3NKKA

Trypsin in complex with fluorine containing fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA02
1GCDA 3DA9B 4MNWA 3RU4E 3U69H 4DIHH 1HYLA 2AIQA 2BDCA 3D23A 1Y8TA 3SNAA 3SN8A 5LPEA 3P8NA 2F9OA 1MZAA 1NFYA 2ODYB 1GBJA 4A5TS 2UUFB 2WV4A 1YPKH 1WV7H 1GJ7B 2J92A 2UWOA 1NY22 4FUCA 1RJXB 1W13U 2H6MA 2FESH 4KTCA 3RMMH 1F0RA 3SGQE 3GCOA 1P2NA 1FY1A 1LPKB 3FAOA 5HM9A 5G4BA 1FY3A 1UTPA 2DUCA 2D8WA 4FUGA 1PQAA 3KQEA 1XVMA 2VU8E 4K1EA 2G51A 4O9VA 1OWKA 4D7FA 3PMBB 5T6DA 1P02A 1SVPA 2ZGJA 2HNTE 4NA7A 3MMGA 2IOTA 1NC6A 3U98H 3QWCH 1AWFH 4Y8ZA 3CENA 1O2SA 1XXFA 3M35A 1H4WA 2W3IA 2OCVB 3QN7A 4TY7A 1NRRH 1F2SE 1AMHA 1S6HA 2ZFPH 3A83A 3E16B 1QB9A 5JPMH 1HXEH 1T4VH 3VXFH 2AFQB 1WOFA 3M3TA 5TJXA 3VGCC 3H7TA 1LKAA 5EQQA 1ABJH 2A4RA 5F8ZA 2ILNA 5A8XA 5C67A 1A7SA 9ESTA 3N7OA 3P8OA 1YPMH 1S81A 1B5GH 1AGJA 2YOLA 3UQOA 3VB7A 1MCTA 4X8VH 5ABWA 1O3KA 1GGDB 1KXCA 3BTWE 4WXIA 1LHDH 1H8IH 3UY9A 1HAOH 3ZZ4A 5DP7A 5EPYA 1TOCB 1VJ9U 4H4FA 2ESTE 1AFQC 4B1TA 3D62A 1B7XB 1M9UA 5CHAB 1Z71A 1JRSA 1CO7E 2G5VA 3OY6U 5C20A 2BY9X 1ORFA 1S83A 1O2OA 1SMFE 5J4QA 4A6LA 4YO9A 4I8JA 5EOKA 1BQYA 1CE5A 3RXPA 3MU5A 1D9IA 5EXLA 2PWXA 3PLBA 1TGNA 3PB1E 3Q3YA 4Q7XA 1Y5AT 2PGBB 3LU9B 4QT8C 3QLPH 4GHTA 4B2CA 2FOHA 9LPRA 3TK6A 1AD8H 1TA2A 4BAMB 2BD9A 4E7RG 3QDZB 6ESTA 1A1RA 3OX7U 1JIRA 4NA8A 3SI4H 3OSYA 1UTNA 5DKMA 3GCTF 1EAUA 1GI3A 1GI7B 2UUYA 2Z3EA 1W2KH 3F9GA 3FP8E 2Y5HA 5EXMA 4YT7H 2P3UB 1J16A 4MPXA 1SSXA 2A5IA 3TNTA 1C5WB 5AF9H 1O2VA 2GZ7A 4B76A 3M5LA 3B23B 3TVJB 1LHEH 1NFXA 1YCPM 1S82A 1T8NA 3VB6A 1BTYA 1GDUA 2GZ9A 1IQNA 1C5LH 1HFDA 1GBDA 1W0ZU 1CGIE 1UTMA 2BX4A 1RD3B 1DVAH 2BLOA 1MH0A 1KYNA 5IYTA 2FLBH 2ZEBA 1HXFH 1VCPA 5FX5A 1C2GA 1O39A 4SGBE 1MTUA 2JH5D 2Q6DA 2ZKSA 6LPRA 3LT3A 3O8RA 1IQGA 2JH0D 3MH5A 1TABE 1CGJE 1UVSH 2G81E 1GJBB 4K5ZA 1GHZA 5EQRA 2J38A 4U32A 3NCLA 3RMOH 1RFNA 1H9HE 1HAHH 3QGJA 5HGGA 1FONA 1AN1E 5JYIA 1UTLM 2VB0A 2F9NA 2ZU2A 1KXEA 1O2GH 1J14A 2QCYA 2SGAA 1KSNA 1HB0B 4XFQA 1C4U2 2BD8A 1OYQA 2CF9H 4H42U 1BBRE 3A7VA 1BTPA 1SGEE 1GBBA 3MH6A 4CR5A 4OS6A 4FU7A 2GV6A 1G2MA 2AGEX 1SGTA 3EA7A 2Y5FA 1DT2A 2WUCA 4A92A 2BM2A 2BD2A 2Y81A 2EI6A 2J9NA 3B8JA 1O3JA 4RKOB 1K1LA 5A0CA 3BTFE 1C5RA 1ZMNA 1SHHB 3AAUA 3MU1A 5LH8A 4AFUA 4AGKA 2ZQ2A 1GG6C 4ZH8A 1PPCE 3TLOA 2ZGXH 2TGAA 2V3HH 1BITA 3DFJA 1C2MA 1EATA 2R3YA 2ZCHP 1Y3YA 2VIVA 2NU0E 2OC1A 1HCGA 4TPIZ 3Q3XA 4XE4A 4UFEH 1CT4E 5FX6A 4K3JA 1HNEE 1BMAA 1VR1H 4UDWH 5DK1A 4DT7B 1FLEE 4JYTA 2ANYA 1O3CA 1BOQA 1NRQH 1S84A 4UD9H 1V2PT 4AG2A 4WMEA 3AW1A 3RUOA 1SGQE 1WCZA 5AVDA 1QL8A 5JB8S 1C5UA 2ZDKA 3K2UA 1DUEA 2ZGCA 3A7TA 3MNBA 2OC8A 1VITH 3MNXA 2QYIA 1LDTT 3EAJA 1W7GH 3SQHE 3VB5A 3K9XB 1CT2E 2A5AA 1ELAA 4LOYH 1EP6A 2Y7ZA 2BY6X 1NS3A 4NWLA 1FNIA 2BXTH 2H9HA 1WTGH 2GP9B 4HI3A 3HPTB 3SNEA 4JK5A 2ZQ1A 1P05A 4UFDH 1AB9C 1SGRE 4GUXA 4YLUA 3GY7A 3A85A 2Q6FA 3ZVCA 1GHAG 4CH8B 1EASA 1O2KA 2ZGHA 3HK6B 2A0QB 1H9LB 3MH7A 4Y8YA 1G2LA 2VH6A 2ZHQH 4MQAA 2W26A 2VWMA 4HTCH 4B71A 1PPEE 4FUDA 4UE7H 3SU1A 1KTSB 1TMTH 3OU0A 2NU3E 1QB6A 5EGMA 1NZQH 5L6NH 5DGJA 1DS2E 1UK4A 2SGDE 3TGJE 3HKJB 3RXEA 1V2TT 1UVUH 1GBMA 1YCPH 3ODDA 2XC5A 3RU4T 4GAWA 1AZZA 1LHFH 1O5BB 1O2QA 2SGFE 1TOMH 3RXSA 1TGTA 5GCHG 3G01A 2FI3E 2JKHA 3BG4C 1GBTA 1TNGA 1P10A 1NM6A 3RXMA 3JZ1B 4JZDH 1CHOG 5JBBS 1O36A 1BMNH 1P2QA 2OLGA 1Y3UA 4CHAC 1O3PB 1V2ST 4OGYA 1SPJA 4JYVH 1HAZB 4XBDA 1OX1A 1EOLA 1V2VT 6CHAB 1SGIB 1GBCA 3ITIA 1KXAA 5GJ4B 5TCCA 5SGAE 4ZKNU 1TAWA 3SORA 3A89A 1KLIH 3FANA 4X1PU 3E1XB 4FUEA 2P3TB 1QFKH 2BTCE 1VZQH 3D49H 1OP2A 4O3UA 1F92A 2HPQH 2OP9A 5A09A 1V2OT 1N8OC 1TPOA 1GI6A 2QGRA 3BG4B 4CH2B 1ETSH 3FP6E 1P12E 4OS7A 3BTKE 2G52A 1QJ6B 4AZ2B 3OYPA 3SHAH 2BDAA 1P09A 3P95A 3UOPA 4CHAB 1RTKA 2GTBA 3ESTA 3HKIB 1P04A 3L6PA 3SUDA 1O3FA 1WAYB 4ZKRU 4ABDA 1UK2A 5T6FA 3S0NA 1HAYB 4INKA 1LQDB 3UOUA 1Q2WA 1O3HA 1C9TA 1ZPBA 1BJUA 2XBWA 4CRGA 1K1MA 1N1LA 2UUKB 1BMMH 1CHGA 2AERH 5A2MH 2ZU3A 1DPOA 1BTUA 1OWJA 2FI5E 4YESB 1HLTH 2PKSC 1MD8A 1O34A 1C5MD 3LGTA 2C3SA 4OS1A 1ZYOA 3RXJA 5JBAS 5TCAA 1C2IA 1O5GH 1QB1A 1O2NA 1QRZA 1LKBA 1TB6H 3A80A 2F83A 2ZWLH 1QA0A 3GY8A 1LO6A 1NRPH 1PYTC 2P8OB 3RXOA 1ETRH 2ZCLP 1ZRBA 1O5EH 2M5TA 1KXBA 1FY4A 2ZDLA 4JMYA 4Q7ZA 2FYQA 4O3TA 1C5VA 3SNCA 2D26C 3RLWH 2RG3A 3M3VA 1XM1A 1MAXA 2TBSA 1X7AC 3B9FH 5DP4A 1O2RA 1TIOA 1T8MA 1EPTC 1W10U 1ZTLA 1O3LA 3TGIE 1YPEH 1YPHC 3A86A 5F8TA 1B0EA 1GHWH 3O8CA 2VIOA 1Z6EA 3NKKA 1IHSH 4JCNA 2BMGB 1CBWB 1EAXA 4FUFA 1GHYH 1ACBE 1YM0A 1TBQH 2ZFQH 3PO1B 5F8XA 4DJZB 1K1IA 2PLXA 2ZP0H 1EAWA 4I33A 2TGTA 1GBFA 1MUEB 1YPJH 4AORA 4TY6A 4R0IA 4Y71A 1C1RA 3M61U 1GJCB 1HPGA 3F1SB 3SUFA 2ZTZA 4D9QA 5FBEA 3MNSA 1LVMA 1S0QA 4JZIA 1RGQA 4IC6A 3A8AA 3KN2A 1TRMA 4Y0YE 4LZ4B 1Y3VA 3I77A 1T7CA 2FX4A 2XCFA 2Z6BD 4IMZA 3ZZBA 4MVNA 3LH3A 5DP8A 1O31A 2AYWA 1SI5H 1GHAF 1GDNA 3KCGH 1D3PB 3ATMA 3OTJE 1KDQA 3EDXB 1WTHD 8GCHG 3LGWA 1A0LA 2HPPH 5K0HA 3U8RH 3A7WA 1Y3XA 4PROA 1V2RT 5A0AE 1FJSA 1O3BA 1SGYE 3LJJA 1Z8GA 4OGXA 3VXEH 1ABIH 2HNTF 2A2XH 1BTHH 1BHXB 4J2YB 1BBRK 2FOBA 1DY8A 4ESTE 1HAGE 4Q2KA 4I7YH 