1P9UA

Coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coronavirus Main Proteinase (3CLpro) Structure: Basis for Design of anti-SARS Drugs
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords putative coronavirus nsp2 (3CL-PRO)
total genus 83
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1p9uA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA01
2GMTC 2G4TA 2ZDAH 2SGEE 3SUGA 1AFQC 2TRMA 4UFDH 1ZPZA 2SGAA 3MWIU 1MAXA 2BDCA 4R8TB 5DKMA 4YT7H 1S6HA 3JZ2B 3P8NA 1DS2E 1C2LA 1LPKB 3V0XA 1CHOF 5FXLA 4BOHA 2C8ZB 1W11U 4B71A 5DP7A 4CRDA 1C5LH 1GHXH 2BD3A 1KLJH 2FLRH 1DT2A 3HK3B 2FYQA 1V2KT 1GJCB 1C2HA 3ATMA 1NRQH 2Y80A 3A7WA 4O97A 1EPTC 3HPTB 1DM4B 2BDHA 1A1RA 1JRTA 1ZHRA 1BA8B 1QR3E 2FPZA 5GCHF 3SU4A 3SV7A 3SV6A 5ESTE 2Z94A 1WU1A 1AD8H 4NIXA 2XCNA 3ZVEA 1NTPA 1PYTC 1W14U 3RLWH 1W12U 1P2JA 3TPIZ 4TY7A 2GCHF 2ALVA 3MH7A 7GCHG 3BSQA 3TJVA 3QWCH 3LIWA 3SJ8A 2R2MB 2JKHA 1AI8H 3LOXA 1BMAA 4AG2A 5C5OA 5EXLA 2R3UA 1EX3A 2CJIA 4IC5A 1O5DH 1TGTA 2XBXA 3E90B 1WCZA 1ZOMA 5T6FA 1RFNA 1D4PB 1ID5H 1B0EA 1K2I1 2YOLA 2O9QA 2G51A 1ZYOA 2ANKH 4CRBA 4IW4E 1AZ8A 2QCYA 4FUCA 1PFXC 1Y59T 4X6OA 1NRPH 1C4V2 1F5LA 1FONA 1C5VA 1TRYA 2ZHWH 2GVFA 1BTPA 1ELTA 1UTNA 1TPSA 2HGTH 1A3EH 1H1BA 3HKJB 1OWDA 3PTNA 4FUEA 3T26A 2ZU5A 3BTKE 4ISOA 1H8DH 2P8OB 1P05A 3UIRA 2ZGCA 4K69A 2NU1E 4O3TA 4JZIA 1TX8A 1K22H 1HAVB 1O2IA 1HDTH 1QQUA 4MTBA 3G01A 1RIWB 1GBLA 1P11E 1HAHH 3R0FA 4ZHMU 1GBEA 1C1PA 2A31A 2GT8A 3LKWA 2WPHS 3SU3A 3BEIB 1FAXA 3L3TA 1CVWH 1G3CA 1SQTA 1MTVA 2A45B 3RMOH 1SGFG 4X8TH 5E2PA 4RN6A 2FESH 3DHKH 1TX6A 4DCDA 3JZ1B 1C2EA 1AVWA 3O8BA 2EEKA 2I6SA 2G4UA 1LHGH 2ZCKP 3RXFA 2WINI 1QB9A 3RXBA 5JBCS 1V2OT 1G36A 4Y76A 4X2XA 4AYVB 4GVUA 2UUKB 1AE5A 4ABDA 2PSXA 4X1QU 1XVOA 3BG4C 1IQIA 1CT2E 5EXMA 4DGJA 2ZFPH 2H9EH 3ZVAA 4KGAA 1RD3B 2BOKA 4NSVA 1JBUH 1NRRH 3L33A 2A5AA 3TITA 2Y5GA 3F68H 1IQJA 1J17T 2OLGA 5FAHA 4WJG2 2ZWLH 1UTPA 2OC1A 1PJPA 1PPBH 4RKJB 1EXFA 2QF3A 2R0KA 2ZDKA 4F4OC 2ZDMA 1MBQA 2FOBA 1MBMA 5DK1A 1RXPA 2GD4B 4AFUA 1ZTJA 3RM0H 5A0CA 3PMJA 3T28A 2ODQA 1Z8JB 2ZPSA 3BTDE 1Z8GA 8ESTE 3A87A 3GY6A 5DPAA 2PTCE 1QHRB 1UVTH 4UE7H 2A32A 1Y3VA 2OC8A 5A0BA 1HAYB 3EQ0H 1C5SA 2J9NA 2AMPA 2PGBB 1SGEE 4D8NA 1C5NH 3RMLH 1XUKA 3BF6H 4IGDA 1O3NA 4KTUA 3AASA 1GI1A 2ILNA 3GICB 1C1VH 4I8LA 1GJ9B 2GMTB 5DP6A 1CGIE 3VEQB 7LPRA 1CBWC 1G3BA 4WXVA 1C1MA 5EQRA 4FUDA 2G8TA 3ZV9A 6GCHF 4X2VA 3LT3A 4JYVH 4LZ1H 3PO1B 2OC0A 1THPB 1ZZZA 2ANWA 2BD5A 1GI5A 4K3JA 4CHAC 1Z6JH 3V13A 4FUIA 2NU0E 1K1PA 4UONA 2H9HA 4B75A 1QRWA 1IQFA 1HLTH 2OD3B 1V2LT 4THNH 1QGFA 3AW1A 2IJOB 1O2QA 4X1PU 4X1RU 1VCQA 4ABBA 3SJIA 1KIGH 1KXAA 5T6DA 3UNSA 3U1JB 4BAOB 2WPJS 2QGRA 4X6MA 5TJXA 1HXEH 5ESBA 3MTYA 1P2NA 2B5TB 1WQSA 4NZLA 1ARBA 2VWLA 2CN0H 3ZZ3A 4O9VA 1XUJA 1H9LB 3TGJE 1UTLM 1FQ3A 1UVUH 2TGDA 2NU4E 4B76A 1CBWB 3ZVBA 1GMHF 2BY8X 3Q3YA 1GBJA 1TALA 3ATKA 4LK4A 3HGPA 3MI4A 1EJAA 3RC4A 1EOLA 3EBNA 1CHOG 5FBEA 3LONA 3VGCC 1HV7A 1A2CH 1MUEB 1JWTA 3RXHA 2BD7A 3HK6B 1ZGVA 2OINA 2CXVA 4ABIA 2LPRA 4BTIB 2IPHA 1QTFA 1A0JA 1O3LA 3T27A 1MTWA 4GAWA 1Z6EA 1IAUA 3TJNA 5CHAB 3GCOA 3ZV8A 1C2DA 1FXYA 1T32A 3FVFB 2SFAA 2XC5A 4YLUA 2P8OC 3QN7A 5DP4A 1O3IA 1BBRE 4GHQA 1MTSA 2IOTA 4XFQA 4TY6A 2HPQH 1YPMH 1UTJA 2FOMB 1IQHA 4WXIA 1MTUA 2XW9A 1MKWH 1KXBA 2ZDLA 1P2IA 3HATH 1MU8B 3RXOA 4AN7A 3UWJH 5F8TA 3S9BA 1YC0A 4UDWH 1GVLA 1NY22 4NFEA 2R3YA 3MH6A 5B6OA 2QIQA 1BOQA 3UR6A 1PPCE 1TABE 1P04A 1O5GH 4Y71A 5A8YA 2AIPA 5K7RA 4YESB 1INCA 2GX4A 5HM9A 4ABJA 1HBTH 2Y7ZA 4HI3A 1IHSH 4AB8A 3U1IB 4O03A 3SOSA 1O2RA 1YM0A 2OQUA 2SGQE 1GBHA 1S84A 1IOEA 2FOEA 1P9UA 3Q76A 3TU7H 1NFYA 1T31A 1NU7B 4CBNA 1G2MA 1C1WH 1B7XB 3T25A 1TIOA 1P06A 2FS8A 1SLXB 3S7KB 1HAIH 1P2OA 2ZU4A 2ZHEH 1P0SH 1S85A 2FOGA 1HRTH 2BLOA 2UWPA 2XC4A 3RXDA 2OUAA 1UCYH 1MD7A 5GXPA 4Y79A 4R0IA 5AFZH 4FVDA 5JBTA 1AVGH 3SUFA 3TGKE 1BB0B 3GY4A 1QIXB 2BY9X 2FI5E 1GHYH 2THFB 3Q00A 1XX9A 5E0JA 1FAKH 3K65B 3MO3A 1O2SA 1BCUH 4YT6H 4CRAA 3D23A 1O3JA 2BY7X 2PWXA 4AFSA 3BTGE 2JETB 4B2CA 3DT0H 3A7VA 2C4FH 4J2YB 3BTWE 3CS7A 4MG3A 4KTCA 2FDAA 3SU5A 4MPWA 2WUCA 1EP6A 1O34A 2WPLS 1ELDE 3LGUA 5FX5A 1E36B 2Y82A 1Y5BT 3VB7A 1A5HA 1BRBE 1O2MA 5H4IB 2D1JA 5FHTA 5JYIA 4JZEH 4CH2B 4MPVA 5A8ZA 1C5ZB 1P12E 5E0HA 2BXTH 1SC8U 2BQ7B 2BX4A 2V35A 8GCHG 3PROA 1S0RA 1CGHA 1NC6A 1BBRH 5GWZA 2VH0A 5HMAA 1MQ5A 4MNXA 5EGMA 1FMGA 4WMDA 1AB9B 2WPKS 5FBIA 2FO9A 4E05H 1C5XB 1GCTB 1RGQA 2UWLA 1G30B 1DWEH 2BZ6H 3SQHE 3I29A 1HJ9A 3HKIB 1V2NT 1DITH 1W8BH 1TGSZ 3M7QA 4HTCH 1SGQE 4JYUH 2D26C 2W3KA 2OTVA 4Y8ZA 1QJ6B 2C3SA 3GOVB 4BXSA 1NS3A 2QN5T 1C5UA 3LC5A 1PPFE 1MD8A 2H9TH 1ETTH 1L4DA 2G55A 1G9IE 1KDQA 3UQOA 2XWAA 1DWDH 4K8BA 4MVNA 3FFGA 2BDYA 1OP2A 5C67A 1IHTH 3FAOA 3SU1A 1OOKB 4AX9H 3A83A 1H4WA 1MU6B 2ZCHP 4Q7ZA 4AORA 1SGPE 2GV6A 1O2UA 1ZHPA 1CA0B 3QX5H 1TNLA 2AGEX 1AWFH 3VGCB 2K7XA 4MPXA 3EA9A 1LMWB 5GJ4B 1QL7A 1UK4A 1ZPBA 1D3DB 1ETRH 3ZVDA 2AGGX 3T62A 1TOCB 1KXFA 1V2PT 3H7OA 5LGOA 2XBWA 3RU4T 3UREA 1NFWA 1WTGH 2CHAC 5DP9A 3GCHB 2QXGA 2B0FA 4Q80A 3DA9B 2PTNA 3Q77A 1S82A 5JBBS 4WY3A 1HNEE 3K2UA 