3NKKA

Trypsin in complex with fluorine containing fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nkkA02
4Y10E 4YT7H 4MNVA 4X1NU 1ZR0A 2R9PA 4WY3A 3MO3A 1OSSA 1PPZA 4J1YA 3E16B 1P12E 3URCA 4NWLA 3RXEA 1PFXC 5E0JA 1F0TA 5DGJA 2UUKB 2PFEA 3UNSA 1DS2E 2VWNA 3A7TA 2TGTA 1TOCB 3A82A 6CHAB 3AW0A 3MH5A 4I7YH 1C1OA 4BTUB 2BD2A 1J16A 4DG4A 1IQIA 1UMAH 3MU8A 1D6RA 1KXAA 2SGPE 2OUAA 3TJVA 3TNSA 1SQAA 1HAIH 1DOJA 1CQQA 2Z9JA 1OOKB 1CT4E 4DJZB 1A3EH 1LHFH 4B75A 3EA8A 3ZZAA 1NROH 1TX6A 4WF8A 1O2WA 8GCHG 2HRVA 4KKDA 5JB8S 4IMZA 3ZZCA 5LH8A 2C4FH 1HIAB 2P8OC 1M9UA 3E0PB 4AB8A 1V2TT 1FI8A 3RMMH 1YPLH 3RM0H 1RFNA 2VVCA 3QUMP 2BX4A 4K1SA 2J2UA 1ZOMA 3SUGA 1DFPA 4KTCA 2BM2A 1PPFE 1SGYE 1BQYA 2XC5A 1TE0A 3T26A 4U30A 2PLXA 2Z6BD 3GCHB 2VH0A 4BAQB 5DP6A 1BTWA 3QZQA 2XBYA 3NUMA 2BVSH 2VWOA 4Y0ZE 2G51A 2BY7X 3MU0A 1YCPM 4WVPE 3A83A 2ZECA 3ATMA 1VITH 2PWXA 4NIXA 1F0RA 2STBE 5FXLA 2FOFA 3PLPA 1BMAA 1Z6JH 1A3BH 1ZJDA 2GT8A 3MNXA 1BTZA 2FZZA 4ZHMU 5L6NH 1SLUB 1T8NA 4YLUA 5I25A 2ZEBA 2BY8X 1EJMA 1C1TA 2QV1A 3R3GB 1ZYOA 3ODDA 1HDTH 3ZVEA 2ZP0H 1LPGB 1GJ8B 1ELEE 3VEQB 1EAWA 4TY6A 2AIPA 2GDEH 5EW1H 1O2VA 4YZUA 1HAZB 3E90B 1JOUB 5E8EH 1LMWB 3RXRA 2KAIA 1BRAA 1OWDA 1UTQA 4YESB 2FYRA 2V0BA 2ZDKA 1SB1H 1DPOA 5A0BA 4XOJA 4Z6AH 3GY2A 3AAUA 2ZU1A 1OP8A 3D49H 3PO1B 1FN6A 1DWBH 1LHEH 5EW2H 1BOQA 1E36B 1HAHH 2WPLS 1KY9A 1XUKA 4GCHG 3PLBA 1C5WB 4FUIA 3SV7A 1WQSA 3MU1A 4J2YB 3EDXB 1TNLA 1FJSA 1AWHB 3M37A 1KTSB 1L4ZA 2ZGXH 1DDJA 1QJ1B 1OX1A 2D1JA 4AYYB 1UVTH 4I33A 4AORA 2QAAA 1UTJA 2C90B 1GI3A 4JMYA 4YLQH 1EOJA 1QRXA 2BZAA 4MPUA 1PQ5A 4WMDA 4KP0A 4A1TA 5C1UA 4FUGA 4DIIH 1QBVH 4MPXA 1AE5A 1FPHH 4CRAA 2PR3A 2WUCA 1V2OT 2VU8E 1SGDE 1P03A 4AN7A 1LHCH 3TJUA 3RXBA 4JYVH 1P2IA 3RXUA 2FDAA 1D6WA 1EX3A 1ETRH 3T5FH 1ZSLA 4ISIH 5CHAB 4X2WA 2OP9A 1THSH 3CS7A 3HK3B 4FVDA 5GIBA 5FPSA 1D9IA 3LC5A 1JIMA 4UFGH 1GGDC 1W7GH 1GI6A 3SUEA 4Q80A 2OC8A 5EGMA 1XXFA 2TGDA 1K1NA 1Y3UA 2CV3A 3IWMA 3SGQE 1UCYH 1O3LA 4RKOB 1GL1A 2R0KA 2UWLA 3VXFH 3B23B 3Q76A 3UTUH 2W7UA 2ASUB 1O39A 2C3SA 1O2XA 4GHQA 3ODFA 3A86A 2B8OH 4NZLA 2H2ZA 3LJJA 4TYDA 3GY4A 1GCTB 1FUJA 1AVGH 1CHGA 2V3HH 3RLWH 1Y5AT 4K8BA 4CH8B 1GVKB 1FY5A 1VR1H 1ZSJA 2H5CA 2H9TH 1EPTC 2Z3CA 1QQUA 5EQQA 3U1IB 3RXJA 1E35B 2XTTB 2ZHEH 1AVXA 1Z8JB 2VGCC 1EB1H 4X8SH 1GMCG 3SQHE 5G4BA 3ZZ6A 3RXPA 3QZRA 3QTOH 1ABJH 1G30B 1EAIA 4ZKNU 3AAVA 2F9BH 1HCGA 3UY9A 3UOPA 2BDCA 4XFQA 1AN1E 2BQ7B 1P05A 4X1QU 1GVZA 1GBJA 2FS8A 5T6GA 3RUOA 5EQSA 1ANCA 1IOEA 3PV4A 1C2JA 2VIDA 1AIXH 3A84A 3EA7A 3MH6A 1MD8A 1Z7KA 1Z71A 2RG3A 3F9FA 4D9RA 1EOLA 4R0IA 4X1PU 3O8BA 1LVBA 1NY22 3FZZA 3PMBB 3TPIZ 1O3DA 2RA3A 1GG6B 1O34A 3I77A 1SQOA 2G81E 3HATH 3PWCA 3NXPA 4X6NA 2FYQA 4AFSA 3E91A 1KTTB 2CJIA 1TRYA 2QC2A 4XDEA 3A7XA 1TLDA 3DD2H 2Q6DA 2G4UA 1KXEA 2BXUH 3BG4B 1GJCB 1D3QB 1ELDE 1CBWB 3LH1A 1V2UT 1O2NA 2QGRA 1VCPA 1EP6A 2H9HA 2FOCA 3GY8A 3PTNA 3MOCA 1EAXA 1QQ4A 2VIPA 1A5IA 3OYPA 1Y59T 1UCYK 4MQAA 1YCPH 3LU9B 4YO9A 4B74A 1GHBF 1ELCA 1A2CH 2XBXA 2LNCA 1DITH 1PQAA 2F9VA 1LKBA 3RMNH 1ELAA 1BMMH 1OKXA 2AMPA 3FP7E 3HKJB 4X8UH 1TX7A 1UTLM 5FCRA 1QCPA 4ZAEA 3N7OA 5A09A 3RXFA 3VB7A 3FVFB 3F6UH 3FFGA 1K1LA 5T3HA 1GHWH 1INCA 4BANB 1C1UH 1G3CA 2AMDA 1DICA 2A32A 4D7GA 1AFEH 5JBTA 3TJNA 5ESTE 2VIVA 3K6YA 2QCYA 3BTWE 3HGNA 1W11U 1MQ6A 1WUNH 1ZLRA 9ESTA 1IQHA 3BN9A 1WOFA 4KTUA 5AF9H 1J9CH 2Y5GA 1EB2A 4LOYH 4VGCB 1WCZA 1ARCA 2HNTE 3I78A 3M3SA 3UWIA 1JWTA 1TALA 3ATLA 3OTJE 3TH3H 3TGIE 1UTKA 5TCCA 3H7TA 3LC3A 2BOKA 1D4PB 4BNRA 1DWCH 3LGTA 1KDQA 3URDA 1SPJA 1NRRH 5DJ7A 3V3MA 1QA0A 4I8GA 2R2MB 1ZJKA 3SV6A 8ESTE 4ZHLU 1HAVA 3RXSA 4ESTE 1IQGA 2ZZUH 2OINA 2ZGHA 4ABIA 1XX9A 1EKBB 2JH0D 1GDNA 2O9QA 1TFXA 1G9IE 1GMCF 1Z8RA 1P9SA 1HAGE 4D7FA 2WYGA 3DFJA 1DVAH 2ANWA 2ESTE 1CT0E 2P94A 1AE8H 2ZCLP 1S83A 2UUJB 2AERH 4IW4E 3C27B 1O5CB 3ZV9A 4X2YA 1KYNA 2G4TA 1YCPK 1GJAB 7KMEH 2SGAA 1CT2E 2SGDE 2AFQB 1S6FA 2XWAA 3SJIA 1GHXH 1NN6A 3SJKA 1B5GH 1G37A 4BOHA 5F03A 4B2CA 1P01A 5C20A 4AFQA 3KQDA 1IQKA 1A0JA 4OGXA 2BLVA 1HGTH 2CHAC 4Y79A 2ZDMA 2VB0A 1RJXB 4A5TS 4CHAC 2BY5X 1Z1JA 2YNBA 1MD7A 3RXQA 1C9PA 1O5FH 5DKMA 5A8ZA 3NKKA 1KXFA 1P8VC 3SJ8A 2NU4E 5JPMH 1BTUA 4K5ZA 3PMAB 4K1EA 1VITF 3S9CA 4Y8ZA 1TQ7B 2ZCKP 1GHZA 1AQ7A 1NFXA 1PPBH 1D3DB 1O35A 1WV7H 4CRFA 1SBWA 1SGNE 4ISNA 2Q6GA 1TOMH 5AFZH 3UR6A 3SORA 5IYTA 3A8CA 3NPSA 2A5IA 1IQNA 3TLOA 3SU2A 2BD8A 1GI7B 1IQJA 1VGCB 3GY5A 1O5EH 3D23A 4X2XA 4YTAA 3ZZ9A 1DLKB 1G2LA 2XXLA 4OS2A 1PPHE 2A2QH 2BDIA 3R0FA 2PGQB 1RXPA 1SGQE 1XKBC 1A5HA 1GDUA 1OWHA 2QYIA 1SGFG 1JIRA 5DP8A 3PMHB 5F8XA 1YPJH 1C2HA 3TIUA 5GXPA 1L1GA 2ZU2A 1L4DA 5GCHG 4A92A 1HBTH 4CBNA 1GMDG 4INHA 3UR9A 1FY3A 1GHAG 1GCDA 2WPHS 1V2KT 2BD7A 2O8LA 1L1NA 3GICB 2EA3A 1ZHPA 1OWEA 4X0WU 5DP3A 1ZRKA 3VXEH 2OQUA 1MKWH 3S9AA 3G01A 3MH4A 4FUBA 2ODQA 3LH3A 1C5ZB 4SGAE 1F0SA 1V2NT 4X2VA 1FZZA 1NRSH 2Y82A 2P3UB 3LT3A 3SO3A 3GCTG 1DE7H 1KLIH 4UFEH 4BAMB 2EEKA 3F1SB 1NRPH 4UD9H 1ESBA 2FESH 4GHTA 1RTFB 5DG6A 1EXFA 2PKSC 1ESTA 1ORFA 5J4QA 2GD4B 2PHBA 2HALA 3TU7H 1MTNC 8KME2 1O31A 