1K21H 1F0SA 1QRWA 4SGAE 1TYNA 4RSPA 2WPMS 1NFUA 2FX6A 1FDPA 5DP6A 1ZMLA 3LH1A 7KMEH 1GHBG 1C1TA 5FPYA 5DG6A 1GMDG 3MO6A 1V2JT 1K22H 4AB8A 3SV8A 1GVLA 5J4SA 4YOIA 2ZU1A 3SGBE 5E0GA 4DOQA 1TGCA 1C2JA 3A84A 5FPTA 3T62A 1ARBA 1WUNH 1YC0A 5BRRE 3SU3A 3E0PB 1P57B 2PUQH 1VJAU 2OD3B 3A87A 5L2ZH 2G4TA 4E05H 5EPNA 1YLDA 4Y6DA 1V2MT 2ZDMA 2AS9A 5E2PA 3IITA 3SUEA 2CGAA 8LPRA 1P03A 2ZHDA 3VEQB 3F9EA 4LXBH 4MPUA 3MOCA 3S9AA 3Q3KA 2O8LA 3GICB 2R2WU 3SI3H 1BRUP 3S7HB 2P93A 2AMDA 4DGJA 3ZVAA 1SGPE 3M5OA 3ZVEA 1OYTH 4MG3A 2O8TA 1HAIH 1SL3A 1FY5A 2GCHG 2VGCC 3UPEA 3RM2H 2GMTB 1GBLA 1O5CB 3ENSB 2GD4B 2RA3A 3TH4H 2FLRH 1C1OA 1G3DA 4ZKOU 4FVDA 1ETTH 5ESTE 1EZUC 1P11E 4OS5A 4NSVA 1QBVH 2VWLA 1GJ6A 1YBWA 1XUGA 1MBQA 2FEQH 2QAAA 3BIVH 1MKXK 2ZZUH 2A4GA 1E34B 1UTKA 4D8NA 2OBOA 1J9CH 1PYTD 1JRTA 2DE8A 5ETXA 1DWDH 2TIOA 1K1JA 1U6QA 3UUZA 1L4ZA 1QQ4A 1GJ8B 3ZZ7A 5DP3A 1JBUH 1MD7A 4ISNA 1PFXC 4NFFA 5DJ7A 2VGCB 5LGOA 1TBZH 3RM0H 3BN9A 3A8CA 2BVRH 1G3CA 2STAE 3PMJA 4TYDA 5I46H 2J4IA 1EB2A 3BF6H 2B8OH 2XBVA 3V7TA 3P92A 2W5EA 3DD2H 5F6MA 1THPB 1ZGIA 4KELA 1GPZA 4ABAA 4ZHMU 2IPHA 1UCYK 1P3CA 5C5NA 1QHRB 2BOHB 1G3EA 2ZO3H 3PYHA 4H6TA 1CU1A 4I8HA 1L4DA 1F5LA 2H9TH 1ELCA 1QL7A 5EQSA 3HATH 4DURA 1ANBA 2OC0A 1L0ZA 1IQHA 4NA9H 8ESTE 3RXDA 3TJOA 1C5QA 1ELBA 2V6NA 4D9RA 2A5KA 2XC4A 1C5TA 4TWYA 3KQBA 3VGCB 3GDUA 4KKDA 1YF4A 1YPGH 1SOZA 1O2HA 1GI5A 3VPKA 1YPHE 3HGNA 2BY8X 4UFFH 3E90B 2GVFA 2QXGA 1P2KA 4X6MA 3M7TA 1MQ6A 1UMAH 1C1WH 1IQLA 3A81A 1J8AA 3QZQA 4WVPE 1GBEA 3Q77A 1AFQB 3STJA 1C1VH 4CRDA 3EGKH 3TNSA 1O3OA 3BTME 3T2NA 1NT1A 3PMHB 4F49A 1ZR0A 1FY8E 1L1GA 1GBAA 1IQMA 1ZJKA 2BQ6B 2WINI 3KF2A 4BXSA 4Y11E 2ZDVH 4A1XA 2RDLA 4GSOA 1P2IA 3I78A 1IQEA 4IN2A 1K9OE 2NU2E 2DE9A 4DG4A 4O03A 2J2UA 4KTSA 1SOTA 1KTTB 4ZKSU 4AOQA 5K7RA 3PWBA 3P70B 3SJOA 2BY7X 8GCHF 2C93B 2Z9IA 1SLVB 3MWIU 2QA9E 1OSSA 3P17H 4ZXYH 2GKVE 1V2UT 4DVAU 5DP9A 2ANMH 4MNYA 4AFSA 1D3TB 1AHTH 1PPGE 1XMNB 1OWDA 4JK6A 1BJVA 3W95A 2G00A 4IW4E 2QF0A 1TQ0B 1C2DA 5GXPA 4X2YA 1C2EA 3MO9A 4LK4A 1GHBF 3GISB 4OS2A 3QTOH 1INCA 1GMDF 2ZG0H 2WV5A 4O97A 4WH8A 3SU5A 3R3GB 3KQCA 2FOAA 1E37B 2VJ1A 3F9FA 5HMAA 2BOKA 2A4OA 4BAOB 2Y80A 4ZHAA 1Y59T 2GV7A 2GZ8A 4NG9H 1O2UA 3K6YA 3LIWA 1MKWH 3VB4A 3BG8A 2AH4X 3RP2A 4UONA 3C1KA 1PPZA 1A61H 4M7GA 2R9PA 3PM3A 1FUJA 2QF3A 5C1YA 2F3CE 1A5GH 2IN2A 3SQEE 5CE1A 3KEEA 5AHGH 3BIUH 1P8VC 3SJ8A 1CVWH 1F5KU 1GVZA 1P9UA 1YKTA 3L33A 3TH2H 2ZU4A 4U30A 3VFEA 4AX9H 4BTUB 4BNRA 1FIWA 1GMHG 3LJOA 4RN6A 1C1MA 3CS7A 1S85A 3RXTA 1Z7KA 1A3BH 3BTEE 3PWCA 4CREA 3ATIA 2FPZA 2W7SA 2GCHF 3ZVDA 4A1VA 2ZTXA 1TNIA 2BDHA 2ZDNA 1GG6B 3SO3A 1UTOA 3BTGE 3TJNA 1A2CH 2XWAA 2O8MA 1N6XA 2VIQA 1SGCA 2ASUB 1E0FD 2YNAA 1JOUB 2VWNA 2H9EH 1OWIA 4I8LA 3E6PH 1TRNA 2J34A 2VH0A 2QN5T 2R0KA 3UFAA 3MFJA 4X8UH 2WPIS 1F0UA 2A4QA 3T27A 1AI8H 2FI4E 3UR6A 1QY6A 1GCTC 4MDSA 1TE0A 1VGCC 2ALPA 1LVOA 2AMPA 1MTNC 2XTTB 3E3TA 4UFGH 2PHBA 2Q6GA 3MH4A 1BRAA 3MO3A 4TPYA 1MU6B 1ELTA 2XWBI 1V3XA 4JZ1A 4U01A 4WMDA 2CHAC 1G36A 3LC5A 3ZZAA 1XXDA 2ANWA 2FWWA 3V0XA 1F7ZA 3SHCH 4DY7B 2FOFA 2FXRA 2HOBA 5E0HA 2QXHA 1NRSH 4Y10E 1SLXB 4ABJA 1DXWA 4ZROA 3S7KB 2JETC 1G9IE 2SNWA 2HGTH 1BCUH 1QL9A 3F9HA 1ARCA 3ZVFA 5C2ZA 3RXHA 1ZHMA 2C8ZB 4Z6AH 1UCYE 4Y7AA 1O2PA 1VITG 3ZZ6A 1KIGH 2VINA 4UEHH 4DCDA 1AB9B 4H6SB 3SZNA 1EAIA 5E2OA 2FYRA 1UTQA 1Z8IB 2D2DA 2PFEA 1JXPA 4MNXA 1O3IA 1SR5C 3TJUA 3T5FH 2AGIX 2SFAA 1O0DH 3V13A 2NWNA 1AUJA 2BD4A 1O3NA 1ZPCA 5E0JA 2VIPA 1SQAA 3MU0A 3RC5A 4XDEA 4AYVB 1HJ9A 4X8TH 5BPEA 3A88A 2FS9A 1HAXB 3EA8A 1C2FA 1C5XB 1RTFB 4AFQA 2PW8H 1TNLA 3UNSA 3P8GA 1CQQA 5GIBA 5L30H 4GVUA 1UHBA 3A7ZA 2UWLA 1DLEA 2Z9LA 4JZFH 1NRNH 2CJIA 3A7YA 1O38A 3TK9A 2G55A 2ZI2H 4YZUA 1Z1IA 2AMQA 2FMJA 4MLFB 3GY5A 2A7JA 1HJAC 3ODFA 2NU1E 4GCHG 2F9VA 3FP7E 1GJ4H 2OBQA 3FFGA 3BTHE 3E8LA 2SGQE 3LDXH 3PTBA 1A3EH 1NESE 1QR3E 1CSOE 1FI8A 1SFIA 4CRAA 4I8GA 4WY3A 3R0FA 1ESBA 1A0HB 2PTNA 2ZDAH 1BIOA 1UHBB 1A4WH 1C1NA 1TLDA 2FOCA 1J17T 1OP8A 1K1OA 3NPSA 3GCHC 1N8OB 1LPGB 1MCVA 3MYWA 4ABBA 2OQUA 2FS8A 1EJNA 2B5TB 1SHYA 1D3QB 3RXFA 3ATKA 4B2BA 2CXVA 3LGIA 3MU4A 3GYMA 2Q1JA 2V35A 4INLA 1BRBE 2XXLA 4F4OC 2ZF0H 4MPVA 2BLWA 2Z94A 1C1PA 1FAKH 3E91A 3NUMA 2P94A 1NPMA 3LOXA 3ZYDA 1TMUH 1O2MA 6GCHG 1RTLA 1O2JA 3F6UH 5EG4A 3URCA 1K28D 2A7HA 1DM4B 5ESBA 1QJ7B 1BMLA 2ZHEH 5FPSA 3QK1A 3EE0B 2C8WB 3UQVA 8KME2 1O33A 2D1JA 4X6NA 2XYAA 2BY5X 1BTWA 1J15A 1QIXB 1P0SH 4D7GA 3BV9B 1ZJDA 2VVCA 1C5ZB 1V6DA 2PKSB 3ZYEA 1MU8B 2V3OH 1XUFA 2ZNKH 3BEUA 4AYYB 1YCPK 4WF8A 1CGHA 1LHCH 5FHTA 3RXUA 1GHVH 1FN6A 3PROA 2XRCA 1O2YA 4K8YA 2A2QH 3UWJH 1GI2A 4CRFA 3LONA 1QRXA 1MBMA 1RIWC 2ODPA 1AVGH 1TFXA 3T29A 1EPTA 3L3TA 2TRMA 3HGPA 1F0TA 2UWPA 1GMHF 2ZGBH 1VCWA 1ESAA 4Y79A 1HV7A 2IJOB 1ZTJA 2FTMA 3ZV8A 1SQTA 1NROH 2BZ6H 3M5NA 2BB4A 1PQ5A 1HUTH 3S9BA 2JH6D 4CRBA 1AIXH 1KLTA 4B74A 3RXQA 4XOJA 3GYLB 1XUKA 1HDTH 1V2KT 1MKXH 3GCNA 3SGAE 2PUXB 3SV9A 3QGNB 1XUJA 3V12A 1EPTB 4X6OA 5DO4H 1AWHB 3T26A 3E0NB 3MTYA 1DSUA 1IQJA 2WPLS 1THSH 3KIDU 4ISIH 1FQ3A 4IS5A 1C1SA 4K1TA 5F03A 