3NKKA

Trypsin in complex with fluorine containing fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA02
1WSSH 1HAHH 3PO1C 3S0NA 1O3MA 2PKSB 2GDEH 3F6UH 2FOCA 2A7HA 1GCDA 2ESTE 4AB8A 1AWFH 4TY6A 1O33A 1HXEH 1FDPA 5HGGA 2AS9A 2XBVA 4K69A 3CS0A 3LGIA 1BBRE 3ATKA 3MO3A 4GCHG 5C1XA 4FVBA 2WYGA 4X0WU 1FLEE 1SL3A 1TNJA 2P3TB 3D49H 1GL0E 4JZ1A 1F5LA 2ZFTA 2C4FH 1TE0A 4Y8XA 2H9HA 2ZGCA 3SU3A 2W26A 3FFGA 1DLEA 3T2NA 1MTNC 4DOQA 4PROA 5GXPA 3LKWA 5I46H 2FEQH 1O3HA 2NU0E 3KHVA 1C5TA 1DVAH 1GJBB 3SUDA 3SHAH 1ANCA 1XUKA 3RXRA 5GDSH 3QX5H 1WCZA 2WPLS 1DITH 2WPIS 4ZKSU 1THSH 5T6DA 1AY6H 1QRZA 2G51A 1C1WH 1HIAB 4B71A 1QJ6B 2A31A 2GCHF 2XTTB 4AORA 7GCHF 3M7TA 2BD7A 2QXIA 4Y0ZE 5BPEA 3CP7A 2QIQA 3TH3H 3BTHE 1GJDB 1NESE 3ZZ7A 1S5SA 4BNRA 1WTGH 4GPGA 3EE0B 1UJ1A 1BCUH 1VJ9U 1E34B 1GG6B 1MKXH 1VR1H 1KLTA 1NFWA 3EDXB 3QK1A 1THRH 3RMNH 5A0CA 3Q3KA 1A5HA 2TGAA 1BZXE 3S9BA 1BQYA 9LPRA 8GCHG 3M35A 4DVAU 2ZKSA 3B9FH 1GBAA 3BG4C 1CO7E 1A0LA 1CHGA 1OP8A 1RFNA 3P17H 3SU0A 4AGJA 1O3OA 1DUAA 1V2TT 4OS4A 1ZSKA 4WXVA 1GJCB 3A7YA 1MMJN 1QB6A 1ELFA 2ZGJA 2PUXB 2A2QH 1O3EA 2SNVA 4FUFA 3KQCA 3LC3A 1G2MA 3NK8A 3RXFA 3GY3A 1FY8E 4K2YA 3EGKH 3NXPA 1EX3A 2G00A 2Q1JA 2GMTB 1A2CH 4Q7YA 4DW2U 1SOTA 1TX6A 3ENSB 1O31A 2P94A 2FDAA 1WBGB 1P2KA 5JPMH 3UWJH 4UFEH 1SBWA 2Z3EA 2J38A 4Y8YA 1TGCA 2UUJB 3MOCA 2XC4A 2SGDE 3ZZ5A 1UTMA 3QZRA 2Z94A 3D62A 1E36B 2PTNA 3ZZ8A 3BN9A 1GPZA 1QBVH 1O38A 3UUZA 3F9EA 4AG1A 1XKAC 4KTUA 3RM0H 1QRXA 4H4FA 1Q2WA 1EOLA 1OYTH 2AIQA 2ZHEH 2R0KA 1C2KA 3BTME 4Q80A 3LU9B 4WH8A 1UVOA 4LZ4B 1EPTC 4FUCA 5DP8A 5BRRE 1SQAA 1T31A 1ANDA 4UDWH 2ZTXA 2ANWA 3PLPA 3MH6A 1TYNA 2WUBA 3A83A 4YLQH 4IN1A 3RM2H 2P3UB 3LJOA 3RXKA 3RXVA 2FOEA 2OTVA 3KIDU 3KQBA 3AVZA 3ZZ3A 2HLCA 3UR6A 1A3EH 1KDQB 2P8OC 1EAIA 4BANB 1EASA 3ZVAA 5E8EH 4K60A 1W0ZU 2OC1A 3URDA 1RIWC 1S6FA 4ZAEA 2Y82A 1V2OT 1Y5AT 2ZDNA 1BITA 2BDAA 4FXGH 1XMNB 4I32A 3ZVEA 1KXEA 1BDAA 1EJMA 2OQUA 1F5RA 1K9OE 3SHCH 1UTJA 4ESTE 3A7WA 1GBFA 4NA8A 4A7IB 1S83A 4DY7B 4JCNA 1O5AB 1GI8B 3BEFB 2Z6BD 1F0UA 4AX9H 1FI8A 4AYVB 4MNXA 1CGHA 1HFDA 3RUOA 1K1IA 1O3DA 1LVMA 1O2NA 1TAWA 2JH5D 2Z7FE 3SU6A 2V0BA 1CE5A 2BD2A 3PMJA 3NPSA 1H4WA 3PMAB 4UEHH 4ASHA 1O3KA 2BB4A 4ABAA 2RG3A 1S0RA 1TNLA 2Z9KA 4GHQA 3A8DA 1XX9A 1L2EA 3PTBA 3PO1B 3VB4A 2NU3E 2BD8A 2VVCA 4I8JA 1XXDA 4X1QU 2IN2A 4A1VA 2ZF0H 2AYWA 2VH6A 3MU5A 4YESB 1TMUH 3TPIZ 1DSTA 2QYIA 2XYAA 5C67A 1P2MA 1C2FA 3KQDA 1IQIA 1WUNH 1RD3B 1VGCC 1U6QA 3V0XA 4ZROA 5JYIA 2PSYA 1EZSC 3ZVBA 3FP8E 5DK1A 5GCHF 3UOUA 3QWCH 4TPIZ 4A1TA 4Y8ZA 1GMDG 1MD8A 1C5SA 1T4VH 1P01A 1GMCF 5EXMA 4DCDA 4HGCA 1ELTA 4AOQA 3SJKA 1GI6A 5B6OA 1OWDA 5A8ZA 2FS8A 1O2MA 2TBSA 1MH0A 1HXFH 1IQNA 1O3IA 2JKHA 1Y3WA 2G5NA 3NUMA 1O39A 1UVTH 1QGFA 1SMFE 2ZDKA 3SV9A 5HXFA 1S85A 3C1KA 3SV7A 1Q31A 3BTKE 3GDUA 4X2VA 1DX5M 1KDQA 1TALA 4QT8C 3RLYH 1BB0B 1B7XB 5EW1H 1X7AC 1O3BA 2C8YB 2Y80A 4DT7B 5IDKA 4AGKA 4NWLA 1P57B 4JZFH 4KTSA 3MU0A 5I25A 2PUQH 1AFQB 2ZU1A 1W8BH 4OGYA 2PHBA 1P2QA 3Q3YA 2ZA5A 3GISB 1YKTA 2XC5A 3DA9B 2SGAA 5EQSA 1P9SA 3RLWH 4KELA 3GDVA 3LJJA 3M5OA 1ZTJA 2ZEBA 3VB5A 3U1JB 2ZU4A 4BAQB 1UTPA 4MNYA 1NPMA 4E06H 1PJPA 1QL7A 2ZHQH 6LPRA 2O8UA 3SNCA 2HNTE 1ZGVA 2BD4A 1GMHF 2I6QA 1W7XH 1G37A 3EYDA 2Z9IA 3PLBA 2GP9B 2KAIB 2B5TB 7ESTE 4B76A 1ID5H 1P09A 2ULLA 1C5MD 1Y8TA 1ANBA 3HATH 1J9CH 3LOXA 1KXFA 2ZZUH 2AERH 3A86A 3S7KB 2STBE 1CT2E 1GI3A 2QA9E 3SZNA 5F6MA 1BMLA 1O3LA 1Y3XA 4AFSA 1HDTH 3UNSA 1TGBA 3TK9A 5JB9S 3HKJB 1DUEA 2STAE 1NU9A 1XUHA 1GHXH 1GL1A 2ZFFH 5L2ZH 1HCGA 3MMGA 5E0HA 2WV5A 1LHDH 1P04A 5EXLA 4XDEA 2QXGA 3B23B 1ARCA 1LPZB 2AMPA 2BVXH 3QTVH 2RDLA 4ABBA 3LDXH 2ZPRA 1TBRH 4MNWA 5GIBA 4JYVH 2FMJA 4MG3A 3RMLH 1G30B 1C4U2 1K1NA 2D26C 1T8MA 2XXLA 2OP9A 1AVGH 2BHGA 2A4QA 3RXMA 3UFAA 1A61H 1QJ7B 1AVXA 1ZRBA 3RXBA 4INKA 1LPGB 1EPTA 4NWKA 2VJ1A 3CS7A 1DT2A 5GCHG 1FJSA 1H8DH 1SGTA 2FTLE 3UNQA 4JZDH 3MNSA 1T32A 3SBKA 1MZAA 1D3DB 2BYAX 1GJ8B 3I29A 1MQ6A 1NRSH 2BY8X 2AMDA 2BY6X 3MH5A 1EUFA 3LH1A 1TPPA 1O3CA 3AASA 2AMQA 1G32B 5F8ZA 5C3NA 5A8XA 1BHXF 5TCCA 1HAYB 2FOAA 2ZFRH 3A7TA 1AFEH 3GY5A 5IYTA 5J4SA 1V2JT 1QBNA 1K1MA 4X2YA 1TNKA 4R8TB 1HAZB 3NCLA 1EP6A 3ZZCA 2VVUA 2QV1A 3A85A 1P05A 1YP9A 1W11U 3MNBA 1YPGH 2WPHS 1F2SE 3TJNA 2DE8A 1UK4A 1C2MA 1E35B 2BX4A 1HYLA 1PQ8A 1TIOA 3SNEA 1O2ZA 5E2PA 3A7XA 3SO3A 4LZ1H 1EZXC 2FOBA 2PR3A 2PSXA 1NRQH 1TB6H 3AAUA 1ZZZA 1Z6JH 3VFEA 1WQVH 3OYPA 5DJ7A 4K8BA 3VEQB 1EZUC 1W3CA 4A92A 1C1VH 1GBJA 2GCTB 4NIWA 3RXEA 1SQTA 1ZSJA 2Y5GA 1VZQH 1C2HA 2BD5A 3WY8A 2R2WU 1ELAA 1O3AA 1W2KH 1W7GH 1V2MT 1K21H 3ZZBA 2C3SA 4O3UA 1TGSZ 5K0HA 1FY5A 1YCPH 3A7VA 3DFJA 3A8BA 3TJOA 1NS3A 1ZMJA 3PROA 1ZTKA 4NZLA 2EI7A 2H5DA 1PPEE 1TPSA 1NT1A 1SLUB 1YLDA 3ZYDA 2BQWB 3VB7A 1TOCB 1A5GH 1LKAA 3BV9B 2SNWA 5A09A 2ZG0H 4X8SH 4RKOB 3BSQA 1NROH 1OP0A 3NZIA 2ZTYA 3LH3A 2TPIZ 1O2SA 1ARBA 1OPHB 3LONA 5EGMA 3SI4H 2H1UA 2TGTA 4AFQA 5FCRA 3JZ1B 5ABWA 2CXVA 1SVPA 1QL8A 4HFPB 4O97A 2FO9A 2HNTC 1XM1A 3D65E 3UTUH 3S9CA 1C1UH 1C1SA 2J94A 3H5CB 2A7JA 1O0DH 1O2UA 2V3OH 4IW4E 1ABJH 4KTCA 4BTTB 