1P9UA

Coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative coronavirus nsp2 (3CL-PRO)
publication title Coronavirus Main Proteinase (3CLpro) Structure: Basis for Design of anti-SARS Drugs
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1p9uA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA01
1YLCA 1TGTA 1IQHA 3CP7A 5DGJA 1ACBE 1YF4A 4FU9A 1SGTA 4JYUH 1C5VA 2YOLA 3ZZ8A 1FIWA 1BQYA 3T27A 2ANMH 2C3SA 1BHXF 1DICA 1GJ6A 3BTKE 2G51A 1ZJDA 4WXVA 1IHSH 2FYQA 2R2MB 1FNIA 4CR5A 1OWEA 4JK6A 3ZVDA 1QA0A 2ALVA 4BTTB 2HGTH 3FP6E 1WYKA 1FLEE 4HZHA 3MI4A 4IBLH 4LZ1H 4ISOA 1FIZA 4B73A 2EI8A 2PUXB 1UTNA 4X6OA 1C4V2 3MO9A 2HPPH 4A5TS 2BDIA 1G2LA 3P6ZB 2BD2A 1NROH 1AMHA 1C1PA 4OS2A 1O0DH 1BTZA 1YPEH 3F1SB 4AGJA 2VJ1A 2FOEA 5FPTA 4AFQA 1C2LA 2DE8A 1BBRE 4I32A 2ZGHA 1AE5A 1QBVH 3FFGA 5JPMH 3RM2H 1LVYA 1WSSH 3BTDE 3LPRA 1VCWA 1KXCA 3M35A 1LVOA 2C8XB 2UWPA 2O8LA 4DT7B 2ZGBH 5GDSH 1KXFA 3UWIA 1TALA 3A84A 2SNWA 3HGPA 3SJ8A 3N7OA 1W2KH 2ZU1A 1J8AA 3SI3H 1L0ZA 3E90B 3EAJA 4DGJA 4YM9A 2EC9H 3MU1A 5AF9H 1Z6JH 2JH5D 1SR5C 3TPIZ 4TPIZ 5LH8A 3NKKA 4X6MA 3GCOA 1AVGH 2P94A 3QUMP 1IQFA 1C9TA 4I8GA 2R3UA 3DFLA 4E7RG 4GPGA 1GWAA 3MOCA 1MU8B 4AFUA 1ETTH 3ZVCA 4NZQA 1GBIA 2W26A 3O8RA 2BLQA 1BITA 1P2MA 3M5NA 5AFYH 1RRKA 1FONA 1V2ST 2BM2A 3RXAA 2A4RA 3OU0A 1O2MA 3ESTA 3PO1C 1K28D 2EEKA 2ZI2H 3A81A 1WCZA 3SU4A 1XMNB 1GI1A 1OYTH 3M5LA 4AOQA 2VINA 2FODA 1P04A 1UTJA 2Y5FA 3RXVA 1C5PA 2ZHEH 4GLYA 4XSKU 1XUIA 2A31A 1AGJA 4Y8XA 1DXWA 3IITA 4Y76A 2QGRA 1TRMA 4INHA 1HXFH 3M3SA 1DY9A 1A5IA 3CS7A 1ZTJA 2BDHA 1C5LH 4FUIA 5JBTA 3QGNB 1KLTA 2DUCA 1A46H 3GYLB 1WTHD 2YNBA 3A7ZA 3H5CB 3ZZCA 6CHAC 4NWKA 2PWXA 1QJ7B 4UD9H 2ZDAH 4Z6AH 1P2QA 2HWLB 1V2MT 3K2UA 3EYDA 3FZDA 4PROA 5FBEA 2PV9B 4B2CA 2XNIA 3GISB 1PPFE 5JB9S 5JDUB 3UR9A 1C1WH 3S9AA 1ZRKA 2F3CE 1QURH 3LH3A 5F8XA 3UOPA 1DM4B 1W12U 2SFAA 1Z8RA 2I6QA 3LC5A 1FPCH 1OOKB 1GDNA 3SJKA 4ZKSU 2ODYB 1ELEE 3PM3A 1P2OA 3MO6A 2XYAA 3DHKH 1XVOA 1HAIH 5LGOA 3TGIE 2GT7A 3VFEA 1AB9B 1UHBA 1EOJA 3S7HB 4LOYH 4TY6A 4TPYA 3BIUH 1P12E 1H9IE 3AW1A 1O5AB 3LDXH 4CR9A 1MTNC 2VU8E 4JZEH 1PQ5A 5LPEA 2BD4A 3B8JA 3SHCH 2OC8A 1HAXB 4WY3A 2EA3A 5FX6A 5JBAS 1TMBH 1LHGH 1TOCB 2NU2E 4AB8A 1N8OC 2F83A 1NFXA 2ZCHP 1L1JA 2GDDA 1B7XB 1GDUA 4R8TB 2A5AA 2H2ZA 1DY8A 2A1DB 5F03A 1D4PB 1SGIB 2WPMS 1T4UH 2BQWB 2WYJA 3SNAA 1CVWH 3GICB 4FUBA 1GHYH 1G2MA 1T7CA 1EAUA 4NSYA 1O3LA 5EXMA 3W95A 1SFIA 4BXSA 3KQDA 1NFWA 1T8LA 4E06H 4K60A 3PLPA 3KL6A 3EQ0H 1GBMA 4K69A 5EXLA 2G8TA 1YYY1 4E05H 1EQ9A 5HXFA 1F5RA 2ZHFH 4H6SB 4MLFB 1V2RT 4ASHA 1SBWA 2GTBA 1FJSA 1EJAA 1WAYB 3SU2A 4Y10E 1PPBH 2FLRH 1IOEA 1MD7A 1O3PB 3MH4A 2FYRA 6GCHF 2BY9X 3SNEA 2KAIB 3KN2A 2BD3A 2ZCLP 1UTOA 1BTPA 4NCYA 1AN1E 2Y80A 3R0FA 5PTPA 4BANB 3VB5A 2AIPA 4CRCA 1CQQA 2ZU2A 4X8UH 3TK9A 1A61H 4MNWA 4X8VH 2R0LA 4ZMAH 4I8KA 5GWZA 3MNBA 1O38A 1XKAC 4IC6A 1SLUB 2OLGA 2ZGJA 3TGKE 3GDSA 2BD8A 3SU3A 1TMUH 3EGKH 3FVFB 1ABIH 4B1TA 4A6LA 1GJDB 4RSPA 1SC8U 4WMFA 1BRAA 1EAWA 2J38A 2FS8A 2CF9H 4BAHB 2W5EA 1A7SA 3EA7A 3HK3B 3K6ZA 4IN2A 1FY1A 1RXPA 1KYNA 2VWMA 5C1XA 3PWBA 1D3PB 1SLXB 4Y7AA 1JIMA 5SGAE 2C93B 1B5GH 1UTKA 4FU7A 1GI0A 2HNTC 3TH2H 3ZZ9A 4XDEA 1GHWH 1DSUA 3RU4E 1QJ1B 1YPGH 1Q3XA 2BMGB 2PKSC 3NK8A 1CSOE 1ESAA 5L6NH 2OD3B 1MAXA 1TABE 3MWIU 4ABAA 1S84A 2ZNKH 1EPTA 7ESTE 1Y3YA 4BAKB 5AVDA 1K1MA 1S83A 3K65B 3L6PA 4CBNA 1C5YB 3RXPA 1K9OE 5GXPA 3URDA 1TNKA 4MPWA 3AVZA 4MQAA 1AQ7A 3HKIB 2BDYA 1QJ6B 1O3EA 4D7FA 1HAVB 1P57B 4NFFA 5IDKA 1YKTA 3S69A 1HFDA 2P3TB 3U98H 4FUFA 3ZV9A 3B9FH 5JBBS 3TH4H 1INCA 1C5WB 1TE0A 1RTLA 3GCHC 2ZFRH 4K8BA 4OGYA 1FZZA 1HAVA 1P02A 4K5ZA 4NGAH 1QFKH 2BVXH 1G30B 1BMNH 4UFFH 2GT8A 2AMPA 1YGCH 1NC6A 2OCVB 1LVBA 2Z3DA 3RMNH 2H9TH 2ZTYA 7KMEH 1O2TA 2G00A 5DO4H 1P05A 3QZQA 2Z3EA 3NPSA 2Q6GA 2GCTC 3E16B 1ZR0A 3AAUA 4NFEA 1SB1H 2Y5HA 2G4UA 3SV2H 3ZZ4A 4MDSA 2BDBA 1CU1A 4YO9A 1YPMH 3P8GA 1T8NA 2VIWA 1JWTA 3STIA 1HAOH 3UQVA 1KDQB 1GCDA 4NIYA 4ISNA 5C2ZA 3TLOA 1SGEE 1Y3XA 2ANYA 5DP9A 2TRMA 4VGCB 1GCTB 3LOXA 2ZHQH 5AHGH 1SG8B 5F8ZA 1SLWB 3LGWA 1KDQA 1MBMA 3GDUA 1GG6C 1XXFA 2WPLS 3ZZ7A 1OWDA 4O9VA 3EA8A 1P06A 4B2BA 5H4IB 2GGVB 3BTEE 1RTFB 1GL0E 1O5DH 4UFGH 4ZUHA 1W10U 1O3AA 2XWAA 1QQUA 4RN6A 4I31A 2XC4A 5A0BA 2VGCB 3SV9A 3SU6A 3ZV8A 2ZDVH 1O2OA 3MH6A 4CBOA 1HYLA 4X6PA 1ZMNA 1FAKH 4CHAC 2WPHS 2NU0E 3P8FA 3V13A 1F0TA 1NESE 5EPNA 4Y0YE 1SGPE 2FZZA 1KXEA 3A87A 3RMOH 1C1OA 3U9AH 1BRUP 2ZQ1A 1C5OH 1GMHF 2UUYA 1WBGB 4ABBA 2ZQ2A 3LJOA 3RXFA 1KTSB 2CMYA 2BQ6B 2QCYA 2XBWA 1O2KA 2FIRH 3OTJE 1CGJE 1NFUA 4YESB 4F4OC 2THFB 4B2AA 4O3TA 3RXTA 2ZC9H 2VIDA 2H6MA 1UTPA 5GIBA 3GOVB 1DPOA 1TAWA 1V2LT 3RDZA 4ABGA 2ZFQH 1SGRE 5B6OA 1GBEA 2B7DH 1GI4A 4GCHG 2GDEH 4DIIH 1FUJA 2H5DA 1L1GA 4AYVB 1EJMA 4CRBA 4GHQA 1XKBC 2V3OH 1OX1A 5L2YH 3TJOA 2D2DA 1Y3WA 1TGSZ 3F68H 3M3VA 1H4WA 1NU7B 3HKJB 3BEFB 1FMGA 2PFEA 4MNXA 2HLCA 4Q80A 1SGQE 2FPZA 1SOTA 2ODPA 1P09A 2ZWLH 2FOBA 1ZYOA 1MTUA 2SGDE 4AYYB 1W13U 5GCHG 1BUIA 1V2NT 1L4DA 1LDTT 5I25A 3UR6A 1MKXK 4INKA 4A1XA 5GPIB 1O5BB 4HFPB 3MU5A 4UONA 1AE8H 5A2MH 2RA0A 3PMHB 