3VB4A

Crystal structure of sars-cov 3c-like protease with b4z
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 83
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb4A02
4NSYA 1TGBA 1DITH 3MU1A 2FTLE 2AFQB 2FP7B 1AI8H 1UHBB 2WYGA 4Y0YE 3U98H 1TRNA 1C5MD 3KQBA 4D9RA 4FU9A 3SGAE 1OWDA 2CF8H 3ZZ6A 1AWFH 1C5XB 2ZG0H 1C5PA 1G3DA 5JBCS 2GV6A 2I6SA 2O8LA 1BB0B 2ANWA 2Y81A 5EW1H 2B7DH 2ZPQA 3RXQA 3UY9A 4X8TH 3MO3A 3SW2B 1TGCA 4A5TS 2P95A 4ISHH 1KSNA 2ZFQH 4AB9A 1CVWH 2C93B 2PKSC 4FUEA 1LCYA 2VGCC 1K1MA 1KTTB 1AFQC 4ABAA 2A4OA 2EEKA 1Y3UA 1TA6A 1JRSA 2PV9B 3RUOA 3RXVA 1W7GH 3RXUA 5AF9H 2BDCA 4LK4A 5ETXA 1C1TA 2P16A 3ZYDA 2BY9X 2AMPA 4X8VH 1NFWA 1A61H 2G55A 4OS2A 4YLUA 2A7HA 2PFEA 2A31A 3RXDA 4NIWA 4ZKNU 3N7OA 2G4TA 2HALA 4Y7BA 5DP5A 4FUIA 2FESH 2ESTE 1F0RA 4AFUA 3M37A 3MU0A 1VITF 1C1VH 5FCKA 3RMLH 1MCTA 4ABHA 1F0UA 1TRYA 4JCNA 5GWZA 4F4OC 1O3CA 1SGQE 2ODPA 2FOBA 2Q6GA 5AFYH 4I8GA 4Q7XA 1CA0B 1P11E 5HGGA 1H9IE 5AFZH 5C20A 3RLYH 1FI8A 1VGCC 1J16A 1BZXE 3K6YA 4U2WA 3SU5A 1PPCE 4TWYA 3A7VA 1A1RA 2BLWA 2NU3E 2WINI 3ODFA 5EXLA 4YOJA 3GDSA 5HXFA 3LGUA 1O3OA 3FP6E 1IAUA 1GDUA 1GJBB 3JZ2B 3LONA 2SGFE 4ZUHA 1W2KH 3LT3A 1ZRBA 4DOQA 1GBHA 1G30B 3OY5U 1C5OH 1BITA 3F9GA 1CHOF 1SVPA 3DFLA 4JZEH 3Q76A 4BANB 3MH7A 3OSYA 4CR5A 2JETB 1N8OB 3GISB 1W8BH 1CO7E 1HFDA 1BTHH 1UTLM 2GKVE 4MLFB 5C1UA 4ABGA 4IW4E 3RXKA 1V2ST 1TIOA 1O3EA 4NA9H 3BG8A 1SLUB 1P09A 5C67A 3MMGA 4IC5A 1O3MA 5I46H 2BQWB 2W5EA 1EPTB 1TNLA 2Y7ZA 3P92A 2FOMB 1T8LA 1IOEA 1XXDA 2PKAB 3UR9A 3QLPH 2FI5E 4GVUA 1EAUA 1ESBA 4Y10E 3T27A 2SGEE 1NC6A 2BD3A 1SGIB 2XYAA 2TGAA 1TQ7B 1W0ZU 4MNYA 4Y71A 5A8YA 2H5CA 1AD8H 4K8BA 7KMEH 2FYRA 1C9PA 1C2FA 4Y8ZA 3LGWA 1K1PA 2TRMA 3QWCH 2CMYA 1YC0A 2FX6A 3M7UA 4UD9H 1RTKA 1O2YA 4ISLA 1L4ZA 3T29A 1OOKB 7GCHF 1Z6EA 1GJAB 4DIHH 3MOCA 2TGTA 1MKWH 3LGYA 4B74A 2A0QB 3FVFB 3BTQE 1W3CA 1J15A 1RFNA 1BTPA 1N1LA 1VCPA 3RXEA 2VIWA 1CA8B 1TGNA 2FO9A 4KELA 2BHGA 1DVAH 2OQ5A 5AHGH 2VIQA 3E6PH 4GSOA 1Z7KA 3G01A 1IQFA 2R0LA 1RIWC 1RJXB 3QK1A 2ZFFH 1EP6A 1YLCA 1RXPA 2Z9LA 4IN2A 4ZHAA 4DJZB 1GHAG 1IHSH 1GHBF 1TOCB 3O8BA 2FM2A 3SU0A 3T2NA 4AFQA 4UFFH 4O97A 4DT7B 1HYLA 1GJ6A 1V2KT 3TU7H 2FS8A 4BXWA 3ZV9A 5J4QA 4ABFA 2PWXA 1T32A 3E16B 4K8YA 2ZNKH 1SR5C 2ZFTA 2OD3B 4R8TB 1NPMA 1O3PB 1O0DH 1KY9A 1C2GA 1AVWA 1ZHMA 1Z71A 1Z8GA 3TGKE 3RU4D 1UCYH 1G32B 3SJ9A 1TBZH 1O3AA 1G3BA 2D26C 5L2ZH 1VJAU 1O5GH 4DW2U 1CT2E 3GCHC 2I6QA 8ESTE 2A45B 5DO4H 1N6XA 4UE7H 2ZGXH 3RU4T 1BTZA 4Y7AA 1BTUA 1A3EH 3SI3H 1GBKA 4XE4A 4RSPA 1SGDE 3S0NA 2PTNA 1NU9A 3SHCH 1NESE 2P93A 4JZIA 2BDHA 3HK6B 1MD7A 2H5DA 2WPLS 3M3SA 1KXCA 8KME2 1HAIH 1BBRE 3ZZDA 2CJIA 3UNQA 1IHTH 1P0SH 1QB6A 1AFEH 1MKXK 4ISIH 3BTTE 2R3UA 2QA9E 1MTUA 1HBTH 2CHAC 3R0FA 1C5WB 2DE9A 1NT1A 1S6FA 2YNBA 4ISOA 5E2PA 4UFDH 1O3JA 1VITH 2ZU2A 1BBRK 4XFQA 1GBTA 2A1DB 1KXFA 3TGJE 3ZZ7A 5C1XA 4YOGA 3Q3XA 2GD4B 2XXLA 3GY5A 1P06A 2V3OH 4INLA 4CR9A 2ZU1A 3PV4A 1ZGVA 2PUXB 1ELCA 1ZHPA 3ATMA 2BDIA 1GBMA 1O2MA 1B0FA 3A88A 3RXCA 2Z3DA 3ZVEA 5E8EH 2STAE 4GCHG 1OS8A 1FAXA 3VB5A 1C9TA 5ESTE 3PROA 1C4V2 1TMBH 1P8VC 3LDXH 2H9TH 4R0IA 4BAKB 3TH4H 1HIAB 1JIMA 1VCWA 3HKIB 4IBLH 5EQSA 1P2KA 1ELAA 3EYDA 4NA7A 1GJ8B 1RD3B 1V2MT 4YTAA 1H9HE 3UNSA 3P6ZB 1SHHB 2FS9A 1D4PB 2BB4A 2PSXA 2QF0A 4X8UH 3E1XB 5A0AE 1O2PA 1DWEH 6ESTA 2AMQA 3M5LA 1MAXA 1V2TT 2F9OA 2IJOB 2CV3A 3M5OA 1CGJE 1CQQA 3QTVH 4NZLA 4X1PU 4YT6H 1GBFA 1GJ9B 6CHAC 5LH8A 1DLEA 1QL8A 4O3TA 2AEIH 1YPHC 5EOKA 1OX1A 1QB1A 1GHAF 1V2LT 3VFEA 5DP6A 1A46H 4JK6A 1PYTD 3GCNA 1TABE 4O03A 1K1IA 2B0FA 3TH2H 1NN6A 2FYQA 1CU1A 3HK3B 2BY6X 1V2UT 3UR6A 2ZCLP 4B2BA 1S6HA 1WU1A 2FLBH 2A32A 5I25A 1UHBA 1OP0A 2KAIA 4FVBA 3SI4H 3HGPA 1BUIA 1V2RT 2BZ6H 2A5AA 4Y8XA 1ZMJA 4I31A 2OINA 3RXAA 4A6LA 5B6OA 4BOHA 4NG9H 2AGIX 1UVPA 3OTJE 1Y3VA 2O8MA 4X0WU 1E0FD 4BAHB 3SGBE 4K3JA 1O2ZA 1UJ1A 1A5GH 1HB0B 2OBOA 1X7AC 1HXFH 4MPUA 4I8HA 3RLWH 2WPMS 1SGRE 4LXBH 5JBAS 1O5CB 2BD4A 4AORA 3ZVDA 4NFEA 1O5FH 3GYLB 1LVBA 1XVOA 2GCTC 1NROH 5BPEA 3ZZ9A 1A0JA 2F9NA 2BOKA 2CHAB 3RXOA 2Z3CA 4X6MA 1AB9C 4U01A 1RIWB 2B8OH 2G81E 4Q80A 2ZGBH 1O2RA 3H7OA 1O30A 3P8GA 1TPAE 1G36A 1NFUA 1XUHA 4I8JA 1NU7B 3EDXB 2QXGA 4B76A 6GCHF 3S69A 1BRCE 1KDQB 4SGBE 4WY3A 4FU7A 1C5YB 1O33A 2FI4E 2QF3A 1FZZA 1IQHA 5EPNA 1C2KA 3HGNA 3RXMA 1SL3A 4PROA 1IQEA 1RTLA 3SV9A 2AS9A 1O3GA 2ZTZA 1CHOG 4X1QU 1DSTA 1UTJA 4X2VA 1ELEE 4IMZA 4TPYA 2EI8A 3UOUA 3RC6A 3SNBA 1LPKB 2FEQH 1NS3A 2ZU4A 3MWIU 1BQYA 2BX4A 1DWCH 3Q3YA 2FOHA 4B2AA 1AE8H 5T6DA 1J9CH 4AFZA 1GI6A 3GY3A 2XBXA 2TGPZ 4BXSA 4JZFH 1HAYB 1WQVH 5DP9A 3ZZBA 1YCPK 2HOBA 1P3EA 1HAVA 5FX6A 2GP9B 2C90B 1D6WA 1JXPA 4I32A 3TITA 1UTMA 2PKAA 1QL9A 5FPTA 2P8OC 3MI4A 1TNJA 2Y7XA 1PYTC 1EP5A 1P2OA 1ESAA 1NRNH 2P3FH 3UQOA 2J2UA 4X1NU 1AZ8A 1C4U2 4E7RG 5C1YA 1K1NA 1F2SE 3CS7A 2ZTXA 4GAWA 1BTYA 5L6NH 2H9HA 1C2IA 4ISNA 3MTYA 4CBOA 3C27B 1EZXC 1O39A 3PO1B 1TWXB 2BLQA 3UWIA 3LJJA 1EZSC 1PQ7A 3PLPA 3F9EA 1AQ7A 1EAWA 3BF6H 1GL0E 1TONA 5T6FA 3K9XB 2ANKH 5ESBA 1GI7B 2B9LA 1KLIH 1GJCB 3D23A 3SJOA 1V2WT 4TWWA 1XM1A 1C4Y2 