4FVDA

Crystal structure of ev71 2a proteinase c110a mutant in complex with substrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
molecule tags Hydrolase/hydrolase substrate
total genus 36
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvdA01
2HPPH 2RCEA 4Q7XA 2TPIZ 1T8OA 1LCYA 1Y3XA 3BG4B 1J14A 4R0IA 4FUBA 2EI8A 1FY1A 5JDUB 4Y0YE 3BF6H 4INLA 2NWNA 1RTKA 2H1UA 4X1PU 3SJOA 1RS0A 3ZZ3A 1Z1JA 1SR5C 3ZZ5A 2OC8A 2EEKA 5FPSA 3MU0A 2VH0A 5EQQA 2ZGXH 1O2MA 1JBUH 3B9FH 4FUDA 4B75A 3E0NB 1CSOE 2ZU5A 8GCHG 1N6YA 4I31A 1BJUA 1NS3A 4J1YA 4E7RG 1B0EA 2TGAA 2W3IA 1F0UA 1BB0B 1OWKA 1ACBE 3MH4A 1TX8A 3SGQE 1Q31A 1ANEA 2ZC9H 3HPTB 1ARBA 1A0HB 3A8AA 1PQ7A 2A32A 3P95A 1LVYA 1OS8A 3Q3KA 2FESH 3RMNH 4ZAEA 1X7AC 4NWLA 2GT7A 1LHEH 1QBNA 5C1XA 4JMYA 4IN2A 5AFYH 1ELFA 5L2YH 2B8OH 1TGNA 1P11E 2R2MB 2J4IA 4Y7BA 4DG4A 1O5DH 1THPB 1A0LA 1SOZA 2HNTF 3GY7A 3IITA 1V2PT 1ELCA 1PYTC 2THFB 5EPYA 1SGPE 1NO9H 1V2QT 1AFEH 3LPRA 4HFPB 3MWIU 4ZHMU 5DKMA 1E36B 5T6DA 1AHTH 2V0BA 1GBKA 2ZPRA 3W95A 4B73A 3QX5H 2F9PA 3I29A 2G51A 3SU1A 4BAQB 4FXGH 4Y79A 2A5IA 4X1SU 5FPTA 1Y8TA 5B6OA 1KSNA 4X6MA 2P3FH 1ABJH 1QL8A 1HIAB 2FOMB 2BXTH 2VJ1A 1EB1H 1K9OE 4I8LA 7ESTE 2GGVB 2VWOA 3UY9A 3NUMA 1AWFH 1SVPA 1JIMA 1BIOA 3KHVA 3NK8A 3E3TA 3Q00A 2XXLA 4JZFH 1A0JA 1EP6A 5T3HA 2BY7X 2FOEA 5C5OA 2G4UA 3CS0A 3R3GB 1GGDB 1ELAA 1SGTA 3RLYH 3NPSA 5E0GA 1SGNE 1UJ1A 4H4FA 4LZ1H 6GCHG 1WYKA 1VR1H 4R8TB 1UTJA 4WMDA 1QBOA 2H6MA 3KQDA 1ZSKA 4TPYA 3P8NA 2HRVA 1OWDA 1T4VH 4VGCB 1VJAU 2P8OB 1O5EH 2PUXB 3GDSA 3BG4C 3KGPA 1GJCB 3OYPA 1AIXH 1O2UA 2CN0H 3G01A 1S6FA 3PMJA 1C5XB 5C67A 1QL9A 2ZTZA 1ZRBA 1A5IA 2BDGA 2Z3CA 1QJ6B 4Y8YA 2CF9H 5TJXA 2XTTB 4CRGA 3U8RH 1AI8H 3OY6U 3PLKA 3CS7A 2QN5T 1NFYA 2ILNA 1D3QB 1GHAF 3LJJA 2OXSA 1AE5A 1TQ7B 2R2WU 3BTQE 2NU1E 5BPEA 2ZF0H 1ZR0A 1O2SA 1VZQH 2Y7XA 3MU1A 1XXFA 3A7VA 1Z8RA 1VITG 1GJ4H 2PGQB 2FS9A 1HUTH 1AY6H 2ZECA 4WXIA 2HVXA 2VIVA 1GHYH 2ZU2A 4X8SH 3QDZB 4NIYA 1P2OA 1OPHB 1K2I1 1TAWA 1O34A 2BX4A 3BTKE 3MU5A 1D6WA 4Q2KA 3TVJB 3ITIA 3MO9A 1BQYA 1HAVA 1UTMA 1O2QA 4NIVA 4ZKOU 3BV9B 1O3OA 4IMZA 4BAMB 5EU8A 1D4PB 4Y10E 1ZGIA 1C2HA 8GCHF 3ZVFA 1XX9A 1ESAA 1SI5H 4AFZA 4AGJA 4FUFA 4WY3A 1TE0A 1YC0A 2ALPA 1SLXB 3VFEA 3TGIE 4CRAA 2TGPZ 1PQ5A 3TJVA 3M36A 3MO6A 4F4OC 3M3SA 3TIUA 2XWBI 1U6QA 1C1OA 1VCWA 3K2UA 2AIPA 1J16A 2BD5A 2BY5X 1YLCA 2ZKSA 1O33A 2VVCA 2EI6A 3ZVDA 1XKAC 2PV9B 4B2BA 2CXVA 2OC7A 1GGDC 1LO6A 2OQUA 1YPHC 3RXBA 3ZVBA 1AFQB 1QTFA 1DANH 5ESTE 2WV5A 2V3OH 1O3BA 5T6FA 1LHDH 2F9NA 3FFGA 2QA9E 1ZOMA 3F1SB 3F9HA 1P9UA 1O3EA 1BMLA 3E91A 3EDXB 1DWBH 1AQ7A 3BIVH 1F5RA 2AGIX 4H42U 2C4FH 4VGCC 1YCPK 2P8OC 1NU9A 1KXEA 1ZTKA 3ENSB 1O2HA 5A2MH 4A7IB 2KAIA 1SGFG 1UTPA 3GY5A 2LNCA 4X6NA 2WYJA 2FI5E 2OQ5A 3A83A 1UK2A 4K60A 1O2KA 2VWNA 3ZZ9A 3NXPA 1WQVH 1EP5A 2IJOB 2D26C 1A3EH 1HB0B 1QGFA 2P3UB 2Z94A 3MMGA 4ABHA 1EZUC 2O8LA 4XBBA 1EOLA 1W14U 1TMBH 2HOBA 3KEEA 2FZZA 5A8XA 3UUZA 1LPKB 1PPGE 2M5TA 3NKKA 4IC5A 1SLWB 6GCHF 1L1NA 3HGNA 2I6SA 4HTCH 2CV3A 1TWXB 1SOTA 2FX6A 3D65E 1FZZA 2V35A 4WVPE 1E35B 1TNLA 2FXRA 3LH1A 4YTAA 1C1WH 1V2RT 2D2DA 4ABBA 2OD3B 3ELAH 1CVWH 3M7TA 1DDJA 1RIWB 2LPRA 5HMAA 1QA0A 4O3TA 3A88A 5EXNA 1A61H 2NU3E 5A09A 4MNWA 3Q3YA 1DSUA 2C8WB 4YT6H 3EA7A 1TOMH 1FMGA 1IQFA 1CGIE 3AW1A 4I8KA 4H6TA 3PROA 3ZZCA 4BAKB 3D62A 1IHTH 5ESBA 1IQMA 1SL3A 4NZQA 3P17H 3UR9A 1O3NA 1TBZH 1WTGH 4NA8A 2TGDA 4O3UA 1RXPA 3KQCA 4Y8ZA 1C5RA 1TPOA 2J94A 1F0SA 1A1RA 1VITF 1BOQA 1AGJA 4OS1A 2STBE 2VH6A 2BTCE 4NWKA 1Q3XA 4JYUH 1HFDA 2BVSH 3ATWA 1GBBA 1SFIA 3K65B 1L1GA 1AMHA 1IQEA 1SSXA 1DWCH 1KLIH 3E8LA 3PLBA 3LOXA 4NFFA 2Z9LA 3BTGE 3RC6A 2JETB 2ZFPH 4LK4A 3O8CA 2STAE 1PFXC 2H9TH 3LGIA 1UK4A 1EOJA 1RGQA 3VB5A 3K9XB 1AFQC 2PKSB 1C5NH 2GKVE 4ZH8A 2YOLA 2QXGA 6CHAB 2J9NA 1O5FH 4X8UH 5DP4A 1FLEE 2HALA 2ALVA 1QRWA 2PSXA 1G3BA 5LPEA 1S82A 1BTPA 3SJIA 2BOKA 1PQAA 2ZTYA 1XUJA 1XM1A 3ATIA 1GDUA 1GI3A 3A8CA 2VB0A 1ZPZA 3GCHB 3VB6A 1H8IH 4ESTE 1GI8B 4AB8A 2A5AA 4IBLH 3DHKH 1HRTH 1CQQA 1CGJE 1HJ8A 3L6PA 4AFUA 2J2UA 1TX7A 1PPBH 2FP7B 1GMDF 1HJ9A 3ZZDA 3TNTA 3MHWU 8KME2 2DE8A 3SU5A 1DSTA 3SOSA 2VVUA 4X0WU 3P92A 1MUEB 3FP7E 3UREA 1XUHA 2BDYA 1YM0A 4I8HA 2PGBB 1MU8B 4JZEH 4FUJA 5FXLA 1HAZB 1E0FD 2FX4A 4MPUA 3SUFA 1V2OT 3T62A 2BY6X 1O2OA 4AORA 1JRTA 2C90B 1IQJA 1HYLA 1QRZA 3AVZA 4OGYA 4BANB 4ABAA 1BBRH 1RIWC 1GWAA 3DUXH 1DS2E 5DP9A 1QQUA 3BIUH 4U32A 4X8TH 1P8VC 1N1LA 1EJNA 2ODPA 4YESB 1O5GH 3UOUA 1GJAB 1GI7B 2BLOA 4A92A 2CHAB 5AF9H 3STJA 2ZDLA 1O2RA 1SLUB 1D3TB 3EA8A 3PB1E 5GIBA 3A82A 3LGVA 1UVUH 5FPYA 2Y82A 4ZKRU 1HNEE 1YPHE 4CBOA 3S9AA 2W5EA 3UOPA 3MNCA 3R0FA 4DCDA 4NGAH 2W3KA 3QK1A 1ELBA 4CR9A 3Q77A 2WUCA 1BZXE 2ZIQH 4I8GA 1UHBA 5EOKA 3SUEA 1NC6A 1WQSA 1V2VT 3OU0A 2BQWB 2JETC 5EPNA 3PTNA 3B8JA 3ZZ4A 1DX5M 1HAVB 1ZSLA 1KLJH 3SV2H 2F91A 2GTBA 1K28D 1SGDE 2PKSC 2PW8H 1GL0E 3PMBB 5GCHG 1P3CA 2GV6A 6CHAC 5TCCA 2ZQ1A 2GCTB 2V6NA 4WH6A 3E6PH 2XBVA 4ZKNU 3MOCA 3URCA 1ZJKA 1M9UA 1NY22 4HGCA 3F9FA 2GDDA 1C5LH 1C9PA 3GCHC 3E16B 3KIDU 4OGXA 3SJ9A 2JH5D 4UDWH 1PPZA 2BX3A 2ZFQH 2GMTB 