GI4A 1QA7A 1GMHG 1N8OC 2QCYA 1AY6H 1E0FD 3RU4E 1IHSH 1TX7A 1XKAC 1TOMH 3NK8A 3SU1A 2ZI2H 1BJVA 4GSOA 3SI4H 1O2HA 2BLQA 2RG3A 2XYAA 3FZZA 2STBE 1O38A 4Z6AH 3OY6U 2FOCA 3ZZCA 4AZ2B 3LKWA 1EPTB 1HAVB 4MQAA 4YM9A 5HYOA 1O2QA 3SU6A 2ZECA 2WPMS 3TJUA 1TOCB 1TBQH 1GCDA 2A2QH 3MNSA 3IG6B 1QJ6B 2D8WA 3HPTB 7ESTE 1HJAB 3ZZ9A 1O2NA 1TPAE 2VJ1A 1MQ5A 1ZMLA 4GCHF 3GY5A 2VH0A 3SBKA 1S81A 1V2KT 5AFYH 1C1TA 1CHOG 1TNKA 5F8XA 4JCNA 2ZDNA 1OWDA 1SGIB 2BYAX 1EZXC 1O34A 3PO1B 1GI3A 3VXFH 1O0DH 6GCHG 1O33A 1ID5H 3M7TA 5I25A 4F49A 1LVYA 2BY9X 3UWJH 3GOVB 1C4U2 1ELTA 1GL0E 1MKXH 3ZZ5A 1GBDA 3Q77A 2PSYA 4X6PA 2D1JA 3ZV9A 3TNSA 2XC5A 3RU4D 1A3EH 2Z9GA 4VGCC 3U8TH 1LHEH 1HRTH 2GVFA 2F91A 3AASA 1A5HA 1GJBB 4QT8C 1LKBA 1V2PT 4YOGA 1GJ7B 1AVWA 5E2PA 5FXLA 2QXHA 5E0GA 1Z8IB 1GBMA 2GZ7A 2PKAA 2CN0H 1GBEA 2RA3A 4MNYA 1QBNA 4BXWA 1GHBG 4YT7H 1GL1A 2XBYA 4A1VA 1UVPA 1P0SH 1GMHF 3FP7E 3RM2H 4I8LA 3BF6H 1SR5C 1T32A 2P3UB 2ALVA 1C5MD 1A7SA 2ZGJA 4X6NA 4UDWH 2XBWA 3A7ZA 1KDQA 2FIRH 3UR9A 1EZQA 1K9OE 2FI3E 1HAHH 1MZDA 2LNCA 2O9QA 1AD8H 4ZH8A 3FAOA 1EAUA 3KQDA 2V6NA 2RCEA 3SQHE 4JYTA 5BPEA 1HAPH 1FAKH 3SV6A 1V6DA 1SHYA 4R8TB 3MU8A 2Z6BD 3AW1A 2B8OH 1C5NH 1WU1A 2A5KA 3NWUA 1QA0A 3PLBA 2FPZA 3TLOA 2VVUA 2THFB 1SGFG 1HAYB 3EA9A 1JRTA 1FNIA 1LPKB 2FYRA 3ELAH 4DY7B 3ZZDA 1FY8E 3VXEH 3TJVA 1ZJKA 1WSSH 6ESTA 5H4IB 3A84A 5FPTA 3GY8A 1NZQH 4X8TH 2Y82A 2TIOA 1VZQH 4IC5A 5C3NA 2G55A 4GAWA 1O2JA 1V2QT 4LZ4B 1DWBH 3K6YA 1KSNA 2M5TA 4IGDA 1QB9A 1P03A 3F68H 2GKVE 1G37A 2ZTZA 2H2ZA 1Y5UT 1WV7H 3VB6A 4THNH 4X0WU 1K28D 1C2LA 2FO9A 3PMAB 4K69A 1O5CB 1TMUH 4NFFA 2FOAA 1GHBF 1S0QA 1XUKA 1O3IA 3QZQA 1NO9H 4A6LA 4BAHB 3TK6A 3SNBA 3PB1E 2GDDA 5EQQA 4KGAA 2ULLA 1SVPA 1OXGA 1G3CA 2GCHF 2G4TA 4IN2A 1Y3XA 1ANEA 1GHWH 1CA0B 3MO6A 5FCKA 4NCYA 2TRMA 4XBDA 4CRDA 3PV4A 2A2XH 3TPIZ 1GDNA 3S9CA 5FHTA 5DP4A 3TGJE 1UTMA 4B2BA 1P12E 3UREA 2BZAA 3RC5A 2VU8E 1ZRBA 2ZCKP 4SGBE 2OC0A 1CVWH 4E06H 1TNGA 3BG8A 1FZZA 4F4OC 1J8AA 1XVMA 1VJAU 3TIUA 2J34A 1EXFA 1UO6A 1DLKB 3SJIA 4WY3A 4I33A 2R0KA 2PUXB 1O35A 4U01A 1PQ8A 1TNHA 4BNRA 2ZQ1A 1TQ0B 3TVJB 4KELA 3T28A 1GHZA 1HBTH 2BTCE 3MH6A 1PYTD 1FPCH 4AFZA 4J2YB 2A7HA 1SGCA 4NSVA 2VWOA 4Q7YA 4A92A 1CT2E 3DUXH 3JZ2B 2FXRA 1O3PB 2FOFA 2HOBA 3LOXA 3PLKA 2OP9A 5J4QA 5E0HA 3GDSA 1TNJA 2WPHS 2ZF0H 1XUJA 3BEIB 1E34B 1O2XA 1UTOA 2F9NA 4KKDA 4WXIA 1AFQB 3ATWA 1PQAA 1ZHPA 1EQ9A 1SGRE 2O8LA 3RXFA 1CE5A 5DJ7A 1G3BA 1KLIH 1ZHRA 4YLQH 1ELDE 3A86A 1VJ9U 3CS7A 3MNBA 4X6MA 1LHFH 2BQWB 1UTJA 5ESTE 4ABIA 1AQ7A 3GISB 2BZ6H 2W7UA 3VGCC 4INKA 1YC0A 2SGPE 1W7XH 1O2PA 1IQGA 3PYHA 2VIDA 1BTHH 2RA0A 1O3DA 1O2LA 4X1PU 1K1OA 1ESTA 3KNXA 1PYTC 1H9HE 1MAYA 2A32A 1RJXB 4DJZB 1KLTA 2H9TH 2ZWLH 1RTKA 5DP8A 3U1JB 1ELFA 3LPRA 1S6FA 4DGJA 2R3YA 1O3FA 3GDVA 4WMDA 1D3PB 1SLUB 1XXFA 3GY3A 5L30H 3RMOH 4DIIH 4X8VH 1PPZA 5K0HA 1TRNA 2PTCE 4Y11E 2FOHA 1PFXC 3VB3A 1CGJE 1TWXB 3UQVA 2VNTA 3A82A 1UJ1A 4NA9H 2FI5E 4WMFA 4CREA 1ZPZA 2XC0A 4M7GA 1W12U 4IMQA 1J14A 3BTDE 3H7OA 3ZVGA 1TNLA 2WPKS 1TALA 1RTFB 4ZAEA 4JK6A 3GY6A 5AF9H 4NSYA 4CRCA 3HGNA 3EDXB 1H9LB 4I31A 3RXMA 1B0EA 1ELBA 1VCWA 2CGAA 4NA7A 4WF8A 5HXFA 1QJ7B 1O2GH 2ODYB 3G01A 1IQHA 2FOMB 1DM4B 3O8CA 1FY1A 1DWCH 3KIDU 1T31A 1NU9A 1JOUB 4ZKRU 2XWBI 2FS8A 3URDA 1NRRH 3ZZ8A 3UFAA 3RLYH 1UTPA 1GI2A 1Z8GA 4YZUA 5EOKA 2BD2A 4Y6DA 3ZVEA 1OP2A 2VWNA 1ZHMA 1Q31A 2SGFE 1MKWK 1C5RA 3S9AA 4HGCA 3SZNA 4CRBA 3IWMA 1LHGH 3V3MA 1GI6A 1GVZA 3T26A 2QF3A 3D23A 2VVCA 4CR9A 1P05A 5BRRE 2GGVB 2J9NA 2JETB 3BEUA 3UIRA 2P94A 3ZZ6A 1CBWC 1X7AC 5CHAB 2J94A 1O3CA 4R0IA 3BTFE 1C5LH 2JH6D 3Q3YA 4O97A 4ZROA 1GBBA 2SGEE 1MTNC 2PWXA 1SC8U 1O3JA 1OWIA 1MU8B 4YOJA 2BM2A 3MO3A 3M7QA 1C5YB 1C2MA 1AE5A 2YOLA 1Z1IA 1FMGA 4NG9H 1T7CA 2VGCC 1LTOA 1FDPA 1ARCA 3SU4A 1F0SA 1LQDB 1RIWC 3RXHA 4YOIA 5HM9A 5EGMA 5ETXA 3SHCH 1Y3WA 1DY9A 3RMLH 2FP7B 