2TBSA 3FP7E 2FXRA 4ZMAH 1C2LA 2ZDAH 1EKBB 2GCHF 5CE1A 1HAPH 1K28D 4ABDA 2AYWA 1GBJA 1P2MA 3MNXA 4OGYA 3MNCA 5DPAA 5GXPA 1D3TB 1HCGA 1SGNE 1AIXH 1VCQA 1OWEA 3CENA 1MMJN 3U1IB 1Y5UT 1BA8B 4NGAH 3U1JB 2ZFSA 5C3NA 1Z1JA 1UCYK 2AIQA 1RS0A 1A5IA 2W26A 3FFGA 4AG2A 3BTFE 2JKHA 2AIPA 3D62A 2BY5X 1YPLH 2F83A 4AN7A 1ELDE 1XKAC 2GMTC 4FUJA 2F9BH 1W0YH 1GBIA 1SOZA 7GCHG 4CRDA 5DK1A 5GCHF 3BTDE 4I8LA 3NXPA 3PMBB 1TQ0B 2G8TA 4H6TA 4Y0ZE 4FUBA 2J95A 1UTQA 1GI5A 1O5EH 1YF4A 2OLGA 2V0BA 3ODDA 1TX7A 3LGTA 2Z9JA 2HNTF 3BEUA 3U8TH 1C5NH 1OYTH 4KGAA 4GPGA 3PYHA 2QV1A 2QIQA 1N8OC 5EG4A 2FDAA 2C4FH 2EI7A 1FLEE 2BD7A 3BTHE 1LDTT 1QRZA 1HLTH 1DXWA 1HGTH 3DUXH 1ABJH 1TBQH 1HAVB 1W11U 3SV6A 3AW0A 2A5KA 1SGYE 4DVAU 4WF8A 1DOJA 1O2KA 1UVUH 2QXHA 1EAXA 1T4UH 1TPOA 1BJVA 1QJ7B 4J2YB 3RXGA 1ZSKA 8LPRA 1RTFB 2C3SA 1C1QA 1A2CH 1ZJKA 2P8OB 3QZQA 3VEQB 3ZVFA 1O34A 4CRAA 2ZHWH 5DGJA 1BTXA 3SNAA 5L2YH 3RXIA 1C2MA 2VIPA 2GCTB 4I7YH 1C5ZB 1TMTH 2C8WB 3M3VA 1HRTH 3IITA 4AZ2B 3QX5H 3E90B 3U9AH 4OS6A 1SGTA 4DY7B 1JBUH 1P01A 1L0ZA 1ABIH 1YPEH 4AG1A 3U8RH 2P3UB 1Z8RA 2ALVA 1S5SA 2FOGA 2HRVA 4U30A 1KIGH 4FUGA 3ZZCA 3ZZ4A 1W7XH 2PR3A 2XC0A 4MQAA 2NWNA 4ZKRU 1J8AA 3TJNA 3D65E 2VWMA 2ULLA 2BXUH 1SLXB 1Y5BT 3GCTF 1HJAB 1K1LA 3LGVA 1LHCH 1UTNA 1FY5A 4K1TA 1KXDA 2GZ8A 5TJXA 2ANMH 1HJ8A 2SGPE 2Z9KA 2ZGJA 3K65B 2A4RA 1DICA 4WH6A 1AUTC 2JETC 1PJPA 2NU2E 2FOEA 4Y6DA 5FPSA 1V2QT 4THNH 3MFJA 1G2LA 1PQ8A 2AMDA 1MTVA 1HAZB 4DGJA 3LJOA 1FY1A 1F5LA 1E37B 1TA2A 4A1XA 3KEEA 2XW9A 3HPTB 1BT7A 2D1JA 1C1RA 1S82A 2HNTC 2ZP0H 4CRGA 1THPB 5JBTA 1NRSH 2VH6A 3A8BA 4FUDA 4UEHH 1O5DH 2DUCA 3VB3A 1PPHE 1H8DH 2UWPA 2F9UA 1O3KA 3S9CA 1DS2E 4INKA 4D8NA 4NWKA 1O2JA 2Y80A 4BNRA 1XXFA 3GCHB 1QL7A 3QO6A 4NIXA 4TY7A 5A0BA 3SNCA 1O2SA 3KGPA 2P3TB 2PLXA 1D9IA 1CA0C 1V2PT 1NRQH 1GHVH 3A7YA 1C5UA 2ZCKP 1Y8TA 4KTCA 1SLWB 4Y79A 2JH0D 1THSH 2ANYA 5K7RA 1DY8A 5CHAC 3DT0H 1TNKA 1T31A 3PMJA 5DJ7A 2A2XH 1QBVH 4IC6A 1AHTH 2A4QA 3TK9A 1RRKA 1TLDA 1LKAA 1FDPA 3DD2H 5E0HA 4NIVA 1A5HA 4X2WA 2SGDE 2GGVB 3MYWA 3ZVBA 1O2TA 1AFQB 1XKBC 3P17H 4K60A 1P10A 1ANDA 1M9UA 2BLOA 1BDAA 3KL6A 2G00A 3ZZAA 1GBAA 3E0NB 3SU2A 2ZDMA 5EXMA 4X2XA 1GMCG 2XNIA 4WMFA 1TNGA 3GY4A 2VVVA 1C1MA 1OP8A 5E2OA 8GCHF 1IQGA 1SPJA 1IQNA 1P03A 1FAKH 1SC8U 3SBKA 2HPQH 5IDKA 1TNHA 2FPZA 1WTHD 2OC7A 3A84A 1ARCA 1YCPH 2AERH 1UK4A 3RXPA 1HAHH 1EZQA 2XBYA 4B1TA 3RMNH 5C5OA 1O3HA 3ZZ3A 5A0CA 2WUCA 1YP9A 2G51A 4ZXXH 1K22H 3KHVA 4AFSA 1EUFA 1DDJA 2QYIA 1BMNH 5E0GA 1F92A 3RXJA 1P2IA 1OXGA 4K2YA 2ZDVH 4HTCH 1MKWK 4VGCB 3SU1A 2GDDA 6LPRA 1O3BA 1SQOA 1C2DA 4ABJA 4YOIA 1ZMLA 2BM2A 2HVXA 3SV8A 2OUAA 1FPHH 2ZDLA 1GPZA 4X6OA 1MBMA 1LVMA 1TPSA 1CGIE 2FMJA 2PGBB 2ZZUH 3VB6A 1T7CA 2QY0B 1DSUA 1IQMA 1ELBA 4M7GA 1LHFH 1GWAA 1ZTLA 1W13U 1IQLA 4Y8YA 1O2NA 1GJ4H 4RKJB 2ZF0H 1L1JA 2ZHFH 3RC5A 4LZ4B 3T62A 5H4IB 5SGAE 2SFAA 1C5VA 1BMLA 5HMAA 3UOPA 1HAOH 4GCHF 2VVUA 3GICB 3PLKA 3TH3H 2GDEH 1BJUA 2ZKSA 3BTKE 4MPWA 1EOJA 4GUXA 3SUFA 1T8NA 4CRFA 1GHZA 2BOHB 2ZQ2A 3Q77A 2FLRH 1QJ6B 1EASA 2J34A 3A8CA 1HAGE 3RXRA 4DCDA 9ESTA 2J94A 2Z94A 1UCYE 3SUGA 4AYVB 1S83A 2LPRA 5HM2A 3RXFA 1EAIA 2XRCA 3AAUA 2O8UA 1O2VA 1QRXA 5C2ZA 5GDSH 1DFPA 1C1SA 2C8ZB 3T26A 3KQDA 3ESTA 3V12A 1OP2A 1ANEA 3EBNA 2THFB 2R2WU 1QFKH 2A4GA 1DWDH 3SQEE 1G37A 5F6MA 3UQVA 1ZOMA 4H42U 1F0TA 4Z0KA 4ZHMU 4A1TA 2OTVA 3BN9A 3MNSA 1TBRH 3QN7A 4Q7ZA 3UFAA 3F1SB 2ZU5A 1C2HA 3VB4A 1O3FA 5T6GA 2ODQA 1AN1E 4FXGH 1YPMH 3M7TA 1TFXA 1PFXC 2GZ7A 4NFFA 3TJUA 1B5GH 2G5NA 2H6MA 1YPHE 3K6ZA 1WUNH 2FOAA 3SU3A 1P2JA 2XC5A 2OXSA 2R2MB 3GDVA 1FUJA 4FU8A 5FPYA 2BVRH 2UWLA 5T3HA 3JZ1B 4ABIA 1T8MA 3RMOH 2WPIS 1EJMA 5J4SA 1KYNA 4YM9A 3QDZB 2XBVA 3EE0B 2VJ1A 3SNDA 1VR1H 5E0JA 1QNJA 4XDEA 3NPSA 2JH5D 4TY6A 3KF2A 3D49H 3F9FA 3BIVH 4CH2B 3KCGH 4E06H 3BTME 2VWOA 3P8OA 1CBWB 1GHYH 1S84A 2VB0A 3TLOA 1UK2A 3MU5A 1MBQA 1C5SA 2LNCA 5DP4A 3LOXA 1YPGH 1Y59T 3CP7A 1HUTH 1KDQA 3QGNB 2P94A 2Z7FE 2FIRH 5LPFA 1DUEA 3SUEA 1PQAA 1O2OA 1GI0A 1HJAC 1JMOH 1V2OT 3TK5A 1P04A 1SGPE 3B8JA 2FOFA 3UPEA 4UONA 2R9PA 4DURA 1T8OA 1GHWH 4FUFA 3SJKA 1EJNA 5JB8S 1IQJA 2W7UA 3M5NA 4E05H 4A7IB 1WCZA 2J4IA 1O3IA 2SNVA 3FANA 3KIDU 5F8TA 4CHAC 2EA3A 5DG6A 4Q7YA 1AZZA 1C5TA 4D9QA 1CT0E 4NCYA 1TALA 2UWOA 1UVOA 4K5ZA 4JMYA 1DXPA 1V2VT 5G4BA 1QBNA 1MUEB 1O2GH 1HDTH 3E8LA 2QN5T 2ZHDA 1FPCH 2FX4A 4NIYA 3TVJB 2A7CA 1AKSB 2ZA5A 1O5AB 1MTSA 5GJ4B 3VGCC 1WAYB 5GCHG 3ZVGA 4OGXA 1GGDC 1PPFE 1UMAH 2W3IA 3A89A 4MTBA 1EJAA 3DA9B 2TPIZ 1P57B 2PKSB 1FV9A 1DWBH 2WV4A 1ZLRA 2NU0E 1NZQH 1A7SA 4JYVH 1BRAA 1JRTA 1LPZB 2XWAA 3Q3KA 1P2QA 4X2YA 1AGJA 1SGFG 2GMTB 4A1VA 1XVMA 1MD8A 1XMNB 1K21H 1BTWA 3RXBA 1SMFE 3PWCA 1S0RA 1GMHG 3BTEE 3SHAH 1NFYA 3L6PA 3ZYEA 1QURH 1T4VH 3AAVA 2QCYA 1GBBA 4O9VA 2KAIB 5AVDA 2ZGCA 3MH5A 1GMHF 2GCHG 1FQ3A 4LOYH 4XOJA 5GPIB 2BD5A 1P05A 4INHA 1XUJA 4BAQB 2GX4A 2W3KA 1ELVA 4AYYB 3OYPA 3Q00A 3EA7A 4FUHA 2WUBA 2BDGA 4UFEH 1FN8A 2Y5HA 4GHQA 2FOCA 1GI1A 1OPHB 1PQ5A 3ENSB 3SJIA 3A7XA 4DIIH 4ESTE 4MG3A 3GY2A 3F9HA 3RXHA 5EXNA 3DHKH 4XBDA 4NWLA 1QR3E 1MU8B 1QQ4A 