2P59A 3MFJA 5JBBS 2AGGX 1LDTT 1SGIB 2NU4E 3O8BA 1SGRE 1BJVA 1EQ9A 4D9QA 2Z9GA 3R3GB 1SB1H 2VB0A 3T25A 3TLOA 4DGJA 2FESH 3BTWE 1C9PA 2AFQB 1IQMA 2A1DB 1G3CA 5DP4A 1HJ9A 1TLDA 2FI3E 3D23A 1JXPA 4E7NA 4DIHH 5T6FA 3M5NA 4AFUA 1NRNH 3GYMA 1UO6A 2OUAA 1LHFH 1L4ZA 3VB6A 1C2LA 1ZHPA 2AH4X 4DJZB 1DDJA 2ZFPH 2VU8E 2NU2E 1DXPA 1G3BA 1Y3YA 1QQ4A 4K8YA 2A4OA 4MQAA 1GG6C 1C2JA 1P11E 5F8TA 1AVWA 2ASUB 1O5CB 3KL6A 4NG9H 2VWMA 4DG4A 3OU0A 4E05H 1ELVA 3MO6A 5T6GA 2VH0A 2J95A 1J8AA 1HAIH 2UWPA 1J16A 5L2YH 1TQ0B 1BUIA 1NRPH 1BIOA 3MYWA 4I8GA 4K1EA 3LGVA 1KTSB 3G01A 4WWYA 4GHTA 1O2HA 1E38B 3RXPA 3PB1E 1TBQH 1GI9B 1K1PA 2WPKS 4IS5A 2XBWA 1EOJA 3W94A 3FZDA 1CGJE 1CA8B 1ABIH 4VGCB 2VNTA 2HGTH 1BTPA 5TJXA 1HGTH 4U30A 1MBMA 2QF3A 1V2VT 4CHAC 1S0QA 2CJIA 3TJUA 1ELEE 5EQRA 1GDQA 1XUIA 1ZMNA 4I8HA 2BY5X 2OC7A 5SGAE 1ZPZA 1H1BA 2CHAC 1YPKH 3FAOA 1W13U 4WMDA 1NO9H 4MLFB 3UQVA 1KIGH 1FUJA 1SLXB 4UFGH 4F49A 1XUJA 4ISLA 1VJAU 4ZH8A 1JWTA 2ZCLP 2P3FH 4CRFA 1DE7H 2BY7X 3P6ZB 1SHHB 3SU5A 2H5CA 3VPKA 1LQEA 3DT0H 1UHBB 1CT0E 1A46H 1TNHA 1N1LA 5EPNA 1RXPA 1SGPE 1OWIA 5C2ZA 1B0FA 2BMGB 3BTTE 3KNXA 1GJ9B 2M5TA 5G4BA 5GPIB 1SR5C 1Y5UT 3P8FA 4VGCC 4B73A 4CRAA 1C1NA 4WH6A 5DP9A 4ABGA 1O37A 4I31A 5E2OA 1QL9A 2ZDLA 3GY7A 4OS5A 5K7RA 1OKXA 1QA7A 1QR3E 1GI4A 1HPGA 3KCGH 2Z3DA 2UUKB 1ESBA 1QA0A 1EXFA 1UHBA 1C1QA 1F0SA 2GZ7A 3RXTA 2VWLA 1PFXC 2BLOA 2B7DH 1DSUA 4JK5A 1O30A 2UWOA 6GCHG 1DANH 1O2IA 1OS8A 2B0FA 1ZJDA 1AD8H 1O2OA 4M7GA 1O5GH 1O2RA 2PFEA 5A0AE 1ETTH 1G2LA 1BT7A 1PPHE 2A5AA 2Y7ZA 3EA8A 3IWMA 1UK2A 1BJUA 3F9GA 1SHYA 3BIVH 4OS1A 2ZC9H 1HAVB 5FBEA 1LVOA 2KAIA 1W14U 3I77A 2XBYA 3BIUH 1IHSH 2BVRH 2GVFA 1BBRH 1O2TA 1BA8B 5DP7A 4X6OA 3SW2B 2OBQA 2PLXA 3BF6H 1C5PA 1W12U 5FHTA 3PWBA 3Q3XA 3FVFB 1SGDE 1MU6B 4HZHA 3E3TA 1OX1A 3PMBB 4X1SU 2BD9A 1F92A 1AO5A 3DHKH 2FI5E 4YTAA 1AKSB 1AHTH 1SFQB 2GV6A 1O5DH 5HM2A 1KLIH 1MCVA 4NFFA 1HB0B 4WMFA 3SUEA 3M3VA 4B2BA 1A5IA 1S6HA 1F0TA 4X2XA 3ZVGA 5F8XA 1AIXH 2OINA 3SJ8A 2A0QB 1P2JA 1WOFA 1V2UT 3BEUA 1SGFG 1OWHA 2H6MA 1CA0B 2PGQB 2A7CA 4Y7BA 1OYQA 4D8NA 4AFZA 1NFUA 4UFFH 4E7RG 1QHRB 1LQDB 4UD9H 1UVSH 2SGPE 4NGAH 1FN6A 3ZVDA 1SLWB 2FOFA 3GCNA 3AAVA 3M3SA 2QXHA 1SGCA 1D3PB 4OGXA 3MH7A 3U8TH 3P92A 1TONA 1GMDF 1PQ7A 2FXRA 4CR5A 3O8CA 5EG4A 2RCEA 7KMEH 1FIWA 1VCPA 1Z6EA 4NCYA 4OS7A 4BTUB 1K28D 4GUXA 4Y11E 4B2CA 4KP0A 3UWIA 1HJAB 5GWZA 4IMQA 3F9HA 3TITA 5LPEA 2ZGBH 3ATLA 2VGCC 1C5YB 2GT7A 3ZVCA 1UCYK 2BDIA 3M7UA 3MH4A 3A88A 3BTQE 4H6TA 1L1NA 2ZDAH 2OC0A 3CENA 4YLUA 1ACBE 3LGUA 2UUYA 1QB9A 2YNBA 4NA7A 4O3TA 1MZDA 2ZNKH 1IQJA 1GBIA 2G4UA 3TNTA 1CHOG 2OD3B 1ETRH 4B1TA 1KYNA 3L3TA 5C5OA 1FNIA 4D7GA 1AI8H 2ZPSA 4IN2A 1RTKA 1Y59T 4YOGA 3T28A 2AGEX 1K1JA 2HALA 5LPRA 2GKVE 4ZKOU 2A4RA 2BDCA 4D7FA 1VCWA 4B2AA 3TK5A 5C1YA 4ISIH 5E0JA 3RXQA 1EB1H 3H7OA 3A84A 4CH2B 3T5FH 2FWWA 1SOZA 2OC8A 3SUGA 2FOMB 1AZZA 1C5RA 4GAWA 1T8OA 4SGBE 1MKWK 2H9TH 1TA6A 3GCHC 1E37B 3JZ2B 1DXWA 2ANKH 4UFDH 1GGDC 2ZU5A 4BTIB 1C5WB 4BAMB 1EAXA 3KN2A 1H9HE 1QB1A 1LVBA 4ABIA 3KEEA 2FPZA 1AQ7A 1JOUB 1Y5BT 3SJ9A 1C5OH 3RC5A 1KXAA 2QN5T 4CHAB 4X2WA 1YM0A 1LHCH 2RA3A 5AVDA 1DWDH 1OWJA 2GV7A 8GCHF 1VITH 2ZDMA 1TGNA 1TRNA 1LMWB 5DP5A 3UNRA 3ODDA 1ZTLA 5C20A 1PPCE 2V3HH 2YNAA 3UY9A 3TU7H 1O2YA 1YBWA 2HOBA 5A8YA 2ALPA 2Z9LA 2CF9H 1ZGIA 1CVWH 3ATIA 4WJG2 2ZHFH 2CF8H 3PYHA 1GHYH 2ZU3A 2TRMA 1FONA 3ZV8A 2ZDVH 3ZZ6A 1TQ7B 1MAYA 1ANEA 1YPHC 4JZEH 5DP6A 5JB8S 1AWHB 9ESTA 1C1PA 2A4GA 2Z9JA 3P8GA 2SFAA 1BMAA 1L4DA 4WXIA 2VIQA 5AFZH 1EP5A 1NC6A 1LPKB 1LO6A 1EPTB 1NU7B 1CA0C 2WUCA 3PWCA 4FUGA 1C5VA 4ISHH 1GHAF 4CRCA 1TRYA 1GBCA 2FX4A 1BRBE 4A5TS 1MUEB 4B75A 1V2NT 2D1JA 3PLKA 1HV7A 1IQLA 2P8OB 2F9BH 1V2KT 4JK6A 1V2LT 2ZO3H 1A7SA 1BTWA 3FP6E 4ZMAH 1OWKA 1KXBA 1H8IH 2FI4E 1CBWC 1JRSA 3E91A 3K65B 1PPZA 3QN7A 1HJAC 1V3XA 1Z8GA 3A7ZA 3MNXA 3FANA 1EATA 1YPLH 1H9LB 2IOTA 1J17T 3GCTG 1DOJA 5A0BA 1P9UA 1TWXB 3A8CA 2A32A 2XC0A 2R3YA 1ESTA 3STIA 3L33A 4I33A 4X8TH 1SG8B 1EKBB 3M7QA 5ESTE 1D6RA 4TY7A 1TA2A 2UUFB 3SOSA 1EAUA 1O2KA 5FAHA 2K1QA 1TNGA 1AUJA 2VWOA 1C1OA 3KQEA 3NWUA 2O8TA 1O3PB 2IJOB 4Y79A 2FIRH 1Y3VA 3TNSA 1GCTC 1QY6A 1D9IA 1VITF 4XBBA 2BVSH 3GY2A 3RU4E 3RMMH 4YT6H 1QBOA 5DG6A 1GHWH 3EAJA 3LGWA 5HYOA 2OQ5A 2HRVA 5EPYA 2XWBI 3BG8A 1T4UH 2GTBA 2THFB 1SGNE 2ZP0H 1C5NH 3ZYEA 4O03A 3V13A 2QY0B 3SQEE 3S9AA 4X8VH 1PPGE 4NZQA 1OSSA 2P16A 1ZPBA 2ZFSA 1WV7H 4O9VA 1YF4A 1O2JA 1FQ3A 5DKMA 4THNH 2NWNA 2PKSC 5HMAA 2GD4B 5PTPA 1AB9B 1HUTH 2XNIA 4X6NA 4YM9A 4J2YB 1Z8JB 1H9IE 2QCYA 1MTNB 1F5KU 2XWAA 4NSYA 3KF2A 1O2QA 4GCHF 3TH2H 3ZZAA 1O5FH 1YCPM 3EA9A 1G3DA 2J9NA 1IQHA 5CHAC 1HAOH 2XW9A 1LTOA 2D8WA 2QGRA 5E0GA 1QIXB 3M36A 2WINI 1XUGA 1GI1A 3VXEH 2H2ZA 3Q77A 1C2IA 4BOHA 1BOQA 1SPJA 2VIWA 4K1TA 1CQQA 1CBWB 1DS2E 3RXOA 4NIXA 1BTYA 4B74A 3RC4A 5FPSA 3U69H 3LC5A 1N8OB 1IAUA 2PV9B 4TWYA 1GVLA 4Z0KA 1O32A 3RXAA 1PYTC 1LKBA 5H4IB 3RXJA 5F03A 5FPYA 2VIPA 3O8DA 3SGQE 1O3JA 1Z8IB 1AMHA 4ZHMU 2F9VA 3SUFA 3C27B 4CRBA 1LHEH 2FS9A 2DUCA 1GCTB 2ZFQH 2AIPA 5GJ4B 6ESTA 1KXDA 1UCYH 1P10A 1HNEE 