4D76A 2Y7ZA 2PKAB 2OC7A 1C5ZB 1HAZB 1YPKH 1CGHA 2BD7A 2FOEA 3C27B 1V2WT 4UD9H 4OS7A 3LC3A 4OS5A 4RSPA 3T29A 4X2XA 1V2RT 4IS5A 2G5NA 1O3NA 3W94A 2A45B 1T4VH 1UK3A 1LVMA 3RXDA 2OLGA 1C2DA 2NU2E 3GCNA 4CRFA 2J38A 1KDQB 5FBEA 4D7FA 2XWAA 4XSKU 2B5TB 3GCTG 1Y3UA 2AFQB 1ELGA 1VITF 7KMEH 1THSH 3QLPH 2PV9B 1DITH 2GCTB 2FTMA 1Q2WA 2ZU3A 3RXKA 1YPGH 3LGUA 2ZU4A 3SJ8A 3U1IB 3M36A 1TLDA 4DURA 1ZZZA 1Z8RA 1MU6B 4WXVA 1S82A 1FY4A 3U98H 2WINI 3QDZB 3A83A 2PTNA 2ZGHA 2BD5A 1GJ5H 1O36A 4GHQA 4NIVA 3LGWA 2IPHA 1DDJA 4Y10E 4X1SU 1N6YA 1V2LT 2J2UA 1QIXB 1ETTH 3SNCA 2Y6TA 1F7ZA 1WTGH 5C1XA 1AVGH 1W2KH 2UWPA 2BB4A 4K8YA 1PPEE 1OOKB 1C4V2 1TX8A 4BTIB 1N6XA 4Q80A 1IQNA 5K7RA 1EP6A 2B9LA 1NT1A 2PKSC 1EZSC 2UUYA 3LGTA 4UE7H 1ACBE 1DX5M 1EB1H 4UEHH 2B7DH 3QWCH 4GCHG 1AVXA 1FONA 3K2UA 3S7KB 2HVXA 1Z6EA 4Y7BA 3M5NA 3TH4H 3GCTF 3OYPA 3RUOA 3QK1A 2GV7A 1Q3XA 1DOJA 1ZOMA 1YBWA 3EA8A 4MPWA 5AFZH 1BTZA 2C8YB 2CXVA 1FI8A 1SGFA 4HTCH 5L2ZH 1A3BH 4ZKSU 1EATA 4U32A 4AFUA 1A0HB 3D62A 1ELEE 5J4SA 3NPSA 2AGEX 1QGFA 4TYDA 3QO6A 4FUFA 1KXAA 1GMCG 3RXTA 3SV2H 4X2WA 2GDEH 3PM3A 3RDZA 4BANB 2Y81A 1WBGB 1C2EA 3A85A 1W11U 1HJAC 1C9TA 3MWIU 3BTKE 1GJ8B 4INLA 4BTUB 3S7HB 3MMGA 1CU1A 3UR6A 3BTEE 5E8EH 1EOJA 1C2IA 1JMOH 1SI5H 2OQ5A 2BY5X 1AWHB 3BSQA 2F9UA 3LH1A 4FUDA 1ZMNA 3PO1C 1KXFA 1SFQB 1V2MT 3SORA 3NZIA 2BY8X 1OWKA 3CENA 2FLRH 1V2VT 2ZC9H 3BTGE 2DE8A 2P3TB 2ZTYA 4KTSA 1F5RA 3LT3A 4ZHAA 3P8OA 1VGCC 4JYUH 2EI7A 4ABDA 2H5DA 1VR1H 3ZYDA 5GDSH 5ABWA 3T25A 4H6SB 1SQTA 3DFLA 1TONA 1QL8A 4FUCA 1HIAB 1WQVH 1AKSA 5AVDA 1LVBA 1YLCA 4X1NU 2BX4A 1GMCF 2A0QB 1AHTH 1PPGE 5A0AE 1D3QB 2C8WB 2BDYA 2PUQH 1PPHE 3KF2A 1DXWA 1GHAG 2VIQA 3LGVA 1D6WA 3NCLA 2Q6FA 4AORA 1O5FH 3M35A 2G00A 3SV8A 2BDIA 4Q7ZA 5DG6A 1O2OA 3KQCA 1GCTB 2BD8A 1O3AA 4OS2A 1E36B 1SFIA 3C1KA 1CSOE 3KGPA 2YNAA 2GCHG 1P2NA 5GWZA 4K1EA 5ESBA 3OX7U 4O3UA 5A2MH 1NU7B 3DFJA 3ODFA 3TJOA 1F92A 3RXRA 1QRZA 2PFEA 1P06A 3ITIA 5DP6A 1HAIH 2BLOA 2PHBA 2R2MB 1L1NA 1L0ZA 2EA3A 2OBOA 1BBRE 4INHA 3U8RH 2V3OH 1HV7A 1YYY1 1E35B 3HGPA 5GIBA 1INCA 1EAXA 1KXBA 2P8OB 3SJ9A 3ENSB 5T3HA 3MU1A 5GPIB 3A81A 3GCHB 2W5EA 1BIOA 2PGBB 3ATIA 3BG4B 2ZDVH 1DUEA 3OY5U 1P2QA 1MBQA 2O8MA
chains in the Genus database with same CATH superfamily
4MPUA 3SO3A 3QUMP 1K1NA 3UB0A 1CA0C 4CRGA 1EAWA 1JRSA 5JB9S 3D49H 1F0TA 4WVPE 5A8ZA 4E05H 1O2KA 2TBSA 4M9FA 2GZ8A 1TRYA 5EXLA 4CBOA 3VPKA 3O8DA 4U30A 5KECA 1GHAF 4ZCNA 4ISOA 4HFPB 2ASUB 1OKXA 2EC9H 4XFQA 2LP6A 2G52A 3F9FA 4TWYA 3E0NB 4J1YA 2EEKA 4ABFA 4XOJA 3RU4T 1CHGA 3M37A 4JZIA 4CHAB 1TMTH 2ANKH 4B76A 4WMEA 3MO9A 1YLDA 3ZVDA 1VCQA 4X2YA 4GHTA 1AU8A 4ISLA 5FAHA 5EQRA 1QQ4A 4KTUA 2C93B 3GY4A 2ZU1A 1W3CA 2RDLA 3UPEA 1P02A 1YPHE 4OS4A 1XMNB 4Y8ZA 1HAOH 1C5WB 3I77A 1EASA 1Z1JA 3A8DA 1K1MA 3ZVAA 3ZZ4A 4AG2A 3ZVBA 4Q7XA 4CR5A 3SUEA 1QR3E 1AFQC 1F0RA 4JZEH 2HALA 1LVOA 2XW9A 5DO4H 1TX6A 1HFDA 3DHKH 3SOSA 1BA8B 2D2DA 2DUCA 1TPOA 1IQKA 1IQFA 3WWFA 1C5OH 1BMAA 3ESTA 1BRUP 2VIWA 2SNWA 4UFFH 1VKYA 1C1OA 3T62A 4MPVA 4IBLH 3MTYA 3B23B 3MU0A 3TK9A 1H8DH 1SLVB 3SGAE 3L3TA 1MABB 2JDID 2WUBA 4RN6A 4BOHA 2R0LA 1CQQA 3ZYEA 2GT7A 5EG4A 1NROH 1MTUA 2ZPRA 3HKIB 5SGAE 1KTSB 2HNTE 1O2IA 2FI4E 3F2GA 2A4RA 3BTWE 2ZCLP 1A5GH 4DG4A 1OPHB 3F9GA 2BXTH 4MTBA 1O5EH 4ABHA 3RXGA 2BOKA 4BAOB 2HRVA 1GBIA 4LZ1H 4NIWA 1O3BA 1TGTA 2EI8A 4IC6A 3OU0A 2ESTE 2Q1JA 2OK5A 1GI9B 3FP6E 2VIPA 2FTLE 1KXEA 3O8RA 1LPGB 2QF4A 2J4IA 1WUNH 4P02A 2ZA5A 4MVNA 2AEIH 4UFEH 1S5SA 3HK6B 3K65B 2BHGA 1ABIH 1EKBB 1XM1A 2ZPSA 3RXSA 2GZ9A 4LK4A 4P00A 1W7GH 1HAVA 1C1QA 1NFWA 4TPYA 2KAIA 3NXPA 4PROA 1ZYOA 1TAWA 2QAAA 1V2TT 1V3XA 1LHDH 1LCYA 3FZDA 2CJIA 1SGYE 2UUJB 2ZPQA 2VWMA 5GJ4B 1GJCB 3QTOH 3RXPA 1EJNA 4AFSA 4JMYA 4ISHH 3SV7A 1EUFA 1RTLA 2UUFB 4NIYA 3V0XA 2J92A 3SNAA 1TMBH 1W8BH 1VCPA 1SQAA 2QYIA 4Y79A 1QL7A 4K1SA 2HNTF 4NZQA 