1NTPA 1WBGB 4ZMAH 5CMXH 1NU7B 2Z3DA 2PV9B 3WY8A 2KAIB 5JB9S 4XBCA 1G37A 4KTUA 3GY4A 2PR3A 4NIYA 1XX9A 2K1QA 1GBIA 2FIRH 4RKJB 1T8LA 5EODA 2R0LA 2WPJS 3A8DA 4NIVA 1O2XA 3A7XA 1TGBA 5HXFA 3ZZ3A 3PLPA 1BTXA 2BQ7B 2BDBA 2LPRA 1VITF 1UVPA 5L2YH 3QX5H 1D4PB 3U1JB 1B0FA 1W7XH 2EEKA 3KNXA 1O5AB 1EJMA 1SGFG 1O3EA 4X1SU 4K1SA 5FBIA 1E38B 3S69A 2TGDA 1HIAA 1QQUA 2ZTYA 1GWAA 3T28A 1UVTH 3DUXH 3RU4D 4IGDA 5T6GA 1S0RA 3IWMA 1AUTC 4NWKA 4YOGA 2HRVA 1O3MA 1W8BH 4ZHLU 1MZDA 1P2OA 1C4Y2 2Z9GA 2G5NA 1AU8A 2VVUA 4ZAEA 2GT7A 3RDZA 1AVXA 3KQDA 1O3AA 4R8TB 1GBKA 1HIAB 1O2IA 3BTDE 3EA9A 2VWOA 1QGFA 3OY5U 2Z9JA 3KGPA 1GHXH 3KHVA 3H7OA 3SU4A 5LPFA 4MNVA 4VGCC 2W7UA 4GCHF 1BA8B 1GJ5H 1MTVA 1FPHH 5A0BA 2NU4E 5FAHA 3P6ZB 2F9UA 1ANCA 1W12U 1MTWA 2GDEH 4ZUHA 3QUMP 3RXAA 1BT7A 1O3DA 1DWBH 4HGCA 2ULLA 2P95A 4FXGH 3H5CB 1BHXF 4ABIA 4JZEH 1ELEE 2ZPSA 1HGTH 5LPRA 4BXWA 2FTLE 4FU9A 1DE7H 1Y3WA 3ZZ5A 3NWUA 1THRH 2RCEA 3BSQA 2W3KA 1GGDC 1W14U 4BAQB 3SNBA 2HALA 5DP5A 3TU7H 4X2XA 1T31A 2LNCA 4VGCB 1GMCG 1OOKB 1EKBB 2OC7A 4INHA 1ZOMA 1G32B 3UNQA 3ATWA 2Y5GA 4CR9A 1TBRH 4NIXA 5CHAC 2R3UA 1OPHB 1UJ1A 1SGFA 1SQOA 6GCHF 2WPKS 4X1NU 1P01A 1CA8B 4E7NA 3A8BA 7ESTE 1DANH 3TIUA 4IC5A 1QBNA 5GDSH 1XUIA 1DFPA 4BOHA 1A46H 1BUIA 5AFZH 1DY9A 1PPBH 1GDQA 4WWYA 4K60A 1BB0B 4D76A 1P2JA 2I6SA 3MI4A 2VIDA 4K2YA 3UNRA 4Y76A 1LPZB 1QURH 2CN0H 2TPIZ 2VIWA 4E06H 1EJAA 1NU9A 1D6RA 2SNVA 5C1UA 1FN8A 1AY6H 3DHKH 1WQSA 2C8XB 2H5CA 1RS0A 1W3CA 4HZHA 2VVVA 1Z8RA 2F9BH 4B73A 2STBE 4FUIA 3PTNA 4U2WA 1O5FH 3SOSA 1UVOA 4IMQA 1F5RA 1BRCE 1C5OH 1SGNE 1ZHPA 1N6YA 1DXPA 1QTFA 2ZCKP 1NN6A 4BTIB 3SJKA 2PSXA 2XNIA 1WSSH 4NCYA 2Y7XA 1LQEA 4MPWA 1TPPA 1XVOA 3URDA 1GI9B 1GI0A 2ZFRH 4X6PA 4KGAA 1YGCH 3NZIA 4DIIH 2A31A 1BZXE 2EC9H 1TNJA 2WUBA 5GPIB 3U9AH 1SG8B 4WJG2 3M36A 5IDKA 1O2TA 3DT0H 4BAKB 1HRTH 2A32A 1TNKA 3SV7A 4FUJA 1GJDB 1G30B 5DPAA 2BDGA 1P2MA 1JIMA 4I31A 2BVSH 4WH6A 3LGVA 3U8OH 1XKAC 5JBTA 1OXGA 4Y0ZE 1DSTA 1Y5BT 4X1QU 5A8ZA 5HYOA 3RXKA 2ZA5A 2FODA 2BD5A 1V2NT 2O8UA 2TGPZ 3GY2A 3ZZ9A 3MHWU 1DICA 2BZAA 1V2WT 4B2AA 2XC0A 5C5OA 4NZLA 4Z0KA 3O8DA 2ZFFH 2AGGX 1WYKA 2Z3CA 2Y82A 5JDUB 1T4UH 3FVFB 3KL6A 1L2EA 3UIRA 5I25A 1HAVA 3TK5A 4YT6H 2SGPE 1K1NA 1IQFA 1EQ9A 1C9PA 3U8TH 1TQ7B 2THFB 5JBCS 1C5PA 1PPHE 1O30A 2RA0A 1RXPA 3UREA 2O9QA 2CF8H 3TJVA 5E8EH 1A5IA 1GL0E 1C2LA 3NK8A 1NO9H 2EA3A 3AAVA 2PGQB 1E36B 3SV6A 2HLCA 3M37A 2Z9KA 1IHTH 2YNBA 1UK3A 1HAVB 2FZZA 3ZZCA 1P3EA 1PPFE 1GL1A 3ELAH 1XKBC 2OINA 1WQVH 4IBLH 1GI4A 1C1UH 1FZZA 2EI7A 3RC4A 1PQ8A 1E35B 2AIPA 2XCNA 1H8DH 2UUJB 1A0JA 3STIA 1LCYA 4JYUH 2ZHWH 2BYAX 4X2VA 3LGUA 1QJ1B 1RRKA 1IQKA 4AB9A 2OQ5A 1H9IE 2V0BA 7GCHG 3AASA 4AGJA 1GJAB 3I29A 2O8WA 3ZVGA 1NFWA 3QZRA 4AG1A 4FUHA 1OKXA 4THNH 3SV2H 4Y8XA 3BTTE 1EZSC 3ZVBA 3GDSA 3UWIA 1O2LA 2FO9A 2ZFTA 3EYDA 1GMCF 3GY6A 2A45B 3CP7A 4GPGA 3RMNH 1BTZA 5FCKA 1YYY1 2FDAA 3M5MA 1K1PA 2F9PA 4FVBA 1ZPZA 3VB3A 1CA0C 1C2KA 1EX3A 2I6QA 1ZSLA 3SJ9A 7LPRA 1AE8H 1SC8U 3PMAB 1GJ9B 2G8TA 1DOJA 1GCTB 1MQ5A 1VGCB 2ZC9H 2PSYA 3SJIA 6CHAC 1QCPA 1MTNB 1EOJA 2CHAB 2SGEE 2ZPRA 2OTVA 2FOEA 1TX7A 4NSYA 4ABEA 1ZZZA 1TGSZ 3BEFB 2J95A 1C4V2 3PV4A 3EQ0H 3DFLA 4IN1A 1HJ8A 3D65E 5FCRA 1TMBH 2JETB 4ABGA 4YOJA 4ISLA 3MNCA 3TGKE 1YP9A 3QTVH 2ZIQH 3S9CA 1CA0B 1FPCH 3Q00A 4LZ1H 1SGDE 2ALVA 2QIQA 1MKWK 1S6FA 2BXUH 1Z8JB 2CMYA 2VNTA 3JZ2B 1VCQA 1TNHA 1YLCA 1D6WA 4ABFA 3UTUH 1EUFA 1AQ7A 1QBOA 1SFQB 3A82A 1GI8B 5EW1H 2C4FH 1ZSKA 2J94A 3ZZDA 1OWHA 2BLQA 3AW0A 3RXGA 1YPLH 5HM2A 3SW2B 4YM9A 4X0WU 3FZDA 1ZGVA 2WPHS 1GBHA 1O2ZA 2G4UA 1AKSA 4XSKU 4K8BA 3RLYH 1KLJH 1TALA 2AEIH 2BD7A 1TRYA 1TX8A 4I32A 2GGVB 1O5DH 3W94A 4HFPB 1JMOH 3GY3A 5T3HA 2QY0B 4X8SH 4BANB 1P06A 1LMWB 2XW9A 4FUBA 4NGAH 4BAHB 1BBRH 4ISOA 1V2QT 2HNTC 1XUHA 1IQIA 2BHGA 2P8OC 3TPIZ 3FZZA 1FMGA 1HJAB 1EP5A 1BDAA 2HVXA 1MAYA 4WXVA 2BVXH 2FOGA 2XBYA 5FXLA 3RXVA 5B6OA 3SNDA 1K2I1 1AKSB 2GX4A 3RXBA 2Y6TA 4YTAA 1CT0E 3GOVB 4AFZA 2QC2A 3Q76A 1Q3XA 1Z1JA 1ELGA 2EI8A 1DX5M 1ZTKA 4BTTB 2GCTC 4Y7BA 5C1XA 1DUAA 1TPSA 3V3MA 3GDVA 2PKAA 2ANKH 4XBBA 5H4IB 1O35A 3ZZ8A 1LVYA 4GHQA 1TPAE 2FM2A 4A7IB 3BTQE 3GCHB 5AFYH 4Q80A 2HWLB 3LKWA 4FU8A 2P59A 1IAUA 4KP0A 2C90B 2H1UA 3TH3H 2ODQA 1EB1H 3ZV9A 1IOEA 1CBWC 1EZXC 2GDDA 3PO1C 1G3BA 1O2WA 1DLKB 3IG6B 3F68H 3LC3A 4GLYA 4X1RU 1UO6A 2OXSA 3LPRA 4ISHH 2H5DA 4J1YA 1AE5A 2QXIA 2WYJA 2PKAB 2P3FH 1A5HA 1C1QA 2F91A 2WYGA 2B0FA 2QV1A 1ZMJA 2GCTB 1DITH 5GWZA 3TITA 2BLVA 4A1TA 3SU6A 1HAPH 2QXJA 2GT8A 1TX6A 1AO5A 4WMFA 2KAIA 2XBXA 2BD3A 1W0YH 1H1BA 1AFEH 2BDYA 3SUGA 1SBWA 1LVBA 3GCTG 1O37A 1ANEA 2R2MB 1EXFA 3RXIA 1C5YB 2ZU5A 3P8FA 4AN7A 1DWCH 1LTOA 3ATLA 1ZSJA 1ANDA 1SLWB 1ZRKA 4YLQH 2OUAA 1L1NA 1ID5H 1RIWB 3LGYA 4X2WA 4Q7YA 3UR9A 7GCHF 1ELVA 1GI1A 1Z6JH 1L1JA 2ZPQA 1WU1A 3SBKA 1MTSA 1QNJA 3HK3B 1O3GA 2PTCE 1EZQA 1ZHRA 3AVZA 1T8OA 2BQWB 3RC6A 1O32A 2BDIA 1Q31A 1MMJN 2H2ZA 1ZLRA 2FOMB 4NIWA 4B75A 4ZXXH 3SU2A 1P9SA 1PJPA 4DW2U 1C2HA 4TWWA 1KXFA 4OS4A 2ZFSA 2B9LA 3MU8A 1QA7A 1KXDA 1TONA 1UCYH 3U1IB 1LHGH 1DWEH 2A1DB 1DDJA 3M7QA 1PQ7A 2BX3A 1SLUB 3BEIB 3CS0A 2B7DH 2P16A 4MTBA 4CBOA 4CRCA 1S5SA 3M3SA 3RMLH 4K69A 1KY9A 3PLKA 4ASHA 3QO6A 3RXLA 1C5SA 1GVKB 1UTJA 1SB1H 2ZECA 2Z7FE 1ELFA 2C8YB 1HBTH 1TA6A 1V2LT 1D3DB 3RXCA 1AZ8A 1OWEA 2CV3A 3C27B 4CBNA 1W11U 1FXYA 3RXRA 5GCHF 1KDQB 1AVWA 3K65B 3NXPA 5EW2H 3M7UA 1JWTA 1OS8A 2FP7B 4ABHA 1CHOF 2ZHFH 2GMTC 5EU8A 1FIZA 3O8BA 1Y5UT 4NFEA 3K6ZA 1ELDE 1FAXA 1C5NH 4NZQA 1TWXB 5A8YA 1OP0A 3SU0A 1FV9A 2A7CA 5C3NA 1T32A 5EXNA 1ESTA 4I8KA 3T25A 5PTPA