3E8LA 1OXGA 1T7CA 5FXLA 2ZQ1A 1FY1A 1NRRH 1YPEH 4AG2A 1KSNA 1MCTA 1C2GA 1P06A 1AKSA 1P12E 2BLWA 4AN7A 3HKIB 2GZ8A 2PWXA 2WPJS 1QFKH 1BHXB 4CH8B 1DY8A 1ZPCA 4ABJA 1Z1IA 1W0YH 3F1SB 3U98H 3QO6A 2C93B 2BLQA 1V2PT 1P03A 1SGEE 1UMAH 2ZHWH 1UVPA 1P0SH 1XVOA 1TBZH 4WF8A 1D3TB 1MQ5A 1J14A 1D4PB 2ANYA 3T27A 3SJIA 4ZXXH 3VXFH 2BLVA 1MU8B 2F83A 1SFIA 1MAXA 3ATMA 1AGJA 5EXNA 2Y5FA 2C8WB 2SGQE 3V3MA 1YPMH 4RSPA 2BDGA 1T8NA 2Y6TA 4KKDA 3U9AH 2F9PA 1OWEA 2IPHA 1HLTH 2Q6DA 3MWIU 4IMZA 1LVYA 3U8OH 5LH8A 1NFYA 3DUXH 2RA0A 3R0FA 5AFYH 1PPBH 2AGIX 3ATWA 1XXFA 2BDYA 3RXLA 2R9PA 1T8LA 3TIUA 1C4Y2 5CHAB 1MKXK 3E6PH 5HM9A 3HK6B 2J92A 2TIOA 1TABE 1O3NA 1RRKA 4NIVA 4Y7AA 3RDZA 2FM2A 3QLPH 2W3KA 4I8LA 1KTTB 2FLBH 2A5KA 2FZZA 4FU9A 1GHBF 5FBIA 3E16B 3SNAA 5ESBA 4YOJA 3RMOH 1MTSA 3A80A 1P3EA 4FUDA 3BTEE 1TNIA 2VGCB 1JMOH 4WY3A 2FTMA 4X1PU 4Y71A 4F4OC 4MPVA 2XRCA 3SNBA 1C5LH 1P8VC 1QCPA 4YO9A 1P02A 1NTPA 4IBLH 2ALVA 3T29A 4NSVA 2BOKA 2ODPA 1GJAB 1PYTD 1AU8A 3P8OA 4FUJA 3SV2H 1DFPA 1IQFA 4ISNA 3M3TA 1YPJH 3QUMP 1V2WT 3RU4D 3Q76A 4BXWA 2ILNA 4X8UH 3MU1A 4TWWA 2ZTZA 3GCHB 2VIVA 3DFLA 2ANMH 3RC6A 3QGJA 1AZ8A 2BY9X 3GCOA 1GHBG 1ORFA 1WYKA 3BTGE 4GVUA 1GI2A 1DWCH 2QXJA 3PTNA 1FV9A 4U01A 4FU8A 1FZZA 3Q00A 1GBHA 1HAVA 1Y3UA 2EI6A 5ETXA 2HPQH 3OY6U 4IC6A 2EEKA 2BQ7B 3NKKA 1THPB 7GCHG 2DE9A 1CHOF 2XCNA 1OP2A 3PMHB 3VB3A 1JBUH 1HJ8A 5LGOA 1V2QT 2TGPZ 3BEIB 1BMNH 5J4QA 1FAXA 1SGYE 2B8OH 2CGAA 4INHA 3RXSA 1DPOA 3SN8A 2HVXA 3AW0A 4GSOA 1DM4B 4RKJB 1FN8A 3MU8A 4K1SA 1YCPK 1S82A 2W7UA 6CHAB 2JETB 1GMCG 4RN6A 2R2MB 1GJ7B 2ZWLH 3P95A 2ZQ2A 2OCVB 1A1RA 4XSKU 3ITIA 2O8WA 5JBCS 2BZ6H 4ZUHA 2Q6FA 2J2UA 1J15A 4INLA 2F9UA 1LCYA 2W5EA 1Z1JA 3VGCB 1GJ6A 1JIRA 1CU1A 2OLGA 3URCA 5DGJA 1KY9A 2GX4A 1UVUH 1O3FA 3TK6A 3M5MA 1FPHH 3A89A 1E0FD 1GBBA 3O8RA 1GMHG 5CE1A 1NY22 1QQUA 2BXTH 4U32A 4JMYA 5DPAA 4FUBA 1Z7KA 4NA9H 1S81A 3UREA 4Y76A 3HPTB 2G52A 1BTXA 3GY8A 3K6ZA 2ZCHP 3SGBE 2W3IA 2O8MA 1MD7A 1QTFA 1YC0A 4D9RA 3PV4A 2EI8A 2QC2A 1PQAA 1K1LA 3LT3A 3BTDE 1ETSH 3GCTF 2F91A 5FCKA 1FMGA 3FZZA 3HGPA 3AW1A 4Z6AH 3TH4H 1L1GA 1DICA 3SV6A 2Z3CA 1SI5H 3HK3B 4LXBH 1JRTA 3A87A 1O2VA 4KGAA 2QF0A 3W95A 1ZYOA 1GI0A 2PGBB 4H6SB 4ABHA 1SC8U 1GDUA 4DURA 1UCYE 3UR9A 2YOLA 2FLRH 4A6LA 2HWLB 1OOKB 1FAKH 2Q6GA 2VIDA 1LHGH 5JBAS 4X1NU 3OY5U 1FXYA 3E0NB 1GHAG 1D6WA 1DWBH 1BTHH 4ZKNU 3GY4A 2UWLA 1PQ5A 1TRMA 1P3CA 5L30H 1ZMLA 4MTBA 1MTUA 1ZOMA 1O2GH 3RXDA 3ZVFA 1QJ1B 1RJXB 1SLVB 6CHAC 1IHTH 1ELDE 4A1XA 1NFXA 4XFQA 1JIMA 1DWEH 1C5QA 1HAXB 3ZV9A 2I6SA 3E1XB 4R0IA 4Y6DA 3K6YA 2P95A 4XE4A 4SGAE 3VGCC 1A4WH 3UPEA 1RS0A 3MU4A 1BMMH 2P93A 4ZHLU 2WPMS 3QDZB 1YLCA 1HIAA 4OS6A 1EAWA 2BQ6B 2FODA 5EW2H 2ZGHA 3T62A 4CBOA 2PKAB 1GHVH 1PPFE 3U1IB 3B8JA 2OXSA 4U2WA 1TPAE 4CRDA 4FVDA 4FUIA 2EC9H 5EOKA 4MDSA 1GBEA 4UONA 4JZIA 3K2UA 2ZPQA 1C5ZB 5DO4H 3LPRA 1P2IA 1SGFA 1BTUA 4Y0YE 1D3QB 2BTCE 1ELGA 4Q7XA 2ZI2H 2J34A 4XOJA 2FYRA 3ESTA 2G55A 5AF9H 3L6PA 1ZLRA 2Y5HA 1N6XA 2Y81A 4K5ZA 4TPYA 2CHAB 2PKAA 2QAAA 1TOMH 1DY9A 2BZAA 2LNCA 1BRUP 3PM3A 3TVJB 2A5IA 5L6NH 1UTOA 2FP7B 3A8AA 1AE5A 1FY4A 4IC5A 4AB9A 4YOIA 4MNVA 1GJ4H 5AHGH 3UIRA 1QURH 1TX7A 2BDHA 1O3GA 1XKBC 1UTQA 2BXUH 4ZKRU 4AZ2B 5JBTA 1VGCB 2PTCE 1EJAA 2CN0H 2JH0D 1V2RT 2FOHA 3GDSA 2PW8H 3TGKE 3GICB 5C5NA 2CV3A 1FPCH 2WV4A 3A81A 5FX6A 2GZ9A 2VINA 1XUFA 1MBQA 2F9NA 2D2DA 3SQHE 2VWNA 2ZU2A 2GMTC 2C90B 3GOVB 4HTCH 1FY3A 1C1RA 1KLJH 3FP7E 2FX6A 3RXIA 2G81E 1L0ZA 4OS2A 3P8NA 2GDDA 2R3UA 2G8TA 1W10U 4X6PA 2V6NA 4JYTA 5EU8A 4ABEA 5T3HA 1G36A 2NU1E 3F9FA 1AE8H 3ZZDA 3QZQA 3MNCA 1TPOA 4HI3A 3V12A 3UOPA 2G5VA 2ZECA 1A3BH 1IQGA 1Z8RA 2SGFE 1IQEA 4CBNA 1UTLM 2SGEE 1N6YA 1O2XA 1IOEA 1C5UA 2BD3A 4IGDA 2GCHG 3UQOA 3ELAH 1TX8A 1TMBH 3F68H 1A0JA 1V6DA 3SORA 1WU1A 2GGVB 2VVVA 1SGQE 1C2EA 3KGPA 2O8LA 1GBKA 1EB2A 1ZHMA 2Y7XA 2LPRA 2ODYB 5FPTA 3P70B 1YYY1 2BX3A 2ZGXH 2GCTC 4Q2KA 3M37A 2XCFA 4CRGA 1BRCE 1O5EH 3N7OA 3MI4A 1EJNA 4LK4A 1B0EA 1G9IE 4NFEA 4X1RU 3RU4T 2AEIH 1HBTH 1L1JA 1CSOE 1MKWH 2ZIQH 2W7SA 1A0HB 3MO9A 1FIZA 3H7TA 2JH6D 4ISOA 5C1UA 1RGQA 1GBMA 4MPUA 3SV8A 1C4V2 2B9LA 1GI5A 1O2WA 1RIWB 4I8KA 2F9OA 4K3JA 4FU7A 1O5BB 2CMYA 3GY6A 3M61U 4D76A 1Q3XA 2HPPH 4AYYB 4MPXA 4H42U 1ZRKA 1HAPH 1YGCH 1O2PA 2V35A 3QTOH 4XBCA 1GDNA 3RXGA 1WQSA 1ZHRA 1V2ST 1XVMA 3E90B 2OBOA 3LGTA 5DP3A 1O34A 1CGIE 1GBTA 3I78A 1S84A 5LPFA 1EZQA 1AB9C 1M9UA 1WTHD 1TGTA 3A82A 3EA7A 3IITA 1Z71A 4J1YA 1VCQA 4JYUH 5FX5A 3GYLB 1ELBA 4NIYA 2G4TA 3BG4B 3EQ0H 1NN6A 2XBXA 4MPWA 3HGNA 1QNJA 4WMEA 8KME2 1HRTH 1F7ZA 1P2OA 1C2DA 3SI3H 1UTNA 4MVNA 3STJA 4FUEA 1AN1E 3SU2A 4BXSA 3SNDA 6GCHF 1N8OC 3DD2H 3RP2A 1BRAA 3MHWU 2FOGA 3RXCA 1MTWA 1K22H 2WYJA 3TGJE 1K1OA 4TYDA 4WVPE 1GHZA 2BDBA 1O36A 2A2XH 8LPRA 3V7TA 4GLYA 8ESTE 4UE7H 1O35A 3ZZ4A 1ESAA 1WAYB 1MTVA 1GBDA 4YT7H 4FUHA 2FYQA 2TGDA 5EODA 1TMTH 3M5LA 3QGNB 4BAKB 1HAGE 3MTYA 3K9XB 2C8ZB 2JETC 2BM2A 3T26A 1GVZA 2ZCKP 4Y10E 4CR9A 2C8XB 3U8RH 4ABFA 1ZSLA 2GT8A 1GVKB 1SQOA 3IG6B 3E0PB 1UTKA 3SGAE 1DLKB 1UK3A 1C1MA 1B5GH 1C9TA 5CMXH 7LPRA 1GJ5H 4I7YH 1RTFB 1CT4E 2J4IA 1GGDB 4ZHAA 1ELCA 3BTFE 1SSXA 1IQKA 3OSYA 4Q7ZA 3TJVA 3ZZ9A 1GI7B 4BAHB 5JDUB 1INCA 2ODQA 3SJOA 4YZUA 1NZQH 3RXHA 2HNTF 3OX7U 1NM6A 5TCAA 1QRWA 1GWAA 5EQQA 1K2I1 2EA3A 5A2MH 2H9EH 4BAOB 2ZHDA 2R0LA 3TGIE 3ODFA 1AFQC 1BTZA 1YPHE 3LGYA 1ZJKA 2O9QA 1RTLA 3S7HB 1VITG 1KXCA 1BBRK 4X6MA 1C1TA 1AUTC 1G3EA 3SU4A 3SU1A 1TFXA 4ABDA 4LOYH 4DIIH 4CREA 3S69A 3OTJE 1GBLA 1ZR0A 3LIWA 2VIOA 4XBDA 1O2LA 2F3CE 2BOHB 1F0RA 4ZXYH 1C5XB 1P2NA 3RXUA 2A45B