1Y5UT 2C3SA 3ODDA 3ZVGA 1V3XA 4UEHH 1Y5BT 1DXWA 2QXHA 2F9BH 3EGKH 1OP2A 1QA7A 1MBMA 1DE7H 1CHOG 1VCPA 1NFXA 2FOGA 3O8RA 2QXJA 5AFZH 7LPRA 3M7QA 1MTNB 4O97A 2OC1A 1K1IA 4FUGA 2A31A 2FEQH 3FP8E 2FLRH 1H9HE 1C2LA 1O3KA 1GMCG 2CMYA 1VGCB 2H2ZA 3TJUA 2QGRA 2F9VA 3ZZBA 3A86A 3PWCA 4DY7B 1YLDA 3KCGH 4YLUA 5FCKA 1GBCA 4BNRA 4SGAE 4X2VA 3SU4A 2A2XH 4DOQA 3RU4D 4B74A 2OINA 1ZTJA 1KY9A 2KAIB 2WPIS 1Z1IA 3AW0A 2A1DB 1W3CA 1G36A 2QXIA 3EE0B 1V2WT 3TJOA 1ZLRA 2WV4A 1S5SA 5EG4A 4YOJA 3TNSA 2XC0A 3N7OA 2FO9A 3Q3XA 4B2AA 2AH4X 3T29A 2CHAC 3SV7A 4LOYH 1GHVH 1S6HA 1GJBB 3DFLA 1TNGA 2ZQ2A 4ZMAH 1G32B 1F0TA 3VXEH 1DY8A 1IQGA 1LHFH 2WPHS 9ESTA 1C5OH 4JK6A 1HXEH 1NPMA 1OYQA 2NU2E 2ZDMA 1YF4A 1NT1A 1HAYB 2VWMA 1HAIH 4ZXYH 2Q6FA 1DT2A 3VXFH 3RU4E 3QTVH 1GI2A 2GV7A 1P02A 1ELGA 3KQBA 1GJ7B 1TOCB 2QAAA 5HM9A 5AVDA 4MPWA 1MH0A 3SQHE 5A0BA 1MTWA 5HXFA 3RP2A 1C2EA 1FIZA 1QB9A 1H8DH 1P05A 1V2TT 4Q7YA 3HK6B 3ZZ7A 3KQEA 1O2GH 1TNIA 1FIWA 2GCTC 3STIA 3PMHB 4JK5A 2ZHWH 1AKSB 2WYGA 1O35A 1LVMA 2ASUB 4NA9H 4Y11E 3RXGA 1W10U 1O38A 2UUFB 1JXPA 3E0PB 1TX6A 2Z9JA 1NRSH 2D1JA 1MKXK 2GMTC 3SGAE 2Z9GA 3PO1B 4DJZB 2QV1A 3H5CB 4AX9H 1O39A 2BD7A 3TU7H 1O37A 2FODA 1E34B 1TIOA 2OC0A 4INHA 3RXRA 3AASA 1HV7A 1K1PA 2SGDE 5G4BA 3KNXA 3V3MA 2G00A 2ZCLP 1MTNC 1TONA 2R0KA 1BTHH 2BZAA 1GHZA 1UTLM 3SNCA 5GCHF 1KXCA 1O3MA 3PWBA 1MKWK 2OUAA 2Y7ZA 1GBTA 2BZ6H 3SQEE 1DXPA 1VGCC 1OWJA 1GDQA 1RTLA 1XXDA 2VGCB 2JH0D 3SV8A 1SGEE 1MAXA 1OP0A 1EPTA 1Z71A 3RUOA 4MNXA 2G5NA 1NRNH 1RD3B 3NCLA 2ANMH 3P8GA 5K7RA 5DO4H 1SB1H 1HDTH 1SGRE 3DA9B 4I8JA 1DICA 1OSSA 4ABEA 1KLTA 1RTFB 2F3CE 1OXGA 1D3PB 1SFQB 3RXJA 3M5LA 1YCPH 1CHOF 1BHXF 2GCHG 1B0FA 1ETRH 2H9HA 4K3JA 1KXBA 1BRCE 1C1SA 1TGCA 4FUEA 3TJNA 2AGGX 2QIQA 1JMOH 1QJ1B 2A45B 1C1NA 2ZU4A 1CO7E 1DLKB 1P0SH 5FCRA 1GHXH 3PV4A 1A2CH 2Z7FE 1OWIA 1AWHB 3ZZ8A 1UO6A 1GMCF 4LXBH 3RXIA 4Y8XA 2ODQA 1UVSH 1O2NA 2BDIA 4K5ZA 1A5GH 2PUQH 2VIOA 4I32A 5EQSA 1UTQA 4ISIH 1AB9B 3M37A 5L2ZH 2ZFTA 1IQLA 2R3YA 3TK9A 1L0ZA 1C4V2 2ANKH 1XMNB 1EZSC 2ZGHA 5CE1A 5JBTA 1XUGA 2G52A 3KN2A 3LJOA 1UVOA 1LHGH 4JZDH 1E38B 2YNBA 2UWLA 1MQ6A 1YYY1 1MBQA 2GZ8A 3PLPA 3A7WA 4JZ1A 3M5OA 2BXUH 3SW2B 1MD8A 2ZPQA 2ZGBH 3MH6A 3S9CA 5A8YA 1THSH 3ZVEA 1TRMA 1C1PA 3F9GA 3UWIA 2ESTE 3FZDA 1Y3VA 3E90B 1FV9A 3P8FA 5JB9S 1TA6A 1C5QA 3RDZA 2FDAA 4BAHB 1BRBE 1TNKA 1G3DA 2ZFFH 2ZG0H 3VPKA 4IS5A 2BLQA 3PO1C 1ELVA 1VCQA 3UR6A 3MH5A 3TPIZ 1FY8E 2XWAA 2Y80A 1UHBB 4WMFA 4WWYA 1P2MA 5E0HA 1TGSZ 4TY6A 1MZAA 3RXSA 2DE9A 1GI4A 1A46H 1EAUA 4ISHH 1P2NA 2BLWA 3RMOH 4GSOA 1P57B 3RXTA 5IDKA 3A89A 3QUMP 1BTUA 4NCYA 2AEIH 1RFNA 4TYDA 2SGAA 1HAGE 1QB6A 1GBDA 4AB9A 1KXAA 2ZP0H 1SGFA 3S7HB 3RXVA 1BBRE 1WBGB 1FAKH 2VGCC 1T4UH 1V2KT 2FTMA 2A7CA 2UWPA 4YOIA 2B9LA 3RXHA 2B0FA 1LQEA 3RXAA 1MTSA 4UONA 1HBTH 1LTOA 3MU8A 1DVAH 3P8OA 1C5SA 1O3JA 1FN6A 1G2MA 1SG8B 1UCYK 2VNTA 2XRCA 1C1RA 1C4U2 5LPRA 2PTCE 4TWYA 1YPLH 1J17T 4KELA 1F2SE 1TQ0B 1SHHB 3LGYA 3A7TA 2HWLB 3A7XA 4RSPA 3FAOA 4ZHLU 3GY8A 2ANYA 4WXVA 2BD8A 2PTNA 2XBXA 1P2KA 1L4DA 2A4OA 3A81A 4K1SA 3UQVA 1PPHE 1UMAH 3GICB 5L6NH 1Z6EA 9LPRA 2ZDVH 3LGUA 5AHGH 2BM2A 4AFQA 5C2ZA 1GDNA 3TH4H 4BOHA 2GX4A 4X6OA 1BJVA 2HNTC 3PM3A 1P2IA 1C5MD 5C5NA 5H4IB 1LVOA 1AB9C 1GCTB 4Y7AA 1V2ST 2C8ZB 2B5TB 3SNAA 5EXMA 4GUXA 8ESTE 4TWWA 3HKJB 2C93B 5FX6A 1AO5A 5T6GA 3M7UA 4GAWA 1O3CA 6ESTA 2G81E 2VIDA 3EYDA 1DY9A 4NG9H 2SFAA 2H9EH 1EKBB 2BHGA 2ULLA 1K1OA 1ESTA 1JWTA 3NWUA 4JYTA 2O8UA 1T8MA 2P59A 3SGBE 1KIGH 2XYAA 1ZZZA 4YO9A 4YZUA 1CT0E 4F49A 1N8OC 1C2FA 3K6YA 1O31A 3QWCH 3U8OH 2A4GA 1AN1E 3TLOA 3A8BA 2RA3A 2WPKS 2IOTA 4B2CA 4DW2U 4IGDA 3RM0H 4XDEA 4AFSA 2TGTA 4MLFB 1C9TA 1SHYA 2TRMA 4UFGH 4IW4E 3RXMA 2WPJS 2D8WA 4TPIZ 3D49H 1GBMA 1ELTA 2ZHFH 1GVZA 1ZMJA 4UE7H 2F9OA 3U9AH 4NIWA 5A0CA 1WV7H 4YLQH 4K1TA 3RXDA 4D76A 1P2JA 3ESTA 2GZ9A 1AZ8A 2BDBA 4GHQA 2GDEH 4FUHA 4A6LA 3GISB 5F8ZA 2Z9IA 2Y6TA 5FX5A 2FOAA 2PR3A 3A80A 1GVLA 4JYVH 3VB4A 1QFKH 1P10A 2BDHA 1H9LB 2VINA 5FHTA 2F83A 1AZZA 3RMLH 4FUIA 3MFJA 1IQNA 4KGAA 1EUFA 2Q6GA 5TCAA 3TITA 5HGGA 2BD2A 4ABDA 3ZV9A 3RU4T 1JRSA 2Z6BD 4ASHA 2GD4B 3UNRA 4Z0KA 1KTSB 1TFXA 3VB7A 3H7OA 3GY6A 1XVMA 1Z8JB 3CP7A 5PTPA 3M3VA 2Q1JA 4AZ2B 1F5KU 1ETTH 1WU1A 3SO3A 1UTKA 1GCTC 1EPTB 1CA0B 1O2XA 1NZQH 1RJXB 1N6XA 3RXFA 2W7UA 4E05H 2VWLA 3S9BA 1TABE 1Y3YA 1VITH 5J4SA 1O2TA 5DP3A 1O0DH 3RXQA 1BTYA 2GT8A 5BRRE 2ZWLH 5DGJA 1W12U 1C5VA 2P94A 2G55A 3UIRA 2ZCKP 1YBWA 1NU7B 1L4ZA 7KMEH 4Q80A 3SORA 4D8NA 1FDPA 5L30H 2G8TA 1DFPA 3ATMA 3OX7U 2NU0E 1MCTA 1JOUB 3SNBA 1MTUA 1EX3A 3UQOA 3ZVCA 1HAPH 3GOVB 4TY7A 1FQ3A 5EXLA 3SNEA 1H4WA 1A5HA 5FBEA 4GHTA 4A1XA 2FPZA 2GVFA 1AVXA 2BVXH 2A4RA 2BD3A 1YP9A 1GI5A 1WTHD 1V2UT 2V3HH 2J95A 1QB1A 1C5WB 1CE5A 1SPJA 1ZPCA 4DURA 2FYRA 3HATH 1J9CH 3I77A 1INCA 5DP6A 2DUCA 2BB4A 4BAOB 2ZU1A 4RKOB 4BTIB 5GPIB 5CHAB 1SGIB 2QY0B 4E06H 3FP6E 5DPAA 2QC2A 2BD4A 1GJ5H 1XVOA 4KTCA 2WPLS 1GG6B 1P01A 2SGFE 3LONA 4X1QU 1MTVA 4BXSA 2HNTE 5C3NA 2J34A 1G3CA 1DWEH 1PPEE 2Y5HA 1W13U 1P9SA 2FOHA 2FOBA 1NTPA 1A3BH 2ZA5A 2P16A 2J92A 5CMXH 4CRCA 1C5YB 