1P9UA

Coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords putative coronavirus nsp2 (3CL-PRO)
publication title Coronavirus Main Proteinase (3CLpro) Structure: Basis for Design of anti-SARS Drugs
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
total genus 83
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1p9uA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p9uA01
1F0UA 1GBFA 2A2XH 4JCNA 9ESTA 1MMJN 1YPHC 4BAMB 1IQLA 1G3DA 3ATWA 1OWEA 1QIXB 1ZSLA 4R8TB 1GVKB 3MU1A 3RXMA 3TK6A 3GISB 1O3CA 3MU8A 3TPIZ 3MWIU 1TRNA 2WYGA 1SGDE 4H4FA 1W3CA 1O36A 3SUDA 1ZTJA 1SGEE 5T6FA 1FPHH 1IAUA 1GBBA 1MKXK 4I8JA 1TMBH 4JZFH 3O8BA 1YPKH 3A8BA 3P70B 1GBHA 2VIOA 4YOGA 4Q80A 4B73A 1MBMA 3SJOA 3UFAA 2F91A 2G52A 3TJUA 2XBXA 2J2UA 3S0NA 2A5KA 4ABFA 4K3JA 3GY4A 3NK8A 5C1XA 3PYHA 1AB9B 2D26C 1W0YH 2ANMH 3P8FA 4UONA 4D76A 2QGRA 2ODQA 1GJ8B 3P17H 1O30A 2G55A 4X0WU 2Z9JA 1BTUA 3M3TA 1SLVB 1TAWA 2VGCB 1NRPH 3PLBA 1IQEA 3ZYDA 4Y79A 3D65E 1MQ5A 4NA7A 2ANWA 4K1SA 3ENSB 3MNBA 4BXWA 1NESE 2A32A 1O2HA 2VH6A 5H4IB 1C5VA 3GYMA 2J95A 4M7GA 2OBQA 5LPRA 5GJ4B 1C9TA 3MO3A 2B7DH 3GCHC 1AQ7A 1CBWB 4ISLA 4GLYA 1YYY1 1GGDB 1DS2E 3I29A 3PROA 1E34B 2G51A 1U6QA 3A86A 4JMYA 5EPNA 2J94A 3GCNA 3QK1A 4D8NA 3M7UA 1A4WH 2FS8A 4FUCA 3KGPA 4IN1A 1J8AA 1UHBA 1ZYOA 1W13U 3F68H 4BANB 1FN8A 3A7XA 1Z1JA 1GJ5H 1ELEE 3QZRA 1FJSA 3UWJH 7GCHF 1ELCA 1EXFA 3GY5A 1ZMLA 3NKKA 2BHGA 4TWWA 2J4IA 2PFEA 1Z71A 3V13A 2Y6TA 4J1YA 2HPQH 2BDBA 4SGAE 4XBDA 1AU8A 1T31A 2ZCHP 1LTOA 1AKSB 5C2ZA 5DG6A 4Y7BA 3SU3A 1DT2A 1TX6A 3SU4A 1A3BH 2PKSC 1O3EA 4Y11E 3SV2H 3UOUA 3ZYEA 1G2MA 2VVVA 5F6MA 4ZAEA 4J2YB 2CN0H 1PPCE 3B8JA 3U1IB 4WMFA 3MNSA 1O2WA 2NU2E 1L1GA 3S9AA 3RXKA 1HAGE 3GY6A 3SQHE 3F9EA 2B8OH 4O97A 1QURH 3RMLH 2CMYA 5JBTA 4NWLA 4WMEA 1RTKA 2H9EH 3A84A 1O3LA 5FCRA 2V6NA 4I31A 3U9AH 1UVTH 2OC0A 2OUAA 3RXQA 1O2LA 2A7HA 1AN1E 1FZZA 2W7UA 4FU7A 1JOUB 4GCHG 3V3MA 3SU6A 1GBEA 3TJVA 3TNSA 3Q00A 3KQCA 1OXGA 4B76A 1O2KA 2BOHB 4K5ZA 1T32A 4CRDA 5LPFA 3A8DA 3KQDA 1SR5C 1W14U 1OWKA 4FU8A 1UK4A 2LNCA 1D3DB 3M37A 2W26A 3ODFA 2ASUB 3HGNA 3R0FA 1C2JA 4E06H 1DLKB 1UO6A 1BBRK 2FLRH 3RUOA 3GCOA 3SORA 2BZAA 4IC6A 5FPYA 5ABWA 1HJAC 1RTLA 1KIGH 2F9OA 1C1NA 4UFDH 2QXGA 2VNTA 3ZV9A 3RXTA 1DM4B 2QV1A 1Y5AT 4OS6A 1AVWA 1ZTKA 1X7AC 1QB9A 3ZZ8A 2UUKB 4MNWA 5EODA 3I78A 1GHXH 1Q3XA 2G00A 1Z8JB 2BZ6H 2VIPA 5EXMA 1HAVB 3SU0A 2QXHA 4X1NU 1BHXF 1E37B 3TH3H 2Z94A 1BT7A 4YLQH 1C5LH 1UJ1A 2DUCA 3SI4H 2BD5A 3QZQA 5C67A 5A0AE 4K1TA 1MTNB 1QBVH 2A4RA 1G36A 2O8WA 1BA8B 3AW1A 3BEFB 3U8TH 4I7YH 3VXFH 1ESBA 4FUEA 4Y7AA 1TIOA 3NWUA 1SPJA 2AERH 4SGBE 2ZQ1A 4GHQA 2XXLA 3TJNA 1EP6A 3LJOA 3RXCA 1TBQH 2CF8H 7KMEH 2BDAA 2BD7A 1XUGA 1ABIH 5C20A 3MMGA 4Q7XA 3V12A 1F5RA 1VCQA 4ZHLU 4AB8A 3UWIA 1C2FA 4I32A 4QT8C 1DLEA 1YC0A 2CHAB 4O3TA 2C90B 3MTYA 1GI1A 4ZXXH 3BTQE 1BTYA 2H9HA 3H7TA 3EQ0H 4E05H 4K1EA 5IDKA 3OY5U 3LGTA 1SC8U 4B71A 1WOFA 2I6QA 1O39A 3KQEA 5GIBA 2PLXA 3GDVA 5EW2H 1NN6A 2VIQA 4FXGH 5B6OA 4JK6A 1CU1A 1FIWA 1DVAH 2BY7X 2VIWA 4NFFA 1CT2E 4BTUB 5FX6A 3TH2H 4JZDH 4Y6DA 1O3DA 3KL6A 4A5TS 1C5WB 1OSSA 1V3XA 3LGYA 7GCHG 1BIOA 1O5CB 3F9FA 1GG6C 2SGDE 1HJ9A 4OS4A 2AS9A 4X1QU 1QB1A 1JMOH 3D23A 3BSQA 2C8XB 1SGCA 1TNKA 2C8ZB 5FCKA 1PPZA 1QY6A 2IOTA 8GCHF 4FUFA 1A7SA 1XUHA 2ZHWH 3U98H 2Z9KA 1C1UH 3A8AA 1IQKA 3M61U 1BMLA 2OC7A 2YNBA 4AB9A 1GBTA 3P8OA 3UR6A 1GI3A 1WCZA 5F8TA 3M3VA 1TRYA 4VGCB 2ZDLA 3T26A 2BY8X 1OYTH 1O3KA 3SU1A 3SJ8A 2P8OC 2GMTC 1Z1IA 2Z7FE 1D3QB 4ABBA 1P05A 1F2SE 1V2OT 1KXDA 1AFQC 1O37A 1SI5H 4I8GA 3EE0B 5GPIB 2CXVA 3ODDA 4IW4E 3M35A 8ESTE 3CP7A 2PKAA 3W95A 1C5YB 1FY8E 1C1OA 1HPGA 3VB7A 1TNLA 4NA9H 5C1UA 1IOEA 4D7GA 3UOPA 2OTVA 3E0NB 3M5OA 1LMWB 3KF2A 1WSSH 4NWKA 1QRXA 3A7VA 3AVZA 5FPSA 1QQ4A 3SUFA 1G2LA 1RIWC 4IC5A 4MPXA 3ZVBA 2TGTA 5LPEA 1NTPA 1EAIA 4Y71A 1PFXC 1LHDH 3M3SA 1EB2A 2PTCE 3EYDA 4XE4A 4Y76A 3VXEH 3AW0A 3ZV8A 2QXIA 5C5NA 2NWNA 1ARBA 4X6MA 2ZTYA 4Y10E 3A7TA 1YKTA 5A0BA 1FNIA 5L2YH 1ID5H 2BDIA 2XRCA 1SQTA 3Q3XA 3PMJA 1HB0B 2R3UA 5EXLA 1O32A 2O8LA 4MNXA 3FZZA 4WH8A 2AGIX 1C2IA 3T25A 1ORFA 5DP8A 1YPJH 2V35A 3L6PA 1ABJH 3RXPA 3SHAH 2VWLA 1C1PA 2ZFRH 4MPVA 4DVAU 4MNYA 2AEIH 2ZGJA 2FP7B 1HV7A 5DGJA 3BTTE 1HLTH 2QXJA 3GDUA 4CRBA 1C2KA 2B0FA 2AMDA 3DUXH 3ZZCA 1VGCC 2ZU5A 4R0IA 1F5LA 4HFPB 1C1QA 4DJZB 3SNEA 1H8DH 4ZKRU 5EU8A 5DP6A 2Y5FA 2WPMS 4BAHB 3VEQB 2G4TA 2J34A 1FPCH 1AVXA 2ZFTA 2GZ9A 1W12U 1Q2WA 3NCLA 5TJXA 1G3CA 1O3AA 1TX7A 3ZVGA 1V2PT 1OX1A 1ZHPA 3GY3A 1BRBE 1TGSZ 3GY8A 3BTWE 2H1UA 3ZVEA 1QNJA 1QGFA 3UREA 2ZDAH 3K65B 2R0KA 3R3GB 2TGPZ 5GXPA 2Y5HA 2FESH 1S6FA 5DP5A 5E2OA 1WYKA 2FI5E 1W0ZU 3SNBA 2PW8H 1V2ST 5ESTE 1BB0B 1K1MA 4FUHA 1UTPA 1TNGA 1GJBB 2FEQH 3PO1B 1S81A 4K8BA 1ETTH 1P11E 2ODPA 3QLPH 4X6PA 1WU1A 2JETB 1CT0E 1P10A 1O2MA 3RMMH 1LHFH 4I33A 5CHAB 4X2XA 2VINA 1FDPA 2AIPA 2ODYB 2OINA 1EATA 4IS5A 5FAHA 2AGEX 2J9NA 1PYTD 1O5EH 2P3TB 4Y0ZE 1T7CA 5SGAE 1TGTA 1ZJKA 5AVDA 4Y8XA 3BEUA 4Z6AH 1HAIH 1Z8IB 1AB9C 3SNDA 2ZU4A 2VVUA 4UFGH 8GCHG 3S9CA 2FS9A 1YGCH 4O3UA 1G32B 3SQEE 3TU7H 4MG3A 1QRZA 1CGHA 4Q7ZA 