2Y81A 2CGAA 3QK1A 4YT7H 4AZ2B 1DX5M 3LC3A 1VJAU 3C27B 4QT8C 3KHVA 2ODQA 4Y7BA 2FDAA 1ZJKA 3UQOA 1FY3A 4FUEA 4NSVA 3JZ2B 4KGAA 3QLPH 2C8ZB 3QN7A 3ZVFA 1C2MA 2FOFA 4NA7A 2OUAA 3UREA 2G5VA 1H9LB 1P3EA 3Q3YA 1C5QA 4I8JA 1MMJN 1CO7E 3P92A 2WPIS 1TPAE 3S7KB 5HMAA 2CF8H 2W7UA 2GV6A 1MBQA 5FPSA 1F0UA 1C2FA 2BTCE 3DUXH 3RU4D 1DITH 2XBXA 2XRCA 1J9CH 1K1JA 2M5TA 3GY4A 2H1UA 1DFPA 3GY8A 1GVZA 1VGCB 1QRWA 1CHGA 5HGGA 4UDWH 3UIRA 4MNVA 2IPHA 1G37A 1DLEA 1ZHRA 1SGYE 3NZIA 2A2XH 3KCGH 4X1NU 1NT1A 3TH3H 1K1OA 4F49A 1EB2A 3BG4C 4IMQA 2UWLA 4WXIA 5E0GA 3U8OH 2G55A 1IQLA 2FWWA 1BMAA 4TWWA 5T3HA 5AFZH 1O2LA 3A8DA 1P8VC 5DP7A 2OC0A 1UK2A 2TBSA 3E1XB 3T2NA 1XUHA 1HJ8A 2GD4B 2ZGXH 4U2WA 5A8YA 1L1NA 2BLOA 3ITIA 1HAYB 1NU9A 1UVPA 5T6GA 3LGIA 3PMAB 2BB4A 1TMTH 3BTWE 1UCYH 2AGGX 3M36A 1GI5A 1S81A 1CBWC 4FUJA 2BZAA 1L4ZA 3AW0A 4D9QA 2FX4A 3EA9A 4IMZA 5C3NA 4K1TA 1UK3A 3VGCC 1XXDA 2VNTA 1CE5A 5EGMA 3TITA 1UVTH 1HJAC 5CHAB 5FCRA 3DA9B 1W14U 4UFEH 3CENA 1FV9A 1UVOA 2BOKA 2O8UA 1G3CA 4H42U 1P0SH 4YTAA 2ZF0H 2PUQH 4U30A 3FAOA 5DP4A 1AUTC 2BX3A 3GCTG 2BY5X 1MH0A 4LK4A 1Y5BT 2HPQH 4UE7H 3RC5A 2Z9JA 4DCDA 3SHAH 2HVXA 3MHWU 2GZ9A 1RJXB 4X6NA 2BXUH 3PV4A 4BOHA 5DP3A 3SGAE 3UNSA 2ZDLA 3F9HA 4X8SH 3D62A 3RXDA 3A89A 1O2ZA 1GGDC 3NXPA 5CMXH 4WMDA 1LHCH 2XXLA 3QO6A 4X1QU 5FCKA 2BOHB 3NCLA 1C5XB 1CGHA 3Q3XA 1GHXH 1GJ5H 1Z7KA 1FY4A 1X7AC 1W8BH 2LNCA 1RD3B 1P2JA 1OP8A 1JIRA 2V0BA 2A45B 1LCYA 2C4FH 5EQSA 2R9PA 1YPJH 4ZHLU 1K1LA 1NRPH 4YT6H 1XUJA 2R0KA 1KSNA 1ZOMA 3BF6H 2VVUA 3C1KA 3SW2B 5C20A 2NU3E 1HAHH 2ZECA 3A85A 5C1YA 4GVUA 1BBRH 2LPRA 2UUKB 2ZIQH 2NU4E 1W11U 4Y6DA 1GJ4H 1HPGA 2PTNA 7GCHF 1PYTC 5DP6A 4X2YA 4CRFA 1FQ3A 2F9PA 1BTHH 3SGBE 1O31A 2FOMB 4I33A 1EUFA 3VXEH 5J4SA 2VIPA 1TX6A 4O97A 2FESH 1QGFA 1UHBB 5E2PA 1EX3A 3PROA 3P95A 3KEEA 5BRRE 4AFSA 2ZO3H 3MNSA 2RCEA 1BDAA 2BX4A 3T25A 1TBZH 1SHHB 1P03A 2G81E 2OQUA 1YCPK 3RXMA 4XOJA 1AVXA 3PTBA 4HGCA 3KQCA 4CRDA 4NWLA 1Y5AT 2FI5E 3MNXA 1KXAA 5EPYA 5IYTA 4OGXA 3RUOA 3VPKA 1SQTA 2P59A 2AERH 3E91A 2W7SA 1QB9A 3M7UA 3D49H 1PFXC 1GHBG 3O8BA 2ZPQA 1O3HA 4RKJB 3RC4A 1E36B 2OP9A 2RA3A 1GBLA 3VB6A 2C8WB 5A09A 1BOQA 5FHTA 3A7XA 3RXOA 4BTIB 2R2WU 2ZPSA 2VWLA 4MPUA 3CS0A 4ABFA 3SNCA 4CH2B 1UJ1A 5HM2A 2K1QA 3OSYA 4X2WA 1FAXA 2WPKS 3UPEA 3L3TA 2VIQA 6ESTA 1G9IE 3F9EA 4XBDA 3SZNA 2P93A 1ARCA 4KTSA 1ZLRA 2XCNA 5EODA 1O3OA 2G52A 1P01A 6LPRA 3RXHA 4KELA 3ZVGA 1P10A 4XE4A 3V12A 1EZSC 4Y79A 2H5CA 3ZZ5A 2FEQH 2BLWA 1C5TA 1NM6A 4FUGA 1ELDE 1GJCB 1NRQH 4IC5A 2ZA5A 3SUGA 4XFQA 3B23B 5ESBA 3ATKA 3SQHE 1OP2A 1RGQA 1WU1A 1O3IA 1QCPA 4ZKRU 1QRXA 3E0PB 1JOUB 1Z8JB 3F6UH 1ELTA 1MKWH 2BXTH 3PO1B 1AIXH 2AS9A 1ESTA 3SNBA 2SGEE 1E35B 1GCTC 1GI9B 4AFZA 1NRRH 4UFDH 1C2HA 2H9EH 3SQEE 1GI8B 4YZUA 4ZHAA 3LONA 1RIWB 4B71A 3P70B 1BRBE 1EJNA 2PW8H 5C5OA 3QZRA 3E6PH 2B9LA 1HIAB 3BG8A 5A0CA 3VB3A 2GVFA 3T28A 2G5NA 3F9GA 3LGYA 1BB0B 1B0FA 1GMDF 4K8YA 1NY22 3M61U 3S0NA 4BTUB 4MG3A 4TYDA 1HIAA 2Z3CA 4ABEA 1EPTB 1DANH 2VIOA 1K1PA 1DSTA 1HLTH 1GBDA 3T5FH 3A7TA 2STBE 3QX5H 2HOBA 4OS4A 1ZPBA 2ZFSA 3SUFA 1GDQA 4CH8B 1BTXA 1AKSB 1O2NA 2HNTE 5I46H 2C90B 1MCVA 1B0EA 3LU9B 4WH8A 3KIDU 4ZKOU 2D26C 1VCQA 1C5RA 3RXBA 1O2HA 1Y8TA 1AKSA 3STJA 1H9HE 1AY6H 1DE7H 4JZDH 4X2VA 1HGTH 2ZG0H 3TJVA 2A32A 2ZDMA 2F9NA 1KTTB 1NRSH 1A0JA 1SMFE 2GCHG 2FMJA 3KQEA 4Y71A 2ZU4A 1O33A 1ANCA 1PQ8A 2O9QA 1W7GH 1J17T 4AN7A 2CHAB 4DVAU 3PYHA 4OS1A 1N8OB 4CRGA 3BTGE 1Z1JA 2WINI 2FI3E 2VB0A 1NS3A 4NZLA 3T26A 2OINA 4ABDA 2O8TA 2R3YA 2VIVA 4KKDA 1QB6A 2LIZA 3URCA 1GBTA 1JMOH 2TGDA 1C5UA 1ESBA 1TYNA 2TGPZ 3H7TA 4Y8ZA 1G32B 1F5LA 3RXQA 3ZVBA 2FP7B 3SUEA 1HNEE 3GY3A 4DY7B 2AIQA 2CV3A 3FP8E 4ZKNU 4FVBA 2ZFTA 1GBAA 4B76A 1C2JA 3BN9A 2F9OA 4SGAE 2A0QB 3SGQE 3MFJA 4DOQA 2AMDA 1P2KA 1TNGA 1ANDA 2GMTC 1O3JA 1ZTKA 5A8ZA 1AHTH 1DWDH 1OYQA 2P8OC 4B74A 4Y8YA 1H8DH 1AO5A 2I6SA 3UUZA 1GVKB 2SGAA 2ZEBA 1XUFA 1ABJH 1O2JA 1SLVB 2JH6D 1A2CH 1IAUA 1D3DB 2RDLA 2VH6A 1OWJA 3K6YA 5FXLA 3PLKA 4GSOA 2UUJB 1ELBA 4AG2A 2A7JA 3DT0H 5GCHF 1AFEH 5A8XA 2EI6A 2BHGA 2BD9A 5DJ7A 3ODDA 1MTVA 2YNAA 3NUMA 1Y59T 1YBWA 1F0RA 5HM9A 1SGFA 2BLVA 1D9IA 3KF2A 3BTHE 1LTOA 1Z1IA 1TPPA 4ZROA 1TPSA 2PHBA 4BXWA 4UEHH 1C5MD 2IJOB 4Q2KA 1YPKH 3SI4H 5LPFA 1TGNA 2ZTXA 1F5KU 1CT0E 1O3MA 2ALPA 1P11E 3P8OA 2PKSB 5JB8S 1MU6B 1SL3A 1MTSA 1EB1H 4JMYA 1Z6EA 3BEIB 1V2WT 3SOSA 1GJBB 2P95A 2SNVA 3S9BA 1ZSLA 1TB6H 3ATWA 1GJ7B 3SN8A 1DDJA 1ELVA 3A88A 4X1SU 1CHOF 1MKWK 1RS0A 3ODFA 2ZFPH 3GY5A 3I77A 4JZ1A 4YLUA 1QA7A 1CA0B 1P9UA 1QL7A 1YLDA 5DG6A 1ZZZA 2ASUB 2XBYA 1TLDA 3IG6B 2TIOA 1ZHMA 4JCNA 3QDZB 3ZVEA 4ESTE 2A4GA 3QTVH 4TY7A 2GZ7A 3ELAH 2A5KA 1AFQB 1K1NA 1LMWB 2F91A 1QIXB 5E8EH 5FBIA 2AH4X 2AYWA 3AAVA 1XUKA 4NIVA 4B75A 1SGFG 1A0HB 1ID5H 3NWUA 1O37A 5DP8A 1H1BA 5J4QA 1QL8A 3SU1A 1QTFA 2GCTB 4Z0KA 1U6QA 3TIUA 1C2GA 2FTLE 5TCAA 1O2IA 2TGTA 1GL1A 2QXGA 1AZZA 3T29A 1DUEA 1THSH 1TNJA 1LVMA 1YPHC 1FY8E 1KLJH 1O2WA 1C5NH 3OYPA 3W94A 2Z7FE 2A7HA 2Z9GA 1UVUH 2ZGCA 2Z94A 1O2SA 5C67A 3ATIA 1IQMA 4THNH 1LKAA 5TCCA 1K2I1 1Z8IB 2D8WA 3MH5A 1AVWA 1O5GH 4JK5A 