1Q2WA 2J94A 3TJOA 4OS7A 5CE1A 2GZ7A 1GHVH 3EE0B 1EKBB 4DW2U 5I46H 1GVKB 1GHAF 7ESTE 1ZJKA 1P2KA 4BTUB 1A4WH 4D76A 1YF4A 1S5SA 3RXLA 3TNSA 3NK8A 3SGQE 1AO5A 4XE4A 2ALPA 2V0BA 3F6UH 1YPHC 4SGAE 2V6NA 2HALA 1HJAC 3I77A 4ZKOU 1GDUA 4AB9A 1O5CB 3ZZAA 1FY3A 1MCVA 3GCTG 1G3DA 1CA8B 3RXQA 1G37A 1DE7H 1CT4E 4X1SU 1O33A 5GDSH 1UTMA 2A1DB 1TBZH 1O2VA 2HPPH 2Q6GA 5FCRA 1C5TA 1W2KH 2H1UA 3ATIA 4TYDA 2BDGA 3P95A 3ODDA 1RTKA 3KNXA 2VINA 3BIUH 4H4FA 4Z0KA 4YOGA 3QGJA 4WF8A 8KME2 6LPRA 1IQGA 2FM2A 2SNWA 1YYY1 1GI9B 1QA7A 1GHZA 2G5NA 3C27B 3VB3A 3UOPA 1TQ7B 1GBKA 3SI4H 3RM2H 2GCTB 1O3GA 1ZSKA 3MU8A 5T3HA 1TB6H 1D6RA 4DJZB 1SSXA 4E7NA 4MNYA 5EXNA 1PQ8A 1K1LA 1LPGB 1MAYA 2PFEA 2RDLA 2F9UA 3VXEH 1XVMA 1FDPA 2ZTXA 2ZZUH 3LDXH 5F8ZA 2ODPA 3S69A 1DVAH 8GCHF 1L1GA 3MH5A 4YM9A 1GMDF 2A2QH 1CO7E 1XUFA 2PKSB 1BTUA 5EQSA 2ZHDA 5DP3A 5EG4A 1MCTA 4FVBA 1YPKH 1O3BA 1QY6A 1ZMNA 1FPCH 2ZFSA 3VB4A 1HXFH 2W3IA 2FEQH 2BLWA 4IBLH 3H7TA 3EAJA 5E2OA 1Z1JA 1BT7A 3VB5A 3LJJA 4NWLA 1HAOH 4CREA 1CSOE 1DXWA 2KAIB 1QJ7B 2HNTE 5GCHG 1MTNC 2ODYB 2ZTZA 1BTXA 3RU4E 1UHBA 1FIZA 1C5OH 1K1MA 4I31A 1ELGA 1HPGA 2EI8A 4HFPB 1DLEA 1Z71A 4KELA 2R2WU 4JMYA 4FU7A 3SHCH 2XBVA 1C5PA 3SW2B 5L2ZH 3GYLB 1BUIA 3BEFB 3DFJA 4HZHA 2XCFA 5GIBA 2YNAA 1TPPA 2VIWA 3A8DA 4FUBA 3RXGA 3MNSA 2LNCA 3PV4A 3SV9A 1UK3A 4Y10E 1HGTH 4OS5A 3U8TH 1BRCE 3RU4D 2J92A 4PROA 2ZPRA 1PPHE 4NA9H 2KAIA 1ELFA 1XM1A 1VCPA 2F91A 3ODFA 1N6YA 4XSKU 1ACBE 3S9AA 3MU4A 4ISLA 3F9FA 1VITH 4ABAA 1EAWA 3KEEA 4D9QA 3UFAA 3ZYEA 3IITA 3RXAA 2VB0A 1AVXA 1WTHD 1MTNB 3ENSB 3B9FH 1LQDB 1ELVA 3P8GA 4MNVA 1XUGA 1T8MA 4LOYH 4AGJA 1V2QT 1YLDA 4X6NA 1KXCA 1DFPA 1DY9A 4B2BA 1OP0A 1W0ZU 1QB6A 2ZI2H 1SGTA 1BBRK 1P09A 1SLVB 4JYTA 1P8VC 2A5IA 1C4Y2 1AGJA 2QAAA 2A4QA 2ZQ2A 2B7DH 3U9AH 1ZTLA 2XC0A 3SNCA 1GJAB 1QL9A 1KTTB 4NGAH 1P2MA 4BXWA 2QY0B 4ABHA 3BIVH 1XXDA 1QRXA 3TK6A 1GI8B 2OXSA 4TWYA 1DWCH 3RLYH 4NIWA 4FU8A 3Q3XA 2AS9A 2JETC 3KCGH 4IN2A 1BJUA 1GBCA 1S0QA 2GTBA 3B8JA 3PWBA 2TPIZ 3URCA 3OY6U 1SGNE 2CGAA 4XDEA 3GY3A 1PQ7A 1HJAB 2VWOA 1G2LA 1TNJA 5HYOA 1Z1IA 1GPZA 3EGKH 1ZTKA 5DJ7A 3PLKA 4I8JA 1YPJH 1KYNA 4IN1A 2H2ZA 1LHCH 1L2EA 2BD8A 4WVPE 4ZH8A 1JMOH 4X0WU 3N7OA 3ZVCA 3M7TA 2FODA 3PMHB 2ZU2A 1T8NA 1TRNA 2SGDE 3QTVH 1GDQA 2BD2A 2ASUB 1MKXK 3A88A 3EYDA 3LJOA 2VVUA 1QNJA 1V2MT 2BDIA 2VU8E 2J4IA 1HAPH 2VIPA 1SBWA 1IQKA 2CV3A 3ZYDA 1OXGA 1PYTD 2V3OH 2C8YB 3PLBA 1O3CA 1BMLA 1BHXB 4IS5A 1F7ZA 1AHTH 2WV5A 1K28D 1VGCB 2Z3DA 3BN9A 1AE8H 4I8HA 1T4UH 1NROH 3STIA 3ZZ4A 4WMFA 1FZZA 2H5CA 1NU9A 4FUJA 2Z9LA 1EASA 2C8WB 1ANBA 1ELCA 1J9CH 1C2GA 1GBMA 1JOUB 3SGBE 3F9GA 3RXMA 2FX6A 1HJ8A 1C1TA 6GCHG 1NFUA 1ZSLA 1DXPA 4NZQA 1J16A 1UHBB 1IQLA 2PUXB 2RA0A 1TNIA 1BMNH 2BHGA 3M3SA 3I78A 3E16B 2A4RA 3AAUA 3PB1E 3PTBA 2ZKSA 2FTMA 1FIWA 1EOJA 1O38A 4OS2A 1DX5M 1CQQA 3GCHC 2SNVA 1QRZA 3D49H 3P8OA 3T29A 2QA9E 1P03A 3QTOH 4I7YH 5DGJA 1M9UA 1VGCC 4TWWA 1O5FH 1P01A 1QBOA 1QBVH 4WH6A 1EP5A 1T7CA 2ZF0H 4CR9A 2XRCA 2LIZA 1TE0A 3A81A 3VFEA 1FPHH 1GMDG 1O3FA 3OY5U 5LPEA 2FS9A 3ESTA 1GJBB 1TMUH 2UUYA 1L1JA 2XTTB 1QL8A 1ZRKA 2O8LA 5ETXA 2BYAX 1GI2A 5FPYA 2AEIH 3SUDA 1C2KA 2CF9H 4DT7B 1S81A 1TBRH 3DD2H 1C9PA 3E6PH 1AZZA 1A46H 3VXFH 3TK5A 4SGBE 2XYAA 1O3EA 1GVZA 4NWKA 1RJXB 3RP2A 1BRAA 1C1NA 1TWXB 1LVOA 2PLXA 4XOJA 1EZUC 2VH6A 3QZRA 2ZU3A 4JK6A 1HYLA 4H6TA 1AMHA 2Q6FA 1IQNA 1GI0A 3SV2H 1SL3A 1Y5UT 1NN6A 1LKAA 4Y6DA 2XBYA 5F03A 2C8XB 1V2RT 1WV7H 2OCVB 4MDSA 1O5AB 3MU1A 1J15A 9LPRA 5TCAA 3OTJE 1AKSB 4A7IB 1YGCH 2GT7A 2HOBA 1SOTA 3ZZ7A 3GDUA 1F0UA 3PMAB 1DDJA 2ULLA 1YBWA 2BLVA 3KQCA 3OSYA 3LC3A 3RXVA 3NPSA 4IMQA 3SUEA 3P70B 4VGCB 1OWHA 2Z3CA 1OWIA 3A86A 4I8KA 1ESAA 1LQEA 3BTQE 4K1SA 4K5ZA 1LPZB 5K0HA 1GBFA 1UTOA 1KXDA 4K2YA 2FX4A 1KY9A 3GISB 1IQEA 1LVYA 1FY8E 5DP8A 2PKAB 2WYGA 1TAWA 1WUNH 2ZQ1A 3A7TA 2W7UA 1FY5A 1V2WT 3FP6E 2OBQA 1ARCA 5SGAE 4X8SH 1QA0A 2TGAA 3SORA 4GSOA 3BTHE 4ABEA 3RXCA 1DUAA 1EJMA 2Z9KA 1GGDB 1JRSA 3LPRA 2FOCA 3A80A 1C2JA 3T2NA 1HIAA 1O39A 4XBBA 1O2ZA 1O2JA 1P3CA 2Z9JA 2A0QB 3K6YA 1PQ5A 1O5EH 2AH4X 1XXFA 2CHAB 2FP7B 3P17H 1WYKA 1Y3XA 3IG6B 1LHEH 2AGIX 2VWMA 1O3MA 2WPMS 2F9VA 1MH0A 1Z8IB 2BD4A 2DUCA 2AMQA 3ATWA 3BG8A 2SGPE 4U30A 2BLQA 2HNTF 5CMXH 1A0LA 4ZHLU 1O3OA 3D62A 3P6ZB 2J38A 2VIOA 3QZQA 2BOHB 3M3TA 1N8OB 1SPJA 3CP7A 3KQBA 5J4QA 3TGIE 2VVVA 4BAKB 1SR5C 4K1EA 2ZGJA 4ISIH 4ZKSU 4FU9A 4OGYA 4D7GA 4IMZA 4BANB 5C1UA 5BPEA 1A7SA 1NZQH 1CT0E 1F5KU 1ESTA 4BAMB 2J34A 3LGTA 3SU6A 4CH8B 4AFZA 8LPRA 5A09A 1H9HE 3VB6A 3O8DA 5L6NH 4JCNA 1EAXA 2ANYA 4A1XA 1YLCA 3GY5A 3ZZBA 4CBOA 1GJ4H 1D3QB 1VJAU 1UVOA 1SLWB 3RXEA 3A8AA 2FYRA 1V6DA 3M5LA 4ZUHA 3RDZA 1MKXH 1YPHE 3MOCA 1MMJN 2ZFRH 4JK5A 2F9BH 3KF2A 5DO4H 3MO9A 1GHWH 2SGFE 1T8OA 1GJDB 1Z8RA 1ZGIA 3M36A 2CMYA 1ZMJA 3PLPA 1AIXH 1FI8A 3LH1A 2HVXA 1BZXE 2EC9H 3A7YA 4LXBH 2A5KA 1GDNA 2PV9B 1W10U 4UFGH 4NA7A 5EODA 4AYYB 3MH4A 3F9EA 6CHAC 1P10A 2Y5FA 2BQ6B 1W0YH 3TH3H 5C2ZA 1P2QA 2BX3A 2BXUH 3V3MA 1NPMA 1UVSH 3BTME 5AHGH 1EATA 3TH4H 2GCHG 4AFQA 2VNTA 7GCHF 1ANEA 4NCYA 4X2YA 1O2GH 1SG8B 3F1SB 2BZAA 5JB9S 4I8GA 5C3NA 3ATLA 