3GDUA 1EOLA 1U6QA 1G3CA 3NWUA 1EB2A 1Y5AT 1GI3A 3LU9B 2Z9GA 1TE0A 3P8NA 3GY7A 5CMXH 1ZGIA 5TCAA 1TYNA 5F03A 1O3NA 2ASUB 2NU1E 1C5LH 2YNAA 1MH0A 1XUFA 3M35A 2D8WA 1OWIA 1O31A 1PPBH 2Y5FA 1GJ7B 1FY4A 1UTPA 1GVZA 2Z6BD 1HIAA 3LIWA 2V35A 1TRMA 1OWJA 1GCDA 1GMDF 2OC8A 3S9AA 1MQ6A 2RDLA 3V13A 4IMQA 3HATH 2OC0A 1UK3A 2Y5GA 1DY9A 1EPTA 2ZECA 1ZYOA 3GOVB 2HWLB 3LC3A 2WYJA 1A0HB 1QJ1B 1B0EA 4MNWA 3HKJB 4AX9H 1J14A 1BRUP 2UUFB 7ESTE 1UTKA 1AO5A 2BVXH 1MKXH 1LVYA 4BTUB 2HGTH 1WQSA 1ANBA 1E36B 3TK6A 1EX3A 1L1NA 4K1EA 2GTBA 2UUJB 4AGJA 1DX5M 2F9PA 3M3TA 3V3MA 2QAAA 4IS5A 3BEFB 1SFQB 3PTBA 1G3EA 6GCHG 3EA9A 1Q3XA 4IN1A 1GI2A 3TGIE 3SV7A 2A5IA 3PTNA 5FHTA 2ZIQH 1GBCA 1WV7H 3TJVA 2VIDA 1W14U 4AB8A 5LPEA 1JWTA 1QY6A 1EZUC 1CBWC 1ZR0A 1JIRA 3ZV8A 1P3CA 4NA8A 3LPRA 4BAOB 1BCUH 4ZKOU 3KNXA 2ZGHA 3SU4A 3KQCA 4D7GA 1GL1A 3AW1A 2BDBA 1DUAA 1LQDB 3SJ8A 3M7QA 1F5KU 1O2UA 1YLDA 1O2HA 3A82A 1FJSA 5JYIA 5DP8A 2AH4X 4CBNA 3GY8A 1O37A 4ZXYH 1SG8B 2BQ6B 3GCOA 1L2EA 1FXYA 1G9IE 1A3BH 3GCTG 3O8DA 5LPRA 2BTCE 3GYMA 3MNBA 1ZZZA 3LH1A 1GG6B 2XTTB 1FONA 3EAJA 1H8IH 1ZTKA 1TAWA 1LVOA 1QCPA 4I8KA 3M36A 1MQ5A 1P2NA 2ZDNA 3LC5A 1QQUA 1XUIA 2FODA 4CHAB 1P12E 5LGOA 1AMHA 3A7ZA 3DFJA 4MNXA 1AVXA 3NCLA 4WMEA 1WSSH 4ABEA 3SQHE 1INCA 1ID5H 2GVFA 2ZFRH 1EPTC 4BTTB 1GJ5H 3BG4B 3P70B 4AGKA 1O3DA 3O8RA 4HI3A 2TGDA 3EGKH 3L33A 2Q6DA 1LTOA 2CN0H 2EC9H 4XSKU 1HV7A 2VIOA 1AVGH 1ETRH 3A7WA 2ZPRA 2RG3A 2PUQH 1CT4E 1MZDA 1C5QA 1O3LA 5FAHA 1XUGA 3MO9A 2F3CE 4MPXA 2VNTA 4BAMB 4H6SB 5HM9A 1B7XB 1F5RA 3F68H 3B9FH 1O2WA 1L4DA 3VB7A 1CSOE 2PSYA 3O8CA 2ZEBA 1NM6A 3BIUH 4F49A 1O2XA 1GJDB 3QUMP 4OS1A 3KN2A 3TIUA 3S7KB 2H1UA 4HZHA 2A2QH 1KLJH 1CHGA 1F0SA 4TPIZ 1SB1H 1Q2WA 4WMDA 3F6UH 4HGCA 4GHTA 4K1SA 2Z3EA 1Z8JB 2C8YB 1TX6A 3ATWA 1SLVB 1TOMH 1UTOA 2BY7X 3FZZA 1ZRKA 4B73A 1AU8A 1ZSJA 1QRWA 1YBWA 3NK8A 2FZZA 1LHEH 4Z6AH 1DPOA 2Y6TA 5CHAB 1S0QA 1WTGH 2YOLA 3NKKA 3UUZA 1LKBA 4Y76A 4WH8A 2XCNA 1GVKB 1Z6JH 1TGSZ 1LQEA 3E91A 3UNRA 1C2EA 2OBQA 3TNSA 1C1OA 1V6DA 5DP3A 1BBRH 1K2I1 1ZPZA 2QXJA 1MAYA 3LGIA 2P59A 1HNEE 2IOTA 3RMMH 4BTIB 5F8XA 4JZ1A 1SFIA 5TCCA 5EGMA 3E3TA 4I33A 1ETSH 1GCTB 2FI3E 1FMGA 1GVLA 2VWNA 3W95A 1DLKB 1HPGA 1YM0A 4B2CA 5BRRE 2OCVB 3NUMA 2QGRA 4FUCA 2DE8A 2NU4E 1TMUH 1YYY1 1O2QA 1YPKH 2STBE 3MU4A 5JPMH 4RN6A 1PPEE 4NSVA 3QTOH 1Z8IB 1DANH 3RXTA 4QT8C 2ZCHP 2V6NA 2K7XA 2ZHEH 3ZVAA 1NTPA 3SU6A 3H5CB 3QGJA 1C2JA 2M5TA 2XBWA 3CS0A 7LPRA 2BX3A 4X1SU 1Y3YA 4O3UA 2CF9H 1GI8B 4YLQH 5A09A 1D3PB 5EW2H 1ZSLA 1MTNB 4FVDA 3PMAB 2H9EH 2BD9A 2BLVA 1Y3WA 4KP0A 4MVNA 1VJ9U 2R3YA 1CE5A 2FTMA 2PTCE 1FIWA 2TIOA 3H7TA 3K2UA 1NRPH 3UWJH 1TX8A 1BMMH 4HFPB 4MPVA 2WPJS 3VPKA 4X6NA 4KTUA 2OC1A 1GI9B 1ZJDA 1JOUB 1GHBG 1O35A 1L1GA 1DT2A 1DM4B 1Q31A 2BDAA 1ZTJA 3URCA 1D6RA 5EPYA 1LPGB 5JBBS 1FY8E 1ANCA 2SGAA 1O36A 1SOTA 3STIA 3MU8A 1W12U 3FZDA 3MO6A 2VVCA 4ABBA 1IQKA 4ASHA 5EU8A 2J38A 1SQTA 2V3HH 4D76A 5IYTA 1ORFA 5FCRA 1LO6A 4X8SH 5PTPA 4KKDA 3LKWA 1MU6B 1UVSH 4B71A 1C1WH 2AGEX 1PPZA 3TNTA 1QBOA 4OS7A 1Z1IA 1YKTA 4MDSA 1HJ9A 3BV9B 1K1JA 1EXFA 5HYOA 2PHBA 2OQUA 1OYQA 1K1OA 3FAOA 1KXEA 4YT7H 2K1QA 1FIZA 3SGQE 2FWWA 2OP9A 1D3QB 1AB9B 5A8XA 3S7HB 2LIZA 3RXLA 3PMHB 1AWHB 1S85A 3ATIA 1ELFA 4Y11E 1KTSB 2B5TB 4OS5A 1GBDA 1QB9A 2QXIA 3MH6A 4X6PA 9LPRA 2IPHA 3TJOA 1C1UH 2SGQE 3BSQA 4WJG2 1SHYA 2J9NA 3BG4C 4XBBA 5EODA 3M5MA 5F8ZA 1SGFA 3V0XA 1GMCF 4WXIA 2Q1JA 1QA0A 1SQAA 3B23B 3SNEA 1NY22 1P9SA 3ELAH 1C1PA 1QTFA 4OS4A 1MCVA 1GBLA 5EQRA 4MNVA 3IWMA 1E34B 4YO9A 3SOSA 2BYAX 1PPGE 1O2LA 2AGGX 2HNTE 4U32A 4J1YA 5FBEA 4RKOB 1XUKA 2ZPSA 1OWHA 2PGQB 4WVPE 1C5RA 2CGAA 2BY8X 3QZRA 2GZ9A 1EQ9A 2IN2A 3A8DA 3M61U 1AY6H 2QC2A 3A8AA 2BXTH 1WYKA 3I29A 2XC4A 1GDQA 4JZDH 2VWLA 1FY3A 3U8OH 1AUJA 4XBCA 3PO1C 4Q2KA 3RDZA 1GHXH 3OU0A 4H4FA 1ZPBA 4JK5A 1NFXA 3T25A 3C1KA 3SV2H 2ZTYA 2SNWA 6CHAB 4D7FA 5JDUB 1MTWA 2BVSH 4JYUH 1D3DB 4YZUA 3VXFH 4WWYA 1NRRH 3RP2A 2RA3A 1SBWA 1KLTA 1LHGH 1MZAA 1TNIA 4IGDA 4NZQA 1WBGB 3NZIA 3S9BA 1UO6A 1TB6H 3A80A 3URDA 4ZHLU 1LMWB 1O2IA 3SUDA 2R0KA 3WY8A 1V3XA 2VINA 1ELGA 2GV7A 1FNIA 1YCPM 1P02A 1BRBE 3EQ0H 3I78A 3ATKA 4UDWH 2XWBI 3BTWE 1GI4A 1QGFA 1SGCA 2F9VA 4JYTA 3A87A 2WV5A 5FBIA 4YESB 2BMGB 1TGTA 1OKXA 2F91A 1SI5H 1AKSA 2ZDKA 3OY6U 2XCFA 1V2NT 1AE5A 3RM0H 5JB9S 3UIRA 4CREA 2ZHQH 1F7ZA 3A85A 3SO3A 3AVZA 1EB1H 1DE7H 3E0PB 3U69H 3RC4A 3VGCB 3T28A 1ESTA 1YPJH 4UFGH 3ZZ8A 2VH0A 3AASA 5L30H 3UREA 2HPPH 1OWKA 4A92A 2BD2A 1H4WA 1GBEA 1ZMNA 3KQEA 1S81A 4B75A 1IQIA 1UVTH 2H2ZA 2RA0A 3EA8A 1CGHA 5K0HA 3SN8A 1FN6A 3TPIZ 4CRCA 1A0LA 3SZNA 3MHWU 1Y3XA 4X1RU 4SGAE 1VGCB 2C8XB 1ACBE 3R3GB 5DKMA 3ITIA 2BD8A 1NO9H 3V7TA 4ZH8A 3VXEH 4WXVA 1ETTH 1RGQA 3A81A 2ZQ1A 3SORA 4ZROA 2A7JA 1ELTA 1XX9A 3RM2H 5FX5A 2G52A 1N6YA 2EI6A 2JH6D 2VGCB 2ZI2H 1H1BA 3BTGE 4E7NA 1E38B 5A8ZA 2G5VA 2J92A 1HAXB 4ZAEA 1ZPCA 2RCEA 1THRH 4GLYA 1BOQA 1VITG 3T5FH 3IG6B 4VGCC 1QHRB 4DG4A 2ODYB 1QA7A 2UUYA 1ARBA 1WOFA 3LH3A 3L3TA 2W7SA 2PW8H 1O5BB 2Y82A 1HXEH 5GIBA 2ILNA 3A7TA 1OSSA 1EATA 2ZU3A 1P9UA 2ZFPH 1ZHRA 3ZVCA 5EQQA 3PLBA 1SGEE 4LZ1H 1BHXB 1BHXF 2Z9IA 3ATLA 1BIOA 3BEIB 1C1NA 1G2MA 3ZZ5A 1O32A 4ZKSU 2UUKB 2Q6FA 1J17T 3PM3A 4AOQA 2G4UA 1BMAA 2BDYA 2O8WA 2ZWLH 4CRBA 1H9LB 3RU4E 3P8FA 2O8TA 2VIVA 3I77A 5C5NA 2O9QA 1MTNC 1TPPA 3W94A 1GMDG 1GG6C 2ALPA 1KXAA 2BQ7B 3OX7U 5DP7A 1GGDB 2GT8A 1O38A 1SSXA 1W10U 3STJA 5FXLA 1A4WH 1KXBA 2WPHS 3MH4A 3A86A 2ZC9H 3UTUH 1VZQH 3RXSA 4KTSA 1K9OE 1QIXB 2BZAA 2WPKS 4K69A 1YGCH 1LHDH 3FP8E 3PB1E 5ABWA 4CH8B 1V2JT 2VU8E 2D2DA 1E35B 1GDNA 3PWBA 2HLCA 5A2MH 3A83A 3P95A 2ZO3H 1GCTC 2CXVA 4TYDA 8GCHG 2GT7A 3GY6A