2ANMH 1ELCA 3A7XA 1IQLA 3U28C 1BCUH 5A0BA 1PJPA 4UFDH 1JIRA 1SGTA 4DCDA 4ASUD 5CE1A 3E6PH 3ZZ3A 1KXDA 4O9VA 2FODA 1NESE 1QJ1B 2CF8H 3QX5H 8ESTE 1NRPH 1OP8A 2ZDMA 3Q3XA 3QGNB 4ZHLU 2VVVA 1WXRA 1BZXE 2CHAB 2A5IA 1NRNH 2PSXA 3A88A 3KN2A 3RMMH 3RXCA 2A4GA 3ATMA 1ELAA 1HAXB 1Z8JB 3SJOA 3W1EA 1BQYA 1U6QA 3B8JA 5IYTA 1H8HD 2AGIX 5DP9A 4TWWA 4X6OA 5CHAC 3KHVA 2J5UA 1PQ5A 2WYGA 4E7RG 1HLTH 1H9IE 1GI1A 1MTWA 2NU4E 4YLUA 5A0CA 1O5DH 4FUBA 4D8NA 5JYIA 1IQJA 2ZFRH 5L6NH 1NRQH 1YF4A 1OWEA 2LIZA 1HDTH 1T4UH 2HVYB 3QTVH 1OX1A 1ZPCA 3HKJB 4OS1A 2IJOB 5IDKA 1C1UH 4YT6H 2V7QD 1UCYE 3KEEA 3E16B 1VITG 4OGXA 5LPEA 4I7YH 1L4ZA 1XUIA 4B6FA 4YXWD 4TSFD 1OWJA 1GHYH 1AO5A 4XBCA 1O2YA 1KXCA 1GBFA 3VG8A 2K8IA 1G3DA 2A7CA 2K1QA 2XC4A 3A87A 1V2OT 3OAAD 5EW1H 1RGQA 1M9UA 3SW2B 3TGIE 2P59A 3K9XB 1T8LA 5JB8S 3P95A 4I8GA 1D9IA 2TGTA 1AKSB 3RXQA 2ANWA 1OWHA 3CNRA 1OYTH 1ZTJA 4FUGA 4MNWA 2NU0E 1Y5BT 2WPLS 3RLWH 1LHCH 4XDEA 1V2ST 3EQ0H 1H8IH 1GGDB 2NU1E 3VB4A 1C2KA 1O2TA 3OTJE 4FVDA 3M3TA 4NIXA 2STAE 1ESAA 1NTPA 1HPGA 3QN7A 1P2KA 2Z3CA 3WW7A 1YGCH 3A7YA 3GYMA 1SGDE 2Z9KA 1TGCA 2P3FH 1D4PB 2YNBA 2AMQA 1T8MA 1C1NA 1NPMA 1G9IE 1TABE 4ABJA 4JZ1A 3A7VA 2GCTC 1UTLM 1BMFD 1D3TB 2WV5A 2GMTB 2XNDD 3V7TA 2KCYA 3L6PA 4I8KA 5TCAA 2O8TA 4FUJA 1A61H 1ZGVA 3TH3H 1TBZH 1C5XB 1G36A 2WSSD 3PMBB 2QE7D 5FX5A 3QGJA 1E37B 4Q2KA 3P8FA 1L1JA 5E0JA 3P8GA 3RXJA 5EQSA 3Q76A 1A5IA 2PR3A 2G81E 3SUDA 5C67A 5EU8A 5F03A 4UFGH 3SV9A 2FYQA 1FXYA 2IOTA 3GS9A 2Z9JA 1XUFA 1C2FA 2VGCB 4JK5A 2Z9IA 2Z94A 2VINA 2KFWA 3MI4A 1P2OA 4X8UH 1RIWB 1YKTA 3BIVH 2BDAA 2TPIZ 3LH3A 1HAGE 2SGQE 1WDIA 4NWKA 2BQ7B 2Z9LA 1SGNE 3RMNH 3E91A 3DCLA 3M5MA 4BXSA 4Z0KA 1TYNA 1S84A 2BXUH 4ESTE 2OD3B 3KL6A 2KX4A 3N7EA 1DSUA 2JH5D 3R0FA 1OYQA 1TQ7B 1IOEA 3RXLA 3V12A 2PP6A 3DSPA 1COWD 3MU5A 3A7WA 4KTCA 2WYJA 2ZDKA 2WUCA 3SNEA 4NA8A 2BD3A 2ZU2A 2F9BH 2ZFPH 5FPYA 1O37A 1K2I1 4RT0A 5CHBA 2QN5T 4OS6A 4X1QU 1FAXA 1UVOA 3UOPA 3H7TA 5FL7D 4H6TA 1MKWH 2AS9A 1BMMH 3K6ZA 3MYWA 1QRXA 4BAMB 3RXAA 1GHXH 3GDUA 4A1XA 2QXIA 2Z7FE 2AMDA 1CA8B 5EODA 1AZZA 1WQSA 2Y5GA 4K3JA 2JH0D 2ZFFH 5A8XA 1SGQE 4I32A 1HNEE 1NM6A 1O5AB 2BD9A 1Y59T 1QB1A 4YTAA 4IMZA 5DP3A 2ZQ2A 4AB9A 1C5PA 1K1IA 1SBWA 2Y5HA 2ZP0H 2W6ID 2CK3D 3MH5A 5GCHF 5G4BA 5T6DA 3EA7A 2FDAA 1GBLA 1THRH 3AK5A 3F9HA 2HLCA 3EAJA 3MQKC 2GV6A 1KIGH 2QF0A 3S9BA 1SGPE 3BTME 1S85A 1ETRH 3FANA 4WWYA 2CV3A 8KME2 1QCPA 2PGQB 5CMXH 3F0PA 1GJDB 3S0NA 1EPTC 1SHHB 4ASHA 2BVRH 2I6SA 3MHWU 1C4Y2 5DGJA 2SGAA 4F55A 1FX0B 1G2LA 5EXMA 1TE0A 1TA6A 2Y5FA 1UVUH 1AB9B 1AMHA 3SHAH 1W13U 4AG1A 1ZRKA 1BRAA 4Y7AA 5JBBS 1SLXB 2AIQA 4TT3D 9ESTA 5DP5A 1C1MA 5LPRA 1C1SA 2EY4C 3MOCA 1V2JT 1GMDF 4AOQA 2XBVA 5C94A 1YPMH 1E38B 1WOFA 3BTTE 1GJ6A 1Y3VA 2F3CE 2F9PA 3D65E 1W0KD 4MPXA 3OEHD 1O2UA 3MH7A 1HXFH 1IQMA 1GG6B 5KEDA 2C8ZB 1K1JA 5B6OA 1BRCE 4H42U 2H1UA 3KQBA 4Y8XA 3T2NA 1AIXH 1XXDA 2GP9B 1TPPA 1MH0A 1SB1H 5JDUB 1DS2E 1RS0A 2A1DB 5AHGH 1BBRK 1MCVA 1P57B 1ZR0A 3PMHB 1WCZA 4MNXA 2W7SA 8LPRA 1FQ3A 3DA9B 3RXEA 1BTUA 1EJMA 3A7TA 1O2VA 2BDBA 1DLEA 1BUIA 3GY7A 1DXPA 2KAIB 4A7IB 2ODPA 1NC6A 1IHTH 4MNVA 3A89A 3ZVCA 1GCTC 1K22H 3MNCA 1SPJA 2K0QA 4DT7B 6CHAB 4ZXYH 1AUJA 4K5ZA 1P11E 1ZPBA 1K21H 3PMJA 1FN6A 1MUEB 1JIMA 5DK1A 1A2CH 1N8OB 1QRWA 3RP2A 2DE9A 1ANDA 5PTPA 3UWIA 4GPGA 1S6HA 1GI8B 1TFXA 1YCPK 1GVKB 1P2IA 4MG3A 2J97A 1Z6JH 5C1UA 1GDUA 2ZNKH 1DWDH 3PTNA 3U9AH 1Z71A 2OTVA 3ZVFA 1ZJDA 2W26A 1A0LA 2P93A 2Y80A 4BAKB 2FOBA 2P8OC 4RKOB 2UWOA 3SUFA 1ARBA 1W14U 1IAUA 3UNRA 3E3TA 4K1TA 2ZGXH 3TH2H 3GCHC 2QGRA 2XCFA 1MTSA 1GPZA 2FX6A 1C5QA 1VGCB 2A7JA 1GBCA 3BG4C 4GUXA 4AGKA 1YP9A 1B7XB 1NN6A 4NZLA 1UHBA 1S6LA 2OBQA 1C2GA 1H1BA 1UTKA 3SN8A 2I6QA 3F3BA 1TA2A 1O2WA 4ABGA 2W3IA 1NFUA 1O5BB 2A4OA 4DOQA 4I8JA 3SU0A 3M7UA 1AI8H 2HPQH 3P6ZB 4FUEA 1Y8TA 2ZIQH 1O39A 3URCA 1TB6H 4VGCB 5DP7A 