2J9NA 1UTNA 2ZGBH 2GCTC 1PQ7A 4KGAA 1CHOF 1B0FA 1ZHRA 2BB4A 1ID5H 1O36A 1O2OA 1MAYA 3DFLA 3ZZDA 2PKAA 1H8DH 1O2GH 5I46H 1LO6A 1DUAA 1O2YA 1FPCH 1OPHB 1SMFE 3U1JB 1ZPCA 1PPCE 1G36A 1SGEE 5A8XA 1O3FA 3S69A 1AMHA 2ZHWH 3PWBA 2P8OB 2ALPA 1S0QA 4ZHAA 1ELBA 2ZA5A 2P59A 3MO6A 1AKSA 2FP7B 1BT7A 4PROA 4Y76A 3SHAH 2AEIH 5HM9A 2V6NA 3ATWA 3MU4A 1C5NH 2ALVA 3RXVA 1C5YB 3QN7A 4FU9A 1B0EA 1OWJA 3BG8A 3LIWA 4ABAA 2XNIA 3SU3A 1BTXA 3BTTE 5EODA 1DSTA 2J94A 2Z9GA 3EE0B 4WMEA 1HAOH 1AO5A 3FP6E 1NPMA 2GP9B 1MTUA 1PYTC 3TK6A 1SHHB 1GJ7B 5T6FA 2AYWA 1HB0B 4I8JA 4Q7YA 1E38B 4WXIA 1O3JA 3T25A 5F8ZA 2QXJA 3W94A 2JETC 2ANMH 6CHAC 1TRNA 4X6PA 1IAUA 1MKWK 2FOGA 2FTMA 4MNXA 1Y5BT 1ZTJA 2ZU5A 5AVDA 2AS9A 5C5OA 3T29A 1GL0E 4NA9H 3RXTA 2QA9E 4K69A 1MQ5A 4X1SU 2BVXH 3T62A 4ABGA 4IBLH 2BDYA 3UNQA 1MH0A 1TA6A 3A89A 1F0UA 1QGFA 4H42U 1C1QA 1C1RA 2BDGA 1O2JA 1P2JA 4I31A 1DY8A 1BIOA 4CRCA 1FNIA 2XYAA 3ZYEA 2Z94A 1O3KA 1QRWA 3A87A 3DT0H 3M5MA 2FOEA 2FEQH 1K22H 1C1SA 1TMUH 4ABHA 5F8TA 3Q00A 1H9LB 2A45B 1TGTA 9LPRA 1D3TB 2AGGX 1GMDF 3RXIA 2QXIA 5E0HA 1GHAF 2A0QB 4TPYA 1P04A 4NSYA 4AGKA 2BTCE 1FIZA 1HXEH 1ZGVA 1QURH 2I6QA 1A0HB 1C5UA 1D3PB 2H9EH 3DA9B 3QLPH 3CP7A 1C1VH 4DURA 1HJ8A 4B73A 1BTHH 2W3KA 2NU2E 1P10A 4DOQA 5EXLA 3D62A 2BYAX 1WTGH 1ABIH 2HPQH 4I8KA 3LGVA 3ZVGA 1HPGA 1MUEB 5HMAA 3MNBA 5EU8A 3GCTF 2QF3A 1P2QA 2VNTA 3MNCA 1FN8A 3SU4A 4FUCA 1P9UA 1UVPA 1C2GA 3H5CB 3U8OH 2PW8H 1IQFA 2VIOA 1DM4B 2B9LA 2SNVA 5FBEA 5LPRA 1QR3E 2J34A 2BHGA 4HI3A 4WH8A 2Y7ZA 2BY6X 3MH7A 2ZCHP 5AHGH 1T31A 1TGBA 1O2QA 1UTPA 1P2OA 3P92A 3SV9A 4CBOA 1BITA 3FP8E 3RU4E 1W13U 2A31A 4MNYA 3BIUH 2ZIQH 2O8UA 3BEIB 3RC5A 5GWZA 1WBGB 1AHTH 3KL6A 4HTCH 5AFYH 3TK5A 3RU4D 1GBTA 2FX6A 1GVLA 2WPIS 2ZFRH 1KIGH 3M7UA 4Z0KA 1RS0A 4MPVA 4KELA 4OGYA 1A4WH 1QNJA 2R3UA 1Y3XA 1S0RA 2Z3DA 3WY8A 3M5NA 3U69H 3KQBA 4NCYA 2FO9A 3SI4H 4Q7XA 1QL7A 7GCHG 3MO9A 3PO1C 4FUEA 1TPOA 4NG9H 1C5QA 2BD5A 1KDQB 1YPHC 1UCYE 5E2OA 1RD3B 2A7CA 3KCGH 3A7WA 4JZDH 1L0ZA 3RM2H 4RSPA 3UQVA 2ODYB 3ZZ3A 3OY5U 1OYTH 1Z1IA 1HJ9A 4XE4A 8GCHF 1SI5H 2ODPA 2SFAA 2P3FH 5FCKA 1ARBA 1FIWA 1S6HA 3RP2A 4A1VA 4E06H 4X8TH 1TBRH 2DUCA 1O30A 1KLTA 1CA0C 2Q6FA 4NIWA 3BIVH 1C2KA 5ETXA 1F2SE 1HRTH 2ZF0H 1YBWA 1OP0A 1GBFA 2BMGB 1EPTB 1MAXA 1XM1A 1EZSC 1GHYH 3EA9A 1ZMLA 2ZHFH 1G3EA 1W3CA 1O33A 1UHBA 2ZHDA 3ESTA 1N1LA 1F5LA 3T28A 1ELVA 3EQ0H 3PB1E 1A1RA 4AX9H 1DXWA 2CN0H 1SGRE 2ZU4A 3T2NA 3RXGA 3L6PA 1W7XH 3K9XB 5L2ZH 1ELGA 4I8LA 4B2AA 2ZQ1A 4TWWA 5FAHA 2GVFA 3SN8A 1BRUP 2ANYA 2PV9B 1GBAA 2O8TA 2RDLA 1AZ8A 1TONA 1SL3A 3CENA 3RC4A 1E34B 2XC4A 3F9EA 3M5LA 5DK1A 2HOBA 3SNBA 4O3TA 2J4IA 1QTFA 1SGPE 3PLKA 1EATA 1UVUH 1QA7A 1KLJH 4JK6A 1C2FA 2BDBA 4RN6A 2TBSA 1LTOA 2FI5E 1MZDA 1XKAC 1VZQH 1NFYA 2A1DB 5TCAA 1DX5M 2XWBI 5ESBA 1V2MT 1MTWA 2A4OA 2OBOA 2Y6TA 1FQ3A 1NS3A 5ABWA 1OWIA 5A0AE 4INLA 1O3BA 4IGDA 1GI1A 1C1MA 5GJ4B 1TAWA 3S7HB 2ZC9H 4YOJA 1PPEE 2D26C 2G5NA 1QY6A 2HWLB 3IG6B 3LGWA 1YPMH 2PUQH 1PPGE 1WAYB 1UK4A 2JH6D 1ZSKA 2FXRA 5EPNA 3SV8A 1T7CA 4GCHF 1ZMJA 1GBEA 3C1KA 3P8FA 4D8NA 2VJ1A 2A4QA 5E0GA 1A61H 2OC1A 4B1TA 1XVOA 1NC6A 2AMQA 2EI7A 2XC0A 1AFQC 4CRBA 4MPWA 3RXMA 1GDQA 1GJDB 2FODA 2CMYA 1GBKA 4Y8YA 1IHSH 1O2KA 4U2WA 1TGNA 4XSKU 1YC0A 1YPGH 1V2WT 4JZIA 1Q2WA 2FMJA 1AUJA 3W95A 5C1XA 5L30H 2R0LA 2IN2A 5JDUB 3A8BA 1ANBA 3DHKH 2R3YA 1W0YH 3A81A 4CRGA 2A5KA 1NTPA 4BTIB 1RIWC 1S84A 2EC9H 4A7IB 3S9BA 4ABDA 1TB6H 1SGTA 4BAHB 1TMBH 2FX4A 4CR9A 3HPTB 1AY6H 4AG2A 1SLWB 2CF8H 3STJA 1QFKH 2OXSA 1O2IA 1BMLA 1YLDA 3V7TA 4ZXXH 3BF6H 4JCNA 1SFIA 2ZFQH 4MG3A 1LVOA 1V2PT 1LKAA 1CU1A 2J92A 4ABBA 2PGBB 1H4WA 4U32A 1CSOE 3MWIU 4MLFB 2STAE 5DP9A 3RU4T 2Y80A 2W5EA 5EQRA 2P3TB 1L1JA 1DT2A 4ISHH 1C5SA 1HJAC 2VWMA 2VVUA 1EZUC 1AWFH 1FDPA 1EASA 4FUHA 1ZPBA 1ETSH 2ZPRA 3LJOA 1E0FD 1SGFA 2FTLE 3FANA 2Y5FA 6GCHG 1EUFA 1WU1A 1QJ7B 1ZZZA 1C4U2 2J95A 2HVXA 2XCNA 4ZUHA 2BY9X 1O2TA 3GY7A 1LHGH 4FXGH 3KGPA 2GDDA 2EI8A 2OTVA 3ATKA 3NWUA 5T6DA 4UONA 1DXPA 4E05H 1LQDB 1N8OC 2ILNA 1V2VT 2BD3A 3ATIA 4VGCC 4A6LA 1P11E 4FU7A 4FUFA 4LK4A 1MU8B 3VPKA 1NRNH 2C8XB 3SQEE 3GCOA 1QL8A 1TPAE 3RC6A 3M36A 2FWWA 1HFDA 3P6ZB 3Q77A 4M7GA 1EJAA 1EZQA 3M35A 1BRBE 1UVOA 2QXHA 4CH2B 2OC7A 4DCDA 2JH5D 1QJ6B 1FY8E 1AZZA 1THPB 2IPHA 1ANEA 1AI8H 1GBHA 2LPRA 2AGIX 1GHVH 3NZIA 2WV5A 3L33A 1YKTA 1C2IA 3BSQA 4MVNA 1B7XB 1G32B 2ZKSA 3ENSB 4NA8A 2DE9A 3NK8A 2XRCA 1C5RA 1AB9C 3D65E 3HK6B 3P8OA 3QTVH 2PTNA 2BD9A 1N6YA 4GPGA 1TABE 1C4V2 3JZ2B 1EQ9A 1O3PB 5EXNA 2ZQ2A 2TGPZ 4O3UA 1HXFH 1GMHG 3GCNA 2BLWA 3GY6A 2BQ6B 1MKXH 2BQWB 1THRH 5L2YH 2KAIB 3LONA 7LPRA 2D8WA 2FI3E 3M3TA 1QIXB 3TK9A 2XBVA 5DP5A 1IQMA 1Y3YA 1K9OE 2ZFPH 3A7YA 2SNWA 1RRKA 5DPAA 4X6MA 1CA8B 1SGCA 4SGBE 1IHTH 2BLOA 3HKIB 2TIOA 1SOZA 1V6DA 5E2PA 5FHTA 1MCTA 1HLTH 3VFEA 1AU8A 1BCUH 2ZNKH 1O2UA 1SHYA 4JZEH 2PTCE 2Z9LA 1C2MA 1LDTT 2CGAA 3S7KB 3O8RA 6LPRA 1DANH 3MYWA 2QN5T 3LGYA 2C93B 3ZVBA 1H8IH 4FVBA 3BTQE 5C1YA 2GX4A 5A8YA 3VGCC 1C4Y2 2XCFA 1MTNB 3BTFE 4OS7A 1SFQB 2BD4A 3Q3YA 3NCLA 4INKA 4TWYA 2OBQA 2C8ZB 3OU0A 2OC0A 1Y8TA 