1SQOA 1GBLA 1T31A 4GPGA 4HZHA 3U1JB 4NIXA 3RXUA 1QCPA 2Z3DA 2AS9A 1D9IA 1ETSH 5JPMH 3SU3A 1T8NA 1EPTC 3QLPH 1BRAA 1CA0C 1ZHRA 1A7SA 4NZLA 1ID5H 4ABFA 3SV6A 3VB3A 5I46H 2JKHA 4KTUA 2VVVA 3GDUA 2JH6D 3RXKA 5FAHA 1FPHH 3QGJA 4THNH 3S0NA 3KL6A 1MKWH 1G3EA 3T2NA 1BMMH 1TA2A 3SI3H 2OP9A 1C2IA 2VIQA 1GBHA 4D7FA 4XFQA 3TH3H 1YPEH 4K1EA 3SHAH 2ANWA 1Y3WA 1Z8GA 4O03A 1CT2E 3TH2H 1SLVB 1BMNH 2FTLE 1OWHA 1ZTLA 8LPRA 2SGEE 2ZHDA 2FIRH 1BTZA 2BD9A 5DK1A 1K1JA 1F7ZA 1V2JT 5GXPA 4WJG2 5LH8A 3UNSA 4DIHH 2ZHQH 4XE4A 4WMEA 1FN8A 5HYOA 2YNAA 3LGTA 1NESE 3BTEE 1IOEA 2AMPA 4X2WA 4RN6A 1DPOA 3SBKA 2BDCA 1GJ9B 4AOQA 4CBNA 5F6MA 1ZYOA 3PTBA 1O2JA 1HPGA 3C27B 5FBIA 1V2LT 3MYWA 3PYHA 3SJ8A 1KXFA 1UK3A 1BITA 1WOFA 1O30A 2HPQH 3LIWA 1PPCE 2ZO3H 1OYTH 1DUEA 4PROA 2B7DH 4OS4A 5LGOA 2R3UA 3EQ0H 1HJAB 1SQTA 1NN6A 1C5UA 1G30B 1O3DA 5CHAC 3GY3A 1PJPA 1SBWA 1CGHA 1EB2A 3EA9A 3EAJA 1MAYA 2J38A 2UUKB 1CA8B 5GJ4B 4MG3A 1GG6C 1V2MT 1Y5AT 1YKTA 5ETXA 3BTFE 5ABWA 1HXFH 2OCVB 3DFJA 2UWOA 1O2WA 1KYNA 4XSKU 2RA0A 4ZKSU 5DG6A 2ZZUH 1W0YH 2QF0A 4NFEA 3BTTE 1YPMH 3OSYA 3QO6A 1W8BH 1C2MA 1O3GA 1QJ7B 1EJAA 2XBWA 1YPJH 3QN7A 3ZYEA 2W7SA 1FI8A 5EW1H 1EAXA 1O3PB 2AYWA 1NM6A 1YPGH 2P95A 1C2KA 2VU8E 1IQIA 1C2GA 4CH8B 2CGAA 3PMAB 2PKAA 2Y81A 3UPEA 2A5KA 1DM4B 3SN8A 3HK3B 1O5AB 5E2OA 3BN9A 4ZROA 1WSSH 4FVDA 2FOCA 5E2PA 1QIXB 3NZIA 1SGQE 1QL7A 2IPHA 4B71A 1NRPH 5EGMA 4A1VA 5C20A 5EW2H 1OP8A 2WUBA 1UVPA 2C8XB 1YPKH 4B76A 1GHBG 1IHSH 1H9IE 4QT8C 4UFDH 3SUDA 3GCOA 3LC3A 1AUTC 1TNHA 1L1JA 2BQ6B 4FU9A 1UCYH 1AU8A 1V2NT 4YM9A 4U01A 1MD7A 2XC5A 5E0JA 3Q76A 4Z6AH 2QYIA 2BVRH 3MNBA 3W94A 2PSYA 4AN7A 1PQ8A 1XUFA 2Z3EA 4K8YA 3V13A 2ZFRH 2OBQA 1W2KH 3MU4A 3UTUH 3U98H 1IQKA 5A8ZA 1CU1A 1GI9B 1AD8H 1O2PA 3H7TA 3OY5U 2ZTXA 1GI0A 3RMMH 2CF8H 1GJ6A 3AAVA 4OS6A 1HAHH 2AERH 2O8TA 3RC4A 2OLGA 3GY2A 3IWMA 4O9VA 3U8TH 3BSQA 3KF2A 1IAUA 4AYVB 4MNYA 4X1NU 1FNIA 3M5MA 2EC9H 4WH8A 4I33A 1SGCA 1HJAC 1ZSJA 3M35A 2XBYA 3LGWA 1O2LA 1S83A 3M3TA 3SHCH 3UWJH 1SC8U 4CHAB 1QBVH 1V6DA 2SGQE 1P3EA 1O3FA 2XNIA 5DP8A 4OS2A 1ZGVA 1FONA 1BT7A 2G4TA 2CJIA 6LPRA 1BTWA 4A5TS 1N8OB 1LPZB 2A2QH 1UTNA 2RDLA 4OS5A 3SUGA 2W26A 4MNVA 1TBQH 1C1QA 4NSVA 3RXLA 2HGTH 1OKXA 1GMHG 3GCNA 1GL1A 2BOHB 1TPPA 1J15A 4MVNA 3F9EA 3SU2A 2ZHEH 1ZMLA 1DOJA 4OS7A 1GCDA 4CR5A 4IMQA 2K1QA 3HGPA 4AG2A 2ZGCA 1O2YA 1S85A 3T28A 4CRBA 2FMJA 1DLEA 2ZNKH 1ZHMA 1ANBA 3T26A 3TGKE 2A7HA 1ANDA 1NRQH 1BHXB 3S69A 3ATKA 4U30A 5C1UA 3P70B 1C1MA 1UTOA 1EAWA 1AE8H 1L2EA 1QHRB 3A7ZA 3QZRA 3SJKA 1GBIA 1WCZA 2O9QA 1ZPBA 2BY8X 4SGBE 3DD2H 4D9RA 1T7CA 2Y5GA 1QNJA 1K22H 5GWZA 2AFQB 1SMFE 1Y3UA 3F68H 1W7GH 1LPGB 5JBAS 1MQ5A 2FOFA 4MPXA 1GMDG 2ZI2H 3LC5A 4X2YA 1VJ9U 4Y76A 1EXFA 2P3TB 4H6SB 3ZV8A 3RM2H 1GBJA 3MI4A 4GCHG 1HCGA 1H1BA 1BUIA 1YCPM 1KDQA 2FWWA 1LKBA 2FS8A 4K69A 1Z8IB 1PYTD 3VGCB 1LVBA 4CH2B 1UVTH 2Q6DA 1BCUH 2ZGJA 1GJ8B 1EASA 2PWXA 3C1KA 2QF3A 3A85A 3RXPA 3MO3A 1S84A 4ZUHA 3LT3A 1F92A 4DIIH 1NRRH 2ZPSA 3CENA 3M5NA 1MMJN 3BTWE 3UFAA 4AG1A 3GYMA 1TGBA 4ISLA 3U1IB 1CBWB 4NA7A 1GHBF 1ELEE 1TB6H 4IN1A 2RG3A 2Z9KA 1TLDA 1Z6JH 4CHAC 4GVUA 1WAYB 4NSYA 1FUJA 1LHCH 1OOKB 1TMUH 1YGCH 2GCHF 1AVWA 5HM2A 3JZ1B 2G5VA 3LH3A 1J8AA 1D6RA 3O8BA 2IN2A 3RXEA 3BTME 1LQDB 2OBOA 1HGTH 1P2QA 3ODFA 3QGNB 3BEUA 3ZZ6A 3ATLA 1C5PA 5F8XA 3AAUA 1LKAA 3QZQA 2C8YB 4KP0A 2FI3E 5EODA 3LDXH 1W11U 2PHBA 1GJDB 4CRDA 2ODYB 4ABIA 1B7XB 2BDAA 1O5BB 3A84A 5DP7A 1EZQA 2VIWA 1P09A 5C1YA 1P06A 1OWEA 5IYTA 2A7JA 4X8VH 2FM2A 2ZFSA 1OX1A 2SNVA 2F9UA 4JZIA 1G37A 2H5CA 4A1TA 2Y5FA 1ORFA 1O3AA 1K1MA 1O5CB 3BG8A 1AKSA 1KXDA 4INKA 3UNQA 1NFUA 4BTUB 1C1VH 4CREA 3MH7A 3P6ZB 4FUCA 3RXOA 2EA3A 1GBEA 3GDVA 3A8DA 2AGEX 3SU6A 4HI3A 5EQRA 1TRNA 1ZMNA 5E8EH 3MTYA 4WF8A 2BQ7B 3OTJE 1ABIH 2BYAX 1QURH 2WINI 2BY9X 5J4QA 4FVBA 4X1RU 1GMHF 3FANA 1S81A 3L33A 1HIAA 2FYQA 2P93A 1P12E 1S0QA 4K8BA 1AUJA 1O2IA 1C1UH 3MNXA 4D7GA 1FY4A 1EATA 5F8TA 4X6PA 1ANCA 2FLBH 3GCTG 1G9IE 1FXYA 3ZYDA 5I25A 1C5TA 4XOJA 2TBSA 1DITH 3TK5A 4YT7H 7GCHG 3VGCC 3T5FH 2PKAB 4ZHAA 2UUYA 1BDAA 3A87A 2QCYA 1K1NA 2ZDKA 3V12A 5JB8S 1QR3E 2A4QA 2PFEA 3JZ2B 1F0RA 4ZXXH 3SNDA 1MCVA 1TMTH 2XW9A 4IC6A 2R0LA 4FU7A 1C5ZB 1TPAE 2ZDNA 1W0ZU 1BA8B 4Y6DA 3MNSA 3K6ZA 5GDSH 1CBWC 1GBAA 1KTTB 4DVAU 4ABGA 1CT4E 1FAXA 1BRUP 3DT0H 1IQHA 3O8DA 1FPCH 2ZEBA 1GI1A 4XBCA 1TNJA 2BLVA 4ISOA 3M61U 3ZVAA 2AIQA 4GCHF 3T27A 2XC4A 4UD9H 1HAOH 1E37B 5JBBS 4DT7B 2I6QA 4Y71A 3HKIB 3LU9B 3V0XA 3IG6B 1TPSA 2R9PA 1O3HA 4X2XA 1O32A 1O2VA 2ZCHP 1K1LA 1Y59T 3RLWH 1GI6A 2O8MA 1TALA 2H5DA 1QQ4A 4ISNA 2UUJB 1O36A 2FI4E 4LZ4B 2XCFA 4MTBA 5LPFA 1C1TA 3ZZAA 3S7KB 1FJSA 3VEQB 3TGJE 5JYIA 3BEFB 1ZRKA 1ZJDA 1BMAA 2O8WA 1XKBC 5K0HA 1LMWB 2GP9B 2GZ7A 1TGTA 1THRH 3URDA 2HLCA 2A0QB 4AYYB 1RRKA 1C2JA 1GHWH 3TK6A 3I78A 1SGYE 1FY5A 1F5LA 1XUIA 4DGJA 1PPFE 1O2ZA 1UCYE 4KKDA 3FZZA 4Y0ZE 3BTHE 1W7XH 1Z7KA 1NFWA 1Q2WA 1A4WH 3GY4A 1K21H 1AVGH 2AMQA 3FVFB 4XBDA 1O3LA 3L3TA 3SV9A 1T8LA 3U69H 1O3IA 2SNWA 4B1TA 1GVKB 4MQAA 1B5GH 4U2WA 1BTXA 1EZXC 5SGAE 1G2LA 2XCNA 1ARCA 4J2YB 1MU6B 4I7YH 4KTSA 1ESBA 5JBCS 5F03A 1MKXH 1ZHPA 3B23B 4M7GA 1TRYA 3E1XB 1EQ9A 2OTVA 1NROH 3BEIB 1ELDE 1S0RA 5DP5A 2SGPE 2VIPA 3T25A 1SQAA 4RKJB 1LDTT 1HAXB 2TIOA 2ZU3A 4BXWA 2PLXA 3SI4H 2AMDA 4BTTB 4E7NA 1FY3A 3RXCA 1P04A 3V7TA 4ABJA 4FU8A 1GPZA 1EJMA 3A7YA 1CHGA 5A0AE 3SZNA 1GBFA 2BMGB 2ZDAH 4AGKA 1C4Y2 4YOGA 3BTDE 3QTOH 5DJ7A 1JIRA 4MPVA 4UFEH 4K2YA 2WPMS 3D23A 1P03A 3F6UH 1HLTH 3GCTF 4Q7ZA 1DUAA 1KDQB 1D3DB 1TYNA 4GLYA 1EAIA 2EI7A 4CRFA 1MZDA 1QRXA 3SU0A 1DWDH 1XUKA 2NU4E 7GCHF 3GYLB 1GHAG 4UFFH 1BBRK 3WY8A 1WUNH 3LKWA 1QY6A 3RC5A 4D9QA 1T32A 1C2DA 1TBRH 4MDSA 4JCNA
