3NKKA

Trypsin in complex with fluorine containing fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA02
1W11U 1ANDA 4BNRA 3MO3A 2QXHA 1L4DA 2VNTA 1FPCH 4WH8A 2NU0E 4K69A 2AMQA 3EA7A 1XXFA 1IQNA 1DSTA 1YPKH 3F9GA 4X8VH 1CT0E 1JIMA 2P95A 3S9CA 1GDNA 3P95A 1AD8H 1SPJA 1IHTH 4IW4E 3LDXH 3QZRA 3LGUA 1GHBG 3Q00A 3W94A 1O37A 4DY7B 1QQUA 1DUAA 2UUYA 5E0JA 2SGQE 4AG2A 3ZV8A 2ZTYA 2P93A 1VCWA 7GCHF 4OS6A 2BQ7B 3RXTA 3LJOA 1O32A 3PLPA 3ELAH 1LHEH 1WUNH 1MTNB 1C1UH 1FUJA 4MVNA 1C5QA 1K1IA 1Z1IA 4NSYA 1C5SA 1UK4A 1SQTA 1BTWA 1OWHA 1SVPA 4IBLH 1J16A 1WQVH 3A85A 2OUAA 2ZU3A 5C3NA 4JK5A 3DHKH 1P2JA 3CS7A 1RTFB 5DK1A 3M3TA 3UQOA 1MQ5A 3QUMP 3LC3A 1EP5A 1NFWA 1EPTC 4UEHH 1G9IE 5C1XA 4A6LA 3CS0A 2FTLE 1HAZB 4ABDA 1T31A 1BMMH 5C20A 1TPAE 2YNBA 3M7QA 4JYTA 3SQEE 1FV9A 1ETTH 2PFEA 2F9NA 1CT4E 1HAYB 1YPJH 1S83A 2W7SA 4K2YA 2R2MB 4ZHAA 1EJAA 2HPPH 1PPEE 1BJUA 2SGFE 1UTJA 1QJ1B 1P9UA 4B74A 5DP3A 1GDQA 1QA0A 2ESTE 4OS2A 1K1JA 4FU8A 1KY9A 3PMJA 3PWCA 1VITG 2Z9IA 3M61U 3RLYH 2A4QA 4GHQA 4H4FA 3VGCC 3M37A 5EODA 3V0XA 1O5CB 2STBE 1YPLH 1AWHB 1BBRH 2ZHFH 1GG6C 1DPOA 1TNKA 2PW8H 1AHTH 1C5RA 1WCZA 2ZZUH 2R0LA 4X6PA 4AGKA 1GL1A 3HGPA 4QT8C 5EQQA 1XUFA 2Q6DA 4DG4A 1JWTA 3SU6A 1F0TA 4GAWA 3SJIA 1A46H 3SU5A 1C5UA 1MKXH 2FI5E 1O2GH 1VGCC 1YPHE 3VGCB 1GI1A 5EPNA 2BB4A 1ANCA 2BZ6H 1TGTA 1UVSH 1EUFA 1MMJN 4AORA 3GICB 4FU7A 4AGJA 3SV7A 3LGVA 4NIWA 4Q7YA 1ANBA 1YPHC 3OU0A 4MPVA 1GG6B 4ZAEA 1EZUC 3K6YA 3D23A 1ID5H 2CXVA 1PQ7A 3RM0H 2SGAA 3EAJA 1ELBA 1FONA 2FLRH 2AIPA 3VB7A 5BPEA 3B9FH 1ARBA 4XDEA 1SGFA 4YESB 1VGCB 2J92A 4JCNA 4X1PU 1IQLA 1F7ZA 1ZPCA 1AN1E 1LMWB 4SGAE 1UHBA 2WPIS 1P2NA 2ZGCA 4Y8ZA 2B8OH 4RKOB 1BHXB 2VH0A 4O3TA 1AZ8A 1XX9A 2QXIA 1O2QA 1XM1A 1AB9C 3JZ1B 1GBCA 5K0HA 3SNAA 1VZQH 3E91A 2RA3A 1Y59T 4WXIA 1AMHA 1TX6A 4B2AA 1SGDE 1LKAA 1UTNA 2ZU4A 4GLYA 2NU2E 1LHDH 2VB0A 4IMZA 1DUEA 1F92A 1C1WH 1GJ5H 2J34A 3S7KB 1Q2WA 4XBCA 2F3CE 3ZYDA 8KME2 5IDKA 2ZFRH 1XXDA 2B7DH 5IYTA 1BTYA 3HATH 3LPRA 1ZMJA 2AS9A 3U9AH 4UFFH 4I7YH 5DGJA 1PPFE 2YOLA 1AB9B 1UHBB 1P10A 2BXTH 4I8KA 2B9LA 5I25A 1SGCA 3FANA 1G3CA 3RXHA 2BM2A 1W8BH 3LGYA 2Q6FA 1JXPA 4LZ1H 3HK6B 3QWCH 4TY7A 5DPAA 2KAIA 1ACBE 4DGJA 1GI4A 2IN2A 4D8NA 2GT8A 2BD8A 4ZKNU 3OSYA 2FS9A 2JKHA 2WV4A 4DIIH 2IJOB 1THPB 2JH6D 2BDYA 5GCHG 2I6SA 4JK6A 2BQ6B 3FZZA 3TJUA 1AZZA 2A4OA 2Y6TA 4RN6A 1OKXA 1O35A 2ODPA 4H42U 1PQAA 1BTXA 3PM3A 1VCPA 4M7GA 4DT7B 3F1SB 2WPLS 1LVOA 1FIWA 1NU9A 5LPEA 2FYQA 1E37B 1GVZA 1BMAA 2BD3A 2M5TA 1O5GH 1P2IA 1ZGVA 2V0BA 3PTBA 5TCAA 2ZU1A 2FODA 2KAIB 1ZPZA 1GMDG 1IAUA 1A0HB 4BOHA 2B0FA 4IGDA 3MMGA 2FOHA 1QHRB 4A1VA 7LPRA 1MU6B 2VWNA 4Y11E 1P2OA 3SUFA 1SOZA 4CHAC 1T8MA 2Z94A 3NCLA 4B2BA 4AYVB 3ZZ6A 4AFUA 2BY5X 1VITH 2BX4A 1GBDA 1OP2A 5EXLA 6GCHG 1YYY1 2F91A 1BUIA 1EJMA 3TJOA 3GDSA 1P2KA 3M5OA 1GBKA 3LU9B 3ZZ4A 6LPRA 3RC4A 1INCA 1SFIA 3M35A 1JBUH 1DT2A 1QB1A 4MNYA 1SGRE 4X0WU 1HAOH 4WF8A 2A1DB 5L2ZH 4CHAB 3UPEA 1IQGA 4Z0KA 5ESTE 2SNVA 3RDZA 8ESTE 1SLXB 4ABHA 1SBWA 2HALA 3CENA 5DKMA 1CE5A 3BTHE 3FFGA 4ZKSU 1CHOG 5DO4H 3ZVAA 1TYNA 2BY7X 4JZIA 1KSNA 3PLKA 3T5FH 3TH3H 5AFZH 4MNWA 1OWIA 3TGJE 1O36A 2F9OA 1QL7A 3O8BA 3TH4H 1S82A 2P3TB 5LPFA 2ZGBH 1YM0A 5EQSA 1RXPA 1ZTKA 1TLDA 4E05H 3RXOA 2EC9H 4XBDA 1O3HA 3M3VA 5B6OA 1CA0C 1O2MA 2ZFSA 2QF0A 1XVMA 1TOCB 1C5NH 1HB0B 1A61H 2XNIA 2BTCE 4D9QA 3MNBA 4MNXA 1O2UA 1MTWA 3GYMA 1SL3A 2C3SA 1V2KT 3A7WA 1THRH 4FU9A 5EXNA 2ZHDA 4X6NA 4ZXYH 1DDJA 1SHYA 3SGAE 2OBQA 3OYPA 1HBTH 3ZVGA 1T8LA 1MCVA 3MNSA 2F83A 1CA0B 2GKVE 5F6MA 1MZDA 1TIOA 1GJ8B 2TGAA 2C90B 3KIDU 3RC6A 1F2SE 4FUGA 2ZFFH 1PJPA 1W10U 4O9VA 2CGAA 1QURH 1P12E 1SGEE 4AYYB 2GMTC 1V2UT 2D26C 2BOKA 1TA6A 3RXEA 3TGIE 3QDZB 1W3CA 4YM9A 2UWPA 1BRCE 3TJVA 1WV7H 3RLWH 3V12A 1ESBA 2AMDA 3SJ9A 1QB9A 1GBAA 1ZHPA 5FPSA 1ELVA 2FDAA 4E7RG 2GGVB 1P04A 1P3EA 4AFQA 2F9BH 5C5NA 3BV9B 2WPJS 1PYTC 1C1RA 4O3UA 2BY9X 3GDUA 3TNTA 1SOTA 2A5KA 1ZLRA 3UY9A 2Y80A 1SGIB 1ZSJA 3KQDA 3KHVA 2FO9A 1KTSB 1Y5AT 2UUKB 4FUHA 4GUXA 4NA8A 1C1PA 1A3EH 1A5HA 3SHAH 3MYWA 2GV6A 2Z3EA 2ANMH 4K1SA 1XVOA 3ZZDA 1GBEA 2ZWLH 1ZMNA 1TE0A 3TNSA 5AFYH 1QRZA 5HGGA 3RXQA 1SFQB 1W7GH 1P11E 4CH2B 1D6WA 1N8OC 5LH8A 1GBTA 2GZ8A 3ZZ7A 1GJAB 3A7XA 2A32A 3BN9A 4INLA 2ZKSA 4K8BA 1C1OA 2BOHB 1GHBF 2XC5A 1FLEE 1SQAA 2OQUA 1G2MA 2DE9A 5AF9H 1Q31A 1O3CA 2STAE 1LDTT 4OS5A 1EATA 4XE4A 2PLXA 3E16B 3MNCA 3SUDA 1HLTH 1DX5M 3DUXH 3TVJB 4I33A 2ZGJA 3V7TA 4ZMAH 1T32A 3VEQB 1N8OB 3MWIU 2HRVA 2PV9B 3RXCA 4U2WA 5C1YA 4GCHG 1MUEB 2GZ9A 1O38A 1FXYA 3RC5A 2NU3E 2BD5A 5H4IB 4BTTB 5J4QA 3N7OA 1O2IA 3A7VA 4NFEA 1Z7KA 4XFQA 1BZXE 1HYLA 1P03A 3NK8A 3P92A 1QNJA 4ZKOU 2BDHA 2QA9E 2FEQH 1BITA 3ZVCA 3LC5A 3ZZCA 2VVCA 1K1PA 2WPMS 2XC0A 1JIRA 2HNTF 3KF2A 4K1TA 4Z6AH 2WYGA 1OWEA 1DWBH 4YTAA 3MH7A 1GGDB 2QXJA 3BTDE 3VB6A 2FOGA 3O8RA 3E6PH 1FN8A 1CHGA 3ITIA 1ZGIA 1LHGH 1AFQC 1TNIA 2SNWA 3A8DA 6CHAC 3PMBB 1EAXA 2IPHA 1QRWA 1ORFA 1AQ7A 2ZDNA 3S69A 3AVZA 1L1JA 3PMHB 2GCHG 1ELEE 2SGDE 1W2KH 2JH0D 4ISLA 3AW1A 4FVDA 1GBIA 1VITF 3MU0A 3UNRA 3RP2A 1OS8A 4R0IA 1YCPM 1D3TB 