1C5XB 1MBQA 2VWLA 5EG4A 5C5NA 1BBRH 3A7VA 1Y3WA 1JRSA 1KSNA 1ZMNA 2Z9IA 4R8TB 1VJAU 2BDHA 1NRQH 4LZ4B 1CGJE 2TPIZ 4IMQA 2NU3E 1O2HA 5DP7A 3O8CA 1J14A 2FIRH 5CMXH 4D9QA 4E7RG 1W0ZU 3ZVFA 5C67A 4HGCA 4JK5A 1ELFA 1A46H 4HZHA 4ABEA 1C5TA 1SSXA 5A2MH 4FU8A 2GKVE 1H9HE 1TYNA 5HYOA 2GMTC 3PTBA 1RTKA 1FLEE 3MMGA 2B0FA 2R2WU 1Q3XA 3E0NB 1CVWH 5HGGA 1YF4A 1TX8A 1O38A 2QF0A 1G3DA 1NU7B 3A85A 1O5DH 1W12U 1SC8U 1LPKB 2ZWLH 1MKXK 3ZVAA 4BTTB 1UHBB 3GISB 2HPPH 3GYLB 2FM2A 3E8LA 1OS8A 1FONA 1ZGIA 2A7HA 8LPRA 1BTPA 2VINA 1N6XA 4UDWH 4AZ2B 5C2ZA 2V3OH 2C8WB 2SGFE 3EGKH 5FX5A 3VB4A 1YP9A 4E7NA 1V2ST 2JETB 2QIQA 3K6ZA 5EXMA 2VIQA 3H7OA 3ZV8A 1P3EA 2F91A 3S0NA 4THNH 2ZG0H 4YOGA 3UNRA 2ZHQH 1H9IE 5SGAE 3UREA 1LCYA 2H6MA 1E37B 1MBMA 3U8RH 1P06A 1W2KH 5F6MA 1A7SA 1EAUA 1F92A 2G8TA 3U8TH 1AD8H 1BHXF 2HLCA 5LPEA 1V2JT 1BTYA 2ZPQA 1YPKH 4FUDA 1O32A 4FUJA 1XMNB 1FMGA 5K0HA 4Y7BA 3FAOA 1GMHF 2ZO3H 2ZDNA 5H4IB 1UJ1A 4OS1A 4Q7ZA 1DWDH 4JZ1A 2ZTZA 5EOKA 2FLBH 3SGAE 4NGAH 1AUTC 3MHWU 1BBRK 1TIOA 1LVMA 5FPTA 1UK2A 1QB1A 3KQEA 1P57B 1PYTD 1SOTA 3SU6A 4YM9A 1O3GA 4K8YA 1TNKA 3LKWA 3TH2H 1XUGA 4OS4A 2ZTYA 5JBBS 1K1OA 1YYY1 5GCHF 3RXLA 2Z3EA 4NZQA 4X8VH 1L2EA 1XUIA 2FOBA 5FPYA 3SHCH 1VCWA 3GCHC 1NM6A 4Y11E 3KIDU 2XBWA 4ZKRU 3SJ9A 1P2NA 3RLYH 3BTME 5A0CA 3V13A 1GI5A 1O3NA 2OCVB 3BTDE 2PUXB 1T8OA 1KXBA 1QB6A 1UO6A 3L3TA 4KTSA 2F3CE 5LGOA 1WQVH 4MNWA 3ZZBA 1ELTA 5GDSH 1SR5C 2Q1JA 3V12A 3GDVA 4XBBA 1S85A 4ZXYH 1VCQA 1NO9H 4ABJA 1V3XA 3UIRA 5C3NA 3F9HA 1O5BB 1UTMA 1V2RT 1RTLA 1CE5A 3MFJA 2WUBA 2WV4A 1NZQH 1TRMA 1OXGA 3M7TA 3AASA 3HGPA 2EI6A 3P8GA 1O3MA 2ULLA 2NU1E 1GJ9B 1K1MA 1TBZH 1J8AA 1BHXB 2FS9A 4Y8XA 3MNSA 1O2PA 2H5DA 3UWJH 1CGIE 1TNIA 3SU1A 4MTBA 4WWYA 3ZZ4A 1O2SA 3QGNB 1SQTA 3TITA 3RDZA 3TVJB 2YNAA 3U98H 1LQEA 1W10U 4I32A 3SNDA 1GPZA 1C5LH 4WXVA 1Z6EA 1UVSH 1ZTLA 1PJPA 3A88A 2GT7A 1TGCA 4WMFA 2ZFSA 1SLXB 2Y81A 1T32A 4RKJB 1SGIB 1GGDB 1AVWA 1CA0B 1K1JA 3RMLH 1GHBG 1ZRBA 1FAKH 3UOUA 5GPIB 3UQOA 1UTOA 4ZH8A 2G00A 1TNGA 3MU5A 4QT8C 1P09A 1HAVB 3SU0A 3E6PH 1O5AB 2G5VA 3BTHE 4X6OA 1YGCH 2F9UA 4AFZA 1HAYB 1BMNH 4H4FA 3PYHA 2HGTH 1TGSZ 1GJ4H 1FY1A 2RCEA 2WPJS 2ZDVH 2FLRH 1C9TA 4O9VA 1XVMA 4JZFH 1TPPA 1NFUA 1U6QA 1HYLA 4NIYA 3SGBE 4H6TA 2Y7XA 1YPHE 2GZ7A 3BV9B 2TGAA 4DIHH 2VGCB 5JYIA 1NFWA 5FBIA 1T8MA 2THFB 2Y5HA 1GBIA 2AH4X 3RMOH 2OD3B 1MTSA 3RXKA 2ZTXA 3ZZ5A 2ZDAH 1NU9A 1DY9A 1OYQA 2GV7A 3LOXA 2UWOA 1V2LT 5TJXA 3BEFB 5CHAC 4GLYA 1BJVA 1TBQH 1SLVB 3SI3H 1WYKA 2B7DH 4JYUH 4YT6H 2HNTF 1O5GH 2BZ6H 1QBOA 4IC6A 1XUJA 5FX6A 3UPEA 3A80A 4CRDA 3SNCA 1PQ8A 3RXDA 1GI0A 1BA8B 1ZPZA 1HUTH 3M3VA 1ZHMA 1EJNA 1NESE 1FV9A 2ZDLA 2GZ8A 1C5PA 4XBDA 2F83A 1LHDH 3QWCH 2CF9H 1HIAA 3MTYA 1K21H 1QBNA 3A8AA 5EPYA 3E3TA 1P3CA 4UFDH 3ZZ8A 4ISLA 1GCTC 4D76A 1T4VH 4ZROA 4ASHA 3KN2A 5PTPA 4NIVA 1O2LA 1X7AC 2VVVA 1TPSA 3TGJE 1QL9A 3I29A 3TJOA 2XW9A 2Z9KA 3P95A 1C5MD 3P8NA 1CO7E 4DVAU 4TY7A 3SV2H 1WTHD 2AGEX 2ZFFH 1G3BA 1AFQB 2C8YB 4NWKA 3V0XA 1YPEH 3KEEA 2G55A 2NU0E 3KQCA 1GBCA 5BPEA 5JB9S 2OLGA 3ZVDA 1C5OH 2BDAA 1W8BH 1O3OA 2BVRH 1FY4A 4WJG2 3LGUA 2BXTH 1XXDA 1SG8B 3VB5A 1BB0B 2CXVA 1A5GH 1VITG 3SOSA 1SVPA 1C2LA 4AFUA 3ELAH 1DSUA 4NA7A 1RIWB 3SU5A 1A0LA 4ZKOU 2A7JA 3T27A 4NFFA 2H1UA 1UK3A 3UUZA 1ANDA 2K1QA 2ZGJA 2J38A 1C2EA 2W7SA 4AB9A 3SUDA 1GG6C 5K7RA 7GCHF 3RXAA 1DLEA 4DT7B 1O0DH 3OY6U 4F4OC 5DO4H 1O3IA 3AW1A 4ISOA 2GCHG 3O8DA 3QX5H 4ABFA 1Y3VA 2ZPSA 1WSSH 1GJBB 3GDUA 2GZ9A 1O2MA 3BG4C 4B76A 1Q31A 3F9GA 1GI2A 2A2XH 2PKAB 1CBWC 4NFEA 4X1RU 1HAPH 1TNJA 2B5TB 2IOTA 4GUXA 4A1XA 1YLCA 3SJOA 2FOMB 1HJAB 4CREA 1GBMA 1OP2A 4LXBH 2BX3A 4UFFH 2HNTC 3BTEE 3LGIA 2D2DA 1KXDA 3KHVA 4AOQA 3ZYDA 1BUIA 1V2QT 3A7ZA 1ZTKA 1O3CA 1J15A 1P2KA 1MU6B 1BDAA 2A4RA 5CE1A 3SZNA 2WPMS 4Y7AA 3ZVCA 5J4SA 1AKSB 4IS5A 1J17T 2WYJA 2QY0B 4Y71A 1IQLA 1GI4A 1GBDA 2FI4E 1BRCE 3GDSA 4U01A 2W3IA 2NWNA 2ZI2H 1N8OB 2ZFTA 4CR5A 1TMTH 2G52A 2P95A 5LPFA 2UUYA 4TPIZ 2O8WA 3LDXH 4IN1A 4O03A 1K1PA 2W26A 2SGQE 2WINI 3UFAA 4BAKB 1DWEH 2M5TA 4GAWA 4MDSA 2GV6A 3TH4H 1JMOH 1VJ9U 1CHOG 2CHAB 1QRZA 3QK1A 4CHAB 1S81A 1F5KU 3P70B 2P16A 5IDKA 2QXGA 2IJOB 3F68H 3MI4A 1K28D 3PMJA 2JKHA 1MTVA 1ESAA 1JRTA 5HM2A 1AB9B 3BTKE 3SBKA 2GTBA 1FXYA 5JBCS 3OSYA 4Q2KA 3B9FH 3QDZB 3KF2A 2Z7FE 4O97A 1BJUA 2VIWA 1GBLA 3QGJA 4WH6A 4DGJA 3RXHA 1O3AA 1NT1A 1W14U 1EPTA 3PM3A 1HAXB 2F9PA 1EZXC 4AG1A 1LVYA 4OS6A 3SUFA 1KXCA 1P02A 3VB3A 2DE8A 2O8MA 1ACBE 4NSVA 4B71A 1DUEA 2FOHA 1XUHA 3EAJA 3Q3XA 2OQ5A 2BLQA 1T8LA 3M61U 3RXOA 4H6SB 1XUFA 3M7QA 1Z8GA 5HXFA 3E1XB 4UE7H 3K2UA 5JBAS 1FAXA 4K60A 1TWXB 5DP4A 1GJ5H 1IQEA 2ANKH 1C1NA 4LZ1H 1BZXE 1GI9B 4GVUA 2A5AA 4K3JA 1C5VA 2BOHB 3Q3KA 3QO6A 4YOIA 3DUXH 1O2RA 3JZ1B 3CS0A 2FPZA 4BXSA 4AGJA 1GBBA 4UEHH 3RXCA 1K2I1 1F7ZA 4ZKSU 5BRRE 1AGJA 1F5RA 1RGQA 2PSYA 1O37A 3SW2B 4HFPB 1QHRB 2RA0A 3VGCB 2GGVB 2TRMA 4Y0YE 1S82A 1C1PA 1S5SA 1BBRE 3IITA 1O2ZA 4GSOA 3GOVB 2GCHF 3SNEA 2I6SA 3EYDA 4XBCA 3P17H 2PSXA 1MZAA 4K2YA 2PKSB 2UUFB 3VB6A 1HNEE 1TQ0B 1ETTH 5B6OA 1JBUH 1GWAA 1C1WH 1VGCC 3TGKE 3GYMA 1H1BA 4I8HA 1TA2A 3SNAA 1O3EA 4B2BA 4F49A 2GCTB 1HV7A 1P2MA 1TNHA 3U9AH 1K1IA 1OWKA 3K65B 7ESTE 1GJ6A 1CGHA 4K1TA 4IC5A 2P93A 3ZZ7A 1MCVA 3TNTA 1G2MA 1C2DA 3GY3A 6ESTA 2A4GA 1JXPA 2YOLA 2GMTB 2V35A 3B8JA 2AIQA 4Y6DA 3PROA 1LPZB 2VH6A 2FOAA 3BEUA 4DY7B 3ITIA 3LPRA 3OX7U 1T4UH 1GI8B 4ZMAH 1P0SH 1Z8IB 2SGEE 3KNXA 3M5OA 1YM0A 6GCHF 3A8DA 1QB9A 3AVZA 4JYTA 2ZGCA 4BXWA 1Y5UT 2F9NA 2ZU3A 4IN2A 4DW2U 4AYVB 2F9OA 3FZDA 4OS5A 2UWPA 4BAOB 1MMJN 2WPKS 1O3HA 1EP5A 3BTGE 3STIA