chains in the Genus database with same CATH superfamily
2HPPH 2RCEA 4Q7XA 2TPIZ 1T8OA 3SYJA 1LCYA 1Y3XA 3BG4B 1J14A 4R0IA 4FUBA 2EI8A 1FY1A 5JDUB 4Y0YE 3BF6H 4INLA 2NWNA 1RTKA 2H1UA 4X1PU 3SJOA 1RS0A 3ZZ3A 1Z1JA 1SR5C 3ZZ5A 2OC8A 2EEKA 5FPSA 3MU0A 2VH0A 5EQQA 2ZGXH 1O2MA 1JBUH 3B9FH 4FUDA 4B75A 3E0NB 1CSOE 3PRBA 2ZU5A 2QF4A 8GCHG 1N6YA 4I31A 1BJUA 1NS3A 4J1YA 4E7RG 1B0EA 2TGAA 2W3IA 2IJD1 1F0UA 1BB0B 1OWKA 1ACBE 3MH4A 1TX8A 3SGQE 1Q31A 1ANEA 2ZC9H 3HPTB 1ARBA 1A0HB 3A8AA 1PQ7A 2A32A 3P95A 1LVYA 1OS8A 3Q3KA 2FESH 3RMNH 4ZAEA 1X7AC 4NWLA 2GT7A 5EIYA 1LHEH 1QBNA 5C1XA 3AK5A 4JMYA 4IN2A 5AFYH 1ELFA 5L2YH 2B8OH 1TGNA 1P11E 2R2MB 2J4IA 4Y7BA 4DG4A 2KCAA 1O5DH 1THPB 1A0LA 1SOZA 2HNTF 3GY7A 3IITA 1V2PT 1ELCA 1PYTC 2THFB 1MABB 3WW7A 5EPYA 1SGPE 1NO9H 1V2QT 1AFEH 3LPRA 4HFPB 3MWIU 4ZHMU 5DKMA 1E36B 5T6DA 1AHTH 2V0BA 1GBKA 2ZPRA 3W95A 4B73A 3QX5H 2F9PA 3I29A 2G51A 3SU1A 4BAQB 4FXGH 4Y79A 2A5IA 4X1SU 5FPTA 1Y8TA 5B6OA 1KSNA 4X6MA 2P3FH 1ABJH 1QL8A 1HIAB 2FOMB 2BXTH 2VJ1A 1EB1H 1K9OE 4I8LA 7ESTE 2GGVB 2VWOA 3UY9A 3NUMA 1AWFH 1SVPA 1JIMA 1BIOA 3KHVA 3NK8A 3E3TA 3Q00A 2XXLA 4JZFH 1A0JA 1EP6A 5T3HA 2BY7X 2FOEA 5C5OA 2G4UA 3CS0A 3R3GB 1GGDB 1ELAA 1SGTA 3RLYH 3NPSA 1E79D 5E0GA 1SGNE 1UJ1A 4H4FA 4LZ1H 6GCHG 1WYKA 1VR1H 2WSSD 4R8TB 1UTJA 4WMDA 1QBOA 2H6MA 3KQDA 5EJZA 1ZSKA 4TPYA 3P8NA 4M9FA 2HRVA 1OWDA 1T4VH 4VGCB 1VJAU 2P8OB 1UW7A 1O5EH 2PUXB 3GDSA 3BG4C 3DCLA 3KGPA 1GJCB 3OYPA 2OK5A 1AIXH 1O2UA 2CN0H 3G01A 1S6FA 3PMJA 1C5XB 5C67A 1QL9A 2ZTZA 1ZRBA 1A5IA 2BDGA 2Z3CA 1QJ6B 4Y8YA 2CF9H 5TJXA 2XTTB 4CRGA 3U8RH 1AI8H 3OY6U 3PLKA 3CS7A 2QN5T 1NFYA 2ILNA 3PV5A 1D3QB 1GHAF 3LJJA 2OXSA 1AE5A 1TQ7B 2R2WU 3BTQE 2NU1E 5BPEA 2ZF0H 1ZR0A 4Q63A 1O2SA 1VZQH 2Y7XA 3MU1A 1XXFA 3A7VA 1Z8RA 1VITG 1GJ4H 2PGQB 2FS9A 1HUTH 1AY6H 2ZECA 4WXIA 2HVXA 2VIVA 1GHYH 2ZU2A 4X8SH 3QDZB 4B6FA 4NIYA 2V7QD 1P2OA 1OPHB 1K2I1 1TAWA 1O34A 2BX4A 3BTKE 3MU5A 1D6WA 4Q2KA 3TVJB 3ITIA 3MO9A 1BQYA 1HAVA 1UTMA 1O2QA 4NIVA 4ZKOU 3OEHD 3BV9B 1O3OA 4IMZA 4BAMB 5EU8A 1D4PB 4Y10E 5FL7D 1ZGIA 1C2HA 8GCHF 3ZVFA 1XX9A 1ESAA 1SI5H 2F4LA 4AFZA 4AGJA 4FUFA 4WY3A 1TE0A 1YC0A 2ALPA 4TSFD 1SLXB 3VFEA 3TGIE 4CRAA 2TGPZ 1PQ5A 3TJVA 3M36A 3MO6A 4F4OC 3M3SA 3TIUA 2XWBI 1U6QA 1C1OA 1VCWA 3K2UA 2AIPA 1J16A 2BD5A 2XOKD 2BY5X 1YLCA 2ZKSA 1O33A 2VVCA 2EI6A 3ZVDA 1XKAC 4DT4A 2PV9B 4B2BA 2CXVA 2OC7A 1GGDC 1LO6A 2OQUA 1YPHC 3RXBA 3ZVBA 1AFQB 1QTFA 1DANH 5ESTE 2WV5A 2V3OH 1O3BA 5T6FA 1LHDH 2F9NA 3FFGA 3PRDA 2QA9E 1ZOMA 3F1SB 3F9HA 1P9UA 1O3EA 1BMLA 3E91A 3EDXB 1DWBH 1AQ7A 3BIVH 1F5RA 2AGIX 4H42U 2C4FH 4VGCC 1YCPK 2P8OC 1NU9A 1KXEA 1ZTKA 3ENSB 1O2HA 5A2MH 4A7IB 3CNRA 2KAIA 1SGFG 1UTPA 3GY5A 4XD7D 2LNCA 4X6NA 2WYJA 3KYGA 2FI5E 2OQ5A 3A83A 1UK2A 4K60A 1O2KA 2VWNA 3ZZ9A 3NXPA 1WQVH 1EP5A 2IJOB 2D26C 4FOUC 1A3EH 1HB0B 1QGFA 2P3UB 2Z94A 3MMGA 4ABHA 1EZUC 2O8LA 4XBBA 1EOLA 1W14U 1TMBH 2HOBA 3KEEA 2FZZA 5A8XA 3UUZA 1LPKB 1PPGE 2M5TA 3NKKA 4IC5A 1SLWB 6GCHF 1L1NA 3HGNA 2I6SA 4HTCH 2CV3A 1TWXB 1SOTA 2FX6A 3D65E 1FZZA 2V35A 4WVPE 1E35B 1TNLA 2FXRA 3LH1A 3DSOA 4YTAA 1C1WH 1V2RT 2D2DA 4ABBA 2OD3B 3ELAH 1CVWH 3M7TA 1DDJA 1RIWB 2LPRA 4Q4LA 1QA0A 5HMAA 4O3TA 3A88A 5EJLA 5EXNA 1A61H 2NU3E 5A09A 4MNWA 3Q3YA 1DSUA 2C8WB 4YT6H 3EA7A 1TOMH 1FMGA 1IQFA 1CGIE 3AW1A 4I8KA 4H6TA 3PROA 3ZZCA 5C94A 4BAKB 3D62A 1IHTH 5ESBA 1IQMA 1SL3A 4NZQA 3P17H 3UR9A 1O3NA 1TBZH 1WTGH 4NA8A 2TGDA 4O3UA 1RXPA 3KQCA 4Y8ZA 1C5RA 2M2AA 1TPOA 2J94A 1F0SA 1A1RA 1VITF 1BOQA 1AGJA 4OS1A 2STBE 2VH6A 2BTCE 3F2FA 1Q3XA 4JYUH 4NWKA 1HFDA 2BVSH 3ATWA 1GBBA 1SFIA 3K65B 1L1GA 1AMHA 1IQEA 1SSXA 1S6LA 1DWCH 1KLIH 3E8LA 3PLBA 3LOXA 5CHBA 4NFFA 2Z9LA 3BTGE 3RC6A 2JETB 2ZFPH 4LK4A 3O8CA 2STAE 1PFXC 2H9TH 3LGIA 1UK4A 1EOJA 1RGQA 3VB5A 3K9XB 5C0UA 1AFQC 2PKSB 1C5NH 2GKVE 4ZH8A 2YOLA 2QXGA 6CHAB 2J9NA 1O5FH 4X8UH 5DP4A 5IK2D 3PV2A 1FLEE 2HALA 4XRNA 2ALVA 1QRWA 2PSXA 1G3BA 5LPEA 1S82A 1BTPA 3SJIA 2BOKA 1PQAA 2ZTYA 1XUJA 1XM1A 3ATIA 1GDUA 1GI3A 3A8CA 2VB0A 1ZPZA 3GCHB 3VB6A 1H8IH 4ESTE 1GI8B 2RDEA 4AB8A 2A5AA 4IBLH 3DHKH 1HRTH 1CQQA 1CGJE 1HJ8A 3L6PA 3H09A 4AFUA 2J2UA 1TX7A 1PPBH 2FP7B 1GMDF 1HJ9A 3ZZDA 3TNTA 3MHWU 8KME2 2DE8A 3SU5A 1DSTA 3SOSA 2VVUA 4X0WU 3P92A 1MUEB 3FP7E 3UREA 1XUHA 2BDYA 1YM0A 4I8HA 2PGBB 1MU8B 4JZEH 4FUJA 5FXLA 1HAZB 1E0FD 2FX4A 3WWFA 4MPUA 3SUFA 1V2OT 3T62A 2BY6X 2W6ID 1O2OA 4AORA 1JRTA 2C90B 1IQJA 1HYLA 1QRZA 3AVZA 4OGYA 4BANB 4ABAA 1BBRH 1RIWC 1GWAA 4ASUD 1YLNA 3DUXH 1DS2E 5DP9A 1QQUA 