chains in the Genus database with same CATH superfamily
1GCDA 2VBCA 3DA9B 4MNWA 3RU4E 3U69H 4DIHH 1HYLA 2AIQA 2BDCA 3D23A 1Y8TA 3SNAA 3SN8A 5LPEA 3P8NA 2F9OA 1MZAA 1NFYA 2ODYB 1GBJA 4A5TS 2UUFB 2WV4A 1YPKH 1WV7H 1GJ7B 2J92A 2UWOA 1NY22 4FUCA 1RJXB 1W13U 2H6MA 2FESH 4KTCA 3RMMH 1F0RA 3F2HA 3SGQE 3GCOA 1P2NA 1FY1A 1LPKB 3FAOA 5HM9A 5G4BA 1FY3A 1UTPA 2DUCA 2D8WA 4FUGA 1PQAA 3KQEA 1XVMA 2VU8E 4K1EA 2G51A 4O9VA 1OWKA 4D7FA 3PMBB 5T6DA 1P02A 3PRDA 1SVPA 2ZGJA 2HNTE 4NA7A 3MMGA 2IOTA 1H8ED 1NC6A 3U98H 3QWCH 1AWFH 4Y8ZA 3CENA 1O2SA 1XXFA 3M35A 1H4WA 2W3IA 2OCVB 3QN7A 4TY7A 2HVYB 1NRRH 1F2SE 1AMHA 1S6HA 2ZFPH 3A83A 3E16B 1QB9A 5JPMH 1HXEH 1T4VH 3VXFH 2AFQB 1WOFA 3M3TA 5TJXA 3VGCC 3H7TA 1LKAA 5EQQA 4ZCNA 1ABJH 2A4RA 5F8ZA 2ILNA 5A8XA 5C67A 1A7SA 9ESTA 3N7OA 3P8OA 1YPMH 1S81A 1B5GH 1AGJA 2YOLA 3UQOA 3VB7A 1MCTA 4X8VH 5ABWA 1O3KA 1GGDB 1KXCA 3BTWE 4WXIA 1LHDH 1H8IH 3UY9A 1HAOH 3ZZ4A 5DP7A 3W1EA 5EPYA 1TOCB 1VJ9U 4H4FA 2ESTE 1AFQC 4B1TA 3D62A 1B7XB 1M9UA 5CHAB 1Z71A 1JRSA 1CO7E 2G5VA 3OY6U 5C20A 2BY9X 1ORFA 1S83A 1O2OA 1SMFE 5J4QA 4A6LA 4YO9A 4I8JA 5EOKA 1BQYA 1CE5A 3RXPA 3MU5A 1D9IA 5EXLA 2PWXA 3PLBA 1TGNA 3PB1E 3Q3YA 1SQRA 4Q7XA 1Y5AT 2PGBB 3LU9B 4QT8C 3QLPH 4GHTA 4B2CA 2FOHA 9LPRA 3TK6A 1AD8H 1TA2A 4BAMB 2BD9A 4E7RG 3QDZB 6ESTA 1A1RA 3OX7U 1JIRA 4NA8A 3SI4H 3OSYA 1UTNA 5DKMA 3GCTF 1EAUA 1GI3A 1GI7B 2UUYA 2Z3EA 1W2KH 3F9GA 3FP8E 2Y5HA 5EXMA 4YT7H 2P3UB 1J16A 4MPXA 1SSXA 2A5IA 3TNTA 1C5WB 5AF9H 1O2VA 2GZ7A 4B76A 3M5LA 3B23B 3TVJB 1LHEH 1NFXA 1YCPM 1S82A 1T8NA 3VB6A 1BTYA 1GDUA 2GZ9A 1IQNA 1C5LH 2J5UA 1HFDA 1GBDA 4F48B 1W0ZU 1CGIE 1UTMA 2BX4A 1RD3B 1DVAH 2BLOA 1MH0A 1KYNA 5IYTA 2FLBH 2ZEBA 1HXFH 1VCPA 5FX5A 1C2GA 1O39A 4SGBE 1MTUA 2JH5D 2Q6DA 2ZKSA 1NBMD 6LPRA 3LT3A 3O8RA 1IQGA 2JH0D 3MH5A 1TABE 1CGJE 1UVSH 2G81E 1GJBB 4K5ZA 1GHZA 5EQRA 4F55A 2J38A 1E79D 4U32A 3NCLA 3RMOH 1RFNA 1H9HE 1HAHH 3QGJA 5HGGA 1FONA 1AN1E 5JYIA 1UTLM 3DCLA 2VB0A 2F9NA 2ZU2A 1KXEA 1O2GH 1J14A 2QCYA 2SGAA 1KSNA 1HB0B 4XFQA 1C4U2 2BD8A 2AHME 1OYQA 2CF9H 4H42U 1BBRE 3A7VA 1BTPA 1SGEE 1GBBA 3MH6A 4CR5A 3WWBA 4OS6A 4FU7A 2GV6A 4RT0A 1G2MA 2AGEX 1SGTA 3EA7A 2Y5FA 1DT2A 2WUCA 4A92A 2BM2A 2BD2A 2Y81A 2EI6A 2J9NA 3B8JA 1O3JA 4RKOB 1K1LA 5A0CA 3BTFE 1C5RA 1ZMNA 1SHHB 3AAUA 3MU1A 5LH8A 4AFUA 4AGKA 2ZQ2A 1GG6C 4ZH8A 1KMHB 1PPCE 3TLOA 2ZGXH 2TGAA 3AK5A 4HG6A 2V3HH 1BITA 3DFJA 3MQKC 1C2MA 1EATA 1YWUA 2R3YA 2ZCHP 1Y3YA 2VIVA 2J97A 2NU0E 2OC1A 4P02A 1HCGA 4TPIZ 3Q3XA 4XE4A 4UFEH 1CT4E 5FX6A 4K3JA 1HNEE 1BMAA 1VR1H 4UDWH 5DK1A 4DT7B 1FLEE 4JYTA 2ANYA 3PRBA 1O3CA 1BOQA 1NRQH 1S84A 4UD9H 1V2PT 4AG2A 4WMEA 3AW1A 3RUOA 1SGQE 1WCZA 5AVDA 1QL8A 5JB8S 1C5UA 2ZDKA 3K2UA 1DUEA 2ZGCA 3A7TA 3MNBA 2OC8A 1VITH 3MNXA 2QYIA 1LDTT 3EAJA 1W7GH 3SQHE 3VB5A 3K9XB 1CT2E 2A5AA 1ELAA 4LOYH 4OM9A 1EP6A 2Y7ZA 2BY6X 2EQNA 1NS3A 4NWLA 1FNIA 2BXTH 2H9HA 1WTGH 2GP9B 4HI3A 3HPTB 3SNEA 4JK5A 2ZQ1A 1P05A 4UFDH 1AB9C 1SGRE 4GUXA 4YLUA 3GY7A 3A85A 2Q6FA 3ZVCA 3N7EA 1GHAG 3N99A 4CH8B 1EASA 1O2KA 2ZGHA 3HK6B 2A0QB 1H9LB 3MH7A 4Y8YA 1G2LA 2VH6A 2ZHQH 4MQAA 2W26A 2VWMA 4HTCH 4B71A 1PPEE 4FUDA 4UE7H 3SU1A 2LELA 1KTSB 1TMTH 3OU0A 2NU3E 1QB6A 5EGMA 1NZQH 5L6NH 5DGJA 3UB0A 1DS2E 1UK4A 2SGDE 3TGJE 3HKJB 3RXEA 1V2TT 1UVUH 1GBMA 1YCPH 3ODDA 2XC5A 3RU4T 4GAWA 1AZZA 1LHFH 1O5BB 1O2QA 2SGFE 1TOMH 3RXSA 1TGTA 5GCHG 3G01A 2FI3E 2JKHA 3BG4C 1GBTA 1TNGA 2KCAA 1P10A 1NM6A 3RXMA 3JZ1B 4JZDH 1CHOG 5JBBS 1O36A 1BMNH 1P2QA 2OLGA 1Y3UA 4CHAC 1O3PB 1V2ST 4OGYA 1SPJA 4JYVH 1HAZB 4XBDA 1OX1A 1EOLA 1V2VT 6CHAB 1SGIB 1GBCA 3ITIA 1KXAA 5GJ4B 5TCCA 5SGAE 4ZKNU 1TAWA 3SORA 3A89A 1KLIH 3FANA 4X1PU 3E1XB 4FUEA 2P3TB 1QFKH 2BTCE 1VZQH 3D49H 1OP2A 4O3UA 1F92A 2HPQH 2OP9A 5A09A 1V2OT 1N8OC 1TPOA 1GI6A 2QGRA 3BG4B 4CH2B 1ETSH 4I86A 3FP6E 1P12E 4OS7A 3BTKE 2G52A 1QJ6B 4AZ2B 2PP6A 3OYPA 3SHAH 2BDAA 1P09A 3P95A 3UOPA 4CHAB 1RTKA 2GTBA 3ESTA 3HKIB 1P04A 3L6PA 3SUDA 1O3FA 1WAYB 5F53A 1MABB 4ZKRU 4ABDA 1UK2A 5T6FA 3S0NA 1HAYB 4INKA 1LQDB 3UOUA 1Q2WA 1O3HA 1C9TA 4FETA 1ZPBA 1BJUA 2XBWA 4CRGA 1K1MA 1N1LA 2UUKB 1BMMH 1CHGA 2AERH 5A2MH 2ZU3A 1DPOA 1BTUA 1OWJA 2FI5E 4YESB 1HLTH 2PKSC 1MD8A 1O34A 1C5MD 3LGTA 2C3SA 4OS1A 1ZYOA 3RXJA 5EJ1A 5JBAS 5TCAA 1C2IA 1O5GH 1QB1A 1O2NA 1QRZA 1LKBA 1TB6H 3A80A 2F83A 2ZWLH 5C0UA 2RDEA 1QA0A 3GY8A 3OAAD 1LO6A 1NRPH 1PYTC 2P8OB 3RXOA 1ETRH 2ZCLP 1ZRBA 1O5EH 2M5TA 1KXBA 1FY4A 2ZDLA 4JMYA 4Q7ZA 2FYQA 4O3TA 1C5VA 3SNCA 2D26C 3RLWH 2RG3A 3M3VA 1XM1A 1MAXA 2TBSA 1X7AC 3B9FH 5DP4A 1O2RA 1TIOA 4TSFD 1T8MA 1EPTC 1OHHD 1W10U 1ZTLA 1O3LA 3TGIE 