4FVDA

Crystal structure of ev71 2a proteinase c110a mutant in complex with substrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase substrate
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
total genus 36
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvdA01
4H42U 4UFDH 1O3CA 2AH4X 1O2TA 3C27B 1O2VA 2W7SA 1O2GH 4BAQB 1N1LA 3MU4A 3TK5A 2VWMA 3SQHE 1G37A 1CQQA 3LGTA 2P16A 3SV6A 1SG8B 1UTNA 2NU1E 2QXIA 3HK3B 1Z6EA 1A61H 3TU7H 2HLCA 5SGAE 1FY8E 3SNEA 3OYPA 1QQUA 1NM6A 1BA8B 4K1EA 1UTQA 4MNYA 1WTGH 1P04A 3M7QA 3KN2A 1VCPA 4UFGH 1AFQC 2BVSH 2AYWA 1C1MA 2OBQA 3SJIA 1C1TA 3E16B 1LHEH 1CBWB 2GCTC 3KIDU 4BAMB 1EASA 1MZAA 4FXGH 1OSSA 3CP7A 4K1TA 4ZXYH 1P2IA 1NTPA 1IQNA 4NG9H 2FI3E 2WV4A 3SNDA 5ETXA 3UQVA 1C5TA 1EZQA 1SGDE 1W13U 2EI8A 4HTCH 2BY8X 1Z1JA 2PKAB 3SU1A 1HIAB 3KEEA 2XC5A 4XBCA 4GCHG 1C5PA 1K1LA 2CV3A 4YT6H 1ELGA 4ZKOU 4YTAA 3SJOA 3FZZA 4OGYA 1BBRH 1TMUH 1TX6A 1GCTC 1DPOA 3A82A 4X6OA 2RA3A 2A5IA 5AFZH 4UONA 1V2LT 1O3NA 1HFDA 1P57B 2BD7A 1NROH 3V12A 4A6LA 1NU7B 1AVXA 1XM1A 1D3TB 1V6DA 2VIPA 2SNVA 1PYTD 2R2WU 1DY8A 1O2UA 1BHXF 1CU1A 1LHDH 2A7CA 4X0WU 4Q7YA 3U8RH 1O2LA 2TGTA 3L6PA 1W14U 1TFXA 1QB9A 2AFQB 3RXIA 1OWJA 3SW2B 4FVBA 4ZUHA 2SGDE 3E1XB 1E37B 1TRNA 1YP9A 4FUEA 1TONA 3QWCH 3FP6E 4LOYH 1A5GH 4ABFA 1QB6A 2GKVE 1OYQA 1C5NH 3PTNA 1KIGH 6GCHF 1CA0B 4CREA 2ZHWH 1OWKA 1C4Y2 2H2ZA 4JZFH 3DD2H 1T8NA 3MNCA 3SU5A 1J9CH 1GJAB 2JH0D 4MTBA 1SGFG 4AYVB 1KXFA 3T5FH 1AGJA 1GJ9B 1NRNH 4AFQA 4CRAA 3GICB 4UDWH 1YYY1 4OGXA 3LGWA 3RXHA 1JRTA 1DWDH 1YPLH 3T27A 4AOQA 2WUCA 2FS8A 4GSOA 3A8DA 4YESB 3RXKA 3FAOA 3F9FA 2C90B 1E34B 2QF3A 1O2JA 3TJNA 1GMDG 4R8TB 1UK4A 1IQHA 3VXEH 1KXBA 4GAWA 1A46H 1C2GA 1DY9A 2AGEX 2SGPE 1GI6A 1TNKA 4Y7AA 2ZGHA 2GD4B 3SGAE 5C20A 1QBVH 1G9IE 1AB9B 3HK6B 3RXDA 1A2CH 4DG4A 4K60A 1EB2A 1O3FA 1P10A 1MBMA 4X1NU 4U32A 3GY4A 1V2PT 1NFXA 2UUFB 1TGTA 3T25A 1QA7A 3K2UA 5T6GA 1AKSA 1BTYA 2ZP0H 2F9OA 1EAIA 2ZKSA 1D6RA 4OS4A 4X1RU 1GBMA 3PMJA 1XXFA 5DJ7A 1JBUH 1TQ7B 5K7RA 3I29A 1CBWC 2Z9KA 1J16A 1OWIA 1BBRK 4D9RA 1PPBH 1FI8A 1TPAE 5F6MA 1GJ6A 3KF2A 2NWNA 3MNBA 4Q7ZA 1AZZA 1P03A 3PWBA 4Y10E 5JBBS 1V2RT 4X2WA 3TITA 2H5DA 2QF0A 3D62A 3SV7A 2YOLA 1O32A 3S0NA 3PYHA 3PROA 2G5NA 1SGTA 1UVPA 2TIOA 2G4TA 1HAOH 1LVYA 2O8TA 2UWPA 5JBAS 2HPQH 2ANMH 1TGCA 1F0UA 1UVTH 1MCTA 3STJA 2A0QB 2FLBH 1C2KA 2FMJA 3U1JB 1H4WA 3CS0A 1T7CA 2CXVA 1ELVA 1NFUA 1ORFA 2J95A 1GBBA 4GVUA 4MPVA 3QTOH 1DDJA 1C5YB 1WQSA 4ZHAA 1H8DH 5HM9A 1D4PB 3RUOA 1ZTKA 3PLPA 3ATLA 4OS2A 1K21H 1GHZA 1V2OT 3V7TA 2BLWA 2XCNA 2ZC9H 5EODA 1JXPA 1P3EA 2G00A 3SNAA 1Y5BT 3ZV9A 4AB8A 4KTSA 2BD3A 1QRXA 3S7KB 1V2TT 7GCHF 1TNGA 2A7JA 1H9LB 1AMHA 1L0ZA 1IAUA 2ULLA 2FYQA 1HAPH 3E0PB 3P8GA 3DFLA 3LGIA 5IDKA 2V6NA 1CGHA 1GBDA 3BEFB 1JIRA 2BQ7B 2ZTZA 1O3HA 3SNBA 2QIQA 2UUYA 1DANH 1O5GH 2G81E 4NA8A 1UTMA 4RKOB 4D8NA 1GJ4H 1D9IA 1V2UT 3LJOA 3LONA 1T8LA 1FY3A 3ATKA 1EZXC 1KDQB 3E6PH 3M3TA 4XOJA 1GBJA 1O2SA 1O5BB 3PWCA 1G36A 1DICA 2NU4E 2BDCA 3F1SB 2ZHFH 2FI5E 4B73A 2FEQH 1OOKB 1WV7H 2HALA 1AE8H 1TNIA 3BV9B 4FUHA 3SQEE 1W2KH 5HMAA 4ISNA 2B8OH 1GHWH 1RD3B 3HGPA 2HOBA 2FP7B 2FOGA 2BXTH 1LO6A 4J2YB 1EZUC 4LK4A 1UTPA 5TCAA 4XSKU 1DWCH 6LPRA 1PQ7A 1Y3XA 1TB6H 1BT7A 3LGYA 5EOKA 5JB8S 2ZNKH 4BAOB 1AB9C 3SO3A 1V2QT 2CN0H 1QL7A 1O36A 5AFYH 1DM4B 1O2PA 2BLOA 1GCDA 1BB0B 1F5LA 1PPFE 2BD4A 1MQ5A 2GZ9A 1Y8TA 2RG3A 2FTMA 3EAJA 5AHGH 2GV6A 2QGRA 4BOHA 3ENSB 1O31A 4ZXXH 1RIWB 2VH0A 4TPYA 1THPB 1B0EA 5JBCS 3HKJB 5HYOA 1IHSH 1C5ZB 3UREA 1PQAA 3A8CA 2ZFTA 5E0JA 1T32A 4AFSA 2ZFSA 2AGIX 1GBEA 4YO9A 4RKJB 4NZLA 1WBGB 2FX6A 1IQLA 4Y8ZA 1FAXA 4RN6A 1T8MA 2FOBA 4FUGA 1GBAA 1NU9A 1KY9A 3EA7A 1HJAB 2C93B 1GWAA 1QJ7B 3M5NA 2Z3EA 2VIOA 1O3DA 2PR3A 3V0XA 4E06H 1TMTH 4JYTA 3NWUA 1C5WB 1KXDA 5GCHG 2WPJS 2NU2E 2ZQ2A 2C8WB 1J17T 2H9TH 1TAWA 1K1PA 1RTKA 2BVRH 3QGNB 1DX5M 3V13A 1GHYH 2A4OA 4X2YA 4BTUB 3MH4A 2ZCKP 1HDTH 1MTNB 1MTSA 3BIUH 3GCTF 1KXCA 4XBDA 3UOUA 1P9UA 1K9OE 3SBKA 3T62A 3BN9A 4Y71A 4ZKSU 3PO1B 4Q80A 4Y8YA 1LPKB 3TH2H 2BB4A 2ODYB 1ZHPA 1MZDA 1O37A 3A80A 1HAZB 1Z8JB 1QFKH 2NU0E 2ZDNA 4DIIH 3U9AH 3SN8A 3SUGA 1XX9A 3ZZDA 1BMLA 3E3TA 4Y76A 2SGFE 3SORA 5JB9S 1A4WH 5GXPA 3A7TA 3MO9A 2G55A 3LC3A 1OKXA 4AYYB 2XW9A 1Z8GA 5FBEA 2BD9A 4QT8C 3RXUA 3HATH 4YM9A 2FOMB 1CO7E 2OQ5A 4X6MA 5EW2H 1HBTH 2Z9LA 2ZFQH 2KAIA 5GJ4B 4I8LA 5F03A 5ABWA 3AW1A 2FOFA 2Y5HA 4MDSA 3URCA 4OS7A 3GY8A 4GUXA 3HGNA 2EC9H 3NXPA 1TA6A 1DWEH 1O3BA 2W3IA 1QHRB 3RU4T 1XUJA 1ANDA 1O3AA 2Z9JA 2W5EA 3UWJH 1YCPK 2PSYA 3A88A 2D1JA 2C8XB 3UNSA 1IQFA 1GBHA 1LCYA 3QGJA 1AIXH 1KXAA 3R3GB 1GHBF 3KQDA 3LT3A 1GHVH 1WQVH 2CHAB 4A92A 1ZZZA 1O2HA 4MNVA 3RM0H 2A1DB 2BZAA 4PROA 1EXFA 3FVFB 4BXSA 1V2WT 2ZFRH 1Y3WA 2H5CA 4B74A 1VJAU 4I33A 1ZMLA 1LHFH 1GG6B 1O33A 3A8BA 3MU8A 3TH3H 4MVNA 1RIWC 1QBNA 3JZ1B 1UVOA 2GCHF 4X2VA 1FZZA 4X2XA 4CBNA 1O38A 3GY2A 5EXLA 1XKAC 2WPKS 4NSVA 3N7OA 5LPRA 1SGYE 4I32A 1EAUA 4A1VA 2J94A 5BPEA 1O2RA 1O3IA 3SHAH 1DLKB 1TRYA 2VVUA 4JCNA 3PV4A 4DOQA 1EX3A 1N6XA 2UWOA 4CRGA 4B1TA 1ZPZA 1P2NA 1OXGA 2IJOB 1HJAC 2WPMS 1HAVA 