1OOKB 1ELBA 3V7TA 4Y8YA 3VFEA 1YPLH 1ZZZA 4A6LA 3QWCH 1MAXA 2BVSH 1GWAA 4TPIZ 3TITA 5EW1H 1HAOH 4H6TA 2ZQ2A 1EUFA 2BVXH 2F9UA 1SBWA 1GGDC 2ZECA 1P8VC 3QTVH 1AFEH 1MU6B 1UHBB 4Q7YA 4X8SH 4A1VA 3ZZ6A 1P2OA 4GVUA 1ZPBA 2ZA5A 1A0HB 3E1XB 1GI4A 1C5RA 4DT7B 3SW2B 1GJ9B 4Y8ZA 1LVOA 2ZDVH 3F9GA 2F3CE 1Q31A 3PV4A 3SNAA 1THSH 1PQ8A 3BTHE 3P8GA 5AFZH 1P3EA 3BG4C 2BDGA 1HUTH 2BLOA 1KLJH 1K1OA 1W7GH 1UCYE 2ZHFH 1ZMNA 3B9FH 3K6ZA 1XMNB 1C1MA 2GKVE 5JBBS 2FYRA 1RJXB 2FM2A 2JH6D 1IQJA 1HAZB 4UFFH 1FLEE 1C5UA 1K21H 1ELTA 4CHAC 3P8NA 1FONA 1B7XB 4ISNA 2FYQA 1DSTA 1INCA 5DPAA 3TVJB 2PHBA 1G30B 4TPYA 4CRFA 3O8CA 3DA9B 3HPTB 1RTFB 3UQVA 2PGQB 2DE8A 1SLUB 1TLDA 1ANEA 3ZVFA 1XVMA 3EA8A 3TIUA 1O5FH 1V2WT 1AUJA 1NFYA 2FOFA 3SGQE 1TONA 3AAUA 2WPLS 4TWYA 3ZVAA 3MO9A 8LPRA 3SUGA 2FZZA 3RU4D 3IITA 2ZTXA 1EB1H 1YPMH 2CV3A 1C2EA 1WAYB 1L4DA 1T8MA 2PR3A 3F6UH 1F0SA 1SLXB 1SOTA 4DOQA 3E16B 1C1WH 2ZTZA 3OY6U 4WF8A 3LOXA 1V2UT 1TFXA 2P3UB 1P0SH 1GI5A 1ELFA 4XSKU 7ESTE 1S0RA 1VZQH 2VU8E 3PM3A 3JZ1B 1C5NH 1LQEA 1O2JA 4ABGA 1S0QA 3KIDU 1BUIA 2AGGX 1G37A 1E36B 1BRCE 1Y3YA 1OKXA 2F9PA 2SFAA 3OSYA 1NRQH 1WQSA 3GYLB 4YT6H 2A1DB 1NPMA 1AWHB 4E7NA 3URDA 4BOHA 1F5KU 1QFKH 1TWXB 5DP3A 1C2DA 1QCPA 3K6YA 2PWXA 5AHGH 5HMAA 1JIRA 3C27B 1K1NA 1GHAF 3HK3B 1V2KT 2BD2A 1P2KA 1FIZA 4ZKOU 3RXSA 5JB9S 2Q6GA 2QF0A 1JWTA 1IHTH 3BTFE 3UR9A 1T4UH 4DG4A 3OU0A 2QYIA 4D7FA 1Z7KA 3BIUH 1K1LA 3ATLA 1MTNC 1HXEH 3MI4A 1HCGA 3RXHA 2G5NA 3Q3YA 1SQOA 2GV6A 2ESTE 3ATMA 4HGCA 4LZ4B 2VJ1A 3EBNA 1NM6A 2A4QA 3BTEE 3STJA 1GDUA 1GHVH 3DFJA 1AD8H 3QX5H 2ZGBH 1NRNH 1GBDA 1PYTC 2ZGHA 1DX5M 2BM2A 2CHAC 1DWCH 1O34A 1FY4A 2R2WU 2ZPQA 4BTTB 1ELDE 3RXEA 2BQ7B 2FI3E 2ZG0H 2YOLA 1C1TA 1P06A 1QR3E 1GCTC 4NGAH 5JDUB 1NFXA 3E90B 4B75A 1CVWH 3RXBA 1VJ9U 2ZGCA 3VB4A 3QTOH 5HM9A 1UCYH 1HBTH 3A88A 3LGVA 1NT1A 4AG2A 1O2UA 1VITH 1CGIE 1OWJA 4XDEA 1AZZA 3IG6B 1WTGH 3SUEA 5A8YA 1UTOA 3PWBA 3PTNA 2Z3CA 1EPTC 1HFDA 2OD3B 1MKWH 2TIOA 3TH4H 2BY5X 2WINI 1JIMA 1N8OC 3QGJA 3SJ9A 1BTHH 1SG8B 2D1JA 1UK3A 3GDSA 1NC6A 1TA6A 1KXEA 4AORA 3GCHB 2EI8A 1Z8RA 1CA0B 5JB8S 1G3BA 2ZZUH 5BRRE 1BRUP 1C2LA 1C2GA 3QGNB 2FOCA 3H5CB 4ZXYH 2EI7A 3L33A 4AX9H 3MH5A 1MCTA 2QC2A 5AF9H 1QJ6B 1O5AB 2ZP0H 2BX4A 5I25A 4MNVA 1LPZB 1DFPA 3BV9B 4BAOB 1F7ZA 1LO6A 1KDQA 3RXDA 5DP9A 4YO9A 3ELAH 1AGJA 3T29A 2SGQE 1TPSA 1VJAU 1YF4A 2GCHF 2B9LA 1S82A 1LPKB 1P12E 4JK5A 2THFB 1YM0A 3Q3KA 2PKSB 2UWLA 6LPRA 1KXFA 3UNRA 3AASA 2Z3DA 5LGOA 5FBEA 3FFGA 1B0FA 1IQNA 1OPHB 1XVOA 4BXSA 5BPEA 1PPEE 3E6PH 3IWMA 2BD8A 1Y5UT 1M9UA 3FVFB 4UFEH 5A0CA 1QTFA 3MO6A 3HGPA 4NSVA 5AFYH 1O3OA 1TGCA 2VB0A 2ZKSA 1A5GH 2PV9B 3BEIB 5DKMA 1QBNA 2ZIQH 2GGVB 3GCTF 2ZFSA 3KEEA 1F0RA 3M5LA 1Z6JH 3A83A 2IJOB 1L1NA 2J38A 4WH6A 1VCPA 2A7CA 2G8TA 1ZJDA 1P03A 2BXUH 2Y80A 1V2RT 1Z6EA 1K28D 1O2QA 3A7WA 1H9HE 2FO9A 2JH5D 3SO3A 3RXIA 4ZMAH 1NU9A 3PMHB 2FX6A 1EZSC 2ZO3H 1GHAG 1PPGE 3MH6A 1AO5A 3A82A 1PPHE 1W2KH 1BTWA 4RKOB 1O3JA 1IHSH 1AE5A 4X2WA 1ESAA 1LVYA 4XBCA 2SNVA 1G3EA 4MDSA 2HGTH 2NU0E 2FODA 4AOQA 4CH8B 1V2JT 3RXVA 4TY6A 1RXPA 2RA0A 2QAAA 5CE1A 1NRRH 5T6GA 2STBE 2W3KA 1EJAA 2A31A 4B74A 4X1RU 4ABIA 1P3CA 3LGIA 1DE7H 1QBOA 2VVCA 1K2I1 2OXSA 1J16A 2WPIS 1HJ8A 4KTUA 1P2JA 4BAQB 3RDZA 1WUNH 2O8MA 2WPHS 2R2MB 1KTSB 1AZ8A 1BQYA 3BTME 2BYAX 1B5GH 3SBKA 1GCDA 2V3HH 3TK5A 3A7YA 1MTVA 3BIVH 2WPKS 3TJOA 3A81A 4KKDA 1D4PB 2P3FH 2HOBA 1O2OA 1FI8A 4OS5A 1P04A 1HGTH 3STIA 2QF3A 4OS1A 1GHBF 1ZPZA 3NPSA 1KTTB 1GJAB 3HATH 4LXBH 2F83A 2HALA 1T8NA 1C9PA 2W7SA 2JETC 5FBIA 3SHCH 1N6XA 1EJNA 1UVSH 1XUJA 4OS7A 2OLGA 2XBWA 1XXDA 1MTSA 2XCFA 1EASA 3D62A 1HIAB 4ASHA 2GTBA 1SFIA 1MU8B 1EAWA 2XW9A 3KN2A 1O3PB 2C93B 5I46H 1LHEH 1ZGIA 1QA7A 2JH0D 1O2IA 1OYQA 2SNWA 4B1TA 2FOHA 1UMAH 1CHOF 1ZSKA 1XUKA 3ZZDA 1A0JA 1P01A 2D2DA 1O2RA 1S85A 1C4Y2 1N6YA 2KAIA 4YLUA 1T8OA 2P94A 4WXVA 1TBZH 3ZZAA 1GL1A 2PGBB 4KELA 4AN7A 1GJ6A 1L2EA 3LT3A 3ZVCA 4MLFB 2K7XA 3D49H 4IMQA 4JZ1A 3KHVA 3CS7A 3HKIB 3LPRA 1SGIB 3ZZ3A 1P57B 1RGQA 1J17T 1SGYE 4KTCA 3ZZ5A 5G4BA 1NFWA 1TNHA 2BTCE 1K9OE 1O2TA 3HK6B 3A8CA 3SV6A 1GG6B 1EPTA 1VR1H 4ZH8A 1V6DA 2WUBA 3SOSA 4F4OC 2FXRA 2C8WB 3A85A 4NA8A 4WVPE 1XX9A 2GCHG 1EX3A 3SGBE 1EZXC 1AVGH 2ZGXH 1XUFA 4X8VH 1GMHF 3M5NA 1W11U 3LC5A 5EQQA 3MH4A 7LPRA 1DY9A 5FPTA 5K0HA 3WY8A 3MHWU 5EOKA 2A4GA 1O3BA 1LVMA 5FHTA 3ZZBA 1EQ9A 3VGCC 3ZZ9A 1YCPH 1BCUH 3FP8E 1WBGB 4CR5A 5J4SA 3MFJA 1QL8A 4BTIB 2ZU1A 1ZRBA 3UNQA 1LHCH 3GCTG 3RP2A 2I6SA 2ZFPH 1MZAA 1SL3A 1V2QT 2P8OB 3NUMA 2HRVA 4AYVB 5J4QA 2OBOA 2WUCA 3VPKA 1TOMH 1AFQB 1OP0A 3P95A 4X1SU 4LZ1H 2AIQA 4K8YA 2H5DA 1OWHA 4Q2KA 1SB1H 2FOBA 4ZROA 1ZMJA 2FOGA 2BLWA 2Y82A 4YT7H 3DHKH 5ETXA 1CQQA 2Y5GA 3OX7U 1Y3UA 2AFQB 1AY6H 1S5SA 6CHAB 1EOJA 2G81E 4DY7B 1RIWB 1RRKA 1ZSJA 4WY3A 2BLQA 5ESBA 5L30H 3SN8A 1XUIA 1Z8GA 2ZCKP 4MQAA 1EKBB 1ZRKA 4THNH 3TLOA 2H9TH 4MPUA 1ETSH 4A7IB 4AFQA 4ABHA 2PSXA 2ALVA 2VGCC 1YCPK 4B2AA 4UE7H 2UUFB 2XC5A 3OTJE 1SGTA 1LPGB 1N1LA 1B0EA 1O2PA 4OGXA 3LONA 1CBWC 4FVBA 5EQRA 4DW2U 1BDAA 1GBIA 4UDWH 4FUGA 1ACBE 1ZLRA 2GX4A 4Z0KA 3GOVB 2AYWA 3P6ZB 3VB5A 1SOZA 