chains in the Genus database with same CATH superfamily
4NSYA 1TGBA 1DITH 3MU1A 2FTLE 2AFQB 2FP7B 1AI8H 1COWD 2J98B 1UHBB 2WYGA 4Y0YE 3U98H 1TRNA 1C5MD 3KQBA 4D9RA 4FU9A 3SGAE 1OWDA 2CF8H 3ZZ6A 1AWFH 1C5XB 3N99A 2ZG0H 1C5PA 1G3DA 5JBCS 2GV6A 2I6SA 2O8LA 1BB0B 2ANWA 2Y81A 5EW1H 2B7DH 2ZPQA 3RXQA 3UY9A 4X8TH 3MO3A 3SW2B 1TGCA 4A5TS 2P95A 4ISHH 1KSNA 2ZFQH 4AB9A 1CVWH 2C93B 2PKSC 4FUEA 1LCYA 2VGCC 1K1MA 3FOAA 4HG6A 1KTTB 1AFQC 4ABAA 2A4OA 2EEKA 1Y3UA 1TA6A 1JRSA 2PV9B 3RUOA 3RXVA 1W7GH 3RXUA 5AF9H 2BDCA 4LK4A 5ETXA 1C1TA 2P16A 3ZYDA 2QE7D 2BY9X 2AMPA 4X8VH 1NFWA 1A61H 2G55A 4OS2A 4YXWD 4YLUA 2A7HA 2PFEA 2A31A 3RXDA 4NIWA 4ZKNU 3N7OA 2G4TA 2HALA 4Y7BA 5DP5A 4FUIA 2FESH 2ESTE 1F0RA 4AFUA 3M37A 3MU0A 1VITF 1C1VH 5FCKA 3RMLH 1MCTA 4ABHA 1F0UA 1TRYA 4JCNA 5GWZA 4F4OC 1O3CA 1SGQE 2ODPA 2FOBA 2Q6GA 5AFYH 4I8GA 4Q7XA 1CA0B 1P11E 5HGGA 1H9IE 5AFZH 5C20A 3RLYH 1FI8A 1VGCC 1J16A 1BZXE 3K6YA 4U2WA 3SU5A 1PPCE 4TWYA 3A7VA 1A1RA 2BLWA 2NU3E 2WINI 1NBMD 3ODFA 5EXLA 4YOJA 3GDSA 5HXFA 3LGUA 1O3OA 3FP6E 1IAUA 1GDUA 1GJBB 3JZ2B 3LONA 2SGFE 4ZUHA 1W2KH 3LT3A 1ZRBA 4DOQA 1GBHA 1G30B 3OY5U 1C5OH 1EFRD 1BITA 3F9GA 1CHOF 1SVPA 3DFLA 4JZEH 3Q76A 4BANB 3MH7A 3OSYA 4CR5A 2JETB 1N8OB 2KFWA 3GISB 1W8BH 1CO7E 4ZCNA 1HFDA 1BTHH 1UTLM 2GKVE 4MLFB 5C1UA 4ABGA 4IW4E 3RXKA 1V2ST 1TIOA 1O3EA 3DSPA 4NA9H 3BG8A 1SLUB 1P09A 5C67A 3MMGA 4IC5A 1O3MA 5I46H 2BQWB 2W5EA 1EPTB 1TNLA 2Y7ZA 3P92A 2FOMB 1E1RD 1T8LA 1IOEA 1XXDA 2PKAB 3UR9A 3QLPH 2FI5E 4GVUA 1EAUA 1ESBA 4Y10E 3T27A 2SGEE 1NC6A 2BD3A 1SGIB 2XYAA 3DSOA 2TGAA 1TQ7B 1W0ZU 4MNYA 4Y71A 5A8YA 2H5CA 1AD8H 4K8BA 7KMEH 2FYRA 1C9PA 2AHME 1C2FA 4Y8ZA 3LGWA 1K1PA 2TRMA 3QWCH 2CMYA 1YC0A 2FX6A 3M7UA 1VKYA 4UD9H 1RTKA 1O2YA 4ISLA 1L4ZA 3T29A 1OOKB 7GCHF 1Z6EA 1GJAB 4DIHH 3MOCA 2TGTA 1MKWH 3LGYA 4B74A 2A0QB 3FVFB 3BTQE 1W3CA 1J15A 1RFNA 3SZEA 1BTPA 1N1LA 1VCPA 3RXEA 2VIWA 1CA8B 1TGNA 2FO9A 4KELA 2BHGA 1DVAH 2OQ5A 5AHGH 2VIQA 3E6PH 4GSOA 1Z7KA 3G01A 1IQFA 2R0LA 1RIWC 2YMSC 1RJXB 3QK1A 2ZFFH 1EP6A 1YLCA 1RXPA 2Z9LA 4IN2A 4ZHAA 4DJZB 1GHAG 1IHSH 5DSFA 1GHBF 1TOCB 3O8BA 2FM2A 3SU0A 3T2NA 4AFQA 4UFFH 4O97A 4DT7B 1HYLA 1GJ6A 1V2KT 3TU7H 2FS8A 4BXWA 3ZV9A 5J4QA 4ABFA 2PWXA 1T32A 3E16B 4K8YA 2ZNKH 1SR5C 2ZFTA 2OD3B 4R8TB 1NPMA 1O3PB 1O0DH 1KY9A 1C2GA 1AVWA 1ZHMA 1Z71A 1Z8GA 3TGKE 3RU4D 1UCYH 1G32B 3SJ9A 1TBZH 1O3AA 1G3BA 2D26C 5L2ZH 1VJAU 1O5GH 2YMSB 4DW2U 1CT2E 3GCHC 2I6QA 8ESTE 2A45B 5DO4H 1N6XA 4UE7H 2ZGXH 3RU4T 1BTZA 4Y7AA 1BTUA 1A3EH 3SI3H 1GBKA 2WV9A 4XE4A 4RSPA 1SGDE 4RT1A 3S0NA 2PTNA 1NU9A 3SHCH 1NESE 2P93A 4JZIA 2BDHA 3HK6B 1MD7A 2H5DA 2WPLS 3M3SA 1KXCA 8KME2 1HAIH 1BBRE 3ZZDA 2CJIA 3UNQA 1IHTH 1P0SH 1QB6A 4OM9A 1AFEH 1MKXK 2JIZD 4ISIH 3BTTE 2R3UA 2QA9E 1MTUA 1HBTH 2CHAC 3R0FA 1C5WB 2DE9A 1NT1A 1S6FA 2YNBA 4ISOA 5E2PA 4UFDH 1O3JA 1VITH 2ZU2A 1BBRK 4XFQA 1GBTA 2A1DB 1KXFA 3TGJE 3ZZ7A 5C1XA 4YOGA 3Q3XA 2GD4B 2XXLA 3GY5A 1P06A 2V3OH 4INLA 4CR9A 2ZU1A 3PV4A 1ZGVA 2PUXB 1ELCA 1ZHPA 3ATMA 2BDIA 1GBMA 1O2MA 1B0FA 3A88A 3RXCA 2Z3DA 3ZVEA 5E8EH 2STAE 4GCHG 1OS8A 1H8HD 1FAXA 3VB5A 5C0TA 1C9TA 5ESTE 3PROA 1C4V2 1TMBH 1P8VC 3LDXH 5KGOA 2H9TH 4R0IA 4BAKB 3TH4H 1HIAB 1JIMA 1VCWA 3HKIB 4IBLH 5EQSA 1P2KA 1ELAA 3EYDA 4NA7A 1GJ8B 1RD3B 1V2MT 4YTAA 1H9HE 3UNSA 3P6ZB 1SHHB 2FS9A 1D4PB 2BB4A 2PSXA 2QF0A 4X8UH 3E1XB 5A0AE 1O2PA 1DWEH 6ESTA 2AMQA 3M5LA 1MAXA 1V2TT 2F9OA 2IJOB 2CV3A 3M5OA 4Q63A 1CGJE 1CQQA 3FO8D 3QTVH 4NZLA 4X1PU 4YT6H 1GBFA 1GJ9B 6CHAC 5LH8A 1DLEA 1QL8A 4O3TA 2AEIH 1YPHC 5EOKA 1OX1A 1QB1A 1GHAF 1V2LT 3F2GA 4TT3D 3VFEA 5DP6A 1A46H 4JK6A 1PYTD 3GCNA 1TABE 4O03A 1K1IA 2B0FA 3TH2H 1NN6A 2HLDD 2FYQA 1CU1A 3HK3B 3SYJA 2BY6X 1V2UT 3UR6A 2ZCLP 4B2BA 1S6HA 1WU1A 2FLBH 2A32A 5I25A 1UHBA 1OP0A 2KAIA 4FVBA 3SI4H 3HGPA 1BUIA 5CDFE 1V2RT 2BZ6H 2A5AA 4Y8XA 1ZMJA 4I31A 2OINA 3RXAA 4A6LA 5B6OA 4BOHA 4NG9H 2AGIX 1UVPA 3OTJE 1Y3VA 2O8MA 4X0WU 1E0FD 4BAHB 3SGBE 1SKYE 4K3JA 1O2ZA 1UJ1A 1A5GH 1HB0B 2OBOA 1X7AC 1HXFH 4MPUA 4I8HA 3RLWH 2WPMS 1SGRE 4LXBH 5JBAS 1O5CB 2BD4A 4AORA 3ZVDA 4NFEA 1O5FH 3GYLB 3PRBA 1LVBA 1XVOA 2GCTC 1NROH 5BPEA 3ZZ9A 1A0JA 2F9NA 2BOKA 2CHAB 2W6ID 3RXOA 2Z3CA 4X6MA 1AB9C 4U01A 1RIWB 2B8OH 4Z1MD 3F0PA 2G81E 4Q80A 2ZGBH 1O2RA 3H7OA 1O30A 3P8GA 1TPAE 1G36A 1NFUA 1XUHA 4I8JA 1NU7B 3EDXB 2QXGA 4B76A 6GCHF 3S69A 1BRCE 1KDQB 4SGBE 4WY3A 4FU7A 1C5YB 1O33A 2FI4E 2QF3A 1FZZA 1IQHA 5EPNA 1C2KA 3HGNA 3RXMA 1SL3A 4PROA 1IQEA 1RTLA 3SV9A 2AS9A 1O3GA 2ZTZA 1CHOG 4X1QU 1DSTA 1UTJA 4X2VA 