chains in the Genus database with same CATH superfamily
1WSSH 1HAHH 3PO1C 3S0NA 1O3MA 2PKSB 2GDEH 3F6UH 2FOCA 2A7HA 1GCDA 2ESTE 2IPQX 4AB8A 1AWFH 4TY6A 1O33A 1HXEH 1FDPA 5HGGA 2AS9A 2XBVA 4K69A 3CS0A 3LGIA 1BBRE 3ATKA 3MO3A 4GCHG 5C1XA 4FVBA 2WYGA 4X0WU 1FLEE 1SL3A 1TNJA 2P3TB 3D49H 1GL0E 4JZ1A 1F5LA 2ZFTA 2C4FH 1TE0A 4Y8XA 2H9HA 2ZGCA 3SU3A 2W26A 2KCPA 3FFGA 1DLEA 3T2NA 1MTNC 3OAAD 4PROA 4DOQA 5GXPA 3LKWA 5I46H 2FEQH 1O3HA 2NU0E 3KHVA 1C5TA 1DVAH 1GJBB 3SUDA 3SHAH 1ANCA 1XUKA 3RXRA 5GDSH 3QX5H 1WCZA 2WPLS 1DITH 2WPIS 4ZKSU 1THSH 5T6DA 1AY6H 1QRZA 2G51A 2V3MA 5EJLA 1C1WH 1HIAB 4B71A 1QJ6B 2A31A 2GCHF 3DSOA 2XTTB 4AORA 7GCHF 3M7TA 4FETA 2BD7A 2QXIA 4Y0ZE 5BPEA 3CP7A 2QIQA 3TH3H 3BTHE 1GJDB 1NESE 3ZZ7A 1S5SA 4BNRA 1WTGH 4GPGA 3EE0B 1UJ1A 1BCUH 1VJ9U 1E34B 1GG6B 1MKXH 1VR1H 1KLTA 1NFWA 3EDXB 3QK1A 1THRH 3RMNH 5A0CA 1EFRD 3Q3KA 1A5HA 2TGAA 1BZXE 3S9BA 1BQYA 4ACAA 9LPRA 8GCHG 3M35A 4DVAU 2ZKSA 3B9FH 1GBAA 3BG4C 1CO7E 1A0LA 1CHGA 1OP8A 1RFNA 3P17H 3SU0A 4AGJA 1O3OA 1DUAA 1V2TT 4OS4A 1ZSKA 4WXVA 1GJCB 3A7YA 1MMJN 1QB6A 1ELFA 2ZGJA 2F4LA 2PUXB 2A2QH 1O3EA 2SNVA 4FUFA 3KQCA 2J98B 3LC3A 1G2MA 3NK8A 3RXFA 3GY3A 1FY8E 4K2YA 3EGKH 3NXPA 1EX3A 2G00A 2Q1JA 2GMTB 1A2CH 4Q7YA 4DW2U 1SOTA 1TX6A 1QZ8A 3ENSB 1O31A 2P94A 2FDAA 1WBGB 1P2KA 5JPMH 3UWJH 4UFEH 1SBWA 2Z3EA 2J38A 4Y8YA 1TGCA 2UUJB 3MOCA 5DN6D 2XC4A 2SGDE 3ZZ5A 1UTMA 2GJGA 2YMSB 3QZRA 2Z94A 3D62A 1E36B 2PTNA 3ZZ8A 3BN9A 1GPZA 1QBVH 1O38A 3UUZA 3F9EA 4AG1A 1XKAC 4KTUA 3RM0H 1QRXA 4H4FA 1Q2WA 1EOLA 1OYTH 2AIQA 2ZHEH 2CK3D 2L6OA 2R0KA 1C2KA 3BTME 4Q80A 2QF4A 3LU9B 4WH8A 1UVOA 4LZ4B 1EPTC 4FUCA 5DP8A 5BRRE 1SQAA 1T31A 1ANDA 4UDWH 2ZTXA 2ANWA 3PLPA 3MH6A 1TYNA 2WUBA 3A83A 4YLQH 4IN1A 3RM2H 2P3UB 3LJOA 3RXKA 3RXVA 2FOEA 2OTVA 3KIDU 3KQBA 3AVZA 3ZZ3A 2HLCA 3UR6A 2JDID 1A3EH 1KDQB 2P8OC 1EAIA 4BANB 1EASA 3ZVAA 5E8EH 4K60A 1W0ZU 2OC1A 3URDA 1RIWC 1S6FA 4ZAEA 2Y82A 1V2OT 1Y5AT 2ZDNA 1BITA 2BDAA 4FXGH 1XMNB 4I32A 3ZVEA 1KXEA 1BDAA 1EJMA 2OQUA 1F5RA 1K9OE 3SHCH 1UTJA 4ESTE 3A7WA 3KYFA 1GBFA 4NA8A 4A7IB 1S83A 4DY7B 4JCNA 1O5AB 1GI8B 3BEFB 2J5UA 2Z6BD 1F0UA 4AX9H 1FI8A 4AYVB 4MNXA 1CGHA 1HFDA 3RUOA 1K1IA 1O3DA 1LVMA 1O2NA 1TAWA 2JH5D 2Z7FE 3SU6A 2YMSC 3EE7A 2V0BA 1CE5A 2BD2A 3PMJA 3NPSA 1H4WA 3PMAB 4UEHH 4ASHA 1O3KA 2BB4A 4ABAA 2RG3A 1S0RA 1TNLA 2Z9KA 4GHQA 3A8DA 1XX9A 1L2EA 3PTBA 3PO1B 3VB4A 2NU3E 3N7EA 2BD8A 2VVCA 4I8JA 1XXDA 4X1QU 2IN2A 4A1VA 2ZF0H 2AYWA 2VH6A 3MU5A 4YESB 1TMUH 3TPIZ 1DSTA 2QYIA 5EIYA 2K8IA 2XYAA 5C67A 1P2MA 1C2FA 3KQDA 1IQIA 1WUNH 1RD3B 1VGCC 1U6QA 3V0XA 4ZROA 5JYIA 2PSYA 1EZSC 3ZVBA 3FP8E 5DK1A 5GCHF 3UOUA 3QWCH 4TPIZ 3F0OA 4A1TA 4Y8ZA 1GMDG 1MD8A 1C5SA 1T4VH 1P01A 1GMCF 5EXMA 5HIZA 4DCDA 4HGCA 1ELTA 4AOQA 3SJKA 1GI6A 5B6OA 1OWDA 5A8ZA 2FS8A 1O2MA 2TBSA 1MH0A 1HXFH 1IQNA 1O3IA 4ASUD 2JKHA 1Y3WA 2G5NA 3NUMA 1O39A 1UVTH 1QGFA 1SMFE 2ZDKA 5KEDA 3SV9A 5HXFA 4AC9A 1S85A 3C1KA 3SV7A 1Q31A 3BTKE 3GDUA 4X2VA 1DX5M 1KDQA 1TALA 4QT8C 3RLYH 1BB0B 1B7XB 5EW1H 1X7AC 1O3BA 2C8YB 2Y80A 4DT7B 5IDKA 4AGKA 3AK5A 4NWLA 1P57B 4JZFH 4KTSA 3MU0A 5I25A 2PUQH 1AFQB 2ZU1A 1W8BH 4OGYA 2PHBA 1P2QA 2KCAA 3Q3YA 2ZA5A 3GISB 1YKTA 2XC5A 3DA9B 2SGAA 5EQSA 1P9SA 3RLWH 4KELA 3GDVA 3LJJA 3M5OA 1ZTJA 2ZEBA 3VB5A 3U1JB 2ZU4A 4BAQB 1UTPA 1S6LA 4MNYA 1NPMA 4E06H 1PJPA 1QL7A 2ZHQH 6LPRA 2O8UA 3SNCA 2HNTE 1ZGVA 2BD4A 1GMHF 1W0KD 2I6QA 1W7XH 1G37A 3EYDA 2Z9IA 3PLBA 2GP9B 2KAIB 2B5TB 2HLDD 7ESTE 4B76A 1ID5H 1P09A 5F53A 2ULLA 1COWD 1C5MD 1Y8TA 1ANBA 3HATH 1J9CH 3LOXA 1KXFA 5IK2D 2ZZUH 2AERH 3A86A 3S7KB 2STBE 1CT2E 1GI3A 2QA9E 3SZNA 5F6MA 1BMLA 1O3LA 1Y3XA 4AFSA 1HDTH 3UNSA 1KMHB 1TGBA 3TK9A 5JB9S 3HKJB 1DUEA 2STAE 1NU9A 1XUHA 1GHXH 1GL1A 2ZFFH 5L2ZH 1HCGA 1OHHD 3MMGA 5E0HA 2WV5A 1LHDH 1P04A 5EXLA 4XDEA 2QXGA 3B23B 4F48B 1ARCA 1LPZB 2AMPA 2BVXH 3QTVH 2RDLA 4ABBA 3LDXH 2ZPRA 1TBRH 4MNWA 4Q4LA 5GIBA 4JYVH 2FMJA 4MG3A 3RMLH 1G30B 1C4U2 1K1NA 2D26C 1T8MA 2XXLA 2OP9A 1AVGH 2BHGA 2A4QA 3RXMA 3UFAA 1A61H 1QJ7B 1AVXA 1ZRBA 3RXBA 4INKA 1LPGB 1EPTA 4NWKA 2VJ1A 3CS7A 1DT2A 5GCHG 2XOKD 1FJSA 1H8DH 1SGTA 2FTLE 3UNQA 4JZDH 3MNSA 1T32A 3SBKA 1MZAA 1D3DB 2BYAX 1GJ8B 3I29A 1MQ6A 1NRSH 2BY8X 2AMDA 2BY6X 3MH5A 1EUFA 3LH1A 1SQRA 1O3CA 1TPPA 3AASA 2AMQA 1G32B 5F8ZA 5C3NA 5A8XA 1BHXF 5TCCA 1HAYB 2FOAA 1E79D 2ZFRH 3A7TA 1AFEH 3GY5A 5IYTA 5J4SA 1V2JT 3WWFA 1QBNA 1K1MA 4X2YA 1TNKA 4R8TB 1HAZB 3NCLA 1EP6A 3ZZCA 2VVUA 2QV1A 3A85A 1P05A 1YP9A 1E1RD 1W11U 1YPGH 2WPHS 3MNBA 1F2SE 3TJNA 2DE8A 1UK4A 1C2MA 1E35B 2BX4A 1HYLA 1PQ8A 1TIOA 3SNEA 1O2ZA 1VKYA 5E2PA 