1YPEH 1YPHC 3A86A 5F8TA 1B0EA 1GHWH 3O8CA 2VIOA 1Z6EA 3NKKA 1IHSH 4JCNA 2IPQX 2BMGB 1CBWB 1EAXA 2GJGA 4FUFA 1GHYH 1ACBE 1YM0A 1TBQH 2ZFQH 3PO1B 5F8XA 4DJZB 1K1IA 2PLXA 2ZP0H 1EAWA 4I33A 2TGTA 1GBFA 1MUEB 1YPJH 4AORA 4TY6A 4R0IA 4Y71A 1C1RA 3M61U 1GJCB 1HPGA 3F1SB 3SUFA 2ZTZA 4D9QA 5FBEA 3MNSA 1LVMA 1S0QA 4JZIA 1RGQA 4IC6A 3A8AA 3N7DA 3KN2A 1TRMA 4Y0YE 4LZ4B 1Y3VA 3I77A 1T7CA 2KX4A 2FX4A 2XCFA 2Z6BD 4IMZA 3ZZBA 4MVNA 3LH3A 5DP8A 1O31A 2AYWA 1SI5H 1GHAF 1GDNA 3KCGH 1D3PB 3ATMA 3OTJE 1KDQA 3EDXB 1WTHD 8GCHG 3LGWA 1A0LA 2HPPH 5K0HA 3U8RH 3A7WA 1Y3XA 4PROA 1V2RT 5A0AE 1FJSA 1O3BA 1SGYE 3LJJA 1Z8GA 4OGXA 3VXEH 1ABIH 2HNTF 2A2XH 1BTHH 1BHXB 4J2YB 1BBRK 2FOBA 1DY8A 4ESTE 1HAGE 4Q2KA 4I7YH 1K21H 1F0SA 1QRWA 4SGAE 1TYNA 4RSPA 2WPMS 1NFUA 2FX6A 1FDPA 5DP6A 1ZMLA 3LH1A 7KMEH 1GHBG 1C1TA 5FPYA 5DG6A 1GMDG 3MO6A 1V2JT 1K22H 4AB8A 3OE7D 3SV8A 1GVLA 5J4SA 4YOIA 2ZU1A 3SGBE 5E0GA 4DOQA 1TGCA 1C2JA 3A84A 5FPTA 3T62A 1ARBA 1WUNH 1YC0A 5BRRE 3SU3A 3E0PB 1P57B 2PUQH 1VJAU 2OD3B 3A87A 5L2ZH 2G4TA 4E05H 5EPNA 3VG8A 1YLDA 4Y6DA 1V2MT 2ZDMA 2AS9A 5E2PA 3IITA 3SUEA 2CGAA 8LPRA 1P03A 2ZHDA 3VEQB 3F9EA 4LXBH 4MPUA 3MOCA 3S9AA 3Q3KA 2O8LA 3GICB 2R2WU 3SI3H 1BRUP 3S7HB 2P93A 2AMDA 4DGJA 3ZVAA 1SGPE 3M5OA 3ZVEA 1OYTH 4MG3A 2O8TA 1HAIH 1SL3A 1FY5A 2GCHG 2VGCC 3UPEA 3RM2H 2GMTB 1GBLA 1O5CB 3ENSB 2GD4B 2RA3A 3TH4H 2FLRH 1C1OA 1G3DA 4ZKOU 4FVDA 1ETTH 4RI0A 5ESTE 1EZUC 1P11E 4OS5A 4NSVA 1QBVH 2VWLA 1GJ6A 1YBWA 1XUGA 1MBQA 2FEQH 2QAAA 3BIVH 1MKXK 2JIZD 2A4GA 1E34B 1UTKA 2ZZUH 4D8NA 2OBOA 1J9CH 1PYTD 1JRTA 2DE8A 5ETXA 1DWDH 2TIOA 1K1JA 1U6QA 3UUZA 1L4ZA 1QQ4A 1GJ8B 3ZZ7A 5DP3A 1JBUH 1MD7A 4ISNA 1PFXC 4NFFA 5DJ7A 2VGCB 5LGOA 1TBZH 3RM0H 3BN9A 3A8CA 2BVRH 1G3CA 2STAE 3KYGA 3PMJA 4TYDA 5I46H 2J4IA 1EB2A 3BF6H 2B8OH 5EIYA 2XBVA 3V7TA 3P92A 2W5EA 3DD2H 5F6MA 1THPB 1ZGIA 4KELA 1GPZA 4ABAA 4ZHMU 2IPHA 1UCYK 1P3CA 5C5NA 1QHRB 2BOHB 1G3EA 2ZO3H 3PYHA 4H6TA 1CU1A 4I8HA 1L4DA 1F5LA 2H9TH 1ELCA 1QL7A 3U28C 5EQSA 3HATH 4DURA 1ANBA 2OC0A 1L0ZA 1IQHA 4NA9H 8ESTE 3RXDA 3TJOA 1C5QA 1ELBA 2JJ2D 2V6NA 4D9RA 2A5KA 2XC4A 1C5TA 4TWYA 3KQBA 3VGCB 3GDUA 3F0OA 4KKDA 1YF4A 1YPGH 1SOZA 3PV5A 1O2HA 1GI5A 3VPKA 1YPHE 3HGNA 1FX0B 2BY8X 3E90B 2GVFA 4UFFH 4XD7D 2QXGA 1P2KA 4X6MA 3M7TA 1MQ6A 1UMAH 1C1WH 1IQLA 3A81A 1J8AA 3QZQA 4WVPE 2KCPA 1GBEA 3Q77A 1AFQB 3STJA 1C1VH 4CRDA 3EGKH 3TNSA 1O3OA 3BTME 3T2NA 1NT1A 3PMHB 4F49A 1ZR0A 1FY8E 1L1GA 1GBAA 1IQMA 1ZJKA 2BQ6B 2WINI 3KF2A 4BXSA 4Y11E 2ZDVH 4A1XA 2RDLA 4GSOA 4B6FA 1P2IA 3I78A 1IQEA 4IN2A 3SYJA 1K9OE 2NU2E 2DE9A 4DG4A 4O03A 2J2UA 4KTSA 1SOTA 1KTTB 4ZKSU 4AOQA 5K7RA 3PWBA 3P70B 3SJOA 2BY7X 8GCHF 2C93B 1E1RD 2Z9IA 1SLVB 3MWIU 2QA9E 1OSSA 3P17H 4ZXYH 2GKVE 1V2UT 4DVAU 5DP9A 2ANMH 4MNYA 4AFSA 5KEDA 1D3TB 2KFWA 1AHTH 1PPGE 1OWDA 1XMNB 4JK6A 1BJVA 3W95A 2G00A 4IW4E 2QF0A 1TQ0B 1C2DA 5GXPA 4X2YA 1C2EA 3MO9A 1NBME 4LK4A 1GHBF 3GISB 4OS2A 3QTOH 1INCA 1GMDF 2K8IA 2WV5A 2ZG0H 4O97A 4WH8A 3R3GB 3KQCA 2FOAA 1E37B 2VJ1A 3F9FA 3DSPA 3KQ5A 5HMAA 1K0HA 2BOKA 2A4OA 4BAOB 2RFKC 2YMSC 2Y80A 4ZHAA 1Y59T 2GV7A 2GZ8A 4NG9H 1O2UA 4YXWD 3K6YA 3LIWA 1MKWH 3VB4A 3BG8A 1BMFD 2AH4X 3RP2A 4UONA 2XNDD 3C1KA 1PPZA 1A61H 4M7GA 2R9PA 3PM3A 1FUJA 2QF3A 5C1YA 2F3CE 1A5GH 2IN2A 3SQEE 5CE1A 3KEEA 5AHGH 3BIUH 1P8VC 3SJ8A 1CVWH 1F5KU 1GVZA 1P9UA 1YKTA 3L33A 3TH2H 2W6ID 2ZU4A 4U30A 3VFEA 4AX9H 4BTUB 4BNRA 1FIWA 1GMHG 3LJOA 4RN6A 1C1MA 3CS7A 1S85A 3RXTA 1Z7KA 1A3BH 3BTEE 3PWCA 4CREA 3ATIA 4P00A 2FPZA 2W7SA 2GCHF 3ZVDA 4A1VA 2ZTXA 1TNIA 2BDHA 2ZDNA 1GG6B 3SO3A 1UTOA 3BTGE 3TJNA 1A2CH 2XWAA 2O8MA 1N6XA 2VIQA 1SGCA 2ASUB 2IJD1 1E0FD 2YNAA 1JOUB 1YLNA 2VWNA 2H9EH 1OWIA 4I8LA 3E6PH 1TRNA 2J34A 2VH0A 2QN5T 2R0KA 3UFAA 3MFJA 4X8UH 2WPIS 1F0UA 2A4QA 1E1QD 3T27A 1AI8H 2FI4E 3UR6A 1QY6A 1GCTC 4MDSA 1TE0A 1VGCC 2ALPA 1LVOA 2AMPA 1MTNC 2XTTB 3E3TA 4UFGH 2PHBA 2Q6GA 3MH4A 1BRAA 3MO3A 4TPYA 1MU6B 1ELTA 2XWBI 1V3XA 4JZ1A 4U01A 4WMDA 2CHAC 1G36A 3LC5A 3ZZAA 1XXDA 2ANWA 2FWWA 3V0XA 1F7ZA 3SHCH 4DY7B 2FOFA 3FN8A 2FXRA 2HOBA 5E0HA 2QXHA 1NRSH 4Y10E 1SLXB 4ABJA 1DXWA 4ZROA 3S7KB 2JETC 1G9IE 2SNWA 2HGTH 1BCUH 1QL9A 3F9HA 1ARCA 3ZVFA 5C2ZA 3RXHA 1ZHMA 2C8ZB 4Z6AH 1UCYE 4Y7AA 1O2PA 1VITG 3ZZ6A 1KIGH 2VINA 4UEHH 4DCDA 1AB9B 4H6SB 3SZNA 1EAIA 5E2OA 2FYRA 1UTQA 1Z8IB 2D2DA 2PFEA 1JXPA 4MNXA 1O3IA 1SR5C 3TJUA 3T5FH 2AGIX 2SFAA 1O0DH 3V13A 2NWNA 5HIYA 1AUJA 5C94A 2BD4A 1O3NA 1ZPCA 5E0JA 2VIPA 1SQAA 3MU0A 3RC5A 4XDEA 4AYVB 1HJ9A 4X8TH 5BPEA 3A88A 2FS9A 1HAXB 3EA8A 1C2FA 1C5XB 1RTFB 4AFQA 2PW8H 1TNLA 3UNSA 3P8GA 1CQQA 5GIBA 5L30H 4GVUA 1UHBA 3A7ZA 2UWLA 1DLEA 2Z9LA 4JZFH 1NRNH 2CJIA 3A7YA 1O38A 3TK9A 2G55A 2ZI2H 4YZUA 1Z1IA 3EE7A 2QF4A 2AMQA 2FMJA 4MLFB 3GY5A 2A7JA 1HJAC 3F3BA 3ODFA 2NU1E 4GCHG 2F9VA 3FP7E 1GJ4H 2OBQA 3FFGA 3BTHE 3E8LA 2SGQE 3LDXH 3PTBA 1A3EH 1NESE 1QR3E 1CSOE 1FI8A 1SFIA 4CRAA 4I8GA 4WY3A 3R0FA 1ESBA 1A0HB 2PTNA 2ZDAH 1BIOA 1UHBB 1A4WH 1C1NA 1TLDA 3KYFA 2FOCA 1UW7A 2YMSD 4XRNA 1J17T 1OP8A 1K1OA 3NPSA 1YY3A 3GCHC 3GS9A 1N8OB 1LPGB 1MCVA 3MYWA 4ABBA 2OQUA 