3LC5A 3SI3H 3WWBA 3RXBA 1FN8A 1F5KU 1UTQA 2WPJS 5JBTA 1IQEA 1AWFH 3FP8E 1YLNA 2ZHEH 3OTPA 3M3VA 1DSTA 4CHAC 4B74A 1GI7B 3LU9B 9LPRA 2BVXH 1AGJA 1NFXA 5EPYA 1GJAB 3M61U 1UTNA 2G4UA 2XCNA 3FOAA 3T27A 1XUHA 2F83A 1CHOF 1L1GA 5T6FA 2ZFQH 1UK2A 4BAQB 2SFAA 1GDQA 1P3CA 1BDAA 2F9VA 2UUKB 4AX9H 2QY0B 3Q3KA 3IITA 5EJLA 3EYDA 6GCHF 1DE7H 1F5LA 3OSYA 2ZKSA 2OCVB 1D3DB 5L2YH 1C2JA 1HJ8A 5C2ZA 2QA9E 3UNQA 2BLVA 3TJNA 3RXOA 4X1RU 2JIZD 2J95A 1BBRH 1DFPA 1AN1E 1AZ8A 1KYNA 1NRSH 2FMJA 1FLEE 4ACBA 4K60A 2V3HH 1HYLA 4A5TS 1SL3A 3AAVA 1CT0E 1O3OA 2BLWA 3KCGH 2ZHQH 1WYKA 3NUMA 1O3EA 1P01A 1C5TA 1GHVH 3SU2A 2W3KA 1B0FA 1RRKA 4I86A 1UK4A 1BTXA 2HPPH 1HUTH 1A4WH 1QTFA 1BTPA 2WV4A 5HM2A 2R9PA 3LIWA 1ABJH 1PPFE 4O3TA 2VH6A 3UUZA 3A8CA 1GBKA 1QB6A 3PWBA 3UTUH 1TGBA 1YCPH 2BMGB 1P09A 4A1TA 3AAUA 1P2MA 3AW0A 1YCPM 2QXGA 2OC1A 1XKBC 3R3GB 4B1TA 1C5SA 4ZHMU 3DD2H 1L2EA 1V2UT 2PW8H 2J98A 1HXEH 1THPB 1BITA 4B2CA 2BQ6B 5JBAS 1A1RA 3FFGA 4ISIH 5HGGA 1ZSJA 3LJJA 1OSSA 1QNJA 4AN7A 2BX3A 3MU4A 5EPNA 3SUGA 1C1VH 1ETSH 2GT8A 2BVSH 4WH8A 2ZU5A 2D26C 3A8AA 3LDXH 1AE8H 1MCTA 3JZ1B 3PTBA 2GD4B 1UVSH 3ZZBA 1C1PA 2M2AA 2ANYA 1AUTC 1XX9A 1EP5A 2G8TA 2R3UA 1O5GH 1FV9A 4D9RA 4WH6A 2XXLA 2GTBA 1J17T 1T8NA 5JBCS 5EJ1A 4Y76A 1ELVA 5T1VA 2O8WA 2FEQH 4ZKNU 1LO6A 1C9PA 4FUIA 4FVBA 3P92A 3BN9A 1Y5AT 4GVUA 4XD7D 1J9CH 1L4DA 5C5NA 2A31A 3GYLB 4IW4E 2FESH 2BDCA 4LOYH 3M3SA 1WTHD 2BDHA 1TGSZ 2FX4A 1ESBA 2FZZA 2OQUA 1ZTKA 1MMJN 2UWLA 2VB0A 1QY6A 2WPDD 4ABEA 2ZHDA 3CP7A 4O03A 2W6JD 1EPTA 2SGDE 1YPEH 3RXUA 2NWNA 4NFEA 4DW2U 2XTTB 5HIYA 3OE7D 3EBNA 3E90B 2HGTH 3UNSA 3H5CB 3BIUH 4LXBH 3F1SB 1S83A 4ABAA 2ZHWH 2BDGA 3MH4A 4NWLA 4ZXXH 2CHAC 4B73A 1UCYK 2ZZUH 1EZUC 4X8SH 1P04A 2FOGA 3LGIA 1DUAA 1MQ6A 1QHRB 1P2JA 1ANCA 4D9QA 4IN1A 2ZDLA 1YPHC 2ZCHP 4Y8YA 1ZGIA 5TCCA 5F6MA 2ZFSA 1JWTA 1PQ7A 2GX4A 1EOLA 1GBAA 2NU3E 1GBTA 5LPFA 2BD4A 5EXNA 3SU5A 2C4FH 3A8BA 1H8ED 3VGCB 2H9HA 1QBOA 4B71A 3UAIC 1HIAA 6LPRA 1O3KA 1FPHH 2L6OA 1BOQA 1DICA 2OXSA 3M5LA 3VB7A 2TGPZ 4Q4LA 1ANBA 2WHXA 3VEQB 3ZIAD 2ZEBA 1O30A 5LGOA 4CRAA 2LPRA 1HJ9A 4JZDH 3BTHE 2Q6GA 1MZAA 3WY8A 4AYYB 1ZSKA 4Y71A 5FX6A 3RXVA 2FM2A 2JETC 4AB8A 1FIZA 2RDEA 1P8VC 1BMNH 1EX3A 3T5FH 2CF9H 1C2HA 1ZTLA 4FUHA 2WPIS 1SG8B 1GVLA 5EW2H 2HNTC 1S0RA 2XNIA 1Z7KA 3M5OA 1JXPA 2H6MA 3Q00A 1P9UA 1O32A 1W0YH 4FU7A 2Z3DA 1J16A 2V0BA 3PWCA 1O3HA 3OEED 3W95A 4CBNA 1SSXA 5E2OA 1O3MA 1QL9A 4YO9A 3F9EA 1QBVH 4WJG2 7LPRA 7GCHG 1A0JA 1LDTT 2ZFTA 1F0UA 2KCOA 4GLYA 1DANH 2AH4X 2YMSB 1BT7A 1UVTH 4JZFH 2Y7XA 3ATLA 2ZHFH 1QURH 1GGDC 3A80A 3PLPA 2C3SA 4H4FA 1GI5A 1K1LA 3NRLA 3ZV8A 1OP0A 1H4WA 1P3EA 2OINA 4X2VA 1MD7A 1FJSA 1IQIA 1MD8A 2KM0A 4DVAU 1O2RA 2VBCA 3GICB 1LQEA 2C90B 2ZDAH 2GMTC 5C1YA 3UOUA 1C5UA 2JKHA 1QFKH 1SOZA 3LGYA 4MLFB 2VIOA 2FS9A 2O8UA 2A5AA 3E1XB 4CH8B 2BY7X 3LONA 1GBJA 3SU3A 1BB0B 2QIQA 2ZGBH 4U2WA 3EGKH 1SLWB 1BHXF 5LH8A 2FWWA 1ZMJA 1B5GH 4K2YA 3SJKA 3L33A 5DPAA 2AIPA 5I46H 1CT4E 2FLBH 1O3LA 5JPMH 2BY6X 2EI6A 4SGAE 4E7NA 3TU7H 2WV9A 4Q63A 1TRMA 1NS3A 1LMWB 5B6LA 2XBXA 1C5VA 2Z3EA 3GCOA 3SZEA 3ODDA 1DWEH 1CBWB 1UCYH 4K8BA 8GCHG 4TY6A 1KTTB 4AYVB 1UHBB 1MAXA 2ILNA 2ZTXA 3SGBE 1TGNA 1CGIE 3TK5A 2H9EH 1P9SA 1FUJA 1T8OA 1A46H 1GJ4H 1MTNB 3B9FH 5F8TA 4B75A 7GCHF 1XVOA 1Y3YA 3FVFB 3TNTA 1PPBH 2TGAA 1ZSLA 2CMYA 2F43B 4AFQA 5FCRA 2AERH 4CH2B 2H5CA 1W10U 1VITH 4ZKOU 1KY9A 3STIA 5GCHG 2P95A 3E8LA 4FU9A 3RXIA 1O2SA 4ISNA 4UONA 3GY2A 3S69A 4Y0YE 3CS0A 1TIOA 2KR7A 2XRCA 2AYWA 3BTQE 3V13A 4XBBA 1G32B 1QQUA 1TNIA 2IN2A 2QXJA 2SNVA 4OGYA 3KQEA 3I29A 1EB2A 3O8BA 3F6UH 4JYVH 3RC6A 1TBRH 1BMLA 1C1RA 4ZUHA 3E0PB 1BTYA 3MNXA 1FY3A 3HATH 2ZGCA 1DT2A 2ALPA 3ATKA 3MFJA 3EE0B 4FU8A 1V2NT 1BHXB 1HGTH 5DKMA 1BRBE 1YPLH 1F2SE 4ACAA 2G51A 1WAYB 1GMDG 2PLXA 1W0ZU 1SOTA 1RD3B 3SQEE 1EAIA 1ORFA 1KLJH 1O2ZA 1C1WH 2BOHB 2F9OA 3VFEA 