3A7XA 3SO3A 4LZ1H 1EZXC 2FOBA 2PR3A 2PSXA 1NRQH 1TB6H 3AAUA 1ZZZA 2RDEA 1Z6JH 3VFEA 1WQVH 3OYPA 5DJ7A 2KZ4A 4K8BA 3VEQB 1EZUC 1W3CA 4A92A 1C1VH 1GBJA 2GCTB 4NIWA 3RXEA 1SQTA 1ZSJA 2Y5GA 1VZQH 1C2HA 2BD5A 3WY8A 2R2WU 1ELAA 1O3AA 1W2KH 1W7GH 1V2MT 1K21H 3ZZBA 2C3SA 4O3UA 1TGSZ 5K0HA 1FY5A 1YCPH 3A7VA 3DFJA 3A8BA 3TJOA 1NS3A 1ZMJA 3PROA 1ZTKA 5C0UA 4NZLA 2EI7A 2H5DA 1PPEE 1TPSA 1NT1A 1SLUB 1YLDA 3ZYDA 2BQWB 1K0HA 3F3BA 3VB7A 1TOCB 3OEHD 1A5GH 1LKAA 3BV9B 2SNWA 5A09A 2ZG0H 4X8SH 4RKOB 2IJD1 1NBMD 3BSQA 1NROH 1OP0A 3NZIA 2ZTYA 3LH3A 2TPIZ 1O2SA 1ARBA 1OPHB 3LONA 5EGMA 3SI4H 2H1UA 2TGTA 4AFQA 5FCRA 3JZ1B 5ABWA 2CXVA 1SVPA 1QL8A 4HFPB 4O97A 2FO9A 2HNTC 1XM1A 3D65E 3UTUH 3S9CA 1C1UH 1C1SA 2J94A 3H5CB 2A7JA 1O0DH 1O2UA 2V3OH 3OFND 2M2AA 4IW4E 1ABJH 4KTCA 4BTTB 2P59A 3MFJA 5JBBS 2AGGX 1LDTT 1SGIB 2NU4E 3O8BA 1SGRE 1BJVA 1EQ9A 4D9QA 2Z9GA 3R3GB 1SB1H 2VB0A 4Q63A 3T25A 3TLOA 4DGJA 2FESH 2L74A 1C9PA 2AFQB 3BTWE 1IQMA 2A1DB 1G3CA 5DP4A 1HJ9A 1TLDA 2FI3E 3D23A 1JXPA 4E7NA 4DIHH 5HKKD 5T6FA 3M5NA 4AFUA 1NRNH 3GYMA 1UO6A 2OUAA 1LHFH 1L4ZA 3VB6A 2PP6A 3PV5A 1C2LA 1ZHPA 2AH4X 4DJZB 1DDJA 2ZFPH 2VU8E 2NU2E 1DXPA 1G3BA 1Y3YA 2KX4A 1QQ4A 4K8YA 2A4OA 4MQAA 1GG6C 1C2JA 1P11E 5F8TA 1AVWA 2ASUB 1O5CB 3KL6A 4NG9H 2VWMA 4DG4A 3OU0A 4RI0A 4E05H 1ELVA 3MO6A 5T6GA 2VH0A 2J95A 1J8AA 1HAIH 2UWPA 1J16A 1WXRA 3U28C 5L2YH 1TQ0B 1BUIA 1NRPH 1BIOA 3MYWA 4I8GA 4K1EA 3LGVA 1KTSB 3G01A 4WWYA 4GHTA 1O2HA 1E38B 3RXPA 3PB1E 1TBQH 1GI9B 1K1PA 2WPKS 4IS5A 2XBWA 1EOJA 3W94A 3FZDA 1CGJE 1CA8B 1ABIH 4VGCB 2VNTA 2HGTH 1BTPA 5TJXA 1HGTH 4U30A 1MBMA 2QF3A 1V2VT 4CHAC 1S0QA 2CJIA 3TJUA 1ELEE 5EQRA 1GDQA 2W6ID 1XUIA 2QF5A 1ZMNA 4I8HA 2BY5X 2OC7A 5SGAE 2KCOA 1ZPZA 1H1BA 2CHAC 1YPKH 3FAOA 1W13U 4WMDA 1NO9H 4MLFB 3UQVA 1KIGH 2KFWA 1FUJA 3KQ5A 1SLXB 4UFGH 4F55A 4F49A 1XUJA 4ISLA 4OM9A 1VJAU 4ZH8A 1JWTA 2ZCLP 2P3FH 4CRFA 1DE7H 2BY7X 3P6ZB 1SHHB 3SU5A 2H5CA 3VPKA 1LQEA 3DT0H 1UHBB 1CT0E 1A46H 1TNHA 1N1LA 1NBME 5EPNA 1RXPA 1SGPE 2HVYB 1OWIA 5C2ZA 1B0FA 2BMGB 3VG8A 3BTTE 3KNXA 1GJ9B 2M5TA 5G4BA 5GPIB 1SR5C 1Y5UT 3P8FA 4VGCC 4B73A 4CRAA 1C1NA 4WH6A 5DP9A 4ABGA 1O37A 4I31A 5E2OA 1QL9A 2ZDLA 3GY7A 4OS5A 4B6FA 5K7RA 1OKXA 1QA7A 1QR3E 1GI4A 1HPGA 3KCGH 2Z3DA 2UUKB 1ESBA 1QA0A 1EXFA 1UHBA 1C1QA 1F0SA 2GZ7A 3RXTA 1PFXC 2BLOA 2VWLA 2B7DH 1DSUA 4JK5A 1O30A 2UWOA 6GCHG 1DANH 1O2IA 1OS8A 2B0FA 1ZJDA 1AD8H 1O2OA 4M7GA 1O5GH 1O2RA 2PFEA 5A0AE 1ETTH 1G2LA 1BT7A 1PPHE 2A5AA 2Y7ZA 3EA8A 3IWMA 1UK2A 1BJUA 3F9GA 1SHYA 3BIVH 4OS1A 2ZC9H 1HAVB 5FBEA 1LVOA 2KAIA 1W14U 3I77A 2XBYA 3BIUH 1IHSH 2BVRH 2GVFA 3DCLA 1BBRH 1O2TA 1BA8B 5DP7A 4X6OA 3SW2B 2OBQA 2PLXA 3BF6H 1C5PA 1YLNA 1W12U 5FHTA 3PWBA 3Q3XA 3FVFB 1SGDE 1MU6B 4HZHA 3E3TA 1OX1A 3PMBB 4X1SU 2BD9A 1F92A 1AO5A 3DHKH 2FI5E 4YTAA 1AKSB 1AHTH 1SFQB 2GV6A 1O5DH 5HM2A 1KLIH 1MCVA 4NFFA 1HB0B 4WMFA 3SUEA 3M3VA 4B2BA 1A5IA 1S6HA 1F0TA 4X2XA 3ZVGA 5F8XA 1AIXH 2OINA 3SJ8A 2J97A 2A0QB 1P2JA 1WOFA 1V2UT 3BEUA 3OE7D 3UAIC 1SGFG 1OWHA 2H6MA 1CA0B 2PGQB 2WSSD 2A7CA 4Y7BA 1OYQA 4D8NA 4AFZA 1NFUA 3F0PA 4UFFH 4E7RG 1QHRB 1LQDB 4UD9H 4M9FA 1UVSH 2SGPE 4NGAH 1FN6A 3ZVDA 1SLWB 2FOFA 3GCNA 3AAVA 3M3SA 2QXHA 1SGCA 3WW7A 1D3PB 4OGXA 3MH7A 3U8TH 3P92A 1TONA 1GMDF 1PQ7A 2FXRA 4CR5A 3O8CA 5EG4A 2RCEA 7KMEH 1FIWA 1VCPA 1Z6EA 4NCYA 4OS7A 4BTUB 1K28D 4GUXA 4Y11E 4B2CA 4KP0A 3UWIA 1HJAB 5GWZA 4IMQA 3F9HA 3TITA 5LPEA 2ZGBH 3ATLA 1W0JD 2VGCC 1C5YB 2GT7A 3ZVCA 1UCYK 2BDIA 3M7UA 3MH4A 3A88A 3BTQE 4H6TA 1L1NA 2ZDAH 2OC0A 3CENA 4YLUA 1ACBE 3LGUA 2UUYA 1QB9A 2YNBA 4NA7A 4O3TA 1MZDA 2ZNKH 1IQJA 2G4UA 1GBIA 1MABB 3TNTA 1CHOG 2OD3B 1ETRH 4B1TA 1KYNA 3L3TA 5C5OA 1FNIA 4D7GA 5EJ1A 1AI8H 2ZPSA 3CNRA 4IN2A 1RTKA 5CHBA 1Y59T 4YOGA 3T28A 2AGEX 2JJ1D 1K1JA 2HALA 5LPRA 2GKVE 4ZKOU 2A4RA 2BDCA 4D7FA 1VCWA 4B2AA 3TK5A 5C1YA 4ISIH 5E0JA 3RXQA 1EB1H 3H7OA 3A84A 4CH2B 3T5FH 2FWWA 1SOZA 2OC8A 3SUGA 2FOMB 1AZZA 1C5RA 4GAWA 1T8OA 4SGBE 1MKWK 2H9TH 1TA6A 1H8HD 1E37B 3GCHC 3JZ2B 1DXWA 2ANKH 4UFDH 1GGDC 2ZU5A 4BTIB 1C5WB 4BAMB 1EAXA 3KN2A 1H9HE 1QB1A 1LVBA 4ABIA 3KEEA 1WDIA 2FPZA 1BMFD 1AQ7A 1JOUB 1Y5BT 3SJ9A 1C5OH 3RC5A 1KXAA 4XRNA 2QN5T 4CHAB 4X2WA 1YM0A 1LHCH 2RA3A 5AVDA 1DWDH 3F2FA 1OWJA 2GV7A 8GCHF 4B6EA 1VITH 2ZDMA 4FOUC 1TGNA 1TRNA 1LMWB 5DP5A 3UNRA 3ODDA 1ZTLA 5C20A 1PPCE 2V3HH 2YNAA 3UY9A 3TU7H 1O2YA 1YBWA 2HOBA 5A8YA 2ALPA 2Z9LA 2CF9H 3SYJA 1ZGIA 1CVWH 3ATIA 4WJG2 2ZHFH 2CF8H 3PYHA 3NRLA 1GHYH 2ZU3A 2TRMA 1FONA 3ZV8A 2ZDVH 2K0QA 3ZZ6A 1TQ7B 1MAYA 1ANEA 1YPHC 3F2HA 4JZEH 5DP6A 5JB8S 1AWHB 9ESTA 1C1PA 2A4GA 2Z9JA 3P8GA 2SFAA 1BMAA 1L4DA 4WXIA 5CDFE 2VIQA 5AFZH 3FOAA 1EP5A 1NC6A 1LPKB 1LO6A 1EPTB 1NU7B 1CA0C 2WUCA 3PWCA 4FUGA 1C5VA 4ISHH 1GHAF 4CRCA 1TRYA 1GBCA 2FX4A 1BRBE 4A5TS 1MUEB 4B75A 1V2NT 2D1JA 3PLKA 1HV7A 1IQLA 2XNDD 2P8OB 2F9BH 1V2KT 4JK6A 1V2LT 2ZO3H 1A7SA 4ZCNA 1BTWA 3FP6E 4ZMAH 1OWKA 1KXBA 1H8IH 2FI4E 1CBWC 1JRSA 3E91A 3K65B 1PPZA 3QN7A 1HJAC 1V3XA 1Z8GA 2WPDD 3A7ZA 3MNXA 5KECA 3FANA 1EATA 1YPLH 1H9LB 2IOTA 1J17T 3GCTG 1DOJA 5A0BA 1P9UA 1TWXB 3A8CA 