2FS8A 1EJNA 2B5TB 1SHYA 1D3QB 3RXFA 3ATKA 2L6OA 3UAIC 4B2BA 2CXVA 3LGIA 3MU4A 3GYMA 2Q1JA 2V35A 4INLA 1BRBE 2XXLA 4F4OC 2ZF0H 4MPVA 2BLWA 2Z94A 1C1PA 1FAKH 3E91A 3NUMA 2P94A 4Q63A 1NPMA 2WPDD 3LOXA 3ZYDA 1TMUH 1O2MA 6GCHG 1RTLA 1O2JA 3F6UH 5EG4A 3URCA 1K28D 2A7HA 1DM4B 5ESBA 1QJ7B 1BMLA 2ZHEH 5FPSA 3QK1A 3EE0B 2C8WB 3UQVA 8KME2 5EJZA 1O33A 2D1JA 4X6NA 2XYAA 2BY5X 3OEHD 1BTWA 1J15A 1QIXB 5T1VA 1P0SH 3F2GA 2CK3D 4ACBA 4D7GA 2L74A 3BV9B 1ZJDA 2VVCA 1C5ZB 1V6DA 2PKSB 3ZYEA 1MU8B 2V3OH 1XUFA 2ZNKH 3BEUA 4DT4A 4AYYB 1YCPK 4WF8A 1CGHA 1LHCH 5FHTA 2KCOA 3RXUA 1GHVH 1FN6A 3PROA 2KCYA 2XRCA 1O2YA 4K8YA 2A2QH 3UWJH 1GI2A 4CRFA 3LONA 1QRXA 1MBMA 1RIWC 2ODPA 1AVGH 1TFXA 3T29A 1EPTA 3L3TA 2TRMA 3HGPA 1F0TA 2UWPA 1GMHF 2ZGBH 1WXRA 1VCWA 1ESAA 4Y79A 1HV7A 2IJOB 1ZTJA 2FTMA 3ZV8A 1SQTA 1NROH 2BZ6H 3M5NA 2BB4A 1PQ5A 1HUTH 3S9BA 2JH6D 4CRBA 1AIXH 1KLTA 4B74A 3RXQA 4XOJA 3GYLB 1XUKA 1HDTH 1V2KT 1MKXH 3GCNA 3SGAE 2PUXB 3SV9A 3QGNB 1XUJA 3V12A 1EPTB 5B6LA 4X6OA 5DO4H 4ACAA 1AWHB 3T26A 3E0NB 3MTYA 1DSUA 1IQJA 2WPLS 1THSH 3KIDU 4ISIH 1FQ3A 2K0QA 4IS5A 1C1SA 4K1TA 5F03A 1NTPA 1WBGB 4ZMAH 5CMXH 1NU7B 2Z3DA 2PV9B 3WY8A 2KAIB 5JB9S 4XBCA 1G37A 4KTUA 3GY4A 1QZ8A 2PR3A 2HLDD 4NIYA 1XX9A 2K1QA 1GBIA 2LP6A 2FIRH 1WDIA 4RKJB 1T8LA 5EODA 2R0LA 2WPJS 3A8DA 4NIVA 1O2XA 3A7XA 1TGBA 5HXFA 3ZZ3A 3PLPA 1BTXA 2BQ7B 2BDBA 2LPRA 1VITF 1UVPA 5L2YH 3QX5H 1D4PB 3U1JB 1B0FA 1W7XH 2EEKA 3KNXA 1O5AB 1EJMA 5KECA 1SGFG 1O3EA 4X1SU 4K1SA 5FBIA 1E38B 3S69A 2TGDA 1EFRD 1HIAA 1QQUA 2ZTYA 1GWAA 3T28A 1UVTH 3DUXH 3RU4D 4IGDA 4B6EA 5T6GA 1S0RA 3IWMA 1AUTC 4NWKA 4YOGA 2HRVA 1O3MA 1W8BH 4ZHLU 1MZDA 1P2OA 1C4Y2 3FOAA 2Z9GA 2G5NA 1AU8A 2VVUA 4ZAEA 2GT7A 3RDZA 1AVXA 3KQDA 1O3AA 4R8TB 1GBKA 1HIAB 1O2IA 3BTDE 3EA9A 2VWOA 1QGFA 3OY5U 2Z9JA 3KGPA 1GHXH 3KHVA 3H7OA 3SU4A 5LPFA 4MNVA 4VGCC 2W7UA 4GCHF 1BA8B 3F0PA 1GJ5H 1MTVA 1FPHH 5A0BA 2NU4E 5FAHA 3P6ZB 2F9UA 1ANCA 1VKYA 1W12U 1MTWA 2GDEH 4ZUHA 3QUMP 3RXAA 1BT7A 1O3DA 2EY4C 1DWBH 4HGCA 2ULLA 2P95A 4FXGH 3H5CB 1BHXF 4ABIA 4JZEH 2W6JD 1ELEE 2ZPSA 1HGTH 5LPRA 3FKSD 4BXWA 2FTLE 4FU9A 1DE7H 1Y3WA 3ZZ5A 3NWUA 1THRH 1W0KD 2RCEA 3BSQA 2W3KA 1GGDC 1W14U 5IK2D 4BAQB 3SNBA 2HALA 5DP5A 3TU7H 4X2XA 1T31A 2LNCA 4VGCB 1GMCG 1OOKB 1EKBB 2OC7A 4INHA 1ZOMA 1G32B 2WHXA 3UNQA 3ATWA 2Y5GA 4CR9A 1TBRH 4NIXA 5CHAC 2R3UA 1OPHB 1UJ1A 1SGFA 1SQOA 6GCHF 2WPKS 4X1NU 1P01A 1CA8B 4E7NA 3A8BA 2QF5A 7ESTE 1DANH 3TIUA 2JDID 4IC5A 1QBNA 5GDSH 1XUIA 1DFPA 4BOHA 1A46H 1BUIA 5AFZH 1DY9A 1PPBH 1GDQA 2KM0A 4WWYA 4K60A 1BB0B 4D76A 1P2JA 2I6SA 3MI4A 2VIDA 4K2YA 2JJ1D 3UNRA 4Y76A 1LPZB 1QURH 2CN0H 2TPIZ 2VIWA 5HIZA 1EJAA 1NU9A 4E06H 1D6RA 2SNVA 5C1UA 1FN8A 1AY6H 3DHKH 1WQSA 2C8XB 2H5CA 3WW7A 1RS0A 1W3CA 4HZHA 2VVVA 1Z8RA 2F9BH 4B73A 2STBE 4FUIA 3PTNA 4U2WA 3DSOA 1O5FH 3SOSA 1UVOA 4IMQA 1F5RA 3NRLA 1BRCE 1C5OH 1SGNE 1ZHPA 1N6YA 1DXPA 1QTFA 2ZCKP 1NN6A 4BTIB 3H09A 3SJKA 2PSXA 2XNIA 1WSSH 4NCYA 2Y7XA 1LQEA 5DN6D 4MPWA 1TPPA 1XVOA 2M2AA 3URDA 1GI9B 1GI0A 2ZFRH 4X6PA 4KGAA 1YGCH 3NZIA 4DIIH 2A31A 1BZXE 1SKYE 2EC9H 1TNJA 2WUBA 5GPIB 3U9AH 1SG8B 4WJG2 3M36A 5IDKA 1O2TA 3DT0H 4BAKB 1HRTH 2A32A 1TNKA 3SV7A 4FUJA 1GJDB 1G30B 5DPAA 2BDGA 1P2MA 1JIMA 4I31A 2BVSH 4WH6A 3LGVA 3U8OH 1XKAC 5JBTA 2WSSD 1OXGA 4Y0ZE 1DSTA 1Y5BT 5CHBA 4X1QU 5A8ZA 5HYOA 3RXKA 2ZA5A 2FODA 2BD5A 1V2NT 3OTPA 2O8UA 2TGPZ 3GY2A 3ZZ9A 3MHWU 1DICA 2BZAA 1V2WT 4B2AA 2XC0A 2OK5A 5C5OA 4NZLA 4Z0KA 3O8DA 2ZFFH 2AGGX 1WYKA 2Z3CA 2Y82A 5JDUB 1T4UH 3FVFB 3KL6A 1L2EA 3UIRA 5I25A 1HAVA 3TK5A 4YT6H 2SGPE 1K1NA 1IQFA 1EQ9A 1C9PA 3U8TH 1TQ7B 2THFB 5JBCS 3F2FA 2KR7A 1C5PA 1PPHE 1O30A 2RA0A 1RXPA 3UREA 5C0TA 2O9QA 2CF8H 3TJVA 5E8EH 1A5IA 1GL0E 3DSGA 1C2LA 3NK8A 5GNDA 1NO9H 2EA3A 3AAVA 2PGQB 1E36B 3SV6A 2HLCA 3M37A 2Z9KA 1IHTH 2YNBA 2YMSB 1UK3A 1HAVB 1S6LA 2FZZA 3ZZCA 2V7QD 1P3EA 1PPFE 1GL1A 3ELAH 1XKBC 2OINA 1WQVH 4IBLH 1GI4A 1C1UH 2J98A 1FZZA 2EI7A 3RC4A 1PQ8A 1E35B 2AIPA 2XCNA 1H8DH 2UUJB 1A0JA 3STIA 1LCYA 4JYUH 2ZHWH 2BYAX 4X2VA 3LGUA 3SZEA 1QJ1B 1RRKA 1IQKA 4AB9A 2OQ5A 1H9IE 2V0BA 7GCHG 3AASA 4AGJA 1GJAB 3I29A 2O8WA 3ZVGA 1NFWA 3QZRA 4AG1A 4FUHA 1OKXA 4THNH 3SV2H 4Y8XA 3BTTE 2J98B 1EZSC 3ZVBA 3PV2A 3GDSA 3UWIA 1O2LA 2FO9A 2ZFTA 3EYDA 1GMCF 3GY6A 2A45B 3CP7A 4GPGA 3RMNH 1BTZA 5FCKA 1YYY1 2FDAA 3M5MA 1K1PA 5HKKD 2F9PA 4FVBA 1ZPZA 3VB3A 1CA0C 1C2KA 1EX3A 2I6QA 1ZSLA 3SJ9A 7LPRA 1AE8H 1SC8U 3PMAB 1GJ9B 2G8TA 1DOJA 1GCTB 1MQ5A 1VGCB 2ZC9H 2PSYA 3SJIA 6CHAC 1QCPA 1MTNB 1EOJA 2CHAB 2SGEE 2ZPRA 2OTVA 2FOEA 1TX7A 3CNRA 4NSYA 4ABEA 1ZZZA 1TGSZ 3BEFB 2J95A 1C4V2 3PV4A 3EQ0H 3DFLA 4IN1A 1HJ8A 3FO8D 3D65E 5FCRA 1TMBH 2JETB 4ABGA 4YOJA 4ISLA 3MNCA 4FOUC 1YP9A 3TGKE 2F43B 3QTVH 2ZIQH 3S9CA 2XOKD 1CA0B 1FPCH 3Q00A 4LZ1H 1SGDE 2ALVA 3OFND 2QIQA 1MKWK 1S6FA 2BXUH 1Z8JB 2CMYA 2VNTA 3JZ2B 1VCQA 1TNHA 1YLCA 4RT1A 1D6WA 4ABFA 3UTUH 5CDFE 1EUFA 1AQ7A 1QBOA 1SFQB 3A82A 1GI8B 5EW1H 2C4FH 1ZSKA 2J94A 3ZZDA 1OWHA 2BLQA 3AW0A 3RXGA 1YPLH 5HM2A 3SW2B 4YM9A 4X0WU 3FZDA 1ZGVA 2WPHS 1GBHA 1O2ZA 2G4UA 1AKSA 4XSKU 4K8BA 3RLYH 