2HGTH 3BF6H 2V3HH 5GDSH 3KQEA 1ZZZA 1FDPA 1TRMA 2FIRH 1QBOA 2V6NA 1XMNB 1C5PA 1X7AC 2LNCA 1O3PB 1AFQB 1P2QA 2Z9JA 2AIQA 1BBRE 2W3KA 1UTPA 4MG3A 5A2MH 3SNDA 2PTNA 6CHAB 4NIVA 4YT6H 5DP4A 1ZSKA 1GJDB 5HMAA 1EZSC 1EXFA 3RXPA 1L1GA 1A7SA 1GI2A 1ELTA 3PROA 3D49H 4KGAA 1Z8RA 2A4RA 2BVSH 1FY8E 1V2MT 3EQ0H 3RXFA 1GL0E 1C5ZB 2GDDA 3SBKA 1GHZA 2D8WA 2BLVA 2CHAB 2VIWA 3A83A 4MPUA 1LPKB 2CF9H 3MO9A 1G3EA 1CO7E 1HFDA 1S84A 5EW1H 1HGTH 1XUIA 2W26A 3D62A 1V2NT 2BDAA 3U1JB 3P8NA 3URDA 4Y10E 3CP7A 4WMDA 1K21H 2ZHEH 2SGEE 1SSXA 1ZYOA 1BOQA 2XBWA 2YNAA 1FN6A 1ZTLA 1G3BA 1TONA 3LGIA 5HM9A 4INKA 2BYAX 4JYUH 1E38B 1EPTA 1GCTC 2BY8X 1N6XA 1DLEA 2ZTXA 3RM2H 1LTOA 1CQQA 4ESTE 3P17H 1C1VH 1J17T 3K2UA 1UVPA 1D6RA 1YGCH 1O2HA 4TWWA 1P09A 2Q1JA 2Z6BD 3A8BA 2VIOA 4UDWH 3LONA 3UQVA 3SNCA 1P2MA 1ZRKA 1A2CH 4AB9A 3SI3H 1SGFG 4ABAA 1LO6A 3PO1C 4R8TB 1QY6A 1GVLA 1O3NA 1O5FH 1RRKA 1ZJDA 5EXMA 1C4V2 1DVAH 3M5MA 1GCTB 1PPBH 4NG9H 1B5GH 3LOXA 3GY5A 5JBCS 3A86A 3F9FA 3KEEA 4X6OA 1GWAA 3SJOA 7KMEH 3TIUA 1EPTB 1GPZA 1KIGH 1UTKA 1Y8TA 1Z8JB 2P59A 3WY8A 1ELDE 1H4WA 3ZYEA 1C4U2 2H1UA 2QYIA 1FI8A 1OOKB 2VGCC 5G4BA 1QL9A 1C2HA 1V2TT 2A0QB 1PFXC 1OWKA 3VB3A 4X2WA 1HJAC 2BX3A 4DCDA 5GCHF 3T28A 5JBBS 3UFAA 4H6TA 1HIAA 2ALPA 4Y0YE 1JRTA 2ZI2H 3RXLA 1P0SH 1SGPE 3LH1A 1TPSA 4X8UH 2ANYA 2G81E 1TB6H 1HJ8A 3QX5H 3KQCA 2ZDAH 3RU4D 3BSQA 1XUJA 4FUEA 1C1QA 4FUCA 1JMOH 1DS2E 2OD3B 1AWFH 2VGCB 3EYDA 1GJBB 1P9SA 3I29A 3L6PA 1SQOA 4I8LA 1FPHH 4K8YA 1HJAB 4XSKU 4YLUA 1O3FA 1TNHA 4K5ZA 4TY6A 3MH6A 3VFEA 4MPWA 4BANB 2W7UA 3A82A 3Q77A 2AMPA 1GI5A 3RXKA 1EQ9A 1A4WH 5EGMA 2HNTE 2FP7B 1D3DB 2B5TB 2UWLA 4HZHA 1C2LA 1KLTA 1WSSH 2UUFB 2WPHS 2ZFPH 2NU1E 1S0QA 3SNBA 1RFNA 3STIA 3FAOA 2PSXA 1HIAB 2ALVA 3DFLA 1Z6JH 4BAKB 2GV7A 2GX4A 2HNTC 2GD4B 3H7OA 1GJ7B 3NWUA 5TJXA 4AZ2B 1FAKH 1F0SA 2H5DA 1PPGE 4U30A 2FZZA 1RJXB 4CBOA 3RMNH 2C8WB 1QIXB 1BMNH 3STJA 1MQ6A 3Q3KA 1C1NA 4GHTA 3A88A 2FOAA 4JZDH 1UVOA 2ZFTA 2GVFA 4I8HA 5PTPA 1ABJH 4UONA 1F0RA 3EGKH 1O2PA 2BVXH 1WTGH 1IQKA 3M7TA 1BCUH 2AGGX 1EASA 2P8OC 5F03A 4TPIZ 1LHCH 1QGFA 1E35B 3TJNA 1LPZB 2Q6GA 2QCYA 2H2ZA 1CU1A 2A5IA 1L2EA 3QLPH 1BQYA 3M36A 1UCYK 1TX8A 3FP6E 5EQRA 5L6NH 2O9QA 3RMMH 4FUJA 5GJ4B 1KXCA 2A2XH 2FOBA 3LGWA 3SI4H 1LVMA 3NPSA 1BT7A 4HTCH 4ASHA 3U69H 2AFQB 1KXEA 1DFPA 2O8UA 1O39A 5E0HA 1EKBB 2G00A 2PKSC 2RCEA 4RKJB 3L33A 1O33A 3QZQA 4FXGH 1QFKH 3LKWA 2XWAA 3F9HA 4IC5A 4OGXA 3SN8A 3NKKA 1NRNH 9LPRA 1XKAC 3UUZA 2A5AA 1WQSA 3GY8A 3QTVH 4NZLA 5A8ZA 1S0RA 3B8JA 2WV5A 3UR9A 4NWLA 2ILNA 4SGBE 1F5RA 3MO6A 4ABJA 3SV6A 5BRRE 4GSOA 3TK9A 1FY1A 1SG8B 4MLFB 2BLWA 3FP8E 2C8YB 3E8LA 2HLCA 2H5CA 2PKSB 3SUEA 1GBBA 3F68H 2G55A 5J4SA 2G4UA 1S81A 3ZZ3A 1QJ6B 2ZCLP 1QJ7B 4TPYA 3M5NA 3NUMA 1J15A 1O0DH 2XYAA 1HXEH 2G5VA 3SOSA 2XW9A 3KCGH 3A80A 3G01A 4CBNA 5EG4A 3NZIA 3NXPA 3URCA 4MQAA 1NY22 1RTLA 1PQ5A 1BRAA 1GI9B 1SB1H 1TBZH 3GCHC 3QN7A 5EOKA 5A09A 1SGNE 1C2KA 2Y7ZA 1O2NA 1XKBC 1BTZA 2THFB 3UOUA 5A0AE 1QBNA 2I6QA 3SORA 3MOCA 5C5OA 1D3PB 4ABEA 5FPYA 1UK2A 3GY4A 2R3UA 3B23B 1J14A 2ZO3H 3A7YA 2Y7XA 2D1JA 3BTTE 3E0PB 4FUDA 1NU7B 5DP5A 5DP7A 1K1LA 3UREA 1PPZA 2AERH 1MZAA 1IQIA 4I32A 4BXSA 1FY4A 1H1BA 1UO6A 3O8DA 2H9TH 3GCHB 4IN1A 1C2GA 3E90B 3S7HB 3TPIZ 2VVVA 5C67A 3AAUA 1H8IH 4TYDA 5GPIB 4ABIA 3GY3A 1T4VH 1QCPA 1HAHH 3Q3XA 1GMCG 1KXAA 1MCTA 2A4GA 1IOEA 3OY6U 1BB0B 2OCVB 1NFYA 2BLOA 4Y8XA 3DT0H 1RS0A 1DWDH 3TGKE 3H7TA 4Q7ZA 2NU4E 3V13A 1V2WT 4O97A 4WMFA 2ZPRA 2ZTZA 1YCPK 1V2ST 2ZQ1A 4ZH8A 6ESTA 3PLBA 1AUTC 1THSH 1XUGA 1OP0A 4H6SB 4YOIA 1V2QT 1B0EA 1TGNA 1DWCH 2BVRH 1TA2A 1S6HA 3ZZ5A 1MTSA 3SJ8A 4Y71A 1ZSLA 1TGSZ 1WU1A 3SU2A 2FM2A 4CRBA 2W3IA 1O2KA 3SJKA 1UK3A 2XRCA 1C4Y2 1MTUA 3D65E 3HGNA 4FUIA 1HAVA 1YPEH 1W7XH 1T8OA 3A8AA 4D9RA 1NZQH 5EW2H 3UOPA 2C8ZB 2ZU2A 1MH0A 3UNSA 4X6MA 2ZDKA 3ZZBA 2GCTC 1EX3A 4JZEH 8GCHG 5I46H 5L2YH 1WAYB 1F5KU 3RXDA 1AO5A 4NA7A 1L4ZA 5K7RA 3RU4E 1ZRBA 3DFJA 1O3AA 1UCYH 3LH3A 4HI3A 3RXBA 1Y3XA 1ZMLA 2ZG0H 2ZECA 1Y3VA 2GCHF 1TALA 1O2VA 4NGAH 3V3MA 4CRFA 1IQHA 4NCYA 4NWKA 1CGJE 3GCTF 2HOBA 1C5MD 2BY6X 1A5IA 1ELAA 5TCCA 3BG4C 1YP9A 2GMTB 5A8XA 3U1IB 1HAVB 2A7CA 4B75A 1IHSH 2FX4A 2GCTB 3T2NA 3TU7H 3DA9B 3C27B 4CRGA 1NROH 3I77A 1SR5C 1GHYH 2BDGA 1DSUA 1HJ9A 1H9LB 1LQEA 3SU4A 1ZHMA 2BMGB 2BQWB 1AE8H 1ZR0A 4FUBA 5A8YA 1LPGB 3QO6A 3GCNA 2FPZA 1IQMA 2ZCHP 1NRSH 1V2OT 2BD4A 3RXMA 4ZHMU 3BG4B 1D3QB 2PGBB 4HFPB 1UTLM 1Y5BT 4Y79A 1IQJA 3VXEH 4YT7H 1M9UA 2ZQ2A 1YLCA 4Q80A 2VVUA 4DJZB 3S9BA 2BD9A 2R0KA 1A0JA 1QBVH 2QIQA 1BJVA 5FBIA 4ZHLU 1C2JA 1NESE 4O03A 3A89A 1O2JA 2QXGA 2ZHWH 3EE0B 3TH2H 1TRYA 4ABBA 1FAXA 2ULLA 1UTQA 2GP9B 4PROA 5EU8A 1O3LA 1C2IA 2QGRA 1H8DH 5L30H 3ODFA 2C8XB 1E36B 3SUGA 5ABWA 1C2MA 1NRRH 1T8NA 5CHAC 1HAIH 5HYOA 2BLQA 2RA0A 3LJJA 4IC6A 1GHAG 1QL8A 1HNEE 3M5LA 1EAIA 2VU8E 2PWXA 1C1MA 2AEIH 1GI8B 2ZCKP 1BDAA 2J2UA 4BAMB 1MAYA 1O3BA 1SGYE 1JRSA 2WUCA 5FX6A 1GJ9B 2P16A 4Q7XA 3S0NA 1CT2E 1VCQA 1GMHG 3OX7U 4ZXXH 4B71A 5FAHA 3BEUA 2NWNA 1NM6A 3A87A 1OPHB 1DXWA 3P8GA 3OY5U 1P57B 1FMGA 1TNGA 1HRTH 1MD7A 