2HLDD 3BIUH 4U32A 4X8TH 5GNDA 1P8VC 1N1LA 1EJNA 2ODPA 4YESB 1O5GH 3UOUA 5KGOA 1GJAB 1GI7B 2BLOA 4A92A 2CHAB 5AF9H 3STJA 2ZDLA 1O2RA 1SLUB 1D3TB 3EA8A 3PB1E 5KEDA 5GIBA 3A82A 3LGVA 1UVUH 5FPYA 1BMFD 2Y82A 4ZKRU 1HNEE 1YPHE 4CBOA 3S9AA 2W5EA 3UOPA 3MNCA 3R0FA 2VBCA 4DCDA 4NGAH 2W3KA 2HVYB 3QK1A 1ELBA 4CR9A 3Q77A 2WUCA 1BZXE 2ZIQH 4I8GA 1UHBA 5EOKA 3SUEA 1NC6A 1WQSA 1V2VT 3OU0A 2BQWB 2KCPA 2JETC 5EPNA 3PTNA 3B8JA 3ZZ4A 1DX5M 1HAVB 1ZSLA 4HG6A 1KLJH 3SV2H 2F91A 2GTBA 1K28D 1SGDE 2PKSC 2PW8H 1GL0E 3PMBB 5GCHG 1P3CA 2GV6A 6CHAC 5TCCA 2ZQ1A 2GCTB 2V6NA 4WH6A 4RT1A 3E6PH 2XBVA 4ZKNU 3MOCA 3URCA 1ZJKA 1M9UA 1NY22 4HGCA 3F9FA 2GDDA 1C5LH 1C9PA 3GCHC 3E16B 3KIDU 4OGXA 3SJ9A 2JH5D 4UDWH 1PPZA 2BX3A 2ZFQH 2GMTB 2KX4A 1Y5UT 2C3SA 3ODDA 3ZVGA 1V3XA 4UEHH 1Y5BT 1DXWA 2QXHA 2F9BH 3EGKH 1OP2A 1QA7A 1MBMA 1DE7H 1CHOG 1VCPA 1NFXA 2FOGA 1H8HD 3O8RA 2QXJA 5AFZH 7LPRA 3M7QA 1MTNB 4O97A 2OC1A 1K1IA 4FUGA 2A31A 2FEQH 3FP8E 2FLRH 1H9HE 1C2LA 1O3KA 1GMCG 2CMYA 1VGCB 2H2ZA 3TJUA 2QGRA 2F9VA 3ZZBA 3A86A 3PWCA 4DY7B 1YLDA 3KCGH 4YLUA 5FCKA 1GBCA 4BNRA 4SGAE 4X2VA 3SU4A 2A2XH 4DOQA 3RU4D 4B74A 2OINA 1ZTJA 1KY9A 2KAIB 2WPIS 2J5UA 1Z1IA 3AW0A 2WHXA 2WPDD 2A1DB 1W3CA 1G36A 2QXIA 3EE0B 1V2WT 3TJOA 1ZLRA 2WV4A 1S5SA 5EG4A 4YOJA 3TNSA 2XC0A 3N7OA 2FO9A 3Q3XA 2WV9A 4B2AA 2AH4X 3T29A 2CHAC 3SV7A 4LOYH 3OE7D 1GHVH 1S6HA 1GJBB 3DFLA 1TNGA 2ZQ2A 4ZMAH 1G32B 1F0TA 3VXEH 1DY8A 1IQGA 1LHFH 2WPHS 9ESTA 1C5OH 2J98A 4JK6A 1HXEH 1NPMA 1OYQA 2NU2E 2ZDMA 1YF4A 1E1RD 1NT1A 1HAYB 2VWMA 1HAIH 4ZXYH 2Q6FA 1DT2A 3VXFH 1OHHD 3RU4E 3QTVH 1GI2A 2GV7A 1P02A 1ELGA 3KQBA 1GJ7B 1TOCB 2QAAA 5HM9A 5AVDA 4MPWA 1MH0A 3SQHE 5A0BA 1MTWA 5HXFA 3RP2A 1C2EA 1FIZA 1QB9A 3F2GA 1H8DH 1P05A 1V2TT 4Q7YA 1NBMD 3HK6B 3ZZ7A 3KQEA 1O2GH 1TNIA 1FIWA 2GCTC 3STIA 1WDIA 3PMHB 4JK5A 2ZHWH 1AKSB 2WYGA 1O35A 1LVMA 2ASUB 4NA9H 4Y11E 3RXGA 1W10U 1O38A 2UUFB 1JXPA 1KMHB 3E0PB 1TX6A 2Z9JA 1NRSH 2D1JA 1MKXK 2GMTC 3SGAE 2Z9GA 3PO1B 4DJZB 2QV1A 3H5CB 4AX9H 1O39A 2BD7A 3TU7H 1O37A 2FODA 1E34B 1TIOA 2OC0A 4INHA 3RXRA 3AASA 1HV7A 1K1PA 2SGDE 5G4BA 3KNXA 3V3MA 2G00A 2L6OA 2ZCLP 1MTNC 1TONA 2R0KA 1BTHH 2BZAA 1GHZA 1UTLM 3SNCA 5GCHF 1KXCA 1O3MA 3PWBA 1MKWK 2OUAA 2Y7ZA 1GBTA 2BZ6H 3SQEE 4RT0A 3ZIAD 1DXPA 1VGCC 1OWJA 1GDQA 1RTLA 4FETA 1XXDA 2VGCB 2JH0D 3SV8A 1SGEE 1MAXA 1OP0A 1EPTA 1Z71A 3RUOA 4MNXA 2G5NA 1NRNH 1RD3B 3NCLA 2ANMH 3P8GA 5K7RA 5DO4H 1SB1H 1HDTH 1SGRE 3KQ5A 3DA9B 4I8JA 1DICA 1OSSA 4ABEA 1KLTA 1RTFB 2F3CE 1OXGA 1D3PB 1SFQB 3RXJA 3M5LA 1YCPH 1CHOF 1BHXF 2GCHG 1B0FA 1ETRH 2H9HA 4K3JA 1KXBA 1BRCE 1C1SA 1TGCA 4FUEA 3TJNA 2AGGX 2QIQA 2J97A 1JMOH 1QJ1B 2A45B 1C1NA 2ZU4A 1CO7E 1DLKB 1P0SH 5FCRA 1GHXH 3PV4A 1A2CH 2Z7FE 1OWIA 1AWHB 3ZZ8A 1UO6A 1GMCF 4LXBH 3RXIA 4Y8XA 2ODQA 1UVSH 1O2NA 2BDIA 4K5ZA 1A5GH 2PUQH 2VIOA 4I32A 5EQSA 1UTQA 4ISIH 1AB9B 3M37A 5L2ZH 2ZFTA 1IQLA 2R3YA 3TK9A 1L0ZA 1C4V2 2JIZD 2ANKH 1XMNB 1EZSC 2ZGHA 5CE1A 5JBTA 1XUGA 2G52A 3KN2A 3LJOA 4ACAA 1UVOA 1LHGH 2PP6A 4JZDH 1E38B 2YNBA 2UWLA 1MQ6A 3GS9A 1YYY1 1MBQA 2GZ8A 3PLPA 3A7WA 4JZ1A 3M5OA 2BXUH 3SW2B 1MD8A 2ZPQA 2ZGBH 3MH6A 3S9CA 5A8YA 1THSH 3ZVEA 3F2HA 1TRMA 1C1PA 3F9GA 3UWIA 2ESTE 3FZDA 1Y3VA 3E90B 1FV9A 3P8FA 5JB9S 1TA6A 3W1EA 1C5QA 3RDZA 2FDAA 4BAHB 1BRBE 1TNKA 1G3DA 2ZFFH 2ZG0H 3VPKA 4IS5A 2BLQA 3PO1C 1ELVA 1VCQA 3UR6A 3MH5A 3TPIZ 1FY8E 2XWAA 2Y80A 1UHBB 4WMFA 4WWYA 1P2MA 5E0HA 1TGSZ 4TY6A 1MZAA 3RXSA 2DE9A 1GI4A 1A46H 1EAUA 4ISHH 1P2NA 2BLWA 3RMOH 4GSOA 1P57B 3RXTA 5IDKA 3A89A 2V3MA 1BTUA 3QUMP 4NCYA 2AEIH 1RFNA 4TYDA 3DSPA 2SGAA 1HAGE 1QB6A 1GBDA 2KR7A 1KXAA 2ZP0H 1SGFA 4AB9A 3S7HB 3RXVA 1BBRE 1WBGB 1FAKH 2VGCC 1T4UH 1V2KT 2FTMA 2A7CA 2UWPA 4YOIA 2B9LA 3RXHA 2B0FA 1LQEA 3RXAA 1MTSA 3N7EA 4UONA 1HBTH 1LTOA 3MU8A 1DVAH 3P8OA 1C5SA 1O3JA 1FN6A 1G2MA 1SG8B 1UCYK 2VNTA 3OFND 2XRCA 1C1RA 1C4U2 5LPRA 2PTCE 4TWYA 3FKSD 1YPLH 1J17T 4KELA 1F2SE 1TQ0B 1SHHB 3LGYA 3A7TA 2HWLB 3A7XA 4RSPA 3FAOA 5HIYA 4ZHLU 3GY8A 2ANYA 4WXVA 2BD8A 2PTNA 2XBXA 1P2KA 1L4DA 2A4OA 3A81A 4K1SA 3UQVA 1PPHE 1UMAH 3GICB 5L6NH 1Z6EA 9LPRA 2ZDVH 3LGUA 5AHGH 2BM2A 4AFQA 5C2ZA 1GDNA 3TH4H 4BOHA 2GX4A 4X6OA 1BJVA 2HNTC 3PM3A 1P2IA 1C5MD 5C5NA 5H4IB 1LVOA 1AB9C 1GCTB 4Y7AA 1V2ST 2C8ZB 2B5TB 3SNAA 5EXMA 4GUXA 8ESTE 1COWD 4TWWA 2GJGA 3HKJB 2C93B 5FX6A 1AO5A 5T6GA 3M7UA 4GAWA 1O3CA 6ESTA 2G81E 2VIDA 3EYDA 1DY9A 4NG9H 2SFAA 2H9EH 4P00A 1EKBB 2BHGA 2ULLA 3UB0A 1K1OA 1ESTA 1JWTA 3NWUA 4JYTA 2O8UA 1T8MA 2P59A 3SGBE 1KIGH 2XYAA 1ZZZA 4YO9A 4YZUA 1CT0E 4F49A 1N8OC 1C2FA 3K6YA 2J98B 1O31A 3QWCH 3U8OH 2KM0A 2A4GA 1AN1E 3TLOA 3A8BA 2RA3A 2WPKS 2IOTA 4B2CA 4DW2U 4IGDA 3RM0H 4XDEA 5F53A 4AFSA 2TGTA 4MLFB 1C9TA 1SHYA 2TRMA 4UFGH 4IW4E 3RXMA 2WPJS 2D8WA 4TPIZ 3D49H 1GBMA 1ELTA 2ZHFH 1GVZA 1ZMJA 4UE7H 2F9OA 3U9AH 4NIWA 5A0CA 3OAAD 1WV7H 1SQRA 4YLQH 4K1TA 3RXDA 4D76A 1P2JA 3ESTA 2GZ9A 1AZ8A 2BDBA 2K8IA 2GDEH 4FUHA 4GHQA 3GISB 4A6LA 5F8ZA 2Z9IA 2Y6TA 5FX5A 2FOAA 2PR3A 5DSFA 3A80A 1GVLA 4JYVH 3VB4A 1QFKH 1P10A 2BDHA 1H9LB 2VINA 5FHTA 2F83A 3SZEA 1W0KD 1AZZA 3RMLH 4FUIA 3MFJA 1IQNA 1H8ED 