3KQ5A 1E79D 3TITA 1G30B 1MKXK 1ZLRA 4DIHH 3BV9B 4Y0ZE 3ZZAA 1RXPA 1EJAA 1XUGA 1BTWA 1YM0A 8GCHF 1EFRD 4KP0A 3P8NA 1E1QD 1MBMA 3DSOA 5C20A 1N1LA 2B0FA 4ZMAH 3BEFB 1GJ9B 2ODQA 5GXPA 1DY8A 1P10A 3U8OH 1O31A 1SMFE 4RKJB 5HMAA 1E1RD 3TGKE 1G3EA 4MDSA 1AB9C 2VIVA 2ZG0H 4B2AA 5FBIA 3UQOA 1RFNA 1SQOA 2VWLA 5FPSA 4AGJA 2OC8A 4NGAH 5A09A 1NFYA 2AMPA 2K7XA 1TPSA 2G5VA 5TJXA 1HCGA 3ZZ7A 2QV1A 3U69H 3NKKA 1J15A 3SGQE 4D7GA 3DT0H 4BTTB 2TGDA 1OS8A 5F8ZA 2V35A 3STJA 1LPZB 4TY7A 4YESB 1UW7A 2AGGX 1YPJH 1GG6C 1SGEE 5C5OA 4HZHA 1BJUA 1LKAA 1O3GA 4RI0A 2OUAA 3AVZA 2Q6DA 3LJOA 1HB0B 3P70B 1O2MA 1K1PA 1GBHA 1DPOA 3PROA 1DVAH 2HWLB 1FIWA 1NY22 1AFEH 1MTVA 3SNDA 3P17H 5A8YA 1JBUH 1UMAH 2PKSB 1D6RA 4ABBA 1NBME 3I78A 4FXGH 3RC4A 1G2MA 2KZ4A 1CO7E 3UY9A 1GI0A 1FY5A 5C0UA 3QZRA 3N7OA 4TPIZ 1GWAA 4I8HA 5T6GA 3HK3B 2P16A 1PPCE 2R2WU 2ZO3H 4XE4A 3RM0H 2C8XB 6CHAC 4HI3A 2A4QA 3VB5A 2QC2A 1GI4A 1QA7A 1GMHG 4Z1MD 1N8OC 5GNDA 2QCYA 1AY6H 1E0FD 3RU4E 1IHSH 1TX7A 1XKAC 1TOMH 3NK8A 3SU1A 2ZI2H 1BJVA 4GSOA 3SI4H 1O2HA 2BLQA 2RG3A 2XYAA 3FZZA 2STBE 1O38A 4Z6AH 3OY6U 2FOCA 3ZZCA 4AZ2B 3LKWA 1EPTB 1HAVB 4MQAA 4YM9A 1YY3A 5HYOA 1O2QA 3SU6A 2ZECA 2WPMS 3TJUA 1TOCB 1TBQH 1GCDA 2A2QH 3MNSA 3IG6B 1QJ6B 2D8WA 3HPTB 7ESTE 1HJAB 3ZZ9A 1O2NA 1TPAE 2VJ1A 1MQ5A 3F0OA 1ZMLA 4GCHF 3GY5A 2VH0A 3SBKA 1S81A 1V2KT 5AFYH 1C1TA 1CHOG 1TNKA 5F8XA 4JCNA 2ZDNA 1OWDA 1SGIB 2BYAX 1EZXC 1O34A 3PO1B 1GI3A 3VXFH 1O0DH 6GCHG 1O33A 1ID5H 3M7TA 5I25A 4F49A 1LVYA 2BY9X 3UWJH 3GOVB 1C4U2 1SKYE 1ELTA 1GL0E 1MKXH 3ZZ5A 1GBDA 3Q77A 2PSYA 4X6PA 2D1JA 3ZV9A 3TNSA 2XC5A 3RU4D 1A3EH 2Z9GA 4VGCC 3U8TH 1LHEH 1HRTH 2GVFA 2F91A 3AASA 1A5HA 1GJBB 4QT8C 1LKBA 1V2PT 4YOGA 1GJ7B 1AVWA 5E2PA 5FXLA 2QXHA 5E0GA 1Z8IB 1GBMA 2GZ7A 2PKAA 2CN0H 1GBEA 2RA3A 4MNYA 1QBNA 4BXWA 1GHBG 4YT7H 1GL1A 2XBYA 4A1VA 1UVPA 1P0SH 1GMHF 3FP7E 5F53A 3RM2H 4I8LA 3BF6H 1SR5C 1T32A 2P3UB 2ALVA 1C5MD 1A7SA 4XRNA 2ZGJA 4X6NA 4UDWH 2XBWA 3A7ZA 1KDQA 2FIRH 3UR9A 5KGOA 1EZQA 1K9OE 2FI3E 1HAHH 1MZDA 2LNCA 2O9QA 1AD8H 4ZH8A 3F2FA 3FAOA 1EAUA 3KQDA 2V6NA 2RCEA 3SQHE 4JYTA 5BPEA 1HAPH 1FAKH 3SV6A 1V6DA 1SHYA 4R8TB 3MU8A 2Z6BD 3AW1A 2B8OH 1C5NH 1WU1A 2A5KA 3NWUA 1QA0A 3PLBA 2FPZA 3TLOA 2VVUA 2THFB 5DN6D 1SGFG 1HAYB 3EA9A 1JRTA 1FNIA 1LPKB 2FYRA 3ELAH 4DY7B 3ZZDA 1FY8E 3VXEH 3TJVA 4DT4A 1ZJKA 1WSSH 6ESTA 5H4IB 3A84A 5FPTA 3GY8A 1NZQH 4X8TH 2Y82A 2TIOA 1VZQH 4IC5A 5C3NA 2G55A 4GAWA 1O2JA 1V2QT 4LZ4B 1DWBH 3K6YA 1KSNA 2M5TA 4IGDA 5IK2D 1QB9A 1P03A 3F68H 2GKVE 1G37A 2ZTZA 2H2ZA 1Y5UT 1SQRA 1WV7H 3VB6A 4THNH 4X0WU 1K28D 1C2LA 2FO9A 3PMAB 4K69A 1O5CB 1TMUH 4NFFA 2FOAA 1GHBF 1S0QA 1XUKA 1O3IA 3QZQA 1NO9H 4A6LA 4BAHB 3TK6A 3SNBA 3PB1E 2GDDA 5EQQA 4KGAA 2ULLA 1SVPA 1OXGA 1G3CA 2GCHF 2G4TA 3EE7A 1Y3XA 4IN2A 1ANEA 1GHWH 1CA0B 3MO6A 5FCKA 4NCYA 2TRMA 4XBDA 4CRDA 3PV4A 3F2HA 2A2XH 3TPIZ 4OM9A 1GDNA 3S9CA 5EIYA 5FHTA 5DP4A 3TGJE 1UTMA 4B2BA 1P12E 3PRDA 2BZAA 3UREA 3RC5A 2VU8E 5CDFE 1ZRBA 2ZCKP 4SGBE 2OC0A 1CVWH 4E06H 1TNGA 3BG8A 1FZZA 4F4OC 1J8AA 1XVMA 1VJAU 3DSGA 3TIUA 2J34A 1EXFA 1UO6A 1DLKB 3SJIA 2KCAA 4WY3A 4I33A 2R0KA 2PUXB 1O35A 4U01A 1PQ8A 1TNHA 4BNRA 2ZQ1A 1TQ0B 3TVJB 4KELA 3T28A 1GHZA 1HBTH 2BTCE 3MH6A 1PYTD 1FPCH 4AFZA 4J2YB 2A7HA 1SGCA 4NSVA 2VWOA 5DSFA 4Q7YA 4A92A 1CT2E 3DUXH 3JZ2B 2FXRA 1O3PB 2FOFA 2HOBA 3LOXA 3PLKA 2OP9A 2F4LA 5EJZA 2WZQA 5E0HA 5J4QA 3GDSA 1TNJA 2WPHS 2ZF0H 1XUJA 3BEIB 1E34B 1O2XA 1UTOA 2F9NA 2L74A 4KKDA 4WXIA 1AFQB 3ATWA 1PQAA 1ZHPA 1EQ9A 1SGRE 2O8LA 3RXFA 1CE5A 5DJ7A 1G3BA 1KLIH 1ZHRA 4YLQH 1ELDE 1W0JD 3A86A 1VJ9U 3CS7A 3MNBA 4X6MA 1LHFH 2BQWB 1UTJA 5ESTE 2YMSD 1AQ7A 4ABIA 3GISB 2BZ6H 2W7UA 3VGCC 4INKA 1YC0A 2SGPE 1W7XH 1O2PA 1IQGA 3PYHA 2VIDA 1BTHH 2RA0A 3FKSD 1O3DA 1O2LA 4X1PU 1K1OA 1ESTA 3KNXA 1PYTC 1H9HE 1MAYA 2A32A 1RJXB 4DJZB 1KLTA 2H9TH 2ZWLH 1RTKA 5DP8A 3U1JB 