1XUGA 1W12U 4H4FA 4K8YA 1HGTH 4KKDA 1O39A 5C1UA 2A2QH 4DIHH 1G3EA 3LDXH 3T2NA 1YPMH 1C5SA 3SU4A 1O2MA 3BEUA 8GCHF 2AMPA 2BM2A 3MU1A 2BLVA 3G01A 1AKSB 3SUFA 1KTSB 1NO9H 4Q2KA 1SBWA 5C2ZA 2ANWA 3M3SA 3TGIE 4CR9A 9ESTA 4FUJA 4CRDA 5L30H 3ZZ3A 4LXBH 1O5EH 1C2LA 1SLXB 2VWNA 4X8SH 1KYNA 1L4DA 3O8CA 1GJBB 5EPYA 1E35B 1RTFB 4THNH 1EOLA 5T6DA 5PTPA 2GT7A 3RXCA 2ZHEH 4AZ2B 1G32B 4O03A 1WAYB 2XC4A 3BG4C 2RA0A 3GISB 1FIZA 2Y6TA 4HGCA 1Z71A 1C4U2 1L2EA 2ALPA 3GY5A 1SPJA 3A7XA 1C2EA 1CE5A 1OX1A 2YNAA 3MYWA 1ARCA 2BDGA 1DUAA 1UK2A 1JIMA 1XUIA 1NT1A 2XYAA 4AX9H 2EI7A 5GDSH 4IC5A 3TGJE 2ZHDA 1ZGIA 1VJ9U 4WXVA 1LVOA 1W10U 2Q6FA 1G3BA 1YPKH 2FX4A 4BNRA 1GJDB 1EPTA 3GYLB 1F5RA 2R0LA 9LPRA 2C4FH 3RXEA 2F91A 1Q3XA 1QURH 1P3CA 2Z7FE 1E38B 2A4RA 2PUQH 1O3LA 1F5KU 2SNWA 1ELTA 1PPCE 2GDDA 4NIXA 3VEQB 4IN2A 1YPGH 4NFEA 2P95A 3ODDA 3MI4A 2ZCLP 3Q3XA 3RC4A 1RRKA 3EDXB 1O2KA 4OS1A 3MFJA 1ESBA 3KNXA 2CHAC 3ZVEA 1AO5A 1GHBG 4UFEH 1WYKA 3CS7A 1BQYA 1PQ8A 1GJ7B 1LMWB 1A3BH 1O5DH 5E2OA 3ZYDA 1DT2A 4D9QA 1GG6C 1T8OA 2PKSB 2Y81A 1ELEE 1LVBA 1K2I1 1HXEH 4JYVH 1HUTH 1EATA 1C1SA 4NCYA 1EAWA 1P06A 3U1IB 1FV9A 3GY6A 2GCHG 1UVUH 1HJ9A 4INHA 3UUZA 4AGKA 2UWLA 4MPUA 1QL9A 3TK9A 1SGCA 1SGNE 2FOCA 2CF9H 3SI3H 3RU4E 4ZKNU 2AIQA 4WY3A 1K1IA 2G8TA 2GV7A 3H5CB 3STIA 2VNTA 1EB1H 4ABBA 4BTTB 2Z94A 1C4V2 2F9NA 2AEIH 1DSTA 5A8ZA 1DVAH 1GDNA 4DY7B 5JPMH 1UCYE 1ID5H 3OY6U 2A4QA 1C2MA 1HAXB 1SHHB 2ZFPH 3RC6A 4MG3A 1M9UA 1Y3VA 5FHTA 4AFZA 1EUFA 4GPGA 2A31A 1S6FA 3MHWU 1P9SA 5HM2A 1GVLA 1HXFH 2JETB 1TYNA 4NGAH 2OC8A 8GCHG 2R0KA 5FX5A 1IQEA 3IWMA 4UEHH 3CENA 2H9HA 3LPRA 1D3DB 1GBFA 3B23B 4INKA 5G4BA 2GT8A 1O5AB 2QC2A 3Q3YA 1P05A 3M37A 4I8GA 1OYTH 3M3VA 1MTUA 5HGGA 2PTNA 1X7AC 3QZRA 3Q76A 1VCQA 2FESH 1MCVA 7KMEH 1VITH 2P3UB 1C1RA 1VR1H 3ELAH 1K28D 1QR3E 2EI6A 1C1UH 1W0YH 1AFEH 1VZQH 3Q00A 1LPZB 5TJXA 2GTBA 4D7FA 2F9BH 5AF9H 3GY7A 1F0SA 2YNBA 2OUAA 5C5NA 1PPEE 4IGDA 1GGDB 1E36B 4FUDA 3VB6A 4MNWA 3C1KA 1RS0A 4TWWA 2ZU4A 3O8DA 4HI3A 4ZHLU 2Y5GA 1GHXH 3SU2A 2FS9A 5JYIA 3AAVA 4J1YA 2JKHA 4B76A 1Y59T 8KME2 3R0FA 1FPCH 1XUFA 4Q7XA 3GYMA 1A0HB 3LC5A 3U69H 1CGIE 3JZ2B 1F7ZA 2AGGX 1GL1A 2PLXA 1DFPA 3OTJE 1SLVB 1TRMA 4JMYA 3SGQE 1C1NA 1A7SA 3RU4D 3M5OA 3ZZBA 1GBKA 1YCPM 2A32A 4GHTA 3WY8A 1E0FD 1C2IA 2GP9B 1QJ1B 2STBE 2F83A 3QDZB 1MAXA 4XFQA 1YPJH 3SV9A 2BDYA 1C5RA 4KTUA 4NIYA 4MQAA 2NU3E 4X6PA 1AWFH 1O2QA 5FXLA 3QLPH 1O30A 1GI8B 3F68H 1GI7B 1RXPA 2QV1A 5DP9A 1FY4A 1HRTH 5DGJA 1F92A 3ITIA 2KAIB 2J2UA 1DWBH 3VB7A 1C5VA 4IS5A 4Y6DA 2PKSC 3SV2H 1O3MA 1C5MD 1PJPA 3AVZA 1ETSH 4FUCA 3GDVA 3RXRA 1ZRBA 1EZSC 1BTUA 2TBSA 5FPSA 3S9AA 3ZZ5A 4YT7H 1GMHF 2V0BA 1O35A 4FU8A 1C2JA 1OWHA 1L1GA 1OWEA 5J4SA 1P0SH 1UO6A 3MOCA 5E0GA 3ZVAA 2ZDVH 1ZLRA 5GWZA 1SOZA 1SR5C 1CGJE 2ZECA 4DVAU 1SOTA 3SOSA 3OX7U 3S7HB 4DW2U 4ESTE 2PSXA 3LOXA 1Q31A 1XUKA 2ZDLA 3QTVH 1TALA 1Z7KA 1O3KA 3QK1A 4I31A 2OD3B 2Z9GA 4WH8A 3F9EA 4AORA 4JK6A 3I77A 1NC6A 2AMQA 1CA0C 3RDZA 3VFEA 3M36A 3PB1E 2PFEA 6GCHG 1WUNH 1KTTB 1TIOA 1HAGE 5A09A 1EKBB 1SQTA 1ARBA 2HNTC 5L2ZH 2JETC 1JWTA 2Z3DA 2K1QA 3M5MA 4X1SU 2FODA 2W7UA 3U8OH 1DOJA 1P02A 2G52A 1GI2A 3GDUA 3ZVGA 3KCGH 2J9NA 1GDQA 2AMDA 1SGPE 2B0FA 1LDTT 3M7TA 3RXJA 3BSQA 1QTFA 1SB1H 2PWXA 1F0RA 3OSYA 4YZUA 2ZZUH 2OXSA 4ABEA 2DE8A 1UTOA 4WXIA 1P8VC 1LKAA 2BQWB 2HNTF 5C3NA 3MH7A 1QIXB 4B75A 2XXLA 1Y5UT 1AUTC 1HAVB 4CH8B 1MTWA 3GCOA 3NKKA 1JMOH 4ZHMU 2BOKA 1TGNA 4TY7A 1SQAA 5A8XA 1SL3A 3ATIA 1FQ3A 2DUCA 1ZHMA 2FOAA 2RDLA 2Y80A 1HNEE 1YCPH 3GCHB 1CT2E 3QN7A 1IOEA 2D26C 4FVDA 4DT7B 1GI0A 3BTKE 1MTVA 4JZEH 4AN7A 2BVXH 3ESTA 1ACBE 1YM0A 1N8OB 4JZIA 1QRZA 3VPKA 1L1NA 1XKBC 1GI9B 1GPZA 3V3MA 1OWDA 2ASUB 2ZWLH 4NFFA 3BG8A 2GMTB 3RMNH 3RXPA 2ZPSA 3SZNA 1AZ8A 1TX7A 4INLA 2QXHA 1MBQA 2OINA 2FLRH 1UVSH 1GDUA 3F6UH 4HFPB 1S5SA 3BIVH 1O2ZA 2TGAA 3BTHE 3E90B 3ZZ6A 3P95A 4VGCB 3MNXA 4U30A 1PPZA 3B9FH 1NFYA 1MKXK 3UTUH 1SGEE 5CMXH 5DP7A 3QX5H 5DP3A 4I8JA 1XXDA 1NRQH 1FPHH 1HAHH 2THFB 5ESBA 1T31A 2O8WA 3BF6H 5EQQA 1MQ6A 1S6HA 1UCYK 1L4ZA 1S82A 1EPTB 1PPGE 3RM2H 3GDSA 1SI5H 5FX6A 1GMHG 1UHBA 1CT0E 5EG4A 4K1SA 4BANB 4AG1A 2O8UA 3NZIA 4NWKA 5LPEA 1U6QA 4Z0KA 3K6ZA 2RCEA 1KLTA 4SGAE 5DG6A 3FP8E 2HRVA 3RMMH 5GPIB 2BY9X 1S81A 1V2JT 3VGCB 1BRCE 7GCHG 1FJSA 1W7GH 3UIRA 2I6QA 2ALVA 1O5CB 1O2XA 4I8KA 4O3TA 3RXTA 1YKTA 1QY6A 2Y82A 3UY9A 2XBVA 1BCUH 1HB0B 2ZGXH 3KQBA 1LVMA 4IC6A 2OC1A 3A87A 1TABE 1ELBA 1S85A 1UTJA 4FUFA 3TJVA 4ABAA 3BTEE 1ELDE 3AASA 3VB3A 1MU8B 1ZOMA 1WTHD 2ZHQH 1BTWA 2ZTXA 3RXVA 4K2YA 2QCYA 2C8ZB 3P8NA 2A5KA 1BJUA 1XUHA 1QNJA 4DJZB 2C8YB 1ABIH 2HVXA 4HZHA 2ZU1A 3OY5U 1T4UH 4CR5A 2BY5X 1WOFA 3UNRA 5E8EH 4KELA 4Y11E 3K6YA 5GIBA 4FU7A 1LQEA 1PPHE 5C1XA 3GOVB 3ATWA 4YLQH 1MMJN 1VCWA 2Q1JA 3W95A 1W8BH 2LNCA 1MKWK 4F4OC 2BX3A 1TE0A 1ANCA 1BMAA 5K0HA 1C5XB 5CHAB 2P3TB 1C2DA 5CE1A 2JH6D 3GCHC 1O2IA 5HXFA 1LHCH 2XBWA 1C9PA 1S83A 1NN6A 3U8TH 2FM2A 1BUIA 1ZPCA 1GBCA 1C1OA 1WSSH 3IITA 2P3FH 1QL8A 1EQ9A 3TNTA 3P70B 2H6MA 1CHGA 1LPGB 1N8OC 3PMHB 3SV8A 5A8YA 1BHXB 2PUXB 3LGVA 2BQ6B 5F8ZA 4X8TH 1FY1A 1UTLM 