2Y7ZA 5DK1A 3A7YA 4AB9A 1C2DA 1K22H 1XX9A 5K0HA 3AASA 1GG6B 1BIOA 4FVDA 3GYMA 3RXSA 3HPTB 1EP6A 2AMQA 3UNRA 2B0FA 1TIOA 1QBNA 1GBBA 1V6DA 3HK6B 1SHYA 1O2QA 4OS5A 1C1MA 5JYIA 3GCTF 3LGTA 4X0WU 1NZQH 4ZXYH 2PGQB 1VITG 1ETSH 2SGPE 2ILNA 1O3GA 3GY2A 1BA8B 2BZ6H 2ZCKP 3GY7A 1FPHH 2PSYA 4FU8A 4GUXA 1JRSA 3PTNA 4CHAB 1OWIA 1XUGA 1H8IH 2SGFE 1OP0A 2ZPRA 1CT2E 4MTBA 4CRAA 1DWEH 1V2VT 2JH0D 4LXBH 2PSXA 4OS7A 1LHFH 5L2ZH 4KTCA 4AX9H 2OXSA 1KY9A 1O3BA 2XTTB 1SFQB 3FZZA 1C1NA 1UTQA 8GCHG 2EI7A 4FUDA 1GBCA 1BMMH 1HB0B 1O32A 2O8WA 1IQJA 1GHAG 4U32A 1CA8B 1JXPA 1JBUH 2WUCA 1LHEH 3BTTE 3GCNA 3SNDA 1EOLA 4BNRA 1BTWA 1DVAH 1E37B 2SGQE 1GJ8B 1BZXE 1FI8A 2QC2A 4Y11E 2GZ8A 1VJ9U 1W0ZU 4AORA 3FANA 1WQVH 1TPOA 3TNSA 1A5HA 2QXJA 3HGNA 5T6FA 4X1RU 2BDAA 2A4OA 1BHXB 3SV6A 1N1LA 1TBRH 3QWCH 2XC0A 2ANWA 1ZTLA 1O3FA 2ZKSA 1V2KT 1GMCG 3E0NB 2FX6A 1IHTH 2A7CA 2QYIA 1EZQA 1N6YA 1WOFA 2NU1E 1AB9C 1HXEH 1NFYA 2ZU3A 1F92A 5ESTE 1TOMH 5LPRA 1O5CB 1TA2A 2FI4E 1YM0A 1C5SA 1T8MA 4KP0A 4XBBA 3Q77A 4X1PU 1P2NA 4RKOB 2UWOA 3RMMH 1S0QA 4HI3A 4I8LA 2VVCA 2Y6TA 1LPKB 1TX7A 1TA6A 3V0XA 5DP5A 4D76A 4YOJA 2GX4A 1IQIA 1YPLH 3A86A 3P17H 3A8CA 1FN6A 1MZDA 1OS8A 2DE9A 1PPHE 1V2UT 1PPCE 3SO3A 5CE1A 1XVMA 3D65E 3LT3A 3F9FA 1NTPA 1O2XA 2F9VA 1WUNH 1QY6A 5DKMA 1GHBF 3A7VA 4GHTA 1PPGE 2F9BH 2FOHA 4K1SA 5EW2H 4J1YA 2JETB 2BY8X 3MYWA 3Q3KA 3WY8A 2BD5A 4ISLA 3RLYH 1W3CA 2XBVA 4X8TH 5L30H 1O39A 4H4FA 1SGCA 5TJXA 1F2SE 1S85A 1QRZA 1SI5H 2OQ5A 3ATMA 1EZXC 1A1RA 1BCUH 1G36A 1ORFA 2ULLA 4A92A 3Q00A 1WV7H 2ESTE 2BYAX 4ABIA 3SUDA 1TQ0B 2J2UA 2ZDNA 3OY5U 1UTLM 3LIWA 1V2TT 3TU7H 4E7NA 1P2IA 1BTUA 1MTWA 3MMGA 5E0HA 5G4BA 3KGPA 1ELAA 1O2YA 1HAGE 3TJNA 1LKBA 1ZGVA 2CJIA 1VCPA 2PTCE 4JYTA 1Y5UT 1GVLA 1RIWC 1LQDB 2C8YB 3BG4B 5T6DA 3RXGA 1G3DA 1EASA 1UO6A 1D6RA 3UOUA 1CT4E 1T4VH 5FX5A 2ZHDA 1ZGIA 2WUBA 3U1JB 1V2JT 9ESTA 1HJ9A 3E8LA 4IN1A 3RXJA 1GBJA 1EPTC 3M3TA 1V2OT 2QF0A 2ZP0H 1L2EA 2Q6DA 2OC7A 4Y0ZE 2O8MA 2A2QH 1CBWB 2J9NA 1NN6A 1VZQH 1ETRH 4DIHH 1ANEA 2PKAB 2FO9A 3VGCB 1A3BH 2QXHA 4D7GA 1Y3VA 2TGAA 3HATH 3BIVH 1OSSA 3SJIA 1TNLA 1SOZA 3SBKA 1HJAB 4ISIH 4DG4A 1GI7B 4YOGA 3ZZAA 3RC6A 2NWNA 4YOIA 1DOJA 2PKAA 3MTYA 1IQEA 5EOKA 5F8TA 1C2IA 4O3UA 1EKBB 2ZDKA 3KQBA 2B8OH 1AWFH 1LQEA 1ELFA 4JYVH 1V3XA 4JZFH 2OBQA 2ZHWH 3UWJH 1TONA 7LPRA 2HALA 2QA9E 4DW2U 2CHAC 4ABHA 1S5SA 3QGJA 1P3CA 8ESTE 1EAIA 1SSXA 2W3IA 1GGDB 1M9UA 3RXUA 3BV9B 2ZU5A 5C1UA 1VR1H 1BTYA 1ARBA 1QHRB 1TFXA 1THRH 4WF8A 4WWYA 1UCYK 3A80A 3SU5A 2Q6FA 2JKHA 3RM0H 1TRNA 1A0LA 2GCHF 1OWHA 3UFAA 4XBCA 1O5FH 2QY0B 2BDGA 2WPJS 4ZHMU 3DFJA 1GI6A 3A7WA 2WV4A 3LGUA 1QBOA 1SPJA 3I78A 2BQ7B 1S6HA 4INLA 4VGCC 5EQRA 2QIQA 1BJUA 1HAPH 2BVSH 4GAWA 9LPRA 3TNTA 2QAAA 7GCHG 3S9CA 4WVPE 1UMAH 2IOTA 4Q7XA 5FAHA 1O3NA 3M37A 1MUEB 1GI2A 5C5NA 1YCPM 1A3EH 3RLWH 3DD2H 5BPEA 1W7XH 4KTUA 1GPZA 1WQSA 3KNXA 1DXPA 5DPAA 3LGVA 2FLBH 3ZZ3A 6CHAB 2KAIA 1ZRBA 1O2PA 2VGCC 3RMLH 1LO6A 5A0AE 2Q1JA 1FDPA 3RXCA 2QF3A 3RXLA 4Q7YA 2BD7A 1SVPA 1UK4A 3FP7E 1IQGA 1V2QT 3G01A 4MVNA 1AI8H 3LJJA 3P8NA 4NIWA 1N6XA 1BMLA 4DJZB 2PLXA 4M7GA 1HV7A 1C2EA 3SJOA 1W0YH 1Q31A 4NG9H 3M5OA 1DUAA 1K1IA 2G4TA 4AG1A 4ZXXH 5E0JA 2ZTZA 1RFNA 4ABJA 1C4U2 5ETXA 2GP9B 2J95A 2XWBI 2VWOA 1MKXH 3SJ9A 1EXFA 1DWBH 1GJ9B 1QB1A 2FOAA 1MTNB 3GDVA 3EDXB 2V6NA 1O3CA 4SGBE 1YC0A 1HRTH 2V35A 1C1SA 1HDTH 2FTMA 4FUCA 1AUJA 4HTCH 1NPMA 3BSQA 2FM2A 3U69H 4ZAEA 2VWNA 2ZFFH 1UVSH 1D3TB 3L33A 1CA0C 1BBRK 2QN5T 5ABWA 2Z6BD 3E3TA 1JRTA 1GI3A 1GJAB 1Z71A 2FS9A 6GCHG 2FOGA 3UTUH 1ELCA 8KME2 5GJ4B 4BAOB 4A1VA 1AFQC 4CREA 4OS6A 5E2OA 4NA9H 3K9XB 1TBQH 1AWHB 1O2UA 3TVJB 1ZMJA 2XC5A 3A8BA 1BJVA 1D6WA 3I29A 4K1EA 3TK5A 3ZZ6A 1EP5A 5EG4A 1F0SA 1T31A 1MCTA 3MNCA 3ZZDA 3ENSB 3EE0B 4GCHF 1ZHPA 4X2XA 2AEIH 5EW1H 1O2VA 2B5TB 1YP9A 3Q76A 2XCFA 1ZMLA 1E0FD 1OPHB 2K7XA 1QL9A 1BT7A 4WH6A 1S0RA 3IWMA 1CGIE 3M5MA 2VH0A 1AZ8A 1C1TA 1GMDG 1TNIA 1ANBA 3ZZBA 4A7IB 2J34A 2J94A 4K3JA 3VEQB 1O2RA 2CXVA 1PPZA 2J92A 1KXDA 1G3BA 1GHVH 4JZIA 1C2KA 1PQAA 1GHZA 4NA8A 1DWCH 4YLQH 1ZPCA 3U8TH 4BAMB 2F9UA 1TWXB 1PJPA 1SGDE 3U1IB 3O8CA 3VB4A 4H6TA 4K2YA 1P9SA 3QTOH 3UY9A 4D9RA 2W3KA 2CN0H 1PYTD 1VITH 2Z9LA 2BY7X 1EAXA 2ANKH 3EBNA 1DT2A 4DURA 3MU4A 1O35A 3V3MA 4J2YB 1HUTH 1GBHA 1MQ6A 4TWYA 2HNTF 3TK6A 1D3QB 1IQNA 1SQOA 1UTMA 2BY6X 1DLKB 5K7RA 3VXFH 2UUFB 3RXEA 1HAZB 1EZUC 1G3EA 1C1RA 1EATA 3O8DA 1TNHA 1VGCC 1AU8A 1QNJA 3ATLA 1NRNH 1Y3UA 1C1UH 2FXRA 3SV8A 3RXKA 2A5IA 1ZSJA 3R3GB 1T8OA 3V7TA 1V2PT 1C1QA 3A83A 4I7YH 1C9PA 2V3HH 1FY5A 4FXGH 2PGBB 1SGNE 1FXYA 3GY6A 4Q7ZA 2AFQB 1VITF 1K21H 1GBKA 4BAQB 2Y5GA 1O36A 1O2GH 8LPRA 1Z8GA 2AGIX 2GV7A 1T32A 2A4QA 3T62A 2RG3A 4U01A 3TJUA 1MD8A 4FUHA 3RU4T 3A82A 1O3KA 1J16A 1TX8A 3GCHB 3OX7U 2XW9A 1O5EH 5F6MA 1PPEE 1TQ7B 1MAYA 3SU0A 3PB1E 3MU8A 1QR3E 1E38B 4WJG2 3ZYEA 1TGCA 8GCHF 2PR3A 2VVVA 3U8RH 1RTKA 2H9HA 1TRYA 3LKWA 4NIXA 1GHAF 1KXBA 2P16A 4IGDA 1NO9H 1S6FA 4D8NA 3RXRA 4MPXA 5CHAC 3RP2A 1HBTH 3UNQA 1XM1A 1LPGB 5EU8A 3RXIA 5HYOA 1C1VH 1KIGH 1TGBA 4LZ4B 1J15A 1LHDH 3BEUA 4IW4E 3M7TA 4ZH8A 1GBFA 3H7OA 4A1TA 1E34B 1A4WH 2QV1A 1SQAA 1FN8A 3M7QA 2Y7XA 3SORA 2WYGA 3PMBB 1IQKA 5JBCS 4I8HA 2GMTB 1C5ZB 1YPHE 3BTFE 4MNYA 1GMCF 1OKXA 2P8OB 1ELGA 1HCGA 1DS2E 2IN2A 2Z9IA 2Z9KA 1C4Y2 2D1JA 1UCYE 2J4IA 3ZVAA 1LPZB 1THPB 2BVRH 2FOCA 4IS5A 1Q2WA 2P3UB 1KLIH 1F7ZA 1GMHG 3BTQE 2Y82A 3OY6U 1A5GH 1BRCE 3BTME 3SV7A 1OWKA 3PMJA 3MO3A 2QXIA 2OTVA 2BDCA 3PLBA 2JETC 4R0IA 3ZYDA 1O3DA 2HRVA 3TGJE 1YCPH 1O30A 1QQ4A 1WTGH 3JZ1B 1OXGA 3MH7A 2OC1A 1PQ7A 1S82A 2AGEX 1CHOG 2WV5A 5FPYA 3LH1A 2P3FH 2ZZUH 3D23A 1ZPZA 4O03A 5EXNA 4WMEA 1MQ5A 1AD8H 3MU0A 5EQQA 1J14A 2STAE 2TPIZ 1ZSKA 2OBOA 4AGKA 4ISHH 3A8AA 3PWCA 1MZAA 2GKVE 3VB7A 1O34A 4MPVA