1ELEE 4IMZA 4TPYA 2EI8A 3UOUA 3OE7D 3RC6A 3SNBA 1LPKB 2FEQH 2LP6A 1NS3A 2ZU4A 3MWIU 1BQYA 2BX4A 1DWCH 3Q3YA 2FOHA 2YMSD 1AE8H 4B2AA 5T6DA 1J9CH 4AFZA 1GI6A 2K8IA 3GY3A 5F53A 2XBXA 3KYGA 5HIYA 2TGPZ 4BXSA 4JZFH 1HAYB 1WQVH 5DP9A 3ZZBA 1YCPK 2HOBA 1P3EA 1HAVA 5FX6A 2GP9B 2C90B 1D6WA 1JXPA 4I32A 3TITA 1UTMA 2PKAA 1QL9A 5FPTA 2P8OC 3MI4A 1TNJA 2Y7XA 1PYTC 1EP5A 1P2OA 1ESAA 1NRNH 2P3FH 3UQOA 2J2UA 4X1NU 1AZ8A 1C4U2 4E7RG 5C1YA 1K1NA 1F2SE 3CS7A 2ZTXA 4GAWA 1BTYA 5L6NH 2H9HA 1C2IA 4ISNA 3MTYA 4CBOA 3C27B 1EZXC 2JJ1D 1O39A 3PO1B 1TWXB 2BLQA 3UWIA 3LJJA 1EZSC 1PQ7A 3PLPA 3F9EA 1AQ7A 3DSGA 1EAWA 3BF6H 1GL0E 1TONA 5T6FA 3K9XB 2ANKH 5ESBA 1GI7B 2B9LA 1KLIH 1GJCB 3D23A 3SJOA 1V2WT 4TWWA 1XM1A 1C4Y2 2TBSA 3FP7E 2FXRA 2IJD1 4ZMAH 1C2LA 2ZDAH 1EKBB 5EJLA 2GCHF 5CE1A 1HAPH 1K28D 4ABDA 2AYWA 1GBJA 1P2MA 3GS9A 3MNXA 4OGYA 3MNCA 5DPAA 5GXPA 1D3TB 1HCGA 1VCQA 1AIXH 1SGNE 1OWEA 3CENA 1MMJN 3U1IB 1Y5UT 1BA8B 4NGAH 3U1JB 2ZFSA 5C3NA 1Z1JA 1UCYK 2AIQA 3N7EA 3MQKC 1RS0A 1A5IA 2W26A 3FFGA 4AG2A 3BTFE 2JKHA 2AIPA 3D62A 3N7DA 1KMHB 2BY5X 1YPLH 2F83A 4AN7A 1ELDE 1XKAC 2GMTC 4FUJA 2F9BH 1W0YH 1GBIA 1SOZA 7GCHG 4CRDA 5DK1A 5GCHF 3BTDE 4I8LA 3NXPA 3PMBB 1TQ0B 2G8TA 4H6TA 4Y0ZE 4FUBA 2J95A 1UTQA 1GI5A 1O5EH 1YF4A 2OLGA 2V0BA 3ODDA 1TX7A 3LGTA 2Z9JA 2HNTF 3BEUA 5CHBA 1C5NH 3U8TH 1OYTH 4KGAA 4GPGA 3PYHA 2QV1A 2QIQA 1N8OC 5EG4A 2FDAA 2C4FH 2EI7A 1FLEE 2BD7A 3BTHE 1LDTT 1QRZA 4I86A 1HLTH 1DXWA 1HGTH 3DUXH 1ABJH 1TBQH 1HAVB 1W11U 2EQNA 3SV6A 3AW0A 2A5KA 1SGYE 4DVAU 4WF8A 1DOJA 5C94A 1O2KA 1UVUH 2QXHA 1EAXA 1T4UH 1TPOA 1BJVA 1QJ7B 4J2YB 3RXGA 1ZSKA 8LPRA 1RTFB 2C3SA 1C1QA 1A2CH 1ZJKA 2P8OB 3QZQA 3VEQB 3ZVFA 2KR7A 1O34A 4CRAA 2ZHWH 5DGJA 1BTXA 3SNAA 5L2YH 3RXIA 1C2MA 2VIPA 2GCTB 4I7YH 1C5ZB 1TMTH 2C8WB 3M3VA 1HRTH 3IITA 4AZ2B 3QX5H 3E90B 3U9AH 4OS6A 1SGTA 4DY7B 5EJZA 1JBUH 1P01A 1L0ZA 1ABIH 1YPEH 4AG1A 3U8RH 2P3UB 1Z8RA 2ALVA 1S5SA 2FOGA 2HRVA 4U30A 1KIGH 4FUGA 3ZZCA 3ZZ4A 1W7XH 2PR3A 2XC0A 4MQAA 2NWNA 4ZKRU 1J8AA 3TJNA 3D65E 2VWMA 2ULLA 2BXUH 1SLXB 1Y5BT 2RDEA 3GCTF 1HJAB 1K1LA 3LGVA 1LHCH 1UTNA 1FY5A 4K1TA 1KXDA 2GZ8A 5TJXA 2ANMH 1HJ8A 2SGPE 2Z9KA 2ZGJA 3K65B 2A4RA 1DICA 4WH6A 1AUTC 2JETC 1PJPA 2NU2E 2FOEA 4Y6DA 5FPSA 1V2QT 1OHHD 4THNH 3MFJA 1G2LA 1PQ8A 2AMDA 1MTVA 1S6LA 1HAZB 4DGJA 3LJOA 1FY1A 1F5LA 1E37B 1TA2A 4A1XA 3KEEA 2XW9A 3HPTB 1BT7A 2D1JA 1C1RA 1S82A 2HNTC 2ZP0H 4CRGA 1THPB 5JBTA 1NRSH 2VH6A 3A8BA 4FUDA 4UEHH 1O5DH 2DUCA 3VB3A 1PPHE 1H8DH 2UWPA 2F9UA 1O3KA 3S9CA 3WW7A 1DS2E 4INKA 4D8NA 4NWKA 1O2JA 2Y80A 4BNRA 1XXFA 3GCHB 1QL7A 3QO6A 4NIXA 2VBCA 4TY7A 5A0BA 3SNCA 1O2SA 3KGPA 2P3TB 2PLXA 1D9IA 1CA0C 1V2PT 1NRQH 1GHVH 3A7YA 1C5UA 2ZCKP 1Y8TA 4KTCA 1SLWB 4Y79A 2JH0D 1WDIA 1THSH 2ANYA 5K7RA 1DY8A 5CHAC 3DT0H 1TNKA 1T31A 3PMJA 5DJ7A 2A2XH 1QBVH 4IC6A 1AHTH 2A4QA 3TK9A 1RRKA 1TLDA 1LKAA 1FDPA 3DD2H 5E0HA 4NIVA 1A5HA 4X2WA 2SGDE 2GGVB 3MYWA 3ZVBA 1O2TA 1AFQB 1XKBC 3P17H 4K60A 1P10A 1ANDA 1M9UA 2BLOA 1BDAA 3KL6A 2G00A 2HVYB 3ZZAA 1GBAA 2LELA 3E0NB 2ZDMA 2L74A 3SU2A 5EXMA 4X2XA 1GMCG 2XNIA 4WMFA 1TNGA 3GY4A 2VVVA 1C1MA 1OP8A 5E2OA 8GCHF 1IQGA 1SPJA 1IQNA 1P03A 1FAKH 1SC8U 3SBKA 2HPQH 5IDKA 1TNHA 2FPZA 1WTHD 2OC7A 3A84A 1ARCA 1YCPH 2AERH 1UK4A 3RXPA 3U28C 1HAHH 1EZQA 2XBYA 2WSSD 4B1TA 4F48B 3RMNH 4FOUC 5C5OA 1O3HA 3ZZ3A 3OEED 5A0CA 2WUCA 1YP9A 2G51A 4ZXXH 1K22H 3KHVA 4AFSA 1EUFA 1DDJA 2QYIA 2XNDD 1BMNH 5E0GA 1F92A 3RXJA 2XOKD 1P2IA 1OXGA 4K2YA 2ZDVH 4HTCH 1MKWK 4VGCB 3SU1A 2GDDA 6LPRA 1O3BA 1SQOA 1C2DA 4ABJA 4YOIA 1ZMLA 2BM2A 2HVXA 3SV8A 2OUAA 1FPHH 2ZDLA 3ZIAD 1GPZA 4X6OA 1MBMA 1LVMA 1TPSA 1CGIE 2FMJA 2PGBB 2ZZUH 3VB6A 1T7CA 1DSUA 1IQMA 1ELBA 2QY0B 4M7GA 1LHFH 1GWAA 1ZTLA 1W13U 3F2FA 1IQLA 4Y8YA 1O2NA 1GJ4H 4RKJB 2ZF0H 1L1JA 2ZHFH 3RC5A 4LZ4B 3T62A 5H4IB 5SGAE 2SFAA 1C5VA 1BMLA 5HMAA 4P00A 3UOPA 1HAOH 4GCHF 2VVUA 3GICB 3PLKA 1QZ8A 4F55A 3TH3H 2GDEH 1BJUA 2ZKSA 3BTKE 4MPWA 1EOJA 4GUXA 3SUFA 2W6JD 1T8NA 4CRFA 1GHZA 2BOHB 2ZQ2A 3Q77A 2FLRH 1QJ6B 1EASA 2J34A 3A8CA 1HAGE 3RXRA 4DCDA 9ESTA 2J94A 2Z94A 1UCYE 3SUGA 4AYVB 1S83A 2CK3D 2LPRA 5HM2A 3RXFA 1EAIA 2XRCA 3AAUA 2O8UA 1YLNA 1O2VA 1QRXA 5C2ZA 5GDSH 1DFPA 1C1SA 2C8ZB 3T26A 3KQDA 3ESTA 3V12A 1OP2A 1ANEA 3EBNA 2THFB 2R2WU 1QFKH 2A4GA 3PV2A 1DWDH 2WPDD 3SQEE 1G37A 5F6MA 3UQVA 1ZOMA 4RT0A 4H42U 1F0TA 4Z0KA 4ZHMU 4A1TA 2OTVA 3BN9A 3MNSA 1TBRH 3QN7A 4Q7ZA 3UFAA 3F1SB 2ZU5A 1C2HA 3VB4A 1O3FA 5T6GA 2ODQA 1AN1E 4FXGH 1YPMH 3M7TA 1TFXA 1PFXC 2GZ7A 4NFFA 3TJUA 1B5GH 2G5NA 2H6MA 4Q4LA 1YPHE 3K6ZA 1WUNH 2FOAA 3SU3A 1P2JA 2XC5A 2IPQX 2OXSA 2R2MB 3GDVA 1FUJA 4FU8A 5FPYA 2BVRH 2UWLA 5T3HA 3JZ1B 4ABIA 1T8MA 3RMOH 2WPIS 1EJMA 5J4SA 1KYNA 4YM9A 3QDZB 2XBVA 3EE0B 2VJ1A 3SNDA 1VR1H 5E0JA 1QNJA 4XDEA 3NPSA 4DT4A 2JH5D 4TY6A 3KF2A 3D49H 3F9FA 3BIVH 4CH2B 3KCGH 4E06H 3BTME 2VWOA 3P8OA 1CBWB 1GHYH 1S84A 2VB0A 3TLOA 1UK2A 3MU5A 1MBQA 1C5SA 2LNCA 5DP4A 3LOXA 1YPGH 1Y59T 3CP7A 1HUTH 1KDQA 3QGNB 2P94A 2Z7FE 2FIRH 5LPFA 1DUEA 3SUEA 1PQAA 1O2OA 1GI0A 1HJAC 3OTPA 1JMOH 1V2OT 1YY3A 3TK5A 1P04A 5C17A 1SGPE 