1C1RA 1BTHH 4CRGA 1O2NA 1BHXF 2IN2A 1PPEE 5IYTA 3KQDA 1OSSA 1T8LA 4CR5A 1DSTA 1BQYA 2PHBA 2BVXH 1SGDE 2P94A 2QC2A 2F83A 5BRRE 1QURH 1O30A 2WV4A 3QGNB 2FOAA 1KLIH 2UWOA 1NRSH 4BAHB 4ZROA 1F92A 1TGCA 4B1TA 1O0DH 3U69H 3BG4B 2P93A 2G00A 1E38B 3RXTA 5C1YA 2QV1A 1BTZA 3A7XA 3ZZ6A 3MMGA 1SHYA 4HGCA 6CHAB 2GGVB 1GHAG 1WSSH 2H5DA 1AFQB 1D6WA 2M5TA 3A7ZA 3L6PA 3HGNA 4BNRA 5L30H 1TNKA 2H6MA 4UFEH 4MPUA 4ZHAA 1OKXA 2F9OA 1YPGH 1ZMLA 1TGBA 3SO3A 2OC7A 5EU8A 2G81E 4D7FA 5C1XA 2ZA5A 4DIHH 1F0SA 3GCTF 5AVDA 3KQEA 4YOIA 1V3XA 1TQ0B 2GP9B 4Z6AH 2FZZA 1KXEA 1O3AA 2Y6TA 2AYWA 3RXJA 1P02A 5LPRA 1O36A 3KGPA 1HUTH 4CRCA 1TFXA 3CENA 1O2XA 4MNWA 3OU0A 1AUJA 3TH2H 3RMMH 1FN8A 1KDQB 2A2XH 3O8RA 1C1QA 1C9TA 1SMFE 1FY4A 1VR1H 4H6SB 1K21H 2ZDNA 1GHBF 1H8IH 3MNBA 3TJUA 1TX7A 2ZFFH 1AKSA 1NFXA 4GCHF 3V12A 1GCTC 2P3TB 1HAGE 3SBKA 2D2DA 2Z7FE 1TPOA 1L4ZA 3SGAE 1YCPH 4NA8A 1SFIA 2GCTC 3GYMA 3D65E 1B5GH 3DFLA 3RXIA 1MZAA 4ASHA 4Y8YA 1GWAA 5E0GA 5C5NA 2BM2A 2VIDA 5EOKA 2D8WA 3UY9A 2QF0A 5C20A 1TRMA 3Q3KA 3SU0A 3WY8A 4A1VA 3R3GB 5GPIB 3QLPH 3PWCA 2G5VA 3PYHA 1AFEH 3VPKA 2OQ5A 5FCKA 1V2ST 3NKKA 1SGIB 3E0PB 4E06H 1C5WB 5LPFA 4YOJA 1O3PB 1FLEE 2W5EA 3M5MA 3BTFE 1OWKA 5JB8S 1SLUB 4H42U 1C2FA 2FOFA 3ZVFA 3MNXA 4X1NU 1VITG 4BTTB 3GY2A 1UK2A 1GJ6A 1WAYB 3TNTA 1E37B 5HXFA 1CGJE 1EJNA 1AN1E 4XBCA 3S0NA 3H5CB 2WUBA 3QDZB 3FZZA 3E3TA 2O8TA 1EAIA 4A5TS 2I6QA 3MFJA 2OBOA 4E7RG 2BVSH 3ITIA 2ZFTA 1IQMA 1F0RA 4ZKRU 3RUOA 1BJVA 4KTSA 1HCGA 1L0ZA 1C5RA 1LHDH 2Z9GA 1SB1H 1DWBH 4B74A 1F5RA 1D9IA 1VJ9U 1AWHB 1TMTH 4ZKNU 3UR9A 1WQVH 1ORFA 4ZXYH 3UOUA 1EQ9A 4ABFA 2JH5D 1ETSH 1THSH 1NRNH 3RXKA 5HGGA 3RXUA 1F0TA 4VGCC 1XUHA 2C90B 3UQVA 4LZ4B 5CHAC 3SU2A 3UWIA 1O2KA 1OS8A 3LU9B 4JZ1A 1SGCA 1A3BH 1C5YB 1P3EA 1EB1H 4FUFA 1S83A 1OWJA 4AZ2B 2Z3EA 5ABWA 2EI7A 2AFQB 1JIRA 5T6GA 1V2TT 1E34B 2GDDA 1AB9C 4DG4A 4NIVA 4I32A 1WOFA 3SV8A 1FY1A 4X6PA 4WWYA 4ESTE 3EA7A 1BTWA 1U6QA 2B8OH 1LCYA 4JZDH 1GGDC 5TCCA 1AUTC 1THRH 4RSPA 4Y7BA 3T5FH 1PPGE 2A7CA 1ZHMA 1LHFH 2P16A 2B9LA 4X2WA 4KP0A 1FN6A 2O8WA 2BQWB 1JIMA 2W7SA 2VGCC 1SFQB 2GZ9A 1ZPCA 4J1YA 1GG6B 1ANCA 5EPNA 2GDEH 4M7GA 1EPTA 2C93B 1OYQA 3ELAH 1ZLRA 2Q6DA 3NUMA 3KIDU 3UPEA 3SI3H 2ESTE 5AFYH 1NO9H 3A8BA 3LH3A 1OP8A 1YPEH 2PUQH 1YCPK 2HNTC 5DP5A 3S7HB 2BY5X 2HRVA 2XNIA 5A0AE 9ESTA 4XBDA 2AIQA 2PKSC 1TA2A 1FJSA 1GHBG 2Y81A 5EQQA 4ISNA 3GDSA 2Z6BD 1LVBA 2ZNKH 4GCHG 2P3FH 3AAVA 1NM6A 2R0LA 4Q7XA 1ZR0A 2J95A 2FI4E 2XXLA 2ZC9H 2UUFB 1QJ1B 1EB2A 3E91A 5PTPA 3O8CA 2ZGBH 3SNDA 3QUMP 1C1OA 2VIVA 1RRKA 3M61U 1HAVA 4U2WA 4ZMAH 3IWMA 1XUIA 4FXGH 1ABJH 4U01A 1TPAE 2VGCB 2FTLE 1Y3UA 1N6XA 3RXRA 4OGXA 1GI6A 1O3KA 2ZHFH 2Z9IA 1GMHG 1ZJDA 1ELEE 1GG6C 1SHHB 4OS6A 4B73A 3FANA 4UEHH 1C1UH 2BY6X 2ZP0H 2ZPQA 1A5GH 2BVRH 2G52A 4Y0YE 4YTAA 5L2YH 2V3HH 1LTOA 3MU0A 3AW0A 3NWUA 4UFFH 1K9OE 1GBIA 3SJ9A 2HWLB 2HLCA 1QB1A 3MYWA 7KMEH 2BDBA 3P92A 3OX7U 3M37A 1TYNA 1A0HB 1GBTA 1LDTT 2A4OA 4QT8C 1TONA 2DE9A 3KHVA 1EZQA 1VITF 1ELAA 3ZVGA 2GZ8A 2BTCE 3GDVA 1GBBA 1GBAA 1TNGA 5HM2A 1UTKA 3A82A 1LVMA 5EW2H 5G4BA 5AF9H 4TPYA 6ESTA 2Q1JA 3U8OH 4DVAU 2PSYA 2BB4A 3MHWU 4TPIZ 1UCYE 1HFDA 2YNBA 1LKBA 4DURA 4YO9A 1BMMH 4INHA 1BTYA 2K1QA 2FMJA 2ZGXH 4ZAEA 3M3VA 1A5IA 3SNAA 1GL0E 1DLKB 3OYPA 2GV7A 2Y7XA 1Q31A 1BIOA 1C1SA 1QFKH 1N1LA 1O31A 1GI3A 1GMCG 3UTUH 1QQ4A 4ISHH 1DPOA 5FPTA 3ZZ9A 4RKOB 1MQ6A 1V2UT 1D3PB 4K8YA 5I25A 1DSUA 4YLQH 1O32A 2O8MA 3E8LA 1UCYK 2ANMH 2WPIS 3E1XB 3TVJB 2ZFQH 1DICA 3PO1C 2ZCLP 1UO6A 2ZEBA 3MO6A 1TA6A 3UUZA 1AU8A 4NFFA 5FX6A 3RXSA 4ZXXH 2BD9A 2ZDVH 2NU2E 4CRFA 3U98H 2CF8H 3B23B 3P8FA 1N8OC 3SHAH 1UMAH 1CHGA 1ZRBA 4KKDA 2ZTYA 4FUGA 1ZSJA 4A1TA 3TLOA 3RC6A 2JH6D 1TBQH 4Y7AA 5F8XA 1GJ7B 4OS4A 1FV9A 4A92A 5A2MH 2OP9A 2UUJB 1MKWK 3M35A 2TIOA 1TOMH 3CS0A 3LGWA 1TLDA 1E0FD 1GI7B 4GPGA 1WBGB 1SVPA 4Q7YA 4AG1A 2VIQA 2QYIA 1VZQH 1C5MD 3SN8A 2ZG0H 5A8XA 1RS0A 2F9NA 3ZZDA 1O2PA 1T4VH 5IDKA 3AVZA 1O3DA 4INKA 1OPHB 3GCNA 1P57B 2FI3E 3GY7A 1W13U 1C5QA 3FP7E 4MLFB 1SGFA 2FOHA 1K1NA 3A85A 4GUXA 1LO6A 1S6FA 1RTLA 2NWNA 3M7UA 3MU5A 1Y5AT 1HAXB 4Q2KA 4BAQB 3W94A 1O2OA 2F9PA 1O3HA 3RC5A 1PPZA 5EW1H 1HAZB 2F3CE 2P95A 4U32A 3NCLA 1SQOA 1NT1A 2PW8H 2RCEA 1SOZA 2PR3A 1DOJA 3A8CA 1TNHA 3K9XB 4X8UH 1Y8TA 1EUFA 3URDA 1O35A 3UNQA 3E0NB 2P3UB 1K1JA 4UD9H 2FXRA 4NIYA 3STJA 4AOQA 3MNCA 2ZHQH 4INLA 3TIUA 1Y3YA 2VVCA 1AQ7A 2ZU1A 1MZDA 2STBE 4DY7B 2QXIA 4I33A 2PKAA 1C2MA 3U8RH 1KLTA 4F49A 2VWNA 2BDAA 4DOQA 4O3UA 1EZSC 1Q3XA 2XWBI 2R9PA 5JBAS 1W3CA 5F6MA 1ABIH 1FNIA 3QO6A 3C1KA 3V7TA 1E35B 1KTSB 1O2YA 4WH8A 1SQAA 1XKAC 4Y0ZE 4K60A 3A84A 3S9CA 2RA3A 3ZZCA 1RTFB 1YCPM 3SZNA 4IC6A 2WYJA 4JZFH 4YZUA 1YKTA 3SJOA 3F9HA 2P59A 1HB0B 1O2LA 1CA0C 1J8AA 1AY6H 4CHAB 1P9SA 1DANH 1SGRE 1O2TA 1VCWA 2JH0D 2ZGHA 1RIWC 1X7AC 3UNRA 1TGNA 1O2HA 2RG3A 3A89A 3LGIA 4NG9H 2ZECA 2TGTA 2W26A 4MQAA 3SQEE 5JPMH 4GLYA 3TK9A 1OYTH 1F2SE 2J2UA 1DY8A 1V2VT 2O8UA 1C4U2 3BTEE 1XMNB 5DG6A 1K1IA 1Z7KA 3PM3A 1V2JT 1QCPA 2FIRH 1W7XH 5E8EH 2EA3A 3RMNH 5EPYA 3QK1A 5LH8A 1OWEA 3KN2A 3BEUA 1SI5H 2A7JA 3EDXB 3M5NA 1G32B 4DIIH 1CE5A 1GJ5H 3BTTE 1FUJA 5FPSA 3KL6A 1ELBA 4K1TA 2A4GA 1L1NA 3GY8A 3LGYA 1D3TB 1JXPA 2TBSA 1HIAB 3LGVA 1GBDA 1UVPA 1ESBA 1H9IE 4FUHA 2A7HA 4OS1A 1UJ1A 2TGPZ 2STAE 4Y8XA 4A6LA 4Y11E 2BMGB 4NSYA 1J14A 4GHTA 1O37A 1G3EA 1W7GH 3SNBA 1GL1A 1B0FA 1YPLH 3K6ZA 1SGYE 3FP8E 2FWWA 4WMEA 1C2IA 2ZO3H 1UTQA 5JDUB 1KSNA 3EA8A 2PGQB 1BRUP 1O5BB 1EZXC 3PMBB 3W95A 3SJKA 2VJ1A 2EI6A 1GJ8B 3DUXH 1GI4A 1Y3WA 2AMDA 2Y5HA 1YP9A 2QXJA 4B2AA 2NU3E 1ANDA 1O2WA 3FZDA 1QBNA 3BV9B 4AGKA 1EAUA 2ZIQH 1PQAA 1EPTB 1K1OA 2GKVE 4X8VH 1NESE 2DE8A 3SNEA 1BITA 1BDAA 3NXPA 1OX1A 3ZZ8A 5J4SA 1GMCF 3RXPA 4ABGA 1TMBH 1DUEA 2QXHA 3NZIA 3ZZ5A 1GCDA 1XKBC 3M5OA 1A61H 2FLBH 4D9RA 1CU1A 2AERH