1YC0A 5CHAB 1K22H 3BTKE 2Y5HA 3MU1A 1O5EH 1WTHD 1ELFA 7ESTE 4AX9H 2OQ5A 2Y82A 1Z8IB 2FOEA 3RXRA 1S5SA 3U8TH 2ZP0H 1AVGH 1NTPA 2CV3A 1UTMA 5JB8S 1DITH 1ZPBA 2C93B 2ODQA 3GDVA 1Y3YA 2BD2A 3QGNB 4X1NU 2G4TA 3ZVBA 2ZA5A 1D9IA 2ZFQH 1OWJA 1YCPH 5HM2A 3OTJE 1O2SA 1GHVH 3MH5A 3SU1A 1P02A 1NO9H 5DP9A 2FI3E 2DE8A 1P3CA 2EI6A 1GI3A 2QC2A 2TGPZ 3IG6B 5GXPA 3ATLA 3DD2H 2F9UA 1TAWA 2ZDMA 4LK4A 1W12U 2WPKS 4X1QU 3PMAB 1BTPA 5DP6A 2VJ1A 3LT3A 1MTNC 2H9HA 1KLJH 3M7UA 5F8ZA 4U01A 5GIBA 1ELGA 1F0UA 2ODYB 4NA9H 2VWMA 3EA8A 4BXWA 3T26A 2CMYA 3S9AA 3SGBE 4B2CA 1HAPH 1N6YA 1UMAH 4CRCA 3SU3A 3MTYA 5E2PA 3BEIB 1FQ3A 1E34B 3BTME 4KTUA 4KTCA 3ZV9A 3VB4A 1FY3A 1Z71A 2VIPA 1EZXC 1P06A 3GYLB 3UNQA 1FNIA 2DUCA 1W13U 4YOGA 2VINA 3PB1E 3ATWA 1HXFH 3BIVH 3UIRA 4UE7H 3T62A 1NC6A 1FIZA 1OP8A 1HPGA 3BIUH 2G5NA 1SLUB 2G8TA 5T6DA 3UTUH 2BDIA 4UFEH 2BDCA 1G3DA 1F5LA 4IMQA 2ANWA 1GHXH 3SGQE 1EJNA 1NT1A 2ZGXH 3ESTA 2Z9KA 4TWYA 1K1NA 2Z9GA 1ZJKA 3RXIA 4CRDA 3A7ZA 2ZEBA 2TGTA 4LZ4B 3U8OH 2PKAA 4ABGA 1C1SA 1A0LA 4K1EA 4Y6DA 1D4PB 3K65B 3UR6A 4NIYA 4X1RU 1GI0A 3UWIA 1B7XB 4OGYA 1AKSA 1HUTH 1BTUA 1SHHB 5JDUB 1AUJA 4YLQH 2OC1A 2J38A 2ZPSA 4X8SH 4JZ1A 3SU0A 3TK5A 1SGTA 3BEFB 3GOVB 1SLVB 4CR5A 3EDXB 3GY7A 3RXGA 1U6QA 2RDLA 1TPOA 5AVDA 2Z9LA 3PO1B 5E8EH 1TNJA 4MPXA 2XBXA 1GJ4H 1P01A 1DICA 2BD7A 1HAXB 3ATIA 3TK6A 1O2LA 5ETXA 4WVPE 2O8LA 4WH6A 1ZTJA 1GVKB 4FUFA 3TLOA 1O31A 2WYJA 2XBYA 2IOTA 1AI8H 3ZZAA 2TPIZ 1O2TA 1UTOA 1K28D 2RG3A 1BRUP 2PKAB 2PUQH 4J2YB 2BDBA 1O5BB 5FCRA 1V2JT 3SV8A 1GBLA 1DE7H 2ZNKH 3R0FA 1YF4A 4I8JA 3ZVFA 1GHWH 2ZDVH 4GPGA 1AKSB 4K60A 3W95A 5T3HA 1G30B 5GWZA 1PPCE 2VH6A 2ZGHA 1Y5UT 2AH4X 1GI6A 2VIVA 2ZPQA 2J95A 1T4UH 4E06H 2GTBA 1Y3UA 2WUBA 3RXSA 4DVAU 1GMDF 2EA3A 7GCHG 1AFEH 2FYRA 2QAAA 1PYTD 5FXLA 2FWWA 5T6FA 2ZIQH 4B73A 3VPKA 4XBBA 3A7TA 1QR3E 2P3UB 1G32B 4VGCC 1GI7B 4F49A 1ELCA 4CR9A 4AFSA 5T6GA 1BMLA 1GBFA 1Z8GA 5ESBA 6GCHF 1TMTH 1WOFA 1A1RA 3Q3YA 4Y8YA 1LHFH 2O8WA 3BTFE 4WMEA 4ZUHA 3MNXA 2A31A 1GCDA 2PTCE 1O3GA 4MTBA 2OP9A 3L3TA 3PYHA 5CE1A 3A84A 1ABIH 1O2YA 4CRAA 5JPMH 1EOJA 2VIQA 1J9CH 4JYVH 2J4IA 3K9XB 2G51A 1O3KA 1TRNA 3RXUA 3E1XB 2EI7A 3F6UH 4ISNA 1H9IE 2JH5D 1C9TA 3BTWE 3MFJA 2A7JA 1DLKB 4VGCB 1UVTH 3PWBA 3RMLH 1J8AA 5F8XA 2HPQH 2O8TA 1AIXH 1SC8U 1O2RA 2TRMA 1ETRH 1OYTH 1CHOF 3SV9A 1OX1A 5SGAE 2J9NA 2PHBA 2R2WU 1JOUB 1GBMA 1TMUH 1SGQE 1V2RT 4YZUA 1T7CA 2PUXB 2ZHQH 4D7GA 2PSYA 1O3JA 2D2DA 1UVUH 4JZFH 1DOJA 1XUHA 2Z7FE 3MU4A 2ASUB 4I31A 1Z6EA 1TGCA 3RXJA 1DWEH 4AG1A 1E0FD 4AFZA 2FS8A 2P8OB 3ENSB 2OXSA 2TGDA 4Y76A 1OYQA 3T25A 4DIHH 2QV1A 4UFGH 3ZZ8A 3C1KA 5E0GA 2FESH 2GZ7A 1GMCF 2V3OH 2EEKA 3HKIB 1EOLA 1SLWB 4LXBH 1G37A 4X8TH 1TOMH 1LVBA 3O8CA 2AYWA 1AU8A 2P94A 3KQBA 4ZROA 2CN0H 2OLGA 2Y5FA 3FVFB 5EPYA 2FLBH 4X1SU 1ESTA 1MKWK 5FCKA 4D76A 2QN5T 3AAVA 1KXBA 1TGBA 1CGIE 3P70B 1C5TA 1TABE 2SGPE 4CREA 5DG6A 2FI4E 2GT7A 3KGPA 1BRBE 1GBHA 2FOFA 4A1XA 1MU8B 3T27A 3U98H 1W14U 4A5TS 3KN2A 4KKDA 3SNEA 1AVWA 1ZOMA 4THNH 1G2LA 4NSVA 1TFXA 5DJ7A 1C5XB 4X2XA 1A5GH 3E3TA 8GCHF 2QF3A 3GY2A 1EP6A 3RXVA 1O5AB 2J94A 1RD3B 2GDEH 4AN7A 3QK1A 4CH8B 3RXAA 3A81A 3QGJA 2K1QA 4KP0A 4AB8A 1UCYE 1BA8B 1MTVA 1OWDA 2ZDLA 1QQ4A 2CF8H 4IS5A 4KELA 1QRXA 3BTEE 1V6DA 2VIDA 1FY5A 2Z3DA 4ISIH 1LVYA 1O2OA 2HVXA 1C5VA 2TIOA 3VB5A 3P8OA 1CBWC 5A0CA 1IQEA 2A7HA 1KXDA 3H5CB 4FVBA 1VJAU 1O2XA 1O5DH 1GJCB 3ZZ9A 2ZF0H 2FMJA 2F9PA 2PR3A 4NFFA 1MBQA 4LOYH 1K2I1 4BAQB 3SQHE 1TBRH 2A2QH 3MI4A 4KTSA 2FX6A 1NPMA 1Z1JA 3SV2H 1GDUA 4JMYA 1NFUA 1GJ6A 3T29A 3BTGE 1TQ7B 1KLIH 4A92A 2O8MA 2OBOA 1O3DA 2A45B 1C5LH 3SHCH 2W5EA 4ZKRU 1ARCA 1H9HE 1KYNA 1CBWB 5FBEA 1EZQA 3E0NB 2SFAA 1W0YH 5JBAS 4BTUB 2UUJB 4NZQA 5FX5A 4I8GA 1NFXA 3KNXA 3LGTA 1MBMA 1QA7A 1DY8A 1L0ZA 3BTQE 1EB1H 4WWYA 3K6ZA 4BAHB 4OS4A 2AGIX 2XC4A 4GCHF 1YKTA 3AASA 2PGQB 2ANKH 3HPTB 1KTTB 1NS3A 2JETC 4HGCA 4U32A 4E7NA 1V2PT 5C1UA 1MD8A 3MHWU 1RIWC 2XXLA 3RU4T 2OC0A 4WJG2 1KXFA 2CJIA 1GHAF 4DW2U 1V3XA 1G36A 1TMBH 4F4OC 1B0FA 2OINA 1PQ8A 1C5YB 2G52A 1YPMH 1K1OA 3IITA 4Y7BA 4DOQA 1HDTH 2OTVA 1ESAA 1WBGB 4MNVA 3JZ2B 2VWLA 1GMHF 1NN6A 1MAXA 3HK3B 3BG8A 1BIOA 1P05A 4Y0ZE 5JBTA 4ABFA 1C2DA 1O3IA 2BZAA 2HWLB 4Y7AA 3KL6A 1V2LT 1ETSH 1C2EA 1EAUA 1RTKA 1XUKA 2F9VA 1ZHRA 4ISHH 1WYKA 2JETB 4RSPA 1UJ1A 3ZVDA 1RIWB 1TQ0B 1O3MA 1V2VT 3P8FA 3MU5A 3GY6A 1TNLA 1EB2A 1O30A 3IWMA 1C2FA 2Z3CA 2AGEX 1QB6A 1FZZA 1CA8B 2XCFA 3PTNA 2XWBI 4MDSA 4ISOA 2Y5GA 1CVWH 1VJ9U 4B76A 1KDQA 1Y3WA 5F8TA 1EAWA 2TBSA 3MH4A 3VXFH 2R9PA 3P6ZB 1HAGE 2FTMA 2VWOA 2FOCA 5LPRA 1P8VC 1K9OE 3I78A 5E2OA 1YPGH 4IN2A 3GISB 5DP8A 3AW0A 5AHGH 4A1TA 1N1LA 1DY9A 1FJSA 1MKWH 1A3BH 1VR1H 4INHA 1AY6H 1DXPA 1BTHH 1CGHA 1O3OA 1W0ZU 1SMFE 1HV7A 3FP7E 4OS1A 4GVUA 1C5WB 1LKBA 4BAOB 1O3EA 3F9EA 1Q3XA 2H9EH 4BTIB 1YBWA 5A0BA 2WINI 5JYIA 1IQFA 3U8RH 2LPRA 1TPPA 2C4FH 3TITA 1C1TA 1SI5H 1BBRK 2ZC9H 1GBJA 1PPHE 5CMXH 2BHGA 3ZVEA 1KDQB 2EI8A 1BHXF 4D7FA 4K3JA 8LPRA 3PV4A 3ODDA 1DM4B 1O2WA 3Q76A 2BXUH 2OC7A 4WXVA 2QY0B 3MU8A 1YLDA 3M3SA 4XOJA 1GGDC 3HKJB 1MKXK 1NRPH 3RMOH 4J1YA 3QTOH 9ESTA 5JB9S 3EA9A 4YO9A 1C9PA 4UD9H 2UWOA 1OSSA 1C5OH 1O2ZA 1TBQH 5FHTA 3LIWA 3RUOA 5FPTA 3ATMA 1NRQH 1O34A 2P3FH 4YOJA 2XTTB 2FOMB 1CSOE 2OC8A 1S85A 2ZU5A 4A7IB 4NIXA 5LGOA 1TX7A 1AVXA 1LQDB 3GCOA 1AGJA 1RGQA 1TWXB 1LCYA 4AOQA 3FZDA 5C2ZA 1L1NA 2FXRA 1S6FA 4WY3A 2R3YA 1K1MA 5HXFA 2XBVA 1DANH 3R3GB 2V35A 4X2YA 1ANEA 3SZNA 4UFDH 2Y81A 3GCTG 1OXGA 2H6MA 2XCNA 4DURA 4X2VA 2CHAC 3SW2B 1QTFA 3ATKA 4OS7A 1AE5A 3SO3A 4Q2KA 3UWJH 4B1TA 1HCGA 3A8CA