3B8JA 2FOFA 3UPEA 4UONA 2R9PA 4DURA 1T8OA 1GHWH 4FUFA 3SJKA 1EJNA 5JB8S 1IQJA 2W7UA 3M5NA 4E05H 4A7IB 1WCZA 2J4IA 1O3IA 2SNVA 3FANA 3KIDU 5F8TA 1W0KD 4CHAC 2EA3A 5DG6A 2KCPA 4Q7YA 1AZZA 1C5TA 1E1QD 4D9QA 1CT0E 4NCYA 1TALA 2UWOA 1UVOA 4K5ZA 1UW7A 1DXPA 1V2VT 4JMYA 5G4BA 1QBNA 1MUEB 1O2GH 1HDTH 3E8LA 5KEDA 2QN5T 2ZHDA 1FPCH 2FX4A 4NIYA 4ACAA 3TVJB 2A7CA 1AKSB 2ZA5A 1O5AB 1MTSA 5GJ4B 3VGCC 3WWBA 2QF5A 1WAYB 5GCHG 4XD7D 4OGXA 3ZVGA 1GGDC 1PPFE 3F3BA 1UMAH 2W3IA 3A89A 4MTBA 1EJAA 3DA9B 2TPIZ 1P57B 2PKSB 1FV9A 1DWBH 2WV4A 1ZLRA 2NU0E 1NZQH 1A7SA 4JYVH 1BRAA 1JRTA 1LPZB 2XWAA 3Q3KA 2KCOA 1P2QA 4X2YA 1AGJA 1SGFG 2GMTB 4A1VA 1XVMA 1MD8A 1XMNB 1K21H 1BTWA 3RXBA 1SMFE 3PWCA 1S0RA 1GMHG 3BTEE 3SHAH 1NFYA 3L6PA 3ZYEA 1QURH 1T4VH 3AAVA 2QCYA 1GBBA 4O9VA 2KAIB 5AVDA 2ZGCA 3MH5A 1GMHF 2GCHG 1FQ3A 4LOYH 4XOJA 5GPIB 2BD5A 1P05A 4INHA 1XUJA 4BAQB 2GX4A 2W3KA 1ELVA 4AYYB 3OYPA 3Q00A 3EA7A 4FUHA 2WUBA 2BDGA 4UFEH 1H8ED 1FN8A 2KCYA 2Y5HA 4GHQA 2FOCA 1GI1A 1OPHB 1PQ5A 3ENSB 3SJIA 3A7XA 4DIIH 4ESTE 4MG3A 3GY2A 3F9HA 3RXHA 5EXNA 3DHKH 4XBDA 4NWLA 1QR3E 1MU8B 2WHXA 3KQ5A 1QQ4A 3GDUA 1EOLA 1U6QA 1G3CA 3NWUA 1EB2A 1Y5AT 1GI3A 3LU9B 4B6FA 3FN8A 2Z9GA 1BMFD 1TE0A 3P8NA 3GY7A 5CMXH 1ZGIA 5TCAA 1TYNA 1SQRA 5F03A 1O3NA 2ASUB 2NU1E 1C5LH 2YNAA 1MH0A 1XUFA 3M35A 2D8WA 1OWIA 1O31A 1PPBH 2Y5FA 1GJ7B 1FY4A 1UTPA 1GVZA 2Z6BD 1HIAA 3LIWA 2V35A 1TRMA 1OWJA 1GCDA 1GMDF 2OC8A 3S9AA 1MQ6A 2RDLA 3V13A 4IMQA 3HATH 2OC0A 1UK3A 2Y5GA 1DY9A 1EPTA 2ZECA 1ZYOA 3GOVB 2HWLB 3LC3A 2WYJA 2JJ2D 1A0HB 1QJ1B 1B0EA 4MNWA 3HKJB 4AX9H 1J14A 1BRUP 2UUFB 7ESTE 1UTKA 1AO5A 2BVXH 1MKXH 1LVYA 4BTUB 2HGTH 1WQSA 1ANBA 1E36B 3TK6A 1EX3A 3F2HA 1L1NA 4K1EA 2GTBA 2UUJB 4AGJA 2V3MA 1DX5M 2F9PA 3M3TA 3V3MA 2QAAA 4IS5A 1FX0B 3BEFB 1SFQB 3PTBA 1G3EA 6GCHG 3EA9A 1Q3XA 4IN1A 1GI2A 3TGIE 3SV7A 2A5IA 3PTNA 5FHTA 2ZIQH 1GBCA 1WV7H 3TJVA 2VIDA 1W14U 4AB8A 5LPEA 1JWTA 1QY6A 1EZUC 1CBWC 1ZR0A 1JIRA 3ZV8A 1P3CA 4NA8A 3LPRA 4BAOB 1BCUH 4ZKOU 3KNXA 2ZGHA 3SU4A 3KQCA 4D7GA 1GL1A 3AW1A 2BDBA 1DUAA 1LQDB 1NBME 3SJ8A 3H09A 3M7QA 4RI0A 1F5KU 1O2UA 1YLDA 1O2HA 3A82A 1FJSA 5JYIA 5DP8A 2AH4X 4CBNA 3GY8A 1O37A 4ZXYH 1SG8B 2BQ6B 3GCOA 1L2EA 1FXYA 1G9IE 1A3BH 3GCTG 3O8DA 5LPRA 2BTCE 3GYMA 3MNBA 1ZZZA 3LH1A 1GG6B 2XTTB 1FONA 3EAJA 1H8IH 1ZTKA 1TAWA 1LVOA 1QCPA 2JDID 4I8KA 5HIZA 3M36A 1WXRA 1MQ5A 1P2NA 2ZDNA 3LC5A 1QQUA 1XUIA 2FODA 4CHAB 1P12E 5LGOA 1AMHA 3A7ZA 3DFJA 4MNXA 1AVXA 3NCLA 4WMEA 1WSSH 4ABEA 3SQHE 1INCA 1ID5H 2GVFA 2ZFRH 1EPTC 4BTTB 1GJ5H 3BG4B 3P70B 4AGKA 1O3DA 3O8RA 4HI3A 2TGDA 3EGKH 3L33A 2Q6DA 1LTOA 2L6OA 2CN0H 2EC9H 2QF4A 4XSKU 1HV7A 2VIOA 1AVGH 3AK5A 1ETRH 3PV5A 3A7WA 2EY4C 2ZPRA 2RG3A 2PUQH 3KYFA 1CT4E 1MZDA 1C5QA 1O3LA 5FAHA 4P02A 1XUGA 3MO9A 2F3CE 4MPXA 2VNTA 4BAMB 4H6SB 5HM9A 1B7XB 1F5RA 3F68H 3B9FH 1O2WA 1L4DA 3VB7A 1CSOE 2PSYA 3O8CA 2ZEBA 1NM6A 3BIUH 4F49A 1O2XA 1GJDB 3QUMP 4OS1A 3KN2A 3TIUA 3S7KB 2H1UA 4HZHA 2A2QH 1KLJH 1CHGA 1F0SA 4TPIZ 2J5UA 1SB1H 1Q2WA 4WMDA 3F6UH 4HGCA 4GHTA 2PP6A 2RFKC 4K1SA 2Z3EA 3DCLA 1Z8JB 3F0OA 2C8YB 1TX6A 3ATWA 1SLVB 1TOMH 1UTOA 2BY7X 3FKSD 3FZZA 1ZRKA 4B73A 1AU8A 1ZSJA 1QRWA 1YBWA 3NK8A 2FZZA 5EJ1A 1LHEH 4Z6AH 1DPOA 2Y6TA 5CHAB 1S0QA 4TSFD 1WTGH 2YOLA 3EE7A 5KECA 3NKKA 3UUZA 1LKBA 4Y76A 4WH8A 2XCNA 1GVKB 1Z6JH 1TGSZ 1LQEA 3E91A 1K0HA 3UNRA 1C2EA 2OBQA 3TNSA 1C1OA 1V6DA 5DP3A 1BBRH 4AC9A 1K2I1 1ZPZA 2QXJA 1MAYA 3LGIA 2P59A 1HNEE 2IOTA 2KCAA 3RMMH 4BTIB 5B6LA 5F8XA 4JZ1A 1SFIA 5TCCA 5EGMA 3E3TA 4I33A 1ETSH 1GCTB 2FI3E 1FMGA 1GVLA 2VWNA 3W95A 1DLKB 1HPGA 1YM0A 4B2CA 5BRRE 2OCVB 3NUMA 2QGRA 4FUCA 2DE8A 2NU4E 1TMUH 1YYY1 2KZ4A 1O2QA 1YPKH 2STBE 2M2AA 3MU4A 5JPMH 4RN6A 1PPEE 4B6EA 4NSVA 3QTOH 1Z8IB 1DANH 3RXTA 4QT8C 2ZCHP 2V6NA 2K7XA 2ZHEH 3ZVAA 1NTPA 3SU6A 3H5CB 3QGJA 1C2JA 2M5TA 2XBWA 3CS0A 4XRNA 7LPRA 2BX3A 4X1SU 1Y3YA 4O3UA 2CF9H 1GI8B 4YLQH 5A09A 5GNDA 1D3PB 5EW2H 1ZSLA 1MTNB 4FVDA 3PMAB 2H9EH 2BD9A 2BLVA 1Y3WA 4KP0A 4MVNA 1VJ9U 2R3YA 1MABB 1CE5A 2FTMA 2PTCE 1FIWA 2TIOA 3H7TA 3K2UA 1NRPH 3UWJH 1TX8A 1BMMH 4HFPB 4MPVA 2WPJS 3CNRA 3VPKA 4X6NA 4KTUA 2OC1A 1GI9B 1ZJDA 1JOUB 1GHBG 1O35A 1L1GA 1DT2A 1DM4B 1Q31A 2BDAA 1ZTJA 3URCA 1D6RA 5EPYA 1LPGB 5JBBS 1FY8E 1ANCA 1O36A 1SOTA 2SGAA 3STIA 3MU8A 2WZQA 1W12U 3FZDA 3MO6A 2VVCA 4ABBA 1IQKA 4ASHA 3NRLA 5EU8A 2J38A 1SQTA 2V3HH 4D76A 3W1EA 5IYTA 1ORFA 5FCRA 1LO6A 4X8SH 5PTPA 4KKDA 3LKWA 1MU6B 1UVSH 4B71A 1C1WH 2AGEX 1PPZA 3TNTA 1QBOA 4OS7A 1Z1IA 1YKTA 4MDSA 1HJ9A 3BV9B 1K1JA 1EXFA 5HYOA 2PHBA 2OQUA 1OYQA 1K1OA 3FAOA 1KXEA 4YT7H 2K1QA 1FIZA 3SGQE 2FWWA 1YWUA 2OP9A 1D3QB 1AB9B 5A8XA 3S7HB 2LIZA 3RXLA 3PMHB 1AWHB 1S85A 3ATIA 5EIYA 1ELFA 4Y11E 1KTSB 2B5TB 4OS5A 1GBDA 1QB9A 2QXIA 3MH6A 4X6PA 9LPRA 2IPHA 3TJOA 1C1UH 2SGQE 3BSQA 4WJG2 1SHYA 2J9NA 3BG4C 4XBBA 5EODA 3M5MA 5F8ZA 1SGFA 3V0XA 1GMCF 4WXIA 2Q1JA 1QA0A 1SQAA 3B23B 3SNEA 1NY22 1P9SA 3ELAH 1C1PA 1QTFA 4OS4A 1MCVA 1GBLA 5EQRA 4MNVA 3IWMA 1E34B 4YO9A 3SOSA 3OAAD 2BYAX 1PPGE 1O2LA 2AGGX 2HNTE 4U32A 4J1YA 5FBEA 4RKOB 2K0QA 1XUKA 2ZPSA 1OWHA 2PGQB 4WVPE 