4TSFD 2A32A 2XC0A 2R3YA 1ESTA 1YWUA 3STIA 3L33A 4I33A 4X8TH 1SG8B 1EKBB 3M7QA 5ESTE 1D6RA 4TY7A 1TA2A 2UUFB 3PRDA 3SOSA 1EAUA 1O2KA 5FAHA 2K1QA 1TNGA 1AUJA 2VWOA 1C1OA 3KQEA 3NWUA 2O8TA 5KGOA 1O3PB 2IJOB 4Y79A 2FIRH 1Y3VA 4HG6A 3TNSA 1GCTC 1QY6A 1D9IA 1VITF 4XBBA 2BVSH 3GY2A 3RU4E 3RMMH 4I86A 4YT6H 1QBOA 5DG6A 1GHWH 3EAJA 3LGWA 5HYOA 2OQ5A 2HRVA 5EPYA 2XWBI 3BG8A 1T4UH 2GTBA 2THFB 1SGNE 2ZP0H 1C5NH 3ZYEA 4O03A 3V13A 2QY0B 3SQEE 3S9AA 4X8VH 1PPGE 4NZQA 1OSSA 2P16A 1ZPBA 2ZFSA 5B6LA 1WV7H 4O9VA 1YF4A 3N7DA 1O2JA 1FQ3A 5DKMA 4THNH 2NWNA 2PKSC 5HMAA 2GD4B 5PTPA 1AB9B 3W1EA 1HUTH 2AHME 2XNIA 4X6NA 4YM9A 4J2YB 1Z8JB 1H9IE 2QCYA 1MTNB 1F5KU 2XWAA 4NSYA 3KF2A 1O2QA 4GCHF 3TH2H 3ZZAA 3H09A 1O5FH 1YCPM 3EA9A 1G3DA 2J9NA 1IQHA 5CHAC 1HAOH 2XW9A 1LTOA 2D8WA 2QGRA 5E0GA 1QIXB 3M36A 2WINI 1XUGA 1GI1A 3VXEH 2H2ZA 3Q77A 1C2IA 4BOHA 2KR7A 2LP6A 1BOQA 1SPJA 2VIWA 4K1TA 1CQQA 1CBWB 1DS2E 3RXOA 4NIXA 1BTYA 4B74A 2WV9A 3RC4A 5FPSA 3U69H 3LC5A 1N8OB 1IAUA 2PV9B 4TWYA 1GVLA 4Z0KA 1O32A 3RXAA 1PYTC 1LKBA 5H4IB 3RXJA 5F03A 5FPYA 2VIPA 3O8DA 3SGQE 1O3JA 1Z8IB 1AMHA 4ZHMU 2F9VA 3SUFA 5C17A 3C27B 4CRBA 1LHEH 2FS9A 2DUCA 1GCTB 2ZFQH 2AIPA 5GJ4B 6ESTA 1KXDA 1UCYH 2QE7D 1P10A 1HNEE 3E8LA 1OXGA 1T7CA 5FXLA 2ZQ1A 1FY1A 1NRRH 1YPEH 5DSFA 4AG2A 1KSNA 1MCTA 1C2GA 1P06A 1AKSA 1P12E 2BLWA 4AN7A 3HKIB 2OK5A 2GZ8A 2PWXA 2WPJS 1QFKH 1BHXB 4CH8B 1DY8A 1ZPCA 4ABJA 1Z1IA 1W0YH 3F1SB 3U98H 3QO6A 2C93B 2BLQA 1V2PT 1P03A 1SGEE 1UMAH 2ZHWH 1UVPA 1P0SH 1XVOA 1TBZH 4WF8A 1D3TB 1MQ5A 1E1QD 3FO8D 1J14A 1D4PB 2ANYA 3T27A 3SJIA 4ZXXH 3VXFH 2BLVA 1MU8B 2F83A 1SFIA 1MAXA 3ATMA 1AGJA 5EXNA 2Y5FA 2C8WB 2SGQE 1UW7A 3V3MA 1YPMH 4RSPA 2BDGA 1T8NA 2Y6TA 3ZIAD 4KKDA 3U9AH 2F9PA 1OWEA 2IPHA 1HLTH 2Q6DA 3MWIU 4IMZA 1LVYA 3U8OH 5LH8A 1NFYA 3DUXH 2RA0A 3R0FA 5AFYH 1PPBH 2AGIX 3ATWA 1XXFA 2BDYA 3RXLA 2R9PA 1T8LA 3TIUA 1C4Y2 5CHAB 1MKXK 3E6PH 5HM9A 3HK6B 2J92A 2TIOA 1TABE 1O3NA 1RRKA 4NIVA 4Y7AA 5EJZA 3RDZA 2FM2A 3QLPH 2W3KA 4I8LA 1KTTB 2FLBH 2A5KA 2FZZA 4FU9A 1GHBF 5FBIA 3E16B 3SNAA 5ESBA 5FL7D 4YOJA 3RMOH 1MTSA 3A80A 1P3EA 4FUDA 3BTEE 1TNIA 2VGCB 1JMOH 4WY3A 1YY3A 2FTMA 4X1PU 4Y71A 4F4OC 4MPVA 2XRCA 3SNBA 1C5LH 1P8VC 1QCPA 2EQNA 2EY4C 4YO9A 1P02A 1NTPA 4IBLH 2ALVA 3T29A 4NSVA 2BOKA 2ODPA 1GJAB 1PYTD 1AU8A 3P8OA 4FUJA 3SV2H 1DFPA 1IQFA 4ISNA 3M3TA 1YPJH 3QUMP 1V2WT 2LELA 3RU4D 3Q76A 1SKYE 4BXWA 2ILNA 4X8UH 3MU1A 4TWWA 2ZTZA 3GCHB 2VIVA 3DFLA 2ANMH 3RC6A 3QGJA 1AZ8A 2BY9X 3GCOA 1GHBG 1ORFA 1WYKA 3N99A 3BTGE 4GVUA 1GI2A 1DWCH 2QXJA 3PTNA 1FV9A 4U01A 4FU8A 1FZZA 3Q00A 1GBHA 1HAVA 1Y3UA 2EI6A 5ETXA 2HPQH 3OY6U 4IC6A 2EEKA 2BQ7B 3NKKA 1THPB 7GCHG 5C0TA 2DE9A 1CHOF 2XCNA 1OP2A 3PMHB 3VB3A 1JBUH 1HJ8A 5LGOA 1V2QT 2TGPZ 3BEIB 1BMNH 5J4QA 1FAXA 1SGYE 2B8OH 2CGAA 4INHA 3RXSA 1DPOA 3SN8A 2HVXA 3AW0A 4GSOA 1DM4B 4RKJB 1FN8A 3MU8A 4K1SA 1YCPK 1S82A 2W7UA 6CHAB 2JETB 1GMCG 4RN6A 2R2MB 1GJ7B 2ZWLH 3P95A 2ZQ2A 2OCVB 1A1RA 4XSKU 3ITIA 2O8WA 5JBCS 2BZ6H 4ZUHA 2Q6FA 2J2UA 5T1VA 3F2GA 1J15A 4INLA 2F9UA 1LCYA 2W5EA 4P00A 1Z1JA 3VGCB 1GJ6A 1JIRA 1CU1A 2OLGA 3URCA 5DGJA 1KY9A 2GX4A 1UVUH 1O3FA 3TK6A 3M5MA 1FPHH 3A89A 1E0FD 1GBBA 3O8RA 1GMHG 5CE1A 1NY22 1QQUA 2BXTH 4U32A 4JMYA 5DPAA 4FUBA 1Z7KA 4NA9H 1S81A 3UREA 4Y76A 3HPTB 2G52A 1BTXA 3GY8A 3K6ZA 2ZCHP 3SGBE 2W3IA 2O8MA 1MD7A 1QTFA 1YC0A 4D9RA 3PV4A 2EI8A 2QC2A 1PQAA 1K1LA 3LT3A 3GS9A 3BTDE 1ETSH 3GCTF 2F91A 5FCKA 1FMGA 3FZZA 3HGPA 1FX0B 3AW1A 4Z6AH 3TH4H 1L1GA 1DICA 3SV6A 2Z3CA 1SI5H 3HK3B 4LXBH 1JRTA 3A87A 1O2VA 4DT4A 4KGAA 2QF0A 3W95A 1ZYOA 1GI0A 2PGBB 4H6SB 4ABHA 1SC8U 1GDUA 4DURA 1UCYE 3UR9A 2YOLA 2FLRH 4A6LA 2HWLB 1OOKB 1FAKH 2Q6GA 2VIDA 1LHGH 5JBAS 4X1NU 3OY5U 1FXYA 3E0NB 1GHAG 1D6WA 1DWBH 1BTHH 4ZKNU 3GY4A 2UWLA 1PQ5A 1TRMA 1P3CA 5L30H 1ZMLA 4MTBA 1MTUA 1ZOMA 1O2GH 3RXDA 3ZVFA 1QJ1B 1RJXB 4ACBA 1SLVB 6CHAC 1IHTH 1ELDE 4A1XA 1NFXA 4XFQA 1JIMA 1DWEH 1C5QA 1HAXB 3ZV9A 2I6SA 3E1XB 4R0IA 4Y6DA 3WWBA 3K6YA 2P95A 4XE4A 4SGAE 3VGCC 1A4WH 3UPEA 1RS0A 3MU4A 1BMMH 2P93A 4ZHLU 2WPMS 3QDZB 1YLCA 1HIAA 4OS6A 1EAWA 5HIYA 2BQ6B 2FODA 5EW2H 2ZGHA 3T62A 4CBOA 2PKAB 1GHVH 1PPFE 3U1IB 3B8JA 4XD7D 2OXSA 4U2WA 1TPAE 4CRDA 4FVDA 4FUIA 2EC9H 3OTPA 5EOKA 4MDSA 1GBEA 4UONA 4JZIA 3K2UA 2ZPQA 1C5ZB 5DO4H 3LPRA 1P2IA 1SGFA 1BTUA 4Y0YE 1D3QB 2BTCE 1ELGA 4Q7XA 2ZI2H 2J34A 4XOJA 2FYRA 3ESTA 2G55A 5AF9H 2JJ2D 3L6PA 3FN8A 1ZLRA 2F43B 2Y5HA 1N6XA 2Y81A 4K5ZA 4TPYA 2CHAB 2PKAA 2QAAA 1TOMH 4P02A 1DY9A 2BZAA 2LNCA 3MQKC 1BRUP 3PM3A 3TVJB 2A5IA 5L6NH 1UTOA 2FP7B 3A8AA 1AE5A 1FY4A 3DSPA 4IC5A 4AB9A 4YOIA 4MNVA 1GJ4H 5AHGH 3UIRA 1QURH 1TX7A 2BDHA 1O3GA 1XKBC 1UTQA 2BXUH 4ZKRU 4AZ2B 5JBTA 2JIZD 1VGCB 2PTCE 1EJAA 2CN0H 2JH0D 1V2RT 2FOHA 3GDSA 2PW8H 3TGKE 3GICB 5C5NA 2CV3A 2J98A 1FPCH 2WV4A 3A81A 5FX6A 2GZ9A 2VINA 1XUFA 3KYGA 1MBQA 2F9NA 4Z1MD 2D2DA 3SQHE 2VWNA 2ZU2A 2GMTC 2C90B 3GOVB 4HTCH 1FY3A 1C1RA 1KLJH 3FP7E 2FX6A 3RXIA 2G81E 1L0ZA 4OS2A 3P8NA 2GDDA 2R3UA 2G8TA 1W10U 4X6PA 2V6NA 4JYTA 5EU8A 4ABEA 5T3HA 1G36A 2NU1E 3F9FA 2WHXA 1AE8H 3ZZDA 3QZQA 3MNCA 