chains in the Genus database with same CATH superfamily
1W11U 1ANDA 2KR7A 3MO3A 2QXHA 4BNRA 1L4DA 2VNTA 1FPCH 4WH8A 2NU0E 4K69A 2AMQA 3EA7A 1XXFA 1IQNA 1DSTA 1YPKH 3F9GA 4X8VH 1CT0E 1JIMA 2P95A 3S9CA 1GDNA 3P95A 1AD8H 1SPJA 1IHTH 4IW4E 3LDXH 5GNDA 3QZRA 3LGUA 1GHBG 3Q00A 3W94A 1O37A 4DY7B 1QQUA 1DUAA 2UUYA 5E0JA 2SGQE 4AG2A 3ZV8A 2ZTYA 2P93A 1VCWA 7GCHF 3KQ5A 4OS6A 2BQ7B 3RXTA 3CNRA 2HLDD 3LJOA 1O32A 3PLPA 3ELAH 1LHEH 1WUNH 1MTNB 1C1UH 1FUJA 4MVNA 1C5QA 1K1IA 1Z1IA 5EJZA 4NSYA 1C5SA 1UK4A 1SQTA 1BTWA 1OWHA 1SVPA 4IBLH 1J16A 1WQVH 2QE7D 3A85A 2OUAA 2ZU3A 5C3NA 4JK5A 3DHKH 3UB0A 1P2JA 3CS7A 1RTFB 5DK1A 3M3TA 3UQOA 1MQ5A 3QUMP 3LC3A 1EP5A 1NFWA 1EPTC 4UEHH 1G9IE 5C1XA 4A6LA 3CS0A 1H8ED 2FTLE 1HAZB 4ABDA 1T31A 1BMMH 5C20A 1TPAE 2YNBA 3M7QA 4JYTA 3SQEE 5CDFE 1FV9A 1ETTH 2PFEA 2F9NA 1CT4E 1HAYB 1YPJH 1S83A 2W7SA 4K2YA 2R2MB 4ZHAA 1EJAA 2HPPH 1PPEE 1BJUA 2SGFE 1UTJA 1QJ1B 1P9UA 4B74A 5EJ1A 4ASUD 5DP3A 1GDQA 1QA0A 2ESTE 4OS2A 1K1JA 4FU8A 1KY9A 3PMJA 3PWCA 1VITG 2Z9IA 3M61U 3RLYH 5B6LA 2A4QA 4GHQA 4H4FA 3VGCC 3M37A 3UAIC 5EODA 3V0XA 1O5CB 2STBE 1YPLH 1AWHB 1BBRH 2ZHFH 1GG6C 1DPOA 1TNKA 2PW8H 1AHTH 1C5RA 1WCZA 2ZZUH 2R0LA 4X6PA 4AGKA 3N7EA 1GL1A 3HGPA 4QT8C 5EQQA 1XUFA 2Q6DA 4DG4A 1JWTA 3SU6A 1F0TA 4GAWA 3SJIA 1A46H 3SU5A 1C5UA 1MKXH 2FI5E 1O2GH 4M9FA 1VGCC 1YPHE 3VGCB 1GI1A 2YMSD 5EPNA 2BB4A 1ANCA 2BZ6H 1TGTA 1UVSH 1EUFA 1MMJN 4AORA 3GICB 4FU7A 5DSFA 4AGJA 3SV7A 3LGVA 4NIWA 4Q7YA 1ANBA 1YPHC 3OU0A 4MPVA 1GG6B 4ZAEA 1EZUC 3KYFA 3K6YA 3D23A 1ID5H 2CXVA 1PQ7A 3RM0H 2SGAA 3EAJA 1ELBA 1FONA 2FLRH 2AIPA 3VB7A 5BPEA 3B9FH 1ARBA 4XDEA 1SGFA 4YESB 1VGCB 2J92A 4JCNA 4X1PU 1IQLA 1F7ZA 1ZPCA 1AN1E 1LMWB 4SGAE 1UHBA 2WPIS 1P2NA 2ZGCA 4Y8ZA 2B8OH 4RKOB 1BHXB 2VH0A 4O3TA 1AZ8A 1XX9A 2QXIA 1O2QA 1XM1A 1AB9C 3EE7A 3JZ1B 1GBCA 5K0HA 3SNAA 1VZQH 3E91A 2RA3A 1Y59T 4WXIA 1AMHA 1TX6A 4B2AA 1S6LA 1SGDE 1LKAA 1UTNA 2ZU4A 4GLYA 2NU2E 1LHDH 2VB0A 4IMZA 1DUEA 1F92A 1C1WH 1GJ5H 2J34A 2F43B 3S7KB 1Q2WA 4XBCA 2F3CE 3ZYDA 8KME2 5IDKA 2ZFRH 1XXDA 2B7DH 5IYTA 1BTYA 3HATH 3LPRA 1ZMJA 2AS9A 1FX0B 3U9AH 4UFFH 4I7YH 5DGJA 1PPFE 2YOLA 1AB9B 1UHBB 1P10A 2BXTH 4I8KA 2B9LA 5I25A 1SGCA 3FANA 1G3CA 3SYJA 3RXHA 2BM2A 1W8BH 3LGYA 2Q6FA 1JXPA 4LZ1H 3HK6B 3QWCH 4TY7A 1YWUA 5DPAA 2KAIA 1ACBE 4DGJA 1GI4A 2IN2A 4D8NA 2GT8A 2BD8A 4ZKNU 3OSYA 2FS9A 2JKHA 2WV4A 4DIIH 2IJOB 1THPB 2JH6D 1E1QD 2BDYA 5GCHG 2I6SA 4JK6A 2BQ6B 3FZZA 3MQKC 3TJUA 1AZZA 2A4OA 2Y6TA 4RN6A 5CHBA 1OKXA 1O35A 2ODPA 4H42U 1PQAA 1BTXA 3PM3A 1VCPA 4M7GA 4DT7B 3F1SB 2WPLS 1LVOA 1FIWA 1NU9A 2L6OA 5LPEA 2FYQA 1E37B 1GVZA 1BMAA 2BD3A 2M5TA 1O5GH 1P2IA 1ZGVA 2V0BA 3PTBA 5TCAA 2ZU1A 2FODA 2KAIB 1ZPZA 1GMDG 1IAUA 1A0HB 4BOHA 2B0FA 4IGDA 3MMGA 2W6ID 2FOHA 1QHRB 4A1VA 7LPRA 1MU6B 2VWNA 4Y11E 1P2OA 3SUFA 1SOZA 4CHAC 2KCPA 1T8MA 2Z94A 3NCLA 4B2BA 4AYVB 3ZZ6A 4AFUA 2BY5X 1VITH 2BX4A 1GBDA 1OP2A 5EXLA 6GCHG 1YYY1 2CK3D 2F91A 1BUIA 1EJMA 3TJOA 1E79D 3GDSA 1P2KA 5DN6D 3FN8A 3M5OA 1GBKA 3LU9B 3ZZ4A 6LPRA 3RC4A 5C0UA 1INCA 1SFIA 3M35A 1JBUH 1DT2A 1QB1A 4MNYA 1SGRE 4X0WU 1HAOH 4WF8A 2A1DB 5L2ZH 4XRNA 4CHAB 3UPEA 1IQGA 4Z0KA 5ESTE 2SNVA 3RDZA 8ESTE 1SLXB 4ABHA 1SBWA 2HALA 3CENA 5DKMA 1CE5A 3BTHE 3F2HA 3FFGA 4ZKSU 1CHOG 5DO4H 3ZVAA 1TYNA 2BY7X 4JZIA 1KSNA 3PLKA 3T5FH 3TH3H 5AFZH 4MNWA 1OWIA 4TSFD 3TGJE 1O36A 2F9OA 1QL7A 3O8BA 3TH4H 1S82A 2P3TB 5LPFA 2ZGBH 1YM0A 5EQSA 1RXPA 1ZTKA 1TLDA 4E05H 3RXOA 4RT0A 2EC9H 4XBDA 1O3HA 3M3VA 5B6OA 1CA0C 1O2MA 2ZFSA 2QF0A 1XVMA 1TOCB 1C5NH 1HB0B 1A61H 2PP6A 2XNIA 2BTCE 4D9QA 3MNBA 4MNXA 1O2UA 1MTWA 3GYMA 4I86A 1SL3A 2C3SA 1V2KT 3A7WA 1THRH 4FU9A 2IPQX 5EXNA 2ZHDA 4X6NA 4ZXYH 2JIZD 1DDJA 1SHYA 3SGAE 2OBQA 3OYPA 1HBTH 3ZVGA 1T8LA 1MCVA 3MNSA 2F83A 1CA0B 2GKVE 5F6MA 1MZDA 1TIOA 1GJ8B 2TGAA 2C90B 3KIDU 3RC6A 4ACBA 1F2SE 4FUGA 3N99A 2ZFFH 1NBMD 1PJPA 1W10U 4O9VA 2CGAA 1QURH 1P12E 1SGEE 4AYYB 2GMTC 1V2UT 2D26C 2BOKA 1TA6A 3RXEA 3TGIE 3QDZB 1W3CA 4YM9A 2UWPA 1BRCE 3TJVA 1WV7H 3RLWH 3V12A 1ESBA 2AMDA 3SJ9A 1QB9A 1GBAA 1ZHPA 5FPSA 1ELVA 2FDAA 4E7RG 2GGVB 3F0PA 1P04A 2JJ2D 1P3EA 4AFQA 2F9BH 5C5NA 3BV9B 2WPJS 1PYTC 1C1RA 4O3UA 2L74A 2BY9X 3GDUA 2WSSD 3TNTA 1SOTA 2A5KA 1ZLRA 3UY9A 2Y80A 1SGIB 1ZSJA 3KQDA 3KHVA 2FO9A 1KTSB 1Y5AT 2UUKB 4FUHA 4GUXA 4NA8A 1C1PA 1A3EH 1A5HA 3SHAH 3MYWA 2GV6A 2Z3EA 2ANMH 4K1SA 1XVOA 3ZZDA 1GBEA 2ZWLH 1ZMNA 1TE0A 3TNSA 5AFYH 1QRZA 5HGGA 3RXQA 1SFQB 1W7GH 1P11E 4CH2B 1D6WA 1N8OC 5LH8A 1GBTA 2GZ8A 3ZZ7A 1GJAB 3A7XA 2A32A 3BN9A 4INLA 2ZKSA 4K8BA 3F3BA 1C1OA 2BOHB 1GHBF 2XC5A 4RI0A 1FLEE 1SQAA 2OQUA 