1ZTLA 1ELAA 1GCTB 1ZMNA 3A7WA 4WWYA 4X8UH 2A4GA 2OQUA 1P2KA 4YOJA 1C2HA 1P2QA 5EQRA 3L33A 1G2LA 1BZXE 2OC0A 3M35A 3PLBA 4SGBE 3S9BA 4I7YH 1A0LA 1K1JA 5C1YA 3A84A 2SFAA 5EXMA 4OS6A 5H4IB 1SGQE 2R2MB 3F9GA 3TJOA 5EW1H 2TPIZ 4D7GA 1BDAA 2IOTA 2ZGCA 5EXNA 1AVWA 3NUMA 2FOEA 4JZDH 5DPAA 5T6FA 1IQJA 2BD2A 3ATMA 1DXPA 4TYDA 4DCDA 1MTNC 2XTTB 1Y5AT 2QA9E 2VU8E 2H9EH 4K69A 3GCTG 2JH5D 4B2BA 1EPTC 3PO1C 2G4UA 1NPMA 1XMNB 2VB0A 3KQEA 3EYDA 1V2NT 5L6NH 1QCPA 2O8MA 1BTHH 1SGIB 1YPHC 4ABIA 1O3GA 3LGUA 4XDEA 3K9XB 1D3QB 2BDAA 3RXAA 3O8BA 2ZGBH 2M5TA 1F0TA 3A89A 2VVCA 1ZMJA 3O8RA 4UE7H 4TWYA 3RLWH 4ASHA 3H7OA 4ISOA 1TX8A 4BXWA 2I6SA 2CJIA 1SGFA 2ZF0H 3ZZ4A 1B0FA 1O2YA 1SGRE 1AY6H 2HPPH 1YF4A 2BXUH 1HJ8A 2FO9A 1O3EA 1A3EH 2VGCB 3LJJA 4WMFA 1GL0E 4AB9A 4BAKB 3S9CA 3RXFA 2SGAA 3TK6A 1C5LH 2G51A 3PMBB 3BTFE 7ESTE 1GMCF 2WINI 1AWHB 5TCCA 4B2CA 1C1PA 3EE0B 4ZMAH 2EA3A 4XBBA 4H6SB 1BJVA 2HNTE 4ABHA 2ZI2H 2DE9A 1DS2E 1P12E 3DUXH 4NSYA 3VXFH 3RXOA 1ZSKA 2BMGB 5FCRA 2XC0A 3A86A 1AUJA 2PV9B 3A83A 1J15A 4YOGA 1TOMH 2OC7A 2GDEH 2BD5A 3SUEA 4ISLA 1SVPA 5FPYA 4FUBA 2QYIA 1IQGA 1FIWA 1LKBA 3RC5A 5A0CA 1GJ5H 6ESTA 1KLJH 1ZTJA 2WPLS 3ZV8A 2ZU5A 3A85A 4A1TA 1TNHA 3MO3A 4WMDA 1NZQH 1YPEH 1GJCB 2F9VA 2GZ7A 5CHAC 1OP2A 1ZJDA 3DA9B 4O3UA 3F9HA 3GCNA 3ODFA 4ABJA 1XVOA 1TPPA 2Z6BD 1TBRH 1YLDA 2Z9IA 4B2AA 3SJ8A 1A1RA 2W26A 3L3TA 2BDBA 2VVVA 1KSNA 2GZ8A 4IMQA 1AE5A 4JYUH 3SUDA 4LZ4B 1GHAF 1LQDB 2SGEE 3ZZ7A 5I46H 2R3YA 1TA2A 2B7DH 1BOQA 3SHCH 4Y8XA 1PQ5A 2CMYA 2QXJA 3QZQA 1GBLA 4IN1A 1J8AA 1DITH 3HPTB 3TIUA 4ZH8A 4MLFB 4ZAEA 2ANYA 3E0NB 5JBTA 2V3HH 3KHVA 3TPIZ 1Z8RA 1INCA 4X6NA 2GX4A 1FN8A 4ISIH 1P2OA 1NRRH 1AQ7A 1P11E 3E91A 2FYRA 1GI3A 4NZQA 3SU3A 1CA8B 3T26A 2WPIS 1EJNA 4A1XA 1ZSLA 1A0JA 1UMAH 3K65B 3FP7E 1TNLA 3ZVDA 4CRFA 1H1BA 2TGPZ 2PGQB 1GI1A 2ANKH 1TBZH 1QGFA 1YC0A 1HCGA 4GLYA 2IPHA 2WYJA 2VH6A 5DO4H 1BMMH 5B6OA 4WJG2 5I25A 1AN1E 1TBQH 1NESE 2ZFFH 5EU8A 3ZZAA 5C5OA 4NIVA 1Y3YA 4U2WA 2BY6X 2BLQA 3A7VA 5DKMA 5EQSA 2QY0B 3BTDE 1W11U 3LH3A 4FU9A 4YOIA 5J4QA 3OU0A 5FPTA 2ZO3H 3BTME 2BHGA 1TOCB 1TPSA 3MH5A 3LIWA 4ABGA 1C5OH 3MU0A 3P6ZB 1ESTA 1YBWA 4GHQA 3MH6A 2CGAA 4RSPA 2BZ6H 4B71A 1S0RA 2VIVA 2ZIQH 2WPHS 2VGCC 1THSH 1OPHB 2A45B 2ILNA 3A8AA 1G3CA 1AU8A 1EJMA 5E0HA 1O3PB 1KXEA 4UFFH 4ABDA 2ZQ1A 4IW4E 4X1QU 1W7XH 1HAIH 1K1NA 3KGPA 1GMCG 1NY22 1UHBB 3UR6A 5T3HA 4CBOA 1ZJKA 1BMNH 2CF8H 2ZU2A 4M7GA 1CSOE 1QB1A 1QA0A 1UTKA 2OP9A 2PTCE 2XNIA 4AFUA 1RTLA 4KP0A 2ZG0H 2FZZA 3MTYA 2BDHA 4XE4A 2HWLB 3LU9B 2F9UA 1JOUB 2A7HA 5EGMA 3TGKE 1CHOF 1ELCA 3D23A 3LH1A 2F3CE 1TGBA 1BRBE 2IN2A 4O97A 4JK5A 1O3OA 1UJ1A 3KQCA 2STAE 2C3SA 1MAYA 2Y7XA 3PM3A 1FY5A 1GI4A 5LH8A 2XRCA 2F9PA 3BTTE 3FFGA 5GCHF 4A5TS 3MO6A 1H9HE 3QUMP 1HAYB 2QXGA 1FMGA 3EGKH 1J14A 4MPWA 1FN6A 1ZPBA 3IG6B 2J92A 4O9VA 3KL6A 4JZ1A 3VB5A 2ODPA 1BRAA 1ZYOA 1F2SE 2XCFA 3BTWE 1BTPA 1FONA 1SMFE 1NS3A 1MKXH 1DSUA 1TMBH 4R0IA 2GVFA 1GHAG 2B5TB 2SGQE 3AAUA 3T28A 2P8OB 1ANBA 1PYTC 4CRBA 1Z8IB 2WYGA 1AD8H 2FOHA 4NA9H 1S0QA 1N6YA 3UWIA 1UCYH 2ZCHP 3RXSA 3B8JA 3RXGA 3RXLA 1LHGH 4Y79A 1O3JA 1ZR0A 4WMEA 1ABJH 2FPZA 2O9QA 4MNXA 4ISHH 3UFAA 1HLTH 1W0ZU 1DLEA 1TWXB 1THRH 3EA8A 3P8OA 1C1WH 1C9TA 4MPXA 2PKAA 3MU5A 5DP5A 2OTVA 1HIAA 2BOHB 2P94A 1VITF 2W3KA 2GGVB 1H9IE 1GJ8B 3MMGA 4Z6AH 3SI4H 5JDUB 1IQMA 1SHYA 2VWOA 4CH2B 4CRCA 4WF8A 3RMLH 1W3CA 1S84A 2VINA 3DFJA 7LPRA 1BRUP 4DGJA 3ZYEA 1KLIH 1ZSJA 3SGBE 3ZVBA 3A7ZA 1YGCH 4K8BA 4X1PU 1FUJA 5FAHA 3RLYH 1VGCB 1YPHE 2HGTH 4UD9H 1TGSZ 4E7NA 1FXYA 3TLOA 1MH0A 1GGDC 4Y0YE 5LGOA 3UR9A 2H1UA 2AIPA 3UOPA 1A5HA 5IYTA 4FUIA 2BX4A 3E8LA 1V2MT 1WCZA 2FDAA 4LZ1H 2ESTE 2AS9A 1ETRH 3M61U 5C67A 1QQ4A 1Z6JH 2Q6DA 3SJKA 2PW8H 2VIDA 3Q77A 4Y0ZE 3SU0A 2VJ1A 3A7YA 3P8FA 4AG2A 1SC8U 6CHAB 1V3XA 1CVWH 4I8HA 1GVKB 1MKWH 4NA7A 3DHKH 5F8XA 2R3UA 1SLUB 3SU6A 1G2MA 2VIQA 3RXQA 1Y3UA 1OS8A 1TNJA 3QO6A 4F49A 1ELFA 1GBTA 5L2YH 3MNSA 2A2XH 1C1QA 1O2WA 1EP6A 4KGAA 1D3PB 1P2MA 2V35A 2FIRH 3NPSA 1O34A 5DK1A 1HV7A 4E7RG 3UPEA 1GBIA 3RXMA 3SJ9A 3TH4H 1O2OA 4ZKRU 1IHTH 3Q3KA 1CHOG 2OLGA 4D76A 1FLEE 3VB4A 4CHAB 3BTQE 5F8TA 3P17H 1NRSH 1RFNA 3ZVFA 3RP2A 1G3DA 4U01A 2FI4E 1OP0A 8LPRA 1A5IA 1T4VH 1O5FH 3AW0A 5AVDA 1DXWA 1C5UA 5EPNA 3TJUA 1TQ0B 2D8WA 4YLUA 1EAXA 1GVZA 2P8OC 2P93A 1FAKH 1DUEA 2EEKA 5FCKA 1CT4E 3RXBA 1ESAA 2G5VA 1YLCA 1DE7H 4Y7BA 3ZZ8A 4ZROA 3NK8A 4AGJA 2XBYA 4IMZA 3RMOH 2Y7ZA 3M5LA 4K3JA 1BIOA 1GI5A 1BITA 1B7XB 2BY7X 2XWBI 3URDA 3GY3A 2WUBA 3H7TA 3A81A 2A5AA 3W94A 3BG4B 1HPGA 2XWAA 3FZDA 3BTGE 2ZA5A 1VITG 1BTXA 4KTCA 1XVMA 2BTCE 2J4IA 2R9PA 3ZZ9A 3PLKA 3T29A 1G30B 1NFWA 1K1MA 1QJ6B 2XBXA 4NIWA 1SFQB 3ZZCA 2O8LA 2OCVB 1AFQB 1IQIA 2TRMA 3PTBA 1EP5A 2ZPQA 4H6TA 3PMAB 2GCTB 2ODQA 5A0BA 1VGCC 4OS5A 1K1OA 1TLDA 2UUKB 5DP8A 3M7UA 1QBOA 4NWLA 2ZU3A 1JRSA 3LKWA 1SQOA 2QN5T 3TNSA 1Q2WA 1RJXB 2Z3CA 2UUJB 2VIWA 2ZPRA 1SFIA 5FBIA 1AI8H 1FDPA 1H8IH 5DP4A 4GCHF 3P92A 1AHTH 1RGQA 1WU1A 1MD8A 3HKIB 2FWWA 6CHAC 5ESTE 1V2KT 1L1JA 2P59A 1SSXA 3EQ0H 1BBRE 3S69A 1O0DH 5LPFA 4K5ZA 2PHBA 5DP6A 2BDIA 1C5QA 4A7IB 2GMTC 2ZTYA 1EOJA 1KDQA 4IBLH 1BTZA 1K22H 1MU6B 1V2VT 2D2DA 1C1VH 8ESTE 2TGDA 1ANEA 2QAAA 2Y5FA 3ZVCA 1B5GH 2J34A 5BRRE 1UK3A 2WV5A 5A2MH 1D6WA 3BEIB 4DURA 4VGCC 1MD7A 4BTIB 1HYLA 3D65E 4WH6A 5A0AE 3UQOA 4WVPE 3EA9A 1Z1IA 2B9LA 2OBOA 4TPIZ 5E2PA 2ZDMA 4CHAC 1C2FA 2Q6GA 3FANA 1NRPH 1EJAA 1ZGVA 3DT0H 3TVJB 2ZGJA 1ETTH 2ZDKA 3NCLA 1LTOA 2ZEBA 1IQKA 2VWLA 3I78A 3UNQA 1MUEB 4E05H 1P09A 1V2ST 3SNCA 1QRWA 1SLWB 4BAHB 2ZDAH 2FXRA 3D49H 1P2JA 1ZHRA 2BYAX 1PFXC 1OP8A 4X8VH 2J38A 1AVGH 1FNIA 2PGBB 1TPOA 2V3OH 3U98H 1ZRKA 3VGCC 2AERH 2LPRA 3MWIU 2BD8A 1P01A 4TY6A 2FTLE 1GMDF 1O2NA