1MKXH 2ZPRA 4NIXA 1C4U2 1BJUA 2C4FH 2ZHQH 3U1JB 3B23B 2TPIZ 4F49A 1VGCB 1NY22 2GD4B 2EI6A 1DUAA 1H1BA 5E0HA 1J9CH 2Z9IA 2GVFA 1BHXB 1VITF 3SGAE 3Q77A 1GHBG 1S84A 1EAUA 1GBKA 2A5AA 1Y3WA 2GT8A 3MU0A 2CGAA 2ZWLH 5A8XA 2PSYA 2W3IA 4KP0A 4HZHA 4INLA 2BMGB 3KCGH 4AG1A 1CHGA 2FMJA 1BMAA 2BX3A 1FN6A 2P16A 4K60A 2ZNKH 1DXWA 1UVOA 2P95A 3Q76A 2OP9A 1TMUH 2A0QB 2WYJA 4AGKA 3PTBA 1LQDB 2ZDMA 2OC1A 1UVPA 1HXFH 4H42U 3A87A 1LDTT 1W10U 1GBAA 4D9QA 5GWZA 3A80A 4CRAA 5LH8A 3MOCA 3MNCA 3ZZ7A 1BTXA 3PLKA 4ISHH 2AMQA 2F9VA 3VB3A 1JRSA 1TRMA 1AHTH 3T27A 5A09A 2GCTB 4X1PU 4AFUA 4INHA 1BJVA 1DUEA 1PQ7A 1EZQA 3TGIE 1OP2A 1HDTH 4ABJA 2SGEE 2Y7XA 3RXJA 3PLPA 1A46H 2P93A 4A1TA 2QN5T 4K2YA 2JKHA 1GMHG 1TABE 2FLBH 3MNXA 3P92A 3CS0A 2BQWB 4FVDA 2QA9E 1UTNA 4RSPA 2ZI2H 2FOAA 1J15A 2EA3A 1UTKA 4B2CA 4AFZA 1O3NA 2TRMA 1QQUA 1TE0A 2XCNA 2NU4E 2O8UA 4X8UH 1IQHA 2SGFE 1BMNH 1THPB 4YOJA 1O3MA 1FY1A 1Y59T 1AE8H 4NIWA 5C5OA 1GJCB 5A2MH 4X6NA 3RU4E 4JYTA 1TYNA 3UTUH 4UEHH 4TYDA 1O2NA 5EPYA 3QO6A 4YZUA 5EGMA 1O5BB 2IN2A 3S7HB 1A3EH 4CREA 1MH0A 1TPAE 3BTKE 1CA0C 4X2YA 1C2HA 3E8LA 2UWPA 1ANBA 3ITIA 1C1RA 2BDCA 2UWOA 1MTWA 2FX4A 1FAXA 1P02A 3RXUA 1O35A 2RCEA 3QUMP 3KNXA 1ZHMA 2PUQH 2Z6BD 2TGAA 2HNTC 1GMDF 4KGAA 2BQ6B 1GBLA 2ULLA 1BTPA 3RC5A 1QJ7B 4H6SB 1O3FA 1K1JA 1P2QA 4NFEA 1KDQB 2ZU2A 1W8BH 1NRSH 1E35B 3MU4A 1DICA 1V2LT 2Q6FA 3BG4B 1S83A 2CJIA 4A92A 1A5IA 4E7RG 5A8ZA 1FUJA 2RG3A 3LGWA 1PPFE 4GUXA 3A89A 4NCYA 2BVRH 4FU9A 3F9HA 2CF9H 2LPRA 1FMGA 5E0GA 1OWIA 4CHAB 1V2NT 1FY3A 2XTTB 3RC4A 1Y3VA 4FUIA 2A4OA 1CGJE 1SGFG 1TMTH 2QIQA 3L3TA 1BBRH 3ATIA 1ZHRA 2ZHEH 1TGNA 3LH1A 3RM0H 3RU4T 3RMNH 2TGDA 2XBYA 4Y0YE 2BB4A 2FI4E 1C4V2 3MYWA 1C1SA 4DCDA 5F8XA 4INKA 2PUXB 4CH2B 2Z3EA 3AAVA 4U32A 1GBMA 3LGUA 1ESTA 3M5MA 3MU5A 4ISIH 2XNIA 4DIIH 1K1PA 2ALPA 1KLTA 1V2VT 4HI3A 1D3TB 2A7JA 2BY9X 3FP7E 4ISOA 3RLWH 1O3GA 2A5IA 1QA0A 2Y7ZA 3SV9A 3RXRA 1ANCA 1IQIA 1FAKH 2HLCA 2H2ZA 1KY9A 2V3OH 9LPRA 1K22H 2Q6DA 2BDYA 1ARCA 1VITG 1K1IA 2C8YB 2OCVB 4IBLH 2GZ8A 2H5CA 2WV4A 1SGRE 3UQOA 1ZTLA 3W94A 4PROA 5DP7A 1BRAA 1D9IA 3RXLA 1GDQA 3RXAA 3BF6H 5EG4A 1C5MD 3EDXB 1RS0A 1SGNE 1AMHA 1KXAA 1CE5A 2OQ5A 3BG8A 1LKBA 4IN2A 4U30A 2VH0A 4B2BA 1VCWA 4I8LA 4NG9H 5GCHF 3TNTA 1F92A 1KYNA 2RA3A 3UUZA 1T8LA 1DWDH 3C1KA 2V0BA 1EZUC 3PMAB 2ZCLP 1EOLA 4TY7A 2IPHA 1DY8A 1DSUA 3NXPA 2SGPE 1MQ6A 1TQ7B 3E0PB 1Y5BT 2O9QA 3EGKH 1AI8H 2OC8A 4VGCC 4CBOA 1PJPA 4MPWA 8KME2 2BD3A 4D9RA 2GZ7A 2GDDA 5E0JA 1UCYK 3JZ2B 1YBWA 5E8EH 1KLIH 1KXCA 2PKAB 2FOEA 4FUDA 4O9VA 3SU5A 5TCAA 3BTDE 5DK1A 1A1RA 1O3HA 1LKAA 1E0FD 2ZF0H 1D6RA 4ZHAA 1MKWK 1AKSA 1F0TA 3OYPA 4K69A 3UY9A 1EJMA 1NS3A 4NIYA 2GDEH 3LH3A 3ZZ4A 1P9UA 3LKWA 1SVPA 5C1YA 3S9BA 2YNAA 1MD8A 3KQBA 2XC4A 5HGGA 3T28A 2FOMB 1GJ7B 5HYOA 1MD7A 1TX8A 3TGKE 3S69A 4XBBA 1FXYA 1Y3XA 1GBJA 1QHRB 3SU2A 2EEKA 4NSYA 2TBSA 1QL7A 3SNCA 1SGQE 2HWLB 4YESB 2G4UA 4HTCH 1SGPE 2BD4A 6ESTA 3RMOH 1MAYA 4ABDA 2KAIB 1XXFA 1XM1A 2VWMA 1O0DH 4YM9A 1GCTB 1GI8B 3LU9B 1YP9A 3VB6A 4XOJA 3O8RA 1ELGA 4NZQA 1ETRH 5T6DA 2BD9A 1W7XH 1NO9H 1WQVH 4WMDA 1L1JA 4JYUH 2SGAA 1ZPCA 3F1SB 4YTAA 1LCYA 5EQSA 1GMDG 2UUYA 4I8KA 1DOJA 1MUEB 2O8TA 1EPTB 4AGJA 1DANH 1BMMH 1O38A 4ZKNU 1ZR0A 1S6HA 1NFUA 3I77A 3PWCA 4CRCA 4CR9A 1N8OB 1P09A 4FUBA 4MVNA 5JPMH 1GMCF 1EAXA 4AZ2B 4ZHMU 1DWBH 1L4ZA 1G9IE 2RDLA 2WV5A 1HJAB 1GHZA 2BLVA 3UNSA 1TNIA 3RLYH 2NU1E 1JRTA 1E38B 5JYIA 4X8TH 3G01A 4WJG2 5CMXH 3LC3A 2LIZA 1SLWB 4LK4A 2K1QA 5JBCS 3E3TA 3K9XB 3K2UA 5L2ZH 2BXTH 3T62A 2FPZA 3TGJE 1D3PB 3URCA 4A1XA 2WPJS 1SHYA 2R9PA 1HAVA 2A2QH 1UTLM 2Z9GA 1QL9A 1MZDA 1PQ5A 4IMZA 3U8OH 3V0XA 4NIVA 1ZGVA 2FIRH 1UTJA 3SJKA 2P59A 3H7OA 4OGYA 3DFLA 1YPEH 3PO1C 4ZKSU 3EAJA 1TQ0B 5HM2A 4FUJA 2FTLE 2FWWA 5HXFA 2DE9A 1QJ1B 3O8DA 2HPPH 3MH7A 5CHAC 3UIRA 5EXNA 3SV7A 4KTSA 3ATKA 2BDHA 2J92A 3FAOA 1OWDA 3BN9A 3SI3H 3DD2H 6GCHF 1DWEH 4AYYB 4IGDA 1C5TA 1HRTH 1ZOMA 1UTQA 1BITA 3QDZB 2NU3E 4RKJB 1O31A 1GI2A 1O5DH 6CHAC 5IYTA 4YOIA 2BOKA 1FQ3A 1DPOA 2A45B 5GCHG 5T3HA 1SGFA 4GPGA 1KSNA 1O2XA 1YPHE 1P2MA 1ELVA 1AIXH 1A2CH 1TALA 2XWAA 2HVXA 2XYAA 3PB1E 1JXPA 1FY5A 4I8HA 4GSOA 1O3IA 3SZNA 3GICB 3DT0H 2UUJB 1IQFA 4O03A 1QB6A 4X6OA 2R3YA 5FX5A 3RC6A 4GHTA 3HKJB 2GT7A 1J14A 1CO7E 1BTZA 1RFNA 1O2SA 1H9LB 4WXIA 1QRWA 3EA9A 2STAE 1C5SA 1TBRH 2ZU3A 1GBCA 1YLDA 2VWNA 4ZUHA 2ZFFH 2ILNA 1DDJA 3RXGA 1H8IH 3RM2H 4BAKB 4DGJA 2XC0A 1A5HA 1TPOA 1C5QA 2ZPSA 1C1VH 4DURA 3TK9A 4UD9H 2M5TA 5DO4H 1V2TT 1GL0E 1GI7B 4OS2A 1PPBH 4X2VA 1GI0A 3M7QA 1V2MT 1AUTC 1TA2A 1O2VA 2ZFQH 4U01A 5F8ZA 1OP8A 1MBQA 2EC9H 3PMBB 1YPGH 1P2IA 2GMTB 3SJIA 5L6NH 3E91A 4XFQA 2ZC9H 4WWYA 5F03A 1ANDA 2BY6X 2F9NA 3A7ZA 1C5OH 1MCVA 2HNTF 3T2NA 1HAHH 4DIHH 1UTMA 2Z9LA 4RN6A 1EP5A 4GAWA 1TOCB 3SV8A 4LOYH 2AH4X 1O33A 3RXOA 1SFQB 3M7TA 1AWFH 3UPEA 3ESTA 2HNTE 1KXBA 3EA7A 1TGBA 3CENA 4AFSA 1ELAA 4NZLA 1CT4E 1LHGH 1C5PA 3FANA 1GVZA 4ABEA 1XKAC 3FZDA 2GP9B 2C3SA 1CA8B 1GVLA 4CBNA 2B5TB 1Y8TA 1HNEE 2GCTC 1GJ4H 2ANYA 1LVBA 1HYLA 3FP6E 2F9BH 1HAXB 1BOQA 4MTBA 3NZIA 3QN7A 2VIVA 3RXFA 1O5GH 3ZVDA 2ZDKA 1YCPM 1GMCG 1FV9A 3GY7A 3N7OA 2VWOA 1HAPH 1XKBC 2R0LA 2FTMA 2QY0B 2QCYA 3U8RH 1HIAA 1IQGA 1UVUH 5TCCA 1THRH 1GPZA 1SMFE 1A0LA 5FXLA 3BTGE 2D8WA 2Q1JA 3M36A 2OQUA 1TNJA 5JBAS 1T4VH 5DP4A 1L0ZA 4CRGA 4BNRA 1D6WA 2Y81A 1RD3B 3T5FH 2AMPA 4ABAA 1DXPA 1SSXA 2ZHDA 1TB6H 3S7KB 2XWBI 1GI9B 2W5EA 2FDAA 4JZIA 2ANKH 1BBRE 4U2WA 2PTNA 5C3NA 3U69H 3LIWA 1NZQH 1O2GH 1H4WA 1MTUA 1GI6A 5DJ7A 4GCHF 2XBVA 1SQAA 3LJJA 1TPPA 1HAYB 5K7RA 1GHWH 1O2YA 1UK2A 5GDSH 1GJDB 1NU7B 1H9IE 1YLCA 2ZDNA 2VIDA 1IQMA 2ZEBA 1C5ZB 4JZEH 1GHYH 2GV7A 1WTHD 5E2PA 1P2NA 1SHHB 5PTPA 3VGCB 6GCHG 1O2ZA 1JBUH 1GDNA 1P9SA 1OS8A 1C5XB 1NROH 1A61H 3LDXH 4JYVH 1C2MA 1CSOE 1DITH 3GY2A 1CHOG 2G5VA 4ESTE 1BZXE 2H6MA 1WV7H 1PQAA