1ELFA 3LPRA 1S6FA 4DGJA 2R3YA 1O3FA 3GDVA 4WMDA 1D3PB 1SLUB 1XXFA 3GY3A 2EQNA 5L30H 3RMOH 4DIIH 4X8VH 1PPZA 5K0HA 1TRNA 2PTCE 4Y11E 2FOHA 4B6EA 1PFXC 3VB3A 1CGJE 1TWXB 3UQVA 2VNTA 3A82A 1UJ1A 4NA9H 2FI5E 4WMFA 4CREA 1ZPZA 2XC0A 2YMSC 4M7GA 1W12U 4IMQA 1J14A 3BTDE 3H09A 3H7OA 3ZVGA 1TNLA 3FO8D 2WPKS 1TALA 1RTFB 3PV2A 4ZAEA 4JK6A 3GY6A 5AF9H 4NSYA 4CRCA 3HGNA 3EDXB 1H9LB 4I31A 3RXMA 1B0EA 1ELBA 1VCWA 2CGAA 4NA7A 2KCPA 4WF8A 5HXFA 1QJ7B 1O2GH 2ODYB 3G01A 1KMHB 1IQHA 2FOMB 1DM4B 3O8CA 1FY1A 1DWCH 3KIDU 1T31A 1NU9A 1JOUB 4ZKRU 2XWBI 2FS8A 3URDA 1OHHD 1NRRH 3ZZ8A 3UFAA 3RLYH 1UTPA 1GI2A 1Z8GA 4YZUA 5EOKA 2BD2A 4Y6DA 3ZVEA 1OP2A 2VWNA 1ZHMA 1Q31A 2SGFE 1MKWK 1C5RA 3S9AA 4HGCA 3SZNA 4CRBA 3IWMA 1LHGH 3V3MA 1GI6A 1GVZA 2GJGA 3T26A 2QF3A 3D23A 2VVCA 4CR9A 1P05A 5BRRE 2GGVB 2J9NA 2JETB 3BEUA 5C17A 3UIRA 2P94A 3ZZ6A 1CBWC 1X7AC 5CHAB 2J94A 1O3CA 4R0IA 3BTFE 1C5LH 2JH6D 3Q3YA 2IPQX 4O97A 4ZROA 1GBBA 2SGEE 1MTNC 2PWXA 1SC8U 1O3JA 1OWIA 1MU8B 4YOJA 2BM2A 3MO3A 3M7QA 1C5YB 1C2MA 1AE5A 2YOLA 1Z1IA 1FMGA 4NG9H 1T7CA 2VGCC 3OFND 2AHME 1LTOA 1FDPA 1ARCA 3SU4A 1F0SA 1LQDB 1RIWC 3RXHA 4YOIA 5HM9A 5EGMA 5ETXA 3SHCH 1Y3WA 1DY9A 3RMLH 2FP7B 4D76A 2Y7ZA 2PKAB 2OC7A 1C5ZB 3N7DA 1HAZB 1YPKH 1CGHA 2BD7A 2FOEA 3C27B 1V2WT 4UD9H 4OS7A 3LC3A 4OS5A 4RSPA 3T29A 4X2XA 1V2RT 4IS5A 2G5NA 1O3NA 3W94A 2A45B 1T4VH 1UK3A 1LVMA 3RXDA 2OLGA 1C2DA 2NU2E 3GCNA 4CRFA 2J38A 1KDQB 5FBEA 4D7FA 2XWAA 4XSKU 2B5TB 3GCTG 1Y3UA 2JJ2D 2AFQB 1ELGA 1VITF 7KMEH 1THSH 3QLPH 2PV9B 4RT1A 1DITH 2GCTB 2FTMA 1Q2WA 2ZU3A 3RXKA 1YPGH 3LGUA 2ZU4A 3SJ8A 3U1IB 3M36A 1TLDA 2JJ1D 1ZZZA 4DURA 1Z8RA 1MU6B 4WXVA 1S82A 1FY4A 3U98H 2WINI 3QDZB 3A83A 2PTNA 2ZGHA 2BD5A 1GJ5H 1O36A 4GHQA 4NIVA 3LGWA 2IPHA 1DDJA 4Y10E 4X1SU 1N6YA 1V2LT 2J2UA 3N99A 1QIXB 1ETTH 3SNCA 2Y6TA 1F7ZA 1WTGH 5C1XA 1AVGH 1W2KH 2UWPA 3KYFA 2BB4A 4K8YA 1PPEE 1OOKB 1C4V2 1TX8A 4BTIB 2XOKD 1N6XA 4Q80A 2QF5A 1IQNA 5K7RA 3FN8A 1EP6A 2B9LA 1NT1A 2PKSC 1EZSC 2UUYA 3LGTA 4UE7H 1ACBE 1DX5M 1EB1H 4UEHH 2B7DH 3QWCH 5HIZA 4GCHG 4F48B 1AVXA 1FONA 3K2UA 3S7KB 2HVXA 1Z6EA 3PV5A 4Y7BA 3M5NA 3TH4H 3GCTF 3OYPA 3RUOA 3QK1A 2J98B 2GV7A 1Q3XA 1DOJA 1ZOMA 1YBWA 3EA8A 4MPWA 5AFZH 1BTZA 2V3MA 2C8YB 2CXVA 1FI8A 1SGFA 4HTCH 5L2ZH 1A3BH 4ZKSU 1EATA 4U32A 4AFUA 1A0HB 3D62A 1ELEE 5J4SA 3NPSA 2AGEX 1QGFA 4TYDA 3QO6A 4FUFA 1KXAA 1GMCG 3RXTA 3SV2H 4X2WA 2GDEH 3PM3A 3RDZA 4BANB 2Y81A 1WBGB 1C2EA 3A85A 1W11U 1HJAC 1C9TA 1YWUA 3MWIU 3BTKE 1GJ8B 4INLA 4BTUB 3S7HB 3MMGA 1CU1A 3UR6A 3BTEE 5E8EH 1EOJA 1C2IA 1JMOH 1SI5H 2OQ5A 2RFKC 2BY5X 1AWHB 3BSQA 2F9UA 3LH1A 3PRBA 4FUDA 1ZMNA 4FOUC 3PO1C 1KXFA 1SFQB 1V2MT 3SYJA 3SORA 3NZIA 2BY8X 1OWKA 3CENA 2FLRH 3KYGA 1V2VT 2ZC9H 3BTGE 2DE8A 2P3TB 2ZTYA 4KTSA 1F5RA 3LT3A 4ZHAA 1NBMD 1VGCC 3P8OA 4JYUH 2EI7A 2IJD1 2H5DA 1VR1H 4ABDA 3ZYDA 5GDSH 5ABWA 3T25A 4H6SB 1SQTA 3DFLA 1QZ8A 5HKKD 1TONA 1QL8A 4FUCA 1HIAB 1WQVH 1AKSA 5AVDA 1LVBA 1YLCA 4X1NU 2BX4A 1GMCF 2A0QB 1AHTH 1PPGE 5A0AE 1D3QB 2C8WB 2BDYA 2PUQH 1PPHE 3KF2A 1DXWA 1GHAG 2VIQA 3LGVA 4FETA 1D6WA 3NCLA 2Q6FA 4AORA 1O5FH 3M35A 2G00A 3SV8A 2LELA 2BDIA 4Q7ZA 5DG6A 1O2OA 3KQCA 1GCTB 2BD8A 1O3AA 4OS2A 1E36B 1SFIA 3C1KA 1CSOE 3KGPA 2YNAA 2GCHG 1P2NA 5GWZA 4K1EA 5ESBA 3OX7U 4O3UA 5A2MH 1NU7B 3DFJA 3ODFA 3TJOA 1F92A 3RXRA 1QRZA 2PFEA 1P06A 3ITIA 5DP6A 1HAIH 2BLOA 2PHBA 2R2MB 1L1NA 1L0ZA 2EA3A 2OBOA 1BBRE 4INHA 3U8RH 2V3OH 1HV7A 1YYY1 4HG6A 1E35B 1K0HA 3HGPA 5GIBA 1INCA 1EAXA 4AC9A 1KXBA 2P8OB 3SJ9A 3ENSB 5T3HA 2HLDD 3MU1A 5GPIB 3A81A 3GCHB 2W5EA 1BIOA 2PGBB 3ATIA 3BG4B 2ZDVH 1DUEA 3OY5U 1P2QA 1MBQA 2O8MA 5C0TA
chains in the Genus database with same CATH topology