chains in the Genus database with same CATH superfamily
4H42U 4UFDH 1O3CA 2AH4X 1O2TA 3C27B 1O2VA 2W7SA 1O2GH 4BAQB 1N1LA 3MU4A 3TK5A 2VWMA 3SQHE 1G37A 1CQQA 3LGTA 2P16A 3SV6A 1SG8B 1UTNA 2NU1E 2QXIA 3HK3B 1Z6EA 1A61H 3TU7H 2HLCA 5SGAE 1FY8E 3SNEA 3OYPA 1QQUA 1NM6A 1BA8B 4K1EA 1UTQA 4MNYA 1WTGH 1P04A 3M7QA 3KN2A 1VCPA 4UFGH 1AFQC 2BVSH 2AYWA 1C1MA 1H8HD 2OBQA 3SJIA 1C1TA 3E16B 1LHEH 1CBWB 2GCTC 4DT4A 3KIDU 4BAMB 2K0QA 1EASA 1MZAA 4FXGH 1OSSA 3CP7A 4K1TA 4ZXYH 1P2IA 1NTPA 1IQNA 4NG9H 2FI3E 2WV4A 3SNDA 5ETXA 3UQVA 1C5TA 1EZQA 1SGDE 1W13U 2EI8A 4HTCH 2BY8X 1Z1JA 2PKAB 3SU1A 1HIAB 3KEEA 2XC5A 4XBCA 4GCHG 1C5PA 1K1LA 2CV3A 3N7DA 4YT6H 1ELGA 4ZKOU 4YTAA 3SJOA 3FZZA 4OGYA 1BBRH 1TMUH 1TX6A 1GCTC 1DPOA 3A82A 4X6OA 2RA3A 2A5IA 5AFZH 4UONA 1V2LT 1O3NA 1HFDA 1P57B 2BD7A 1NROH 3V12A 4A6LA 1NU7B 1AVXA 1XM1A 1D3TB 1V6DA 2VIPA 2SNVA 1PYTD 2R2WU 1DY8A 1O2UA 2XNDD 1BHXF 2WSSD 1CU1A 1LHDH 2A7CA 4X0WU 2YMSB 4Q7YA 3U8RH 1O2LA 3CNRA 2TGTA 3L6PA 1W14U 1TFXA 1QB9A 2AFQB 3RXIA 1OWJA 3SW2B 4FVBA 4ZUHA 2SGDE 3E1XB 1E37B 1TRNA 1YP9A 4FUEA 1TONA 3QWCH 3FP6E 4LOYH 1A5GH 4ABFA 1QB6A 2GKVE 1OYQA 1C5NH 3PTNA 1KIGH 6GCHF 1CA0B 4CREA 2ZHWH 1OWKA 1C4Y2 2H2ZA 4JZFH 3DD2H 1T8NA 3MNCA 3SU5A 3H09A 1J9CH 1VKYA 1GJAB 2JH0D 4MTBA 1SGFG 4AYVB 1KXFA 3T5FH 1AGJA 1GJ9B 1NRNH 4AFQA 4CRAA 3GICB 4UDWH 1YYY1 4OGXA 3LGWA 3RXHA 1JRTA 1DWDH 1YPLH 3T27A 4AOQA 2WUCA 2FS8A 4GSOA 3A8DA 4YESB 3RXKA 4ACAA 3FAOA 3F9FA 2C90B 1E34B 2J98B 2QF3A 1O2JA 3TJNA 1GMDG 4R8TB 1UK4A 1IQHA 3VXEH 1KXBA 4GAWA 1A46H 1C2GA 1DY9A 2AGEX 2SGPE 1GI6A 1BMFD 3OTPA 4P02A 1TNKA 4Y7AA 2ZGHA 2GD4B 3SGAE 5C20A 1QBVH 1G9IE 1AB9B 3HK6B 3RXDA 1A2CH 4DG4A 4K60A 1EB2A 1O3FA 1P10A 1MBMA 4X1NU 4U32A 3GY4A 1V2PT 1NFXA 2UUFB 1TGTA 3T25A 1QA7A 3K2UA 5T6GA 1AKSA 1BTYA 2ZP0H 2F9OA 1EAIA 2ZKSA 1D6RA 4OS4A 5KECA 4X1RU 1GBMA 3PMJA 1XXFA 5DJ7A 1JBUH 1TQ7B 5K7RA 3I29A 1CBWC 2Z9KA 1J16A 1OWIA 1BBRK 4D9RA 1PPBH 1FI8A 1NBMD 1TPAE 5F6MA 1GJ6A 3KF2A 2NWNA 3MNBA 4Q7ZA 1AZZA 4XD7D 1P03A 3PWBA 4Y10E 5JBBS 1V2RT 4X2WA 3TITA 2H5DA 3ZIAD 2QF0A 2F4LA 3D62A 3SV7A 2YOLA 1O32A 3S0NA 3PYHA 3PROA 2G5NA 2F43B 1SGTA 1UVPA 2TIOA 2G4TA 1HAOH 1LVYA 2O8TA 2UWPA 5JBAS 2HPQH 2ANMH 1TGCA 1F0UA 1UVTH 1MCTA 3STJA 2A0QB 2FLBH 1C2KA 2FMJA 3U1JB 1H4WA 3CS0A 1T7CA 2CXVA 1ELVA 1NFUA 1ORFA 2J95A 3FN8A 1GBBA 4GVUA 4MPVA 3QTOH 1DDJA 1C5YB 1WQSA 4ZHAA 1H8DH 5HM9A 1D4PB 3RUOA 1ZTKA 3PLPA 3ATLA 4OS2A 1K21H 1GHZA 1V2OT 3V7TA 2BLWA 2XCNA 2ZC9H 5EODA 1JXPA 1P3EA 2G00A 3SNAA 1Y5BT 3ZV9A 4AB8A 4KTSA 2BD3A 1QRXA 3S7KB 1V2TT 7GCHF 1TNGA 2A7JA 1H9LB 3UAIC 1AMHA 1L0ZA 1IAUA 2ULLA 4ACBA 2FYQA 1HAPH 3E0PB 3P8GA 3DFLA 3LGIA 5IDKA 2V6NA 1CGHA 1GBDA 3BEFB 1JIRA 2BQ7B 2KCYA 2ZTZA 1O3HA 3SNBA 2QIQA 2UUYA 1DANH 1O5GH 2G81E 4NA8A 1UTMA 4RKOB 4D8NA 1GJ4H 1D9IA 1V2UT 3LJOA 3LONA 1T8LA 1FY3A 3ATKA 1EZXC 1KDQB 3E6PH 3M3TA 4XOJA 1GBJA 1O2SA 1O5BB 3PWCA 1YY3A 1G36A 1DICA 2BDCA 2NU4E 3F1SB 2ZHFH 2FI5E 4B73A 2FEQH 1OOKB 1WV7H 2HALA 1AE8H 1TNIA 3BV9B 4FUHA 3SQEE 1W2KH 5HMAA 4ISNA 2B8OH 1GHWH 1RD3B 3HGPA 2HOBA 2FP7B 3DSPA 2FOGA 2BXTH 1LO6A 4J2YB 1EZUC 4LK4A 1UTPA 5TCAA 4XSKU 1DWCH 6LPRA 1PQ7A 1Y3XA 1TB6H 1BT7A 3LGYA 5EOKA 5JB8S 2ZNKH 4BAOB 1AB9C 3SO3A 1V2QT 2CN0H 1QL7A 1O36A 5AFYH 1DM4B 1O2PA 2BLOA 2IJD1 1GCDA 1BB0B 1F5LA 1PPFE 3KYGA 2BD4A 1MQ5A 2GZ9A 1Y8TA 2RG3A 2FTMA 3EAJA 5AHGH 2GV6A 2QGRA 4BOHA 3ENSB 1O31A 4ZXXH 1RIWB 2VH0A 4TPYA 1THPB 1B0EA 5JBCS 3HKJB 5HYOA 1IHSH 1C5ZB 3UREA 1PQAA 3A8CA 2ZFTA 5E0JA 1T32A 4AFSA 2ZFSA 2AGIX 1GBEA 2HVYB 4YO9A 4RKJB 4NZLA 1WBGB 2FX6A 1IQLA 4Y8ZA 1FAXA 4RN6A 1T8MA 2FOBA 4FUGA 1GBAA 1NU9A 5C0UA 4YXWD 1KY9A 3EA7A 1HJAB 2C93B 1GWAA 1QJ7B 2JJ2D 3M5NA 2Z3EA 2VIOA 1FX0B 1O3DA 2PR3A 3V0XA 4E06H 1TMTH 4JYTA 3NWUA 1C5WB 1KXDA 5GCHG 2WPJS 2NU2E 2ZQ2A 2C8WB 1J17T 2H9TH 1TAWA 1K1PA 1RTKA 2BVRH 3QGNB 1DX5M 3V13A 1GHYH 2A4OA 4X2YA 4BTUB 3MH4A 2ZCKP 1HDTH 1MTNB 1MTSA 3BIUH 3GCTF 1KXCA 4XBDA 3UOUA 1P9UA 1K9OE 3SBKA 3T62A 3BN9A 4Y71A 5EJ1A 4ZKSU 3PO1B 4Q80A 4Y8YA 1LPKB 3TH2H 2BB4A 2ODYB 1ZHPA 1MZDA 1O37A 3A80A 1HAZB 1Z8JB 1QFKH 2NU0E 2ZDNA 4DIIH 3U9AH 5GNDA 3SN8A 3SUGA 1XX9A 3ZZDA 1BMLA 3E3TA 4Y76A 3SZEA 2SGFE 3SORA 3F2HA 5JB9S 1A4WH 5GXPA 3A7TA 3MO9A 2L74A 2G55A 3LC3A 1OKXA 4AYYB 2XW9A 1Z8GA 1SKYE 5FBEA 2BD9A 4QT8C 3RXUA 3HATH 4YM9A 2FOMB 1S6LA 1CO7E 2OQ5A 4X6MA 5EW2H 1HBTH 2Z9LA 2ZFQH 2KAIA 3OEHD 5GJ4B 4I8LA 5F03A 3W1EA 5ABWA 3AW1A 3OFND 1E1QD 2FOFA 2KR7A 2Y5HA 4MDSA 3URCA 4OS7A 3GY8A 4GUXA 