chains in the Genus database with same CATH superfamily
2LELA 4Y10E 4YT7H 4MNVA 4X1NU 1ZR0A 2R9PA 4WY3A 3MO3A 1OSSA 1PPZA 4J1YA 3E16B 1P12E 3URCA 4NWLA 3RXEA 1PFXC 5E0JA 1F0TA 5DGJA 2UUKB 1OHHD 2PFEA 3UNSA 1DS2E 3WWFA 2VWNA 3A7TA 2TGTA 1TOCB 3A82A 3H09A 6CHAB 3AW0A 3MH5A 4I7YH 1C1OA 4BTUB 2BD2A 1J16A 4DG4A 1IQIA 1UMAH 3MU8A 1D6RA 1KXAA 2SGPE 2OUAA 3TJVA 3TNSA 1SQAA 1HAIH 1DOJA 1CQQA 2Z9JA 1OOKB 3DSOA 1CT4E 4DJZB 1A3EH 1LHFH 4B75A 3EA8A 3ZZAA 1NROH 1TX6A 4WF8A 1O2WA 8GCHG 2HRVA 4KKDA 5JB8S 4IMZA 3ZZCA 5LH8A 2C4FH 1HIAB 2P8OC 1M9UA 3E0PB 4P00A 4AB8A 1V2TT 1EFRD 1FI8A 3RMMH 1YPLH 3RM0H 1RFNA 2VVCA 5KEDA 3QUMP 2BX4A 3OEHD 2J2UA 4K1SA 1ZOMA 3SUGA 1DFPA 4KTCA 2BM2A 1PPFE 1SGYE 1BQYA 2XC5A 1TE0A 3T26A 4U30A 2PLXA 2Z6BD 3GCHB 2VH0A 4BAQB 5DP6A 1BTWA 3QZQA 2XBYA 3NUMA 2BVSH 2VWOA 4Y0ZE 2G51A 2BY7X 3MU0A 1YCPM 4WVPE 3A83A 2ZECA 3ATMA 1VITH 2PWXA 4NIXA 1F0RA 5T1VA 2STBE 5FXLA 2FOFA 3PLPA 1BMAA 1Z6JH 1A3BH 1ZJDA 2GT8A 3MNXA 1BTZA 2FZZA 4ZHMU 2LP6A 5L6NH 1SLUB 1T8NA 4YLUA 5I25A 2ZEBA 2BY8X 1EJMA 1C1TA 2QV1A 3R3GB 1ZYOA 3ODDA 4ACAA 1HDTH 3ZVEA 2ZP0H 1LPGB 1GJ8B 1ELEE 3VEQB 1EAWA 4TY6A 2AIPA 2GDEH 5EW1H 1O2VA 4YZUA 1HAZB 3E90B 1JOUB 5E8EH 1LMWB 3RXRA 5HIYA 2KAIA 1BRAA 1OWDA 1UTQA 4YESB 2FYRA 2V0BA 2ZDKA 1SB1H 1DPOA 5A0BA 4XOJA 4Z6AH 5KECA 3GY2A 3AAUA 2ZU1A 1OP8A 3D49H 3PO1B 1FN6A 1DWBH 1LHEH 5EW2H 1BOQA 1KMHB 1E36B 1HAHH 2WPLS 1KY9A 1XUKA 4GCHG 3PLBA 5KGOA 5C0TA 1C5WB 4FUIA 3SV7A 1WQSA 3MU1A 4J2YB 3EDXB 1TNLA 1FJSA 2XOKD 1AWHB 3M37A 1KTSB 1L4ZA 2ZGXH 1DDJA 1QJ1B 1OX1A 2D1JA 4AYYB 1UVTH 4I33A 4AORA 2QAAA 1UTJA 2C90B 1GI3A 3KQ5A 4JMYA 4YLQH 1EOJA 1QRXA 2BZAA 4MPUA 1PQ5A 4WMDA 4KP0A 4A1TA 5C1UA 4FUGA 4DIIH 1QBVH 4MPXA 1AE5A 1FPHH 3F2FA 4CRAA 2PR3A 2WUCA 1V2OT 2PP6A 2VU8E 1SGDE 1P03A 4AN7A 1LHCH 3TJUA 3RXBA 4JYVH 1P2IA 3RXUA 2FDAA 1D6WA 1EX3A 1ETRH 3T5FH 1ZSLA 4ISIH 5CHAB 4X2WA 2J98B 2OP9A 1THSH 3CS7A 3HK3B 4F48B 4FVDA 5GIBA 5FPSA 1D9IA 3LC5A 1JIMA 4UFGH 1GGDC 1W7GH 1GI6A 3SUEA 4Q80A 2OC8A 5EGMA 1XXFA 2HLDD 1K1NA 1Y3UA 2CV3A 2TGDA 3IWMA 3CNRA 3SGQE 1UCYH 1O3LA 4RKOB 1GL1A 2J5UA 2R0KA 2UWLA 3VXFH 3B23B 3Q76A 3UTUH 2W7UA 2ASUB 1O39A 2C3SA 1O2XA 4GHQA 3ODFA 3A86A 2B8OH 4NZLA 2H2ZA 3LJJA 4TYDA 3GY4A 1GCTB 1FUJA 1AVGH 1CHGA 2V3HH 3RLWH 1Y5AT 4K8BA 4CH8B 1GVKB 1FY5A 1VR1H 1ZSJA 2H5CA 2H9TH 1EPTC 2Z3CA 1QQUA 5EQQA 3U1IB 3RXJA 1E35B 2XTTB 2ZHEH 1AVXA 1Z8JB 4RT1A 2VGCC 1EB1H 4X8SH 1GMCG 3SQHE 5G4BA 3ZZ6A 3RXPA 3QZRA 3DCLA 3QTOH 1ABJH 1G30B 1EAIA 4ZKNU 3AAVA 2F9BH 1HCGA 3UY9A 4TT3D 3UOPA 2BDCA 4XFQA 1AN1E 2BQ7B 1P05A 4X1QU 2WSSD 1GVZA 1GBJA 2QF4A 2FS8A 5T6GA 3RUOA 5EQSA 1ANCA 1IOEA 1H8ED 3PV4A 1C2JA 2VIDA 2YMSC 1AIXH 3A84A 3EA7A 3MH6A 1MD8A 1Z7KA 1Z71A 2RG3A 3F9FA 4D9RA 1EOLA 4R0IA 4X1PU 1FX0B 1LVBA 3O8BA 1NY22 3FZZA 3PMBB 3TPIZ 1O3DA 2RA3A 1GG6B 1O34A 5EIYA 3I77A 1SQOA 2G81E 3HATH 3PWCA 1VKYA 3NXPA 4X6NA 3WWBA 2FYQA 4AFSA 3E91A 1KTTB 2CJIA 1TRYA 2QC2A 4XDEA 3A7XA 1TLDA 2CK3D 3DD2H 2Q6DA 2G4UA 1KXEA 2BXUH 3BG4B 1E79D 1GJCB 1D3QB 1ELDE 1CBWB 3LH1A 1V2UT 1O2NA 2QGRA 3GS9A 1VCPA 1EP6A 2H9HA 2FOCA 3GY8A 3PTNA 3MOCA 1EAXA 1QQ4A 2VIPA 1A5IA 3OYPA 1Y59T 1UCYK 4MQAA 1YCPH 3LU9B 4YO9A 4B74A 1GHBF 1ELCA 1A2CH 2XBXA 2LNCA 1DITH 1PQAA 2F9VA 1LKBA 3RMNH 1ELAA 1BMMH 1OKXA 2AMPA 3FP7E 3HKJB 4X8UH 1TX7A 1UTLM 5FCRA 1QCPA 4ZAEA 3N7OA 5A09A 3RXFA 1H8HD 3VB7A 3FVFB 3F6UH 3FFGA 1K1LA 5T3HA 1GHWH 1INCA 4BANB 1C1UH 1G3CA 2AMDA 1DICA 2A32A 4D7GA 1AFEH 5C94A 5JBTA 3TJNA 5ESTE 2VIVA 3K6YA 2QCYA 3BTWE 3HGNA 1W11U 1MQ6A 1WUNH 1ZLRA 9ESTA 1IQHA 3BN9A 1WOFA 3KYGA 4KTUA 3FOAA 5AF9H 1J9CH 2Y5GA 1EB2A 4LOYH 4VGCB 1WCZA 1ARCA 2HNTE 3I78A 3M3SA 3UWIA 1JWTA 1TALA 3ATLA 3OTJE 3TH3H 3TGIE 1UTKA 5TCCA 3H7TA 3LC3A 2BOKA 1D4PB 4BNRA 1DWCH 3LGTA 1KDQA 3URDA 1SPJA 1NRRH 5DJ7A 3V3MA 1QA0A 4I8GA 2R2MB 1ZJKA 3SV6A 8ESTE 4ZHLU 1HAVA 3RXSA 4ESTE 3PV2A 1IQGA 2ZZUH 2OINA 2ZGHA 4ABIA 1XX9A 1EKBB 2JH0D 1GDNA 2O9QA 1TFXA 1G9IE 1GMCF 1Z8RA 1P9SA 1HAGE 4D7FA 2WYGA 3DFJA 1DVAH 2ANWA 2ESTE 1CT0E 2P94A 1AE8H 2ZCLP 1S83A 2UUJB 2AERH 4IW4E 3C27B 1O5CB 3ZV9A 2EQNA 4X2YA 1KYNA 2G4TA 1YCPK 1GJAB 7KMEH 2SGAA 1CT2E 2SGDE 2AFQB 1S6FA 2XWAA 3SJIA 1GHXH 1NN6A 3SJKA 1B5GH 1G37A 4BOHA 5F03A 4B2CA 1P01A 5C20A 4AFQA 3KQDA 1IQKA 1A0JA 4OGXA 2BLVA 1HGTH 2CHAC 4Y79A 2ZDMA 2VB0A 1RJXB 4A5TS 4CHAC 2BY5X 1Z1JA 2WPDD 1MD7A 2YNBA 3RXQA 1C9PA 1O5FH 5DKMA 5A8ZA 3NKKA 1KXFA 1P8VC 3SJ8A 2NU4E 5JPMH 1BTUA 1QZ8A 4K5ZA 3PMAB 4K1EA 1VITF 3S9CA 4Y8ZA 1TQ7B 2ZCKP 1GHZA 1AQ7A 1NFXA 1PPBH 1D3DB 1O35A 2W6ID 1WV7H 4CRFA 1SBWA 1SGNE 4ISNA 2Q6GA 1TOMH 