chains in the Genus database with same CATH superfamily
2JIZD 3NRLA 1F0UA 2XNDD 1GBFA 2A2XH 4JCNA 9ESTA 1MMJN 1YPHC 4BAMB 1IQLA 1G3DA 3ATWA 1OWEA 1QIXB 1ZSLA 4R8TB 1GVKB 3MU1A 2WSSD 3RXMA 3TK6A 3GISB 1O3CA 3MU8A 3TPIZ 3MWIU 1TRNA 2WYGA 1SGDE 4H4FA 1W3CA 1O36A 3SUDA 1ZTJA 1SGEE 5T6FA 1FPHH 1IAUA 1GBBA 1MKXK 4I8JA 1TMBH 4JZFH 3O8BA 1YPKH 3A8BA 3P70B 1GBHA 1YY3A 2VIOA 4YOGA 4Q80A 4B73A 1MBMA 3SJOA 3UFAA 2F91A 2G52A 3TJUA 2XBXA 2J2UA 3S0NA 2A5KA 4ABFA 4K3JA 3GY4A 2KCOA 3NK8A 3PYHA 5FL7D 5C1XA 1AB9B 2D26C 2J98A 1W0YH 2ANMH 3P8FA 4UONA 4D76A 2QGRA 2ODQA 1GJ8B 3P17H 5DN6D 1O30A 2G55A 4X0WU 2Z9JA 1BTUA 3M3TA 1SLVB 1H8ED 1TAWA 2VGCB 1NRPH 3UB0A 3PLBA 1IQEA 3KYFA 3ZYDA 4Y79A 4RT1A 3D65E 1MQ5A 4NA7A 2ANWA 2V7QD 4K1SA 3ENSB 3MNBA 4BXWA 1NESE 2A32A 1O2HA 2VH6A 5H4IB 5EJ1A 2KM0A 1C5VA 3GYMA 2J95A 4M7GA 2OBQA 5LPRA 5GJ4B 1C9TA 3MO3A 2B7DH 3GCHC 1AQ7A 1CBWB 4ISLA 2IPQX 4GLYA 1YYY1 1GGDB 1DS2E 3I29A 5T1VA 3PROA 1E34B 2G51A 1U6QA 3A86A 4JMYA 5EPNA 2J94A 3GCNA 3QK1A 4D8NA 3M7UA 1A4WH 2FS8A 4FUCA 3GS9A 3KGPA 4IN1A 1J8AA 1UHBA 1ZYOA 1W13U 3F68H 4BANB 1FN8A 3A7XA 1Z1JA 1GJ5H 1ELEE 3QZRA 1FJSA 3UWJH 7GCHF 1ELCA 1EXFA 3GY5A 1ZMLA 3NKKA 2BHGA 4TWWA 2J4IA 2PFEA 1Z71A 3V13A 2Y6TA 4J1YA 2HPQH 2BDBA 4SGAE 4XBDA 1AU8A 1T31A 2ZCHP 1LTOA 1AKSB 5C2ZA 5DG6A 4Y7BA 3SU3A 1DT2A 1TX6A 3SU4A 3UAIC 1A3BH 2PKSC 1O3EA 4Y11E 3SV2H 3UOUA 3ZYEA 1G2MA 2VVVA 5F6MA 4ZAEA 4J2YB 2CN0H 1PPCE 3B8JA 3FO8D 4WMFA 3MNSA 1O2WA 3U1IB 2NU2E 1L1GA 3S9AA 3RXKA 1HAGE 3GY6A 3SQHE 3F9EA 2B8OH 4O97A 1QURH 3RMLH 2CMYA 5JBTA 4NWLA 4WMEA 1RTKA 2H9EH 3A84A 1O3LA 5FCRA 2V6NA 4I31A 3U9AH 1UVTH 2OC0A 2OUAA 3RXQA 2V3MA 1NBMD 1O2LA 2A7HA 1AN1E 1FZZA 2W7UA 4FU7A 1JOUB 4GCHG 3V3MA 3W1EA 3SU6A 5HIYA 1GBEA 3TJVA 5DSFA 3TNSA 3Q00A 3KQCA 1OXGA 4B76A 1O2KA 2BOHB 4K5ZA 1T32A 4CRDA 5LPFA 3A8DA 3KQDA 1SR5C 1W14U 1OWKA 4FU8A 1UK4A 2LNCA 1D3DB 3M37A 2W26A 3ODFA 3WW7A 2ASUB 3HGNA 3R0FA 1C2JA 4E06H 1DLKB 1UO6A 1BBRK 3ZIAD 2FLRH 3RUOA 2K0QA 3GCOA 3SORA 2BZAA 4Q63A 4IC6A 5FPYA 5ABWA 1HJAC 1RTLA 1KIGH 2F9OA 3N99A 1C1NA 4UFDH 2QXGA 2VNTA 3ZV9A 3RXTA 1DM4B 2QV1A 1Y5AT 4OS6A 1AVWA 1ZTKA 1X7AC 1QB9A 3ZZ8A 2UUKB 4MNWA 5EODA 3I78A 1GHXH 1Q3XA 2G00A 1Z8JB 2BZ6H 2VIPA 5EXMA 1HAVB 3SU0A 2QXHA 4X1NU 3EE7A 1BHXF 1E37B 3TH3H 2Z94A 1BT7A 4YLQH 1C5LH 1UJ1A 2DUCA 3SI4H 2BD5A 3QZQA 5C67A 5A0AE 4K1TA 1MTNB 1QBVH 2A4RA 1G36A 2O8WA 1BA8B 3AW1A 3BEFB 3U8TH 4I7YH 3VXFH 1ESBA 4FUEA 4Y7AA 1TIOA 3NWUA 1SPJA 2AERH 4SGBE 2ZQ1A 4GHQA 2XXLA 3TJNA 1EP6A 3LJOA 3RXCA 1TBQH 2CF8H 7KMEH 2BDAA 2BD7A 1SKYE 1ABIH 1XUGA 5C20A 3MMGA 4Q7XA 3V12A 1F5RA 1VCQA 4ZHLU 4AB8A 3UWIA 1C2FA 4I32A 4QT8C 1DLEA 1YC0A 2CHAB 4O3TA 2C90B 3MTYA 1GI1A 4ZXXH 3BTQE 1BTYA 2H9HA 2KCPA 3H7TA 3EQ0H 4E05H 4K1EA 5IDKA 3OY5U 3LGTA 1SC8U 4B71A 1WOFA 2I6QA 1O39A 3KQEA 5GIBA 2PLXA 3GDVA 5EW2H 1NN6A 3F2HA 2VIQA 4FXGH 5B6OA 4JK6A 1CU1A 1FIWA 1DVAH 2BY7X 2VIWA 4NFFA 1CT2E 4BTUB 5FX6A 3TH2H 4JZDH 4Y6DA 1O3DA 3KL6A 4A5TS 1C5WB 1OSSA 1V3XA 3LGYA 7GCHG 1BIOA 1O5CB 3F9FA 1GG6C 2SGDE 1HJ9A 4OS4A 2AS9A 4X1QU 1QB1A 1JMOH 3D23A 3BSQA 2C8XB 1SGCA 1TNKA 2C8ZB 5FCKA 1PPZA 1QY6A 2IOTA 8GCHF 4FUFA 1A7SA 1XUHA 2ZHWH 3U98H 2Z9KA 1KMHB 1C1UH 3A8AA 2F43B 1IQKA 3M61U 1BMLA 2OC7A 2WPDD 2YNBA 4AB9A 1GBTA 3P8OA 3UR6A 1GI3A 1WCZA 5F8TA 3M3VA 1TRYA 4VGCB 2ZDLA 3T26A 2BY8X 1OYTH 1O3KA 3SU1A 3SJ8A 2P8OC 2GMTC 1Z1IA 2Z7FE 1D3QB 4ABBA 1P05A 1F2SE 1V2OT 1KXDA 1AFQC 1O37A 1SI5H 4I8GA 3EE0B 5GPIB 2CXVA 2CK3D 2IJD1 3ODDA 4IW4E 3M35A 8ESTE 3CP7A 2PKAA 3W95A 1C5YB 1FY8E 1C1OA 1HPGA 3VB7A 1TNLA 4NA9H 5C1UA 1IOEA 4D7GA 3UOPA 1VKYA 2OTVA 3E0NB 3M5OA 1LMWB 3KF2A 1WSSH 4NWKA 1QRXA 3A7VA 3AVZA 5FPSA 2YMSC 1QQ4A 3SUFA 1G2LA 1RIWC 4IC5A 4MPXA 3ZVBA 2TGTA 5LPEA 1NTPA 1EAIA 4Y71A 1PFXC 1LHDH 3M3SA 1EB2A 2PTCE 3EYDA 4XE4A 4Y76A 3VXEH 3AW0A 3ZV8A 2QXIA 5C5NA 4B6FA 2NWNA 1ARBA 4X6MA 4I86A 2ZTYA 4Y10E 3A7TA 1YKTA 5A0BA 1FNIA 5L2YH 1ID5H 2BDIA 2XRCA 1SQTA 3Q3XA 3PMJA 1HB0B 2R3UA 5EXLA 4FETA 1O32A 2O8LA 4MNXA 3FZZA 4WH8A 2AGIX 1C2IA 3T25A 1ORFA 5DP8A 1YPJH 2V35A 3L6PA 1ABJH 3RXPA 3SHAH 2VWLA 1C1PA 2ZFRH 4MPVA 4DVAU 4MNYA 2AEIH 2ZGJA 2FP7B 1HV7A 5DGJA 3BTTE 1HLTH 2QXJA 3GDUA 4CRBA 1C2KA 2B0FA 2AMDA 3DUXH 3OEED 3ZZCA 1VGCC 2ZU5A 4R0IA 1F5LA 4HFPB 1C1QA 4DJZB 3SNEA 1H8DH 4ZKRU 5EU8A 5DP6A 2Y5FA 3OE7D 2WPMS 4BAHB 3VEQB 2G4TA 2J34A 1FPCH 1AVXA 2ZFTA 2GZ9A 1W12U 1Q2WA 3NCLA 