chains in the Genus database with same CATH superfamily
2GMTC 2G4TA 2ZDAH 2SGEE 3SUGA 1AFQC 2TRMA 4UFDH 4AC9A 1ZPZA 2SGAA 3MWIU 1MAXA 2BDCA 3ZIAD 4R8TB 5DKMA 4YT7H 1S6HA 3JZ2B 4ZCNA 3P8NA 1DS2E 1C2LA 1LPKB 3V0XA 1CHOF 5FXLA 4BOHA 2C8ZB 1W11U 4B71A 5DP7A 4CRDA 2L6OA 1C5LH 1GHXH 2BD3A 1KLJH 2FLRH 1DT2A 3HK3B 2FYQA 1V2KT 1GJCB 3N7DA 1C2HA 3ATMA 1NRQH 2Y80A 3A7WA 4O97A 1EPTC 3HPTB 1DM4B 2BDHA 1A1RA 1JRTA 1ZHRA 1BA8B 1QR3E 2FPZA 5GCHF 3SU4A 3SV7A 3SV6A 5ESTE 2Z94A 1WU1A 1AD8H 4NIXA 2XCNA 3ZVEA 1NTPA 1PYTC 1W14U 3RLWH 3N99A 1W12U 1P2JA 3KYFA 3TPIZ 4TY7A 2V7QD 2GCHF 2ALVA 3U28C 4XD7D 3MH7A 7GCHG 3BSQA 3TJVA 3QWCH 3LIWA 3SJ8A 2R2MB 2JKHA 1AI8H 3LOXA 1BMAA 4AG2A 5C5OA 5EXLA 2R3UA 1EX3A 2CJIA 4IC5A 1O5DH 1TGTA 2XBXA 3E90B 1WCZA 1ZOMA 5T6FA 1RFNA 1D4PB 5F53A 1ID5H 1B0EA 1K2I1 2YOLA 2O9QA 1E1QD 2G51A 1ZYOA 2ANKH 4CRBA 4IW4E 1AZ8A 2QCYA 4FUCA 1PFXC 1Y59T 4X6OA 1NRPH 1C4V2 1F5LA 1FONA 1C5VA 1TRYA 2ZHWH 1UW7A 2GVFA 1BTPA 1ELTA 1UTNA 1TPSA 2HGTH 1A3EH 1H1BA 3HKJB 1OWDA 3PTNA 4FUEA 3T26A 2ZU5A 3BTKE 4ISOA 1H8DH 2P8OB 1P05A 3UIRA 2ZGCA 4K69A 2NU1E 4O3TA 4JZIA 1TX8A 1K22H 1HAVB 1O2IA 1HDTH 1QQUA 4MTBA 3G01A 3KYGA 1RIWB 1GBLA 1P11E 1HAHH 3R0FA 4ZHMU 1GBEA 1C1PA 2A31A 2GT8A 3LKWA 2WPHS 3SU3A 4RT0A 3BEIB 1FAXA 3L3TA 1CVWH 1G3CA 1SQTA 1MTVA 2A45B 3RMOH 3OEHD 1SGFG 4X8TH 5E2PA 4RN6A 2FESH 3DHKH 1TX6A 4DCDA 2CK3D 3JZ1B 1C2EA 2KCAA 1AVWA 3O8BA 2EEKA 2I6SA 2G4UA 1LHGH 2ZCKP 3RXFA 2WINI 1QB9A 3RXBA 5JBCS 1V2OT 1G36A 4Y76A 4X2XA 4AYVB 4GVUA 2UUKB 1AE5A 4ABDA 2PSXA 4X1QU 1XVOA 3BG4C 4M9FA 1IQIA 1CT2E 5EXMA 4DGJA 2ZFPH 2H9EH 3ZVAA 4KGAA 1K0HA 1RD3B 2BOKA 4NSVA 1JBUH 1NRRH 3L33A 2A5AA 3TITA 2Y5GA 3F68H 1IQJA 1J17T 3PRBA 2OLGA 5FAHA 4WJG2 2ZWLH 1UTPA 1SKYE 2OC1A 1PJPA 1PPBH 4RKJB 1EXFA 2QF3A 2R0KA 2ZDKA 4F4OC 2ZDMA 1MBQA 2FOBA 1MBMA 5DK1A 1RXPA 2GD4B 4AFUA 1E79D 1ZTJA 3RM0H 3PMJA 3T28A 5A0CA 2ODQA 1Z8JB 2ZPSA 3BTDE 4FOUC 1Z8GA 8ESTE 3A87A 3GY6A 5DPAA 1NBMD 2PTCE 1QHRB 1UVTH 4UE7H 2A32A 5HKKD 1Y3VA 2OC8A 5A0BA 1HAYB 3EQ0H 1C5SA 2J9NA 2J5UA 2AMPA 2PGBB 1SGEE 3F2HA 4D8NA 1C5NH 1WDIA 1XUKA 3RMLH 3BF6H 4IGDA 1O3NA 4KTUA 2J98A 2EY4C 3AASA 1GI1A 2ILNA 3GICB 1C1VH 4I8LA 1GJ9B 2GMTB 5DP6A 1CGIE 3VEQB 7LPRA 1CBWC 1G3BA 4WXVA 1C1MA 5EQRA 4FUDA 2G8TA 3ZV9A 6GCHF 4X2VA 3LT3A 4JYVH 4LZ1H 3PO1B 2OC0A 1THPB 1ZZZA 2ANWA 2BD5A 1GI5A 4K3JA 4CHAC 1Z6JH 3V13A 4FUIA 2NU0E 1K1PA 4UONA 2H9HA 4B75A 1QRWA 1IQFA 1HLTH 2OD3B 1V2LT 4THNH 1QGFA 3AW1A 2IJOB 4RT1A 1O2QA 4X1PU 4X1RU 1VCQA 4ABBA 3SJIA 1KIGH 1KXAA 5T6DA 3UNSA 3U1JB 4BAOB 2WPJS 2QGRA 4X6MA 5TJXA 1HXEH 5ESBA 3MTYA 1P2NA 2B5TB 1WQSA 4NZLA 1ARBA 2VWLA 2CN0H 3ZZ3A 4O9VA 1XUJA 1H9LB 3TGJE 1UTLM 1FQ3A 1UVUH 2TGDA 2NU4E 3WWFA 4B76A 1CBWB 3ZVBA 1GMHF 2BY8X 3Q3YA 3VG8A 1GBJA 1TALA 3ATKA 4LK4A 3HGPA 3MI4A 1EJAA 3RC4A 1EOLA 3EBNA 1CHOG 5FBEA 3LONA 3VGCC 1HV7A 1A2CH 1MUEB 1JWTA 1KMHB 3RXHA 2BD7A 3HK6B 1ZGVA 2OINA 2CXVA 4ABIA 2LPRA 4BTIB 2IPHA 1QTFA 1A0JA 1O3LA 3T27A 1MTWA 3SYJA 4GAWA 1Z6EA 2KCPA 1IAUA 3TJNA 5CHAB 3GCOA 3ZV8A 1C2DA 1FXYA 1T32A 3FVFB 2SFAA 2XC5A 4YLUA 2P8OC 3QN7A 5DP4A 1O3IA 1BBRE 4GHQA 1MTSA 2IOTA 4XFQA 4TY6A 2HPQH 1YPMH 1UTJA 2FOMB 1IQHA 4WXIA 1MTUA 2XW9A 1MKWH 1KXBA 2ZDLA 1P2IA 3HATH 1MU8B 3RXOA 4AN7A 3UWJH 2GJGA 3F2GA 5F8TA 3S9BA 1YC0A 4UDWH 3OFND 1GVLA 1NY22 4NFEA 2R3YA 3MH6A 5B6OA 2QIQA 1BOQA 3UR6A 1PPCE 1TABE 5GNDA 1P04A 1O5GH 4Y71A 5A8YA 2AIPA 5K7RA 4ACBA 4YESB 1INCA 2OK5A 2GX4A 5HM9A 4ABJA 1HBTH 2Y7ZA 4HI3A 1IHSH 4AB8A 3U1IB 4O03A 3SOSA 1O2RA 1YM0A 2OQUA 2SGQE 1GBHA 1S84A 1IOEA 2FOEA 1P9UA 3Q76A 3TU7H 1NFYA 1T31A 1NU7B 4CBNA 1G2MA 1C1WH 1B7XB 3T25A 1TIOA 1P06A 2FS8A 1SLXB 3S7KB 1HAIH 1P2OA 2ZU4A 2ZHEH 1P0SH 1S85A 2FOGA 1HRTH 2BLOA 2UWPA 2XC4A 3RXDA 2OUAA 1UCYH 2WV9A 1MD7A 5GXPA 4Y79A 4R0IA 5AFZH 4FVDA 5JBTA 1AVGH 3SUFA 3TGKE 1BB0B 3GY4A 1QIXB 2BY9X 2FI5E 1GHYH 2THFB 3Q00A 1XX9A 5E0JA 5EJLA 1FAKH 3K65B 3MO3A 1O2SA 1BCUH 4YT6H 4CRAA 3D23A 1O3JA 2BY7X 2PWXA 4AFSA 3BTGE 2JETB 4B2CA 3DT0H 3A7VA 2C4FH 4J2YB 3BTWE 3CS7A 4MG3A 4KTCA 2FDAA 3SU5A 4MPWA 2WUCA 1EP6A 1O34A 2WPLS 1ELDE 3LGUA 5FX5A 1E36B 2Y82A 1Y5BT 3VB7A 1A5HA 1BRBE 1O2MA 5H4IB 2D1JA 5FHTA 5JYIA 4JZEH 4CH2B 4MPVA 5A8ZA 1C5ZB 1P12E 5E0HA 2BXTH 1SC8U 2BQ7B 2BX4A 2V35A 8GCHG 1EFRD 5KECA 2VBCA 3PROA 1S0RA 1CGHA 1NC6A 1BBRH 5GWZA 2VH0A 5HMAA 1MQ5A 4MNXA 5EGMA 1FMGA 4WMDA 1AB9B 2WPKS 5FBIA 2FO9A 4E05H 1C5XB 1GCTB 