4KGAA 1EUFA 4ACBA 2Q6GA 5TCAA 3TITA 5HGGA 2BD2A 4ABDA 2EQNA 3ZV9A 3RU4T 1JRSA 2Z6BD 4ASHA 2GD4B 3VG8A 3UNRA 4Z0KA 1KTSB 1TFXA 3VB7A 3H7OA 3GY6A 1XVMA 1Z8JB 3CP7A 5PTPA 3M3VA 4I86A 2Q1JA 4AZ2B 1F5KU 1ETTH 1WU1A 3SO3A 1UTKA 1GCTC 1EPTB 1CA0B 1O2XA 1NZQH 1RJXB 1N6XA 2W6JD 2W7UA 3RXFA 4E05H 2VWLA 3S9BA 3DSGA 1TABE 1Y3YA 1VITH 5J4SA 1O2TA 5DP3A 1O0DH 3RXQA 1BTYA 2GT8A 5BRRE 2ZWLH 5DGJA 1W12U 1C5VA 2P94A 2KZ4A 2G55A 3UIRA 2ZCKP 1YBWA 1NU7B 1L4ZA 7KMEH 4Q80A 3SORA 4D8NA 1W0JD 1FDPA 5L30H 2G8TA 1DFPA 3ATMA 3OX7U 2NU0E 1MCTA 1JOUB 3SNBA 1MTUA 1EX3A 3UQOA 3ZVCA 1HAPH 3FO8D 3GOVB 4TY7A 2RFKC 1FQ3A 5EXLA 3SNEA 1H4WA 1A5HA 5FBEA 4GHTA 4A1XA 2FPZA 2GVFA 1AVXA 1VKYA 2BVXH 2A4RA 2BD3A 1YP9A 1GI5A 1WTHD 1V2UT 1FX0B 2V3HH 2J95A 1QB1A 1C5WB 1CE5A 1SPJA 1ZPCA 4DURA 2FYRA 3HATH 1J9CH 5T1VA 3I77A 1INCA 5DP6A 2DUCA 2BB4A 2LP6A 4BAOB 2ZU1A 4RKOB 4BTIB 5GPIB 5CHAB 1SGIB 2QY0B 2XNDD 4E06H 3FP6E 5DPAA 2JDID 2QC2A 2BD4A 1GJ5H 3FOAA 1XVOA 4KTCA 2WPLS 1GG6B 1P01A 2SGFE 3LONA 4X1QU 1MTVA 4BXSA 2HNTE 5C3NA 2CK3D 2J34A 1G3CA 1DWEH 1PPEE 2Y5HA 1W13U 1P9SA 2FOHA 2FOBA 1NTPA 1A3BH 2ZA5A 2P16A 2J92A 5CMXH 4CRCA 1C5YB 1SQOA 1GBLA 1T31A 4GPGA 4HZHA 1K0HA 3U1JB 4NIXA 3RXUA 1QCPA 2Z3DA 4YXWD 2AS9A 1D9IA 1ETSH 5JPMH 3SU3A 1T8NA 1EPTC 3QLPH 1BRAA 1CA0C 1ZHRA 1A7SA 4NZLA 1ID5H 4ABFA 3SV6A 3VB3A 5I46H 2JKHA 4KTUA 2VVVA 3GDUA 2JH6D 3RXKA 5FAHA 1FPHH 3QGJA 4THNH 3S0NA 3KL6A 1MKWH 1G3EA 3T2NA 1BMMH 1TA2A 3SI3H 2KCOA 2OP9A 1C2IA 2VIQA 1GBHA 4D7FA 4XFQA 3TH3H 1YPEH 4K1EA 3SHAH 2ANWA 1Y3WA 1Z8GA 4O03A 1CT2E 3TH2H 1SLVB 1BMNH 2FTLE 1OWHA 1ZTLA 5EJ1A 8LPRA 2SGEE 2ZHDA 2FIRH 1BTZA 2BD9A 5DK1A 1K1JA 1F7ZA 1V2JT 5GXPA 4WJG2 5LH8A 3UNSA 4DIHH 1EFRD 2ZHQH 4XE4A 4WMEA 1FN8A 5HYOA 2YNAA 3LGTA 1NESE 3BTEE 1IOEA 2AMPA 4X2WA 4RN6A 1DPOA 3SBKA 2BDCA 1GJ9B 4AOQA 4CBNA 5F6MA 3MQKC 1ZYOA 3PTBA 1O2JA 2JJ1D 1HPGA 3C27B 5FBIA 1V2LT 3MYWA 3PYHA 3SJ8A 1KXFA 1UK3A 1BITA 1WOFA 1O30A 2HPQH 3LIWA 1PPCE 2ZO3H 1OYTH 1DUEA 4PROA 2B7DH 2QF5A 4OS4A 5LGOA 2R3UA 3EQ0H 1HJAB 1SQTA 1NN6A 1C5UA 1G30B 1O3DA 5CHAC 1SKYE 3GY3A 1PJPA 1SBWA 1CGHA 1EB2A 3EA9A 3EAJA 1MAYA 2J38A 2UUKB 1CA8B 5GJ4B 4MG3A 1GG6C 1V2MT 1Y5AT 1YKTA 5ETXA 3BTFE 3FN8A 4Z1MD 5ABWA 1HXFH 2OCVB 3DFJA 2UWOA 1O2WA 1KYNA 4XSKU 2RA0A 4ZKSU 5DG6A 2ZZUH 1W0YH 2QF0A 4NFEA 3BTTE 1YPMH 3OSYA 3QO6A 1W8BH 1C2MA 1O3GA 1QJ7B 1EJAA 2XBWA 1YPJH 3QN7A 3ZYEA 2W7SA 1FI8A 5EW1H 1EAXA 1O3PB 2AYWA 1NM6A 1YPGH 2P95A 1C2KA 1NBME 2VU8E 5C0TA 1IQIA 1C2GA 4CH8B 2CGAA 3PMAB 2PKAA 2Y81A 3UPEA 2A5KA 1DM4B 3SN8A 3HK3B 1YY3A 1O5AB 5E2OA 3BN9A 4ZROA 1WSSH 4FVDA 2FOCA 5E2PA 1QIXB 3NZIA 1SGQE 1QL7A 2IPHA 4B71A 1NRPH 5EGMA 4A1VA 5C20A 5EW2H 1OP8A 2KFWA 2WUBA 1UVPA 2C8XB 1YPKH 4B76A 1GHBG 1IHSH 1H9IE 4QT8C 4UFDH 3SUDA 3GCOA 3LC3A 2YMSC 1AUTC 1TNHA 1L1JA 2BQ6B 4FU9A 1UCYH 1AU8A 1V2NT 4YM9A 4U01A 1MD7A 2XC5A 5E0JA 3Q76A 3OTPA 4Z6AH 2QYIA 2BVRH 4ZCNA 3MNBA 3W94A 2PSYA 4AN7A 1PQ8A 1XUFA 2Z3EA 4K8YA 3V13A 2ZFRH 2OBQA 1W2KH 3MU4A 3UTUH 3U98H 1IQKA 5A8ZA 1CU1A 1GI9B 1AD8H 5C17A 1O2PA 3H7TA 3OY5U 2ZTXA 1GI0A 3RMMH 2CF8H 1GJ6A 3AAVA 4OS6A 1HAHH 2AERH 2O8TA 3RC4A 2OLGA 3GY2A 3IWMA 4O9VA 3U8TH 3BSQA 3KF2A 1IAUA 4AYVB 4MNYA 4X1NU 1FNIA 3M5MA 2EC9H 4WH8A 4I33A 1SGCA 1HJAC 1ZSJA 3M35A 2XBYA 3LGWA 1O2LA 1S83A 3M3TA 3SHCH 3UWJH 2KCYA 1SC8U 4CHAB 1QBVH 1V6DA 2SGQE 1P3EA 4TT3D 1O3FA 2XNIA 5DP8A 4OS2A 1ZGVA 1FONA 1BT7A 2G4TA 2CJIA 6LPRA 1BTWA 4A5TS 1N8OB 1LPZB 2A2QH 1UTNA 2RDLA 4OS5A 3SUGA 2W26A 4MNVA 1TBQH 1C1QA 4NSVA 3RXLA 2HGTH 1OKXA 1GMHG 3GCNA 1GL1A 2BOHB 1TPPA 2JJ2D 1J15A 4MVNA 3F9EA 3SU2A 2ZHEH 1ZMLA 1DOJA 4OS7A 1GCDA 3EE7A 4CR5A 4IMQA 2K1QA 3HGPA 4AG2A 2ZGCA 1O2YA 1S85A 3T28A 4CRBA 2FMJA 1DLEA 2ZNKH 1ZHMA 1ANBA 3T26A 3TGKE 2A7HA 1ANDA 1NRQH 1BHXB 3S69A 3ATKA 4U30A 5C1UA 3P70B 1C1MA 1UTOA 1EAWA 1AE8H 1L2EA 1QHRB 3A7ZA 3QZRA 3SJKA 1GBIA 1WCZA 2O9QA 1ZPBA 2BY8X 4SGBE 3DD2H 4D9RA 3UAIC 1T7CA 3U28C 2Y5GA 1QNJA 1K22H 5GWZA 3WWBA 2AFQB 1SMFE 1Y3UA 3F68H 1W7GH 1LPGB 5JBAS 1MQ5A 2FOFA 4MPXA 1GMDG 2ZI2H 3LC5A 4X2YA 1VJ9U 4Y76A 1EXFA 2P3TB 4F55A 4H6SB 3ZV8A 3RM2H 1GBJA 3MI4A 4GCHG 1HCGA 1H1BA 1BUIA 1YCPM 1KDQA 2FWWA 4RI0A 1LKBA 2FS8A 4K69A 1Z8IB 1PYTD 4F48B 3VGCB 1LVBA 4CH2B 1UVTH 2Q6DA 1BCUH 2ZGJA 1GJ8B 1EASA 2PWXA 3C1KA 4B6EA 5KECA 2QF3A 3A85A 3RXPA 3MO3A 1S84A 4ZUHA 3LT3A 5DN6D 1F92A 4DIIH 1NRRH 2ZPSA 3CENA 3OEED 3M5NA 1MMJN 3BTWE 3UFAA 4AG1A 3GYMA 1TGBA 4ISLA 3U1IB 1CBWB 4NA7A 1GHBF 1ELEE 1TB6H 4IN1A 2RG3A 2Z9KA 1TLDA 1Z6JH 4CHAC 4GVUA 1WAYB 4NSYA 1FUJA 1LHCH 1OOKB 1TMUH 1YGCH 2EY4C 2GCHF 4AC9A 1AVWA 5HM2A 3JZ1B 2G5VA 2YMSD 3LH3A 1J8AA 1D6RA 3O8BA 2IN2A 3RXEA 3BTME 1LQDB 2OBOA 1HGTH 1P2QA 3ODFA 3QGNB 3BEUA 3ZZ6A 3ATLA 1C5PA 5F8XA 3AAUA 1LKAA 3QZQA 2C8YB 4KP0A 2FI3E 5EODA 2F43B 3LDXH 1W11U 2PHBA 1GJDB 4CRDA 2ODYB 4ABIA 1B7XB 2BDAA 1O5BB 3A84A 2AHME 5DP7A 1EZQA 2VIWA 1P09A 5C1YA 1P06A 1OWEA 5IYTA 2A7JA 4X8VH 2FM2A 4P02A 5HIZA 2ZFSA 1OX1A 2SNVA 3F0OA 2F9UA 4JZIA 1G37A 2H5CA 4A1TA 2WZQA 2Y5FA 1ORFA 1O3AA 1K1MA 1O5CB 3BG8A 1AKSA 1KXDA 4INKA 3UNQA 1NFUA 4BTUB 1C1VH 4CREA 