5TJXA 1G3CA 1O3AA 1TX7A 3ZVGA 3OAAD 1V2PT 1OX1A 1ZHPA 3GY3A 1BRBE 5GNDA 1TGSZ 3GY8A 3BTWE 2H1UA 3ZVEA 1QNJA 1QGFA 3UREA 2ZDAH 3K65B 2R0KA 3R3GB 2TGPZ 5GXPA 2Y5HA 2FESH 1S6FA 5DP5A 5E2OA 1WDIA 1WYKA 2FI5E 1W0ZU 3SNBA 2PW8H 1V2ST 5ESTE 1BB0B 1K1MA 4FUHA 1UTPA 1TNGA 1GJBB 3N7EA 2FEQH 3PO1B 1S81A 4K8BA 1ETTH 1P11E 2ODPA 3QLPH 4X6PA 1WU1A 2JETB 1CT0E 1P10A 1O2MA 3RMMH 1LHFH 4I33A 5CHAB 1E1QD 4X2XA 2VINA 1FDPA 2AIPA 2ODYB 2OINA 5C0TA 1EATA 4IS5A 5FAHA 2AGEX 2J9NA 1PYTD 1O5EH 2P3TB 4Y0ZE 1T7CA 5SGAE 1TGTA 2J98B 1ZJKA 5AVDA 4Y8XA 3BEUA 4Z6AH 1HAIH 1Z8IB 1AB9C 3SNDA 2ZU4A 2VVUA 4UFGH 8GCHG 3S9CA 2FS9A 1YGCH 4O3UA 1G32B 3SQEE 3H09A 5CHBA 3TU7H 3PV5A 4MG3A 1QRZA 1CGHA 4Q7ZA 1OOKB 1ELBA 3V7TA 4Y8YA 3VFEA 1YWUA 1YPLH 1ZZZA 4A6LA 3QWCH 1MAXA 2BVSH 1GWAA 2W6ID 4TPIZ 3TITA 5EW1H 1HAOH 4H6TA 2ZQ2A 1EUFA 2BVXH 2F9UA 1SBWA 1GGDC 2ZECA 1P8VC 3QTVH 2WZQA 1AFEH 1MU6B 1UHBB 4Q7YA 4X8SH 4A1VA 3ZZ6A 1P2OA 4GVUA 1ZPBA 2ZA5A 1A0HB 3E1XB 1GI4A 1C5RA 5IK2D 4DT7B 3SW2B 1GJ9B 4Y8ZA 1LVOA 2ZDVH 3F9GA 2F3CE 1Q31A 3PV4A 3SNAA 3MQKC 1THSH 1PQ8A 3BTHE 3P8GA 5AFZH 1P3EA 3BG4C 2BDGA 1HUTH 2BLOA 1KLJH 1K1OA 1W7GH 1UCYE 2ZHFH 1ZMNA 3B9FH 3K6ZA 1XMNB 1C1MA 2GKVE 5JBBS 2FYRA 1RJXB 2FM2A 2JH6D 2LP6A 1IQJA 1HAZB 4UFFH 3KYGA 1FLEE 1C5UA 1K21H 1ELTA 4CHAC 3P8NA 1FONA 1B7XB 4ISNA 2FYQA 1DSTA 1INCA 5DPAA 3TVJB 2PHBA 4XRNA 2KZ4A 1G30B 2KX4A 4TPYA 4CRFA 3O8CA 3DA9B 3HPTB 1RTFB 4DT4A 3UQVA 2PGQB 2DE8A 1SLUB 1TLDA 1ANEA 3ZVFA 1XVMA 3EA8A 3TIUA 1O5FH 1V2WT 1AUJA 1NFYA 2FOFA 3SGQE 1TONA 3AAUA 4Z1MD 2WPLS 4TWYA 3ZVAA 3MO9A 8LPRA 3SUGA 2FZZA 3RU4D 3IITA 2ZTXA 1EB1H 1YPMH 2CV3A 1C2EA 1WAYB 1L4DA 1T8MA 2PR3A 3F6UH 4TT3D 2L6OA 1F0SA 1SLXB 1SOTA 4DOQA 3E16B 1C1WH 2ZTZA 3OY6U 4WF8A 3LOXA 1V2UT 1TFXA 2P3UB 1P0SH 1GI5A 1ELFA 4XSKU 7ESTE 1S0RA 1VZQH 2VU8E 3PM3A 3FN8A 3JZ1B 1C5NH 1LQEA 1O2JA 4ABGA 1S0QA 3KIDU 1BUIA 2AGGX 1G37A 1E36B 1BRCE 1Y3YA 1OKXA 2F9PA 2SFAA 3OSYA 1NRQH 1WQSA 3GYLB 4YT6H 2A1DB 1NPMA 2XOKD 1AWHB 4E7NA 3URDA 4BOHA 1F5KU 1QFKH 1TWXB 5DP3A 2KR7A 1C2DA 1QCPA 3K6YA 2PWXA 5AHGH 5HMAA 1JIRA 3C27B 1K1NA 1GHAF 3HK3B 1V2KT 2BD2A 2PP6A 1P2KA 1FIZA 4ZKOU 3RXSA 5JB9S 2Q6GA 2L74A 2QF0A 1JWTA 1IHTH 2WHXA 2VBCA 3BTFE 3UR9A 1T4UH 4DG4A 3OU0A 2QYIA 4D7FA 1Z7KA 3BIUH 1K1LA 3ATLA 1MTNC 1HXEH 3MI4A 1HCGA 3RXHA 2G5NA 3Q3YA 1SQOA 2GV6A 2ESTE 3ATMA 4HGCA 4LZ4B 2VJ1A 3EBNA 1NM6A 2A4QA 3BTEE 3STJA 1GDUA 1GHVH 3DFJA 1AD8H 3QX5H 2YMSD 2ZGBH 5B6LA 1NRNH 1GBDA 1PYTC 2ZGHA 1DX5M 2BM2A 2CHAC 1DWCH 1O34A 1FY4A 2R2WU 2ZPQA 4BTTB 1ELDE 3RXEA 2BQ7B 5HKKD 2FI3E 2ZG0H 2YOLA 4YXWD 1C1TA 3DSGA 1P06A 1QR3E 1GCTC 4NGAH 5JDUB 1NFXA 3E90B 4B75A 1CVWH 3RXBA 1VJ9U 2ZGCA 1W0JD 3VB4A 3QTOH 3F2FA 1UCYH 5HM9A 1HBTH 3A88A 3LGVA 1NT1A 4AG2A 1O2UA 1VITH 1CGIE 4ASUD 1OWJA 4XDEA 1AZZA 3IG6B 4RI0A 1WTGH 3SUEA 5A8YA 1UTOA 3PWBA 3PTNA 2Z3CA 1EPTC 1HFDA 2OD3B 1MKWH 1NBME 2TIOA 3TH4H 2BY5X 2WINI 1JIMA 1N8OC 3QGJA 5HIZA 3SJ9A 1BTHH 1SG8B 2D1JA 1UK3A 3GDSA 1NC6A 1TA6A 1KXEA 4AORA 3GCHB 2EI8A 1Z8RA 1CA0B 5JB8S 1G3BA 2ZZUH 5BRRE 2W6JD 1BRUP 1C2LA 1C2GA 3QGNB 2FOCA 3H5CB 4ZXYH 2EI7A 3L33A 4AX9H 3MH5A 1COWD 1MCTA 2QC2A 5AF9H 1QJ6B 1O5AB 2ZP0H 2BX4A 5I25A 4MNVA 1LPZB 1DFPA 3BV9B 4BAOB 1F7ZA 1LO6A 1KDQA 3RXDA 5DP9A 4YO9A 3ELAH 1AGJA 3T29A 2SGQE 1TPSA 1VJAU 1YF4A 2GCHF 2B9LA 1S82A 1LPKB 1P12E 4JK5A 2THFB 1YM0A 3Q3KA 2PKSB 2UWLA 6LPRA 1KXFA 3UNRA 3AASA 5KEDA 2Z3DA 5LGOA 5FBEA 3FFGA 1B0FA 1IQNA 1OPHB 1XVOA 4ACAA 4BXSA 5BPEA 2LELA 1PPEE 3E6PH 3IWMA 2BD8A 1Y5UT 1M9UA 3FVFB 4UFEH 5A0CA 1QTFA 3MO6A 3HGPA 4NSVA 5AFYH 1O3OA 1OHHD 1TGCA 2VB0A 2ZKSA 1A5GH 2PV9B 3BEIB 5DKMA 1QBNA 2ZIQH 2GGVB 3GCTF 2ZFSA 3KEEA 1F0RA 3M5LA 1Z6JH 3A83A 2IJOB 1L1NA 2J38A 4WH6A 1VCPA 2A7CA 2G8TA 1ZJDA 1P03A 2BXUH 2Y80A 1V2RT 3U28C 1Z6EA 1K28D 1O2QA 3A7WA 1H9HE 2FO9A 2JH5D 3SO3A 3RXIA 4ZMAH 1NU9A 3PMHB 2FX6A 1EZSC 2ZO3H 1GHAG 3FOAA 1PPGE 3MH6A 1AO5A 3A82A 1PPHE 1W2KH 1BTWA 4RKOB 1O3JA 1IHSH 1AE5A 4X2WA 1ESAA 1LVYA 4XBCA 2SNVA 1G3EA 4OM9A 4MDSA 2HGTH 2NU0E 2FODA 4AOQA 4CH8B 1V2JT 3RXVA 4TY6A 1RXPA 2RA0A 2QAAA 5CE1A 1NRRH 5T6GA 2STBE 2W3KA 1EJAA 2A31A 4B74A 4X1RU 4ABIA 1P3CA 5KGOA 3LGIA 1DE7H 1QBOA 2VVCA 1K2I1 2OXSA 1J16A 2WPIS 1HJ8A 4KTUA 1P2JA 4BAQB 3RDZA 1WUNH 2O8MA 2WPHS 2R2MB 1KTSB 1AZ8A 1BQYA 3BTME 2BYAX 1B5GH 3SBKA 1GCDA 2V3HH 3TK5A 3A7YA 1MTVA 3BIVH 2WPKS 3TJOA 3A81A 4KKDA 1D4PB 2P3FH 2HOBA 1O2OA 1FI8A 4OS5A 1P04A 1HGTH 3STIA 2QF3A 4OS1A 1GHBF 1ZPZA 3NPSA 1KTTB 1GJAB 3HATH 4LXBH 2F83A 2HALA 1T8NA 1C9PA 2W7SA 2JETC 5FBIA 3SHCH 5EJLA 1N6XA 1EJNA 1UVSH 1XUJA 3KQ5A 4OS7A 2OLGA 2XBWA 1XXDA 4Q4LA 1MTSA 2XCFA 1EASA 3D62A 1HIAB 4ASHA 2GTBA 1SFIA 1UW7A 1MU8B 1EAWA 2XW9A 3KN2A 1O3PB 2C93B 5I46H 1LHEH 1ZGIA 1QA7A 2JH0D 1O2IA 1OYQA 2SNWA 4B1TA 2FOHA 1UMAH 1CHOF 1ZSKA 1XUKA 3ZZDA 1A0JA 1P01A 2D2DA 1O2RA 1S85A 1C4Y2 1N6YA 2KAIA 4YLUA 1T8OA 2P94A 4WXVA 1TBZH 3ZZAA 1GL1A 2PGBB 4KELA 4AN7A 1GJ6A 1L2EA 3LT3A 3ZVCA 4F48B 4MLFB 2KCYA 2K7XA 3D49H 4IMQA 4JZ1A 3KHVA 3CS7A 3HKIB 3LPRA 1SGIB 3ZZ3A 1P57B 1RGQA 1J17T 1SGYE 4KTCA 3ZZ5A 5G4BA 1NFWA 1TNHA 2BTCE 1K9OE 1O2TA 3HK6B 