3HGNA 2EC9H 3NXPA 1TA6A 1DWEH 1O3BA 2W3IA 1QHRB 3RU4T 1XUJA 1ANDA 1O3AA 2Z9JA 2W5EA 3UWJH 1YCPK 2PSYA 3A88A 2D1JA 2C8XB 3UNSA 1COWD 1IQFA 1GBHA 1LCYA 3GS9A 3QGJA 5IK2D 1AIXH 1KXAA 3R3GB 1GHBF 3KQDA 3LT3A 1GHVH 1WQVH 2CHAB 4A92A 1ZZZA 1O2HA 4MNVA 3RM0H 2A1DB 2BZAA 3PV2A 1EXFA 3FVFB 4PROA 4BXSA 1V2WT 2ZFRH 1Y3WA 2H5CA 4B74A 1VJAU 4I33A 1ZMLA 1LHFH 1GG6B 1O33A 3A8BA 3MU8A 3TH3H 4MVNA 2EQNA 1RIWC 1QBNA 3JZ1B 1UVOA 2GCHF 4X2VA 1FZZA 4X2XA 4CBNA 5F53A 1O38A 3GY2A 5EXLA 2WZQA 1XKAC 2WPKS 4NSVA 3N7OA 5LPRA 1SGYE 4I32A 1EAUA 4A1VA 2J94A 5BPEA 1O2RA 1O3IA 2LELA 3SHAH 1DLKB 1TRYA 2VVUA 4JCNA 3PV4A 4DOQA 1EX3A 1N6XA 2UWOA 4CRGA 4B1TA 1ZPZA 1P2NA 1OXGA 2IJOB 1HJAC 2WPMS 1HAVA 1XUGA 2JDID 1W12U 4H4FA 4K8YA 1HGTH 4KKDA 1O39A 5C1UA 2A2QH 4DIHH 1G3EA 3LDXH 3T2NA 1YPMH 1C5SA 3SU4A 1O2MA 3BEUA 8GCHF 2AMPA 2BM2A 3MU1A 2BLVA 3G01A 1AKSB 3SUFA 1KTSB 1NO9H 4Q2KA 1SQRA 1SBWA 5C2ZA 2ANWA 3M3SA 3TGIE 4CR9A 9ESTA 4FUJA 4CRDA 5L30H 4RT0A 3ZZ3A 4LXBH 1O5EH 1C2LA 4AC9A 1SLXB 2VWNA 4X8SH 1KYNA 1L4DA 3O8CA 1KMHB 1GJBB 4HG6A 5EPYA 1E35B 1RTFB 3U28C 4THNH 1EOLA 5T6DA 5PTPA 2GT7A 3RXCA 2ZHEH 4AZ2B 1G32B 4O03A 1WAYB 5C0TA 2XC4A 3BG4C 2VBCA 2RA0A 3GISB 1FIZA 2Y6TA 4HGCA 1Z71A 1C4U2 1L2EA 2ALPA 3GY5A 1SPJA 3A7XA 1C2EA 1CE5A 1OX1A 2YNAA 3MYWA 1ARCA 2BDGA 1DUAA 1UK2A 1JIMA 1XUIA 1NT1A 2XYAA 4AX9H 2EI7A 5GDSH 4IC5A 3TGJE 2ZHDA 1ZGIA 1VJ9U 4WXVA 1LVOA 1W10U 2Q6FA 1G3BA 1YPKH 2FX4A 5FL7D 4BNRA 1GJDB 1EPTA 2V3MA 3GYLB 1F5RA 2R0LA 9LPRA 2C4FH 3RXEA 2F91A 1Q3XA 1QURH 1P3CA 2Z7FE 1E38B 2A4RA 2PUQH 1O3LA 1F5KU 2SNWA 1ELTA 1PPCE 2GDDA 1OHHD 4NIXA 3VEQB 4IN2A 1YPGH 4NFEA 2P95A 3ODDA 3MI4A 2ZCLP 3Q3XA 3RC4A 1RRKA 3EDXB 1O2KA 4OS1A 3MFJA 1ESBA 3KNXA 2CHAC 3ZVEA 1AO5A 1GHBG 4UFEH 1WYKA 3CS7A 1EFRD 1BQYA 1PQ8A 1GJ7B 1LMWB 1A3BH 4Q63A 1O5DH 5E2OA 3ZYDA 1DT2A 4D9QA 3WWFA 1GG6C 1T8OA 2PKSB 2Y81A 1ELEE 1LVBA 1K2I1 1HXEH 4JYVH 1HUTH 1EATA 1C1SA 4NCYA 1EAWA 1P06A 3U1IB 1FV9A 3GY6A 2GCHG 1UVUH 1HJ9A 4INHA 3UUZA 4AGKA 2UWLA 4MPUA 1QL9A 3PRBA 3TK9A 1SGCA 1SGNE 2FOCA 2CF9H 3SI3H 3RU4E 4ZKNU 2AIQA 2J5UA 4WY3A 1K1IA 2G8TA 2GV7A 3H5CB 3STIA 2VNTA 1EB1H 4ABBA 4BTTB 2Z94A 1C4V2 2F9NA 2AEIH 1DSTA 5A8ZA 1DVAH 1GDNA 4DY7B 5JPMH 1UCYE 1ID5H 3OY6U 2A4QA 1C2MA 2WV9A 1HAXB 1SHHB 2ZFPH 3RC6A 4MG3A 1M9UA 1Y3VA 5FHTA 4AFZA 1EUFA 4GPGA 2A31A 1S6FA 3MHWU 1P9SA 5HM2A 1GVLA 1E79D 1HXFH 2JETB 1TYNA 4NGAH 2OC8A 8GCHG 2R0KA 5FX5A 1IQEA 5C17A 3IWMA 4UEHH 3CENA 2H9HA 3LPRA 1D3DB 1GBFA 3B23B 4INKA 5G4BA 2GT8A 1O5AB 2QC2A 3Q3YA 1P05A 3M37A 4I8GA 1OYTH 3M3VA 1MTUA 5HGGA 2PTNA 1X7AC 3QZRA 3Q76A 1VCQA 2FESH 1MCVA 5EJLA 7KMEH 1VITH 2P3UB 2WPDD 1C1RA 1VR1H 3ELAH 1K28D 1QR3E 2EI6A 1C1UH 1W0YH 1AFEH 1VZQH 3KQ5A 1LPZB 3Q00A 5TJXA 2GTBA 4D7FA 2F9BH 5AF9H 3GY7A 1F0SA 2YNBA 2OUAA 5C5NA 1PPEE 3FO8D 3OAAD 4IGDA 1GGDB 1E36B 4FUDA 3VB6A 4MNWA 3C1KA 1RS0A 4TWWA 2ZU4A 3O8DA 4HI3A 4ZHLU 2Y5GA 1GHXH 3SU2A 2FS9A 5JYIA 3AAVA 4J1YA 2JKHA 4B76A 1Y59T 2W6ID 8KME2 3R0FA 1FPCH 1XUFA 4Q7XA 3GYMA 1A0HB 3LC5A 3U69H 1CGIE 3JZ2B 1F7ZA 2AGGX 1GL1A 2PLXA 1DFPA 3OTJE 1SLVB 1TRMA 4JMYA 3SGQE 2RFKC 1C1NA 1A7SA 3RU4D 3M5OA 3ZZBA 1GBKA 1YCPM 2A32A 4GHTA 3WY8A 1E0FD 1C2IA 2GP9B 1QJ1B 2STBE 2F83A 3QDZB 5CDFE 1MAXA 4XFQA 1YPJH 3SV9A 2BDYA 1C5RA 4KTUA 4NIYA 4MQAA 2NU3E 4X6PA 1AWFH 1O2QA 5FXLA 3QLPH 1O30A 1GI8B 3F68H 1GI7B 1RXPA 2QV1A 5DP9A 1FY4A 1HRTH 5DGJA 1F92A 3ITIA 2KAIB 2J2UA 1DWBH 3VB7A 1C5VA 4IS5A 4Y6DA 2PKSC 3SV2H 1O3MA 1C5MD 1PJPA 3AVZA 1ETSH 4FUCA 3GDVA 3RXRA 1ZRBA 1EZSC 1BTUA 2TBSA 5FPSA 3S9AA 3ZZ5A 2IPQX 4YT7H 1GMHF 2V0BA 1O35A 4FU8A 1C2JA 1OWHA 1L1GA 1OWEA 5J4SA 1P0SH 1UO6A 2YMSC 3MOCA 5E0GA 3ZVAA 2ZDVH 1ZLRA 5GWZA 1SOZA 1SR5C 1CGJE 2ZECA 4DVAU 1SOTA 3SOSA 3OX7U 3S7HB 4DW2U 3DSOA 2PSXA 3LOXA 1Q31A 4ESTE 1XUKA 2ZDLA 3QTVH 1TALA 1Z7KA 1O3KA 3QK1A 4I31A 2OD3B 2Z9GA 4WH8A 3F9EA 4AORA 4JK6A 3I77A 1NC6A 2AMQA 1CA0C 3RDZA 3VFEA 3M36A 3PB1E 2PFEA 6GCHG 1WUNH 1KTTB 1TIOA 1HAGE 5A09A 1EKBB 1SQTA 1ARBA 2HNTC 5L2ZH 2JETC 1JWTA 2Z3DA 2K1QA 4OM9A 3M5MA 4X1SU 2FODA 2W7UA 3EE7A 3U8OH 1DOJA 1P02A 2G52A 1GI2A 3GDUA 3ZVGA 3KCGH 2J9NA 1GDQA 2AMDA 1SGPE 2B0FA 1LDTT 3M7TA 3RXJA 3BSQA 1QTFA 1SB1H 2PWXA 1F0RA 3OSYA 4YZUA 3DSGA 2ZZUH 2OXSA 4Q4LA 2DE8A 4ABEA 5EIYA 1UTOA 4WXIA 1P8VC 1LKAA 2BQWB 2HNTF 5C3NA 3MH7A 1QIXB 4B75A 2EY4C 2XXLA 1Y5UT 3WW7A 1AUTC 1HAVB 4CH8B 1MTWA 3F0PA 3GCOA 3NKKA 1JMOH 4FETA 4ZHMU 2BOKA 1TGNA 3FKSD 4TY7A 1SQAA 5A8XA 1SL3A 3ATIA 1FQ3A 2DUCA 1ZHMA 2FOAA 2RDLA 2Y80A 1HNEE 1YCPH 3GCHB 1CT2E 3QN7A 1IOEA 2D26C 4FVDA 4DT7B 1GI0A 3BTKE 1MTVA 4JZEH 4AN7A 2BVXH 3ESTA 1ACBE 1YM0A 1N8OB 4JZIA 1QRZA 3VPKA 1L1NA 1XKBC 1GI9B 1GPZA 3V3MA 1OWDA 2ASUB 2ZWLH 4NFFA 3BG8A 2GMTB 3RMNH 3RXPA 2ZPSA 3SZNA 1AZ8A 1TX7A 4INLA 2QXHA 1MBQA 2OINA 2FLRH 1UVSH 1GDUA 3F6UH 4HFPB 1S5SA 3BIVH 1O2ZA 2TGAA 3BTHE 3E90B 3ZZ6A 3P95A 4VGCB 3MNXA 4U30A 1PPZA 3B9FH 2CK3D 1NFYA 1MKXK 3UTUH 1SGEE 5CMXH 5DP7A 3QX5H 5DP3A 4I8JA 1XXDA 1NRQH 1FPHH 1HAHH 2THFB 5ESBA 1T31A 2O8WA 3BF6H 5EQQA 1MQ6A 1S6HA 1UCYK 1L4ZA 1S82A 1EPTB 1PPGE 3RM2H 3GDSA 1SI5H 5FX6A 1GMHG 1UHBA 