1RGQA 2UWLA 1G30B 1DWEH 2BZ6H 3SQHE 3I29A 1HJ9A 3HKIB 1V2NT 1DITH 1W8BH 1TGSZ 5FL7D 3M7QA 4HTCH 1SGQE 4JYUH 2D26C 2W3KA 2OTVA 4Y8ZA 1QJ6B 2C3SA 3GOVB 4BXSA 1NS3A 2QN5T 1C5UA 3LC5A 1PPFE 1MD8A 2H9TH 1ETTH 1L4DA 2G55A 1G9IE 1KDQA 3UQOA 2XWAA 1DWDH 4K8BA 4MVNA 3FFGA 1OHHD 2BDYA 5EJ1A 1OP2A 5C67A 1IHTH 3FAOA 3SU1A 1OOKB 4AX9H 3A83A 1H4WA 1MU6B 2JIZD 2ZCHP 4Q7ZA 4AORA 1SGPE 2GV6A 1O2UA 1ZHPA 1CA0B 3QX5H 1TNLA 2AGEX 1QZ8A 5EJZA 1AWFH 3VGCB 2K7XA 4MPXA 3EA9A 1LMWB 5GJ4B 1QL7A 1UK4A 1FX0B 1ZPBA 1D3DB 1ETRH 3ZVDA 2AGGX 3T62A 1TOCB 1KXFA 1V2PT 3H7OA 5LGOA 2XBWA 3RU4T 3UREA 1NFWA 1WTGH 2CHAC 5DP9A 3GCHB 2QXGA 2B0FA 4Q80A 3DA9B 2PTNA 3Q77A 1S82A 5JBBS 4WY3A 1HNEE 3K2UA 1Q2WA 2J94A 3TJOA 4OS7A 5CE1A 2GZ7A 1GHVH 3EE0B 1EKBB 4DW2U 5I46H 1GVKB 1GHAF 7ESTE 1ZJKA 1P2KA 4BTUB 1A4WH 4D76A 1YF4A 1S5SA 3RXLA 3TNSA 3NK8A 3SGQE 1AO5A 4XE4A 2ALPA 2V0BA 3F6UH 1YPHC 4SGAE 2V6NA 2HALA 1HJAC 3I77A 4ZKOU 1GDUA 4AB9A 1O5CB 3ZZAA 1FY3A 1MCVA 3GCTG 1G3DA 1CA8B 3RXQA 3PV5A 1G37A 1DE7H 1CT4E 3N7EA 4X1SU 1O33A 5GDSH 1UTMA 2A1DB 1TBZH 1O2VA 2HPPH 2Q6GA 5FCRA 1C5TA 1W2KH 2H1UA 3ATIA 4TYDA 2BDGA 3AK5A 3P95A 2RFKC 3ODDA 1RTKA 3KNXA 2YMSB 2VINA 1WXRA 3BIUH 4H4FA 4Z0KA 4YOGA 3QGJA 4WF8A 8KME2 6LPRA 2HVYB 1IQGA 2FM2A 2SNWA 1YYY1 1GI9B 1QA7A 1GHZA 2G5NA 3C27B 3VB3A 3UOPA 1TQ7B 1GBKA 3SI4H 3RM2H 2GCTB 1O3GA 1ZSKA 3MU8A 5T3HA 1TB6H 1D6RA 4DJZB 1SSXA 4E7NA 4MNYA 5EXNA 1PQ8A 1K1LA 1LPGB 1MAYA 2PFEA 2RDLA 2F9UA 4FETA 1XVMA 3VXEH 1FDPA 2ZTXA 2ZZUH 3LDXH 5F8ZA 1SQRA 2ODPA 3S69A 1DVAH 8GCHF 1L1GA 3MH5A 4YM9A 1GMDF 2A2QH 1CO7E 1XUFA 2PKSB 1BTUA 5EQSA 2ZHDA 5DP3A 5EG4A 1MCTA 4FVBA 1YPKH 1O3BA 1QY6A 1ZMNA 1FPCH 3F0OA 2ZFSA 3VB4A 1HXFH 2W3IA 2FEQH 2BLWA 4IBLH 3H7TA 3EAJA 5E2OA 1Z1JA 1BT7A 3VB5A 3LJJA 4NWLA 1HAOH 4CREA 1CSOE 1DXWA 2KAIB 1QJ7B 2HNTE 2IJD1 5GCHG 1MTNC 2ODYB 2ZTZA 1BTXA 3RU4E 1UHBA 1FIZA 2HLDD 1C5OH 1K1MA 4I31A 1ELGA 2WHXA 1HPGA 2EI8A 4HFPB 1DLEA 1Z71A 2LP6A 4KELA 2R2WU 4JMYA 4FU7A 3SHCH 2XBVA 1C5PA 3SW2B 5HIYA 5L2ZH 3GYLB 1BUIA 3BEFB 3DFJA 4HZHA 2XCFA 5GIBA 2YNAA 1TPPA 2VIWA 3A8DA 4FUBA 3RXGA 3MNSA 2LNCA 3PV4A 3SV9A 1UK3A 4Y10E 1HGTH 4OS5A 3U8TH 1BRCE 3FKSD 3RU4D 2J92A 4PROA 2ZPRA 1PPHE 4NA9H 2KAIA 1ELFA 1XM1A 1VCPA 2F91A 3ODFA 5CHBA 3WW7A 1N6YA 4XSKU 1ACBE 3S9AA 3MU4A 4ISLA 3F9FA 1VITH 4ABAA 1EAWA 3KEEA 4D9QA 3UFAA 3ZYEA 3IITA 3RXAA 2VB0A 1AVXA 1WTHD 1MTNB 3ENSB 3B9FH 1LQDB 1ELVA 3P8GA 4MNVA 1XUGA 1T8MA 4LOYH 4AGJA 1V2QT 1YLDA 4X6NA 1KXCA 1DFPA 1DY9A 4B2BA 1OP0A 1W0ZU 1QB6A 2ZI2H 1SGTA 1BBRK 1P09A 1SLVB 4JYTA 1P8VC 2A5IA 1C4Y2 1AGJA 2QAAA 2A4QA 2ZQ2A 2B7DH 3U9AH 1ZTLA 2XC0A 3SNCA 1GJAB 1VKYA 1QL9A 2V3MA 1KTTB 4NGAH 1P2MA 4BXWA 2QY0B 4ABHA 3BIVH 1XXDA 1QRXA 3TK6A 1GI8B 2OXSA 4TWYA 2JJ1D 1DWCH 3RLYH 4NIWA 4FU8A 3Q3XA 2AS9A 2JETC 3KCGH 4IN2A 1BJUA 1GBCA 1S0QA 2GTBA 3B8JA 3PWBA 2TPIZ 3URCA 3OY6U 1SGNE 2CGAA 4XDEA 3GY3A 1PQ7A 1HJAB 2VWOA 1G2LA 1TNJA 5HYOA 1Z1IA 2KCYA 1GPZA 3EGKH 1ZTKA 5DJ7A 3PLKA 4I8JA 1YPJH 1KYNA 4IN1A 2H2ZA 1LHCH 1L2EA 2BD8A 4WVPE 4ZH8A 1JMOH 4X0WU 3N7OA 4DT4A 3ZVCA 3M7TA 2FODA 3PMHB 2ZU2A 1MABB 1T8NA 1TRNA 2SGDE 3QTVH 1GDQA 2BD2A 2ASUB 1MKXK 3A88A 3EYDA 3LJOA 2VVUA 1QNJA 2F43B 1V2MT 2BDIA 2VU8E 2J4IA 1HAPH 1NBME 2VIPA 1SBWA 1IQKA 2CV3A 3ZYDA 1OXGA 1PYTD 2V3OH 2C8YB 3PLBA 1O3CA 1BMLA 1BHXB 4IS5A 1F7ZA 1AHTH 2WV5A 1K28D 1VGCB 2Z3DA 3BN9A 1AE8H 4I8HA 1T4UH 1NROH 2JJ2D 3STIA 3ZZ4A 4WMFA 1FZZA 2H5CA 1NU9A 4FUJA 2Z9LA 1EASA 2C8WB 1ANBA 1ELCA 1J9CH 1C2GA 4F48B 1GBMA 1JOUB 3SGBE 3F9GA 3RXMA 2FX6A 1HJ8A 1C1TA 6GCHG 1NFUA 1ZSLA 1DXPA 3MQKC 4NZQA 1J16A 1UHBB 1IQLA 2PUXB 2RA0A 1TNIA 1BMNH 4ASUD 2BHGA 3M3SA 3I78A 3E16B 2A4RA 3AAUA 3PB1E 3PTBA 2ZKSA 2FTMA 3H09A 2KX4A 1FIWA 1EOJA 1O38A 5C0UA 4OS2A 2QF4A 1DX5M 1CQQA 3GCHC 2SNVA 1QRZA 3D49H 3P8OA 3T29A 2QA9E 1P03A 3QTOH 4I7YH 5DGJA 1M9UA 1VGCC 4TWWA 1O5FH 1P01A 1QBOA 1QBVH 4WH6A 1EP5A 1T7CA 2ZF0H 4TT3D 4CR9A 2XRCA 2LIZA 1TE0A 3A81A 3VFEA 1FPHH 1GMDG 1O3FA 3OY5U 5LPEA 2FS9A 3ESTA 1GJBB 1TMUH 3FN8A 2UUYA 1L1JA 2XTTB 1QL8A 1ZRKA 2O8LA 5ETXA 2BYAX 1GI2A 5FPYA 2AEIH 3SUDA 1C2KA 2CF9H 4DT7B 1S81A 1TBRH 3DD2H 1C9PA 3E6PH 1AZZA 1A46H 3VXFH 3TK5A 4SGBE 2XYAA 1O3EA 1GVZA 4NWKA 1RJXB 3RP2A 1BRAA 1C1NA 1TWXB 1LVOA 2PLXA 4XOJA 1EZUC 2VH6A 3QZRA 2ZU3A 3FOAA 4JK6A 1HYLA 4H6TA 1AMHA 2Q6FA 1IQNA 1GI0A 3SV2H 1SL3A 1Y5UT 1NN6A 1LKAA 4Y6DA 2XBYA 5F03A 2C8XB 1V2RT 1WV7H 2OCVB 3OEED 4MDSA 1O5AB 3MU1A 1J15A 9LPRA 5TCAA 3OTJE 4ACAA 1AKSB 3WWBA 4A7IB 1YGCH 2GT7A 2HOBA 1SOTA 3ZZ7A 3GDUA 1F0UA 3PMAB 1DDJA 1W0JD 2ULLA 1YBWA 2BLVA 3KQCA 1W0KD 3OSYA 3LC3A 3RXVA 3NPSA 4IMQA 3SUEA 3P70B 4VGCB 1OWHA 3DCLA 2Z3CA 1OWIA 3A86A 4I8KA 1ESAA 1LQEA 3BTQE 4K1SA 4K5ZA 1LPZB 5K0HA 1GBFA 1UTOA 1KXDA 4K2YA 2FX4A 1KY9A 3GISB 1IQEA 1LVYA 1FY8E 5DP8A 2PKAB 2WYGA 1TAWA 1WUNH 2ZQ1A 3A7TA 2F4LA 2W7UA 1FY5A 1V2WT 3FP6E 2OBQA 1ARCA 5SGAE 4X8SH 1QA0A 2TGAA 3SORA 4GSOA 3BTHE 4ABEA 3RXCA 3KQ5A 1DUAA 1EJMA 2Z9KA 1GGDB 1JRSA 3LPRA 2FOCA 3A80A 1C2JA 3T2NA 1HIAA 1O39A 4XBBA 1O2ZA 1O2JA 2KZ4A 1P3CA 2Z9JA 2A0QB 3K6YA 1PQ5A 1O5EH 2AH4X 1XXFA 2CHAB 2FP7B 3P17H 1WYKA 