1C5RA 1E79D 2CGAA 2BY8X 3QZRA 2GZ9A 1EQ9A 2IN2A 3A8DA 3M61U 1AY6H 2QC2A 3A8AA 4M9FA 2BXTH 1WYKA 3I29A 2XC4A 1GDQA 4JZDH 2VWLA 1FY3A 3U8OH 1AUJA 4XBCA 3PO1C 4Q2KA 3RDZA 1GHXH 3OU0A 4H4FA 1ZPBA 4JK5A 1NFXA 3T25A 5T1VA 2F4LA 2J98A 2J97A 3C1KA 3SV2H 2ZTYA 2SNWA 6CHAB 4D7FA 5JDUB 1MTWA 2BVSH 4JYUH 1D3DB 4YZUA 3VXFH 4WWYA 1NRRH 3RP2A 2RA3A 1SBWA 1KLTA 1LHGH 1MZAA 1TNIA 4IGDA 4NZQA 1WBGB 3NZIA 3S9BA 1UO6A 1TB6H 3A80A 3URDA 4ZHLU 1LMWB 3WWFA 1O2IA 3SUDA 2F43B 2R0KA 3WY8A 1V3XA 2VINA 1ELGA 2GV7A 2KM0A 1FNIA 1YCPM 1P02A 1BRBE 3EQ0H 3I78A 3ATKA 4UDWH 2XWBI 3BTWE 1GI4A 1QGFA 1SGCA 2F9VA 4JYTA 3A87A 2WV5A 5FBIA 3VG8A 4YESB 2BMGB 1TGTA 1OKXA 2F91A 1SI5H 1AKSA 4ASUD 2ZDKA 3OY6U 2XCFA 1V2NT 1AE5A 3RM0H 5JB9S 3UIRA 4CREA 2ZHQH 1F7ZA 3A85A 3SO3A 3AVZA 1EB1H 1DE7H 3E0PB 3U69H 3RC4A 3VGCB 3T28A 1ESTA 5C0UA 1YPJH 4UFGH 3ZZ8A 2VH0A 3AASA 5L30H 3UREA 2KX4A 2HPPH 1OWKA 4A92A 2BD2A 1H4WA 1GBEA 1ZMNA 3KQEA 1S81A 4B75A 1IQIA 5HKKD 1UVTH 2H2ZA 2RA0A 3UAIC 3EA8A 1CGHA 5K0HA 3SN8A 1FN6A 3TPIZ 4CRCA 1A0LA 3SZNA 3MHWU 1Y3XA 4X1RU 4SGAE 1VGCB 2C8XB 1ACBE 3R3GB 5DKMA 3ITIA 2BD8A 1NO9H 3V7TA 4ZH8A 3VXEH 4WXVA 2V7QD 5DN6D 1ETTH 1RGQA 3A81A 2ZQ1A 3SORA 4ZROA 2A7JA 1ELTA 1XX9A 3OEHD 3RM2H 5FX5A 2G52A 1N6YA 2EI6A 2JH6D 2VGCB 2ZI2H 1H1BA 3BTGE 4E7NA 1E38B 5A8ZA 2G5VA 2J92A 3UB0A 1HAXB 4ZAEA 1ZPCA 2RCEA 1THRH 4GLYA 1BOQA 5IK2D 1VITG 3T5FH 3IG6B 4VGCC 1QHRB 4DG4A 2ODYB 1QA7A 2UUYA 1ARBA 1WOFA 3LH3A 3L3TA 2W7SA 2PW8H 1O5BB 2Y82A 1HXEH 4ACBA 5GIBA 2ILNA 3A7TA 1OSSA 1EATA 2ZU3A 1P9UA 2ZFPH 1ZHRA 3ZVCA 5EQQA 3PLBA 1SGEE 4LZ1H 1BHXB 1BHXF 2Z9IA 3ATLA 1BIOA 3BEIB 1C1NA 1G2MA 3ZZ5A 1O32A 4ZKSU 1W0JD 2UUKB 2Q6FA 1J17T 3PM3A 4AOQA 2G4UA 1BMAA 2BDYA 2O8WA 2ZWLH 4CRBA 1H9LB 3RU4E 3P8FA 2O8TA 2VIVA 3I77A 5FL7D 5C5NA 2O9QA 1MTNC 1TPPA 3W94A 1GMDG 1GG6C 2ALPA 1KXAA 2BQ7B 3OX7U 5DP7A 1GGDB 2GT8A 1O38A 2OK5A 1SSXA 1W10U 3STJA 5FXLA 1A4WH 1KXBA 2WPHS 3MH4A 3A86A 2ZC9H 3UTUH 3PRDA 1VZQH 3RXSA 4KTSA 1K9OE 1QIXB 2BZAA 2WPKS 4K69A 1YGCH 1LHDH 3FP8E 3PB1E 5ABWA 4CH8B 1V2JT 2VU8E 2D2DA 1E35B 1GDNA 2GJGA 3PWBA 2HLCA 5A2MH 3A83A 3P95A 2ZO3H 1GCTC 3OFND 2CXVA 4TYDA 4FETA 8GCHG 2GT7A 3GY6A
chains in the Genus database with same CATH topology
4NSYA 1TGBA 1DITH 3MU1A 2FTLE 2AFQB 2FP7B 1AI8H 1UHBB 2WYGA 4Y0YE 3U98H 1TRNA 1C5MD 3KQBA 4D9RA 4FU9A 3SGAE 1OWDA 2CF8H 3ZZ6A 1AWFH 1C5XB 2ZG0H 1C5PA 1G3DA 5JBCS 2GV6A 2I6SA 2O8LA 1BB0B 2ANWA 2Y81A 5EW1H 2B7DH 2ZPQA 3RXQA 3UY9A 4X8TH 3MO3A 3SW2B 1TGCA 4A5TS 2P95A 4ISHH 1KSNA 2ZFQH 4AB9A 1CVWH 2C93B 2PKSC 4FUEA 1LCYA 2VGCC 1K1MA 1KTTB 1AFQC 4ABAA 2A4OA 2EEKA 1Y3UA 1TA6A 1JRSA 2PV9B 3RUOA 3RXVA 1W7GH 3RXUA 5AF9H 2BDCA 4LK4A 5ETXA 1C1TA 2P16A 3ZYDA 2BY9X 2AMPA 4X8VH 1NFWA 1A61H 2G55A 4OS2A 4YLUA 2A7HA 2PFEA 2A31A 3RXDA 4NIWA 4ZKNU 3N7OA 2G4TA 2HALA 4Y7BA 5DP5A 4FUIA 2FESH 2ESTE 1F0RA 4AFUA 3M37A 3MU0A 1VITF 1C1VH 5FCKA 3RMLH 1MCTA 4ABHA 1F0UA 1TRYA 4JCNA 5GWZA 4F4OC 1O3CA 1SGQE 2ODPA 2FOBA 2Q6GA 5AFYH 4I8GA 4Q7XA 1CA0B 1P11E 5HGGA 1H9IE 5AFZH 5C20A 3RLYH 1FI8A 1VGCC 1J16A 1BZXE 3K6YA 4U2WA 3SU5A 1PPCE 4TWYA 3A7VA 1A1RA 2BLWA 2NU3E 2WINI 3ODFA 5EXLA 4YOJA 3GDSA 5HXFA 3LGUA 1O3OA 3FP6E 1IAUA 1GDUA 1GJBB 3JZ2B 3LONA 2SGFE 4ZUHA 1W2KH 3LT3A 1ZRBA 4DOQA 1GBHA 1G30B 3OY5U 1C5OH 1BITA 3F9GA 1CHOF 1SVPA 3DFLA 4JZEH 3Q76A 4BANB 3MH7A 3OSYA 4CR5A 2JETB 1N8OB 3GISB 1W8BH 1CO7E 1HFDA 1BTHH 1UTLM 2GKVE 4MLFB 5C1UA 4ABGA 4IW4E 3RXKA 1V2ST 1TIOA 1O3EA 4NA9H 3BG8A 1SLUB 1P09A 5C67A 3MMGA 4IC5A 1O3MA 5I46H 2BQWB 2W5EA 1EPTB 1TNLA 2Y7ZA 3P92A 2FOMB 1T8LA 1IOEA 1XXDA 2PKAB 3UR9A 3QLPH 2FI5E 4GVUA 1EAUA 1ESBA 4Y10E 3T27A 2SGEE 1NC6A 2BD3A 1SGIB 2XYAA 2TGAA 1TQ7B 1W0ZU 4MNYA 4Y71A 5A8YA 2H5CA 1AD8H 4K8BA 7KMEH 2FYRA 1C9PA 1C2FA 4Y8ZA 3LGWA 1K1PA 2TRMA 3QWCH 2CMYA 1YC0A 2FX6A 3M7UA 4UD9H 1RTKA 1O2YA 4ISLA 1L4ZA 3T29A 1OOKB 7GCHF 1Z6EA 1GJAB 4DIHH 3MOCA 2TGTA 1MKWH 3LGYA 4B74A 2A0QB 3FVFB 3BTQE 1W3CA 1J15A 1RFNA 1BTPA 1N1LA 1VCPA 3RXEA 2VIWA 1CA8B 1TGNA 2FO9A 4KELA 2BHGA 1DVAH 2OQ5A 5AHGH 2VIQA 3E6PH 4GSOA 1Z7KA 3G01A 1IQFA 2R0LA 1RIWC 1RJXB 3QK1A 2ZFFH 1EP6A 1YLCA 1RXPA 2Z9LA 4IN2A 4ZHAA 4DJZB 1GHAG 1IHSH 1GHBF 1TOCB 3O8BA 2FM2A 3SU0A 3T2NA 4AFQA 4UFFH 4O97A 4DT7B 1HYLA 1GJ6A 1V2KT 3TU7H 2FS8A 4BXWA 3ZV9A 5J4QA 4ABFA 2PWXA 1T32A 3E16B 4K8YA 2ZNKH 1SR5C 2ZFTA 2OD3B 4R8TB 1NPMA 1O3PB 1O0DH 1KY9A 1C2GA 1AVWA 1ZHMA 1Z71A 1Z8GA 3TGKE 3RU4D 1UCYH 1G32B 3SJ9A 1TBZH 1O3AA 1G3BA 2D26C 5L2ZH 1VJAU 1O5GH 4DW2U 1CT2E 3GCHC 2I6QA 8ESTE 2A45B 5DO4H 1N6XA 4UE7H 2ZGXH 3RU4T 1BTZA 4Y7AA 1BTUA 1A3EH 3SI3H 1GBKA 4XE4A 4RSPA 1SGDE 3S0NA 2PTNA 1NU9A 3SHCH 1NESE 2P93A 4JZIA 2BDHA 3HK6B 1MD7A 2H5DA 2WPLS 3M3SA 1KXCA 8KME2 1HAIH 1BBRE 3ZZDA 2CJIA 3UNQA 1IHTH 1P0SH 1QB6A 1AFEH 1MKXK 4ISIH 3BTTE 2R3UA 2QA9E 1MTUA 1HBTH 2CHAC 3R0FA 1C5WB 2DE9A 1NT1A 1S6FA 2YNBA 4ISOA 5E2PA 4UFDH 1O3JA 1VITH 2ZU2A 1BBRK 4XFQA 1GBTA 2A1DB 1KXFA 3TGJE 3ZZ7A 5C1XA 4YOGA 3Q3XA 2GD4B 2XXLA 3GY5A 1P06A 2V3OH 4INLA 4CR9A 2ZU1A 3PV4A 1ZGVA 2PUXB 1ELCA 1ZHPA 3ATMA 2BDIA 1GBMA 1O2MA 1B0FA 3A88A 