3A8CA 3SV6A 1GG6B 1EPTA 1VR1H 4ZH8A 1V6DA 2WUBA 3SOSA 4F4OC 2FXRA 2C8WB 3A85A 4NA8A 4WVPE 1XX9A 2GCHG 1EX3A 3SGBE 1EZXC 1AVGH 2ZGXH 1XUFA 4X8VH 1GMHF 3M5NA 1W11U 3LC5A 5EQQA 3MH4A 7LPRA 1DY9A 5FPTA 5K0HA 3WY8A 3MHWU 3PV2A 5EOKA 2A4GA 1O3BA 1LVMA 5FHTA 3ZZBA 1EQ9A 3VGCC 3ZZ9A 2QF4A 1YCPH 1BCUH 3FP8E 1WBGB 4CR5A 5J4SA 3MFJA 1QL8A 4BTIB 2ZU1A 1ZRBA 3UNQA 1LHCH 3GCTG 3RP2A 2I6SA 2ZFPH 1MZAA 1SL3A 1V2QT 2P8OB 3NUMA 2HRVA 4AYVB 5J4QA 2OBOA 2WUCA 3VPKA 1TOMH 2JDID 1AFQB 1OP0A 3P95A 4X1SU 4LZ1H 2AIQA 4K8YA 2H5DA 1OWHA 4Q2KA 1SB1H 2FOBA 4ZROA 1ZMJA 2FOGA 3SZEA 2BLWA 2Y82A 5CDFE 4YT7H 3DHKH 5ETXA 1CQQA 2Y5GA 3OX7U 1Y3UA 2J97A 5F53A 2AFQB 1AY6H 1S5SA 6CHAB 1EOJA 2G81E 4DY7B 1RIWB 1RRKA 1ZSJA 4WY3A 1S6LA 2BLQA 3OEHD 3DSPA 5ESBA 5L30H 3SN8A 1XUIA 1Z8GA 2ZCKP 4MQAA 5EJZA 1EKBB 1ZRKA 4THNH 3TLOA 2H9TH 4MPUA 1ETSH 4A7IB 4AFQA 4ABHA 2PSXA 2ALVA 2VGCC 1YCPK 4B2AA 4UE7H 2UUFB 2XC5A 3OTJE 1SGTA 2EQNA 1LPGB 1N1LA 1B0EA 1O2PA 4ZCNA 4OGXA 3LONA 1CBWC 4FVBA 5EQRA 4DW2U 1BDAA 1GBIA 4UDWH 3CNRA 4FUGA 1ACBE 1ZLRA 2GX4A 4Z0KA 3GOVB 2AYWA 3P6ZB 3VB5A 1SOZA 2KFWA 1MKXH 2ZPRA 4NIXA 1C4U2 1BJUA 2C4FH 2ZHQH 3U1JB 3B23B 2TPIZ 4F49A 1VGCB 1NY22 2GD4B 2EI6A 1DUAA 1H1BA 5E0HA 1J9CH 2Z9IA 2GVFA 1BHXB 1VITF 3SGAE 3Q77A 1GHBG 1S84A 1EAUA 1GBKA 2A5AA 1Y3WA 2GT8A 3F2GA 3MU0A 2CGAA 2ZWLH 5A8XA 2PSYA 2W3IA 4KP0A 4HZHA 4INLA 2BMGB 3KCGH 4AG1A 1CHGA 2FMJA 1BMAA 2BX3A 4TSFD 1FN6A 2P16A 4K60A 2ZNKH 1DXWA 1UVOA 2P95A 3Q76A 2OP9A 1TMUH 2A0QB 2WYJA 4AGKA 3PTBA 1LQDB 2ZDMA 2OC1A 1UVPA 1HXFH 4H42U 3A87A 1LDTT 1W10U 1GBAA 4D9QA 5GWZA 3A80A 4CRAA 5LH8A 3MOCA 3MNCA 3ZZ7A 1BTXA 3PLKA 4ISHH 2AMQA 2F9VA 3VB3A 1JRSA 3PRDA 2QE7D 1TRMA 1AHTH 3T27A 5A09A 2GCTB 4X1PU 4AFUA 4INHA 1BJVA 1DUEA 1PQ7A 1EZQA 3TGIE 1OP2A 1HDTH 4ABJA 2SGEE 2Y7XA 3RXJA 3PLPA 1A46H 2P93A 4A1TA 2QN5T 4K2YA 2JKHA 1GMHG 1TABE 2FLBH 3MNXA 3P92A 3CS0A 2BQWB 4FVDA 2QA9E 1UTNA 4RSPA 2ZI2H 2FOAA 1J15A 2EA3A 1UTKA 4B2CA 4AFZA 1O3NA 2TRMA 1QQUA 1TE0A 2XCNA 2NU4E 2O8UA 4X8UH 1IQHA 2SGFE 1BMNH 1THPB 4YOJA 1O3MA 1FY1A 1Y59T 1AE8H 4NIWA 5C5OA 1GJCB 5A2MH 4X6NA 3RU4E 4JYTA 1TYNA 3UTUH 4UEHH 4TYDA 1MABB 1O2NA 5EPYA 3QO6A 4YZUA 5EGMA 1O5BB 2IN2A 3S7HB 1A3EH 4CREA 1MH0A 1TPAE 3BTKE 1CA0C 4X2YA 1C2HA 3E8LA 2UWPA 1ANBA 3ITIA 1C1RA 2BDCA 2UWOA 1MTWA 1E1RD 2FX4A 1FAXA 1P02A 3RXUA 1O35A 2RCEA 3QUMP 3KNXA 2GJGA 1ZHMA 2PUQH 2Z6BD 2TGAA 2HNTC 1GMDF 4KGAA 2BQ6B 1GBLA 2ULLA 1BTPA 3RC5A 1W0KD 1QJ7B 4H6SB 1O3FA 1K1JA 1P2QA 4NFEA 1KDQB 2ZU2A 1W8BH 1NRSH 1E35B 3MU4A 1DICA 1V2LT 2Q6FA 3BG4B 1S83A 2CJIA 4A92A 1A5IA 4E7RG 5A8ZA 1FUJA 1YLNA 2RG3A 3LGWA 1PPFE 4GUXA 3A89A 4NCYA 2BVRH 4FU9A 3WWFA 3F9HA 2CF9H 2LPRA 1FMGA 5E0GA 1OWIA 4CHAB 1V2NT 1FY3A 2XTTB 3RC4A 1Y3VA 4FUIA 2A4OA 1CGJE 1SGFG 1TMTH 2JJ2D 2QIQA 3L3TA 1BBRH 3ATIA 4RT0A 1ZHRA 2ZHEH 1TGNA 3LH1A 3OTPA 3RM0H 3RU4T 5KECA 3RMNH 2TGDA 2XBYA 4Y0YE 2BB4A 2FI4E 1C4V2 3MYWA 1C1SA 4DCDA 5F8XA 4INKA 2PUXB 4CH2B 2Z3EA 3AAVA 4U32A 1GBMA 3LGUA 2K8IA 1ESTA 3M5MA 2HLDD 3MU5A 4ISIH 2XNIA 3DSOA 4DIIH 1K1PA 2ALPA 1KLTA 1V2VT 4HI3A 1D3TB 2A7JA 2BY9X 3FP7E 4ISOA 3RLWH 1O3GA 2A5IA 1QA0A 2Y7ZA 3SV9A 3RXRA 1ANCA 1IQIA 1FAKH 2HLCA 2H2ZA 1KY9A 2V3OH 4FOUC 2RDEA 9LPRA 1K22H 3F0OA 2Q6DA 2BDYA 1ARCA 1VITG 1K1IA 2C8YB 4AC9A 4B6EA 2OCVB 4IBLH 2GZ8A 2H5CA 2WV4A 1SGRE 3UQOA 1ZTLA 3W94A 4M9FA 4PROA 5DP7A 1BRAA 3AK5A 1D9IA 3RXLA 1GDQA 3RXAA 3BF6H 5EG4A 1C5MD 3EDXB 1RS0A 1SGNE 1AMHA 1KXAA 1CE5A 2OQ5A 3BG8A 1LKBA 4IN2A 4U30A 2VH0A 4B2BA 1VCWA 4I8LA 4NG9H 1SQRA 5GCHF 3TNTA 1F92A 1KYNA 2RA3A 3UUZA 1T8LA 1DWDH 2HVYB 3C1KA 2V0BA 1EZUC 3PMAB 2ZCLP 1EOLA 4TY7A 2IPHA 1DY8A 1DSUA 3F3BA 3NXPA 2SGPE 4HG6A 1MQ6A 1TQ7B 3E0PB 1Y5BT 2O9QA 3EGKH 1AI8H 2OC8A 4VGCC 4CBOA 1PJPA 4MPWA 8KME2 2BD3A 4P02A 4D9RA 2GZ7A 2GDDA 5E0JA 1UCYK 3JZ2B 1YBWA 5E8EH 1KLIH 1KXCA 2AHME 2FOEA 2PKAB 4FUDA 4O9VA 3SU5A 5TCAA 3BTDE 5DK1A 1A1RA 1O3HA 1LKAA 1E0FD 2ZF0H 1D6RA 4ZHAA 1MKWK 1AKSA 1F0TA 3OYPA 4K69A 3UY9A 1EJMA 1NS3A 4NIYA 2GDEH 3LH3A 3ZZ4A 1P9UA 3LKWA 1SVPA 5C1YA 3S9BA 2YNAA 1MD8A 3KQBA 2XC4A 5HGGA 3T28A 2FOMB 1GJ7B 5HYOA 1MD7A 1TX8A 3TGKE 3S69A 4XBBA 1FXYA 1Y3XA 1GBJA 1QHRB 3SU2A 2EEKA 2RFKC 4NSYA 2TBSA 1QL7A 3SNCA 1SGQE 2HWLB 4YESB 2F4LA 2G4UA 4HTCH 1SGPE 2BD4A 6ESTA 3RMOH 1MAYA 4ABDA 2KAIB 1XXFA 1XM1A 2VWMA 1O0DH 4YM9A 1GCTB 1GI8B 3LU9B 1YP9A 3VB6A 4XOJA 3O8RA 1ELGA 4NZQA 1ETRH 5T6DA 2BD9A 1W7XH 1NO9H 1WQVH 4WMDA 1L1JA 4JYUH 2SGAA 1ZPCA 3F1SB 4YTAA 1LCYA 5EQSA 1GMDG 4P00A 2UUYA 4I8KA 1DOJA 1MUEB 2O8TA 1EPTB 4AGJA 1DANH 1BMMH 1O38A 4ZKNU 1ZR0A 1S6HA 1NFUA 3WWBA 4ACBA 3I77A 3PWCA 4CRCA 4CR9A 1N8OB 1BMFD 1P09A 4FUBA 4MVNA 1H8HD 5JPMH 1GMCF 1EAXA 4AZ2B 4ZHMU 1DWBH 1L4ZA 1G9IE 2RDLA 2WV5A 1HJAB 1GHZA 2BLVA 3UNSA 1TNIA 3RLYH 2NU1E 3PRBA 5C17A 1JRTA 1E38B 5JYIA 4X8TH 3G01A 4WJG2 5CMXH 3LC3A 2LIZA 1SLWB 4LK4A 2K1QA 5JBCS 3E3TA 3K9XB 3K2UA 5L2ZH 2BXTH 3T62A 2FPZA 3TGJE 1D3PB 3URCA 4A1XA 2WPJS 1SHYA 2R9PA 1HAVA 2A2QH 1UTLM 2Z9GA 1QL9A 1MZDA 1PQ5A 4IMZA 3U8OH 3V0XA 4NIVA 1ZGVA 2FIRH 1UTJA 3SJKA 1QZ8A 2P59A 3H7OA 3DFLA 4OGYA 1YPEH 3PO1C 4ZKSU 3EAJA 1TQ0B 