chains in the Genus database with same CATH superfamily
1YLCA 1TGTA 1IQHA 3CP7A 5DGJA 3FKSD 1ACBE 1YF4A 3N99A 4FU9A 1SGTA 4JYUH 1C5VA 2YOLA 3ZZ8A 1FIWA 1BQYA 3T27A 2ANMH 2C3SA 1BHXF 1DICA 1GJ6A 3BTKE 2G51A 1ZJDA 4WXVA 1IHSH 2FYQA 2R2MB 1FNIA 4CR5A 1OWEA 4JK6A 3ZVDA 1QA0A 2ALVA 4BTTB 2HGTH 3FP6E 1WYKA 1FLEE 4HZHA 3MI4A 4IBLH 4LZ1H 4ISOA 5GNDA 1FIZA 4B73A 2EI8A 2PUXB 1UTNA 3PRDA 4X6OA 1C4V2 3MO9A 2HPPH 4A5TS 2YMSC 2BDIA 4B6EA 1G2LA 3P6ZB 2BD2A 1NROH 1AMHA 1C1PA 4OS2A 1O0DH 1BTZA 1YPEH 3F1SB 4AGJA 2VJ1A 2FOEA 2RFKC 5FPTA 4AFQA 1C2LA 2DE8A 1BBRE 4I32A 2ZGHA 1AE5A 1QBVH 3FFGA 5JPMH 3RM2H 1LVYA 1WSSH 3BTDE 3LPRA 1VCWA 1KXCA 3M35A 1LVOA 2C8XB 2UWPA 2O8LA 4DT7B 2ZGBH 5GDSH 1KXFA 3UWIA 4RI0A 1TALA 3A84A 2SNWA 3HGPA 3SJ8A 3N7OA 1W2KH 2ZU1A 1J8AA 3SI3H 1L0ZA 1QZ8A 3E90B 3EAJA 4DGJA 4YM9A 2EC9H 3MU1A 5AF9H 1Z6JH 2JH5D 1SR5C 3TPIZ 4TPIZ 5LH8A 3NKKA 5T1VA 4X6MA 3GCOA 1AVGH 2P94A 3QUMP 1IQFA 1C9TA 4I8GA 2R3UA 3DFLA 4E7RG 4GPGA 1GWAA 3MOCA 1MU8B 2XOKD 1ETTH 3ZVCA 4AFUA 4NZQA 5DN6D 1GBIA 2W26A 3O8RA 2BLQA 1BITA 3F0PA 3FO8D 1P2MA 3M5NA 5AFYH 1RRKA 3OEHD 1FONA 1V2ST 2BM2A 3RXAA 2A4RA 3OU0A 1O2MA 3ESTA 3PO1C 1K28D 2EEKA 2ZI2H 3A81A 1WCZA 3SU4A 1XMNB 1GI1A 1OYTH 1S6LA 3M5LA 4AOQA 2VINA 2FODA 1P04A 1UTJA 2Y5FA 3RXVA 1C5PA 2ZHEH 4GLYA 4XSKU 1XUIA 2A31A 1AGJA 4Y8XA 1DXWA 3IITA 4Y76A 2QGRA 1TRMA 2V7QD 4INHA 1HXFH 3M3SA 1DY9A 1A5IA 3CS7A 1ZTJA 2BDHA 1C5LH 4FUIA 5JBTA 3QGNB 1KLTA 2DUCA 1A46H 3GYLB 1WTHD 2YNBA 3A7ZA 3H5CB 3ZZCA 6CHAC 4NWKA 2PWXA 1QJ7B 4UD9H 2ZDAH 4Z6AH 1P2QA 2HWLB 1V2MT 3K2UA 1W0KD 3EYDA 3FZDA 4PROA 5FBEA 2PV9B 4B2CA 2XNIA 3GISB 2AHME 1PPFE 2J98A 5JB9S 5KGOA 5JDUB 3UR9A 1C1WH 3S9AA 1ZRKA 2F3CE 1QURH 3LH3A 5F8XA 3UOPA 1DM4B 1W12U 2SFAA 1Z8RA 2I6QA 3LC5A 1FPCH 1OOKB 1GDNA 3SJKA 4ZKSU 2ODYB 5C94A 1ELEE 3PM3A 1P2OA 3MO6A 4ZCNA 2XYAA 3DHKH 1XVOA 1HAIH 5LGOA 3TGIE 2GT7A 3VFEA 1AB9B 1UHBA 1EOJA 3S7HB 4LOYH 4TY6A 4TPYA 3BIUH 1P12E 1H9IE 3UAIC 3AW1A 1O5AB 1WDIA 3LDXH 4CR9A 1MTNC 2VU8E 4JZEH 1PQ5A 5LPEA 2BD4A 3B8JA 3SHCH 2OC8A 1HAXB 4WY3A 2EA3A 5FX6A 5JBAS 1TMBH 1LHGH 1TOCB 2NU2E 4AB8A 1N8OC 2F83A 1NFXA 2ZCHP 1L1JA 2GDDA 1B7XB 1GDUA 4R8TB 2A5AA 2H2ZA 1DY8A 2A1DB 3F2FA 5F03A 1D4PB 1SGIB 2WPMS 1T4UH 2BQWB 2WYJA 3SNAA 1CVWH 3GICB 4FUBA 1GHYH 1G2MA 1T7CA 1EAUA 4NSYA 1O3LA 5EXMA 3W95A 1SFIA 4BXSA 3KQDA 1NFWA 1T8LA 4E06H 4K60A 3PLPA 3KL6A 3EQ0H 1GBMA 4K69A 5EXLA 2G8TA 1YYY1 4E05H 1EQ9A 5HXFA 1F5RA 2ZHFH 4H6SB 4MLFB 1V2RT 4ASHA 1SBWA 2GTBA 1COWD 1FJSA 1EJAA 1WAYB 3SU2A 4Y10E 1PPBH 2FLRH 1IOEA 1MD7A 5KECA 1O3PB 1KMHB 3MH4A 2FYRA 6GCHF 2BY9X 3SNEA 2KAIB 3KN2A 2BD3A 2ZCLP 1UTOA 1BTPA 4NCYA 1AN1E 2Y80A 3R0FA 5PTPA 4BANB 3VB5A 2AIPA 4CRCA 1CQQA 2ZU2A 4X8UH 3TK9A 1A61H 3F0OA 4MNWA 4X8VH 2R0LA 4ZMAH 4I8KA 5GWZA 3MNBA 1O38A 1XKAC 4IC6A 1SLUB 2OLGA 2ZGJA 4I86A 3TGKE 3GDSA 2BD8A 3SU3A 1TMUH 3EGKH 3FVFB 1ABIH 3F2GA 4B1TA 4A6LA 1GJDB 4RSPA 1SC8U 4WMFA 1BRAA 1EAWA 2J38A 2FS8A 2CF9H 4BAHB 5C17A 2W5EA 1A7SA 3EA7A 3HK3B 3K6ZA 4IN2A 1FY1A 1RXPA 1KYNA 2VWMA 5C1XA 3PWBA 1D3PB 1SLXB 4Y7AA 1JIMA 5SGAE 2C93B 1B5GH 1UTKA 4FU7A 1GI0A 2HNTC 3TH2H 3ZZ9A 4XDEA 1GHWH 1DSUA 3DSOA 3RU4E 1QJ1B 1YPGH 3PV2A 1Q3XA 2BMGB 2PKSC 3NK8A 1CSOE 1ESAA 5L6NH 2OD3B 1MAXA 1TABE 3MWIU 4ABAA 1S84A 2ZNKH 1EPTA 7ESTE 1Y3YA 4BAKB 5AVDA 1K1MA 4AC9A 2KCOA 1S83A 3K65B 3L6PA 4CBNA 1C5YB 3RXPA 1K9OE 5GXPA 3URDA 1TNKA 4MPWA 3AVZA 4MQAA 4P00A 1AQ7A 3HKIB 2BDYA 1QJ6B 1O3EA 4D7FA 1HAVB 1P57B 4NFFA 5IDKA 1YKTA 3S69A 1HFDA 2P3TB 3U98H 4FUFA 3ZV9A 3B9FH 5JBBS 3TH4H 1INCA 1C5WB 1TE0A 1RTLA 3GCHC 2ZFRH 4K8BA 4OGYA 1FZZA 1HAVA 1P02A 4K5ZA 2WV9A 4NGAH 1QFKH 2BVXH 1G30B 1BMNH 4UFFH 2GT8A 2AMPA 1YGCH 1NC6A 2OCVB 1LVBA 2Z3DA 3RMNH 2H9TH 2ZTYA 7KMEH 1O2TA 2G00A 5DO4H 1P05A 3QZQA 2Z3EA 3NPSA 2Q6GA 2GCTC 3E16B 1ZR0A 3AAUA 4NFEA 1SB1H 2Y5HA 2G4UA 3SV2H 3ZZ4A 4MDSA 2BDBA 3DSPA 1CU1A 4YO9A 1YPMH 3P8GA 3WWBA 1T8NA 2VIWA 1JWTA 3STIA 1HAOH 3UQVA 1KDQB 1GCDA 4NIYA 4ISNA 5C2ZA 3TLOA 1SGEE 1Y3XA 2ANYA 5DP9A 2TRMA 3KQ5A 4VGCB 1GCTB 3LOXA 2ZHQH 5AHGH 1SG8B 5F8ZA 1SLWB 3LGWA 1KDQA 1MBMA 3GDUA 1GG6C 1XXFA 2WPLS 3ZZ7A 1OWDA 4O9VA 3EA8A 1P06A 4B2BA 5H4IB 2GGVB 3BTEE 4F55A 1RTFB 1GL0E 1O5DH 4UFGH 4ZUHA 1W10U 1O3AA 2XWAA 1QQUA 4RN6A 4I31A 2XC4A 5A0BA 2VGCB 3SV9A 3SU6A 3ZV8A 2ZDVH 1O2OA 3MH6A 2CK3D 4CBOA 1HYLA 4X6PA 1ZMNA 1FAKH 4CHAC 2WPHS 2NU0E 3P8FA 1E1QD 3V13A 1F0TA 1NESE 5EPNA 4Y0YE 1SGPE 2FZZA 1KXEA 3A87A 3RMOH 