3RXCA 2Z3DA 3ZVEA 5E8EH 2STAE 4GCHG 1OS8A 1FAXA 3VB5A 1C9TA 5ESTE 3PROA 1C4V2 1TMBH 1P8VC 3LDXH 2H9TH 4R0IA 4BAKB 3TH4H 1HIAB 1JIMA 1VCWA 3HKIB 4IBLH 5EQSA 1P2KA 1ELAA 3EYDA 4NA7A 1GJ8B 1RD3B 1V2MT 4YTAA 1H9HE 3UNSA 3P6ZB 1SHHB 2FS9A 1D4PB 2BB4A 2PSXA 2QF0A 4X8UH 3E1XB 5A0AE 1O2PA 1DWEH 6ESTA 2AMQA 3M5LA 1MAXA 1V2TT 2F9OA 2IJOB 2CV3A 3M5OA 1CGJE 1CQQA 3QTVH 4NZLA 4X1PU 4YT6H 1GBFA 1GJ9B 6CHAC 5LH8A 1DLEA 1QL8A 4O3TA 2AEIH 1YPHC 5EOKA 1OX1A 1QB1A 1GHAF 1V2LT 3VFEA 5DP6A 1A46H 4JK6A 1PYTD 3GCNA 1TABE 4O03A 1K1IA 2B0FA 3TH2H 1NN6A 2FYQA 1CU1A 3HK3B 2BY6X 1V2UT 3UR6A 2ZCLP 4B2BA 1S6HA 1WU1A 2FLBH 2A32A 5I25A 1UHBA 1OP0A 2KAIA 4FVBA 3SI4H 3HGPA 1BUIA 1V2RT 2BZ6H 2A5AA 4Y8XA 1ZMJA 4I31A 2OINA 3RXAA 4A6LA 5B6OA 4BOHA 4NG9H 2AGIX 1UVPA 3OTJE 1Y3VA 2O8MA 4X0WU 1E0FD 4BAHB 3SGBE 4K3JA 1O2ZA 1UJ1A 1A5GH 1HB0B 2OBOA 1X7AC 1HXFH 4MPUA 4I8HA 3RLWH 2WPMS 1SGRE 4LXBH 5JBAS 1O5CB 2BD4A 4AORA 3ZVDA 4NFEA 1O5FH 3GYLB 1LVBA 1XVOA 2GCTC 1NROH 5BPEA 3ZZ9A 1A0JA 2F9NA 2BOKA 2CHAB 3RXOA 2Z3CA 4X6MA 1AB9C 4U01A 1RIWB 2B8OH 2G81E 4Q80A 2ZGBH 1O2RA 3H7OA 1O30A 3P8GA 1TPAE 1G36A 1NFUA 1XUHA 4I8JA 1NU7B 3EDXB 2QXGA 4B76A 6GCHF 3S69A 1BRCE 1KDQB 4SGBE 4WY3A 4FU7A 1C5YB 1O33A 2FI4E 2QF3A 1FZZA 1IQHA 5EPNA 1C2KA 3HGNA 3RXMA 1SL3A 4PROA 1IQEA 1RTLA 3SV9A 2AS9A 1O3GA 2ZTZA 1CHOG 4X1QU 1DSTA 1UTJA 4X2VA 1ELEE 4IMZA 4TPYA 2EI8A 3UOUA 3RC6A 3SNBA 1LPKB 2FEQH 1NS3A 2ZU4A 3MWIU 1BQYA 2BX4A 1DWCH 3Q3YA 2FOHA 4B2AA 1AE8H 5T6DA 1J9CH 4AFZA 1GI6A 3GY3A 2XBXA 2TGPZ 4BXSA 4JZFH 1HAYB 1WQVH 5DP9A 3ZZBA 1YCPK 2HOBA 1P3EA 1HAVA 5FX6A 2GP9B 2C90B 1D6WA 1JXPA 4I32A 3TITA 1UTMA 2PKAA 1QL9A 5FPTA 2P8OC 3MI4A 1TNJA 2Y7XA 1PYTC 1EP5A 1P2OA 1ESAA 1NRNH 2P3FH 3UQOA 2J2UA 4X1NU 1AZ8A 1C4U2 4E7RG 5C1YA 1K1NA 1F2SE 3CS7A 2ZTXA 4GAWA 1BTYA 5L6NH 2H9HA 1C2IA 4ISNA 3MTYA 4CBOA 3C27B 1EZXC 1O39A 3PO1B 1TWXB 2BLQA 3UWIA 3LJJA 1EZSC 1PQ7A 3PLPA 3F9EA 1AQ7A 1EAWA 3BF6H 1GL0E 1TONA 5T6FA 3K9XB 2ANKH 5ESBA 1GI7B 2B9LA 1KLIH 1GJCB 3D23A 3SJOA 1V2WT 4TWWA 1XM1A 1C4Y2 2TBSA 3FP7E 2FXRA 4ZMAH 1C2LA 2ZDAH 1EKBB 2GCHF 5CE1A 1HAPH 1K28D 4ABDA 2AYWA 1GBJA 1P2MA 3MNXA 4OGYA 3MNCA 5DPAA 5GXPA 1D3TB 1HCGA 1SGNE 1AIXH 1VCQA 1OWEA 3CENA 1MMJN 3U1IB 1Y5UT 1BA8B 4NGAH 3U1JB 2ZFSA 5C3NA 1Z1JA 1UCYK 2AIQA 1RS0A 1A5IA 2W26A 3FFGA 4AG2A 3BTFE 2JKHA 2AIPA 3D62A 2BY5X 1YPLH 2F83A 4AN7A 1ELDE 1XKAC 2GMTC 4FUJA 2F9BH 1W0YH 1GBIA 1SOZA 7GCHG 4CRDA 5DK1A 5GCHF 3BTDE 4I8LA 3NXPA 3PMBB 1TQ0B 2G8TA 4H6TA 4Y0ZE 4FUBA 2J95A 1UTQA 1GI5A 1O5EH 1YF4A 2OLGA 2V0BA 3ODDA 1TX7A 3LGTA 2Z9JA 2HNTF 3BEUA 3U8TH 1C5NH 1OYTH 4KGAA 4GPGA 3PYHA 2QV1A 2QIQA 1N8OC 5EG4A 2FDAA 2C4FH 2EI7A 1FLEE 2BD7A 3BTHE 1LDTT 1QRZA 1HLTH 1DXWA 1HGTH 3DUXH 1ABJH 1TBQH 1HAVB 1W11U 3SV6A 3AW0A 2A5KA 1SGYE 4DVAU 4WF8A 1DOJA 1O2KA 1UVUH 2QXHA 1EAXA 1T4UH 1TPOA 1BJVA 1QJ7B 4J2YB 3RXGA 1ZSKA 8LPRA 1RTFB 2C3SA 1C1QA 1A2CH 1ZJKA 2P8OB 3QZQA 3VEQB 3ZVFA 1O34A 4CRAA 2ZHWH 5DGJA 1BTXA 3SNAA 5L2YH 3RXIA 1C2MA 2VIPA 2GCTB 4I7YH 1C5ZB 1TMTH 2C8WB 3M3VA 1HRTH 3IITA 4AZ2B 3QX5H 3E90B 3U9AH 4OS6A 1SGTA 4DY7B 1JBUH 1P01A 1L0ZA 1ABIH 1YPEH 4AG1A 3U8RH 2P3UB 1Z8RA 2ALVA 1S5SA 2FOGA 2HRVA 4U30A 1KIGH 4FUGA 3ZZCA 3ZZ4A 1W7XH 2PR3A 2XC0A 4MQAA 2NWNA 4ZKRU 1J8AA 3TJNA 3D65E 2VWMA 2ULLA 2BXUH 1SLXB 1Y5BT 3GCTF 1HJAB 1K1LA 3LGVA 1LHCH 1UTNA 1FY5A 4K1TA 1KXDA 2GZ8A 5TJXA 2ANMH 1HJ8A 2SGPE 2Z9KA 2ZGJA 3K65B 2A4RA 1DICA 4WH6A 1AUTC 2JETC 1PJPA 2NU2E 2FOEA 4Y6DA 5FPSA 1V2QT 4THNH 3MFJA 1G2LA 1PQ8A 2AMDA 1MTVA 1HAZB 4DGJA 3LJOA 1FY1A 1F5LA 1E37B 1TA2A 4A1XA 3KEEA 2XW9A 3HPTB 1BT7A 2D1JA 1C1RA 1S82A 2HNTC 2ZP0H 4CRGA 1THPB 5JBTA 1NRSH 2VH6A 3A8BA 4FUDA 4UEHH 1O5DH 2DUCA 3VB3A 1PPHE 1H8DH 2UWPA 2F9UA 1O3KA 3S9CA 1DS2E 4INKA 4D8NA 4NWKA 1O2JA 2Y80A 4BNRA 1XXFA 3GCHB 1QL7A 3QO6A 4NIXA 4TY7A 5A0BA 3SNCA 1O2SA 3KGPA 2P3TB 2PLXA 1D9IA 1CA0C 1V2PT 1NRQH 1GHVH 3A7YA 1C5UA 2ZCKP 1Y8TA 4KTCA 1SLWB 4Y79A 2JH0D 1THSH 2ANYA 5K7RA 1DY8A 5CHAC 3DT0H 1TNKA 1T31A 3PMJA 5DJ7A 2A2XH 1QBVH 4IC6A 1AHTH 2A4QA 3TK9A 1RRKA 1TLDA 1LKAA 1FDPA 3DD2H 5E0HA 4NIVA 1A5HA 4X2WA 2SGDE 2GGVB 3MYWA 3ZVBA 1O2TA 1AFQB 1XKBC 3P17H 4K60A 1P10A 1ANDA 1M9UA 2BLOA 1BDAA 3KL6A 2G00A 3ZZAA 1GBAA 3E0NB 3SU2A 2ZDMA 5EXMA 4X2XA 1GMCG 2XNIA 4WMFA 1TNGA 3GY4A 2VVVA 1C1MA 1OP8A 5E2OA 8GCHF 1IQGA 1SPJA 1IQNA 1P03A 1FAKH 1SC8U 3SBKA 2HPQH 5IDKA 1TNHA 2FPZA 1WTHD 2OC7A 3A84A 1ARCA 1YCPH 2AERH 1UK4A 3RXPA 1HAHH 1EZQA 2XBYA 4B1TA 3RMNH 5C5OA 1O3HA 3ZZ3A 5A0CA 2WUCA 1YP9A 2G51A 4ZXXH 1K22H 3KHVA 4AFSA 1EUFA 1DDJA 2QYIA 1BMNH 5E0GA 1F92A 3RXJA 1P2IA 1OXGA 4K2YA 2ZDVH 4HTCH 1MKWK 4VGCB 3SU1A 2GDDA 6LPRA 1O3BA 1SQOA 1C2DA 4ABJA 4YOIA 1ZMLA 2BM2A 2HVXA 3SV8A 2OUAA 1FPHH 2ZDLA 1GPZA 4X6OA 1MBMA 1LVMA 1TPSA 1CGIE 2FMJA 2PGBB 2ZZUH 3VB6A 1T7CA 2QY0B 1DSUA 1IQMA 1ELBA 4M7GA 1LHFH 1GWAA 1ZTLA 1W13U 1IQLA 4Y8YA 1O2NA 1GJ4H 4RKJB 2ZF0H 1L1JA 2ZHFH 3RC5A 4LZ4B 3T62A 5H4IB 5SGAE 2SFAA 1C5VA 1BMLA 5HMAA 3UOPA 1HAOH 4GCHF 2VVUA 3GICB 3PLKA 3TH3H 2GDEH 1BJUA 2ZKSA 3BTKE 4MPWA 1EOJA 4GUXA 3SUFA 1T8NA 4CRFA 1GHZA 2BOHB