1G2MA 2DE9A 2VBCA 5AF9H 1Q31A 1O3CA 2STAE 1LDTT 3SV8A 4OS5A 1EATA 4P00A 4XE4A 2PLXA 3E16B 3MNCA 3SUDA 1HLTH 3OEHD 1DX5M 3DUXH 3TVJB 4I33A 2ZGJA 3V7TA 4ZMAH 1T32A 3VEQB 1N8OB 3MWIU 2HRVA 2PV9B 3RXCA 4U2WA 5C1YA 4GCHG 1MUEB 2GZ9A 1O38A 1FXYA 3RC5A 2NU3E 2BD5A 5H4IB 4BTTB 5J4QA 3N7OA 1O2IA 3A7VA 4NFEA 1Z7KA 4XFQA 1BZXE 1HYLA 1P03A 3NK8A 3P92A 1QNJA 4ZKOU 2BDHA 2QA9E 2FEQH 1BITA 3ZVCA 3LC5A 3ZZCA 2VVCA 1K1PA 2WPMS 2XC0A 1JIRA 2HNTF 3KF2A 4K1TA 4Z6AH 2WYGA 1OWEA 1DWBH 4YTAA 3MH7A 1GGDB 2QXJA 3BTDE 1KMHB 3VB6A 2WZQA 2FOGA 3O8RA 3E6PH 4B6EA 1FN8A 1CHGA 3ITIA 1ZGIA 1LHGH 1AFQC 1TNIA 2SNWA 3A8DA 1COWD 6CHAC 3PMBB 1EAXA 2IPHA 1QRWA 1ORFA 1AQ7A 2ZDNA 3S69A 3AVZA 1L1JA 3PMHB 2GCHG 1YLNA 1ELEE 2SGDE 1W2KH 2JH0D 4ISLA 3AW1A 4FVDA 1GBIA 1VITF 3MU0A 3UNRA 3RP2A 3PV2A 1OS8A 4R0IA 1YCPM 1D3TB 2HGTH 3BF6H 2V3HH 5GDSH 3KQEA 1ZZZA 1FDPA 1TRMA 2FIRH 1QBOA 3F2FA 2V6NA 1XMNB 1C5PA 1X7AC 2LNCA 1O3PB 1AFQB 1P2QA 2Z9JA 2AIQA 1BBRE 2W3KA 2HVYB 1UTPA 4MG3A 5A2MH 3SNDA 2PTNA 6CHAB 4NIVA 2W6JD 4YT6H 5DP4A 1ZSKA 1GJDB 5HMAA 1EZSC 1EXFA 3RXPA 1L1GA 1A7SA 1GI2A 1ELTA 2K0QA 3PROA 3D49H 4KGAA 1Z8RA 2A4RA 5HKKD 2BVSH 1FY8E 1V2MT 3EQ0H 3RXFA 1GL0E 1C5ZB 1OHHD 2EQNA 2GDDA 3SBKA 1GHZA 2D8WA 2BLVA 2CHAB 2VIWA 3A83A 4MPUA 1LPKB 2CF9H 3MO9A 1G3EA 1CO7E 1HFDA 1S84A 5EW1H 1HGTH 1VKYA 1XUIA 2W26A 3D62A 1V2NT 3WWBA 2BDAA 3U1JB 3P8NA 3URDA 4Y10E 3CP7A 4WMDA 1K21H 2ZHEH 2SGEE 1SSXA 4HG6A 1ZYOA 1BOQA 2XBWA 2YNAA 1FN6A 1ZTLA 1G3BA 1TONA 3LGIA 5HM9A 4INKA 2BYAX 4JYUH 1E38B 1EPTA 1GCTC 2BY8X 1N6XA 1DLEA 2ZTXA 3RM2H 1LTOA 1CQQA 4ESTE 3P17H 1C1VH 1J17T 3K2UA 4RT1A 1UVPA 1D6RA 1YGCH 1O2HA 4TWWA 1P09A 2Q1JA 2Z6BD 3A8BA 2VIOA 2KCOA 4UDWH 3LONA 3UQVA 3SNCA 1P2MA 1ZRKA 1A2CH 4AB9A 3SI3H 1SGFG 4ABAA 1LO6A 3PO1C 4R8TB 1QY6A 1GVLA 3W1EA 1O3NA 1O5FH 1RRKA 1ZJDA 5EXMA 1C4V2 1DVAH 3M5MA 1GCTB 1PPBH 4NG9H 1B5GH 3LOXA 3GY5A 5JBCS 3A86A 3F9FA 3KEEA 4X6OA 1GWAA 3SJOA 7KMEH 3TIUA 1EPTB 1GPZA 4F48B 1KIGH 1UTKA 1Y8TA 1Z8JB 2P59A 3WY8A 1ELDE 3N7DA 1H4WA 3ZYEA 1C4U2 2H1UA 2QYIA 1NBME 1FI8A 1OOKB 2VGCC 5G4BA 1QL9A 1C2HA 1V2TT 2A0QB 1PFXC 1OWKA 3VB3A 4X2WA 1HJAC 2BX3A 4DCDA 5GCHF 3T28A 5JBBS 3UFAA 4H6TA 1HIAA 2ALPA 4Y0YE 1SQRA 1JRTA 2ZI2H 3RXLA 1P0SH 1SGPE 3LH1A 1TPSA 3F2GA 4X8UH 2ANYA 2QF4A 2G81E 1TB6H 1HJ8A 3QX5H 2WPDD 3KQCA 2ZDAH 3RU4D 3BSQA 1XUJA 4FUEA 1C1QA 4FUCA 1JMOH 1DS2E 2OD3B 1AWFH 2VGCB 3EYDA 1GJBB 1P9SA 2RDEA 3I29A 3L6PA 1SQOA 4I8LA 1FPHH 4K8YA 2OK5A 1HJAB 4XSKU 3FKSD 1O3FA 4YLUA 1TNHA 4K5ZA 4TY6A 3MH6A 3VFEA 4MPWA 4BANB 2W7UA 3A82A 3Q77A 2AMPA 1GI5A 3RXKA 1EQ9A 1A4WH 5EGMA 2HNTE 2FP7B 1D3DB 2B5TB 2UWLA 4HZHA 1C2LA 1KLTA 1WSSH 2UUFB 2WPHS 2ZFPH 2NU1E 1S0QA 3SNBA 1RFNA 3STIA 3FAOA 2PSXA 1HIAB 2ALVA 3DFLA 1Z6JH 4BAKB 2GV7A 2GX4A 2HNTC 2GD4B 3H7OA 1GJ7B 3NWUA 5TJXA 4AZ2B 1FAKH 1F0SA 2H5DA 1PPGE 4U30A 2FZZA 1RJXB 4CBOA 3RMNH 2C8WB 1QIXB 1BMNH 3STJA 1MQ6A 3Q3KA 1C1NA 4F55A 4GHTA 3A88A 2FOAA 4JZDH 1UVOA 2ZFTA 2GVFA 4I8HA 5PTPA 1ABJH 4UONA 1F0RA 3EGKH 1O2PA 2BVXH 1WTGH 1IQKA 3M7TA 1BCUH 2AGGX 1EASA 2P8OC 5F03A 4TPIZ 1LHCH 1QGFA 1E35B 3TJNA 1LPZB 2Q6GA 2QCYA 2H2ZA 1CU1A 2A5IA 1L2EA 3QLPH 1BQYA 3M36A 1UCYK 1TX8A 3FP6E 5EQRA 5L6NH 5T1VA 2O9QA 3RMMH 4FUJA 5GJ4B 1KXCA 2A2XH 2FOBA 4ZCNA 3LGWA 3SI4H 1LVMA 3NPSA 1BT7A 4HTCH 4ASHA 3U69H 2AFQB 3PRDA 1KXEA 1DFPA 2O8UA 1O39A 3FOAA 5E0HA 1EKBB 2G00A 2PKSC 2RCEA 4RKJB 3L33A 1O33A 3QZQA 4FXGH 1QFKH 3LKWA 2XWAA 3F9HA 4IC5A 4OGXA 3SN8A 3NKKA 1NRNH 9LPRA 1XKAC 1EFRD 3UUZA 2A5AA 1WQSA 3GY8A 3QTVH 4NZLA 5A8ZA 1S0RA 3B8JA 2WV5A 1UW7A 3UR9A 4NWLA 2ILNA 4SGBE 1F5RA 3MO6A 4ABJA 2XOKD 3SV6A 5BRRE 4GSOA 3TK9A 1FY1A 1SG8B 4MLFB 2BLWA 3FP8E 2C8YB 3E8LA 2HLCA 2H5CA 2PKSB 3SUEA 1GBBA 3F68H 2G55A 2M2AA 5J4SA 2G4UA 1S81A 3ZZ3A 1QJ6B 1W0KD 2ZCLP 1QJ7B 4TPYA 3M5NA 2IJD1 3NUMA 1J15A 1O0DH 2XYAA 1HXEH 2G5VA 3SOSA 2XW9A 3KCGH 3A80A 3G01A 4CBNA 5EG4A 1BMFD 3NZIA 3NXPA 3URCA 4MQAA 1NY22 1RTLA 3DCLA 1PQ5A 3FO8D 1BRAA 1GI9B 1SB1H 1TBZH 3GCHC 3PRBA 3QN7A 5EOKA 5A09A 1SGNE 1C2KA 2V7QD 2Y7ZA 1O2NA 1XKBC 1BTZA 2THFB 3UOUA 5A0AE 1QBNA 2I6QA 3SORA 3MOCA 5C5OA 1D3PB 4ABEA 5FPYA 1UK2A 3GY4A 2R3UA 2EY4C 1MABB 3B23B 1J14A 2ZO3H 3A7YA 2Y7XA 2D1JA 3BTTE 3E0PB 4FUDA 1NU7B 5DP5A 5DP7A 4AC9A 1K1LA 3UREA 1PPZA 2AERH 1MZAA 1IQIA 4I32A 4BXSA 1FY4A 1H1BA 1UO6A 3O8DA 2H9TH 3GCHB 4IN1A 1C2GA 3E90B 3S7HB 3TPIZ 2VVVA 5C67A 3AAUA 5C17A 1H8IH 4TYDA 5GPIB 4ABIA 3GY3A 2KZ4A 1T4VH 1QCPA 1HAHH 3Q3XA 1GMCG 1KXAA 1MCTA 2A4GA 1IOEA 3OY6U 1BB0B 2OCVB 1NFYA 2BLOA 4Y8XA 3DT0H 1RS0A 1DWDH 1YY3A 3TGKE 3H7TA 4Q7ZA 2NU4E 2JDID 3V13A 1V2WT 4O97A 4WMFA 2ZPRA 2ZTZA 1YCPK 5KEDA 1V2ST 2ZQ1A 4ZH8A 6ESTA 3PLBA 1AUTC 1THSH 1XUGA 1OP0A 4H6SB 4YOIA 1V2QT 1B0EA 1TGNA 1DWCH 2BVRH 1TA2A 1S6HA 3ZZ5A 1MTSA 3SJ8A 4Y71A 1ZSLA 1TGSZ 1WU1A 3KYGA 3SU2A 2FM2A 4CRBA 2W3IA 1O2KA 3SJKA 1UK3A 2XRCA 1C4Y2 1MTUA 3D65E 3HGNA 4FUIA 1HAVA 3F0OA 1YPEH 1W7XH 1T8OA 3A8AA 4D9RA 1NZQH 5EW2H 3UOPA 2C8ZB 2ZU2A 1MH0A 3OEED 3UNSA 4X6MA 1SKYE 2ZDKA 3ZZBA 2GCTC 1EX3A 4JZEH 8GCHG 5I46H 5L2YH 1WAYB 1F5KU 3RXDA 1AO5A 4NA7A 