1TPOA 4HI3A 3V12A 3UOPA 2G5VA 2VBCA 2ZECA 1A3BH 1IQGA 1Z8RA 2SGFE 1IQEA 4CBNA 2KM0A 1UTLM 2SGEE 1N6YA 1O2XA 1IOEA 1C5UA 2BD3A 4IGDA 2GCHG 3UQOA 3ELAH 1TX8A 1TMBH 3F68H 1A0JA 1V6DA 3SORA 1WU1A 3SZEA 2GGVB 2VVVA 1SGQE 1C2EA 3PV2A 3KGPA 2O8LA 1GBKA 1EB2A 3FKSD 1ZHMA 2Y7XA 2LPRA 2ODYB 5FPTA 3P70B 1YYY1 2BX3A 2W6JD 2ZGXH 2GCTC 4Q2KA 3M37A 2XCFA 4CRGA 1BRCE 1O5EH 3N7OA 3MI4A 1EJNA 4LK4A 2V7QD 1B0EA 1G9IE 4NFEA 4X1RU 3RU4T 2AEIH 1HBTH 4YXWD 1L1JA 1CSOE 1MKWH 2ZIQH 2W7SA 1A0HB 3MO9A 1FIZA 2RFKC 3H7TA 2JH6D 4ISOA 5C1UA 1RGQA 1GBMA 4MPUA 3SV8A 1C4V2 2B9LA 1GI5A 1O2WA 1RIWB 4I8KA 2F9OA 4K3JA 4FU7A 1O5BB 2CMYA 3GY6A 3M61U 4D76A 1Q3XA 2HPPH 4AYYB 4MPXA 4H42U 1ZRKA 1H8ED 1HAPH 1YGCH 1O2PA 2V35A 3QTOH 4XBCA 1GDNA 3RXGA 1WQSA 1ZHRA 1V2ST 1XVMA 3E90B 2OBOA 3LGTA 5DP3A 1O34A 1CGIE 1GBTA 3I78A 1S84A 4TT3D 5LPFA 3PRBA 1EZQA 1AB9C 1M9UA 1WTHD 2WZQA 1TGTA 3A82A 3EA7A 3IITA 1Z71A 4J1YA 1VCQA 4JYUH 5FX5A 3GYLB 1ELBA 4NIYA 2G4TA 3BG4B 3EQ0H 1NN6A 2XBXA 4MPWA 3HGNA 5C94A 1QNJA 4WMEA 8KME2 1HRTH 1F7ZA 1P2OA 1C2DA 3SI3H 1UTNA 4MVNA 3STJA 4FUEA 1AN1E 3SU2A 4BXSA 3SNDA 6GCHF 1N8OC 3DD2H 3RP2A 1BRAA 3MHWU 2FOGA 3RXCA 1MTWA 1K22H 2WYJA 3TGJE 1K1OA 4TYDA 4WVPE 1GHZA 2BDBA 1O36A 2A2XH 8LPRA 3V7TA 4GLYA 8ESTE 4UE7H 1O35A 3ZZ4A 5GNDA 1ESAA 2KCYA 1WAYB 1MTVA 1GBDA 4YT7H 4FUHA 2FYQA 2TGDA 5EODA 1TMTH 3M5LA 3QGNB 4BAKB 1HAGE 3UB0A 3MTYA 3K9XB 2C8ZB 2JETC 2BM2A 3T26A 1GVZA 2ZCKP 4Y10E 4CR9A 4RT0A 2C8XB 3U8RH 4ABFA 1ZSLA 2GT8A 1GVKB 1SQOA 3DSGA 3IG6B 3E0PB 1UTKA 3SGAE 3OEED 1DLKB 1UK3A 1C1MA 1B5GH 1C9TA 5CMXH 7LPRA 1GJ5H 4I7YH 1RTFB 1CT4E 2J4IA 1GGDB 4ZHAA 1ELCA 3BTFE 1SSXA 1IQKA 3OSYA 4Q7ZA 3TJVA 3ZZ9A 1GI7B 4BAHB 5JDUB 1INCA 2ODQA 3SJOA 4YZUA 1NZQH 3RXHA 2HNTF 3OX7U 4RT1A 1NM6A 5TCAA 1QRWA 1GWAA 5EQQA 1K2I1 2EA3A 5A2MH 2H9EH 4BAOB 2ZHDA 2R0LA 2YMSD 3TGIE 3ODFA 1AFQC 1BTZA 1YPHE 3LGYA 1ZJKA 2O9QA 1RTLA 3S7HB 1VITG 1KXCA 1BBRK 4X6MA 1C1TA 1AUTC 1G3EA 3SU4A 3SU1A 1TFXA 4ABDA 4LOYH 4DIIH 4CREA 3S69A 3OTJE 1GBLA 1ZR0A 3LIWA 2VIOA 4XBDA 1O2LA 2F3CE 2BOHB 1F0RA 4ZXYH 1C5XB 1P2NA 3RXUA 2A45B
chains in the Genus database with same CATH topology
1WSSH 1HAHH 3PO1C 3S0NA 1O3MA 2PKSB 2GDEH 3F6UH 2FOCA 2A7HA 1GCDA 2ESTE 4AB8A 1AWFH 4TY6A 1O33A 1HXEH 1FDPA 5HGGA 2AS9A 2XBVA 4K69A 3CS0A 3LGIA 1BBRE 3ATKA 3MO3A 4GCHG 5C1XA 4FVBA 2WYGA 4X0WU 1FLEE 1SL3A 1TNJA 2P3TB 3D49H 1GL0E 4JZ1A 1F5LA 2ZFTA 2C4FH 1TE0A 4Y8XA 2H9HA 2ZGCA 3SU3A 2W26A 3FFGA 1DLEA 3T2NA 1MTNC 4DOQA 4PROA 5GXPA 3LKWA 5I46H 2FEQH 1O3HA 2NU0E 3KHVA 1C5TA 1DVAH 1GJBB 3SUDA 3SHAH 1ANCA 1XUKA 3RXRA 5GDSH 3QX5H 1WCZA 2WPLS 1DITH 2WPIS 4ZKSU 1THSH 5T6DA 1AY6H 1QRZA 2G51A 1C1WH 1HIAB 4B71A 1QJ6B 2A31A 2GCHF 2XTTB 4AORA 7GCHF 3M7TA 2BD7A 2QXIA 4Y0ZE 5BPEA 3CP7A 2QIQA 3TH3H 3BTHE 1GJDB 1NESE 3ZZ7A 1S5SA 4BNRA 1WTGH 4GPGA 3EE0B 1UJ1A 1BCUH 1VJ9U 1E34B 1GG6B 1MKXH 1VR1H 1KLTA 1NFWA 3EDXB 3QK1A 1THRH 3RMNH 5A0CA 3Q3KA 1A5HA 2TGAA 1BZXE 3S9BA 1BQYA 9LPRA 8GCHG 3M35A 4DVAU 2ZKSA 3B9FH 1GBAA 3BG4C 1CO7E 1A0LA 1CHGA 1OP8A 1RFNA 3P17H 3SU0A 4AGJA 1O3OA 1DUAA 1V2TT 4OS4A 1ZSKA 4WXVA 1GJCB 3A7YA 1MMJN 1QB6A 1ELFA 2ZGJA 2PUXB 2A2QH 1O3EA 2SNVA 4FUFA 3KQCA 3LC3A 1G2MA 3NK8A 3RXFA 3GY3A 1FY8E 4K2YA 3EGKH 3NXPA 1EX3A 2G00A 2Q1JA 2GMTB 1A2CH 4Q7YA 4DW2U 1SOTA 1TX6A 3ENSB 1O31A 2P94A 2FDAA 1WBGB 1P2KA 5JPMH 3UWJH 4UFEH 1SBWA 2Z3EA 2J38A 4Y8YA 1TGCA 2UUJB 3MOCA 2XC4A 2SGDE 3ZZ5A 1UTMA 3QZRA 2Z94A 3D62A 1E36B 2PTNA 3ZZ8A 3BN9A 1GPZA 1QBVH 1O38A 3UUZA 3F9EA 4AG1A 1XKAC 4KTUA 3RM0H 1QRXA 4H4FA 1Q2WA 1EOLA 1OYTH 2AIQA 2ZHEH 2R0KA 1C2KA 3BTME 4Q80A 3LU9B 4WH8A 1UVOA 4LZ4B 1EPTC 4FUCA 5DP8A 5BRRE 1SQAA 1T31A 1ANDA 4UDWH 2ZTXA 2ANWA 3PLPA 3MH6A 1TYNA 2WUBA 3A83A 4YLQH 4IN1A 3RM2H 2P3UB 3LJOA 3RXKA 3RXVA 2FOEA 2OTVA 3KIDU 3KQBA 3AVZA 3ZZ3A 2HLCA 3UR6A 1A3EH 1KDQB 2P8OC 1EAIA 4BANB 1EASA 3ZVAA 5E8EH 4K60A 1W0ZU 2OC1A 3URDA 1RIWC 1S6FA 4ZAEA 2Y82A 1V2OT 1Y5AT 2ZDNA 1BITA 2BDAA 4FXGH 1XMNB 4I32A 3ZVEA 1KXEA 1BDAA 1EJMA 2OQUA 1F5RA 1K9OE 3SHCH 1UTJA 4ESTE 3A7WA 1GBFA 4NA8A 4A7IB 1S83A 4DY7B 4JCNA 1O5AB 1GI8B 3BEFB 2Z6BD 1F0UA 4AX9H 1FI8A 4AYVB 4MNXA 1CGHA 1HFDA 3RUOA 1K1IA 1O3DA 1LVMA 1O2NA 1TAWA 2JH5D 2Z7FE 3SU6A 2V0BA 1CE5A 2BD2A 3PMJA 3NPSA 1H4WA 3PMAB 4UEHH 4ASHA 1O3KA 2BB4A 4ABAA 2RG3A 1S0RA 1TNLA 2Z9KA 4GHQA 3A8DA 1XX9A 1L2EA 3PTBA 3PO1B 3VB4A 2NU3E 2BD8A 2VVCA 4I8JA 1XXDA 4X1QU 2IN2A 4A1VA 2ZF0H 2AYWA 2VH6A 3MU5A 4YESB 1TMUH 3TPIZ 1DSTA 2QYIA 2XYAA 5C67A 1P2MA 1C2FA 3KQDA 1IQIA 1WUNH 1RD3B 1VGCC 1U6QA 3V0XA 4ZROA 5JYIA 2PSYA 1EZSC 3ZVBA 3FP8E 5DK1A 5GCHF 3UOUA 3QWCH 4TPIZ 4A1TA 4Y8ZA 1GMDG 1MD8A 1C5SA 1T4VH 1P01A 1GMCF 5EXMA 4DCDA 4HGCA 1ELTA 4AOQA 3SJKA 1GI6A 5B6OA 1OWDA 5A8ZA 2FS8A 1O2MA 2TBSA 1MH0A 1HXFH 1IQNA 1O3IA 2JKHA 1Y3WA 2G5NA 3NUMA 1O39A 1UVTH 1QGFA 1SMFE 2ZDKA 3SV9A 5HXFA 1S85A 3C1KA 3SV7A 1Q31A 3BTKE 3GDUA 4X2VA 1DX5M 1KDQA 1TALA 4QT8C 3RLYH 1BB0B 1B7XB 5EW1H 1X7AC 1O3BA 2C8YB 2Y80A 4DT7B 5IDKA 4AGKA 4NWLA 1P57B 4JZFH 4KTSA 3MU0A 5I25A 2PUQH 1AFQB 2ZU1A 1W8BH 4OGYA 2PHBA 1P2QA 3Q3YA 2ZA5A 