4MPUA 3SO3A 3QUMP 1K1NA 1CA0C 4CRGA 1EAWA 1JRSA 5JB9S 3D49H 1F0TA 4WVPE 5A8ZA 4E05H 1O2KA 2TBSA 2GZ8A 1TRYA 5EXLA 4CBOA 3VPKA 3O8DA 4U30A 1GHAF 4ISOA 4HFPB 2ASUB 1OKXA 2EC9H 4XFQA 2G52A 3F9FA 4TWYA 3E0NB 4J1YA 2EEKA 4ABFA 4XOJA 3RU4T 1CHGA 3M37A 4JZIA 4CHAB 1TMTH 2ANKH 4B76A 4WMEA 3MO9A 1YLDA 3ZVDA 1VCQA 4X2YA 4GHTA 1AU8A 4ISLA 5FAHA 5EQRA 1QQ4A 4KTUA 2C93B 3GY4A 2ZU1A 1W3CA 2RDLA 3UPEA 1P02A 1YPHE 4OS4A 1XMNB 4Y8ZA 1HAOH 1C5WB 3I77A 1EASA 1Z1JA 3A8DA 1K1MA 3ZVAA 3ZZ4A 4AG2A 3ZVBA 4Q7XA 4CR5A 3SUEA 1QR3E 1AFQC 1F0RA 4JZEH 2HALA 1LVOA 2XW9A 5DO4H 1TX6A 1HFDA 3DHKH 3SOSA 1BA8B 2D2DA 2DUCA 1TPOA 1IQKA 1IQFA 1C5OH 1BMAA 3ESTA 1BRUP 2VIWA 2SNWA 4UFFH 1C1OA 3T62A 4MPVA 4IBLH 3MTYA 3B23B 3MU0A 3TK9A 1H8DH 1SLVB 3SGAE 3L3TA 2WUBA 4RN6A 4BOHA 2R0LA 1CQQA 3ZYEA 2GT7A 5EG4A 1NROH 1MTUA 2ZPRA 3HKIB 5SGAE 1KTSB 2HNTE 1O2IA 2FI4E 2A4RA 3BTWE 2ZCLP 1A5GH 4DG4A 1OPHB 3F9GA 2BXTH 4MTBA 1O5EH 4ABHA 3RXGA 2BOKA 4BAOB 2HRVA 1GBIA 4LZ1H 4NIWA 1O3BA 1TGTA 2EI8A 4IC6A 3OU0A 2ESTE 2Q1JA 1GI9B 3FP6E 2VIPA 2FTLE 1KXEA 3O8RA 1LPGB 2J4IA 1WUNH 2ZA5A 4MVNA 2AEIH 4UFEH 1S5SA 3HK6B 3K65B 2BHGA 1ABIH 1EKBB 1XM1A 2ZPSA 3RXSA 2GZ9A 4LK4A 1W7GH 1HAVA 1C1QA 1NFWA 4TPYA 2KAIA 3NXPA 4PROA 1ZYOA 1TAWA 2QAAA 1V2TT 1V3XA 1LHDH 1LCYA 3FZDA 2CJIA 1SGYE 2UUJB 2ZPQA 2VWMA 5GJ4B 1GJCB 3QTOH 3RXPA 1EJNA 4AFSA 4JMYA 4ISHH 3SV7A 1EUFA 1RTLA 2UUFB 4NIYA 3V0XA 2J92A 3SNAA 1TMBH 1W8BH 1VCPA 1SQAA 2QYIA 4Y79A 1QL7A 4K1SA 2HNTF 4NZQA 2ANMH 1ELCA 3A7XA 1IQLA 1BCUH 5A0BA 1PJPA 4UFDH 1JIRA 1SGTA 4DCDA 5CE1A 3E6PH 3ZZ3A 1KXDA 4O9VA 2FODA 1NESE 1QJ1B 2CF8H 3QX5H 8ESTE 1NRPH 1OP8A 2ZDMA 3Q3XA 3QGNB 4ZHLU 2VVVA 1BZXE 2CHAB 2A5IA 1NRNH 2PSXA 3A88A 3KN2A 3RMMH 3RXCA 2A4GA 3ATMA 1ELAA 1HAXB 1Z8JB 3SJOA 1BQYA 1U6QA 3B8JA 5IYTA 2AGIX 5DP9A 4TWWA 4X6OA 5CHAC 3KHVA 1PQ5A 2WYGA 4E7RG 1HLTH 1H9IE 1GI1A 1MTWA 2NU4E 4YLUA 5A0CA 1O5DH 4FUBA 4D8NA 5JYIA 1IQJA 2ZFRH 5L6NH 1NRQH 1YF4A 1OWEA 2LIZA 1HDTH 1T4UH 3QTVH 1OX1A 1ZPCA 3HKJB 4OS1A 2IJOB 5IDKA 1C1UH 4YT6H 1UCYE 3KEEA 3E16B 1VITG 4OGXA 5LPEA 4I7YH 1L4ZA 1XUIA 1OWJA 1GHYH 1AO5A 4XBCA 1O2YA 1KXCA 1GBFA 1G3DA 2A7CA 2K1QA 2XC4A 3A87A 1V2OT 5EW1H 1RGQA 1M9UA 3SW2B 3TGIE 2P59A 3K9XB 1T8LA 5JB8S 3P95A 4I8GA 1D9IA 2TGTA 1AKSB 3RXQA 2ANWA 1OWHA 1OYTH 1ZTJA 4FUGA 4MNWA 2NU0E 1Y5BT 2WPLS 3RLWH 1LHCH 4XDEA 1V2ST 3EQ0H 1H8IH 1GGDB 2NU1E 3VB4A 1C2KA 1O2TA 3OTJE 4FVDA 3M3TA 4NIXA 2STAE 1ESAA 1NTPA 1HPGA 3QN7A 1P2KA 2Z3CA 1YGCH 3A7YA 3GYMA 1SGDE 2Z9KA 1TGCA 2P3FH 1D4PB 2YNBA 2AMQA 1T8MA 1C1NA 1NPMA 1G9IE 1TABE 4ABJA 4JZ1A 3A7VA 2GCTC 1UTLM 1D3TB 2WV5A 2GMTB 3V7TA 3L6PA 5TCAA 4I8KA 2O8TA 4FUJA 1A61H 1ZGVA 3TH3H 1TBZH 1C5XB 1G36A 3PMBB 5FX5A 3QGJA 1E37B 4Q2KA 3P8FA 1L1JA 5E0JA 3P8GA 3RXJA 5EQSA 3Q76A 1A5IA 2PR3A 2G81E 3SUDA 5C67A 5EU8A 5F03A 4UFGH 3SV9A 2FYQA 1FXYA 2IOTA 2Z9JA 1XUFA 1C2FA 2VGCB 4JK5A 2Z9IA 2Z94A 2VINA 3MI4A 1P2OA 4X8UH 1RIWB 1YKTA 3BIVH 2BDAA 2TPIZ 3LH3A 1HAGE 2SGQE 4NWKA 2BQ7B 2Z9LA 1SGNE 3RMNH 3E91A 3M5MA 4BXSA 4Z0KA 1TYNA 1S84A 2BXUH 4ESTE 2OD3B 3KL6A 1DSUA 2JH5D 3R0FA 1OYQA 1TQ7B 1IOEA 3RXLA 3V12A 3MU5A 3A7WA 4KTCA 2WYJA 2ZDKA 2WUCA 3SNEA 4NA8A 2BD3A 2ZU2A 2F9BH 2ZFPH 5FPYA 1O37A 1K2I1 2QN5T 4OS6A 4X1QU 1FAXA 1UVOA 3UOPA 3H7TA 4H6TA 1MKWH 2AS9A 1BMMH 3K6ZA 3MYWA 1QRXA 4BAMB 3RXAA 1GHXH 3GDUA 4A1XA 2QXIA 2Z7FE 2AMDA 1CA8B 5EODA 1AZZA 1WQSA 2Y5GA 4K3JA 2JH0D 2ZFFH 5A8XA 1SGQE 4I32A 1HNEE 1NM6A 1O5AB 2BD9A 1Y59T 1QB1A 4YTAA 4IMZA 5DP3A 2ZQ2A 4AB9A 1C5PA 1K1IA 1SBWA 2Y5HA 2ZP0H 3MH5A 5GCHF 5G4BA 5T6DA 3EA7A 2FDAA 1GBLA 1THRH 3F9HA 2HLCA 3EAJA 2GV6A 1KIGH 2QF0A 3S9BA 1SGPE 3BTME 1S85A 1ETRH 3FANA 4WWYA 2CV3A 8KME2 1QCPA 2PGQB 5CMXH 1GJDB 3S0NA 1EPTC 1SHHB 4ASHA 2BVRH 2I6SA 3MHWU 1C4Y2 5DGJA 2SGAA 1G2LA 5EXMA 1TE0A 1TA6A 2Y5FA 1UVUH 1AB9B 1AMHA 3SHAH 1W13U 4AG1A 1ZRKA 1BRAA 4Y7AA 5JBBS 1SLXB 2AIQA 9ESTA 5DP5A 1C1MA 5LPRA 1C1SA 3MOCA 1V2JT 1GMDF 4AOQA 2XBVA 1YPMH 1E38B 1WOFA 3BTTE 1GJ6A 1Y3VA 2F3CE 2F9PA 3D65E 4MPXA 1O2UA 3MH7A 1HXFH 1IQMA 1GG6B 2C8ZB 1K1JA 