1C1OA 3U9AH 1BRUP 2ZQ1A 1E79D 1C5OH 1GMHF 2UUYA 1WBGB 4ABBA 2ZQ2A 3LJOA 3RXFA 1KTSB 2QF4A 2CMYA 2BQ6B 2QCYA 2XBWA 1O2KA 2FIRH 3OTJE 1CGJE 1NFUA 4YESB 4F4OC 2THFB 4B2AA 4P02A 4O3TA 3RXTA 5C0TA 2ZC9H 2VIDA 2H6MA 1UTPA 5GIBA 3GOVB 1DPOA 1TAWA 1V2LT 2L6OA 3RDZA 4ABGA 2ZFQH 1SGRE 5B6OA 1GBEA 2B7DH 1GI4A 4GCHG 2GDEH 4DIIH 1FUJA 2JIZD 2H5DA 1L1GA 4AYVB 1EJMA 4CRBA 4GHQA 1XKBC 2V3OH 1OX1A 5L2YH 3TJOA 2D2DA 1Y3WA 1TGSZ 3F68H 3M3VA 1H4WA 1NU7B 3HKJB 3BEFB 1FMGA 2PFEA 5EJLA 4MNXA 2HLCA 4Q80A 1SGQE 2FPZA 1SOTA 2ODPA 1P09A 2ZWLH 2FOBA 1ZYOA 1MTUA 2SGDE 4AYYB 1W13U 5FL7D 5GCHG 1BUIA 1V2NT 1L4DA 1LDTT 5I25A 4RT1A 3UR6A 1MKXK 4INKA 4A1XA 5GPIB 1O5BB 4HFPB 3MU5A 4UONA 1AE8H 5A2MH 2RA0A 3PMHB 2Y81A 2CGAA 3QK1A 4YT7H 4AZ2B 1DX5M 3LC3A 1VJAU 3C27B 4QT8C 3KHVA 2WPDD 2ODQA 4Y7BA 2FDAA 1ZJKA 3UQOA 1FY3A 4FUEA 4NSVA 3JZ2B 4KGAA 3QLPH 2C8ZB 3QN7A 3ZVFA 1C2MA 2FOFA 4NA7A 2OUAA 3UREA 1H9LB 1P3EA 2G5VA 3Q3YA 1C5QA 4I8JA 1MMJN 1CO7E 3P92A 2WPIS 1TPAE 3S7KB 5HMAA 2CF8H 2W7UA 2GV6A 1MBQA 5FPSA 1F0UA 1C2FA 2BTCE 3DUXH 3RU4D 5HIZA 1DITH 2XBXA 2XRCA 1J9CH 1K1JA 2M5TA 3GY4A 2H1UA 1DFPA 3GY8A 1GVZA 1VGCB 4M9FA 1QRWA 1CHGA 5HGGA 4UDWH 3UIRA 4MNVA 2IPHA 1G37A 1DLEA 1ZHRA 1SGYE 3NZIA 2A2XH 3KCGH 4X1NU 1NT1A 3TH3H 1K1OA 4F49A 1EB2A 3BG4C 4IMQA 1VKYA 2UWLA 4WXIA 5E0GA 3U8OH 2G55A 2KFWA 1IQLA 1H8ED 2FWWA 1BMAA 4TWWA 5T3HA 5AFZH 1O2LA 3A8DA 1P8VC 5DP7A 2OC0A 1UK2A 2TBSA 3E1XB 3T2NA 1XUHA 1HJ8A 2GD4B 2ZGXH 4U2WA 5A8YA 1L1NA 2BLOA 3ITIA 1HAYB 1NU9A 1UVPA 5T6GA 3LGIA 3PMAB 2BB4A 2LELA 1TMTH 3BTWE 1UCYH 2AGGX 3M36A 1GI5A 1S81A 1CBWC 4FUJA 2IJD1 2BZAA 1L4ZA 3AW0A 4D9QA 2FX4A 3EA9A 4IMZA 5C3NA 4K1TA 1UK3A 3VGCC 1XXDA 2VNTA 1CE5A 5EGMA 3OEED 3TITA 1UVTH 1HJAC 5CHAB 5FCRA 3DA9B 1W14U 4UFEH 3CENA 1FV9A 1UVOA 2BOKA 2O8UA 1G3CA 4H42U 1P0SH 4YTAA 2ZF0H 2PUQH 4U30A 3FAOA 5DP4A 1AUTC 2BX3A 2KCPA 3GCTG 2BY5X 1MH0A 4LK4A 1Y5BT 2HPQH 4UE7H 3RC5A 2VBCA 3SZEA 2Z9JA 4DCDA 2EQNA 3SHAH 1K0HA 2HVXA 3MHWU 2GZ9A 1RJXB 4X6NA 2BXUH 3PV4A 4BOHA 5DP3A 3SGAE 3UNSA 2ZDLA 3F9HA 4X8SH 3D62A 5EJ1A 3RXDA 3A89A 1O2ZA 1GGDC 3NXPA 5CMXH 4WMDA 1LHCH 2XXLA 5IK2D 3QO6A 4X1QU 5FCKA 2BOHB 3NCLA 1C5XB 1CGHA 3Q3XA 1GHXH 5B6LA 1GJ5H 1Z7KA 1FY4A 1X7AC 1W8BH 2LNCA 1RD3B 1P2JA 1OP8A 1JIRA 2V0BA 2A45B 1LCYA 2C4FH 5EQSA 2R9PA 1YPJH 4Q4LA 4ZHLU 1K1LA 1NRPH 2KM0A 4YT6H 1XUJA 4Q63A 2R0KA 3FOAA 1KSNA 1ZOMA 3BF6H 4F48B 2VVUA 3C1KA 3SW2B 5C20A 2NU3E 1HAHH 2ZECA 3A85A 5C1YA 2J98B 4GVUA 1BBRH 2LPRA 2UUKB 2ZIQH 2NU4E 1W11U 4Y6DA 1GJ4H 1HPGA 3PRBA 2PTNA 7GCHF 1PYTC 5DP6A 4X2YA 2F4LA 4CRFA 1FQ3A 2F9PA 1BTHH 3SGBE 1O31A 2FOMB 4I33A 1EUFA 3VXEH 5J4SA 2VIPA 1TX6A 4O97A 2FESH 1QGFA 1UHBB 5E2PA 1EX3A 3PROA 3P95A 3KEEA 5BRRE 4AFSA 2ZO3H 3MNSA 2RCEA 1BDAA 2BX4A 3T25A 1TBZH 1NBME 1SHHB 1P03A 2G81E 2OQUA 1YCPK 3RXMA 4XOJA 1AVXA 3PTBA 4HGCA 3KQCA 4CRDA 4NWLA 1Y5AT 2FI5E 3MNXA 1KXAA 5EPYA 5IYTA 4OGXA 3RUOA 3VPKA 1SQTA 2P59A 2AERH 3E91A 2W7SA 2YMSB 1QB9A 3M7UA 3D49H 1PFXC 1GHBG 3O8BA 2ZPQA 1O3HA 4RKJB 3RC4A 1E36B 2OP9A 2RA3A 1GBLA 3VB6A 2C8WB 5A09A 4DT4A 1BOQA 5FHTA 3A7XA 3RXOA 4BTIB 2R2WU 2ZPSA 2VWLA 4MPUA 3CS0A 4ABFA 3SNCA 4CH2B 1UJ1A 5HM2A 2K1QA 3OSYA 3OE7D 4X2WA 1FAXA 2WPKS 1YWUA 3UPEA 3L3TA 2W6JD 2VIQA 6ESTA 1G9IE 3N7EA 3F9EA 4XBDA 3SZNA 2P93A 4B6FA 1ARCA 4KTSA 1ZLRA 2XCNA 5EODA 1O3OA 2G52A 1P01A 3F2HA 6LPRA 3RXHA 4KELA 3ZVGA 2KCYA 1P10A 4XE4A 3V12A 1EZSC 4Y79A 2H5CA 3ZZ5A 2FEQH 2BLWA 1C5TA 1NM6A 4FUGA 1ELDE 1GJCB 1NRQH 4IC5A 5CHBA 2ZA5A 3SUGA 4XFQA 3B23B 5ESBA 3ATKA 3SQHE 1OP2A 1RGQA 1WU1A 1O3IA 1QCPA 4ZKRU 1QRXA 3E0PB 1JOUB 1Z8JB 3F6UH 1ELTA 1MKWH 2BXTH 3PO1B 1AIXH 2AS9A 1ESTA 3SNBA 2SGEE 1E35B 1GCTC 1GI9B 4AFZA 1NRRH 4UFDH 1C2HA 2H9EH 3SQEE 1GI8B 5F53A 4YZUA 4ZHAA 3LONA 1RIWB 4B71A 3P70B 1BRBE 1EJNA 2PW8H 5C5OA 3QZRA 3E6PH 2B9LA 1HIAB 3BG8A 5A0CA 3VB3A 2GVFA 3T28A 2G5NA 3F9GA 3LGYA 1BB0B 1B0FA 1GMDF 4K8YA 1NY22 3M61U 3S0NA 4BTUB 4MG3A 4TYDA 1HIAA 2Z3CA 4ABEA 1EPTB 1DANH 2VIOA 1K1PA 1DSTA 1HLTH 1GBDA 3T5FH 3A7TA 2STBE 3QX5H 2HOBA 4OS4A 1ZPBA 2ZFSA 3SUFA 1GDQA 4CH8B 1BTXA 1SQRA 1AKSB 2KR7A 1O2NA 2HNTE 5I46H 2C90B 1MCVA 1B0EA 3LU9B 2YMSD 4WH8A 5DSFA 3KIDU 4ZKOU 2D26C 1VCQA 1C5RA 3RXBA 1O2HA 1Y8TA 1AKSA 3STJA 1H9HE 1AY6H 1DE7H 4JZDH 4X2VA 2JJ2D 1HGTH 2ZG0H 3TJVA 2A32A 2ZDMA 2F9NA 1KTTB 1NRSH 1A0JA 1SMFE 5HKKD 2GCHG 2FMJA 3KQEA 4Y71A 2ZU4A 1O33A 1ANCA 1PQ8A 2O9QA 1W7GH 1J17T 4AN7A 2CHAB 4DVAU 3PYHA 4OS1A 1N8OB 1W0JD 4CRGA 3BTGE 1Z1JA 2WINI 3DCLA 2FI3E 2VB0A 1NS3A 4NZLA 3T26A 2OINA 4ABDA 2O8TA 2R3YA 2VIVA 4KKDA 1QB6A 2LIZA 2KCAA 3URCA 1GBTA 1JMOH 2TGDA 1C5UA 1ESBA 1TYNA 2TGPZ 3H7TA 4Y8ZA 1G32B 1F5LA 3RXQA 3ZVBA 2FP7B 3SUEA 1HNEE 3GY3A 4DY7B 2AIQA 2CV3A 3FP8E 4ZKNU 4FVBA 2ZFTA 1GBAA 4B76A 1C2JA 3BN9A 2F9OA 4SGAE 2A0QB 3SGQE 2V3MA 3MFJA 4DOQA 2AMDA 1P2KA 1TNGA 1ANDA 3GS9A 2GMTC 1O3JA 1ZTKA 5A8ZA 5EJZA 1AHTH 1BMFD 1DWDH 1OYQA 2P8OC 4B74A 4Y8YA 1H8DH 1AO5A 2I6SA 3UUZA 1GVKB 2SGAA 2ZEBA 1XUFA 3VG8A 1ABJH 1O2JA 1SLVB 2JH6D 1A2CH 1IAUA 1D3DB 2RDLA 2VH6A 1OWJA 3K6YA 5FXLA 3PLKA 4GSOA 2UUJB 1ELBA 4AG2A 2A7JA 3DT0H 5GCHF 