3MH7A 3P6ZB 4FUCA 3RXOA 5B6LA 2EA3A 1GBEA 3GDVA 3A8DA 2AGEX 3SU6A 4HI3A 5EQRA 1TRNA 1ZMNA 5E8EH 3MTYA 4WF8A 2BQ7B 3OTJE 1ABIH 2BYAX 1QURH 2WINI 2BY9X 5J4QA 4FVBA 4X1RU 4OM9A 1GMHF 2L74A 3FANA 1S81A 3L33A 1HIAA 2FYQA 2P93A 1P12E 1S0QA 4K8BA 1AUJA 1O2IA 1C1UH 3MNXA 4D7GA 1FY4A 1EATA 5F8TA 4X6PA 1ANCA 2FLBH 3GCTG 1G9IE 1FXYA 3ZYDA 5I25A 1C5TA 4XOJA 2TBSA 1DITH 3TK5A 4YT7H 7GCHG 3VGCC 3T5FH 2PKAB 4ZHAA 2UUYA 1BDAA 3A87A 2QCYA 1K1NA 2ZDKA 3N99A 3V12A 5JB8S 1QR3E 2A4QA 2PFEA 3JZ2B 1F0RA 4ZXXH 3SNDA 1MCVA 1TMTH 2XW9A 1YWUA 4IC6A 2R0LA 4FU7A 1C5ZB 1TPAE 2ZDNA 1W0ZU 1BA8B 4Y6DA 3MNSA 3K6ZA 5GDSH 1CBWC 1GBAA 1KTTB 4DVAU 4ABGA 1E1QD 1CT4E 1FAXA 1BRUP 3DT0H 1IQHA 3O8DA 1FPCH 2ZEBA 1GI1A 2LELA 4XBCA 1TNJA 2BLVA 4ISOA 3F3BA 3M61U 3ZVAA 2AIQA 4GCHF 3T27A 2XC4A 4UD9H 1HAOH 1E37B 5JBBS 4DT7B 2I6QA 4Y71A 2IPQX 3HKIB 3LU9B 3V0XA 3IG6B 1TPSA 2R9PA 1O3HA 4X2XA 1O32A 1O2VA 2ZCHP 1K1LA 1Y59T 3RLWH 1GI6A 2O8MA 1TALA 2H5DA 1QQ4A 4ISNA 2UUJB 1O36A 2FI4E 4LZ4B 2XCFA 4MTBA 5LPFA 1C1TA 3ZZAA 3S7KB 1FJSA 3VEQB 3TGJE 5JYIA 3BEFB 1ZRKA 1ZJDA 1BMAA 2O8WA 1XKBC 5K0HA 1LMWB 2GP9B 2GZ7A 1TGTA 1THRH 3URDA 2HLCA 2A0QB 4AYYB 1RRKA 1C2JA 1GHWH 3TK6A 3I78A 1SGYE 1FY5A 1F5LA 1XUIA 4DGJA 3KYFA 1PPFE 1O2ZA 1UCYE 4KKDA 3FZZA 4Y0ZE 3BTHE 1W7XH 1Z7KA 1NFWA 1Q2WA 1A4WH 3GY4A 1K21H 1AVGH 2AMQA 3FVFB 4XBDA 1O3LA 3L3TA 3SV9A 1QZ8A 1T8LA 3U69H 1O3IA 2SNWA 4B1TA 1GVKB 4MQAA 1B5GH 4U2WA 1BTXA 1EZXC 5SGAE 1G2LA 2XCNA 1ARCA 4J2YB 1MU6B 4I7YH 4KTSA 1ESBA 5JBCS 5F03A 1MKXH 1ZHPA 3B23B 5CDFE 4M7GA 1TRYA 3E1XB 1EQ9A 2OTVA 1NROH 5HKKD 3BEIB 3N7DA 1ELDE 1S0RA 5DP5A 2SGPE 2VIPA 3T25A 1SQAA 4RKJB 1LDTT 1HAXB 2TIOA 2ZU3A 4BXWA 2PLXA 3SI4H 2AMDA 4BTTB 4E7NA 1FY3A 3RXCA 1P04A 3V7TA 4ABJA 4FU8A 3F0PA 1GPZA 1EJMA 3A7YA 1CHGA 5A0AE 3SZNA 2QE7D 1GBFA 2BMGB 2ZDAH 4AGKA 1C4Y2 4YOGA 3BTDE 3QTOH 5DJ7A 1JIRA 4MPVA 4UFEH 4K2YA 3NRLA 2WPMS 3D23A 1P03A 3F6UH 1HLTH 3GCTF 4Q7ZA 1DUAA 1KDQB 1D3DB 1TYNA 4GLYA 1EAIA 2EI7A 4CRFA 1MZDA 1QRXA 3SU0A 2YMSB 1DWDH 1XUKA 1WXRA 2NU4E 7GCHF 3GYLB 1GHAG 4UFFH 2K0QA 1BBRK 3WY8A 1WUNH 3LKWA 1QY6A 3RC5A 4D9QA 1T32A 1C2DA 1TBRH 4MDSA 4JCNA
chains in the Genus database with same CATH topology
2HPPH 2RCEA 4Q7XA 2TPIZ 1T8OA 1LCYA 1Y3XA 3BG4B 1J14A 4R0IA 4FUBA 2EI8A 1FY1A 5JDUB 4Y0YE 3BF6H 4INLA 2NWNA 1RTKA 2H1UA 4X1PU 3SJOA 1RS0A 3ZZ3A 1Z1JA 1SR5C 3ZZ5A 2OC8A 2EEKA 5FPSA 3MU0A 2VH0A 5EQQA 2ZGXH 1O2MA 1JBUH 3B9FH 4FUDA 4B75A 3E0NB 1CSOE 2ZU5A 8GCHG 1N6YA 4I31A 1BJUA 1NS3A 4J1YA 4E7RG 1B0EA 2TGAA 2W3IA 1F0UA 1BB0B 1OWKA 1ACBE 3MH4A 1TX8A 3SGQE 1Q31A 1ANEA 2ZC9H 3HPTB 1ARBA 1A0HB 3A8AA 1PQ7A 2A32A 3P95A 1LVYA 1OS8A 3Q3KA 2FESH 3RMNH 4ZAEA 1X7AC 4NWLA 2GT7A 1LHEH 1QBNA 5C1XA 4JMYA 4IN2A 5AFYH 1ELFA 5L2YH 2B8OH 1TGNA 1P11E 2R2MB 2J4IA 4Y7BA 4DG4A 1O5DH 1THPB 1A0LA 1SOZA 2HNTF 3GY7A 3IITA 1V2PT 1ELCA 1PYTC 2THFB 5EPYA 1SGPE 1NO9H 1V2QT 1AFEH 3LPRA 4HFPB 3MWIU 4ZHMU 5DKMA 1E36B 5T6DA 1AHTH 2V0BA 1GBKA 2ZPRA 3W95A 4B73A 3QX5H 2F9PA 3I29A 2G51A 3SU1A 4BAQB 4FXGH 4Y79A 2A5IA 4X1SU 5FPTA 1Y8TA 5B6OA 1KSNA 4X6MA 2P3FH 1ABJH 1QL8A 1HIAB 2FOMB 2BXTH 2VJ1A 1EB1H 1K9OE 4I8LA 7ESTE 2GGVB 2VWOA 3UY9A 3NUMA 1AWFH 1SVPA 1JIMA 1BIOA 3KHVA 3NK8A 3E3TA 3Q00A 2XXLA 4JZFH 1A0JA 1EP6A 5T3HA 2BY7X 2FOEA 5C5OA 2G4UA 3CS0A 3R3GB 1GGDB 1ELAA 1SGTA 3RLYH 3NPSA 5E0GA 1SGNE 1UJ1A 4H4FA 4LZ1H 6GCHG 1WYKA 1VR1H 4R8TB 1UTJA 4WMDA 1QBOA 2H6MA 3KQDA 1ZSKA 4TPYA 3P8NA 2HRVA 1OWDA 1T4VH 4VGCB 1VJAU 2P8OB 1O5EH 2PUXB 3GDSA 3BG4C 3KGPA 1GJCB 3OYPA 1AIXH 1O2UA 2CN0H 3G01A 1S6FA 3PMJA 1C5XB 5C67A 1QL9A 2ZTZA 1ZRBA 1A5IA 2BDGA 2Z3CA 1QJ6B 4Y8YA 2CF9H 5TJXA 2XTTB 4CRGA 3U8RH 1AI8H 3OY6U 3PLKA 3CS7A 2QN5T 1NFYA 2ILNA 1D3QB 1GHAF 3LJJA 2OXSA 1AE5A 1TQ7B 2R2WU 3BTQE 2NU1E 5BPEA 2ZF0H 1ZR0A 1O2SA 1VZQH 2Y7XA 3MU1A 1XXFA 3A7VA 1Z8RA 1VITG 1GJ4H 2PGQB 2FS9A 1HUTH 1AY6H 2ZECA 4WXIA 2HVXA 2VIVA 1GHYH 2ZU2A 4X8SH 3QDZB 4NIYA 1P2OA 1OPHB 1K2I1 1TAWA 1O34A 2BX4A 3BTKE 3MU5A 1D6WA 4Q2KA 3TVJB 3ITIA 3MO9A 1BQYA 1HAVA 1UTMA 1O2QA 4NIVA 4ZKOU 3BV9B 1O3OA 4IMZA 4BAMB 5EU8A 1D4PB 4Y10E 1ZGIA 1C2HA 8GCHF 3ZVFA 1XX9A 1ESAA 1SI5H 4AFZA 4AGJA 4FUFA 4WY3A 1TE0A 1YC0A 2ALPA 1SLXB 3VFEA 3TGIE 4CRAA 2TGPZ 1PQ5A 3TJVA 3M36A 3MO6A 4F4OC 3M3SA 3TIUA 2XWBI 1U6QA 1C1OA 1VCWA 3K2UA 2AIPA 1J16A 2BD5A 2BY5X 1YLCA 2ZKSA 1O33A 2VVCA 2EI6A 3ZVDA 1XKAC 2PV9B 4B2BA 2CXVA 2OC7A 1GGDC 1LO6A 2OQUA 1YPHC 3RXBA 3ZVBA 1AFQB 1QTFA 1DANH 5ESTE 2WV5A 2V3OH 1O3BA 5T6FA 1LHDH 2F9NA 3FFGA 2QA9E 1ZOMA 3F1SB 3F9HA 1P9UA 1O3EA 1BMLA 3E91A 3EDXB 1DWBH 1AQ7A 3BIVH 1F5RA 2AGIX 4H42U 2C4FH 4VGCC 1YCPK 2P8OC 1NU9A 1KXEA 1ZTKA 3ENSB 1O2HA 5A2MH 4A7IB 2KAIA 1SGFG 1UTPA 3GY5A 2LNCA 4X6NA 2WYJA 2FI5E 2OQ5A 3A83A 1UK2A 4K60A 1O2KA 2VWNA 3ZZ9A 3NXPA 1WQVH 1EP5A 2IJOB 2D26C 1A3EH 1HB0B 1QGFA 2P3UB 2Z94A 3MMGA 4ABHA 1EZUC 2O8LA 4XBBA 1EOLA 1W14U 1TMBH 2HOBA 3KEEA 2FZZA 5A8XA 3UUZA 1LPKB 1PPGE 2M5TA 3NKKA 4IC5A 1SLWB 6GCHF 1L1NA 3HGNA 2I6SA 4HTCH 2CV3A 1TWXB 1SOTA 2FX6A 3D65E 1FZZA 2V35A 4WVPE 1E35B 1TNLA 2FXRA 3LH1A 4YTAA 1C1WH 1V2RT 2D2DA 4ABBA 2OD3B 3ELAH 