2VBCA 4FETA 5AFZH 3UR6A 3SORA 5IYTA 3A8CA 4Q63A 3NPSA 2A5IA 1IQNA 3TLOA 3SU2A 2BD8A 1GI7B 1IQJA 1VGCB 3GY5A 1O5EH 3D23A 2GJGA 4X2XA 4YTAA 3ZZ9A 1DLKB 1G2LA 2XXLA 4OS2A 1PPHE 2A2QH 2BDIA 3R0FA 2PGQB 1RXPA 1SGQE 1XKBC 1A5HA 1GDUA 3EE7A 1OWHA 2QYIA 1SGFG 1JIRA 5DP8A 3PMHB 5F8XA 1YPJH 1C2HA 3TIUA 5GXPA 1L1GA 2ZU2A 1L4DA 5GCHG 4A92A 1HBTH 4CBNA 1GMDG 4INHA 3UR9A 1FY3A 1GHAG 1GCDA 2WPHS 5HKKD 1V2KT 2BD7A 2O8LA 1L1NA 3GICB 2EA3A 1ZHPA 1OWEA 4X0WU 5DP3A 1ZRKA 3VXEH 2OQUA 1MKWH 3S9AA 3G01A 2RFKC 3MH4A 4FUBA 2ODQA 3LH3A 1C5ZB 4SGAE 1F0SA 1V2NT 4X2VA 1FZZA 1NRSH 2Y82A 2P3UB 3LT3A 3SO3A 3GCTG 1DE7H 1KLIH 4UFEH 4BAMB 2EEKA 2EY4C 3F1SB 1NRPH 4UD9H 1ESBA 2FESH 4GHTA 1RTFB 4HG6A 1EXFA 5DG6A 3FN8A 2PKSC 1ESTA 1ORFA 5J4QA 2W6JD 2GD4B 2PHBA 2HALA 3TU7H 1MTNC 8KME2 1O31A 2J9NA 1UTNA 2ZGBH 2GCTC 1PQ7A 4KGAA 1CHOF 1B0FA 1ZHRA 2BB4A 1ID5H 2JJ1D 1O36A 1O2OA 1MAYA 3DFLA 3ZZDA 2PKAA 1H8DH 1O2GH 5I46H 1LO6A 1DUAA 1O2YA 1FPCH 1OPHB 1SMFE 2KCPA 3U1JB 1ZPCA 1PPCE 1G36A 1SGEE 5A8XA 1O3FA 3S69A 1AMHA 2ZHWH 3PWBA 2P8OB 2ALPA 1S0QA 4P02A 4ZHAA 1ELBA 2ZA5A 2P59A 3MO6A 1AKSA 2FP7B 1BT7A 4PROA 4Y76A 3SHAH 2AEIH 5HM9A 2V6NA 3ATWA 3MU4A 1C5NH 2ALVA 3RXVA 1C5YB 3QN7A 4FU9A 1B0EA 1OWJA 3BG8A 3LIWA 4ABAA 2XNIA 3SU3A 1BTXA 3BTTE 5EODA 1DSTA 2J94A 2Z9GA 3EE0B 4WMEA 1HAOH 1AO5A 3FP6E 1NPMA 2GP9B 1MTUA 1PYTC 3TK6A 4M9FA 1SHHB 1GJ7B 5T6FA 2AYWA 1HB0B 4I8JA 4Q7YA 1E38B 4WXIA 1O3JA 3T25A 5F8ZA 2QXJA 3W94A 2JETC 2ANMH 6CHAC 1TRNA 3WW7A 4X6PA 1IAUA 1MKWK 2FOGA 2FTMA 4MNXA 1Y5BT 1ZTJA 2ZU5A 5AVDA 2AS9A 5C5OA 3T29A 1GL0E 4NA9H 3RXTA 2QA9E 4K69A 1MQ5A 4X1SU 2BVXH 3T62A 4ABGA 4IBLH 2BDYA 3UNQA 1MH0A 1TA6A 3A89A 1F0UA 1QGFA 4H42U 1C1QA 1C1RA 2BDGA 1O2JA 1P2JA 4I31A 1DY8A 1BIOA 4CRCA 1FNIA 2XYAA 3ZYEA 2Z94A 1O3KA 1QRWA 3A87A 3DT0H 3M5MA 2FOEA 2FEQH 1BMFD 1K22H 1C1SA 1TMUH 4ABHA 5F8TA 3Q00A 1H9LB 2A45B 1TGTA 9LPRA 1D3TB 2AGGX 1GMDF 3RXIA 2QXIA 5E0HA 1GHAF 2A0QB 4TPYA 1P04A 4NSYA 4AGKA 2BTCE 1FIZA 1MABB 1HXEH 2I6QA 1QURH 1ZGVA 1A0HB 1C5UA 1D3PB 2H9EH 3DA9B 3QLPH 3CP7A 1C1VH 4DURA 1HJ8A 4B73A 1BTHH 2W3KA 2NU2E 1P10A 4DOQA 2XNDD 5EXLA 3D62A 2BYAX 1WTGH 1ABIH 2HPQH 4I8KA 3LGVA 3ZVGA 1HPGA 1MUEB 5HMAA 1K0HA 3MNBA 5EU8A 3GCTF 2QF3A 1P2QA 2VNTA 3MNCA 1FN8A 3SU4A 4FUCA 1P9UA 1UVPA 1C2GA 3H5CB 3U8OH 2PW8H 1IQFA 2VIOA 1DM4B 2B9LA 2SNVA 5FBEA 5LPRA 1QR3E 2J34A 2BHGA 4HI3A 4WH8A 2Y7ZA 2BY6X 3MH7A 2ZCHP 5AHGH 1T31A 1TGBA 1O2QA 1UTPA 1P2OA 3P92A 3SV9A 4CBOA 2K0QA 2KFWA 1BITA 3FP8E 3RU4E 3OTPA 1W13U 2A31A 4MNYA 3BIUH 2ZIQH 2O8UA 3BEIB 3RC5A 5GWZA 1WBGB 1AHTH 3KL6A 4HTCH 5AFYH 3TK5A 3RU4D 1GBTA 2FX6A 1GVLA 2WPIS 2ZFRH 1KIGH 3M7UA 4Z0KA 1RS0A 4MPVA 4KELA 4OGYA 1A4WH 1QNJA 2R3UA 3F0OA 1Y3XA 1S0RA 2Z3DA 3WY8A 3M5NA 3VG8A 3U69H 3KQBA 4NCYA 2FO9A 3SI4H 4Q7XA 1QL7A 7GCHG 3MO9A 3PO1C 4FUEA 1TPOA 4NG9H 1C5QA 2BD5A 1KDQB 1YPHC 1UCYE 5E2OA 1RD3B 2A7CA 2M2AA 3KCGH 3A7WA 4JZDH 1L0ZA 3RM2H 4RSPA 3UQVA 2ODYB 3ZZ3A 3OY5U 1OYTH 1Z1IA 1HJ9A 4XE4A 8GCHF 1SI5H 2ODPA 2SFAA 2P3FH 5FCKA 1ARBA 1FIWA 1S6HA 3RP2A 4A1VA 4E06H 4X8TH 1TBRH 2DUCA 3ZIAD 1O30A 1KLTA 1CA0C 2Q6FA 4NIWA 3BIVH 1C2KA 5ETXA 1F2SE 1HRTH 2ZF0H 1YBWA 1OP0A 1GBFA 2BMGB 1EPTB 1MAXA 1XM1A 1EZSC 1GHYH 3EA9A 1ZMLA 2ZHFH 1G3EA 1W3CA 1O33A 1UHBA 2ZHDA 3ESTA 1N1LA 1F5LA 3T28A 1ELVA 3EQ0H 3PB1E 1A1RA 4AX9H 1DXWA 2CN0H 1SGRE 2ZU4A 3T2NA 3RXGA 3L6PA 1W7XH 3K9XB 5L2ZH 1ELGA 4I8LA 4B2AA 5DSFA 2ZQ1A 4DT4A 4TWWA 1YWUA 5FAHA 2GVFA 3SN8A 1BRUP 2ANYA 2PV9B 1GBAA 2O8TA 2RDLA 1AZ8A 1TONA 1SL3A 2YMSB 3CENA 3RC4A 1E34B 2XC4A 3F9EA 3M5LA 5DK1A 2HOBA 3SNBA 4O3TA 2J4IA 1QTFA 1SGPE 3PLKA 1EATA 1UVUH 1QA7A 1KLJH 5CDFE 4JK6A 1C2FA 2BDBA 4RN6A 2TBSA 1LTOA 2FI5E 1MZDA 1XKAC 1VZQH 1NFYA 2A1DB 5TCAA 1UW7A 1DX5M 2XWBI 5ESBA 1V2MT 1MTWA 4XD7D 2A4OA 2OBOA 2Y6TA 1FQ3A 1NS3A 5ABWA 1OWIA 5A0AE 4INLA 1O3BA 4IGDA 1GI1A 1C1MA 5GJ4B 1S6LA 1TAWA 3S7HB 2ZC9H 4YOJA 1PPEE 2D26C 2G5NA 1QY6A 2HWLB 2V7QD 3IG6B 3LGWA 1YPMH 2PUQH 1PPGE 1WAYB 3DSPA 1UK4A 2JH6D 1ZSKA 2FXRA 5EPNA 3SV8A 3OE7D 1T7CA 1WDIA 4GCHF 1ZMJA 1GBEA 3C1KA 3P8FA 4D8NA 2VJ1A 2A4QA 5E0GA 1A61H 2OC1A 4B1TA 1XVOA 1NC6A 2AMQA 2EI7A 2XC0A 1AFQC 4CRBA 4MPWA 2YMSD 3RXMA 1GDQA 1GJDB 2FODA 2CMYA 1GBKA 1SQRA 1IHSH 1O2KA 4U2WA 1TGNA 4XSKU 4Y8YA 1YC0A 1YPGH 1V2WT 4JZIA 1Q2WA 2FMJA 1AUJA 3W95A 5C1XA 5L30H 2R0LA 2IN2A 5JDUB 3A8BA 1ANBA 5EJZA 3DHKH 2R3YA 1W0YH 3PV5A 3A81A 4CRGA 2A5KA 1NTPA 4BTIB 1RIWC 1S84A 2EC9H 4A7IB 3S9BA 3N7DA 1TB6H 4ABDA 1SGTA 3N7EA 4BAHB 1TMBH 2FX4A 4CR9A 3HPTB 1AY6H 4AG2A 1SLWB 2CF8H 3STJA 1QFKH 2OXSA 1O2IA 1BMLA 1YLDA 3V7TA 4ZXXH 3BF6H 4JCNA 1SFIA 2ZFQH 4MG3A 1LVOA 1V2PT 1LKAA 1CU1A 2J92A 4ABBA 2PGBB 1H4WA 4U32A 1CSOE 3MWIU 4MLFB 2STAE 5DP9A 3RU4T 2Y80A 2W5EA 5EQRA 3F2GA 2P3TB 1L1JA 1DT2A 4ISHH 1C5SA 1HJAC 2VWMA 2VVUA 1EZUC 1AWFH 1FDPA 1EASA 4FUHA 1ZPBA 1ETSH 2ZPRA 4B6FA 3LJOA 1E0FD 3N99A 1SGFA 2FTLE 3FANA 1NBMD 2Y5FA 6GCHG 1EUFA 4Q4LA 1WU1A 1QJ7B 1ZZZA 1C4U2 2J95A 2HVXA 2XCNA 4ZUHA 2BY9X 1O2TA 3GY7A 2F4LA 1LHGH 4FXGH 3KGPA 2GDDA 2EI8A 2OTVA 3ATKA 3NWUA 1COWD 5T6DA 4UONA 1DXPA 4E05H 