1AFEH 5A8XA 2EI6A 2BHGA 2BD9A 5DJ7A 3ODDA 2J97A 1MTVA 2YNAA 4ACBA 3NUMA 1Y59T 1YBWA 1F0RA 5HM9A 1SGFA 2BLVA 1D9IA 3KF2A 1NBMD 3BTHE 1LTOA 1Z1IA 1TPPA 4ZROA 1TPSA 2PHBA 4BXWA 4UEHH 1C5MD 2IJOB 4Q2KA 1YPKH 3SI4H 5LPFA 1TGNA 2ZTXA 1F5KU 1CT0E 1O3MA 2ALPA 1P11E 3P8OA 2PKSB 5JB8S 1MU6B 1SL3A 1MTSA 1EB1H 4JMYA 1Z6EA 3BEIB 1V2WT 3SOSA 1GJBB 4ACAA 2P95A 2SNVA 3S9BA 1ZSLA 1TB6H 3ATWA 1GJ7B 3SN8A 1DDJA 1ELVA 3A88A 4X1SU 1CHOF 1MKWK 1RS0A 3ODFA 2ZFPH 3GY5A 3I77A 4JZ1A 4YLUA 1QA7A 1CA0B 1P9UA 1QL7A 1YLDA 5DG6A 1ZZZA 2ASUB 2XBYA 1TLDA 3IG6B 2TIOA 1ZHMA 4JCNA 3QDZB 3ZVEA 4ESTE 2A4GA 3QTVH 4TY7A 2GZ7A 3ELAH 2A5KA 3WW7A 1AFQB 1K1NA 1LMWB 2F91A 1QIXB 5E8EH 5FBIA 2JJ1D 2AH4X 2AYWA 3AAVA 1XUKA 4NIVA 4B75A 1SGFG 1A0HB 1ID5H 3NWUA 1O37A 5DP8A 1H1BA 5J4QA 1QL8A 3SU1A 1QTFA 2GCTB 4Z0KA 3DSGA 1U6QA 3TIUA 2J5UA 1C2GA 2FTLE 5TCAA 1O2IA 2TGTA 1GL1A 2QXGA 1AZZA 3T29A 1DUEA 1THSH 1TNJA 1LVMA 1YPHC 1FY8E 1KLJH 1O2WA 1C5NH 3OYPA 3W94A 2Z7FE 2A7HA 4FOUC 2QF5A 2Z9GA 1UVUH 2ZGCA 2Z94A 1O2SA 5C67A 3ATIA 1IQMA 4THNH 1LKAA 5TCCA 1K2I1 1Z8IB 2D8WA 3MH5A 1AVWA 1O5GH 4JK5A 2Y7ZA 5DK1A 3A7YA 3SYJA 4AB9A 1C2DA 1K22H 1XX9A 5K0HA 3AASA 1GG6B 1BIOA 4FVDA 3GYMA 3RXSA 3HPTB 1EP6A 2AMQA 3UNRA 2B0FA 1TIOA 1MABB 2F43B 1QBNA 1GBBA 1V6DA 2WHXA 5CDFE 3HK6B 1SHYA 4RT0A 1O2QA 4OS5A 1C1MA 5JYIA 3GCTF 3LGTA 4X0WU 1NZQH 4ZXYH 2PGQB 1VITG 2OK5A 1ETSH 2SGPE 4OM9A 2ILNA 1O3GA 3GY2A 3FN8A 1BA8B 2BZ6H 2ZCKP 3GY7A 4XRNA 1FPHH 2PSYA 4FU8A 4GUXA 1JRSA 2RDEA 3PTNA 4CHAB 1OWIA 1XUGA 1H8IH 2SGFE 1OP0A 2ZPRA 1CT2E 4MTBA 4CRAA 1DWEH 1V2VT 2JH0D 2LP6A 2PSXA 4LXBH 1LHFH 4OS7A 5L2ZH 4KTCA 4AX9H 2OXSA 1KY9A 1O3BA 2XTTB 1SFQB 3FZZA 1C1NA 1UTQA 3KYFA 8GCHG 2EI7A 4FUDA 1GBCA 1BMMH 1HB0B 1O32A 2O8WA 1IQJA 1GHAG 4U32A 1CA8B 1JXPA 2W6ID 1JBUH 2WUCA 1LHEH 3BTTE 3GCNA 3SNDA 3WWFA 1EOLA 4BNRA 1BTWA 1DVAH 1E37B 2SGQE 1GJ8B 1BZXE 1FI8A 2QC2A 4Y11E 2GZ8A 1VJ9U 1W0ZU 4AORA 3FANA 1WQVH 1TPOA 3TNSA 1A5HA 2QXJA 3HGNA 5T6FA 4X1RU 4HG6A 2BDAA 2A4OA 1BHXB 3SV6A 1N1LA 1TBRH 3QWCH 2XC0A 2ANWA 1ZTLA 1O3FA 2ZKSA 1V2KT 1GMCG 3KYGA 3E0NB 2FX6A 1IHTH 2A7CA 2QYIA 1EZQA 1N6YA 1WOFA 2NU1E 1AB9C 1HXEH 1NFYA 2ZU3A 1F92A 5ESTE 1TOMH 5LPRA 1O5CB 1TA2A 2FI4E 1YM0A 1C5SA 1T8MA 4KP0A 4XBBA 3Q77A 4X1PU 1P2NA 4RKOB 2UWOA 3RMMH 1S0QA 4HI3A 4I8LA 3W1EA 2VVCA 2Y6TA 1LPKB 1TX7A 1TA6A 3V0XA 2WZQA 5DP5A 4D76A 4YOJA 2GX4A 1IQIA 1EFRD 1YPLH 3A86A 3P17H 3A8CA 1FN6A 1MZDA 1OS8A 2DE9A 1PPHE 1YLNA 1V2UT 1PPCE 3SO3A 5CE1A 1XVMA 3D65E 3LT3A 3F9FA 1NTPA 1O2XA 3AK5A 2F9VA 1WUNH 4TSFD 1QY6A 5DKMA 1GHBF 3A7VA 2WSSD 4GHTA 1PPGE 2F9BH 2FOHA 4K1SA 5EW2H 4J1YA 2JETB 2BY8X 3MYWA 3Q3KA 3WY8A 2BD5A 4ISLA 3RLYH 1W3CA 2XBVA 4X8TH 3H09A 1O39A 4H4FA 5L30H 1SGCA 5TJXA 1F2SE 1S85A 1QRZA 1SI5H 2OQ5A 3ATMA 1EZXC 1OHHD 1A1RA 1BCUH 4ASUD 1G36A 1ORFA 2ULLA 4A92A 3Q00A 1WV7H 2ESTE 2BYAX 4ABIA 3SUDA 1TQ0B 2J2UA 2ZDNA 3OY5U 1UTLM 3LIWA 1V2TT 3NRLA 3TU7H 4E7NA 1P2IA 1BTUA 1MTWA 3MMGA 5E0HA 5G4BA 4Z1MD 3KGPA 1ELAA 1O2YA 3OFND 1HAGE 3TJNA 1LKBA 1ZGVA 2CJIA 1VCPA 2PTCE 4JYTA 1Y5UT 5C0UA 1GVLA 1RIWC 1LQDB 2C8YB 3BG4B 4FETA 5T6DA 3RXGA 3UB0A 1G3DA 1EASA 1UO6A 1D6RA 3UOUA 1CT4E 3PV5A 1T4VH 5FX5A 2ZHDA 1ZGIA 2WUBA 3U1JB 1V2JT 9ESTA 1HJ9A 3E8LA 4IN1A 1SKYE 4TT3D 3RXJA 1GBJA 1EPTC 3M3TA 1V2OT 2QF0A 2ZP0H 1L2EA 2Q6DA 2OC7A 4Y0ZE 2O8MA 2A2QH 1CBWB 2J9NA 1NN6A 1VZQH 1ETRH 4DIHH 1ANEA 2PKAB 2FO9A 3VGCB 1A3BH 2QXHA 4D7GA 1Y3VA 2TGAA 3HATH 3BIVH 1OSSA 3F3BA 3SJIA 1TNLA 1SOZA 3SBKA 1HJAB 4ISIH 4DG4A 1GI7B 4YOGA 3ZZAA 3RC6A 2NWNA 4YOIA 1DOJA 2PKAA 3MTYA 1IQEA 5EOKA 1FX0B 5F8TA 1C2IA 4O3UA 1EKBB 2ZDKA 3KQBA 2B8OH 1AWFH 1LQEA 1ELFA 4JYVH 1V3XA 5HIYA 4JZFH 2OBQA 2ZHWH 3UWJH 1TONA 2KZ4A 2HALA 2QA9E 4DW2U 7LPRA 2CHAC 4ABHA 3U28C 1S5SA 3QGJA 1P3CA 8ESTE 1EAIA 1SSXA 2W3IA 2M2AA 1GGDB 1M9UA 3RXUA 3BV9B 2ZU5A 5C1UA 1VR1H 1BTYA 1ARBA 1QHRB 3CNRA 1TFXA 1THRH 4WF8A 4WWYA 1UCYK 3A80A 3SU5A 2Q6FA 2JKHA 3RM0H 1TRNA 1A0LA 2GCHF 1OWHA 3UFAA 4XBCA 1O5FH 2GJGA 2QY0B 2BDGA 2WPJS 4ZHMU 3DFJA 1GI6A 3A7WA 2WV4A 3LGUA 1QBOA 1SPJA 3I78A 2BQ7B 1S6HA 4INLA 4VGCC 5EQRA 2QIQA 1BJUA 1HAPH 2BVSH 4GAWA 9LPRA 3TNTA 2QAAA 7GCHG 3S9CA 4WVPE 1UMAH 2IOTA 4Q7XA 5FAHA 1O3NA 3M37A 1MUEB 1GI2A 5C5NA 1YCPM 1A3EH 3RLWH 3DD2H 5BPEA 1W7XH 4KTUA 1GPZA 1WQSA 3KNXA 1DXPA 5DPAA 1H8HD 3LGVA 2FLBH 3ZZ3A 6CHAB 2KAIA 1ZRBA 1O2PA 2VGCC 3RMLH 1LO6A 5A0AE 2Q1JA 1FDPA 3RXCA 2QF3A 3RXLA 4Q7YA 2BD7A 1SVPA 1UK4A 3FP7E 1IQGA 1V2QT 3G01A 4MVNA 1AI8H 3LJJA 3P8NA 4NIWA 1N6XA 1BMLA 4DJZB 2PLXA 4M7GA 1HV7A 1C2EA 3SJOA 1W0YH 1Q31A 4NG9H 3ZIAD 2XNDD 3M5OA 1DUAA 1K1IA 2G4TA 4AG1A 4ZXXH 5E0JA 2ZTZA 1RFNA 4ABJA 1C4U2 5ETXA 2GP9B 2J95A 3N7DA 2XWBI 2VWOA 1MKXH 3SJ9A 1EXFA 1DWBH 1GJ9B 1QB1A 3EE7A 2FOAA 1MTNB 3GDVA 3EDXB 1YY3A 2V6NA 2K8IA 1O3CA 4SGBE 1YC0A 1HRTH 2V35A 1C1SA 1HDTH 2FTMA 4FUCA 1AUJA 4HTCH 2QE7D 1NPMA 3BSQA 2FM2A 2IPQX 3U69H 4ZAEA 2VWNA 2ZFFH 1UVSH 1D3TB 3L33A 1CA0C 1BBRK 2QN5T 5ABWA 2Z6BD 2L74A 3E3TA 1JRTA 1GI3A 1GJAB 1Z71A 2FS9A 5KEDA 6GCHG 2FOGA 3UTUH 1ELCA 8KME2 5GJ4B 4BAOB 4A1VA 1AFQC 4CREA 4OS6A 5E2OA 4NA9H 3K9XB 1TBQH 1AWHB 