5B6OA 1BRCE 4H42U 2H1UA 3KQBA 4Y8XA 3T2NA 1AIXH 1XXDA 2GP9B 1TPPA 1MH0A 1SB1H 5JDUB 1DS2E 1RS0A 2A1DB 5AHGH 1BBRK 1MCVA 1P57B 1ZR0A 3PMHB 1WCZA 4MNXA 2W7SA 8LPRA 1FQ3A 3DA9B 3RXEA 1BTUA 1EJMA 3A7TA 1O2VA 2BDBA 1DLEA 1BUIA 3GY7A 1DXPA 2KAIB 4A7IB 2ODPA 1NC6A 1IHTH 4MNVA 3A89A 3ZVCA 1GCTC 1K22H 3MNCA 1SPJA 4DT7B 6CHAB 4ZXYH 1AUJA 4K5ZA 1P11E 1ZPBA 1K21H 3PMJA 1FN6A 1MUEB 1JIMA 5DK1A 1A2CH 1N8OB 1QRWA 3RP2A 2DE9A 1ANDA 5PTPA 3UWIA 4GPGA 1S6HA 1GI8B 1TFXA 1YCPK 1GVKB 1P2IA 4MG3A 1Z6JH 5C1UA 1GDUA 2ZNKH 1DWDH 3PTNA 3U9AH 1Z71A 2OTVA 3ZVFA 1ZJDA 2W26A 1A0LA 2P93A 2Y80A 4BAKB 2FOBA 2P8OC 4RKOB 2UWOA 3SUFA 1ARBA 1W14U 1IAUA 3UNRA 3E3TA 4K1TA 2ZGXH 3TH2H 3GCHC 2QGRA 2XCFA 1MTSA 1GPZA 2FX6A 1C5QA 1VGCB 2A7JA 1GBCA 3BG4C 4GUXA 4AGKA 1YP9A 1B7XB 1NN6A 4NZLA 1UHBA 2OBQA 1C2GA 1H1BA 1UTKA 3SN8A 2I6QA 1TA2A 1O2WA 4ABGA 2W3IA 1NFUA 1O5BB 2A4OA 4DOQA 4I8JA 3SU0A 3M7UA 1AI8H 2HPQH 3P6ZB 4FUEA 1Y8TA 2ZIQH 1O39A 3URCA 1TB6H 4VGCB 5DP7A 3LC5A 3SI3H 3RXBA 1FN8A 1F5KU 1UTQA 2WPJS 5JBTA 1IQEA 1AWFH 3FP8E 2ZHEH 3M3VA 1DSTA 4CHAC 4B74A 1GI7B 3LU9B 9LPRA 2BVXH 1AGJA 1NFXA 5EPYA 1GJAB 3M61U 1UTNA 2G4UA 2XCNA 3T27A 1XUHA 2F83A 1CHOF 1L1GA 5T6FA 2ZFQH 1UK2A 4BAQB 2SFAA 1GDQA 1P3CA 1BDAA 2F9VA 2UUKB 4AX9H 2QY0B 3Q3KA 3IITA 3EYDA 6GCHF 1DE7H 1F5LA 3OSYA 2ZKSA 2OCVB 1D3DB 5L2YH 1C2JA 1HJ8A 5C2ZA 2QA9E 3UNQA 2BLVA 3TJNA 3RXOA 4X1RU 2J95A 1BBRH 1DFPA 1AN1E 1AZ8A 1KYNA 1NRSH 2FMJA 1FLEE 4K60A 2V3HH 1HYLA 4A5TS 1SL3A 3AAVA 1CT0E 1O3OA 2BLWA 3KCGH 2ZHQH 1WYKA 3NUMA 1O3EA 1P01A 1C5TA 1GHVH 3SU2A 2W3KA 1B0FA 1RRKA 1UK4A 1BTXA 2HPPH 1HUTH 1A4WH 1QTFA 1BTPA 2WV4A 5HM2A 2R9PA 3LIWA 1ABJH 1PPFE 4O3TA 2VH6A 3UUZA 3A8CA 1GBKA 1QB6A 3PWBA 3UTUH 1TGBA 1YCPH 2BMGB 1P09A 4A1TA 3AAUA 1P2MA 3AW0A 1YCPM 2QXGA 2OC1A 1XKBC 3R3GB 4B1TA 1C5SA 4ZHMU 3DD2H 1L2EA 1V2UT 2PW8H 1HXEH 1THPB 1BITA 4B2CA 2BQ6B 5JBAS 1A1RA 3FFGA 4ISIH 5HGGA 1ZSJA 3LJJA 1OSSA 1QNJA 4AN7A 2BX3A 3MU4A 5EPNA 3SUGA 1C1VH 1ETSH 2GT8A 2BVSH 4WH8A 2ZU5A 2D26C 3A8AA 3LDXH 1AE8H 1MCTA 3JZ1B 3PTBA 2GD4B 1UVSH 3ZZBA 1C1PA 2ANYA 2G8TA 1AUTC 1EP5A 1XX9A 2R3UA 1O5GH 1FV9A 4D9RA 4WH6A 2XXLA 2GTBA 1J17T 1T8NA 5JBCS 4Y76A 1ELVA 2O8WA 2FEQH 4ZKNU 1LO6A 1C9PA 4FUIA 4FVBA 3P92A 3BN9A 1Y5AT 4GVUA 1J9CH 1L4DA 5C5NA 2A31A 3GYLB 4IW4E 2FESH 2BDCA 4LOYH 3M3SA 1WTHD 2BDHA 1TGSZ 2FX4A 1ESBA 2FZZA 2OQUA 1ZTKA 1MMJN 2UWLA 2VB0A 1QY6A 4ABEA 2ZHDA 3CP7A 4O03A 1EPTA 2SGDE 1YPEH 3RXUA 2NWNA 4NFEA 4DW2U 2XTTB 3UNSA 3EBNA 3E90B 2HGTH 3H5CB 3BIUH 4LXBH 3F1SB 1S83A 4ABAA 2ZHWH 2BDGA 3MH4A 4NWLA 4ZXXH 2CHAC 4B73A 1UCYK 2ZZUH 1EZUC 4X8SH 1P04A 2FOGA 3LGIA 1DUAA 1MQ6A 1QHRB 1P2JA 1ANCA 4D9QA 4IN1A 2ZDLA 1YPHC 2ZCHP 4Y8YA 1ZGIA 5TCCA 5F6MA 2ZFSA 1JWTA 1PQ7A 2GX4A 1EOLA 1GBAA 2NU3E 1GBTA 5LPFA 2BD4A 5EXNA 3SU5A 2C4FH 3A8BA 3VGCB 2H9HA 1QBOA 4B71A 1HIAA 6LPRA 1O3KA 1FPHH 1BOQA 1DICA 2OXSA 3M5LA 3VB7A 2TGPZ 3VEQB 1ANBA 5LGOA 2ZEBA 1O30A 4CRAA 2LPRA 1HJ9A 4JZDH 3BTHE 2Q6GA 1MZAA 3WY8A 4AYYB 1ZSKA 4Y71A 5FX6A 3RXVA 2FM2A 2JETC 4AB8A 1FIZA 1P8VC 1BMNH 1EX3A 3T5FH 2CF9H 1C2HA 1ZTLA 4FUHA 2WPIS 1SG8B 1GVLA 5EW2H 2HNTC 1S0RA 2XNIA 1Z7KA 3M5OA 1JXPA 2H6MA 3Q00A 1P9UA 1O32A 1W0YH 4FU7A 2Z3DA 1J16A 2V0BA 3PWCA 1O3HA 3W95A 4CBNA 1SSXA 5E2OA 1O3MA 1QL9A 4YO9A 3F9EA 1QBVH 4WJG2 7LPRA 7GCHG 1A0JA 1LDTT 2ZFTA 1F0UA 4GLYA 1DANH 2AH4X 1BT7A 1UVTH 4JZFH 2Y7XA 3ATLA 2ZHFH 1QURH 1GGDC 3A80A 3PLPA 2C3SA 4H4FA 1GI5A 1K1LA 3ZV8A 1OP0A 1H4WA 1P3EA 2OINA 4X2VA 1MD7A 1FJSA 1IQIA 1MD8A 4DVAU 1O2RA 3GICB 1LQEA 2C90B 2ZDAH 2GMTC 5C1YA 3UOUA 1C5UA 2JKHA 1QFKH 1SOZA 3LGYA 4MLFB 2VIOA 2FS9A 2O8UA 2A5AA 3E1XB 4CH8B 2BY7X 3LONA 1GBJA 3SU3A 1BB0B 2QIQA 2ZGBH 4U2WA 3EGKH 1SLWB 1BHXF 5LH8A 2FWWA 1ZMJA 1B5GH 4K2YA 3SJKA 3L33A 5DPAA 2AIPA 5I46H 1CT4E 2FLBH 1O3LA 5JPMH 2BY6X 2EI6A 4SGAE 4E7NA 3TU7H 1TRMA 1NS3A 1LMWB 2XBXA 1C5VA 2Z3EA