1CT0E 5EG4A 4K1SA 4BANB 4AG1A 2O8UA 3NZIA 4B6EA 4NWKA 5LPEA 1U6QA 4Z0KA 3K6ZA 2RCEA 1KLTA 4SGAE 5DG6A 3FP8E 2HRVA 3RMMH 5GPIB 2BY9X 1S81A 1V2JT 3VGCB 1BRCE 7GCHG 1FJSA 1W7GH 3UIRA 2I6QA 2ALVA 1O5CB 1O2XA 4I8KA 4O3TA 3RXTA 1YKTA 1QY6A 2Y82A 3UY9A 2XBVA 4M9FA 1BCUH 1HB0B 2ZGXH 5B6LA 3KQBA 1LVMA 3F2GA 4IC6A 2OC1A 3A87A 1TABE 1ELBA 1S85A 1UTJA 2KM0A 4FUFA 3TJVA 4ABAA 3BTEE 1ELDE 3AASA 3VB3A 1MU8B 1ZOMA 1WTHD 2ZHQH 1BTWA 2ZTXA 5HIZA 3RXVA 4K2YA 2QCYA 2C8ZB 3P8NA 2A5KA 1BJUA 1XUHA 1QNJA 4DJZB 2C8YB 1ABIH 5C94A 2HVXA 2KCOA 2ZU1A 4HZHA 3OY5U 1T4UH 4B6FA 4CR5A 2BY5X 1WOFA 3UNRA 1E1RD 5E8EH 4F48B 4KELA 4Y11E 3K6YA 5GIBA 4FU7A 1LQEA 1PPHE 5C1XA 3GOVB 3ATWA 4YLQH 1MMJN 1VCWA 2Q1JA 3SYJA 3W95A 1W8BH 2LNCA 1MKWK 4F4OC 2BX3A 1TE0A 1ANCA 1BMAA 5K0HA 1C5XB 5CHAB 3AK5A 2P3TB 1C2DA 5CE1A 2JH6D 3GCHC 1O2IA 5HXFA 1LHCH 2XBWA 1C9PA 1S83A 1NN6A 3U8TH 2FM2A 1BUIA 1ZPCA 1GBCA 1C1OA 1WSSH 3IITA 2P3FH 1QL8A 1EQ9A 3TNTA 3P70B 2H6MA 1CHGA 1LPGB 1N8OC 3PMHB 3SV8A 5A8YA 1BHXB 2PUXB 3LGVA 2BQ6B 5F8ZA 4X8TH 1FY1A 1UTLM 1ZTLA 1ELAA 1W0JD 1GCTB 1ZMNA 3A7WA 4WWYA 4X8UH 3DCLA 2A4GA 2OQUA 1P2KA 4YOJA 1C2HA 1P2QA 5EQRA 3L33A 1G2LA 1BZXE 2OC0A 3M35A 3PLBA 1WDIA 4SGBE 3S9BA 4I7YH 1A0LA 3N7EA 1K1JA 5C1YA 3A84A 2SFAA 5EXMA 2PP6A 4OS6A 5H4IB 1SGQE 2R2MB 3F9GA 2JIZD 3TJOA 5EW1H 2TPIZ 4D7GA 1BDAA 2IOTA 2ZGCA 5EXNA 1AVWA 3NUMA 2FOEA 4JZDH 5DPAA 5T6FA 1IQJA 2BD2A 3ATMA 1DXPA 4TYDA 4DCDA 1MTNC 2XTTB 1Y5AT 2QA9E 2VU8E 2H9EH 4K69A 3GCTG 2JH5D 4B2BA 1EPTC 3PO1C 2G4UA 1NPMA 1XMNB 2VB0A 3KQEA 3EYDA 1V2NT 5L6NH 1QCPA 2O8MA 1BTHH 3OE7D 1SGIB 1YPHC 4ABIA 1O3GA 3LGUA 4XDEA 3K9XB 1D3QB 2BDAA 3RXAA 3O8BA 2ZGBH 2M5TA 1F0TA 2LP6A 3A89A 2VVCA 1ZMJA 3O8RA 4UE7H 4TWYA 3RLWH 4ASHA 1UW7A 3H7OA 4ISOA 1TX8A 4BXWA 2I6SA 2CJIA 1SGFA 2ZF0H 3ZZ4A 1B0FA 1O2YA 1SGRE 1AY6H 2HPPH 1YF4A 2BXUH 1HJ8A 2FO9A 1O3EA 1A3EH 2VGCB 3LJJA 4WMFA 1GL0E 4AB9A 4BAKB 3S9CA 3RXFA 4RI0A 2SGAA 2QE7D 3TK6A 1C5LH 2G51A 3PMBB 3BTFE 5HIYA 7ESTE 1GMCF 2WINI 1AWHB 5TCCA 4B2CA 1C1PA 3EE0B 4ZMAH 2EA3A 4XBBA 4H6SB 1BJVA 2HNTE 3KYFA 4ABHA 2ZI2H 2DE9A 1DS2E 1P12E 3DUXH 4NSYA 3VXFH 3RXOA 1ZSKA 2BMGB 1K0HA 5FCRA 2XC0A 3A86A 1AUJA 2PV9B 3A83A 1J15A 4YOGA 1TOMH 2OC7A 2GDEH 2BD5A 3SUEA 4ISLA 1SVPA 5FPYA 2KFWA 4FUBA 2QYIA 1IQGA 1FIWA 1LKBA 3RC5A 5A0CA 1GJ5H 6ESTA 1KLJH 1ZTJA 2WPLS 3ZV8A 2ZU5A 3A85A 4A1TA 1TNHA 3MO3A 4WMDA 1NZQH 1YPEH 1GJCB 2F9VA 2GZ7A 5CHAC 2AHME 1OP2A 1ZJDA 1QZ8A 3DA9B 4O3UA 3F9HA 3GCNA 3ODFA 4ABJA 1XVOA 1TPPA 2Z6BD 1TBRH 1YLDA 2Z9IA 4B2AA 4FOUC 3SJ8A 1A1RA 2W26A 3L3TA 2BDBA 2VVVA 1KSNA 2GZ8A 4IMQA 1AE5A 2V7QD 4JYUH 3SUDA 4LZ4B 1GHAF 1LQDB 2SGEE 3ZZ7A 5I46H 2R3YA 4F55A 1TA2A 2B7DH 1BOQA 3SHCH 4Y8XA 1PQ5A 2CMYA 2QXJA 3QZQA 1GBLA 2YMSD 4IN1A 1J8AA 1DITH 3HPTB 3TIUA 4ZH8A 4MLFB 4ZAEA 2ANYA 3E0NB 5JBTA 2V3HH 3KHVA 4ZCNA 3TPIZ 1Z8RA 1INCA 4X6NA 2GX4A 1FN8A 3F3BA 4ISIH 1P2OA 1NRRH 1AQ7A 5KGOA 1NBME 1P11E 3E91A 2FYRA 1GI3A 4NZQA 3SU3A 1CA8B 3T26A 2KCPA 2WPIS 1EJNA 4A1XA 1ZSLA 1A0JA 1UMAH 3K65B 2KCAA 3FP7E 1TNLA 3ZVDA 4CRFA 1YLNA 4Z1MD 1H1BA 2TGPZ 2PGQB 1GI1A 2ANKH 1TBZH 1QGFA 1YC0A 2OK5A 1HCGA 4GLYA 2IPHA 2WYJA 2VH6A 5DO4H 1BMMH 5B6OA 4WJG2 5I25A 1AN1E 1TBQH 1NESE 2ZFFH 5EU8A 3PV5A 3ZZAA 5C5OA 4NIVA 1Y3YA 4U2WA 2BY6X 2BLQA 3A7VA 5DKMA 5EQSA 2QY0B 3BTDE 1W11U 3LH3A 4FU9A 4YOIA 5J4QA 3OU0A 5FPTA 2ZO3H 3BTME 2BHGA 1TOCB 1TPSA 3MH5A 3LIWA 4ABGA 1C5OH 3MU0A 3P6ZB 1ESTA 1YBWA 4GHQA 3MH6A 2CGAA 4RSPA 2BZ6H 4B71A 1S0RA 2VIVA 2ZIQH 2WPHS 2VGCC 1THSH 1OPHB 2GJGA 2A45B 5KEDA 2ILNA 3A8AA 1G3CA 1AU8A 1EJMA 5E0HA 1O3PB 1KXEA 4UFFH 4ABDA 2ZQ1A 4IW4E 4X1QU 1W7XH 1HAIH 1K1NA 3KGPA 1GMCG 1NY22 1UHBB 3UR6A 5T3HA 4CBOA 1ZJKA 1BMNH 2CF8H 2ZU2A 4M7GA 1CSOE 1QB1A 1WXRA 1QA0A 1UTKA 2OP9A 2PTCE 2XNIA 4AFUA 1RTLA 4KP0A 2ZG0H 2FZZA 3MTYA 2BDHA 4XE4A 5CHBA 2HWLB 3LU9B 2F9UA 1JOUB 2A7HA 5EGMA 5T1VA 3TGKE 1CHOF 1ELCA 3D23A 3LH1A 2F3CE 1TGBA 5HKKD 1BRBE 2IN2A 4O97A 4JK5A 1O3OA 1UJ1A 3KQCA 2W6JD 2STAE 2C3SA 1MAYA 2Y7XA 3PM3A 1FY5A 1GI4A 5LH8A 2XRCA 2F9PA 3BTTE 3FFGA 5GCHF 4A5TS 2KX4A 3MO6A 1H9HE 3QUMP 1HAYB 2QXGA 1FMGA 3EGKH 1J14A 4MPWA 1FN6A 1ZPBA 3IG6B 2J92A 2K8IA 4O9VA 3FOAA 3KL6A 1W0KD 4JZ1A 3VB5A 2ODPA 1BRAA 1ZYOA 1F2SE 2XCFA 3BTWE 4TT3D 1BTPA 1FONA 1SMFE 5DSFA 1NS3A 1MKXH 1DSUA 1TMBH 4R0IA 2GVFA 1GHAG 2B5TB 2SGQE 3AAUA 3T28A 2P8OB 1ANBA 1PYTC 2QF4A 4CRBA 1Z8IB 2WYGA 1AD8H 2FOHA 4NA9H 1S0QA 1N6YA 3UWIA 1UCYH 2ZCHP 3RXSA 3B8JA 3RXGA 3RXLA 1LHGH 4Y79A 1O3JA 1ZR0A 4WMEA 1ABJH 2FPZA 2O9QA 4MNXA 4ISHH 3UFAA 1HLTH 1W0ZU 3NRLA 1DLEA 1TWXB 1THRH 3EA8A 5EJZA 3P8OA 1C1WH 1C9TA 4MPXA 2PKAA 3MU5A 5DP5A 1HIAA 2OTVA 2BOHB 2P94A 1VITF 2W3KA 2GGVB 2M2AA 1H9IE 1GJ8B 3MMGA 4Z6AH 3SI4H 5JDUB 1IQMA 1MABB 1SHYA 2VWOA 4CH2B 4CRCA 4WF8A 3RMLH 1W3CA 1S84A 2VINA 3DFJA 7LPRA 1BRUP 4DGJA 3ZYEA 1KLIH 1ZSJA 4XRNA 3SGBE 3ZVBA 3A7ZA 1YGCH 4K8BA 4X1PU 1FUJA 5FAHA 3RLYH 1VGCB 1YPHE 2HGTH 4UD9H 1TGSZ 4RT1A 1FXYA 4E7NA 3TLOA 1MH0A 1GGDC 4Y0YE 5LGOA 3UR9A 2H1UA 2AIPA 3UOPA 1A5HA 5IYTA 4FUIA 2BX4A 3E8LA 1V2MT 1WCZA 2FDAA 4LZ1H 2ESTE 2AS9A 1ETRH 3M61U 5C67A 1QQ4A 