1Y3XA 3IG6B 1LHEH 2AGIX 2VWMA 1O3MA 2WPMS 2F9VA 1MH0A 1Z8IB 2BD4A 2DUCA 4XRNA 2AMQA 3ATWA 3BG8A 2SGPE 4U30A 2BLQA 2HNTF 5CMXH 1A0LA 4ZHLU 1O3OA 3D62A 3P6ZB 2J38A 2VIOA 3QZQA 2BOHB 3M3TA 1N8OB 1SPJA 3CP7A 3KQBA 5J4QA 3TGIE 2VVVA 4BAKB 1SR5C 4K1EA 2ZGJA 4ISIH 4ZKSU 4FU9A 4OGYA 4D7GA 4IMZA 4BANB 5C1UA 5BPEA 1A7SA 1NZQH 3F0PA 1CT0E 1F5KU 1ESTA 4BAMB 5KGOA 5DN6D 2J34A 3LGTA 3SU6A 4CH8B 4AFZA 8LPRA 5A09A 1YY3A 1H9HE 3VB6A 3O8DA 5L6NH 4JCNA 1EAXA 2ANYA 4A1XA 1YLCA 2J97A 3GY5A 3ZZBA 4CBOA 1GJ4H 1D3QB 1VJAU 1UVOA 1SLWB 3RXEA 3A8AA 2FYRA 1V6DA 3M5LA 4ZUHA 3RDZA 1MKXH 1YPHE 3MOCA 2M2AA 1MMJN 2ZFRH 4JK5A 2F9BH 3KF2A 5DO4H 3MO9A 1GHWH 2SGFE 2JDID 1T8OA 1GJDB 1Z8RA 1ZGIA 3M36A 2CMYA 1ZMJA 3PLPA 1AIXH 1FI8A 3LH1A 2HVXA 1BZXE 2EC9H 3A7YA 4LXBH 2A5KA 1GDNA 2PV9B 1W10U 4UFGH 4NA7A 5EODA 4AYYB 3MH4A 3F9EA 6CHAC 4P02A 1P10A 2Y5FA 2BQ6B 1W0YH 3TH3H 5C2ZA 1P2QA 2BX3A 2BXUH 3V3MA 1NPMA 1UVSH 3BTME 5AHGH 1EATA 3TH4H 2GCHG 5C17A 4AFQA 2VNTA 7GCHF 1ANEA 4NCYA 4X2YA 1O2GH 1SG8B 3F1SB 2BZAA 5JB9S 4I8GA 5C3NA 3ATLA 1C1RA 1BTHH 4CRGA 1O2NA 1BHXF 2IN2A 1PPEE 5IYTA 3KQDA 1OSSA 1T8LA 4CR5A 1DSTA 2AHME 1BQYA 2PHBA 2BVXH 1SGDE 2P94A 2QC2A 2F83A 1YWUA 1QURH 5BRRE 1O30A 2WV4A 3QGNB 2FOAA 1KLIH 2UWOA 1NRSH 4BAHB 4ZROA 1F92A 1TGCA 4B1TA 1O0DH 3U69H 3BG4B 2P93A 2G00A 1E38B 3RXTA 5C1YA 2QV1A 1BTZA 3A7XA 3ZZ6A 3MMGA 1SHYA 4HGCA 3SZEA 6CHAB 2GGVB 1GHAG 1WSSH 2H5DA 1AFQB 1D6WA 2M5TA 3A7ZA 3L6PA 3HGNA 4BNRA 5L30H 1TNKA 2H6MA 4UFEH 4MPUA 4ZHAA 1OKXA 2F9OA 1YPGH 1ZMLA 1TGBA 3SO3A 2OC7A 5EU8A 2G81E 4D7FA 5C1XA 2ZA5A 4DIHH 1F0SA 3GCTF 5AVDA 3KQEA 4YOIA 1V3XA 1TQ0B 2GP9B 4Z6AH 2FZZA 1KXEA 1O3AA 2KFWA 2Y6TA 2AYWA 4YXWD 3RXJA 1P02A 5LPRA 4Q4LA 1O36A 3DSPA 3KGPA 1HUTH 4CRCA 1TFXA 3CENA 1O2XA 2YMSC 4MNWA 3OU0A 1AUJA 3TH2H 3RMMH 1FN8A 1KDQB 2A2XH 3O8RA 1C1QA 1C9TA 1SMFE 1FY4A 1VR1H 4H6SB 1K21H 2ZDNA 1GHBF 1H8IH 3MNBA 3TJUA 1TX7A 2ZFFH 1AKSA 1NFXA 4GCHF 3V12A 1GCTC 2P3TB 1HAGE 3SBKA 2D2DA 2Z7FE 1TPOA 1L4ZA 3SGAE 1YCPH 4NA8A 1SFIA 2GCTC 3GYMA 3D65E 1B5GH 3DFLA 3RXIA 1MZAA 4ASHA 4Y8YA 1GWAA 5E0GA 5C5NA 2BM2A 2VIDA 5EOKA 2D8WA 3UY9A 2QF0A 3F3BA 5C20A 1TRMA 2PP6A 3Q3KA 3SU0A 3WY8A 4A1VA 3R3GB 5GPIB 3QLPH 3PWCA 2G5VA 3PYHA 2RDEA 1AFEH 3VPKA 2OQ5A 5FCKA 1V2ST 3NKKA 1SGIB 3E0PB 4E06H 1C5WB 5LPFA 4YOJA 1O3PB 1FLEE 2W5EA 3M5MA 3PRDA 3BTFE 1OWKA 2KM0A 5JB8S 1SLUB 4H42U 1C2FA 1COWD 3DSGA 2FOFA 1YLNA 3MNXA 4X1NU 3ZVFA 1VITG 4BTTB 3GY2A 1UK2A 3CNRA 1GJ6A 1WAYB 3TNTA 1E37B 5HXFA 1CGJE 1EJNA 1AN1E 4XBCA 3S0NA 3H5CB 2WUBA 3QDZB 3FZZA 4B6EA 3E3TA 2O8TA 1EAIA 4A5TS 2I6QA 3MFJA 2OBOA 4E7RG 2BVSH 3ITIA 2ZFTA 1IQMA 4Z1MD 1F0RA 4ZKRU 3RUOA 1BJVA 4KTSA 1HCGA 2QE7D 5CDFE 1L0ZA 1C5RA 1LHDH 2Z9GA 1SB1H 5KEDA 1DWBH 4B74A 1F5RA 1D9IA 1VJ9U 1AWHB 1TMTH 4ZKNU 3UR9A 1WQVH 1ORFA 4ZXYH 3UOUA 1EQ9A 4ABFA 2JH5D 1ETSH 1THSH 1NRNH 3RXKA 5HGGA 3RXUA 1F0TA 4VGCC 1XUHA 2C90B 3UQVA 4LZ4B 2W6JD 5CHAC 3SU2A 3UWIA 1O2KA 2EQNA 1OS8A 3LU9B 4JZ1A 3UAIC 1SGCA 3UB0A 1A3BH 1C5YB 1P3EA 1EB1H 4FUFA 1S83A 1OWJA 4AZ2B 4OM9A 2Z3EA 5ABWA 2EI7A 2AFQB 1JIRA 5T6GA 1V2TT 1E34B 2GDDA 1AB9C 4DG4A 4NIVA 4I32A 1WOFA 3SV8A 1FY1A 3F2FA 4X6PA 4WWYA 4ESTE 3EA7A 1BTWA 1U6QA 2B8OH 1LCYA 4JZDH 1GGDC 5TCCA 1AUTC 1THRH 4RSPA 4Y7BA 3T5FH 5C0TA 1PPGE 2A7CA 1ZHMA 1LHFH 2P16A 2B9LA 4X2WA 2KCOA 4I86A 4KP0A 1FN6A 2O8WA 4HG6A 2BQWB 1JIMA 2W7SA 2VGCC 1SFQB 2GZ9A 1ZPCA 4J1YA 1GG6B 1ANCA 5EPNA 2GDEH 4M7GA 1EPTA 2C93B 1OYQA 3ELAH 1ZLRA 2Q6DA 3NUMA 3KIDU 3UPEA 3SI3H 2ESTE 5AFYH 1NO9H 3A8BA 3LH3A 1OP8A 1YPEH 2PUQH 1YCPK 2HNTC 5DP5A 3S7HB 2BY5X 2HRVA 2XNIA 5A0AE 9ESTA 3FO8D 4XBDA 3DSOA 2AIQA 2PKSC 1TA2A 1FJSA 1GHBG 2Y81A 5EQQA 4ISNA 3GDSA 2Z6BD 1LVBA 2ZNKH 4GCHG 2P3FH 3AAVA 1NM6A 2R0LA 4Q7XA 1ZR0A 2J95A 2FI4E 2XXLA 2ZC9H 2UUFB 1QJ1B 1EB2A 3E91A 5PTPA 3O8CA 4Q63A 2ZGBH 3SNDA 3QUMP 1C1OA 2VIVA 1RRKA 3M61U 1HAVA 4U2WA 4ZMAH 3IWMA 1XUIA 4FXGH 1ABJH 4TSFD 4U01A 1TPAE 2VGCB 2W6ID 2FTLE 1Y3UA 1N6XA 2J98B 3RXRA 4OGXA 1GI6A 1O3KA 2ZHFH 2Z9IA 1GMHG 1ZJDA 1ELEE 1GG6C 1SHHB 4OS6A 4B73A 3FANA 4UEHH 1C1UH 4RI0A 2BY6X 2ZP0H 2ZPQA 4P00A 2YMSD 1A5GH 2BVRH 2G52A 4Y0YE 4YTAA 5L2YH 2V3HH 1LTOA 3MU0A 1BMFD 3AW0A 3NWUA 4UFFH 1K9OE 1GBIA 3SJ9A 2HWLB 2HLCA 5HIZA 1QB1A 2L74A 3MYWA 2BDBA 7KMEH 3P92A 3W1EA 3OX7U 3M37A 1TYNA 1A0HB 1GBTA 1H8HD 1LDTT 2A4OA 4QT8C 1TONA 2DE9A 3KHVA 1EZQA 1VITF 1ELAA 3ZVGA 2GZ8A 2BTCE 3GDVA 1GBBA 1GBAA 1TNGA 5HM2A 1UTKA 3A82A 1LVMA 5EW2H 2K8IA 5G4BA 5AF9H 4TPYA 6ESTA 2Q1JA 3U8OH 4DVAU 2PSYA 2BB4A 3MHWU 4TPIZ 1UCYE 1HFDA 2YNBA 1LKBA 2WSSD 4DURA 4YO9A 1BMMH 4INHA 1BTYA 2K1QA 2FMJA 2ZGXH 1S6LA 4ZAEA 3M3VA 1A5IA 3SNAA 1GL0E 1DLKB 3OYPA 2GV7A 2Y7XA 1Q31A 1BIOA 1C1SA 1QFKH 1N1LA 1O31A 1GI3A 1GMCG 3UTUH 1QQ4A 3GS9A 4ISHH 1DPOA 5FPTA 3ZZ9A 5B6LA 4RKOB 4F55A 1MQ6A 1V2UT 1D3PB 4K8YA 5I25A 1DSUA 4YLQH 1O32A 2O8MA 3E8LA 1UCYK 2ANMH 2WPIS 3E1XB 3TVJB 2ZFQH 1DICA 3PO1C 2ZCLP 1UO6A 2ZEBA 3MO6A 1TA6A 3UUZA 1AU8A 4NFFA 5FX6A 3RXSA 4ZXXH 2BD9A 2ZDVH 2NU2E 4CRFA 3U98H 2CF8H 3B23B 3P8FA 1N8OC 3SHAH 1UMAH 1CHGA 1ZRBA 4KKDA 2ZTYA 2XOKD 4FUGA 1ZSJA 4A1TA 3TLOA 3PV2A 