1LQDB 1N8OC 2ILNA 1V2VT 2BD3A 2JIZD 3ATIA 4VGCC 4A6LA 1P11E 4FU7A 4FUFA 4LK4A 1MU8B 3VPKA 1NRNH 2C8XB 2J98A 3SQEE 3GCOA 1QL8A 1TPAE 3RC6A 3M36A 2FWWA 1HFDA 3P6ZB 3Q77A 4M7GA 1EJAA 1EZQA 3M35A 1BRBE 1UVOA 2QXHA 2KM0A 3F2HA 4CH2B 4I86A 2OC7A 4DCDA 2JH5D 1QJ6B 1FY8E 1AZZA 1THPB 2IPHA 1ANEA 2IJD1 1AI8H 1GBHA 2LPRA 2AGIX 1GHVH 3NZIA 2WV5A 3L33A 1YKTA 1C2IA 3BSQA 4MVNA 1B7XB 1G32B 2V3MA 2ZKSA 3ENSB 2L74A 4NA8A 2DE9A 3NK8A 2XRCA 1C5RA 1AB9C 3D65E 3HK6B 3P8OA 3QTVH 2PTNA 2BD9A 1N6YA 4GPGA 1TABE 1C4V2 3JZ2B 1EQ9A 1O3PB 5EXNA 2ZQ2A 2TGPZ 1YLNA 4O3UA 1HXFH 1GMHG 3GCNA 2BLWA 3GY6A 2BQ6B 1MKXH 2BQWB 5C0UA 1THRH 5L2YH 2KAIB 3LONA 7LPRA 2D8WA 2FI3E 3M3TA 1QIXB 3TK9A 2XBVA 5DP5A 1IQMA 1Y3YA 1K9OE 2ZFPH 3A7YA 2SNWA 1RRKA 5DPAA 4X6MA 1CA8B 1SGCA 4SGBE 1IHTH 2BLOA 3HKIB 2TIOA 1SOZA 5C17A 1V6DA 5E2PA 5FHTA 1MCTA 1HLTH 3VFEA 1AU8A 2AHME 1BCUH 3U28C 2ZNKH 1O2UA 1SHYA 4JZEH 2PTCE 2Z9LA 1C2MA 1LDTT 2CGAA 3S7KB 3O8RA 6LPRA 1DANH 3MYWA 2QN5T 3LGYA 2C93B 3ZVBA 1H8IH 4FVBA 3BTQE 5C1YA 2GX4A 5A8YA 3AK5A 3VGCC 1C4Y2 2XCFA 1MTNB 3BTFE 4OS7A 1SFQB 2BD4A 3Q3YA 3NCLA 4INKA 4TWYA 2OBQA 2C8ZB 3OU0A 2OC0A 1Y8TA 1C5XB 1MBQA 2VWLA 5EG4A 5C5NA 2KX4A 1BBRH 3A7VA 4ACBA 1Y3WA 1JRSA 2WHXA 1KSNA 1ZMNA 2Z9IA 4R8TB 1VJAU 2BDHA 1NRQH 4LZ4B 1CGJE 2TPIZ 4IMQA 2NU3E 1O2HA 5DP7A 3O8CA 1J14A 2FIRH 5CMXH 4D9QA 4E7RG 1W0ZU 3ZVFA 5C67A 4HGCA 4JK5A 1ELFA 1A46H 4HZHA 4ABEA 1C5TA 1SSXA 5A2MH 4FU8A 1WXRA 2GKVE 1H9HE 1TYNA 5HYOA 2GMTC 3PTBA 1RTKA 1FLEE 3MMGA 2B0FA 2R2WU 4YXWD 1Q3XA 3E0NB 1CVWH 5HGGA 1YF4A 1TX8A 1O38A 2QF0A 1G3DA 1NU7B 3A85A 1O5DH 1W12U 1SC8U 1LPKB 2ZWLH 1MKXK 3ZVAA 4BTTB 1UHBB 3GISB 2HPPH 3GYLB 2FM2A 4ASUD 3E8LA 1OS8A 1FONA 1ZGIA 2A7HA 8LPRA 1BTPA 2VINA 1N6XA 4UDWH 4AZ2B 5C2ZA 2V3OH 2KR7A 2C8WB 2SGFE 3EGKH 5FX5A 3VB4A 1YP9A 4E7NA 1V2ST 2JETB 2QIQA 3K6ZA 5EXMA 2VIQA 3H7OA 3ZV8A 1P3EA 2F91A 3S0NA 4THNH 2ZG0H 4YOGA 3UNRA 2ZHQH 1H9IE 3UAIC 5SGAE 3UREA 1LCYA 2H6MA 1E37B 1MBMA 3U8RH 1P06A 1W2KH 5F6MA 1A7SA 1EAUA 1F92A 2G8TA 3U8TH 1AD8H 5B6LA 1BHXF 2HLCA 5LPEA 1V2JT 1BTYA 2ZPQA 1YPKH 4FUDA 1O32A 4FUJA 1XMNB 1FMGA 5K0HA 4Y7BA 3FAOA 1GMHF 2ZO3H 2ZDNA 5H4IB 1UJ1A 4OS1A 4Q7ZA 1DWDH 4JZ1A 2ZTZA 5EOKA 2FLBH 3SGAE 4NGAH 1AUTC 3MHWU 1BBRK 3OAAD 1SKYE 1TIOA 1LVMA 5EJ1A 4XRNA 2WZQA 5FPTA 1UK2A 1QB1A 3KQEA 1P57B 1PYTD 1SOTA 3SU6A 4YM9A 1O3GA 4K8YA 1TNKA 3LKWA 3TH2H 2WV9A 1XUGA 4OS4A 2ZTYA 5JBBS 1K1OA 1YYY1 5GCHF 3RXLA 2Z3EA 4NZQA 4X8VH 1L2EA 1XUIA 2FOBA 5FPYA 3SHCH 1VCWA 3GCHC 1NM6A 4Y11E 3KIDU 2XBWA 4ZKRU 3SJ9A 1P2NA 3RLYH 3BTME 5A0CA 3V13A 1GI5A 1O3NA 2OCVB 3BTDE 2PUXB 1T8OA 1KXBA 1QB6A 1UO6A 3L3TA 4KTSA 2F3CE 5LGOA 1WQVH 4MNWA 3ZZBA 1ELTA 5GDSH 1SR5C 5IK2D 2Q1JA 3V12A 3GDVA 4XBBA 1S85A 4ZXYH 1VCQA 1NO9H 4ABJA 1V3XA 3UIRA 5C3NA 3F9HA 1O5BB 1UTMA 4AC9A 1V2RT 1RTLA 5GNDA 1CE5A 3MFJA 2WUBA 2WV4A 1NZQH 1TRMA 1OXGA 3M7TA 3AASA 3HGPA 2EI6A 3P8GA 1O3MA 2ULLA 2NU1E 1GJ9B 1K1MA 1TBZH 3W1EA 1J8AA 1BHXB 2FS9A 4Y8XA 3MNSA 1O2PA 2H5DA 3UWJH 1CGIE 3FO8D 1TNIA 3SU1A 4MTBA 4WWYA 3NRLA 3ZZ4A 1O2SA 3QGNB 1SQTA 3TITA 3RDZA 3TVJB 2YNAA 3U98H 1LQEA 1W10U 4I32A 3SNDA 1GPZA 1C5LH 4WXVA 1Z6EA 1UVSH 1ZTLA 1PJPA 3A88A 5CHBA 2GT7A 1TGCA 4WMFA 2ZFSA 1SLXB 2Y81A 1T32A 4RKJB 1SGIB 1GGDB 1AVWA 1CA0B 1K1JA 3KYFA 1GHBG 1ZRBA 1FAKH 3RMLH 3UOUA 5GPIB 3UQOA 1UTOA 4ZH8A 2KCYA 2G00A 1TNGA 3MU5A 1E1RD 4QT8C 1P09A 1HAVB 3SU0A 3E6PH 1O5AB 2G5VA 3BTHE 4X6OA 1YGCH 2F9UA 4AFZA 1HAYB 1BMNH 4H4FA 3PYHA 2HGTH 1TGSZ 1GJ4H 1FY1A 2RCEA 2WPJS 2ZDVH 2FLRH 1C9TA 4FOUC 4O9VA 1XVMA 4JZFH 1TPPA 1NFUA 1U6QA 1HYLA 4NIYA 3SGBE 4H6TA 2Y7XA 1YPHE 3MQKC 2GZ7A 3BV9B 2TGAA 4DIHH 2VGCB 5JYIA 1NFWA 5FBIA 1T8MA 2THFB 2Y5HA 1GBIA 2AH4X 3RMOH 2OD3B 1MTSA 3RXKA 2ZTXA 3ZZ5A 2ZDAH 1NU9A 1DY9A 1OYQA 2GV7A 3LOXA 2UWOA 1V2LT 1YY3A 5TJXA 3BEFB 3SYJA 5CHAC 4GLYA 1BJVA 1TBQH 1SLVB 3SI3H 1WYKA 2B7DH 4JYUH 4YT6H 2HNTF 1O5GH 2BZ6H 1QBOA 4IC6A 3FKSD 1XUJA 5FX6A 3UPEA 3A80A 4CRDA 3SNCA 1PQ8A 3RXDA 1GI0A 1BA8B 1ZPZA 1HUTH 3M3VA 1ZHMA 1EJNA 1NESE 1FV9A 2ZDLA 2GZ8A 1C5PA 1E1QD 4XBDA 2F83A 1LHDH 3QWCH 2CF9H 1HIAA 3MTYA 1K21H 1QBNA 3A8AA 2JJ2D 5EPYA 3E3TA 1P3CA 4UFDH 3ZZ8A 4ISLA 1GCTC 4D76A 1T4VH 4ZROA 4ASHA 3KN2A 5PTPA 4NIVA 1O2LA 1X7AC 2VVVA 1TPSA 3TGJE 1QL9A 2JDID 3I29A 3TJOA 2XW9A 2Z9KA 3P95A 3UB0A 1C5MD 3P8NA 1CO7E 4DVAU 4TY7A 3SV2H 1WTHD 2AGEX 2ZFFH 1G3BA 1AFQB 2C8YB 4NWKA 3V0XA 1YPEH 2RDEA 3KEEA 2G55A 2NU0E 3KQCA 1GBCA 5BPEA 5JB9S 2HVYB 2OLGA 3ZVDA 1C5OH 2BDAA 1W8BH 1O3OA 2BVRH 1FY4A 4WJG2 3LGUA 2BXTH 1XXDA 1SG8B 4Z1MD 3VB5A 1BB0B 2CXVA 1A5GH 1VITG 3SOSA 1SVPA 1C2LA 4AFUA 3ELAH 1DSUA 2KZ4A 4NA7A 1RIWB 3SU5A 1A0LA 4ZKOU 4TSFD 2A7JA 3T27A 4NFFA 2H1UA 1W0KD 1UK3A 3UUZA 1ANDA 2K1QA 2ZGJA 2J38A 1C2EA 2W7SA 4AB9A 3SUDA 1GG6C 5K7RA 7GCHF 3RXAA 2F43B 1DLEA 4DT7B 4F55A 1O0DH 3OY6U 4F4OC 5DO4H 1O3IA 3AW1A 4ISOA 2GCHG 3O8DA 3QX5H 3OEED 4ABFA 3SZEA 1Y3VA 2ZPSA 1WSSH 1GJBB 3GDUA 2GZ9A 1O2MA 3BG4C 4B76A 1Q31A 3F9GA 1GI2A 2A2XH 2PKAB 1CBWC 3F0PA 4NFEA 4X1RU 1HAPH 1TNJA 2B5TB 2IOTA 4GUXA 4A1XA 1YLCA 3SJOA 2FOMB 1HJAB 4CREA 1GBMA 1OP2A 