1Z6JH 2Q6DA 3SJKA 2PW8H 2VIDA 3Q77A 4Y0ZE 3SU0A 2VJ1A 3A7YA 3P8FA 4AG2A 1SC8U 6CHAB 1V3XA 1CVWH 4I8HA 1GVKB 1MKWH 4NA7A 3DHKH 5F8XA 2R3UA 1SLUB 3SU6A 1G2MA 2VIQA 3RXQA 1Y3UA 1OS8A 1TNJA 3QO6A 4F49A 1ELFA 1GBTA 5L2YH 3MNSA 2A2XH 1C1QA 1O2WA 1EP6A 4KGAA 1D3PB 1P2MA 2V35A 2FIRH 3NPSA 1O34A 5DK1A 1HV7A 2J98A 4E7RG 3UPEA 4ASUD 1GBIA 3RXMA 3SJ9A 3TH4H 1O2OA 4ZKRU 1IHTH 3Q3KA 1CHOG 2OLGA 3PRDA 4D76A 3MQKC 1FLEE 3VB4A 4CHAB 3BTQE 2RDEA 5F8TA 3P17H 4P00A 1NRSH 1RFNA 3ZVFA 3RP2A 1G3DA 4U01A 2FI4E 1OP0A 8LPRA 1A5IA 1T4VH 1O5FH 3AW0A 5AVDA 1DXWA 1C5UA 5EPNA 3TJUA 1TQ0B 2D8WA 2WHXA 4YLUA 1EAXA 1GVZA 2P8OC 2P93A 1FAKH 1DUEA 2EEKA 5FCKA 1CT4E 3RXBA 1ESAA 2G5VA 1YLCA 1DE7H 4Y7BA 3ZZ8A 4ZROA 3UB0A 3NK8A 4AGJA 2XBYA 4IMZA 3RMOH 2Y7ZA 3M5LA 4K3JA 1BIOA 1GI5A 1BITA 1B7XB 2BY7X 2XWBI 3URDA 3F0OA 3GY3A 2WUBA 3H7TA 3A81A 2A5AA 3W94A 3BG4B 1HPGA 2XWAA 3FZDA 3BTGE 2ZA5A 1VITG 2JJ1D 1BTXA 2XOKD 4KTCA 1XVMA 3F2FA 2BTCE 2J4IA 2R9PA 3ZZ9A 3PLKA 3T29A 1G30B 1NFWA 1K1MA 1QJ6B 2XBXA 4NIWA 1SFQB 3ZZCA 2O8LA 3OEED 2OCVB 1AFQB 1IQIA 2TRMA 3PTBA 1EP5A 2ZPQA 4H6TA 3PMAB 2GCTB 2ODQA 5A0BA 1VGCC 2KZ4A 4OS5A 1K1OA 1TLDA 2UUKB 5DP8A 4TSFD 3M7UA 1QBOA 4NWLA 2ZU3A 1JRSA 3LKWA 1SQOA 2QN5T 3TNSA 1Q2WA 3VG8A 1RJXB 2Z3CA 2UUJB 2VIWA 2ZPRA 1SFIA 5FBIA 1AI8H 1FDPA 1H8IH 5DP4A 4GCHF 3P92A 1AHTH 1RGQA 1WU1A 1MD8A 3HKIB 2FWWA 6CHAC 5ESTE 1V2KT 1L1JA 2P59A 1SSXA 1YWUA 3EQ0H 1BBRE 3S69A 1O0DH 5LPFA 4K5ZA 2PHBA 5DP6A 2BDIA 1C5QA 4A7IB 2GMTC 2ZTYA 1EOJA 1KDQA 4IBLH 1BTZA 1K22H 1H8ED 1MU6B 1V2VT 2D2DA 1C1VH 8ESTE 2TGDA 1ANEA 2QAAA 2Y5FA 3ZVCA 1B5GH 2J34A 5BRRE 2J97A 1UK3A 2WV5A 5A2MH 1D6WA 3BEIB 4DURA 4VGCC 2QF5A 1MD7A 4BTIB 1HYLA 3D65E 4WH6A 5A0AE 3UQOA 3N99A 3EA9A 4WVPE 1Z1IA 2B9LA 2OBOA 4TPIZ 5E2PA 2ZDMA 4CHAC 1C2FA 2Q6GA 3FANA 1NRPH 1EJAA 1ZGVA 3DT0H 3TVJB 2ZGJA 1ETTH 2ZDKA 3NCLA 1LTOA 2ZEBA 2HLDD 1IQKA 4I86A 2VWLA 3I78A 3UNQA 2L6OA 1MUEB 4E05H 1P09A 1V2ST 3SNCA 1QRWA 1SLWB 4BAHB 2ZDAH 2FXRA 3D49H 1P2JA 1ZHRA 2BYAX 3WWBA 1PFXC 1OP8A 4X8VH 2J38A 1AVGH 1FNIA 1TPOA 2PGBB 2V3OH 3U98H 1ZRKA 3VGCC 5DN6D 2AERH 2LPRA 3MWIU 2BD8A 1P01A 4TY6A 2FTLE 1GMDF 1O2NA
chains in the Genus database with same CATH topology
4H42U 4UFDH 1O3CA 2AH4X 1O2TA 3C27B 1O2VA 2W7SA 1O2GH 4BAQB 1N1LA 3MU4A 3TK5A 2VWMA 3SQHE 1G37A 1CQQA 3LGTA 2P16A 3SV6A 1SG8B 1UTNA 2NU1E 2QXIA 3HK3B 1Z6EA 1A61H 3TU7H 2HLCA 5SGAE 1FY8E 3SNEA 3OYPA 1QQUA 1NM6A 1BA8B 4K1EA 1UTQA 4MNYA 1WTGH 1P04A 3M7QA 3KN2A 1VCPA 4UFGH 1AFQC 2BVSH 2AYWA 1C1MA 2OBQA 3SJIA 1C1TA 3E16B 1LHEH 1CBWB 2GCTC 3KIDU 4BAMB 1EASA 1MZAA 4FXGH 1OSSA 3CP7A 4K1TA 4ZXYH 1P2IA 1NTPA 1IQNA 4NG9H 2FI3E 2WV4A 3SNDA 5ETXA 3UQVA 1C5TA 1EZQA 1SGDE 1W13U 2EI8A 4HTCH 2BY8X 1Z1JA 2PKAB 3SU1A 1HIAB 3KEEA 2XC5A 4XBCA 4GCHG 1C5PA 1K1LA 2CV3A 4YT6H 1ELGA 4ZKOU 4YTAA 3SJOA 3FZZA 4OGYA 1BBRH 1TMUH 1TX6A 1GCTC 1DPOA 3A82A 4X6OA 2RA3A 2A5IA 5AFZH 4UONA 1V2LT 1O3NA 1HFDA 1P57B 2BD7A 1NROH 3V12A 4A6LA 1NU7B 1AVXA 1XM1A 1D3TB 1V6DA 2VIPA 2SNVA 1PYTD 2R2WU 1DY8A 1O2UA 1BHXF 1CU1A 1LHDH 2A7CA 4X0WU 4Q7YA 3U8RH 1O2LA 2TGTA 3L6PA 1W14U 1TFXA 1QB9A 2AFQB 3RXIA 1OWJA 3SW2B 4FVBA 4ZUHA 2SGDE 3E1XB 1E37B 1TRNA 1YP9A 4FUEA 1TONA 3QWCH 3FP6E 4LOYH 1A5GH 4ABFA 1QB6A 2GKVE 1OYQA 1C5NH 3PTNA 1KIGH 6GCHF 1CA0B 4CREA 2ZHWH 1OWKA 1C4Y2 2H2ZA 4JZFH 3DD2H 1T8NA 3MNCA 3SU5A 1J9CH 1GJAB 2JH0D 4MTBA 1SGFG 4AYVB 1KXFA 3T5FH 1AGJA 1GJ9B 1NRNH 4AFQA 4CRAA 3GICB 4UDWH 1YYY1 4OGXA 3LGWA 3RXHA 1JRTA 1DWDH 1YPLH 3T27A 4AOQA 2WUCA 2FS8A 4GSOA 3A8DA 4YESB 3RXKA 3FAOA 3F9FA 2C90B 1E34B 2QF3A 1O2JA 3TJNA 1GMDG 4R8TB 1UK4A 1IQHA 3VXEH 1KXBA 4GAWA 1A46H 1C2GA 1DY9A 2AGEX 2SGPE 1GI6A 1TNKA 4Y7AA 2ZGHA 2GD4B 3SGAE 5C20A 1QBVH 1G9IE 1AB9B 3HK6B 3RXDA 1A2CH 4DG4A 4K60A 1EB2A 1O3FA 1P10A 1MBMA 4X1NU 4U32A 3GY4A 1V2PT 1NFXA 2UUFB 1TGTA 3T25A 1QA7A 3K2UA 5T6GA 1AKSA 1BTYA 2ZP0H 2F9OA 1EAIA 2ZKSA 1D6RA 4OS4A 4X1RU 1GBMA 3PMJA 1XXFA 5DJ7A 1JBUH 1TQ7B 5K7RA 3I29A 1CBWC 2Z9KA 1J16A 1OWIA 1BBRK 4D9RA 1PPBH 1FI8A 1TPAE 5F6MA 1GJ6A 3KF2A 2NWNA 3MNBA 4Q7ZA 1AZZA 1P03A 3PWBA 4Y10E 5JBBS 1V2RT 4X2WA 3TITA 2H5DA 2QF0A 3D62A 3SV7A 2YOLA 1O32A 3S0NA 3PYHA 3PROA 2G5NA 1SGTA 1UVPA 2TIOA 2G4TA 1HAOH 1LVYA 2O8TA 2UWPA 5JBAS 2HPQH 2ANMH 1TGCA 1F0UA 1UVTH 1MCTA 3STJA 2A0QB 2FLBH 1C2KA 2FMJA 3U1JB 1H4WA 3CS0A 1T7CA 2CXVA 1ELVA 1NFUA 1ORFA 2J95A 1GBBA 4GVUA 4MPVA 3QTOH 1DDJA 1C5YB 1WQSA 4ZHAA 1H8DH 5HM9A 1D4PB 3RUOA 1ZTKA 3PLPA 3ATLA 4OS2A 1K21H 1GHZA 1V2OT 3V7TA 2BLWA 2XCNA 2ZC9H 5EODA 1JXPA 1P3EA 2G00A 3SNAA 1Y5BT 3ZV9A 4AB8A 4KTSA 2BD3A 1QRXA 3S7KB 1V2TT 7GCHF 1TNGA 2A7JA 1H9LB 1AMHA 1L0ZA 1IAUA 2ULLA 2FYQA 1HAPH 3E0PB 3P8GA 3DFLA 3LGIA 5IDKA 2V6NA 1CGHA 1GBDA 3BEFB 1JIRA 2BQ7B 2ZTZA 1O3HA 3SNBA 2QIQA 2UUYA 1DANH 1O5GH 2G81E 4NA8A 1UTMA 4RKOB 4D8NA 1GJ4H 1D9IA 1V2UT 3LJOA 3LONA 1T8LA 1FY3A 3ATKA 1EZXC 1KDQB 3E6PH 3M3TA 4XOJA 1GBJA 1O2SA 1O5BB 3PWCA 1G36A 1DICA 2NU4E 2BDCA 3F1SB 2ZHFH 2FI5E 4B73A 2FEQH 1OOKB 1WV7H 2HALA 1AE8H 1TNIA 3BV9B 4FUHA 3SQEE 1W2KH 5HMAA 4ISNA 2B8OH 1GHWH 1RD3B 3HGPA 2HOBA 2FP7B 2FOGA 2BXTH 1LO6A 