3GISB 1YKTA 2XC5A 3DA9B 2SGAA 5EQSA 1P9SA 3RLWH 4KELA 3GDVA 3LJJA 3M5OA 1ZTJA 2ZEBA 3VB5A 3U1JB 2ZU4A 4BAQB 1UTPA 4MNYA 1NPMA 4E06H 1PJPA 1QL7A 2ZHQH 6LPRA 2O8UA 3SNCA 2HNTE 1ZGVA 2BD4A 1GMHF 2I6QA 1W7XH 1G37A 3EYDA 2Z9IA 3PLBA 2GP9B 2KAIB 2B5TB 7ESTE 4B76A 1ID5H 1P09A 2ULLA 1C5MD 1Y8TA 1ANBA 3HATH 1J9CH 3LOXA 1KXFA 2ZZUH 2AERH 3A86A 3S7KB 2STBE 1CT2E 1GI3A 2QA9E 3SZNA 5F6MA 1BMLA 1O3LA 1Y3XA 4AFSA 1HDTH 3UNSA 1TGBA 3TK9A 5JB9S 3HKJB 1DUEA 2STAE 1NU9A 1XUHA 1GHXH 1GL1A 2ZFFH 5L2ZH 1HCGA 3MMGA 5E0HA 2WV5A 1LHDH 1P04A 5EXLA 4XDEA 2QXGA 3B23B 1ARCA 1LPZB 2AMPA 2BVXH 3QTVH 2RDLA 4ABBA 3LDXH 2ZPRA 1TBRH 4MNWA 5GIBA 4JYVH 2FMJA 4MG3A 3RMLH 1G30B 1C4U2 1K1NA 2D26C 1T8MA 2XXLA 2OP9A 1AVGH 2BHGA 2A4QA 3RXMA 3UFAA 1A61H 1QJ7B 1AVXA 1ZRBA 3RXBA 4INKA 1LPGB 1EPTA 4NWKA 2VJ1A 3CS7A 1DT2A 5GCHG 1FJSA 1H8DH 1SGTA 2FTLE 3UNQA 4JZDH 3MNSA 1T32A 3SBKA 1MZAA 1D3DB 2BYAX 1GJ8B 3I29A 1MQ6A 1NRSH 2BY8X 2AMDA 2BY6X 3MH5A 1EUFA 3LH1A 1TPPA 1O3CA 3AASA 2AMQA 1G32B 5F8ZA 5C3NA 5A8XA 1BHXF 5TCCA 1HAYB 2FOAA 2ZFRH 3A7TA 1AFEH 3GY5A 5IYTA 5J4SA 1V2JT 1QBNA 1K1MA 4X2YA 1TNKA 4R8TB 1HAZB 3NCLA 1EP6A 3ZZCA 2VVUA 2QV1A 3A85A 1P05A 1YP9A 1W11U 3MNBA 1YPGH 2WPHS 1F2SE 3TJNA 2DE8A 1UK4A 1C2MA 1E35B 2BX4A 1HYLA 1PQ8A 1TIOA 3SNEA 1O2ZA 5E2PA 3A7XA 3SO3A 4LZ1H 1EZXC 2FOBA 2PR3A 2PSXA 1NRQH 1TB6H 3AAUA 1ZZZA 1Z6JH 3VFEA 1WQVH 3OYPA 5DJ7A 4K8BA 3VEQB 1EZUC 1W3CA 4A92A 1C1VH 1GBJA 2GCTB 4NIWA 3RXEA 1SQTA 1ZSJA 2Y5GA 1VZQH 1C2HA 2BD5A 3WY8A 2R2WU 1ELAA 1O3AA 1W2KH 1W7GH 1V2MT 1K21H 3ZZBA 2C3SA 4O3UA 1TGSZ 5K0HA 1FY5A 1YCPH 3A7VA 3DFJA 3A8BA 3TJOA 1NS3A 1ZMJA 3PROA 1ZTKA 4NZLA 2EI7A 2H5DA 1PPEE 1TPSA 1NT1A 1SLUB 1YLDA 3ZYDA 2BQWB 3VB7A 1TOCB 1A5GH 1LKAA 3BV9B 2SNWA 5A09A 2ZG0H 4X8SH 4RKOB 3BSQA 1NROH 1OP0A 3NZIA 2ZTYA 3LH3A 2TPIZ 1O2SA 1ARBA 1OPHB 3LONA 5EGMA 3SI4H 2H1UA 2TGTA 4AFQA 5FCRA 3JZ1B 5ABWA 2CXVA 1SVPA 1QL8A 4HFPB 4O97A 2FO9A 2HNTC 1XM1A 3D65E 3UTUH 3S9CA 1C1UH 1C1SA 2J94A 3H5CB 2A7JA 1O0DH 1O2UA 2V3OH 4IW4E 1ABJH 4KTCA 4BTTB 2P59A 3MFJA 5JBBS 2AGGX 1LDTT 1SGIB 2NU4E 3O8BA 1SGRE 1BJVA 1EQ9A 4D9QA 2Z9GA 3R3GB 1SB1H 2VB0A 3T25A 3TLOA 4DGJA 2FESH 3BTWE 1C9PA 2AFQB 1IQMA 2A1DB 1G3CA 5DP4A 1HJ9A 1TLDA 2FI3E 3D23A 1JXPA 4E7NA 4DIHH 5T6FA 3M5NA 4AFUA 1NRNH 3GYMA 1UO6A 2OUAA 1LHFH 1L4ZA 3VB6A 1C2LA 1ZHPA 2AH4X 4DJZB 1DDJA 2ZFPH 2VU8E 2NU2E 1DXPA 1G3BA 1Y3YA 1QQ4A 4K8YA 2A4OA 4MQAA 1GG6C 1C2JA 1P11E 5F8TA 1AVWA 2ASUB 1O5CB 3KL6A 4NG9H 2VWMA 4DG4A 3OU0A 4E05H 1ELVA 3MO6A 5T6GA 2VH0A 2J95A 1J8AA 1HAIH 2UWPA 1J16A 5L2YH 1TQ0B 1BUIA 1NRPH 1BIOA 3MYWA 4I8GA 4K1EA 3LGVA 1KTSB 3G01A 4WWYA 4GHTA 1O2HA 1E38B 3RXPA 3PB1E 1TBQH 1GI9B 1K1PA 2WPKS 4IS5A 2XBWA 1EOJA 3W94A 3FZDA 1CGJE 1CA8B 1ABIH 4VGCB 2VNTA 2HGTH 1BTPA 5TJXA 1HGTH 4U30A 1MBMA 2QF3A 1V2VT 4CHAC 1S0QA 2CJIA 3TJUA 1ELEE 5EQRA 1GDQA 1XUIA 1ZMNA 4I8HA 2BY5X 2OC7A 5SGAE 1ZPZA 1H1BA 2CHAC 1YPKH 3FAOA 1W13U 4WMDA 1NO9H 4MLFB 3UQVA 1KIGH 1FUJA 1SLXB 4UFGH 4F49A 1XUJA 4ISLA 1VJAU 4ZH8A 1JWTA 2ZCLP 2P3FH 4CRFA 1DE7H 2BY7X 3P6ZB 1SHHB 3SU5A 2H5CA 3VPKA 1LQEA 3DT0H 1UHBB 1CT0E 1A46H 1TNHA 1N1LA 5EPNA 1RXPA 1SGPE 1OWIA 5C2ZA 1B0FA 2BMGB 3BTTE 3KNXA 1GJ9B 2M5TA 5G4BA 5GPIB 1SR5C 1Y5UT 3P8FA 4VGCC 4B73A 4CRAA 1C1NA 4WH6A 5DP9A 4ABGA 1O37A 4I31A 5E2OA 1QL9A 2ZDLA 3GY7A 4OS5A 5K7RA 1OKXA 1QA7A 1QR3E 1GI4A 1HPGA 3KCGH 2Z3DA 2UUKB 1ESBA 1QA0A 1EXFA 1UHBA 1C1QA 1F0SA 2GZ7A 3RXTA 2VWLA 1PFXC 2BLOA 2B7DH 1DSUA 4JK5A 1O30A 2UWOA 6GCHG 1DANH 1O2IA 1OS8A 2B0FA 1ZJDA 1AD8H 1O2OA 4M7GA 1O5GH 1O2RA 2PFEA 5A0AE 1ETTH 1G2LA 1BT7A 1PPHE 2A5AA 2Y7ZA 3EA8A 3IWMA 1UK2A 1BJUA 3F9GA 1SHYA 3BIVH 4OS1A 2ZC9H 1HAVB 5FBEA 1LVOA 2KAIA 1W14U 3I77A 2XBYA 3BIUH 1IHSH 2BVRH 2GVFA 1BBRH 1O2TA 1BA8B 5DP7A 4X6OA 3SW2B 2OBQA 2PLXA 3BF6H 1C5PA 1W12U 5FHTA 3PWBA 3Q3XA 3FVFB 1SGDE 1MU6B 4HZHA 3E3TA 1OX1A 3PMBB 4X1SU 2BD9A 1F92A 1AO5A 3DHKH 2FI5E 4YTAA 1AKSB 1AHTH 1SFQB 2GV6A 1O5DH 5HM2A 1KLIH 1MCVA 4NFFA 1HB0B 4WMFA 3SUEA 3M3VA 4B2BA 1A5IA 1S6HA 1F0TA 4X2XA 3ZVGA 5F8XA 1AIXH 2OINA 3SJ8A 2A0QB 1P2JA 1WOFA 1V2UT 3BEUA 1SGFG 1OWHA 2H6MA 1CA0B 2PGQB 2A7CA 4Y7BA 1OYQA 4D8NA 4AFZA 1NFUA 4UFFH 4E7RG 1QHRB 1LQDB 4UD9H 1UVSH 2SGPE 4NGAH 1FN6A 3ZVDA 1SLWB 2FOFA 3GCNA 3AAVA 3M3SA 2QXHA 1SGCA 1D3PB 4OGXA 3MH7A 3U8TH 3P92A 1TONA 1GMDF 1PQ7A 2FXRA 4CR5A 3O8CA 5EG4A 2RCEA 7KMEH 1FIWA 1VCPA 1Z6EA 4NCYA 4OS7A 4BTUB 1K28D 4GUXA 4Y11E 4B2CA 4KP0A 3UWIA 1HJAB 5GWZA 4IMQA 3F9HA 3TITA 5LPEA 2ZGBH 3ATLA 2VGCC 1C5YB 2GT7A 3ZVCA 1UCYK 2BDIA 3M7UA 3MH4A 3A88A 3BTQE 4H6TA 1L1NA 2ZDAH 2OC0A 3CENA 4YLUA 1ACBE 3LGUA 2UUYA 1QB9A 2YNBA 4NA7A 4O3TA 1MZDA 2ZNKH 1IQJA 1GBIA 2G4UA 3TNTA 1CHOG 2OD3B 1ETRH 4B1TA 1KYNA 3L3TA 5C5OA 1FNIA 4D7GA 1AI8H 2ZPSA 4IN2A 1RTKA 1Y59T 4YOGA 3T28A 2AGEX 1K1JA 2HALA 5LPRA 2GKVE 4ZKOU 2A4RA 2BDCA 4D7FA 1VCWA 4B2AA 3TK5A 5C1YA 4ISIH 5E0JA 3RXQA 1EB1H 3H7OA 3A84A 4CH2B 3T5FH 2FWWA 1SOZA 2OC8A 3SUGA 2FOMB 1AZZA 1C5RA 4GAWA 1T8OA 4SGBE 1MKWK 2H9TH 1TA6A 3GCHC 1E37B 3JZ2B 1DXWA 2ANKH 4UFDH 1GGDC 2ZU5A 4BTIB 1C5WB 4BAMB 1EAXA 3KN2A