5HM2A 4FUJA 2FTLE 2JJ1D 4F55A 2FWWA 3DCLA 5HXFA 2DE9A 4XD7D 1QJ1B 3O8DA 2HPPH 3MH7A 5CHAC 3UIRA 1FX0B 5EXNA 3SV7A 4KTSA 3ATKA 2BDHA 2J92A 3FAOA 1OWDA 3BN9A 3SI3H 3DD2H 6GCHF 1DWEH 4AYYB 4IGDA 1C5TA 1HRTH 1ZOMA 1UTQA 1BITA 3QDZB 2NU3E 4RKJB 1O31A 1GI2A 1O5DH 6CHAC 5IYTA 4YOIA 2BOKA 1FQ3A 1DPOA 2A45B 5GCHG 5T3HA 1SGFA 4GPGA 1KSNA 1O2XA 1YPHE 1P2MA 1ELVA 1AIXH 1A2CH 1TALA 2XWAA 2HVXA 2XYAA 3PB1E 1JXPA 1FY5A 4I8HA 4GSOA 1O3IA 3SZNA 2WV9A 3GICB 3DT0H 2UUJB 1IQFA 4O03A 1QB6A 4X6OA 2R3YA 2QF5A 5FX5A 3RC6A 4GHTA 3HKJB 1K0HA 2GT7A 1J14A 1CO7E 1BTZA 1RFNA 1O2SA 1H9LB 4WXIA 1QRWA 3EA9A 2STAE 1C5SA 1TBRH 2ZU3A 1GBCA 1YLDA 2VWNA 2J5UA 4ZUHA 2ZFFH 2ILNA 1DDJA 5C94A 3RXGA 1H8IH 3RM2H 4BAKB 4DGJA 2XC0A 1A5HA 1TPOA 1C5QA 2ZPSA 1C1VH 4DURA 3TK9A 4UD9H 2M5TA 5DO4H 1V2TT 3SYJA 1GL0E 1GI7B 4OS2A 1PPBH 4X2VA 1GI0A 3M7QA 1V2MT 1AUTC 1TA2A 1O2VA 2ZFQH 4U01A 5F8ZA 1OP8A 1MBQA 2EC9H 3PMBB 1YPGH 1P2IA 2GMTB 3SJIA 5L6NH 3E91A 4XFQA 2ZC9H 3FKSD 4WWYA 5F03A 1ANDA 2BY6X 2F9NA 3A7ZA 1C5OH 1MCVA 2HNTF 3T2NA 1HAHH 4DIHH 1UTMA 2Z9LA 4RN6A 1EP5A 4GAWA 1TOCB 3SV8A 4LOYH 2AH4X 1O33A 3RXOA 1SFQB 3M7TA 1AWFH 3UPEA 3ESTA 2HNTE 1KXBA 3EA7A 1TGBA 3CENA 4AFSA 1ELAA 4NZLA 1CT4E 1LHGH 2YMSB 1C5PA 3FANA 1GVZA 4ABEA 1XKAC 3FZDA 2C3SA 1CA8B 2GP9B 1GVLA 4CBNA 2B5TB 1Y8TA 1HNEE 2M2AA 2GCTC 1GJ4H 2ANYA 3F0PA 1LVBA 1HYLA 3FP6E 2F9BH 5EIYA 1HAXB 1BOQA 4MTBA 3NZIA 1EFRD 3QN7A 2VIVA 3RXFA 1O5GH 3ZVDA 2ZDKA 1YCPM 1GMCG 1FV9A 3GY7A 3N7OA 2VWOA 1HAPH 1XKBC 2R0LA 2FTMA 2QY0B 2QCYA 3U8RH 1HIAA 1IQGA 1UVUH 5TCCA 1THRH 2OK5A 1GPZA 1SMFE 1A0LA 5FXLA 3BTGE 2D8WA 2Q1JA 3M36A 2OQUA 1TNJA 5JBAS 1T4VH 5DP4A 1L0ZA 4CRGA 4BNRA 1D6WA 2Y81A 1RD3B 3T5FH 2AMPA 2KCAA 4ABAA 1DXPA 1SSXA 2ZHDA 3VG8A 1TB6H 3S7KB 2XWBI 1GI9B 2W5EA 2FDAA 4JZIA 2ANKH 1BBRE 4U2WA 2PTNA 3N7DA 5C3NA 3U69H 3LIWA 1NZQH 1O2GH 1H4WA 1WXRA 1MTUA 1GI6A 5DJ7A 4GCHF 2XBVA 1SQAA 3LJJA 1TPPA 1HAYB 5K7RA 1GHWH 5C0UA 1O2YA 1UK2A 5GDSH 1GJDB 1NU7B 1H9IE 1YLCA 2ZDNA 2VIDA 1IQMA 2ZEBA 1C5ZB 4JZEH 1GHYH 2GV7A 1WTHD 5E2PA 3OFND 1P2NA 1SHHB 5PTPA 3VGCB 6GCHG 1O2ZA 1JBUH 1GDNA 1E79D 1P9SA 1OS8A 2EY4C 1C5XB 1NROH 1A61H 3LDXH 4JYVH 1C2MA 1CSOE 1DITH 3GY2A 1CHOG 2G5VA 4ESTE 1BZXE 2H6MA 1WV7H 1PQAA
chains in the Genus database with same CATH topology
1F0UA 1GBFA 2A2XH 4JCNA 9ESTA 1MMJN 1YPHC 4BAMB 1IQLA 1G3DA 3ATWA 1OWEA 1QIXB 1ZSLA 4R8TB 1GVKB 3MU1A 3RXMA 3TK6A 3GISB 1O3CA 3MU8A 3TPIZ 3MWIU 1TRNA 2WYGA 1SGDE 4H4FA 1W3CA 1O36A 3SUDA 1ZTJA 1SGEE 5T6FA 1FPHH 1IAUA 1GBBA 1MKXK 4I8JA 1TMBH 4JZFH 3O8BA 1YPKH 3A8BA 3P70B 1GBHA 2VIOA 4YOGA 4Q80A 4B73A 1MBMA 3SJOA 3UFAA 2F91A 2G52A 3TJUA 2XBXA 2J2UA 3S0NA 2A5KA 4ABFA 4K3JA 3GY4A 3NK8A 5C1XA 3PYHA 1AB9B 2D26C 1W0YH 2ANMH 3P8FA 4UONA 4D76A 2QGRA 2ODQA 1GJ8B 3P17H 1O30A 2G55A 4X0WU 2Z9JA 1BTUA 3M3TA 1SLVB 1TAWA 2VGCB 1NRPH 3PLBA 1IQEA 3ZYDA 4Y79A 3D65E 1MQ5A 4NA7A 2ANWA 4K1SA 3ENSB 3MNBA 4BXWA 1NESE 2A32A 1O2HA 2VH6A 5H4IB 1C5VA 3GYMA 2J95A 4M7GA 2OBQA 5LPRA 5GJ4B 1C9TA 3MO3A 2B7DH 3GCHC 1AQ7A 1CBWB 4ISLA 4GLYA 1YYY1 1GGDB 1DS2E 3I29A 3PROA 1E34B 2G51A 1U6QA 3A86A 4JMYA 5EPNA 2J94A 3GCNA 3QK1A 4D8NA 3M7UA 1A4WH 2FS8A 4FUCA 3KGPA 4IN1A 1J8AA 1UHBA 1ZYOA 1W13U 3F68H 4BANB 1FN8A 3A7XA 1Z1JA 1GJ5H 1ELEE 3QZRA 1FJSA 3UWJH 7GCHF 1ELCA 1EXFA 3GY5A 1ZMLA 3NKKA 2BHGA 4TWWA 2J4IA 2PFEA 1Z71A 3V13A 2Y6TA 4J1YA 2HPQH 2BDBA 4SGAE 4XBDA 1AU8A 1T31A 2ZCHP 1LTOA 1AKSB 5C2ZA 5DG6A 4Y7BA 3SU3A 1DT2A 1TX6A 3SU4A 1A3BH 2PKSC 1O3EA 4Y11E 3SV2H 3UOUA 3ZYEA 1G2MA 2VVVA 5F6MA 4ZAEA 4J2YB 2CN0H 1PPCE 3B8JA 3U1IB 4WMFA 3MNSA 1O2WA 2NU2E 1L1GA 3S9AA 3RXKA 1HAGE 3GY6A 3SQHE 3F9EA 2B8OH 4O97A 1QURH 3RMLH 2CMYA 5JBTA 4NWLA 4WMEA 1RTKA 2H9EH 3A84A 1O3LA 5FCRA 2V6NA 4I31A 3U9AH 1UVTH 2OC0A 2OUAA 3RXQA 1O2LA 2A7HA 1AN1E 1FZZA 2W7UA 4FU7A 1JOUB 4GCHG 3V3MA 3SU6A 1GBEA 3TJVA 3TNSA 3Q00A 3KQCA 1OXGA 4B76A 1O2KA 2BOHB 4K5ZA 1T32A 4CRDA 5LPFA 3A8DA 3KQDA 1SR5C 1W14U 1OWKA 4FU8A 1UK4A 2LNCA 1D3DB 3M37A 2W26A 3ODFA 2ASUB 3HGNA 3R0FA 1C2JA 4E06H 1DLKB 1UO6A 1BBRK 2FLRH 3RUOA 3GCOA 3SORA 2BZAA 4IC6A 5FPYA 5ABWA 1HJAC 1RTLA 1KIGH 2F9OA 1C1NA 4UFDH 2QXGA 2VNTA 3ZV9A 3RXTA 1DM4B 2QV1A 1Y5AT 4OS6A 1AVWA 1ZTKA 1X7AC 1QB9A 3ZZ8A 2UUKB 4MNWA 5EODA 3I78A 1GHXH 1Q3XA 2G00A 1Z8JB 2BZ6H 2VIPA 5EXMA 1HAVB 3SU0A 2QXHA 4X1NU 1BHXF 1E37B 3TH3H 2Z94A 1BT7A 4YLQH 1C5LH 1UJ1A 2DUCA 3SI4H 2BD5A 3QZQA 5C67A 5A0AE 4K1TA 1MTNB 1QBVH 2A4RA 1G36A 2O8WA 1BA8B 3AW1A 3BEFB 3U8TH 4I7YH 3VXFH 1ESBA 4FUEA 4Y7AA 1TIOA 3NWUA 1SPJA 2AERH 4SGBE 2ZQ1A 4GHQA 2XXLA 3TJNA 1EP6A 3LJOA 3RXCA 1TBQH 2CF8H 7KMEH 2BDAA 2BD7A 1XUGA 1ABIH 5C20A 3MMGA 4Q7XA 3V12A 1F5RA 1VCQA 4ZHLU 4AB8A 3UWIA 1C2FA 4I32A 4QT8C 1DLEA 1YC0A 2CHAB 4O3TA 2C90B 3MTYA 1GI1A 4ZXXH 3BTQE 1BTYA 2H9HA 3H7TA 3EQ0H 4E05H 4K1EA 5IDKA 3OY5U 3LGTA 1SC8U 4B71A 1WOFA 2I6QA 1O39A 3KQEA 5GIBA 2PLXA 3GDVA 5EW2H 1NN6A 2VIQA 4FXGH 5B6OA 4JK6A 1CU1A 1FIWA 1DVAH 2BY7X 2VIWA 4NFFA 1CT2E 4BTUB 5FX6A 3TH2H 4JZDH 4Y6DA 1O3DA 3KL6A 4A5TS 1C5WB 1OSSA 1V3XA 3LGYA 7GCHG 1BIOA 1O5CB 3F9FA 1GG6C 2SGDE 1HJ9A 4OS4A 2AS9A 4X1QU 1QB1A 1JMOH 