4LXBH 2BX3A 4UFFH 2HNTC 3BTEE 5FL7D 3LGIA 2D2DA 1KXDA 3KHVA 4AOQA 3ZYDA 1BUIA 1V2QT 3A7ZA 1ZTKA 1O3CA 1J15A 1P2KA 1MU6B 1BDAA 2A4RA 5CE1A 3SZNA 2WPMS 4Y7AA 3DSGA 3ZVCA 5J4SA 1AKSB 4IS5A 1J17T 2WYJA 2QY0B 4Y71A 1IQLA 3PRBA 1GI4A 1GBDA 5HIZA 2FI4E 1BRCE 3GDSA 4U01A 2W3IA 3PRDA 1NBME 2NWNA 2ZI2H 1N8OB 2ZFTA 4CR5A 1TMTH 2G52A 2P95A 3OFND 2OK5A 5LPFA 2UUYA 4TPIZ 2O8WA 3LDXH 4IN1A 4O03A 4OM9A 2L6OA 4RI0A 1K1PA 2W26A 2SGQE 2WINI 3UFAA 4BAKB 1DWEH 2M5TA 4GAWA 4MDSA 2GV6A 3TH4H 1JMOH 1VJ9U 1CHOG 5F53A 2CHAB 1QRZA 3QK1A 4CHAB 3F3BA 1S81A 1F5KU 3P70B 2P16A 5IDKA 2QXGA 2IJOB 3F68H 3MI4A 1K28D 3PMJA 2JKHA 1MTVA 1ESAA 1JRTA 5HM2A 1AB9B 3BTKE 3SBKA 2GTBA 1FXYA 5JBCS 3OSYA 4Q2KA 3B9FH 3QDZB 3KF2A 2QF5A 2Z7FE 4O97A 1BJUA 2VIWA 1GBLA 3QGJA 4WH6A 4DGJA 3RXHA 1O3AA 1NT1A 1W14U 1EPTA 3PM3A 1HAXB 2KCAA 2F9PA 1EZXC 4AG1A 1LVYA 4OS6A 2J97A 3SUFA 1KXCA 1P02A 3VB3A 2DE8A 2O8MA 5EJLA 1ACBE 2QE7D 4NSVA 4B71A 1DUEA 2FOHA 1XUHA 3EAJA 3Q3XA 2OQ5A 2BLQA 1T8LA 3M61U 3RXOA 4H6SB 1XUFA 3M7QA 1Z8GA 5HXFA 3E1XB 4UE7H 3K2UA 5JBAS 1FAXA 4K60A 1TWXB 5DP4A 1GJ5H 1IQEA 2ANKH 5DN6D 1C1NA 4LZ1H 1BZXE 1GI9B 4GVUA 2A5AA 4K3JA 1C5VA 2BOHB 3Q3KA 3QO6A 4YOIA 3DUXH 1O2RA 3JZ1B 3CS0A 2FPZA 4BXSA 4AGJA 1GBBA 4UEHH 3RXCA 1K2I1 1F7ZA 4ZKSU 5BRRE 1AGJA 1F5RA 1RGQA 2PSYA 2KCOA 1O37A 3SW2B 4HFPB 1QHRB 2RA0A 3VGCB 2GGVB 2TRMA 4Y0YE 1S82A 1C1PA 1S5SA 1BBRE 3IITA 1O2ZA 4GSOA 3GOVB 2GCHF 3SNEA 2I6SA 3EYDA 4XBCA 3P17H 2PSXA 1MZAA 4K2YA 2PKSB 2UUFB 3VB6A 1HNEE 1TQ0B 1ETTH 2IPQX 5B6OA 1JBUH 1GWAA 1C1WH 1VGCC 3TGKE 3GYMA 1H1BA 4I8HA 1TA2A 3SNAA 1O3EA 4B2BA 4F49A 2GCTB 1HV7A 1P2MA 1TNHA 3U9AH 1K1IA 1OWKA 3K65B 7ESTE 1GJ6A 4B6EA 1CGHA 4K1TA 4IC5A 2P93A 3ZZ7A 1MCVA 3TNTA 1G2MA 1C2DA 3GY3A 6ESTA 2A4GA 1JXPA 4RT0A 2YOLA 2GMTB 2K8IA 2V35A 3B8JA 2AIQA 4Y6DA 3PROA 1LPZB 2VH6A 2FOAA 3BEUA 4DY7B 3ITIA 3LPRA 3OX7U 4ZCNA 1T4UH 1GI8B 4ZMAH 1W0JD 1P0SH 1Z8IB 2SGEE 3KNXA 3M5OA 1YM0A 6GCHF 3A8DA 1QB9A 3AVZA 4JYTA 2ZGCA 4BXWA 1Y5UT 2F9NA 2ZU3A 4IN2A 4DW2U 4AYVB 2F9OA 3FZDA 4OS5A 2UWPA 4BAOB 1MMJN 2WPKS 1O3HA 1EP5A 3BTGE 3STIA
chains in the Genus database with same CATH topology
4Y10E 4YT7H 4MNVA 4X1NU 1ZR0A 2R9PA 4WY3A 3MO3A 1OSSA 1PPZA 4J1YA 3E16B 1P12E 3URCA 4NWLA 3RXEA 1PFXC 5E0JA 1F0TA 5DGJA 2UUKB 2PFEA 3UNSA 1DS2E 2VWNA 3A7TA 2TGTA 1TOCB 3A82A 6CHAB 3AW0A 3MH5A 4I7YH 1C1OA 4BTUB 2BD2A 1J16A 4DG4A 1IQIA 1UMAH 3MU8A 1D6RA 1KXAA 2SGPE 2OUAA 3TJVA 3TNSA 1SQAA 1HAIH 1DOJA 1CQQA 2Z9JA 1OOKB 1CT4E 4DJZB 1A3EH 1LHFH 4B75A 3EA8A 3ZZAA 1NROH 1TX6A 4WF8A 1O2WA 8GCHG 2HRVA 4KKDA 5JB8S 4IMZA 3ZZCA 5LH8A 2C4FH 1HIAB 2P8OC 1M9UA 3E0PB 4AB8A 1V2TT 1FI8A 3RMMH 1YPLH 3RM0H 1RFNA 2VVCA 3QUMP 2BX4A 4K1SA 2J2UA 1ZOMA 3SUGA 1DFPA 4KTCA 2BM2A 1PPFE 1SGYE 1BQYA 2XC5A 1TE0A 3T26A 4U30A 2PLXA 2Z6BD 3GCHB 2VH0A 4BAQB 5DP6A 1BTWA 3QZQA 2XBYA 3NUMA 2BVSH 2VWOA 4Y0ZE 2G51A 2BY7X 3MU0A 1YCPM 4WVPE 3A83A 2ZECA 3ATMA 1VITH 2PWXA 4NIXA 1F0RA 2STBE 5FXLA 2FOFA 3PLPA 1BMAA 1Z6JH 1A3BH 1ZJDA 2GT8A 3MNXA 1BTZA 2FZZA 4ZHMU 5L6NH 1SLUB 1T8NA 4YLUA 5I25A 2ZEBA 2BY8X 1EJMA 1C1TA 2QV1A 3R3GB 1ZYOA 3ODDA 1HDTH 3ZVEA 2ZP0H 1LPGB 1GJ8B 1ELEE 3VEQB 1EAWA 4TY6A 2AIPA 2GDEH 5EW1H 1O2VA 4YZUA 1HAZB 3E90B 1JOUB 5E8EH 1LMWB 3RXRA 2KAIA 1BRAA 1OWDA 1UTQA 4YESB 2FYRA 2V0BA 2ZDKA 1SB1H 1DPOA 5A0BA 4XOJA 4Z6AH 3GY2A 3AAUA 2ZU1A 1OP8A 3D49H 3PO1B 1FN6A 1DWBH 1LHEH 5EW2H 1BOQA 1E36B 1HAHH 2WPLS 1KY9A 1XUKA 4GCHG 3PLBA 1C5WB 4FUIA 3SV7A 1WQSA 3MU1A 4J2YB 3EDXB 1TNLA 1FJSA 1AWHB 3M37A 1KTSB 1L4ZA 2ZGXH 1DDJA 1QJ1B 1OX1A 2D1JA 4AYYB 1UVTH 4I33A 4AORA 2QAAA 1UTJA 2C90B 1GI3A 4JMYA 4YLQH 1EOJA 1QRXA 2BZAA 4MPUA 1PQ5A 4WMDA 4KP0A 4A1TA 5C1UA 4FUGA 4DIIH 1QBVH 4MPXA 1AE5A 1FPHH 4CRAA 2PR3A 2WUCA 1V2OT 2VU8E 1SGDE 1P03A 4AN7A 1LHCH 3TJUA 3RXBA 4JYVH 1P2IA 3RXUA 2FDAA 1D6WA 1EX3A 1ETRH 3T5FH 1ZSLA 4ISIH 5CHAB 4X2WA 2OP9A 1THSH 3CS7A 3HK3B 4FVDA 5GIBA 5FPSA 1D9IA 3LC5A 1JIMA 4UFGH 1GGDC 1W7GH 1GI6A 3SUEA 4Q80A 2OC8A 5EGMA 1XXFA 2TGDA 1K1NA 1Y3UA 2CV3A 3IWMA 3SGQE 1UCYH 1O3LA 4RKOB 1GL1A 2R0KA 2UWLA 3VXFH 3B23B 3Q76A 3UTUH 2W7UA 2ASUB 1O39A 2C3SA 1O2XA 4GHQA 3ODFA 3A86A 2B8OH 4NZLA 2H2ZA 3LJJA 4TYDA 3GY4A 1GCTB 1FUJA 1AVGH 1CHGA 2V3HH 3RLWH 1Y5AT 4K8BA 4CH8B 1GVKB 1FY5A 1VR1H 1ZSJA 2H5CA 2H9TH 1EPTC 2Z3CA 1QQUA 5EQQA 3U1IB 3RXJA 1E35B 2XTTB 2ZHEH 1AVXA 1Z8JB 2VGCC 1EB1H 4X8SH 1GMCG 3SQHE 5G4BA 3ZZ6A 3RXPA 3QZRA 3QTOH 1ABJH 1G30B 1EAIA 4ZKNU 3AAVA 2F9BH 1HCGA 3UY9A 3UOPA 2BDCA 4XFQA 1AN1E 2BQ7B 1P05A 4X1QU 1GVZA 1GBJA 2FS8A 5T6GA 3RUOA 5EQSA 1ANCA 1IOEA 3PV4A 1C2JA 2VIDA 1AIXH 3A84A 3EA7A 3MH6A 1MD8A 1Z7KA 1Z71A 2RG3A 3F9FA 4D9RA 1EOLA 4R0IA 4X1PU 3O8BA 1LVBA 1NY22 3FZZA 3PMBB 3TPIZ 1O3DA 2RA3A 1GG6B 1O34A 3I77A 1SQOA 2G81E 3HATH 3PWCA 3NXPA 4X6NA 2FYQA 4AFSA 3E91A 1KTTB 2CJIA 1TRYA 2QC2A 4XDEA 3A7XA 1TLDA 3DD2H 2Q6DA 2G4UA 1KXEA 2BXUH 3BG4B 1GJCB 1D3QB 1ELDE 1CBWB 3LH1A 1V2UT 1O2NA 2QGRA 1VCPA 1EP6A 2H9HA 2FOCA 3GY8A 3PTNA 3MOCA 1EAXA 1QQ4A 2VIPA 1A5IA 3OYPA 1Y59T 1UCYK 4MQAA 1YCPH 3LU9B 4YO9A 4B74A 1GHBF 1ELCA 1A2CH 2XBXA 