1L4ZA 5K7RA 3RU4E 1ZRBA 2AHME 2RFKC 3DFJA 1O3AA 1UCYH 2YMSC 3LH3A 4HI3A 3RXBA 1Y3XA 1ZMLA 2ZG0H 2ZECA 1Y3VA 2GCHF 1TALA 1O2VA 4NGAH 3V3MA 4CRFA 1IQHA 4NCYA 4NWKA 1CGJE 3GCTF 2HOBA 1C5MD 2BY6X 1A5IA 1ELAA 5TCCA 3BG4C 1H8HD 1YP9A 2GMTB 5A8XA 3U1IB 1HAVB 2A7CA 4B75A 1IHSH 2FX4A 2GCTB 3ZIAD 3T2NA 3TU7H 3DA9B 3C27B 4FETA 4CRGA 1NROH 3I77A 3WWFA 2YMSB 1SR5C 1GHYH 2BDGA 1DSUA 1HJ9A 1H9LB 1LQEA 3SU4A 1ZHMA 2BMGB 2BQWB 1AE8H 1ZR0A 4FUBA 5A8YA 1LPGB 3QO6A 3GCNA 2FPZA 1IQMA 2ZCHP 1NRSH 1V2OT 2BD4A 3SZEA 3RXMA 4ZHMU 3BG4B 1D3QB 2PGBB 4HFPB 5EIYA 1UTLM 1Y5BT 4Y79A 1IQJA 3VXEH 3DSOA 1M9UA 4YT7H 2ZQ2A 1YLCA 4Q80A 2VVUA 4DJZB 3S9BA 2BD9A 2R0KA 1A0JA 1QBVH 2QIQA 1BJVA 5FBIA 4ZHLU 1C2JA 1NESE 4O03A 3A89A 1O2JA 2QXGA 2ZHWH 3EE0B 3H09A 1TRYA 3TH2H 1FAXA 4ABBA 2ULLA 1UTQA 2GP9B 4PROA 5EU8A 1O3LA 1C2IA 2QGRA 1H8DH 5L30H 3ODFA 2C8XB 1E36B 3SUGA 2KCAA 5ABWA 1C2MA 3VG8A 1NRRH 1T8NA 5CHAC 1HAIH 5HYOA 2BLQA 2RA0A 3LJJA 4IC6A 1GHAG 1QL8A 1HNEE 3M5LA 1EAIA 2VU8E 2PWXA 1C1MA 2AEIH 1GI8B 2ZCKP 1BDAA 2J2UA 1QZ8A 1MAYA 4BAMB 1O3BA 1SGYE 1JRSA 2WUCA 5FX6A 2KM0A 1GJ9B 2P16A 4Q7XA 5FL7D 3S0NA 1CT2E 1VCQA 1GMHG 1W0JD 3OX7U 4ZXXH 4B71A 5FAHA 3BEUA 1E1RD 2NWNA 1NM6A 3A87A 1OPHB 1DXWA 3P8GA 3OY5U 1P57B 1FMGA 1TNGA 1HRTH 1MD7A 1YC0A 5CHAB 1K22H 4TT3D 3BTKE 2Y5HA 3MU1A 1O5EH 4B6FA 1WTHD 1ELFA 7ESTE 4AX9H 2OQ5A 2Y82A 1Z8IB 2FOEA 3RXRA 1S5SA 3U8TH 2ZP0H 1AVGH 1NTPA 2F4LA 2CV3A 1UTMA 5JB8S 1DITH 1ZPBA 2C93B 2ODQA 3GDVA 1Y3YA 5KECA 2BD2A 3QGNB 4X1NU 2G4TA 3ZVBA 2ZA5A 1D9IA 2ZFQH 1OWJA 1YCPH 5HM2A 3OTJE 1O2SA 1GHVH 3MH5A 3SU1A 1P02A 1NO9H 5DP9A 2FI3E 2DE8A 1P3CA 2EI6A 1GI3A 2QC2A 2TGPZ 2LP6A 3IG6B 5GXPA 3ATLA 3DD2H 2F9UA 1TAWA 2ZDMA 4LK4A 1W12U 2WPKS 4X1QU 3PMAB 1BTPA 5DP6A 2VJ1A 3LT3A 1MTNC 2H9HA 3WW7A 1KLJH 3M7UA 5F8ZA 4U01A 5GIBA 1ELGA 1F0UA 2ODYB 4NA9H 2VWMA 3EA8A 4BXWA 3T26A 2CMYA 3S9AA 3SGBE 4B2CA 3PV5A 1HAPH 1N6YA 4FOUC 1UMAH 4CRCA 3SU3A 3MTYA 1WDIA 5E2PA 3BEIB 1FQ3A 1E34B 3BTME 4KTUA 4KTCA 3ZV9A 3VB4A 1FY3A 1Z71A 5C94A 2VIPA 1EZXC 1P06A 3GYLB 3UNQA 1FNIA 2DUCA 1W13U 4Q4LA 4YOGA 2VINA 2V3MA 3PB1E 3ATWA 1HXFH 3BIVH 3UIRA 4UE7H 3T62A 1NC6A 1FIZA 1OP8A 1HPGA 3BIUH 2G5NA 1SLUB 2G8TA 5T6DA 3UTUH 2BDIA 4UFEH 2BDCA 1G3DA 1F5LA 4IMQA 2ANWA 1GHXH 3SGQE 1EJNA 1NT1A 2ZGXH 3ESTA 2Z9KA 4TWYA 1K1NA 2Z9GA 1ZJKA 3RXIA 4CRDA 3A7ZA 2ZEBA 2TGTA 4LZ4B 3U8OH 2PKAA 4ABGA 1C1SA 1A0LA 4K1EA 4Y6DA 1D4PB 3K65B 3UR6A 4NIYA 4X1RU 1GI0A 3UWIA 1B7XB 4OGYA 1AKSA 1HUTH 1BTUA 1SHHB 5JDUB 1AUJA 4YLQH 2OC1A 2J38A 2ZPSA 4X8SH 4JZ1A 3SU0A 3TK5A 1SGTA 3BEFB 3GOVB 1SLVB 4CR5A 3EDXB 3GY7A 3RXGA 1U6QA 2RDLA 1TPOA 5AVDA 2Z9LA 3PO1B 5E8EH 1TNJA 4MPXA 2XBXA 3DSPA 3AK5A 1GJ4H 1P01A 1DICA 2BD7A 1HAXB 3ATIA 3TK6A 1O2LA 5ETXA 4WVPE 2O8LA 4WH6A 1ZTJA 1GVKB 4FUFA 5HIZA 1O31A 2WYJA 2XBYA 3TLOA 2IOTA 3OAAD 1AI8H 3ZZAA 2TPIZ 1O2TA 1UTOA 1K28D 2RG3A 1BRUP 2PKAB 4ACAA 2PUQH 4J2YB 2BDBA 1O5BB 2XNDD 1V2JT 5FCRA 1GBLA 1DE7H 2ZNKH 3R0FA 1YF4A 4I8JA 3ZVFA 1GHWH 2ZDVH 4GPGA 1AKSB 4K60A 3W95A 5T3HA 1G30B 5GWZA 1PPCE 2VH6A 2ZGHA 1Y5UT 2AH4X 1GI6A 2VIVA 2ZPQA 2J95A 1T4UH 4E06H 2GTBA 1Y3UA 2WUBA 3RXSA 4DVAU 1GMDF 2EA3A 7GCHG 1AFEH 2FYRA 2QAAA 1PYTD 5FXLA 3NRLA 2FWWA 5T6FA 3U28C 2ZIQH 4B73A 3VPKA 4XBBA 3A7TA 1QR3E 2P3UB 1G32B 4VGCC 1GI7B 4F49A 1ELCA 1WXRA 4CR9A 4AFSA 5T6GA 1BMLA 1GBFA 1Z8GA 5ESBA 6GCHF 1TMTH 1WOFA 1A1RA 3Q3YA 4Y8YA 1LHFH 2O8WA 3BTFE 4WMEA 4ZUHA 3MNXA 2A31A 1GCDA 2PTCE 1O3GA 4MTBA 2OP9A 3L3TA 3PYHA 5CE1A 3A84A 1ABIH 3OE7D 1O2YA 4CRAA 5JPMH 1EOJA 2QF5A 2VIQA 1J9CH 4JYVH 2J4IA 3K9XB 2G51A 1O3KA 1TRNA 3RXUA 3E1XB 2EI7A 3F6UH 4ISNA 1H9IE 2JH5D 1C9TA 3BTWE 3MFJA 2A7JA 1DLKB 4VGCB 1UVTH 3PWBA 3RMLH 1J8AA 5F8XA 2HPQH 2O8TA 1AIXH 1SC8U 2J98A 1O2RA 2TRMA 1ETRH 1OYTH 4YXWD 1CHOF 3SV9A 1OX1A 2KCYA 5SGAE 2J9NA 2PHBA 2R2WU 1JOUB 1GBMA 1TMUH 1SGQE 1V2RT 4YZUA 1T7CA 2PUXB 2ZHQH 4D7GA 2PSYA 1O3JA 2D2DA 1UVUH 4JZFH 1DOJA 1XUHA 2Z7FE 3MU4A 2ASUB 4I31A 1Z6EA 1TGCA 3RXJA 1DWEH 4AG1A 2K8IA 1E0FD 4AFZA 2FS8A 2P8OB 3ENSB 2OXSA 2TGDA 4Y76A 1OYQA 3T25A 4DIHH 2QV1A 4UFGH 3ZZ8A 3C1KA 5E0GA 2FESH 2GZ7A 1GMCF 2V3OH 2EEKA 3HKIB 1EOLA 1SLWB 4LXBH 1G37A 4X8TH 1TOMH 1LVBA 3O8CA 2AYWA 1AU8A 2P94A 3KQBA 4ZROA 2J98B 2CN0H 2OLGA 2Y5FA 3FVFB 5EPYA 2FLBH 4X1SU 1ESTA 1MKWK 5FCKA 4D76A 2QN5T 3AAVA 1KXBA 1TGBA 1CGIE 3P70B 1C5TA 1TABE 2SGPE 4CREA 5DG6A 2FI4E 2GT7A 3KGPA 1BRBE 1GBHA 2FOFA 4A1XA 1MU8B 3T27A 3U98H 1W14U 4A5TS 3KN2A 4KKDA 3SNEA 1AVWA 1ZOMA 4THNH 1G2LA 4NSVA 1TFXA 5DJ7A 1C5XB 4X2XA 1A5GH 3E3TA 8GCHF 2QF3A 3GY2A 1EP6A 3RXVA 1O5AB 2J94A 1RD3B 2GDEH 4AN7A 3QK1A 4CH8B 5EJLA 3RXAA 3A81A 3QGJA 2K1QA 4KP0A 4AB8A 1UCYE 1BA8B 1MTVA 1OWDA 2ZDLA 1QQ4A 2CF8H 4IS5A 4KELA 1QRXA 3BTEE 1V6DA 2VIDA 1FY5A 2Z3DA 4ISIH 1LVYA 1O2OA 2HVXA 5C0TA 1C5VA 2TIOA 4OM9A 3VB5A 3P8OA 1CBWC 5A0CA 1IQEA 2A7HA 1KXDA 3H5CB 4FVBA 1VJAU 1O2XA 1O5DH 1GJCB 3ZZ9A 2ZF0H 2FMJA 2F9PA 2PR3A 4NFFA 1MBQA 4LOYH 1K2I1 4BAQB 3SQHE 1TBRH 2A2QH 3MI4A 4KTSA 4Z1MD 2FX6A 1NPMA 1Z1JA 3SV2H 1GDUA 4JMYA 5HIYA 1NFUA 1GJ6A 3T29A 3BTGE 1TQ7B 1KLIH 4A92A 2O8MA 