3RC6A 2JH6D 1TBQH 4Y7AA 5F8XA 1GJ7B 1E1RD 4OS4A 1FV9A 4A92A 5A2MH 2OP9A 2UUJB 1MKWK 3M35A 2TIOA 1TOMH 3CS0A 3LGWA 1TLDA 1E0FD 1GI7B 4GPGA 4B6FA 1WBGB 1SVPA 4Q7YA 4AG1A 2VIQA 2QYIA 1VZQH 1C5MD 3SN8A 2ZG0H 5A8XA 1RS0A 2F9NA 3ZZDA 1O2PA 1T4VH 5IDKA 3AVZA 1O3DA 4INKA 1OPHB 3GCNA 1P57B 2FI3E 3GY7A 1W13U 1C5QA 3FP7E 4MLFB 1SGFA 2FOHA 1K1NA 3A85A 4GUXA 1LO6A 1S6FA 1RTLA 2NWNA 3M7UA 3MU5A 1Y5AT 1HAXB 4Q2KA 4BAQB 3W94A 2WPDD 1O2OA 2F9PA 1O3HA 3RC5A 1PPZA 5EW1H 1HAZB 2F3CE 2P95A 4U32A 3NCLA 1SQOA 1NT1A 2PW8H 2RCEA 2LELA 1SOZA 2PR3A 1DOJA 3A8CA 1TNHA 3K9XB 2K0QA 4X8UH 1Y8TA 1EUFA 3URDA 1O35A 3UNQA 3E0NB 2P3UB 5DSFA 1K1JA 4UD9H 2FXRA 4NIYA 3STJA 2QF5A 3MNCA 4AOQA 2ZHQH 4INLA 3TIUA 1Y3YA 2VVCA 1AQ7A 2ZU1A 1MZDA 2STBE 4DY7B 2QXIA 4I33A 2PKAA 1C2MA 3U8RH 1KLTA 4F49A 2WZQA 2VWNA 2BDAA 4DOQA 4O3UA 1EZSC 1Q3XA 2XWBI 2R9PA 5JBAS 1W3CA 5F6MA 1ABIH 1FNIA 3QO6A 3C1KA 3V7TA 1E35B 1KTSB 2XNDD 1O2YA 4WH8A 1SQAA 1XKAC 2KR7A 4Y0ZE 4K60A 3A84A 3S9CA 2RA3A 3ZZCA 1RTFB 1YCPM 3SZNA 4IC6A 2WYJA 4JZFH 4YZUA 1YKTA 3SJOA 3F9HA 2P59A 1HB0B 1O2LA 1CA0C 1J8AA 1AY6H 4CHAB 1P9SA 1DANH 1SGRE 1O2TA 1VCWA 2JH0D 2ZGHA 1RIWC 1X7AC 3UNRA 1TGNA 5IK2D 1O2HA 2RG3A 3A89A 3LGIA 4NG9H 2ZECA 2TGTA 2W26A 4MQAA 3SQEE 5JPMH 4GLYA 3TK9A 1OYTH 1F2SE 2J2UA 1DY8A 1V2VT 2O8UA 1C4U2 3BTEE 1XMNB 5DG6A 1K1IA 1Z7KA 3PM3A 1V2JT 1QCPA 2FIRH 1W7XH 5E8EH 2EA3A 3RMNH 5EPYA 3QK1A 2IPQX 5LH8A 1OWEA 3KN2A 3BEUA 1SI5H 2A7JA 3EDXB 3M5NA 1G32B 4DIIH 1CE5A 1GJ5H 3BTTE 1FUJA 5FPSA 3KL6A 3EE7A 1ELBA 3NRLA 4K1TA 2A4GA 1L1NA 3GY8A 3LGYA 1D3TB 1JXPA 2TBSA 1HIAB 3LGVA 1GBDA 1UVPA 1ESBA 1H9IE 4FUHA 2A7HA 4OS1A 1UJ1A 1H8ED 2TGPZ 2STAE 4Y8XA 4A6LA 3OAAD 4Y11E 2BMGB 4NSYA 1J14A 4GHTA 1O37A 1G3EA 1W7GH 3SNBA 1GL1A 1B0FA 1YPLH 3K6ZA 1SGYE 3FP8E 2FWWA 4WMEA 1C2IA 2ZO3H 1UTQA 3OE7D 5JDUB 1KSNA 3EA8A 2PGQB 1BRUP 1O5BB 1EZXC 3PMBB 3W95A 3SJKA 2VJ1A 2EI6A 1GJ8B 3DUXH 1GI4A 1Y3WA 2AMDA 2Y5HA 1YP9A 3OTPA 2QXJA 4B2AA 2NU3E 1ANDA 1O2WA 3FZDA 1QBNA 3BV9B 4AGKA 1EAUA 2ZIQH 1PQAA 1EPTB 1K1OA 2GKVE 4X8VH 1NESE 2DE8A 3SNEA 1BITA 1BDAA 3NXPA 1OX1A 3ZZ8A 5J4SA 1GMCF 3RXPA 4ABGA 1TMBH 1DUEA 2QXHA 3NZIA 3ZZ5A 5EIYA 1GCDA 1XKBC 3M5OA 5T1VA 1A61H 2FLBH 4D9RA 5C94A 1CU1A 2AERH
chains in the Genus database with same CATH topology
2GMTC 2G4TA 2ZDAH 2SGEE 3SUGA 1AFQC 2TRMA 4UFDH 1ZPZA 2SGAA 3MWIU 1MAXA 2BDCA 4R8TB 5DKMA 4YT7H 1S6HA 3JZ2B 3P8NA 1DS2E 1C2LA 1LPKB 3V0XA 1CHOF 5FXLA 4BOHA 2C8ZB 1W11U 4B71A 5DP7A 4CRDA 1C5LH 1GHXH 2BD3A 1KLJH 2FLRH 1DT2A 3HK3B 2FYQA 1V2KT 1GJCB 1C2HA 3ATMA 1NRQH 2Y80A 3A7WA 4O97A 1EPTC 3HPTB 1DM4B 2BDHA 1A1RA 1JRTA 1ZHRA 1BA8B 1QR3E 2FPZA 5GCHF 3SU4A 3SV7A 3SV6A 5ESTE 2Z94A 1WU1A 1AD8H 4NIXA 2XCNA 3ZVEA 1NTPA 1PYTC 1W14U 3RLWH 1W12U 1P2JA 3TPIZ 4TY7A 2GCHF 2ALVA 3MH7A 7GCHG 3BSQA 3TJVA 3QWCH 3LIWA 3SJ8A 2R2MB 2JKHA 1AI8H 3LOXA 1BMAA 4AG2A 5C5OA 5EXLA 2R3UA 1EX3A 2CJIA 4IC5A 1O5DH 1TGTA 2XBXA 3E90B 1WCZA 1ZOMA 5T6FA 1RFNA 1D4PB 1ID5H 1B0EA 1K2I1 2YOLA 2O9QA 2G51A 1ZYOA 2ANKH 4CRBA 4IW4E 1AZ8A 2QCYA 4FUCA 1PFXC 1Y59T 4X6OA 1NRPH 1C4V2 1F5LA 1FONA 1C5VA 1TRYA 2ZHWH 2GVFA 1BTPA 1ELTA 1UTNA 1TPSA 2HGTH 1A3EH 1H1BA 3HKJB 1OWDA 3PTNA 4FUEA 3T26A 2ZU5A 3BTKE 4ISOA 1H8DH 2P8OB 1P05A 3UIRA 2ZGCA 4K69A 2NU1E 4O3TA 4JZIA 1TX8A 1K22H 1HAVB 1O2IA 1HDTH 1QQUA 4MTBA 3G01A 1RIWB 1GBLA 1P11E 1HAHH 3R0FA 4ZHMU 1GBEA 1C1PA 2A31A 2GT8A 3LKWA 2WPHS 3SU3A 3BEIB 1FAXA 3L3TA 1CVWH 1G3CA 1SQTA 1MTVA 2A45B 3RMOH 1SGFG 4X8TH 5E2PA 4RN6A 2FESH 3DHKH 1TX6A 4DCDA 3JZ1B 1C2EA 1AVWA 3O8BA 2EEKA 2I6SA 2G4UA 1LHGH 2ZCKP 3RXFA 2WINI 1QB9A 3RXBA 5JBCS 1V2OT 1G36A 4Y76A 4X2XA 4AYVB 4GVUA 2UUKB 1AE5A 4ABDA 2PSXA 4X1QU 1XVOA 3BG4C 1IQIA 1CT2E 5EXMA 4DGJA 2ZFPH 2H9EH 3ZVAA 4KGAA 1RD3B 2BOKA 4NSVA 1JBUH 1NRRH 3L33A 2A5AA 3TITA 2Y5GA 3F68H 1IQJA 1J17T 2OLGA 5FAHA 4WJG2 2ZWLH 1UTPA 2OC1A 1PJPA 1PPBH 4RKJB 1EXFA 2QF3A 2R0KA 2ZDKA 4F4OC 2ZDMA 1MBQA 2FOBA 1MBMA 5DK1A 1RXPA 2GD4B 4AFUA 1ZTJA 3RM0H 5A0CA 3PMJA 3T28A 2ODQA 1Z8JB 2ZPSA 3BTDE 1Z8GA 8ESTE 3A87A 3GY6A 5DPAA 2PTCE 1QHRB 1UVTH 4UE7H 2A32A 1Y3VA 2OC8A 5A0BA 1HAYB 3EQ0H 1C5SA 2J9NA 2AMPA 2PGBB 1SGEE 4D8NA 1C5NH 3RMLH 1XUKA 3BF6H 4IGDA 1O3NA 4KTUA 3AASA 1GI1A 2ILNA 3GICB 1C1VH 4I8LA 1GJ9B 2GMTB 5DP6A 1CGIE 3VEQB 7LPRA 1CBWC 1G3BA 4WXVA 1C1MA 5EQRA 4FUDA 2G8TA 3ZV9A 6GCHF 4X2VA 3LT3A 4JYVH 4LZ1H 3PO1B 2OC0A 1THPB 1ZZZA 2ANWA 2BD5A 1GI5A 4K3JA 4CHAC 1Z6JH 3V13A 4FUIA 2NU0E 1K1PA 4UONA 2H9HA 4B75A 1QRWA 1IQFA 1HLTH 2OD3B 1V2LT 4THNH 1QGFA 3AW1A 2IJOB 1O2QA 4X1PU 4X1RU 1VCQA 4ABBA 3SJIA 1KIGH 1KXAA 5T6DA 3UNSA 3U1JB 4BAOB 2WPJS 2QGRA 4X6MA 5TJXA 1HXEH 5ESBA 3MTYA 1P2NA 2B5TB 1WQSA 4NZLA 1ARBA 2VWLA 2CN0H 3ZZ3A 4O9VA 1XUJA 1H9LB 3TGJE 1UTLM 1FQ3A 1UVUH 2TGDA 2NU4E 4B76A 1CBWB 3ZVBA 1GMHF 2BY8X 3Q3YA 1GBJA 1TALA 3ATKA 4LK4A 3HGPA 3MI4A 1EJAA 3RC4A 1EOLA 3EBNA 1CHOG 5FBEA 3LONA 3VGCC 1HV7A 1A2CH 1MUEB 1JWTA 3RXHA 2BD7A 3HK6B 1ZGVA 2OINA 2CXVA 4ABIA 2LPRA 4BTIB 2IPHA 1QTFA 1A0JA 1O3LA 3T27A 1MTWA 4GAWA 1Z6EA 1IAUA 3TJNA 5CHAB 3GCOA 3ZV8A 1C2DA 1FXYA 1T32A 3FVFB 2SFAA 2XC5A 4YLUA 2P8OC 3QN7A 