1O2UA 3TVJB 1ZMJA 3MQKC 2XC5A 3A8BA 1BJVA 1D6WA 3I29A 4K1EA 3TK5A 3ZZ6A 1EP5A 5EG4A 1F0SA 1UW7A 1T31A 5EIYA 1MCTA 3MNCA 3ZZDA 3ENSB 3EE0B 4GCHF 1ZHPA 4X2XA 2AEIH 5EW1H 1O2VA 2B5TB 1YP9A 1WXRA 3Q76A 2XCFA 1ZMLA 1E0FD 1OPHB 2K7XA 1QL9A 1BT7A 4WH6A 1S0RA 3IWMA 1CGIE 3M5MA 2VH0A 1AZ8A 1C1TA 1GMDG 1TNIA 1ANBA 3ZZBA 4A7IB 2J34A 2J94A 4K3JA 3VEQB 1O2RA 2CXVA 1PPZA 2J92A 1KXDA 1G3BA 1GHVH 4JZIA 1C2KA 1PQAA 1GHZA 4NA8A 1DWCH 4YLQH 1ZPCA 3U8TH 4BAMB 2F9UA 1TWXB 1PJPA 1SGDE 3U1IB 3O8CA 4YXWD 3VB4A 4H6TA 4K2YA 1P9SA 3QTOH 3UY9A 4D9RA 2W3KA 2CN0H 1PYTD 1VITH 2KX4A 2Z9LA 2BY7X 1EAXA 2ANKH 3EBNA 1DT2A 4DURA 3MU4A 1O35A 3V3MA 4J2YB 1HUTH 1GBHA 1MQ6A 4TWYA 2HNTF 3TK6A 1D3QB 1IQNA 1SQOA 1UTMA 2BY6X 1DLKB 5K7RA 3VXFH 2UUFB 3RXEA 2HLDD 1HAZB 1EZUC 1G3EA 1C1RA 1EATA 3O8DA 1TNHA 1VGCC 1AU8A 1QNJA 3ATLA 1NRNH 1Y3UA 1C1UH 2FXRA 3SV8A 3RXKA 2A5IA 1ZSJA 3R3GB 1T8OA 3V7TA 1V2PT 1C1QA 3A83A 4I7YH 1C9PA 4XD7D 2V3HH 1FY5A 4FXGH 2PGBB 1SGNE 1FXYA 3GY6A 4Q7ZA 2AFQB 1VITF 1K21H 1GBKA 4BAQB 2Y5GA 1O36A 1O2GH 8LPRA 1Z8GA 2AGIX 2GV7A 1T32A 2A4QA 3T62A 2RG3A 4U01A 3TJUA 1MD8A 4FUHA 3RU4T 3A82A 1O3KA 1J16A 1TX8A 3GCHB 3OX7U 2XW9A 1O5EH 5F6MA 2JDID 1PPEE 1TQ7B 1MAYA 3SU0A 3PB1E 3MU8A 1QR3E 1E38B 4WJG2 1E1RD 1TGCA 3ZYEA 8GCHF 2PR3A 2VVVA 3U8RH 1RTKA 2H9HA 1TRYA 3LKWA 4NIXA 1GHAF 1KXBA 2P16A 4IGDA 1NO9H 1S6FA 4D8NA 3RXRA 4MPXA 5CHAC 3RP2A 1HBTH 3UNQA 1XM1A 1LPGB 5EU8A 3RXIA 5HYOA 1C1VH 1KIGH 1TGBA 4LZ4B 1J15A 1LHDH 3BEUA 4IW4E 3M7TA 4ZH8A 1GBFA 3H7OA 4A1TA 1E34B 1A4WH 2QV1A 1SQAA 1FN8A 3M7QA 2Y7XA 2PP6A 3SORA 2WYGA 3PMBB 1IQKA 5JBCS 4I8HA 2GMTB 1C5ZB 1YPHE 3BTFE 4MNYA 1GMCF 1OKXA 2P8OB 1ELGA 1HCGA 1DS2E 2IN2A 2Z9IA 2Z9KA 1C4Y2 2D1JA 1UCYE 2J4IA 3OTPA 3OAAD 3ZVAA 1LPZB 1THPB 2BVRH 2FOCA 4IS5A 1Q2WA 2P3UB 1KLIH 1F7ZA 1GMHG 3BTQE 2Y82A 3OY6U 1A5GH 1BRCE 3BTME 3SV7A 1OWKA 3PMJA 3MO3A 2QXIA 2OTVA 2BDCA 3PLBA 2JETC 4R0IA 3ZYDA 1O3DA 2HRVA 3TGJE 1YCPH 1O30A 1QQ4A 1WTGH 2EY4C 3JZ1B 1OXGA 3MH7A 2OC1A 2K0QA 1PQ7A 1S82A 2AGEX 1CHOG 2WV5A 5FPYA 3LH1A 2P3FH 2ZZUH 3D23A 1ZPZA 4O03A 5EXNA 4WMEA 1MQ5A 2HVYB 1AD8H 3MU0A 5EQQA 1J14A 2STAE 2TPIZ 1ZSKA 2OBOA 4AGKA 4ISHH 3A8AA 3PWCA 1MZAA 2GKVE 3VB7A 1O34A 4MPVA
chains in the Genus database with same CATH topology
1YLCA 1TGTA 1IQHA 3CP7A 5DGJA 1ACBE 1YF4A 4FU9A 1SGTA 4JYUH 1C5VA 2YOLA 3ZZ8A 1FIWA 1BQYA 3T27A 2ANMH 2C3SA 1BHXF 1DICA 1GJ6A 3BTKE 2G51A 1ZJDA 4WXVA 1IHSH 2FYQA 2R2MB 1FNIA 4CR5A 1OWEA 4JK6A 3ZVDA 1QA0A 2ALVA 4BTTB 2HGTH 3FP6E 1WYKA 1FLEE 4HZHA 3MI4A 4IBLH 4LZ1H 4ISOA 1FIZA 4B73A 2EI8A 2PUXB 1UTNA 4X6OA 1C4V2 3MO9A 2HPPH 4A5TS 2BDIA 1G2LA 3P6ZB 2BD2A 1NROH 1AMHA 1C1PA 4OS2A 1O0DH 1BTZA 1YPEH 3F1SB 4AGJA 2VJ1A 2FOEA 5FPTA 4AFQA 1C2LA 2DE8A 1BBRE 4I32A 2ZGHA 1AE5A 1QBVH 3FFGA 5JPMH 3RM2H 1LVYA 1WSSH 3BTDE 3LPRA 1VCWA 1KXCA 3M35A 1LVOA 2C8XB 2UWPA 2O8LA 4DT7B 2ZGBH 5GDSH 1KXFA 3UWIA 1TALA 3A84A 2SNWA 3HGPA 3SJ8A 3N7OA 1W2KH 2ZU1A 1J8AA 3SI3H 1L0ZA 3E90B 3EAJA 4DGJA 4YM9A 2EC9H 3MU1A 5AF9H 1Z6JH 2JH5D 1SR5C 3TPIZ 4TPIZ 5LH8A 3NKKA 4X6MA 3GCOA 1AVGH 2P94A 3QUMP 1IQFA 1C9TA 4I8GA 2R3UA 3DFLA 4E7RG 4GPGA 1GWAA 3MOCA 1MU8B 4AFUA 1ETTH 3ZVCA 4NZQA 1GBIA 2W26A 3O8RA 2BLQA 1BITA 1P2MA 3M5NA 5AFYH 1RRKA 1FONA 1V2ST 2BM2A 3RXAA 2A4RA 3OU0A 1O2MA 3ESTA 3PO1C 1K28D 2EEKA 2ZI2H 3A81A 1WCZA 3SU4A 1XMNB 1GI1A 1OYTH 3M5LA 4AOQA 2VINA 2FODA 1P04A 1UTJA 2Y5FA 3RXVA 1C5PA 2ZHEH 4GLYA 4XSKU 1XUIA 2A31A 1AGJA 4Y8XA 1DXWA 3IITA 4Y76A 2QGRA 1TRMA 4INHA 1HXFH 3M3SA 1DY9A 1A5IA 3CS7A 1ZTJA 2BDHA 1C5LH 4FUIA 5JBTA 3QGNB 1KLTA 2DUCA 1A46H 3GYLB 1WTHD 2YNBA 3A7ZA 3H5CB 3ZZCA 6CHAC 4NWKA 2PWXA 1QJ7B 4UD9H 2ZDAH 4Z6AH 1P2QA 2HWLB 1V2MT 3K2UA 3EYDA 3FZDA 4PROA 5FBEA 2PV9B 4B2CA 2XNIA 3GISB 1PPFE 5JB9S 5JDUB 3UR9A 1C1WH 3S9AA 1ZRKA 2F3CE 1QURH 3LH3A 5F8XA 3UOPA 1DM4B 1W12U 2SFAA 1Z8RA 2I6QA 3LC5A 1FPCH 1OOKB 1GDNA 3SJKA 4ZKSU 2ODYB 1ELEE 3PM3A 1P2OA 3MO6A 2XYAA 3DHKH 1XVOA 1HAIH 5LGOA 3TGIE 2GT7A 3VFEA 1AB9B 1UHBA 1EOJA 3S7HB 4LOYH 4TY6A 4TPYA 3BIUH 1P12E 1H9IE 3AW1A 1O5AB 3LDXH 4CR9A 1MTNC 2VU8E 4JZEH 1PQ5A 5LPEA 2BD4A 3B8JA 3SHCH 2OC8A 1HAXB 4WY3A 2EA3A 5FX6A 5JBAS 1TMBH 1LHGH 1TOCB 2NU2E 4AB8A 1N8OC 2F83A 1NFXA 2ZCHP 1L1JA 2GDDA 1B7XB 1GDUA 4R8TB 2A5AA 2H2ZA 1DY8A 2A1DB 5F03A 1D4PB 1SGIB 2WPMS 1T4UH 2BQWB 2WYJA 3SNAA 1CVWH 3GICB 4FUBA 1GHYH 1G2MA 1T7CA 1EAUA 4NSYA 1O3LA 5EXMA 3W95A 1SFIA 4BXSA 3KQDA 1NFWA 1T8LA 4E06H 4K60A 3PLPA 3KL6A 3EQ0H 1GBMA 4K69A 5EXLA 2G8TA 1YYY1 4E05H 1EQ9A 5HXFA 1F5RA 2ZHFH 4H6SB 4MLFB 1V2RT 4ASHA 1SBWA 2GTBA 1FJSA 1EJAA 1WAYB 3SU2A 4Y10E 1PPBH 2FLRH 1IOEA 1MD7A 1O3PB 3MH4A 2FYRA 6GCHF 2BY9X 3SNEA 2KAIB 3KN2A 2BD3A 2ZCLP 1UTOA 1BTPA 4NCYA 1AN1E 2Y80A 3R0FA 5PTPA 4BANB 3VB5A 2AIPA 4CRCA 1CQQA 2ZU2A 4X8UH 3TK9A 1A61H 4MNWA 4X8VH 2R0LA 4ZMAH 4I8KA 5GWZA 3MNBA 1O38A 1XKAC 4IC6A 1SLUB 2OLGA 2ZGJA 3TGKE 3GDSA 2BD8A 3SU3A 1TMUH 3EGKH 3FVFB 1ABIH 4B1TA 4A6LA 1GJDB 4RSPA 1SC8U 4WMFA 1BRAA 1EAWA 2J38A 2FS8A 2CF9H 4BAHB 2W5EA 1A7SA 3EA7A 3HK3B 3K6ZA 4IN2A 1FY1A 1RXPA 1KYNA 2VWMA 5C1XA 3PWBA 1D3PB 1SLXB 4Y7AA 1JIMA 5SGAE 