2OBOA 1O3DA 4DT4A 2A45B 1C5LH 3SHCH 2W5EA 4ZKRU 1ARCA 1H9HE 1KYNA 1CBWB 5FBEA 1EZQA 3E0NB 2SFAA 1W0YH 5JBAS 4BTUB 2UUJB 4NZQA 5FX5A 4I8GA 1NFXA 2JJ1D 3KNXA 3LGTA 1MBMA 1QA7A 2GJGA 1DY8A 1L0ZA 3BTQE 1EB1H 4WWYA 3K6ZA 4BAHB 4OS4A 2AGIX 2XC4A 4GCHF 1YKTA 3AASA 2PGQB 2ANKH 3HPTB 1KTTB 1NS3A 2JETC 4HGCA 4U32A 4E7NA 1V2PT 5C1UA 1MD8A 3MHWU 1RIWC 2XXLA 3RU4T 2OC0A 4WJG2 1KXFA 2CJIA 1GHAF 4P02A 4DW2U 1V3XA 1G36A 1TMBH 4F4OC 1B0FA 2OINA 1PQ8A 1C5YB 2G52A 1YPMH 1K1OA 3IITA 4Y7BA 4DOQA 2WV9A 1HDTH 2OTVA 5KGOA 1ESAA 1WBGB 4MNVA 3JZ2B 2VWLA 1GMHF 1NN6A 1MAXA 3HK3B 3BG8A 1BIOA 1P05A 4Y0ZE 5JBTA 4ABFA 1C2DA 1O3IA 2BZAA 2HWLB 4Y7AA 3KL6A 1V2LT 1ETSH 1C2EA 1EAUA 1RTKA 1XUKA 2F9VA 1ZHRA 4ISHH 1WYKA 3DSGA 2JETB 4RSPA 1UJ1A 3ZVDA 1RIWB 1TQ0B 1O3MA 1V2VT 3P8FA 3MU5A 3GY6A 1TNLA 1EB2A 1O30A 3IWMA 1C2FA 2Z3CA 2AGEX 1QB6A 1FZZA 1CA8B 2XCFA 3PTNA 2XWBI 4MDSA 4ISOA 2Y5GA 1CVWH 1VJ9U 4B76A 2J97A 1KDQA 1Y3WA 5F8TA 1EAWA 2TBSA 3MH4A 3VXFH 2R9PA 3P6ZB 1HAGE 2FTMA 2VWOA 2FOCA 5LPRA 1P8VC 1K9OE 3I78A 5E2OA 1YPGH 4IN2A 3GISB 5DP8A 3AW0A 5AHGH 4A1TA 1N1LA 1DY9A 1FJSA 1MKWH 1A3BH 1VR1H 4INHA 1AY6H 1DXPA 1BTHH 1CGHA 1O3OA 1W0ZU 1SMFE 1HV7A 3FP7E 4OS1A 4GVUA 3OFND 1C5WB 1LKBA 4BAOB 1O3EA 2J5UA 3F9EA 1Q3XA 2H9EH 4BTIB 1YBWA 5A0BA 2WINI 5JYIA 1IQFA 3U8RH 2LPRA 1TPPA 2C4FH 3TITA 1C1TA 1SI5H 1BBRK 2ZC9H 1GBJA 1PPHE 5CMXH 2BHGA 3ZVEA 1KDQB 2EI8A 1BHXF 4D7FA 4K3JA 8LPRA 3PV4A 3ODDA 1DM4B 1O2WA 3Q76A 2BXUH 2OC7A 4WXVA 2QY0B 3MU8A 1YLDA 3M3SA 3OTPA 4XOJA 1GGDC 3HKJB 1MKXK 1NRPH 3RMOH 4J1YA 3QTOH 9ESTA 5JB9S 3EA9A 4YO9A 1C9PA 4UD9H 2UWOA 4Q63A 2KFWA 1OSSA 1C5OH 3GS9A 1O2ZA 1TBQH 5FHTA 3LIWA 3RUOA 5FPTA 3ATMA 1NRQH 1O34A 2P3FH 2KX4A 4YOJA 2XTTB 2FOMB 1CSOE 2OC8A 1S85A 2ZU5A 4A7IB 1K0HA 4NIXA 5IK2D 5LGOA 1TX7A 1AVXA 1LQDB 3GCOA 5F53A 1AGJA 1RGQA 1TWXB 1LCYA 4AOQA 3FZDA 5C2ZA 1L1NA 2FXRA 1S6FA 4WY3A 2R3YA 1K1MA 5HXFA 2XBVA 1DANH 3R3GB 2V35A 4X2YA 1ANEA 3SZNA 4UFDH 2Y81A 3GCTG 1OXGA 2H6MA 2WHXA 2XCNA 4DURA 4X2VA 4XD7D 2CHAC 3SW2B 1QTFA 3ATKA 4OS7A 2LELA 1AE5A 3SO3A 4Q2KA 3UWJH 4B1TA 1HCGA 3A8CA
chains in the Genus database with same CATH topology
1W11U 1ANDA 4BNRA 3MO3A 2QXHA 1L4DA 2VNTA 1FPCH 4WH8A 2NU0E 4K69A 2AMQA 3EA7A 1XXFA 1IQNA 1DSTA 1YPKH 3F9GA 4X8VH 1CT0E 1JIMA 2P95A 3S9CA 1GDNA 3P95A 1AD8H 1SPJA 1IHTH 4IW4E 3LDXH 3QZRA 3LGUA 1GHBG 3Q00A 3W94A 1O37A 4DY7B 1QQUA 1DUAA 2UUYA 5E0JA 2SGQE 4AG2A 3ZV8A 2ZTYA 2P93A 1VCWA 7GCHF 4OS6A 2BQ7B 3RXTA 3LJOA 1O32A 3PLPA 3ELAH 1LHEH 1WUNH 1MTNB 1C1UH 1FUJA 4MVNA 1C5QA 1K1IA 1Z1IA 4NSYA 1C5SA 1UK4A 1SQTA 1BTWA 1OWHA 1SVPA 4IBLH 1J16A 1WQVH 3A85A 2OUAA 2ZU3A 5C3NA 4JK5A 3DHKH 1P2JA 3CS7A 1RTFB 5DK1A 3M3TA 3UQOA 1MQ5A 3QUMP 3LC3A 1EP5A 1NFWA 1EPTC 4UEHH 1G9IE 5C1XA 4A6LA 3CS0A 2FTLE 1HAZB 4ABDA 1T31A 1BMMH 5C20A 1TPAE 2YNBA 3M7QA 4JYTA 3SQEE 1FV9A 1ETTH 2PFEA 2F9NA 1CT4E 1HAYB 1YPJH 1S83A 2W7SA 4K2YA 2R2MB 4ZHAA 1EJAA 2HPPH 1PPEE 1BJUA 2SGFE 1UTJA 1QJ1B 1P9UA 4B74A 5DP3A 1GDQA 1QA0A 2ESTE 4OS2A 1K1JA 4FU8A 1KY9A 3PMJA 3PWCA 1VITG 2Z9IA 3M61U 3RLYH 2A4QA 4GHQA 4H4FA 3VGCC 3M37A 5EODA 3V0XA 1O5CB 2STBE 1YPLH 1AWHB 1BBRH 2ZHFH 1GG6C 1DPOA 1TNKA 2PW8H 1AHTH 1C5RA 1WCZA 2ZZUH 2R0LA 4X6PA 4AGKA 1GL1A 3HGPA 4QT8C 5EQQA 1XUFA 2Q6DA 4DG4A 1JWTA 3SU6A 1F0TA 4GAWA 3SJIA 1A46H 3SU5A 1C5UA 1MKXH 2FI5E 1O2GH 1VGCC 1YPHE 3VGCB 1GI1A 5EPNA 2BB4A 1ANCA 2BZ6H 1TGTA 1UVSH 1EUFA 1MMJN 4AORA 3GICB 4FU7A 4AGJA 3SV7A 3LGVA 4NIWA 4Q7YA 1ANBA 1YPHC 3OU0A 4MPVA 1GG6B 4ZAEA 1EZUC 3K6YA 3D23A 1ID5H 2CXVA 1PQ7A 3RM0H 2SGAA 3EAJA 1ELBA 1FONA 2FLRH 2AIPA 3VB7A 5BPEA 3B9FH 1ARBA 4XDEA 1SGFA 4YESB 1VGCB 2J92A 4JCNA 4X1PU 1IQLA 1F7ZA 1ZPCA 1AN1E 1LMWB 4SGAE 1UHBA 2WPIS 1P2NA 2ZGCA 4Y8ZA 2B8OH 4RKOB 1BHXB 2VH0A 4O3TA 1AZ8A 1XX9A 2QXIA 1O2QA 1XM1A 1AB9C 3JZ1B 1GBCA 5K0HA 3SNAA 1VZQH 3E91A 2RA3A 1Y59T 4WXIA 1AMHA 1TX6A 4B2AA 1SGDE 1LKAA 1UTNA 2ZU4A 4GLYA 2NU2E 1LHDH 2VB0A 4IMZA 1DUEA 1F92A 1C1WH 1GJ5H 2J34A 3S7KB 1Q2WA 4XBCA 2F3CE 3ZYDA 8KME2 5IDKA 2ZFRH 1XXDA 2B7DH 5IYTA 1BTYA 3HATH 3LPRA 1ZMJA 2AS9A 3U9AH 4UFFH 4I7YH 5DGJA 1PPFE 2YOLA 1AB9B 1UHBB 1P10A 2BXTH 4I8KA 2B9LA 5I25A 1SGCA 3FANA 1G3CA 3RXHA 2BM2A 1W8BH 3LGYA 2Q6FA 1JXPA 4LZ1H 3HK6B 3QWCH 4TY7A 5DPAA 2KAIA 1ACBE 4DGJA 1GI4A 2IN2A 4D8NA 2GT8A 2BD8A 4ZKNU 3OSYA 2FS9A 2JKHA 2WV4A 4DIIH 2IJOB 1THPB 2JH6D 2BDYA 5GCHG 2I6SA 4JK6A 2BQ6B 3FZZA 3TJUA 1AZZA 2A4OA 2Y6TA 4RN6A 1OKXA 1O35A 2ODPA 4H42U 1PQAA 1BTXA 3PM3A 1VCPA 4M7GA 4DT7B 3F1SB 2WPLS 1LVOA 1FIWA 1NU9A 5LPEA 2FYQA 1E37B 1GVZA 1BMAA 2BD3A 2M5TA 1O5GH 1P2IA 1ZGVA 2V0BA 3PTBA 5TCAA 2ZU1A 2FODA 2KAIB 1ZPZA 1GMDG 1IAUA 1A0HB 4BOHA 2B0FA 4IGDA 3MMGA 2FOHA 1QHRB 4A1VA 7LPRA 1MU6B 2VWNA 4Y11E 1P2OA 3SUFA 1SOZA 4CHAC 1T8MA 2Z94A 3NCLA 4B2BA 4AYVB 3ZZ6A 4AFUA 2BY5X 1VITH 2BX4A 1GBDA 1OP2A 5EXLA 6GCHG 1YYY1 2F91A 1BUIA 1EJMA 3TJOA 3GDSA 1P2KA 3M5OA 1GBKA 3LU9B 3ZZ4A 6LPRA 3RC4A 1INCA 1SFIA 3M35A 1JBUH 1DT2A 1QB1A 4MNYA 1SGRE 4X0WU 1HAOH 4WF8A 2A1DB 5L2ZH 4CHAB 3UPEA 1IQGA 4Z0KA 5ESTE 2SNVA 3RDZA 8ESTE 1SLXB 4ABHA 1SBWA 2HALA 