1KLJH 1TALA 2AEIH 2BD7A 1TRYA 1TX8A 4I32A 2GGVB 1O5DH 3W94A 4HFPB 1JMOH 3GY3A 5T3HA 2QY0B 4X8SH 4BANB 1P06A 1LMWB 2XW9A 4FUBA 4NGAH 4BAHB 1BBRH 4ISOA 5EJLA 1V2QT 2HNTC 1XUHA 1IQIA 2BHGA 2P8OC 3TPIZ 3FZZA 3OEED 1COWD 1FMGA 1HJAB 1EP5A 1BDAA 2HVXA 1MAYA 4WXVA 2BVXH 2FOGA 2XBYA 5FXLA 3RXVA 5B6OA 3SNDA 1K2I1 1AKSB 2GX4A 3RXBA 2Y6TA 4YTAA 4AC9A 1CT0E 3GOVB 4AFZA 2QC2A 3Q76A 1Q3XA 1Z1JA 1ELGA 2EI8A 1DX5M 1ZTKA 4BTTB 2GCTC 4Y7BA 5C1XA 1DUAA 1TPSA 3V3MA 3GDVA 2PKAA 2ANKH 4XBBA 5H4IB 1O35A 3ZZ8A 1LVYA 4GHQA 1TPAE 2FM2A 4A7IB 3BTQE 3GCHB 5AFYH 4Q80A 2HWLB 3LKWA 4FU8A 2P59A 1IAUA 4KP0A 2C90B 2H1UA 3TH3H 2ODQA 1EB1H 3ZV9A 1IOEA 1CBWC 1EZXC 2GDDA 3PO1C 1G3BA 1O2WA 1DLKB 3IG6B 3F68H 3LC3A 4GLYA 4X1RU 5C17A 1UO6A 2OXSA 3LPRA 4ISHH 2H5DA 4J1YA 1AE5A 2QXIA 2WYJA 2PKAB 2P3FH 1A5HA 1C1QA 2F91A 2WYGA 2B0FA 2QV1A 4TT3D 1ZMJA 2GCTB 1DITH 5GWZA 3TITA 2BLVA 4A1TA 3SU6A 1HAPH 2QXJA 2GT8A 5FL7D 1TX6A 1AO5A 4WMFA 2KAIA 2KZ4A 2XBXA 2BD3A 1W0YH 1H1BA 1AFEH 2BDYA 3SUGA 1SBWA 1LVBA 3GCTG 1O37A 4Z1MD 1ANEA 2R2MB 1EXFA 3RXIA 1C5YB 2ZU5A 3P8FA 4AN7A 1DWCH 1LTOA 3ATLA 1ZSJA 1ANDA 1SLWB 1ZRKA 4YLQH 2OUAA 1L1NA 1ID5H 1RIWB 3LGYA 4X2WA 4Q7YA 3UR9A 7GCHF 1ELVA 1GI1A 1Z6JH 2V3MA 1L1JA 2ZPQA 1WU1A 3SBKA 3WWFA 1MTSA 1QNJA 3HK3B 1O3GA 4ASUD 2PTCE 1EZQA 1ZHRA 3AVZA 1T8OA 2BQWB 3RC6A 1O32A 2BDIA 2WZQA 1Q31A 1MMJN 2H2ZA 1ZLRA 2FOMB 4NIWA 4B75A 4ZXXH 3SU2A 1P9SA 1PJPA 1H8HD 3SU5A 4DW2U 1C2HA 4TWWA 1KXFA 4OS4A 2ZFSA 2B9LA 3MU8A 1QA7A 1KXDA 1TONA 1UCYH 3U1IB 1LHGH 1DWEH 2A1DB 1DDJA 3M7QA 1PQ7A 2BX3A 1SLUB 3BEIB 3CS0A 3ZIAD 2B7DH 2P16A 4MTBA 4CBOA 5KGOA 4CRCA 1S5SA 3M3SA 3RMLH 4K69A 1KY9A 3PLKA 4ASHA 3QO6A 3RXLA 1C5SA 1GVKB 1UTJA 1SB1H 2ZECA 2Z7FE 1ELFA 2QE7D 2C8YB 1HBTH 1TA6A 1V2LT 4Q4LA 1D3DB 3RXCA 1AZ8A 1OWEA 2F4LA 2CV3A 3C27B 4CBNA 1W11U 1FXYA 3RXRA 5GCHF 1KDQB 1AVWA 3K65B 3NXPA 5EW2H 3M7UA 1JWTA 1OS8A 2FP7B 2WV9A 4ABHA 1CHOF 2ZHFH 2GMTC 4M9FA 5EU8A 1FIZA 3O8BA 1Y5UT 4NFEA 3K6ZA 1ELDE 1FAXA 1C5NH 4NZQA 1TWXB 5A8YA 5DSFA 1OP0A 3SU0A 1FV9A 2A7CA 5C3NA 1T32A 5EXNA 1ESTA 4I8KA 3T25A 1W0JD 5PTPA
chains in the Genus database with same CATH topology
1GCDA 3DA9B 4MNWA 3RU4E 3U69H 4DIHH 1HYLA 2AIQA 2BDCA 3D23A 1Y8TA 3SNAA 3SN8A 5LPEA 3P8NA 2F9OA 1MZAA 1NFYA 2ODYB 1GBJA 4A5TS 2UUFB 2WV4A 1YPKH 1WV7H 1GJ7B 2J92A 2UWOA 1NY22 4FUCA 1RJXB 1W13U 2H6MA 2FESH 4KTCA 3RMMH 1F0RA 3SGQE 3GCOA 1P2NA 1FY1A 1LPKB 3FAOA 5HM9A 5G4BA 1FY3A 1UTPA 2DUCA 2D8WA 4FUGA 1PQAA 3KQEA 1XVMA 2VU8E 4K1EA 2G51A 4O9VA 1OWKA 4D7FA 3PMBB 5T6DA 1P02A 1SVPA 2ZGJA 2HNTE 4NA7A 3MMGA 2IOTA 1NC6A 3U98H 3QWCH 1AWFH 4Y8ZA 3CENA 1O2SA 1XXFA 3M35A 1H4WA 2W3IA 2OCVB 3QN7A 4TY7A 1NRRH 1F2SE 1AMHA 1S6HA 2ZFPH 3A83A 3E16B 1QB9A 5JPMH 1HXEH 1T4VH 3VXFH 2AFQB 1WOFA 3M3TA 5TJXA 3VGCC 3H7TA 1LKAA 5EQQA 1ABJH 2A4RA 5F8ZA 2ILNA 5A8XA 5C67A 1A7SA 9ESTA 3N7OA 3P8OA 1YPMH 1S81A 1B5GH 1AGJA 2YOLA 3UQOA 3VB7A 1MCTA 4X8VH 5ABWA 1O3KA 1GGDB 1KXCA 3BTWE 4WXIA 1LHDH 1H8IH 3UY9A 1HAOH 3ZZ4A 5DP7A 5EPYA 1TOCB 1VJ9U 4H4FA 2ESTE 1AFQC 4B1TA 3D62A 1B7XB 1M9UA 5CHAB 1Z71A 1JRSA 1CO7E 2G5VA 3OY6U 5C20A 2BY9X 1ORFA 1S83A 1O2OA 1SMFE 5J4QA 4A6LA 4YO9A 4I8JA 5EOKA 1BQYA 1CE5A 3RXPA 3MU5A 1D9IA 5EXLA 2PWXA 3PLBA 1TGNA 3PB1E 3Q3YA 4Q7XA 1Y5AT 2PGBB 3LU9B 4QT8C 3QLPH 4GHTA 4B2CA 2FOHA 9LPRA 3TK6A 1AD8H 1TA2A 4BAMB 2BD9A 4E7RG 3QDZB 6ESTA 1A1RA 3OX7U 1JIRA 4NA8A 3SI4H 3OSYA 1UTNA 5DKMA 3GCTF 1EAUA 1GI3A 1GI7B 2UUYA 2Z3EA 1W2KH 3F9GA 3FP8E 2Y5HA 5EXMA 4YT7H 2P3UB 1J16A 4MPXA 1SSXA 2A5IA 3TNTA 1C5WB 5AF9H 1O2VA 2GZ7A 4B76A 3M5LA 3B23B 3TVJB 1LHEH 1NFXA 1YCPM 1S82A 1T8NA 3VB6A 1BTYA 1GDUA 2GZ9A 1IQNA 1C5LH 1HFDA 1GBDA 1W0ZU 1CGIE 1UTMA 2BX4A 1RD3B 1DVAH 2BLOA 1MH0A 1KYNA 5IYTA 2FLBH 2ZEBA 1HXFH 1VCPA 5FX5A 1C2GA 1O39A 4SGBE 1MTUA 2JH5D 2Q6DA 2ZKSA 6LPRA 3LT3A 3O8RA 1IQGA 2JH0D 3MH5A 1TABE 1CGJE 1UVSH 2G81E 1GJBB 4K5ZA 1GHZA 5EQRA 2J38A 4U32A 3NCLA 3RMOH 1RFNA 1H9HE 1HAHH 3QGJA 5HGGA 1FONA 1AN1E 5JYIA 1UTLM 2VB0A 2F9NA 2ZU2A 1KXEA 1O2GH 1J14A 2QCYA 2SGAA 1KSNA 1HB0B 4XFQA 1C4U2 2BD8A 1OYQA 2CF9H 4H42U 1BBRE 3A7VA 1BTPA 1SGEE 1GBBA 3MH6A 4CR5A 4OS6A 4FU7A 2GV6A 1G2MA 2AGEX 1SGTA 3EA7A 2Y5FA 1DT2A 2WUCA 4A92A 2BM2A 2BD2A 2Y81A 2EI6A 2J9NA 3B8JA 1O3JA 4RKOB 1K1LA 5A0CA 3BTFE 1C5RA 1ZMNA 1SHHB 3AAUA 3MU1A 5LH8A 4AFUA 4AGKA 2ZQ2A 1GG6C 4ZH8A 1PPCE 3TLOA 2ZGXH 2TGAA 2V3HH 1BITA 3DFJA 1C2MA 1EATA 2R3YA 2ZCHP 1Y3YA 2VIVA 2NU0E 2OC1A 1HCGA 4TPIZ 3Q3XA 4XE4A 4UFEH 1CT4E 5FX6A 4K3JA 1HNEE 1BMAA 1VR1H 4UDWH 5DK1A 4DT7B 1FLEE 4JYTA 2ANYA 1O3CA 1BOQA 1NRQH 1S84A 4UD9H 1V2PT 4AG2A 4WMEA 3AW1A 3RUOA 1SGQE 1WCZA 5AVDA 1QL8A 5JB8S 1C5UA 2ZDKA 3K2UA 1DUEA 2ZGCA 3A7TA 3MNBA 2OC8A 1VITH 3MNXA 2QYIA 1LDTT 3EAJA 1W7GH 3SQHE 3VB5A 3K9XB 1CT2E 2A5AA 1ELAA 4LOYH 1EP6A 2Y7ZA 2BY6X 1NS3A 4NWLA 1FNIA 2BXTH 2H9HA 1WTGH 2GP9B 4HI3A 3HPTB 3SNEA 4JK5A 2ZQ1A 1P05A 4UFDH 1AB9C 1SGRE 4GUXA 4YLUA 3GY7A 3A85A 2Q6FA 3ZVCA 1GHAG 4CH8B 1EASA 1O2KA 2ZGHA 3HK6B 2A0QB 1H9LB 3MH7A 4Y8YA 1G2LA 2VH6A 2ZHQH 4MQAA 2W26A 2VWMA 4HTCH 4B71A 1PPEE 4FUDA 4UE7H 3SU1A 