3D23A 3BSQA 2C8XB 1SGCA 1TNKA 2C8ZB 5FCKA 1PPZA 1QY6A 2IOTA 8GCHF 4FUFA 1A7SA 1XUHA 2ZHWH 3U98H 2Z9KA 1C1UH 3A8AA 1IQKA 3M61U 1BMLA 2OC7A 2YNBA 4AB9A 1GBTA 3P8OA 3UR6A 1GI3A 1WCZA 5F8TA 3M3VA 1TRYA 4VGCB 2ZDLA 3T26A 2BY8X 1OYTH 1O3KA 3SU1A 3SJ8A 2P8OC 2GMTC 1Z1IA 2Z7FE 1D3QB 4ABBA 1P05A 1F2SE 1V2OT 1KXDA 1AFQC 1O37A 1SI5H 4I8GA 3EE0B 5GPIB 2CXVA 3ODDA 4IW4E 3M35A 8ESTE 3CP7A 2PKAA 3W95A 1C5YB 1FY8E 1C1OA 1HPGA 3VB7A 1TNLA 4NA9H 5C1UA 1IOEA 4D7GA 3UOPA 2OTVA 3E0NB 3M5OA 1LMWB 3KF2A 1WSSH 4NWKA 1QRXA 3A7VA 3AVZA 5FPSA 1QQ4A 3SUFA 1G2LA 1RIWC 4IC5A 4MPXA 3ZVBA 2TGTA 5LPEA 1NTPA 1EAIA 4Y71A 1PFXC 1LHDH 3M3SA 1EB2A 2PTCE 3EYDA 4XE4A 4Y76A 3VXEH 3AW0A 3ZV8A 2QXIA 5C5NA 2NWNA 1ARBA 4X6MA 2ZTYA 4Y10E 3A7TA 1YKTA 5A0BA 1FNIA 5L2YH 1ID5H 2BDIA 2XRCA 1SQTA 3Q3XA 3PMJA 1HB0B 2R3UA 5EXLA 1O32A 2O8LA 4MNXA 3FZZA 4WH8A 2AGIX 1C2IA 3T25A 1ORFA 5DP8A 1YPJH 2V35A 3L6PA 1ABJH 3RXPA 3SHAH 2VWLA 1C1PA 2ZFRH 4MPVA 4DVAU 4MNYA 2AEIH 2ZGJA 2FP7B 1HV7A 5DGJA 3BTTE 1HLTH 2QXJA 3GDUA 4CRBA 1C2KA 2B0FA 2AMDA 3DUXH 3ZZCA 1VGCC 2ZU5A 4R0IA 1F5LA 4HFPB 1C1QA 4DJZB 3SNEA 1H8DH 4ZKRU 5EU8A 5DP6A 2Y5FA 2WPMS 4BAHB 3VEQB 2G4TA 2J34A 1FPCH 1AVXA 2ZFTA 2GZ9A 1W12U 1Q2WA 3NCLA 5TJXA 1G3CA 1O3AA 1TX7A 3ZVGA 1V2PT 1OX1A 1ZHPA 3GY3A 1BRBE 1TGSZ 3GY8A 3BTWE 2H1UA 3ZVEA 1QNJA 1QGFA 3UREA 2ZDAH 3K65B 2R0KA 3R3GB 2TGPZ 5GXPA 2Y5HA 2FESH 1S6FA 5DP5A 5E2OA 1WYKA 2FI5E 1W0ZU 3SNBA 2PW8H 1V2ST 5ESTE 1BB0B 1K1MA 4FUHA 1UTPA 1TNGA 1GJBB 2FEQH 3PO1B 1S81A 4K8BA 1ETTH 1P11E 2ODPA 3QLPH 4X6PA 1WU1A 2JETB 1CT0E 1P10A 1O2MA 3RMMH 1LHFH 4I33A 5CHAB 4X2XA 2VINA 1FDPA 2AIPA 2ODYB 2OINA 1EATA 4IS5A 5FAHA 2AGEX 2J9NA 1PYTD 1O5EH 2P3TB 4Y0ZE 1T7CA 5SGAE 1TGTA 1ZJKA 5AVDA 4Y8XA 3BEUA 4Z6AH 1HAIH 1Z8IB 1AB9C 3SNDA 2ZU4A 2VVUA 4UFGH 8GCHG 3S9CA 2FS9A 1YGCH 4O3UA 1G32B 3SQEE 3TU7H 4MG3A 1QRZA 1CGHA 4Q7ZA 1OOKB 1ELBA 3V7TA 4Y8YA 3VFEA 1YPLH 1ZZZA 4A6LA 3QWCH 1MAXA 2BVSH 1GWAA 4TPIZ 3TITA 5EW1H 1HAOH 4H6TA 2ZQ2A 1EUFA 2BVXH 2F9UA 1SBWA 1GGDC 2ZECA 1P8VC 3QTVH 1AFEH 1MU6B 1UHBB 4Q7YA 4X8SH 4A1VA 3ZZ6A 1P2OA 4GVUA 1ZPBA 2ZA5A 1A0HB 3E1XB 1GI4A 1C5RA 4DT7B 3SW2B 1GJ9B 4Y8ZA 1LVOA 2ZDVH 3F9GA 2F3CE 1Q31A 3PV4A 3SNAA 1THSH 1PQ8A 3BTHE 3P8GA 5AFZH 1P3EA 3BG4C 2BDGA 1HUTH 2BLOA 1KLJH 1K1OA 1W7GH 1UCYE 2ZHFH 1ZMNA 3B9FH 3K6ZA 1XMNB 1C1MA 2GKVE 5JBBS 2FYRA 1RJXB 2FM2A 2JH6D 1IQJA 1HAZB 4UFFH 1FLEE 1C5UA 1K21H 1ELTA 4CHAC 3P8NA 1FONA 1B7XB 4ISNA 2FYQA 1DSTA 1INCA 5DPAA 3TVJB 2PHBA 1G30B 4TPYA 4CRFA 3O8CA 3DA9B 3HPTB 1RTFB 3UQVA 2PGQB 2DE8A 1SLUB 1TLDA 1ANEA 3ZVFA 1XVMA 3EA8A 3TIUA 1O5FH 1V2WT 1AUJA 1NFYA 2FOFA 3SGQE 1TONA 3AAUA 2WPLS 4TWYA 3ZVAA 3MO9A 8LPRA 3SUGA 2FZZA 3RU4D 3IITA 2ZTXA 1EB1H 1YPMH 2CV3A 1C2EA 1WAYB 1L4DA 1T8MA 2PR3A 3F6UH 1F0SA 1SLXB 1SOTA 4DOQA 3E16B 1C1WH 2ZTZA 3OY6U 4WF8A 3LOXA 1V2UT 1TFXA 2P3UB 1P0SH 1GI5A 1ELFA 4XSKU 7ESTE 1S0RA 1VZQH 2VU8E 3PM3A 3JZ1B 1C5NH 1LQEA 1O2JA 4ABGA 1S0QA 3KIDU 1BUIA 2AGGX 1G37A 1E36B 1BRCE 1Y3YA 1OKXA 2F9PA 2SFAA 3OSYA 1NRQH 1WQSA 3GYLB 4YT6H 2A1DB 1NPMA 1AWHB 4E7NA 3URDA 4BOHA 1F5KU 1QFKH 1TWXB 5DP3A 1C2DA 1QCPA 3K6YA 2PWXA 5AHGH 5HMAA 1JIRA 3C27B 1K1NA 1GHAF 3HK3B 1V2KT 2BD2A 1P2KA 1FIZA 4ZKOU 3RXSA 5JB9S 2Q6GA 2QF0A 1JWTA 1IHTH 3BTFE 3UR9A 1T4UH 4DG4A 3OU0A 2QYIA 4D7FA 1Z7KA 3BIUH 1K1LA 3ATLA 1MTNC 1HXEH 3MI4A 1HCGA 3RXHA 2G5NA 3Q3YA 1SQOA 2GV6A 2ESTE 3ATMA 4HGCA 4LZ4B 2VJ1A 3EBNA 1NM6A 2A4QA 3BTEE 3STJA 1GDUA 1GHVH 3DFJA 1AD8H 3QX5H 2ZGBH 1NRNH 1GBDA 1PYTC 2ZGHA 1DX5M 2BM2A 2CHAC 1DWCH 1O34A 1FY4A 2R2WU 2ZPQA 4BTTB 1ELDE 3RXEA 2BQ7B 2FI3E 2ZG0H 2YOLA 1C1TA 1P06A 1QR3E 1GCTC 4NGAH 5JDUB 1NFXA 3E90B 4B75A 1CVWH 3RXBA 1VJ9U 2ZGCA 3VB4A 3QTOH 5HM9A 1UCYH 1HBTH 3A88A 3LGVA 1NT1A 4AG2A 1O2UA 1VITH 1CGIE 1OWJA 4XDEA 1AZZA 3IG6B 1WTGH 3SUEA 5A8YA 1UTOA 3PWBA 3PTNA 2Z3CA 1EPTC 1HFDA 2OD3B 1MKWH 2TIOA 3TH4H 2BY5X 2WINI 1JIMA 1N8OC 3QGJA 3SJ9A 1BTHH 1SG8B 2D1JA 1UK3A 3GDSA 1NC6A 1TA6A 1KXEA 4AORA 3GCHB 2EI8A 1Z8RA 1CA0B 5JB8S 1G3BA 2ZZUH 5BRRE 1BRUP 1C2LA 1C2GA 3QGNB 2FOCA 3H5CB 4ZXYH 2EI7A 3L33A 4AX9H 3MH5A 1MCTA 2QC2A 5AF9H 1QJ6B 1O5AB 2ZP0H 2BX4A 5I25A 4MNVA 1LPZB 1DFPA 3BV9B 4BAOB 1F7ZA 1LO6A 1KDQA 3RXDA 5DP9A 4YO9A 3ELAH 1AGJA 3T29A 2SGQE 1TPSA 1VJAU 1YF4A 2GCHF 2B9LA 1S82A 1LPKB 1P12E 4JK5A 2THFB 1YM0A 3Q3KA 2PKSB 2UWLA 6LPRA 1KXFA 3UNRA 3AASA 2Z3DA 5LGOA 5FBEA 3FFGA 1B0FA 1IQNA 1OPHB 1XVOA 4BXSA 5BPEA 1PPEE 3E6PH 3IWMA 2BD8A 1Y5UT 1M9UA 3FVFB 4UFEH 5A0CA 1QTFA 3MO6A 3HGPA 4NSVA 5AFYH 1O3OA 1TGCA 2VB0A 2ZKSA 1A5GH 2PV9B 3BEIB 5DKMA 1QBNA 2ZIQH 2GGVB 3GCTF 2ZFSA 3KEEA 1F0RA 3M5LA 1Z6JH 3A83A 2IJOB 1L1NA 2J38A 4WH6A 1VCPA 2A7CA 2G8TA 1ZJDA 1P03A 2BXUH 2Y80A 1V2RT 1Z6EA 1K28D 1O2QA 3A7WA 1H9HE 2FO9A 2JH5D 3SO3A 3RXIA 4ZMAH 1NU9A 3PMHB 2FX6A 1EZSC 2ZO3H 1GHAG 1PPGE 3MH6A 1AO5A 3A82A 1PPHE 1W2KH 1BTWA 4RKOB 1O3JA 1IHSH 1AE5A 4X2WA 1ESAA 1LVYA 4XBCA 2SNVA 1G3EA 4MDSA 2HGTH 2NU0E 2FODA 4AOQA 4CH8B 1V2JT 3RXVA 4TY6A 1RXPA 2RA0A 2QAAA 5CE1A 1NRRH 5T6GA 2STBE 2W3KA 1EJAA 2A31A 4B74A 4X1RU 4ABIA 1P3CA 3LGIA 1DE7H 1QBOA 2VVCA 1K2I1 2OXSA 1J16A 2WPIS