2LNCA 1DITH 1PQAA 2F9VA 1LKBA 3RMNH 1ELAA 1BMMH 1OKXA 2AMPA 3FP7E 3HKJB 4X8UH 1TX7A 1UTLM 5FCRA 1QCPA 4ZAEA 3N7OA 5A09A 3RXFA 3VB7A 3FVFB 3F6UH 3FFGA 1K1LA 5T3HA 1GHWH 1INCA 4BANB 1C1UH 1G3CA 2AMDA 1DICA 2A32A 4D7GA 1AFEH 5JBTA 3TJNA 5ESTE 2VIVA 3K6YA 2QCYA 3BTWE 3HGNA 1W11U 1MQ6A 1WUNH 1ZLRA 9ESTA 1IQHA 3BN9A 1WOFA 4KTUA 5AF9H 1J9CH 2Y5GA 1EB2A 4LOYH 4VGCB 1WCZA 1ARCA 2HNTE 3I78A 3M3SA 3UWIA 1JWTA 1TALA 3ATLA 3OTJE 3TH3H 3TGIE 1UTKA 5TCCA 3H7TA 3LC3A 2BOKA 1D4PB 4BNRA 1DWCH 3LGTA 1KDQA 3URDA 1SPJA 1NRRH 5DJ7A 3V3MA 1QA0A 4I8GA 2R2MB 1ZJKA 3SV6A 8ESTE 4ZHLU 1HAVA 3RXSA 4ESTE 1IQGA 2ZZUH 2OINA 2ZGHA 4ABIA 1XX9A 1EKBB 2JH0D 1GDNA 2O9QA 1TFXA 1G9IE 1GMCF 1Z8RA 1P9SA 1HAGE 4D7FA 2WYGA 3DFJA 1DVAH 2ANWA 2ESTE 1CT0E 2P94A 1AE8H 2ZCLP 1S83A 2UUJB 2AERH 4IW4E 3C27B 1O5CB 3ZV9A 4X2YA 1KYNA 2G4TA 1YCPK 1GJAB 7KMEH 2SGAA 1CT2E 2SGDE 2AFQB 1S6FA 2XWAA 3SJIA 1GHXH 1NN6A 3SJKA 1B5GH 1G37A 4BOHA 5F03A 4B2CA 1P01A 5C20A 4AFQA 3KQDA 1IQKA 1A0JA 4OGXA 2BLVA 1HGTH 2CHAC 4Y79A 2ZDMA 2VB0A 1RJXB 4A5TS 4CHAC 2BY5X 1Z1JA 2YNBA 1MD7A 3RXQA 1C9PA 1O5FH 5DKMA 5A8ZA 3NKKA 1KXFA 1P8VC 3SJ8A 2NU4E 5JPMH 1BTUA 4K5ZA 3PMAB 4K1EA 1VITF 3S9CA 4Y8ZA 1TQ7B 2ZCKP 1GHZA 1AQ7A 1NFXA 1PPBH 1D3DB 1O35A 1WV7H 4CRFA 1SBWA 1SGNE 4ISNA 2Q6GA 1TOMH 5AFZH 3UR6A 3SORA 5IYTA 3A8CA 3NPSA 2A5IA 1IQNA 3TLOA 3SU2A 2BD8A 1GI7B 1IQJA 1VGCB 3GY5A 1O5EH 3D23A 4X2XA 4YTAA 3ZZ9A 1DLKB 1G2LA 2XXLA 4OS2A 1PPHE 2A2QH 2BDIA 3R0FA 2PGQB 1RXPA 1SGQE 1XKBC 1A5HA 1GDUA 1OWHA 2QYIA 1SGFG 1JIRA 5DP8A 3PMHB 5F8XA 1YPJH 1C2HA 3TIUA 5GXPA 1L1GA 2ZU2A 1L4DA 5GCHG 4A92A 1HBTH 4CBNA 1GMDG 4INHA 3UR9A 1FY3A 1GHAG 1GCDA 2WPHS 1V2KT 2BD7A 2O8LA 1L1NA 3GICB 2EA3A 1ZHPA 1OWEA 4X0WU 5DP3A 1ZRKA 3VXEH 2OQUA 1MKWH 3S9AA 3G01A 3MH4A 4FUBA 2ODQA 3LH3A 1C5ZB 4SGAE 1F0SA 1V2NT 4X2VA 1FZZA 1NRSH 2Y82A 2P3UB 3LT3A 3SO3A 3GCTG 1DE7H 1KLIH 4UFEH 4BAMB 2EEKA 3F1SB 1NRPH 4UD9H 1ESBA 2FESH 4GHTA 1RTFB 5DG6A 1EXFA 2PKSC 1ESTA 1ORFA 5J4QA 2GD4B 2PHBA 2HALA 3TU7H 1MTNC 8KME2 1O31A 2J9NA 1UTNA 2ZGBH 2GCTC 1PQ7A 4KGAA 1CHOF 1B0FA 1ZHRA 2BB4A 1ID5H 1O36A 1O2OA 1MAYA 3DFLA 3ZZDA 2PKAA 1H8DH 1O2GH 5I46H 1LO6A 1DUAA 1O2YA 1FPCH 1OPHB 1SMFE 3U1JB 1ZPCA 1PPCE 1G36A 1SGEE 5A8XA 1O3FA 3S69A 1AMHA 2ZHWH 3PWBA 2P8OB 2ALPA 1S0QA 4ZHAA 1ELBA 2ZA5A 2P59A 3MO6A 1AKSA 2FP7B 1BT7A 4PROA 4Y76A 3SHAH 2AEIH 5HM9A 2V6NA 3ATWA 3MU4A 1C5NH 2ALVA 3RXVA 1C5YB 3QN7A 4FU9A 1B0EA 1OWJA 3BG8A 3LIWA 4ABAA 2XNIA 3SU3A 1BTXA 3BTTE 5EODA 1DSTA 2J94A 2Z9GA 3EE0B 4WMEA 1HAOH 1AO5A 3FP6E 1NPMA 2GP9B 1MTUA 1PYTC 3TK6A 1SHHB 1GJ7B 5T6FA 2AYWA 1HB0B 4I8JA 4Q7YA 1E38B 4WXIA 1O3JA 3T25A 5F8ZA 2QXJA 3W94A 2JETC 2ANMH 6CHAC 1TRNA 4X6PA 1IAUA 1MKWK 2FOGA 2FTMA 4MNXA 1Y5BT 1ZTJA 2ZU5A 5AVDA 2AS9A 5C5OA 3T29A 1GL0E 4NA9H 3RXTA 2QA9E 4K69A 1MQ5A 4X1SU 2BVXH 3T62A 4ABGA 4IBLH 2BDYA 3UNQA 1MH0A 1TA6A 3A89A 1F0UA 1QGFA 4H42U 1C1QA 1C1RA 2BDGA 1O2JA 1P2JA 4I31A 1DY8A 1BIOA 4CRCA 1FNIA 2XYAA 3ZYEA 2Z94A 1O3KA 1QRWA 3A87A 3DT0H 3M5MA 2FOEA 2FEQH 1K22H 1C1SA 1TMUH 4ABHA 5F8TA 3Q00A 1H9LB 2A45B 1TGTA 9LPRA 1D3TB 2AGGX 1GMDF 3RXIA 2QXIA 5E0HA 1GHAF 2A0QB 4TPYA 1P04A 4NSYA 4AGKA 2BTCE 1FIZA 1HXEH 1ZGVA 1QURH 2I6QA 1A0HB 1C5UA 1D3PB 2H9EH 3DA9B 3QLPH 3CP7A 1C1VH 4DURA 1HJ8A 4B73A 1BTHH 2W3KA 2NU2E 1P10A 4DOQA 5EXLA 3D62A 2BYAX 1WTGH 1ABIH 2HPQH 4I8KA 3LGVA 3ZVGA 1HPGA 1MUEB 5HMAA 3MNBA 5EU8A 3GCTF 2QF3A 1P2QA 2VNTA 3MNCA 1FN8A 3SU4A 4FUCA 1P9UA 1UVPA 1C2GA 3H5CB 3U8OH 2PW8H 1IQFA 2VIOA 1DM4B 2B9LA 2SNVA 5FBEA 5LPRA 1QR3E 2J34A 2BHGA 4HI3A 4WH8A 2Y7ZA 2BY6X 3MH7A 2ZCHP 5AHGH 1T31A 1TGBA 1O2QA 1UTPA 1P2OA 3P92A 3SV9A 4CBOA 1BITA 3FP8E 3RU4E 1W13U 2A31A 4MNYA 3BIUH 2ZIQH 2O8UA 3BEIB 3RC5A 5GWZA 1WBGB 1AHTH 3KL6A 4HTCH 5AFYH 3TK5A 3RU4D 1GBTA 2FX6A 1GVLA 2WPIS 2ZFRH 1KIGH 3M7UA 4Z0KA 1RS0A 4MPVA 4KELA 4OGYA 1A4WH 1QNJA 2R3UA 1Y3XA 1S0RA 2Z3DA 3WY8A 3M5NA 3U69H 3KQBA 4NCYA 2FO9A 3SI4H 4Q7XA 1QL7A 7GCHG 3MO9A 3PO1C 4FUEA 1TPOA 4NG9H 1C5QA 2BD5A 1KDQB 1YPHC 1UCYE 5E2OA 1RD3B 2A7CA 3KCGH 3A7WA 4JZDH 1L0ZA 3RM2H 4RSPA 3UQVA 2ODYB 3ZZ3A 3OY5U 1OYTH 1Z1IA 1HJ9A 4XE4A 8GCHF 1SI5H 2ODPA 2SFAA 2P3FH 5FCKA 1ARBA 1FIWA 1S6HA 3RP2A 4A1VA 4E06H 4X8TH 1TBRH 2DUCA 1O30A 1KLTA 1CA0C 2Q6FA 4NIWA 3BIVH 1C2KA 5ETXA 1F2SE 1HRTH 2ZF0H 1YBWA 1OP0A 1GBFA 2BMGB 1EPTB 1MAXA 1XM1A 1EZSC 1GHYH 3EA9A 1ZMLA 2ZHFH 1G3EA 1W3CA 1O33A 1UHBA 2ZHDA 3ESTA 1N1LA 1F5LA 3T28A 1ELVA 3EQ0H 3PB1E 1A1RA 4AX9H 1DXWA 2CN0H 1SGRE 2ZU4A 3T2NA 3RXGA 3L6PA 1W7XH 3K9XB 5L2ZH 1ELGA 4I8LA 4B2AA 2ZQ1A 4TWWA 5FAHA 2GVFA 3SN8A 1BRUP 2ANYA 2PV9B 1GBAA 2O8TA 2RDLA 1AZ8A 1TONA 1SL3A 3CENA 3RC4A 1E34B 2XC4A 3F9EA 3M5LA 5DK1A 2HOBA 3SNBA 4O3TA 2J4IA 1QTFA 1SGPE 3PLKA 1EATA 1UVUH 1QA7A 1KLJH 4JK6A 1C2FA 2BDBA 4RN6A 2TBSA 1LTOA 2FI5E 1MZDA 1XKAC 1VZQH 1NFYA 2A1DB 5TCAA 1DX5M 2XWBI 5ESBA 1V2MT 1MTWA 2A4OA 2OBOA 2Y6TA 1FQ3A 1NS3A 5ABWA 1OWIA 5A0AE 4INLA 1O3BA 4IGDA 1GI1A 1C1MA 5GJ4B 1TAWA 3S7HB 2ZC9H 4YOJA 1PPEE 2D26C 2G5NA 1QY6A 2HWLB 3IG6B 3LGWA 1YPMH 2PUQH 1PPGE 1WAYB 1UK4A 2JH6D 1ZSKA 2FXRA 5EPNA