3CENA 5DKMA 1CE5A 3BTHE 3FFGA 4ZKSU 1CHOG 5DO4H 3ZVAA 1TYNA 2BY7X 4JZIA 1KSNA 3PLKA 3T5FH 3TH3H 5AFZH 4MNWA 1OWIA 3TGJE 1O36A 2F9OA 1QL7A 3O8BA 3TH4H 1S82A 2P3TB 5LPFA 2ZGBH 1YM0A 5EQSA 1RXPA 1ZTKA 1TLDA 4E05H 3RXOA 2EC9H 4XBDA 1O3HA 3M3VA 5B6OA 1CA0C 1O2MA 2ZFSA 2QF0A 1XVMA 1TOCB 1C5NH 1HB0B 1A61H 2XNIA 2BTCE 4D9QA 3MNBA 4MNXA 1O2UA 1MTWA 3GYMA 1SL3A 2C3SA 1V2KT 3A7WA 1THRH 4FU9A 5EXNA 2ZHDA 4X6NA 4ZXYH 1DDJA 1SHYA 3SGAE 2OBQA 3OYPA 1HBTH 3ZVGA 1T8LA 1MCVA 3MNSA 2F83A 1CA0B 2GKVE 5F6MA 1MZDA 1TIOA 1GJ8B 2TGAA 2C90B 3KIDU 3RC6A 1F2SE 4FUGA 2ZFFH 1PJPA 1W10U 4O9VA 2CGAA 1QURH 1P12E 1SGEE 4AYYB 2GMTC 1V2UT 2D26C 2BOKA 1TA6A 3RXEA 3TGIE 3QDZB 1W3CA 4YM9A 2UWPA 1BRCE 3TJVA 1WV7H 3RLWH 3V12A 1ESBA 2AMDA 3SJ9A 1QB9A 1GBAA 1ZHPA 5FPSA 1ELVA 2FDAA 4E7RG 2GGVB 1P04A 1P3EA 4AFQA 2F9BH 5C5NA 3BV9B 2WPJS 1PYTC 1C1RA 4O3UA 2BY9X 3GDUA 3TNTA 1SOTA 2A5KA 1ZLRA 3UY9A 2Y80A 1SGIB 1ZSJA 3KQDA 3KHVA 2FO9A 1KTSB 1Y5AT 2UUKB 4FUHA 4GUXA 4NA8A 1C1PA 1A3EH 1A5HA 3SHAH 3MYWA 2GV6A 2Z3EA 2ANMH 4K1SA 1XVOA 3ZZDA 1GBEA 2ZWLH 1ZMNA 1TE0A 3TNSA 5AFYH 1QRZA 5HGGA 3RXQA 1SFQB 1W7GH 1P11E 4CH2B 1D6WA 1N8OC 5LH8A 1GBTA 2GZ8A 3ZZ7A 1GJAB 3A7XA 2A32A 3BN9A 4INLA 2ZKSA 4K8BA 1C1OA 2BOHB 1GHBF 2XC5A 1FLEE 1SQAA 2OQUA 1G2MA 2DE9A 5AF9H 1Q31A 1O3CA 2STAE 1LDTT 4OS5A 1EATA 4XE4A 2PLXA 3E16B 3MNCA 3SUDA 1HLTH 1DX5M 3DUXH 3TVJB 4I33A 2ZGJA 3V7TA 4ZMAH 1T32A 3VEQB 1N8OB 3MWIU 2HRVA 2PV9B 3RXCA 4U2WA 5C1YA 4GCHG 1MUEB 2GZ9A 1O38A 1FXYA 3RC5A 2NU3E 2BD5A 5H4IB 4BTTB 5J4QA 3N7OA 1O2IA 3A7VA 4NFEA 1Z7KA 4XFQA 1BZXE 1HYLA 1P03A 3NK8A 3P92A 1QNJA 4ZKOU 2BDHA 2QA9E 2FEQH 1BITA 3ZVCA 3LC5A 3ZZCA 2VVCA 1K1PA 2WPMS 2XC0A 1JIRA 2HNTF 3KF2A 4K1TA 4Z6AH 2WYGA 1OWEA 1DWBH 4YTAA 3MH7A 1GGDB 2QXJA 3BTDE 3VB6A 2FOGA 3O8RA 3E6PH 1FN8A 1CHGA 3ITIA 1ZGIA 1LHGH 1AFQC 1TNIA 2SNWA 3A8DA 6CHAC 3PMBB 1EAXA 2IPHA 1QRWA 1ORFA 1AQ7A 2ZDNA 3S69A 3AVZA 1L1JA 3PMHB 2GCHG 1ELEE 2SGDE 1W2KH 2JH0D 4ISLA 3AW1A 4FVDA 1GBIA 1VITF 3MU0A 3UNRA 3RP2A 1OS8A 4R0IA 1YCPM 1D3TB 2HGTH 3BF6H 2V3HH 5GDSH 3KQEA 1ZZZA 1FDPA 1TRMA 2FIRH 1QBOA 2V6NA 1XMNB 1C5PA 1X7AC 2LNCA 1O3PB 1AFQB 1P2QA 2Z9JA 2AIQA 1BBRE 2W3KA 1UTPA 4MG3A 5A2MH 3SNDA 2PTNA 6CHAB 4NIVA 4YT6H 5DP4A 1ZSKA 1GJDB 5HMAA 1EZSC 1EXFA 3RXPA 1L1GA 1A7SA 1GI2A 1ELTA 3PROA 3D49H 4KGAA 1Z8RA 2A4RA 2BVSH 1FY8E 1V2MT 3EQ0H 3RXFA 1GL0E 1C5ZB 2GDDA 3SBKA 1GHZA 2D8WA 2BLVA 2CHAB 2VIWA 3A83A 4MPUA 1LPKB 2CF9H 3MO9A 1G3EA 1CO7E 1HFDA 1S84A 5EW1H 1HGTH 1XUIA 2W26A 3D62A 1V2NT 2BDAA 3U1JB 3P8NA 3URDA 4Y10E 3CP7A 4WMDA 1K21H 2ZHEH 2SGEE 1SSXA 1ZYOA 1BOQA 2XBWA 2YNAA 1FN6A 1ZTLA 1G3BA 1TONA 3LGIA 5HM9A 4INKA 2BYAX 4JYUH 1E38B 1EPTA 1GCTC 2BY8X 1N6XA 1DLEA 2ZTXA 3RM2H 1LTOA 1CQQA 4ESTE 3P17H 1C1VH 1J17T 3K2UA 1UVPA 1D6RA 1YGCH 1O2HA 4TWWA 1P09A 2Q1JA 2Z6BD 3A8BA 2VIOA 4UDWH 3LONA 3UQVA 3SNCA 1P2MA 1ZRKA 1A2CH 4AB9A 3SI3H 1SGFG 4ABAA 1LO6A 3PO1C 4R8TB 1QY6A 1GVLA 1O3NA 1O5FH 1RRKA 1ZJDA 5EXMA 1C4V2 1DVAH 3M5MA 1GCTB 1PPBH 4NG9H 1B5GH 3LOXA 3GY5A 5JBCS 3A86A 3F9FA 3KEEA 4X6OA 1GWAA 3SJOA 7KMEH 3TIUA 1EPTB 1GPZA 1KIGH 1UTKA 1Y8TA 1Z8JB 2P59A 3WY8A 1ELDE 1H4WA 3ZYEA 1C4U2 2H1UA 2QYIA 1FI8A 1OOKB 2VGCC 5G4BA 1QL9A 1C2HA 1V2TT 2A0QB 1PFXC 1OWKA 3VB3A 4X2WA 1HJAC 2BX3A 4DCDA 5GCHF 3T28A 5JBBS 3UFAA 4H6TA 1HIAA 2ALPA 4Y0YE 1JRTA 2ZI2H 3RXLA 1P0SH 1SGPE 3LH1A 1TPSA 4X8UH 2ANYA 2G81E 1TB6H 1HJ8A 3QX5H 3KQCA 2ZDAH 3RU4D 3BSQA 1XUJA 4FUEA 1C1QA 4FUCA 1JMOH 1DS2E 2OD3B 1AWFH 2VGCB 3EYDA 1GJBB 1P9SA 3I29A 3L6PA 1SQOA 4I8LA 1FPHH 4K8YA 1HJAB 4XSKU 4YLUA 1O3FA 1TNHA 4K5ZA 4TY6A 3MH6A 3VFEA 4MPWA 4BANB 2W7UA 3A82A 3Q77A 2AMPA 1GI5A 3RXKA 1EQ9A 1A4WH 5EGMA 2HNTE 2FP7B 1D3DB 2B5TB 2UWLA 4HZHA 1C2LA 1KLTA 1WSSH 2UUFB 2WPHS 2ZFPH 2NU1E 1S0QA 3SNBA 1RFNA 3STIA 3FAOA 2PSXA 1HIAB 2ALVA 3DFLA 1Z6JH 4BAKB 2GV7A 2GX4A 2HNTC 2GD4B 3H7OA 1GJ7B 3NWUA 5TJXA 4AZ2B 1FAKH 1F0SA 2H5DA 1PPGE 4U30A 2FZZA 1RJXB 4CBOA 3RMNH 2C8WB 1QIXB 1BMNH 3STJA 1MQ6A 3Q3KA 1C1NA 4GHTA 3A88A 2FOAA 4JZDH 1UVOA 2ZFTA 2GVFA 4I8HA 5PTPA 1ABJH 4UONA 1F0RA 3EGKH 1O2PA 2BVXH 1WTGH 1IQKA 3M7TA 1BCUH 2AGGX 1EASA 2P8OC 5F03A 4TPIZ 1LHCH 1QGFA 1E35B 3TJNA 1LPZB 2Q6GA 2QCYA 2H2ZA 1CU1A 2A5IA 1L2EA 3QLPH 1BQYA 3M36A 1UCYK 1TX8A 3FP6E 5EQRA 5L6NH 2O9QA 3RMMH 4FUJA 5GJ4B 1KXCA 2A2XH 2FOBA 3LGWA 3SI4H 1LVMA 3NPSA 1BT7A 4HTCH 4ASHA 3U69H 2AFQB 1KXEA 1DFPA 2O8UA 1O39A 5E0HA 1EKBB 2G00A 2PKSC 2RCEA 4RKJB 3L33A 1O33A 3QZQA 4FXGH 1QFKH 3LKWA 2XWAA 3F9HA 4IC5A 4OGXA 3SN8A 3NKKA 1NRNH 9LPRA 1XKAC 3UUZA 2A5AA 1WQSA 3GY8A 3QTVH 4NZLA 5A8ZA 1S0RA 3B8JA 2WV5A 3UR9A 4NWLA 2ILNA 4SGBE 1F5RA 3MO6A 4ABJA 3SV6A 5BRRE 4GSOA 3TK9A 1FY1A 1SG8B 4MLFB 2BLWA 3FP8E 2C8YB 3E8LA 2HLCA 2H5CA 2PKSB 3SUEA 1GBBA 3F68H 2G55A 5J4SA 2G4UA 1S81A 3ZZ3A 1QJ6B 2ZCLP 1QJ7B 4TPYA 3M5NA 3NUMA 1J15A 1O0DH 2XYAA 1HXEH 2G5VA 3SOSA 2XW9A 3KCGH 3A80A 3G01A 4CBNA 5EG4A 3NZIA 3NXPA 3URCA 4MQAA 1NY22 1RTLA 1PQ5A 1BRAA 1GI9B 1SB1H 1TBZH 3GCHC 3QN7A 5EOKA 5A09A 1SGNE 1C2KA 2Y7ZA 1O2NA 1XKBC 1BTZA 2THFB 3UOUA 5A0AE 1QBNA 2I6QA 3SORA 3MOCA 5C5OA