1KTSB 1TMTH 3OU0A 2NU3E 1QB6A 5EGMA 1NZQH 5L6NH 5DGJA 1DS2E 1UK4A 2SGDE 3TGJE 3HKJB 3RXEA 1V2TT 1UVUH 1GBMA 1YCPH 3ODDA 2XC5A 3RU4T 4GAWA 1AZZA 1LHFH 1O5BB 1O2QA 2SGFE 1TOMH 3RXSA 1TGTA 5GCHG 3G01A 2FI3E 2JKHA 3BG4C 1GBTA 1TNGA 1P10A 1NM6A 3RXMA 3JZ1B 4JZDH 1CHOG 5JBBS 1O36A 1BMNH 1P2QA 2OLGA 1Y3UA 4CHAC 1O3PB 1V2ST 4OGYA 1SPJA 4JYVH 1HAZB 4XBDA 1OX1A 1EOLA 1V2VT 6CHAB 1SGIB 1GBCA 3ITIA 1KXAA 5GJ4B 5TCCA 5SGAE 4ZKNU 1TAWA 3SORA 3A89A 1KLIH 3FANA 4X1PU 3E1XB 4FUEA 2P3TB 1QFKH 2BTCE 1VZQH 3D49H 1OP2A 4O3UA 1F92A 2HPQH 2OP9A 5A09A 1V2OT 1N8OC 1TPOA 1GI6A 2QGRA 3BG4B 4CH2B 1ETSH 3FP6E 1P12E 4OS7A 3BTKE 2G52A 1QJ6B 4AZ2B 3OYPA 3SHAH 2BDAA 1P09A 3P95A 3UOPA 4CHAB 1RTKA 2GTBA 3ESTA 3HKIB 1P04A 3L6PA 3SUDA 1O3FA 1WAYB 4ZKRU 4ABDA 1UK2A 5T6FA 3S0NA 1HAYB 4INKA 1LQDB 3UOUA 1Q2WA 1O3HA 1C9TA 1ZPBA 1BJUA 2XBWA 4CRGA 1K1MA 1N1LA 2UUKB 1BMMH 1CHGA 2AERH 5A2MH 2ZU3A 1DPOA 1BTUA 1OWJA 2FI5E 4YESB 1HLTH 2PKSC 1MD8A 1O34A 1C5MD 3LGTA 2C3SA 4OS1A 1ZYOA 3RXJA 5JBAS 5TCAA 1C2IA 1O5GH 1QB1A 1O2NA 1QRZA 1LKBA 1TB6H 3A80A 2F83A 2ZWLH 1QA0A 3GY8A 1LO6A 1NRPH 1PYTC 2P8OB 3RXOA 1ETRH 2ZCLP 1ZRBA 1O5EH 2M5TA 1KXBA 1FY4A 2ZDLA 4JMYA 4Q7ZA 2FYQA 4O3TA 1C5VA 3SNCA 2D26C 3RLWH 2RG3A 3M3VA 1XM1A 1MAXA 2TBSA 1X7AC 3B9FH 5DP4A 1O2RA 1TIOA 1T8MA 1EPTC 1W10U 1ZTLA 1O3LA 3TGIE 1YPEH 1YPHC 3A86A 5F8TA 1B0EA 1GHWH 3O8CA 2VIOA 1Z6EA 3NKKA 1IHSH 4JCNA 2BMGB 1CBWB 1EAXA 4FUFA 1GHYH 1ACBE 1YM0A 1TBQH 2ZFQH 3PO1B 5F8XA 4DJZB 1K1IA 2PLXA 2ZP0H 1EAWA 4I33A 2TGTA 1GBFA 1MUEB 1YPJH 4AORA 4TY6A 4R0IA 4Y71A 1C1RA 3M61U 1GJCB 1HPGA 3F1SB 3SUFA 2ZTZA 4D9QA 5FBEA 3MNSA 1LVMA 1S0QA 4JZIA 1RGQA 4IC6A 3A8AA 3KN2A 1TRMA 4Y0YE 4LZ4B 1Y3VA 3I77A 1T7CA 2FX4A 2XCFA 2Z6BD 4IMZA 3ZZBA 4MVNA 3LH3A 5DP8A 1O31A 2AYWA 1SI5H 1GHAF 1GDNA 3KCGH 1D3PB 3ATMA 3OTJE 1KDQA 3EDXB 1WTHD 8GCHG 3LGWA 1A0LA 2HPPH 5K0HA 3U8RH 3A7WA 1Y3XA 4PROA 1V2RT 5A0AE 1FJSA 1O3BA 1SGYE 3LJJA 1Z8GA 4OGXA 3VXEH 1ABIH 2HNTF 2A2XH 1BTHH 1BHXB 4J2YB 1BBRK 2FOBA 1DY8A 4ESTE 1HAGE 4Q2KA 4I7YH 1K21H 1F0SA 1QRWA 4SGAE 1TYNA 4RSPA 2WPMS 1NFUA 2FX6A 1FDPA 5DP6A 1ZMLA 3LH1A 7KMEH 1GHBG 1C1TA 5FPYA 5DG6A 1GMDG 3MO6A 1V2JT 1K22H 4AB8A 3SV8A 1GVLA 5J4SA 4YOIA 2ZU1A 3SGBE 5E0GA 4DOQA 1TGCA 1C2JA 3A84A 5FPTA 3T62A 1ARBA 1WUNH 1YC0A 5BRRE 3SU3A 3E0PB 1P57B 2PUQH 1VJAU 2OD3B 3A87A 5L2ZH 2G4TA 4E05H 5EPNA 1YLDA 4Y6DA 1V2MT 2ZDMA 2AS9A 5E2PA 3IITA 3SUEA 2CGAA 8LPRA 1P03A 2ZHDA 3VEQB 3F9EA 4LXBH 4MPUA 3MOCA 3S9AA 3Q3KA 2O8LA 3GICB 2R2WU 3SI3H 1BRUP 3S7HB 2P93A 2AMDA 4DGJA 3ZVAA 1SGPE 3M5OA 3ZVEA 1OYTH 4MG3A 2O8TA 1HAIH 1SL3A 1FY5A 2GCHG 2VGCC 3UPEA 3RM2H 2GMTB 1GBLA 1O5CB 3ENSB 2GD4B 2RA3A 3TH4H 2FLRH 1C1OA 1G3DA 4ZKOU 4FVDA 1ETTH 5ESTE 1EZUC 1P11E 4OS5A 4NSVA 1QBVH 2VWLA 1GJ6A 1YBWA 1XUGA 1MBQA 2FEQH 2QAAA 3BIVH 1MKXK 2ZZUH 2A4GA 1E34B 1UTKA 4D8NA 2OBOA 1J9CH 1PYTD 1JRTA 2DE8A 5ETXA 1DWDH 2TIOA 1K1JA 1U6QA 3UUZA 1L4ZA 1QQ4A 1GJ8B 3ZZ7A 5DP3A 1JBUH 1MD7A 4ISNA 1PFXC 4NFFA 5DJ7A 2VGCB 5LGOA 1TBZH 3RM0H 3BN9A 3A8CA 2BVRH 1G3CA 2STAE 3PMJA 4TYDA 5I46H 2J4IA 1EB2A 3BF6H 2B8OH 2XBVA 3V7TA 3P92A 2W5EA 3DD2H 5F6MA 1THPB 1ZGIA 4KELA 1GPZA 4ABAA 4ZHMU 2IPHA 1UCYK 1P3CA 5C5NA 1QHRB 2BOHB 1G3EA 2ZO3H 3PYHA 4H6TA 1CU1A 4I8HA 1L4DA 1F5LA 2H9TH 1ELCA 1QL7A 5EQSA 3HATH 4DURA 1ANBA 2OC0A 1L0ZA 1IQHA 4NA9H 8ESTE 3RXDA 3TJOA 1C5QA 1ELBA 2V6NA 4D9RA 2A5KA 2XC4A 1C5TA 4TWYA 3KQBA 3VGCB 3GDUA 4KKDA 1YF4A 1YPGH 1SOZA 1O2HA 1GI5A 3VPKA 1YPHE 3HGNA 2BY8X 4UFFH 3E90B 2GVFA 2QXGA 1P2KA 4X6MA 3M7TA 1MQ6A 1UMAH 1C1WH 1IQLA 3A81A 1J8AA 3QZQA 4WVPE 1GBEA 3Q77A 1AFQB 3STJA 1C1VH 4CRDA 3EGKH 3TNSA 1O3OA 3BTME 3T2NA 1NT1A 3PMHB 4F49A 1ZR0A 1FY8E 1L1GA 1GBAA 1IQMA 1ZJKA 2BQ6B 2WINI 3KF2A 4BXSA 4Y11E 2ZDVH 4A1XA 2RDLA 4GSOA 1P2IA 3I78A 1IQEA 4IN2A 1K9OE 2NU2E 2DE9A 4DG4A 4O03A 2J2UA 4KTSA 1SOTA 1KTTB 4ZKSU 4AOQA 5K7RA 3PWBA 3P70B 3SJOA 2BY7X 8GCHF 2C93B 2Z9IA 1SLVB 3MWIU 2QA9E 1OSSA 3P17H 4ZXYH 2GKVE 1V2UT 4DVAU 5DP9A 2ANMH 4MNYA 4AFSA 1D3TB 1AHTH 1PPGE 1XMNB 1OWDA 4JK6A 1BJVA 3W95A 2G00A 4IW4E 2QF0A 1TQ0B 1C2DA 5GXPA 4X2YA 1C2EA 3MO9A 4LK4A 1GHBF 3GISB 4OS2A 3QTOH 1INCA 1GMDF 2ZG0H 2WV5A 4O97A 4WH8A 3SU5A 3R3GB 3KQCA 2FOAA 1E37B 2VJ1A 3F9FA 5HMAA 2BOKA 2A4OA 4BAOB 2Y80A 4ZHAA 1Y59T 2GV7A 2GZ8A 4NG9H 1O2UA 3K6YA 3LIWA 1MKWH 3VB4A 3BG8A 2AH4X 3RP2A 4UONA 3C1KA 1PPZA 1A61H 4M7GA 2R9PA 3PM3A 1FUJA 2QF3A 5C1YA 2F3CE 1A5GH 2IN2A 3SQEE 5CE1A 3KEEA 5AHGH 3BIUH 1P8VC 3SJ8A 1CVWH 1F5KU 1GVZA 1P9UA 1YKTA 3L33A 3TH2H 2ZU4A 4U30A 3VFEA 4AX9H 4BTUB 4BNRA 1FIWA 1GMHG 3LJOA 4RN6A 1C1MA 3CS7A 1S85A 3RXTA 1Z7KA 1A3BH 3BTEE 3PWCA 4CREA 3ATIA 2FPZA 2W7SA 2GCHF 3ZVDA 4A1VA 2ZTXA 1TNIA 2BDHA 2ZDNA 1GG6B 3SO3A 1UTOA 3BTGE 3TJNA 1A2CH 2XWAA 2O8MA 1N6XA 2VIQA 1SGCA 2ASUB 1E0FD 2YNAA 1JOUB 2VWNA 2H9EH 1OWIA 4I8LA 3E6PH 1TRNA 2J34A 2VH0A 2QN5T 2R0KA 3UFAA 3MFJA 4X8UH 2WPIS 1F0UA 2A4QA 3T27A 1AI8H 2FI4E 3UR6A 1QY6A 1GCTC 4MDSA 1TE0A 1VGCC 2ALPA 1LVOA 2AMPA 1MTNC 2XTTB 3E3TA 4UFGH 2PHBA 2Q6GA 3MH4A 1BRAA 3MO3A 4TPYA 1MU6B 1ELTA 2XWBI 1V3XA 4JZ1A 4U01A 4WMDA