1CVWH 3M7TA 1DDJA 1RIWB 2LPRA 5HMAA 1QA0A 4O3TA 3A88A 5EXNA 1A61H 2NU3E 5A09A 4MNWA 3Q3YA 1DSUA 2C8WB 4YT6H 3EA7A 1TOMH 1FMGA 1IQFA 1CGIE 3AW1A 4I8KA 4H6TA 3PROA 3ZZCA 4BAKB 3D62A 1IHTH 5ESBA 1IQMA 1SL3A 4NZQA 3P17H 3UR9A 1O3NA 1TBZH 1WTGH 4NA8A 2TGDA 4O3UA 1RXPA 3KQCA 4Y8ZA 1C5RA 1TPOA 2J94A 1F0SA 1A1RA 1VITF 1BOQA 1AGJA 4OS1A 2STBE 2VH6A 2BTCE 4NWKA 1Q3XA 4JYUH 1HFDA 2BVSH 3ATWA 1GBBA 1SFIA 3K65B 1L1GA 1AMHA 1IQEA 1SSXA 1DWCH 1KLIH 3E8LA 3PLBA 3LOXA 4NFFA 2Z9LA 3BTGE 3RC6A 2JETB 2ZFPH 4LK4A 3O8CA 2STAE 1PFXC 2H9TH 3LGIA 1UK4A 1EOJA 1RGQA 3VB5A 3K9XB 1AFQC 2PKSB 1C5NH 2GKVE 4ZH8A 2YOLA 2QXGA 6CHAB 2J9NA 1O5FH 4X8UH 5DP4A 1FLEE 2HALA 2ALVA 1QRWA 2PSXA 1G3BA 5LPEA 1S82A 1BTPA 3SJIA 2BOKA 1PQAA 2ZTYA 1XUJA 1XM1A 3ATIA 1GDUA 1GI3A 3A8CA 2VB0A 1ZPZA 3GCHB 3VB6A 1H8IH 4ESTE 1GI8B 4AB8A 2A5AA 4IBLH 3DHKH 1HRTH 1CQQA 1CGJE 1HJ8A 3L6PA 4AFUA 2J2UA 1TX7A 1PPBH 2FP7B 1GMDF 1HJ9A 3ZZDA 3TNTA 3MHWU 8KME2 2DE8A 3SU5A 1DSTA 3SOSA 2VVUA 4X0WU 3P92A 1MUEB 3FP7E 3UREA 1XUHA 2BDYA 1YM0A 4I8HA 2PGBB 1MU8B 4JZEH 4FUJA 5FXLA 1HAZB 1E0FD 2FX4A 4MPUA 3SUFA 1V2OT 3T62A 2BY6X 1O2OA 4AORA 1JRTA 2C90B 1IQJA 1HYLA 1QRZA 3AVZA 4OGYA 4BANB 4ABAA 1BBRH 1RIWC 1GWAA 3DUXH 1DS2E 5DP9A 1QQUA 3BIUH 4U32A 4X8TH 1P8VC 1N1LA 1EJNA 2ODPA 4YESB 1O5GH 3UOUA 1GJAB 1GI7B 2BLOA 4A92A 2CHAB 5AF9H 3STJA 2ZDLA 1O2RA 1SLUB 1D3TB 3EA8A 3PB1E 5GIBA 3A82A 3LGVA 1UVUH 5FPYA 2Y82A 4ZKRU 1HNEE 1YPHE 4CBOA 3S9AA 2W5EA 3UOPA 3MNCA 3R0FA 4DCDA 4NGAH 2W3KA 3QK1A 1ELBA 4CR9A 3Q77A 2WUCA 1BZXE 2ZIQH 4I8GA 1UHBA 5EOKA 3SUEA 1NC6A 1WQSA 1V2VT 3OU0A 2BQWB 2JETC 5EPNA 3PTNA 3B8JA 3ZZ4A 1DX5M 1HAVB 1ZSLA 1KLJH 3SV2H 2F91A 2GTBA 1K28D 1SGDE 2PKSC 2PW8H 1GL0E 3PMBB 5GCHG 1P3CA 2GV6A 6CHAC 5TCCA 2ZQ1A 2GCTB 2V6NA 4WH6A 3E6PH 2XBVA 4ZKNU 3MOCA 3URCA 1ZJKA 1M9UA 1NY22 4HGCA 3F9FA 2GDDA 1C5LH 1C9PA 3GCHC 3E16B 3KIDU 4OGXA 3SJ9A 2JH5D 4UDWH 1PPZA 2BX3A 2ZFQH 2GMTB 1Y5UT 2C3SA 3ODDA 3ZVGA 1V3XA 4UEHH 1Y5BT 1DXWA 2QXHA 2F9BH 3EGKH 1OP2A 1QA7A 1MBMA 1DE7H 1CHOG 1VCPA 1NFXA 2FOGA 3O8RA 2QXJA 5AFZH 7LPRA 3M7QA 1MTNB 4O97A 2OC1A 1K1IA 4FUGA 2A31A 2FEQH 3FP8E 2FLRH 1H9HE 1C2LA 1O3KA 1GMCG 2CMYA 1VGCB 2H2ZA 3TJUA 2QGRA 2F9VA 3ZZBA 3A86A 3PWCA 4DY7B 1YLDA 3KCGH 4YLUA 5FCKA 1GBCA 4BNRA 4SGAE 4X2VA 3SU4A 2A2XH 4DOQA 3RU4D 4B74A 2OINA 1ZTJA 1KY9A 2KAIB 2WPIS 1Z1IA 3AW0A 2A1DB 1W3CA 1G36A 2QXIA 3EE0B 1V2WT 3TJOA 1ZLRA 2WV4A 1S5SA 5EG4A 4YOJA 3TNSA 2XC0A 3N7OA 2FO9A 3Q3XA 4B2AA 2AH4X 3T29A 2CHAC 3SV7A 4LOYH 1GHVH 1S6HA 1GJBB 3DFLA 1TNGA 2ZQ2A 4ZMAH 1G32B 1F0TA 3VXEH 1DY8A 1IQGA 1LHFH 2WPHS 9ESTA 1C5OH 4JK6A 1HXEH 1NPMA 1OYQA 2NU2E 2ZDMA 1YF4A 1NT1A 1HAYB 2VWMA 1HAIH 4ZXYH 2Q6FA 1DT2A 3VXFH 3RU4E 3QTVH 1GI2A 2GV7A 1P02A 1ELGA 3KQBA 1GJ7B 1TOCB 2QAAA 5HM9A 5AVDA 4MPWA 1MH0A 3SQHE 5A0BA 1MTWA 5HXFA 3RP2A 1C2EA 1FIZA 1QB9A 1H8DH 1P05A 1V2TT 4Q7YA 3HK6B 3ZZ7A 3KQEA 1O2GH 1TNIA 1FIWA 2GCTC 3STIA 3PMHB 4JK5A 2ZHWH 1AKSB 2WYGA 1O35A 1LVMA 2ASUB 4NA9H 4Y11E 3RXGA 1W10U 1O38A 2UUFB 1JXPA 3E0PB 1TX6A 2Z9JA 1NRSH 2D1JA 1MKXK 2GMTC 3SGAE 2Z9GA 3PO1B 4DJZB 2QV1A 3H5CB 4AX9H 1O39A 2BD7A 3TU7H 1O37A 2FODA 1E34B 1TIOA 2OC0A 4INHA 3RXRA 3AASA 1HV7A 1K1PA 2SGDE 5G4BA 3KNXA 3V3MA 2G00A 2ZCLP 1MTNC 1TONA 2R0KA 1BTHH 2BZAA 1GHZA 1UTLM 3SNCA 5GCHF 1KXCA 1O3MA 3PWBA 1MKWK 2OUAA 2Y7ZA 1GBTA 2BZ6H 3SQEE 1DXPA 1VGCC 1OWJA 1GDQA 1RTLA 1XXDA 2VGCB 2JH0D 3SV8A 1SGEE 1MAXA 1OP0A 1EPTA 1Z71A 3RUOA 4MNXA 2G5NA 1NRNH 1RD3B 3NCLA 2ANMH 3P8GA 5K7RA 5DO4H 1SB1H 1HDTH 1SGRE 3DA9B 4I8JA 1DICA 1OSSA 4ABEA 1KLTA 1RTFB 2F3CE 1OXGA 1D3PB 1SFQB 3RXJA 3M5LA 1YCPH 1CHOF 1BHXF 2GCHG 1B0FA 1ETRH 2H9HA 4K3JA 1KXBA 1BRCE 1C1SA 1TGCA 4FUEA 3TJNA 2AGGX 2QIQA 1JMOH 1QJ1B 2A45B 1C1NA 2ZU4A 1CO7E 1DLKB 1P0SH 5FCRA 1GHXH 3PV4A 1A2CH 2Z7FE 1OWIA 1AWHB 3ZZ8A 1UO6A 1GMCF 4LXBH 3RXIA 4Y8XA 2ODQA 1UVSH 1O2NA 2BDIA 4K5ZA 1A5GH 2PUQH 2VIOA 4I32A 5EQSA 1UTQA 4ISIH 1AB9B 3M37A 5L2ZH 2ZFTA 1IQLA 2R3YA 3TK9A 1L0ZA 1C4V2 2ANKH 1XMNB 1EZSC 2ZGHA 5CE1A 5JBTA 1XUGA 2G52A 3KN2A 3LJOA 1UVOA 1LHGH 4JZDH 1E38B 2YNBA 2UWLA 1MQ6A 1YYY1 1MBQA 2GZ8A 3PLPA 3A7WA 4JZ1A 3M5OA 2BXUH 3SW2B 1MD8A 2ZPQA 2ZGBH 3MH6A 3S9CA 5A8YA 1THSH 3ZVEA 1TRMA 1C1PA 3F9GA 3UWIA 2ESTE 3FZDA 1Y3VA 3E90B 1FV9A 3P8FA 5JB9S 1TA6A 1C5QA 3RDZA 2FDAA 4BAHB 1BRBE 1TNKA 1G3DA 2ZFFH 2ZG0H 3VPKA 4IS5A 2BLQA 3PO1C 1ELVA 1VCQA 3UR6A 3MH5A 3TPIZ 1FY8E 2XWAA 2Y80A 1UHBB 4WMFA 4WWYA 1P2MA 5E0HA 1TGSZ 4TY6A 1MZAA 3RXSA 2DE9A 1GI4A 1A46H 1EAUA 4ISHH 1P2NA 2BLWA 3RMOH 4GSOA 1P57B 3RXTA 5IDKA 3A89A 3QUMP 1BTUA 4NCYA 2AEIH 1RFNA 4TYDA 2SGAA 1HAGE 1QB6A 1GBDA 4AB9A 1KXAA 2ZP0H 1SGFA 3S7HB 3RXVA 1BBRE 1WBGB 1FAKH 2VGCC 1T4UH 1V2KT 2FTMA 2A7CA 2UWPA 4YOIA 2B9LA 3RXHA 2B0FA 1LQEA 3RXAA 1MTSA 4UONA 1HBTH 1LTOA 3MU8A 1DVAH 3P8OA 1C5SA 1O3JA 1FN6A 1G2MA 1SG8B 1UCYK 2VNTA 2XRCA 1C1RA 1C4U2 5LPRA 2PTCE 4TWYA 1YPLH 1J17T 4KELA 1F2SE 1TQ0B 1SHHB 3LGYA 3A7TA 2HWLB 3A7XA 4RSPA 3FAOA 4ZHLU 3GY8A 2ANYA 4WXVA 2BD8A 2PTNA 2XBXA 1P2KA 1L4DA 2A4OA 3A81A 4K1SA 3UQVA 1PPHE 1UMAH 3GICB 5L6NH 1Z6EA 9LPRA 2ZDVH 3LGUA 5AHGH 2BM2A