5DP4A 1O3IA 1BBRE 4GHQA 1MTSA 2IOTA 4XFQA 4TY6A 2HPQH 1YPMH 1UTJA 2FOMB 1IQHA 4WXIA 1MTUA 2XW9A 1MKWH 1KXBA 2ZDLA 1P2IA 3HATH 1MU8B 3RXOA 4AN7A 3UWJH 5F8TA 3S9BA 1YC0A 4UDWH 1GVLA 1NY22 4NFEA 2R3YA 3MH6A 5B6OA 2QIQA 1BOQA 3UR6A 1PPCE 1TABE 1P04A 1O5GH 4Y71A 5A8YA 2AIPA 5K7RA 4YESB 1INCA 2GX4A 5HM9A 4ABJA 1HBTH 2Y7ZA 4HI3A 1IHSH 4AB8A 3U1IB 4O03A 3SOSA 1O2RA 1YM0A 2OQUA 2SGQE 1GBHA 1S84A 1IOEA 2FOEA 1P9UA 3Q76A 3TU7H 1NFYA 1T31A 1NU7B 4CBNA 1G2MA 1C1WH 1B7XB 3T25A 1TIOA 1P06A 2FS8A 1SLXB 3S7KB 1HAIH 1P2OA 2ZU4A 2ZHEH 1P0SH 1S85A 2FOGA 1HRTH 2BLOA 2UWPA 2XC4A 3RXDA 2OUAA 1UCYH 1MD7A 5GXPA 4Y79A 4R0IA 5AFZH 4FVDA 5JBTA 1AVGH 3SUFA 3TGKE 1BB0B 3GY4A 1QIXB 2BY9X 2FI5E 1GHYH 2THFB 3Q00A 1XX9A 5E0JA 1FAKH 3K65B 3MO3A 1O2SA 1BCUH 4YT6H 4CRAA 3D23A 1O3JA 2BY7X 2PWXA 4AFSA 3BTGE 2JETB 4B2CA 3DT0H 3A7VA 2C4FH 4J2YB 3BTWE 3CS7A 4MG3A 4KTCA 2FDAA 3SU5A 4MPWA 2WUCA 1EP6A 1O34A 2WPLS 1ELDE 3LGUA 5FX5A 1E36B 2Y82A 1Y5BT 3VB7A 1A5HA 1BRBE 1O2MA 5H4IB 2D1JA 5FHTA 5JYIA 4JZEH 4CH2B 4MPVA 5A8ZA 1C5ZB 1P12E 5E0HA 2BXTH 1SC8U 2BQ7B 2BX4A 2V35A 8GCHG 3PROA 1S0RA 1CGHA 1NC6A 1BBRH 5GWZA 2VH0A 5HMAA 1MQ5A 4MNXA 5EGMA 1FMGA 4WMDA 1AB9B 2WPKS 5FBIA 2FO9A 4E05H 1C5XB 1GCTB 1RGQA 2UWLA 1G30B 1DWEH 2BZ6H 3SQHE 3I29A 1HJ9A 3HKIB 1V2NT 1DITH 1W8BH 1TGSZ 3M7QA 4HTCH 1SGQE 4JYUH 2D26C 2W3KA 2OTVA 4Y8ZA 1QJ6B 2C3SA 3GOVB 4BXSA 1NS3A 2QN5T 1C5UA 3LC5A 1PPFE 1MD8A 2H9TH 1ETTH 1L4DA 2G55A 1G9IE 1KDQA 3UQOA 2XWAA 1DWDH 4K8BA 4MVNA 3FFGA 2BDYA 1OP2A 5C67A 1IHTH 3FAOA 3SU1A 1OOKB 4AX9H 3A83A 1H4WA 1MU6B 2ZCHP 4Q7ZA 4AORA 1SGPE 2GV6A 1O2UA 1ZHPA 1CA0B 3QX5H 1TNLA 2AGEX 1AWFH 3VGCB 2K7XA 4MPXA 3EA9A 1LMWB 5GJ4B 1QL7A 1UK4A 1ZPBA 1D3DB 1ETRH 3ZVDA 2AGGX 3T62A 1TOCB 1KXFA 1V2PT 3H7OA 5LGOA 2XBWA 3RU4T 3UREA 1NFWA 1WTGH 2CHAC 5DP9A 3GCHB 2QXGA 2B0FA 4Q80A 3DA9B 2PTNA 3Q77A 1S82A 5JBBS 4WY3A 1HNEE 3K2UA 1Q2WA 2J94A 3TJOA 4OS7A 5CE1A 2GZ7A 1GHVH 3EE0B 1EKBB 4DW2U 5I46H 1GVKB 1GHAF 7ESTE 1ZJKA 1P2KA 4BTUB 1A4WH 4D76A 1YF4A 1S5SA 3RXLA 3TNSA 3NK8A 3SGQE 1AO5A 4XE4A 2ALPA 2V0BA 3F6UH 1YPHC 4SGAE 2V6NA 2HALA 1HJAC 3I77A 4ZKOU 1GDUA 4AB9A 1O5CB 3ZZAA 1FY3A 1MCVA 3GCTG 1G3DA 1CA8B 3RXQA 1G37A 1DE7H 1CT4E 4X1SU 1O33A 5GDSH 1UTMA 2A1DB 1TBZH 1O2VA 2HPPH 2Q6GA 5FCRA 1C5TA 1W2KH 2H1UA 3ATIA 4TYDA 2BDGA 3P95A 3ODDA 1RTKA 3KNXA 2VINA 3BIUH 4H4FA 4Z0KA 4YOGA 3QGJA 4WF8A 8KME2 6LPRA 1IQGA 2FM2A 2SNWA 1YYY1 1GI9B 1QA7A 1GHZA 2G5NA 3C27B 3VB3A 3UOPA 1TQ7B 1GBKA 3SI4H 3RM2H 2GCTB 1O3GA 1ZSKA 3MU8A 5T3HA 1TB6H 1D6RA 4DJZB 1SSXA 4E7NA 4MNYA 5EXNA 1PQ8A 1K1LA 1LPGB 1MAYA 2PFEA 2RDLA 2F9UA 3VXEH 1XVMA 1FDPA 2ZTXA 2ZZUH 3LDXH 5F8ZA 2ODPA 3S69A 1DVAH 8GCHF 1L1GA 3MH5A 4YM9A 1GMDF 2A2QH 1CO7E 1XUFA 2PKSB 1BTUA 5EQSA 2ZHDA 5DP3A 5EG4A 1MCTA 4FVBA 1YPKH 1O3BA 1QY6A 1ZMNA 1FPCH 2ZFSA 3VB4A 1HXFH 2W3IA 2FEQH 2BLWA 4IBLH 3H7TA 3EAJA 5E2OA 1Z1JA 1BT7A 3VB5A 3LJJA 4NWLA 1HAOH 4CREA 1CSOE 1DXWA 2KAIB 1QJ7B 2HNTE 5GCHG 1MTNC 2ODYB 2ZTZA 1BTXA 3RU4E 1UHBA 1FIZA 1C5OH 1K1MA 4I31A 1ELGA 1HPGA 2EI8A 4HFPB 1DLEA 1Z71A 4KELA 2R2WU 4JMYA 4FU7A 3SHCH 2XBVA 1C5PA 3SW2B 5L2ZH 3GYLB 1BUIA 3BEFB 3DFJA 4HZHA 2XCFA 5GIBA 2YNAA 1TPPA 2VIWA 3A8DA 4FUBA 3RXGA 3MNSA 2LNCA 3PV4A 3SV9A 1UK3A 4Y10E 1HGTH 4OS5A 3U8TH 1BRCE 3RU4D 2J92A 4PROA 2ZPRA 1PPHE 4NA9H 2KAIA 1ELFA 1XM1A 1VCPA 2F91A 3ODFA 1N6YA 4XSKU 1ACBE 3S9AA 3MU4A 4ISLA 3F9FA 1VITH 4ABAA 1EAWA 3KEEA 4D9QA 3UFAA 3ZYEA 3IITA 3RXAA 2VB0A 1AVXA 1WTHD 1MTNB 3ENSB 3B9FH 1LQDB 1ELVA 3P8GA 4MNVA 1XUGA 1T8MA 4LOYH 4AGJA 1V2QT 1YLDA 4X6NA 1KXCA 1DFPA 1DY9A 4B2BA 1OP0A 1W0ZU 1QB6A 2ZI2H 1SGTA 1BBRK 1P09A 1SLVB 4JYTA 1P8VC 2A5IA 1C4Y2 1AGJA 2QAAA 2A4QA 2ZQ2A 2B7DH 3U9AH 1ZTLA 2XC0A 3SNCA 1GJAB 1QL9A 1KTTB 4NGAH 1P2MA 4BXWA 2QY0B 4ABHA 3BIVH 1XXDA 1QRXA 3TK6A 1GI8B 2OXSA 4TWYA 1DWCH 3RLYH 4NIWA 4FU8A 3Q3XA 2AS9A 2JETC 3KCGH 4IN2A 1BJUA 1GBCA 1S0QA 2GTBA 3B8JA 3PWBA 2TPIZ 3URCA 3OY6U 1SGNE 2CGAA 4XDEA 3GY3A 1PQ7A 1HJAB 2VWOA 1G2LA 1TNJA 5HYOA 1Z1IA 1GPZA 3EGKH 1ZTKA 5DJ7A 3PLKA 4I8JA 1YPJH 1KYNA 4IN1A 2H2ZA 1LHCH 1L2EA 2BD8A 4WVPE 4ZH8A 1JMOH 4X0WU 3N7OA 3ZVCA 3M7TA 2FODA 3PMHB 2ZU2A 1T8NA 1TRNA 2SGDE 3QTVH 1GDQA 2BD2A 2ASUB 1MKXK 3A88A 3EYDA 3LJOA 2VVUA 1QNJA 1V2MT 2BDIA 2VU8E 2J4IA 1HAPH 2VIPA 1SBWA 1IQKA 2CV3A 3ZYDA 1OXGA 1PYTD 2V3OH 2C8YB 3PLBA 1O3CA 1BMLA 1BHXB 4IS5A 1F7ZA 1AHTH 2WV5A 1K28D 1VGCB 2Z3DA 3BN9A 1AE8H 4I8HA 1T4UH 1NROH 3STIA 3ZZ4A 4WMFA 1FZZA 2H5CA 1NU9A 4FUJA 2Z9LA 1EASA 2C8WB 1ANBA 1ELCA 1J9CH 1C2GA 1GBMA 1JOUB 3SGBE 3F9GA 3RXMA 2FX6A 1HJ8A 1C1TA 6GCHG 1NFUA 1ZSLA 1DXPA 4NZQA 1J16A 1UHBB 1IQLA 2PUXB 2RA0A 1TNIA 1BMNH 2BHGA 3M3SA 3I78A 3E16B 2A4RA 3AAUA 3PB1E 3PTBA 2ZKSA 2FTMA 1FIWA 1EOJA 1O38A 4OS2A 1DX5M 1CQQA 3GCHC 2SNVA 1QRZA 3D49H 3P8OA 3T29A 2QA9E 1P03A 3QTOH 4I7YH 5DGJA 1M9UA 1VGCC 4TWWA 1O5FH 1P01A 1QBOA 1QBVH 4WH6A 1EP5A 1T7CA 2ZF0H 4CR9A 2XRCA 2LIZA 1TE0A 3A81A 3VFEA 1FPHH 1GMDG 1O3FA 3OY5U 5LPEA 2FS9A 3ESTA 1GJBB 1TMUH 2UUYA 1L1JA 2XTTB 1QL8A 1ZRKA 2O8LA 5ETXA 2BYAX 1GI2A 5FPYA 2AEIH 3SUDA 1C2KA 2CF9H 4DT7B 1S81A 1TBRH 3DD2H 1C9PA 3E6PH