4J2YB 1EZUC 4LK4A 1UTPA 5TCAA 4XSKU 1DWCH 6LPRA 1PQ7A 1Y3XA 1TB6H 1BT7A 3LGYA 5EOKA 5JB8S 2ZNKH 4BAOB 1AB9C 3SO3A 1V2QT 2CN0H 1QL7A 1O36A 5AFYH 1DM4B 1O2PA 2BLOA 1GCDA 1BB0B 1F5LA 1PPFE 2BD4A 1MQ5A 2GZ9A 1Y8TA 2RG3A 2FTMA 3EAJA 5AHGH 2GV6A 2QGRA 4BOHA 3ENSB 1O31A 4ZXXH 1RIWB 2VH0A 4TPYA 1THPB 1B0EA 5JBCS 3HKJB 5HYOA 1IHSH 1C5ZB 3UREA 1PQAA 3A8CA 2ZFTA 5E0JA 1T32A 4AFSA 2ZFSA 2AGIX 1GBEA 4YO9A 4RKJB 4NZLA 1WBGB 2FX6A 1IQLA 4Y8ZA 1FAXA 4RN6A 1T8MA 2FOBA 4FUGA 1GBAA 1NU9A 1KY9A 3EA7A 1HJAB 2C93B 1GWAA 1QJ7B 3M5NA 2Z3EA 2VIOA 1O3DA 2PR3A 3V0XA 4E06H 1TMTH 4JYTA 3NWUA 1C5WB 1KXDA 5GCHG 2WPJS 2NU2E 2ZQ2A 2C8WB 1J17T 2H9TH 1TAWA 1K1PA 1RTKA 2BVRH 3QGNB 1DX5M 3V13A 1GHYH 2A4OA 4X2YA 4BTUB 3MH4A 2ZCKP 1HDTH 1MTNB 1MTSA 3BIUH 3GCTF 1KXCA 4XBDA 3UOUA 1P9UA 1K9OE 3SBKA 3T62A 3BN9A 4Y71A 4ZKSU 3PO1B 4Q80A 4Y8YA 1LPKB 3TH2H 2BB4A 2ODYB 1ZHPA 1MZDA 1O37A 3A80A 1HAZB 1Z8JB 1QFKH 2NU0E 2ZDNA 4DIIH 3U9AH 3SN8A 3SUGA 1XX9A 3ZZDA 1BMLA 3E3TA 4Y76A 2SGFE 3SORA 5JB9S 1A4WH 5GXPA 3A7TA 3MO9A 2G55A 3LC3A 1OKXA 4AYYB 2XW9A 1Z8GA 5FBEA 2BD9A 4QT8C 3RXUA 3HATH 4YM9A 2FOMB 1CO7E 2OQ5A 4X6MA 5EW2H 1HBTH 2Z9LA 2ZFQH 2KAIA 5GJ4B 4I8LA 5F03A 5ABWA 3AW1A 2FOFA 2Y5HA 4MDSA 3URCA 4OS7A 3GY8A 4GUXA 3HGNA 2EC9H 3NXPA 1TA6A 1DWEH 1O3BA 2W3IA 1QHRB 3RU4T 1XUJA 1ANDA 1O3AA 2Z9JA 2W5EA 3UWJH 1YCPK 2PSYA 3A88A 2D1JA 2C8XB 3UNSA 1IQFA 1GBHA 1LCYA 3QGJA 1AIXH 1KXAA 3R3GB 1GHBF 3KQDA 3LT3A 1GHVH 1WQVH 2CHAB 4A92A 1ZZZA 1O2HA 4MNVA 3RM0H 2A1DB 2BZAA 4PROA 1EXFA 3FVFB 4BXSA 1V2WT 2ZFRH 1Y3WA 2H5CA 4B74A 1VJAU 4I33A 1ZMLA 1LHFH 1GG6B 1O33A 3A8BA 3MU8A 3TH3H 4MVNA 1RIWC 1QBNA 3JZ1B 1UVOA 2GCHF 4X2VA 1FZZA 4X2XA 4CBNA 1O38A 3GY2A 5EXLA 1XKAC 2WPKS 4NSVA 3N7OA 5LPRA 1SGYE 4I32A 1EAUA 4A1VA 2J94A 5BPEA 1O2RA 1O3IA 3SHAH 1DLKB 1TRYA 2VVUA 4JCNA 3PV4A 4DOQA 1EX3A 1N6XA 2UWOA 4CRGA 4B1TA 1ZPZA 1P2NA 1OXGA 2IJOB 1HJAC 2WPMS 1HAVA 1XUGA 1W12U 4H4FA 4K8YA 1HGTH 4KKDA 1O39A 5C1UA 2A2QH 4DIHH 1G3EA 3LDXH 3T2NA 1YPMH 1C5SA 3SU4A 1O2MA 3BEUA 8GCHF 2AMPA 2BM2A 3MU1A 2BLVA 3G01A 1AKSB 3SUFA 1KTSB 1NO9H 4Q2KA 1SBWA 5C2ZA 2ANWA 3M3SA 3TGIE 4CR9A 9ESTA 4FUJA 4CRDA 5L30H 3ZZ3A 4LXBH 1O5EH 1C2LA 1SLXB 2VWNA 4X8SH 1KYNA 1L4DA 3O8CA 1GJBB 5EPYA 1E35B 1RTFB 4THNH 1EOLA 5T6DA 5PTPA 2GT7A 3RXCA 2ZHEH 4AZ2B 1G32B 4O03A 1WAYB 2XC4A 3BG4C 2RA0A 3GISB 1FIZA 2Y6TA 4HGCA 1Z71A 1C4U2 1L2EA 2ALPA 3GY5A 1SPJA 3A7XA 1C2EA 1CE5A 1OX1A 2YNAA 3MYWA 1ARCA 2BDGA 1DUAA 1UK2A 1JIMA 1XUIA 1NT1A 2XYAA 4AX9H 2EI7A 5GDSH 4IC5A 3TGJE 2ZHDA 1ZGIA 1VJ9U 4WXVA 1LVOA 1W10U 2Q6FA 1G3BA 1YPKH 2FX4A 4BNRA 1GJDB 1EPTA 3GYLB 1F5RA 2R0LA 9LPRA 2C4FH 3RXEA 2F91A 1Q3XA 1QURH 1P3CA 2Z7FE 1E38B 2A4RA 2PUQH 1O3LA 1F5KU 2SNWA 1ELTA 1PPCE 2GDDA 4NIXA 3VEQB 4IN2A 1YPGH 4NFEA 2P95A 3ODDA 3MI4A 2ZCLP 3Q3XA 3RC4A 1RRKA 3EDXB 1O2KA 4OS1A 3MFJA 1ESBA 3KNXA 2CHAC 3ZVEA 1AO5A 1GHBG 4UFEH 1WYKA 3CS7A 1BQYA 1PQ8A 1GJ7B 1LMWB 1A3BH 1O5DH 5E2OA 3ZYDA 1DT2A 4D9QA 1GG6C 1T8OA 2PKSB 2Y81A 1ELEE 1LVBA 1K2I1 1HXEH 4JYVH 1HUTH 1EATA 1C1SA 4NCYA 1EAWA 1P06A 3U1IB 1FV9A 3GY6A 2GCHG 1UVUH 1HJ9A 4INHA 3UUZA 4AGKA 2UWLA 4MPUA 1QL9A 3TK9A 1SGCA 1SGNE 2FOCA 2CF9H 3SI3H 3RU4E 4ZKNU 2AIQA 4WY3A 1K1IA 2G8TA 2GV7A 3H5CB 3STIA 2VNTA 1EB1H 4ABBA 4BTTB 2Z94A 1C4V2 2F9NA 2AEIH 1DSTA 5A8ZA 1DVAH 1GDNA 4DY7B 5JPMH 1UCYE 1ID5H 3OY6U 2A4QA 1C2MA 1HAXB 1SHHB 2ZFPH 3RC6A 4MG3A 1M9UA 1Y3VA 5FHTA 4AFZA 1EUFA 4GPGA 2A31A 1S6FA 3MHWU 1P9SA 5HM2A 1GVLA 1HXFH 2JETB 1TYNA 4NGAH 2OC8A 8GCHG 2R0KA 5FX5A 1IQEA 3IWMA 4UEHH 3CENA 2H9HA 3LPRA 1D3DB 1GBFA 3B23B 4INKA 5G4BA 2GT8A 1O5AB 2QC2A 3Q3YA 1P05A 3M37A 4I8GA 1OYTH 3M3VA 1MTUA 5HGGA 2PTNA 1X7AC 3QZRA 3Q76A 1VCQA 2FESH 1MCVA 7KMEH 1VITH 2P3UB 1C1RA 1VR1H 3ELAH 1K28D 1QR3E 2EI6A 1C1UH 1W0YH 1AFEH 1VZQH 3Q00A 1LPZB 5TJXA 2GTBA 4D7FA 2F9BH 5AF9H 3GY7A 1F0SA 2YNBA 2OUAA 5C5NA 1PPEE 4IGDA 1GGDB 1E36B 4FUDA 3VB6A 4MNWA 3C1KA 1RS0A 4TWWA 2ZU4A 3O8DA 4HI3A 4ZHLU 2Y5GA 1GHXH 3SU2A 2FS9A 5JYIA 3AAVA 4J1YA 2JKHA 4B76A 1Y59T 8KME2 3R0FA 1FPCH 1XUFA 4Q7XA 3GYMA 1A0HB 3LC5A 3U69H 1CGIE 3JZ2B 1F7ZA 2AGGX 1GL1A 2PLXA 1DFPA 3OTJE 1SLVB 1TRMA 4JMYA 3SGQE 1C1NA 1A7SA 3RU4D 3M5OA 3ZZBA 1GBKA 1YCPM 2A32A 4GHTA 3WY8A 1E0FD 1C2IA 2GP9B 1QJ1B 2STBE 2F83A 3QDZB 1MAXA 4XFQA 1YPJH 3SV9A 2BDYA 1C5RA 4KTUA 4NIYA 4MQAA 2NU3E 4X6PA 1AWFH 1O2QA 5FXLA 3QLPH 1O30A 1GI8B 3F68H 1GI7B 1RXPA 2QV1A 5DP9A 1FY4A 1HRTH 5DGJA 1F92A 3ITIA 2KAIB 2J2UA 1DWBH 3VB7A 1C5VA 4IS5A 4Y6DA 2PKSC 3SV2H 1O3MA 1C5MD 1PJPA 3AVZA 1ETSH 4FUCA 3GDVA 3RXRA 1ZRBA 1EZSC 1BTUA 2TBSA 5FPSA 3S9AA 3ZZ5A 4YT7H 1GMHF 2V0BA 1O35A 4FU8A 1C2JA 1OWHA 1L1GA 1OWEA 5J4SA 1P0SH 1UO6A 3MOCA 5E0GA 3ZVAA 2ZDVH 1ZLRA 5GWZA 1SOZA 1SR5C 1CGJE 2ZECA 4DVAU 1SOTA 3SOSA 3OX7U 3S7HB 4DW2U 4ESTE 2PSXA 3LOXA 1Q31A 1XUKA 2ZDLA 3QTVH 1TALA 1Z7KA 1O3KA 3QK1A 4I31A 2OD3B 2Z9GA 4WH8A 3F9EA 4AORA 4JK6A 3I77A 1NC6A 2AMQA 1CA0C 3RDZA 3VFEA 3M36A 3PB1E 2PFEA 6GCHG 1WUNH 1KTTB 1TIOA 1HAGE 5A09A 1EKBB 1SQTA 1ARBA 2HNTC 5L2ZH 2JETC 1JWTA 2Z3DA 2K1QA 3M5MA 4X1SU 2FODA 2W7UA 3U8OH 1DOJA 1P02A 2G52A 1GI2A 3GDUA