2C93B 1B5GH 1UTKA 4FU7A 1GI0A 2HNTC 3TH2H 3ZZ9A 4XDEA 1GHWH 1DSUA 3RU4E 1QJ1B 1YPGH 1Q3XA 2BMGB 2PKSC 3NK8A 1CSOE 1ESAA 5L6NH 2OD3B 1MAXA 1TABE 3MWIU 4ABAA 1S84A 2ZNKH 1EPTA 7ESTE 1Y3YA 4BAKB 5AVDA 1K1MA 1S83A 3K65B 3L6PA 4CBNA 1C5YB 3RXPA 1K9OE 5GXPA 3URDA 1TNKA 4MPWA 3AVZA 4MQAA 1AQ7A 3HKIB 2BDYA 1QJ6B 1O3EA 4D7FA 1HAVB 1P57B 4NFFA 5IDKA 1YKTA 3S69A 1HFDA 2P3TB 3U98H 4FUFA 3ZV9A 3B9FH 5JBBS 3TH4H 1INCA 1C5WB 1TE0A 1RTLA 3GCHC 2ZFRH 4K8BA 4OGYA 1FZZA 1HAVA 1P02A 4K5ZA 4NGAH 1QFKH 2BVXH 1G30B 1BMNH 4UFFH 2GT8A 2AMPA 1YGCH 1NC6A 2OCVB 1LVBA 2Z3DA 3RMNH 2H9TH 2ZTYA 7KMEH 1O2TA 2G00A 5DO4H 1P05A 3QZQA 2Z3EA 3NPSA 2Q6GA 2GCTC 3E16B 1ZR0A 3AAUA 4NFEA 1SB1H 2Y5HA 2G4UA 3SV2H 3ZZ4A 4MDSA 2BDBA 1CU1A 4YO9A 1YPMH 3P8GA 1T8NA 2VIWA 1JWTA 3STIA 1HAOH 3UQVA 1KDQB 1GCDA 4NIYA 4ISNA 5C2ZA 3TLOA 1SGEE 1Y3XA 2ANYA 5DP9A 2TRMA 4VGCB 1GCTB 3LOXA 2ZHQH 5AHGH 1SG8B 5F8ZA 1SLWB 3LGWA 1KDQA 1MBMA 3GDUA 1GG6C 1XXFA 2WPLS 3ZZ7A 1OWDA 4O9VA 3EA8A 1P06A 4B2BA 5H4IB 2GGVB 3BTEE 1RTFB 1GL0E 1O5DH 4UFGH 4ZUHA 1W10U 1O3AA 2XWAA 1QQUA 4RN6A 4I31A 2XC4A 5A0BA 2VGCB 3SV9A 3SU6A 3ZV8A 2ZDVH 1O2OA 3MH6A 4CBOA 1HYLA 4X6PA 1ZMNA 1FAKH 4CHAC 2WPHS 2NU0E 3P8FA 3V13A 1F0TA 1NESE 5EPNA 4Y0YE 1SGPE 2FZZA 1KXEA 3A87A 3RMOH 1C1OA 3U9AH 1BRUP 2ZQ1A 1C5OH 1GMHF 2UUYA 1WBGB 4ABBA 2ZQ2A 3LJOA 3RXFA 1KTSB 2CMYA 2BQ6B 2QCYA 2XBWA 1O2KA 2FIRH 3OTJE 1CGJE 1NFUA 4YESB 4F4OC 2THFB 4B2AA 4O3TA 3RXTA 2ZC9H 2VIDA 2H6MA 1UTPA 5GIBA 3GOVB 1DPOA 1TAWA 1V2LT 3RDZA 4ABGA 2ZFQH 1SGRE 5B6OA 1GBEA 2B7DH 1GI4A 4GCHG 2GDEH 4DIIH 1FUJA 2H5DA 1L1GA 4AYVB 1EJMA 4CRBA 4GHQA 1XKBC 2V3OH 1OX1A 5L2YH 3TJOA 2D2DA 1Y3WA 1TGSZ 3F68H 3M3VA 1H4WA 1NU7B 3HKJB 3BEFB 1FMGA 2PFEA 4MNXA 2HLCA 4Q80A 1SGQE 2FPZA 1SOTA 2ODPA 1P09A 2ZWLH 2FOBA 1ZYOA 1MTUA 2SGDE 4AYYB 1W13U 5GCHG 1BUIA 1V2NT 1L4DA 1LDTT 5I25A 3UR6A 1MKXK 4INKA 4A1XA 5GPIB 1O5BB 4HFPB 3MU5A 4UONA 1AE8H 5A2MH 2RA0A 3PMHB 2Y81A 2CGAA 3QK1A 4YT7H 4AZ2B 1DX5M 3LC3A 1VJAU 3C27B 4QT8C 3KHVA 2ODQA 4Y7BA 2FDAA 1ZJKA 3UQOA 1FY3A 4FUEA 4NSVA 3JZ2B 4KGAA 3QLPH 2C8ZB 3QN7A 3ZVFA 1C2MA 2FOFA 4NA7A 2OUAA 3UREA 2G5VA 1H9LB 1P3EA 3Q3YA 1C5QA 4I8JA 1MMJN 1CO7E 3P92A 2WPIS 1TPAE 3S7KB 5HMAA 2CF8H 2W7UA 2GV6A 1MBQA 5FPSA 1F0UA 1C2FA 2BTCE 3DUXH 3RU4D 1DITH 2XBXA 2XRCA 1J9CH 1K1JA 2M5TA 3GY4A 2H1UA 1DFPA 3GY8A 1GVZA 1VGCB 1QRWA 1CHGA 5HGGA 4UDWH 3UIRA 4MNVA 2IPHA 1G37A 1DLEA 1ZHRA 1SGYE 3NZIA 2A2XH 3KCGH 4X1NU 1NT1A 3TH3H 1K1OA 4F49A 1EB2A 3BG4C 4IMQA 2UWLA 4WXIA 5E0GA 3U8OH 2G55A 1IQLA 2FWWA 1BMAA 4TWWA 5T3HA 5AFZH 1O2LA 3A8DA 1P8VC 5DP7A 2OC0A 1UK2A 2TBSA 3E1XB 3T2NA 1XUHA 1HJ8A 2GD4B 2ZGXH 4U2WA 5A8YA 1L1NA 2BLOA 3ITIA 1HAYB 1NU9A 1UVPA 5T6GA 3LGIA 3PMAB 2BB4A 1TMTH 3BTWE 1UCYH 2AGGX 3M36A 1GI5A 1S81A 1CBWC 4FUJA 2BZAA 1L4ZA 3AW0A 4D9QA 2FX4A 3EA9A 4IMZA 5C3NA 4K1TA 1UK3A 3VGCC 1XXDA 2VNTA 1CE5A 5EGMA 3TITA 1UVTH 1HJAC 5CHAB 5FCRA 3DA9B 1W14U 4UFEH 3CENA 1FV9A 1UVOA 2BOKA 2O8UA 1G3CA 4H42U 1P0SH 4YTAA 2ZF0H 2PUQH 4U30A 3FAOA 5DP4A 1AUTC 2BX3A 3GCTG 2BY5X 1MH0A 4LK4A 1Y5BT 2HPQH 4UE7H 3RC5A 2Z9JA 4DCDA 3SHAH 2HVXA 3MHWU 2GZ9A 1RJXB 4X6NA 2BXUH 3PV4A 4BOHA 5DP3A 3SGAE 3UNSA 2ZDLA 3F9HA 4X8SH 3D62A 3RXDA 3A89A 1O2ZA 1GGDC 3NXPA 5CMXH 4WMDA 1LHCH 2XXLA 3QO6A 4X1QU 5FCKA 2BOHB 3NCLA 1C5XB 1CGHA 3Q3XA 1GHXH 1GJ5H 1Z7KA 1FY4A 1X7AC 1W8BH 2LNCA 1RD3B 1P2JA 1OP8A 1JIRA 2V0BA 2A45B 1LCYA 2C4FH 5EQSA 2R9PA 1YPJH 4ZHLU 1K1LA 1NRPH 4YT6H 1XUJA 2R0KA 1KSNA 1ZOMA 3BF6H 2VVUA 3C1KA 3SW2B 5C20A 2NU3E 1HAHH 2ZECA 3A85A 5C1YA 4GVUA 1BBRH 2LPRA 2UUKB 2ZIQH 2NU4E 1W11U 4Y6DA 1GJ4H 1HPGA 2PTNA 7GCHF 1PYTC 5DP6A 4X2YA 4CRFA 1FQ3A 2F9PA 1BTHH 3SGBE 1O31A 2FOMB 4I33A 1EUFA 3VXEH 5J4SA 2VIPA 1TX6A 4O97A 2FESH 1QGFA 1UHBB 5E2PA 1EX3A 3PROA 3P95A 3KEEA 5BRRE 4AFSA 2ZO3H 3MNSA 2RCEA 1BDAA 2BX4A 3T25A 1TBZH 1SHHB 1P03A 2G81E 2OQUA 1YCPK 3RXMA 4XOJA 1AVXA 3PTBA 4HGCA 3KQCA 4CRDA 4NWLA 1Y5AT 2FI5E 3MNXA 1KXAA 5EPYA 5IYTA 4OGXA 3RUOA 3VPKA 1SQTA 2P59A 2AERH 3E91A 2W7SA 1QB9A 3M7UA 3D49H 1PFXC 1GHBG 3O8BA 2ZPQA 1O3HA 4RKJB 3RC4A 1E36B 2OP9A 2RA3A 1GBLA 3VB6A 2C8WB 5A09A 1BOQA 5FHTA 3A7XA 3RXOA 4BTIB 2R2WU 2ZPSA 2VWLA 4MPUA 3CS0A 4ABFA 3SNCA 4CH2B 1UJ1A 5HM2A 2K1QA 3OSYA 4X2WA 1FAXA 2WPKS 3UPEA 3L3TA 2VIQA 6ESTA 1G9IE 3F9EA 4XBDA 3SZNA 2P93A 1ARCA 4KTSA 1ZLRA 2XCNA 5EODA 1O3OA 2G52A 1P01A 6LPRA 3RXHA 4KELA 3ZVGA 1P10A 4XE4A 3V12A 1EZSC 4Y79A 2H5CA 3ZZ5A 2FEQH 2BLWA 1C5TA 1NM6A 4FUGA 1ELDE 1GJCB 1NRQH 4IC5A 2ZA5A 3SUGA 4XFQA 3B23B 5ESBA 3ATKA 3SQHE 1OP2A 1RGQA 1WU1A 1O3IA 1QCPA 4ZKRU 1QRXA 3E0PB 1JOUB 1Z8JB 3F6UH 1ELTA 1MKWH 2BXTH 3PO1B 1AIXH 2AS9A 1ESTA 3SNBA 2SGEE 1E35B 1GCTC 1GI9B 4AFZA 1NRRH 4UFDH 1C2HA 2H9EH 3SQEE 1GI8B 4YZUA 4ZHAA 3LONA 1RIWB 4B71A 3P70B 1BRBE 1EJNA 2PW8H 5C5OA 3QZRA 3E6PH 2B9LA 1HIAB 3BG8A 5A0CA 3VB3A 2GVFA 3T28A 2G5NA 3F9GA 3LGYA 1BB0B 1B0FA 1GMDF 4K8YA 1NY22 3M61U 3S0NA 4BTUB 4MG3A 4TYDA 1HIAA 2Z3CA 4ABEA 1EPTB 1DANH 2VIOA 1K1PA 1DSTA 1HLTH 1GBDA 3T5FH 3A7TA 2STBE 3QX5H 2HOBA 4OS4A 1ZPBA 2ZFSA 3SUFA 1GDQA 4CH8B 1BTXA 1AKSB 1O2NA 2HNTE 5I46H 2C90B <